4CFQA

Ca-bound truncated (delta13c) and c3s, c81s and c86s mutated s100a4 complexed with non-muscle myosin iia
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
87
structure length
85
Chain Sequence
MASPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSFLGTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSSIAMMSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The C-Terminal Random Coil Region Tunes the Ca2+-Binding Affinity of S100A4 Through Conformational Activation.
pubmed doi rcsb
molecule keywords PROTEIN S100-A4
molecule tags Ca-binding protein/motor protein
source organism Homo sapiens
total genus 32
structure length 85
sequence length 87
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4cfqA00
4AOMA 1JC2A 2P6BB 1CDLA 2JOJA 2LLSA 1CM4A 4GNKB 2LUCA 3FWCA 4QJ4B 4USLA 2MHHA 3QRXA 4MSPA 1NPQA 2KDHA 1EH2A 2NCPA 1LINA 2JNXA 3CZTX 1GJYA 1K9KA 1QV1A 1FPWA 5F6TA 1J7PA 2LVKA 3BUOB 4U8DA 1CDMA 1G33A 1DF0B 5I2QA 2JT3A 1F54A 3I5FC 1WDCC 1CFPA 1M63B 1F4QA 4GGFC 3CR5X 2QACA 3NSOA 4M2QA 3SG6A 1TCFA 1J7RA 3O2PA 4QJ3B 2MRDA 2KYCA 1K9PA 2K7OA 1IG5A 4XJKA 1TN4A 1FBVA 2CT9A 3EK4A 1YTZC 3I5HB 1PALA 4FTGA 1S36A 2KNEA 5HLOA 1QVIZ 4GPLB 2ZRTA 1KK7Y 4ETOA 3JTDC 1PSRA 3D0YB 3VRQA 2DOQA 1TIZA 2KBMA 1OMDA 1MXLC 1E8AA 3LCPC 5AEQA 4MZJA 2CTNA 4PHKA 5AFPA 2KHNA 3NSKA 1TNWA 4YGBB 2KAYA 5DKQA 1NIWA 1YURA 2WOSA 2KI4B 5DKNA 4GFTA 2JRFA 4PE1A 4N5XA 4N1GA 1M39A 1NX2A 2HQ8A 3CR2A 1BLQA 1VRKA 1TNPA 1U5IB 2OS8B 1IWQA 2KI6C 1DMOA 1IH0A 5D69A 1M31A 2L98A 2NCOA 1QIWA 1UHJA 1CB1A 3AKBA 1SL7A 4MEWA 1LKJA 1F8HA 1DGUA 2LC5A 2HETA 2K7BA 3O4YA 1M45A 1Y1AA 1K9UA 3FS7A 1BR1B 3PM8A 1BG1A 2A4JA 2M1UA 2IS9A 4MZKA 1OZOA 1K95A 4YBHB 3TZ1A 1RK9A 3DVKA 1A2XA 3MSEB 2LLTA 3D10A 2EC6C 1BT6A 2KQ6A 3BOWB 4BY4A 2BKHB 4GUKA 5D7FA 1BR4B 1RJVA 3TDIA 1K2HA 1S5GZ 2L51A 1CDPA 2TN4A 1RTP1 3WNXB 5HKYA 1OZSA 1NX1A 3IQOA 1UWOA 3NXAA 4CLNA 1YUTA 1KQMB 1SCMB 1CKKA 4A4CA 3O78A 3I5IC 3PN7B 2CXJA 5KU1A 1SKTA 2COLB 1G8IA 1BU3A 2SASA 4CPVA 2KGRA 1NSHA 1EJ3A 2OTGC 4E68A 4CFRA 1C7VA 1EXRA 2LVIA 2K7DA 2M29A 5CSJA 2WCEA 2M49B 1N0YA 5HLVA 2LMVA 1NUBA 1AP4A 2LE9B 4PHMA 5ER5A 1WLMA 4PALA 1Y1UA 2BECA 1IJ5A 1NWDA 1KK8C 4Q04A 3CGAA 3PSRA 1A75A 3I5GB 2JT0A 2EHBA 2R2IA 4BY5A 2G2BA 5AERA 2M9GA 1PK0D 5I8NA 1CFDA 4ORCB 5HKWA 1Y6WA 1ALWA 1XFYO 2K7CA 1NX0A 2ZNDA 2WNDA 1JUOA 1K8UA 2F8PA 5DKRA 4WQ3A 2M97A 4P2YB 2ISDA 2KYFA 3DVMA 1CTRA 2KOTA 1QTXA 5KTYA 2ZRSA 1QIVA 4YI8A 3BYAA 2PRUA 1XFZO 1AJ4A 1UHHA 4JPZB 2H2KA 2K8MB 3DVEA 2MLFC 2LNKA 1QX2A 3GK1A 4PHNA 4DUQA 4OR9B 2JNFA 1ZOTB 2D8NA 4JQ0D 3LL8B 1A29A 2JPTA 1ODBA 3SJSA 1MQ1A 1KQVA 2Q91A 2BL0B 2Y1MA 3LK1A 4NDCA 1KWOC 3OP0A 4WRIA 2MAZA 1S6CA 2E30A 3EVVA 1OMVA 2LUXA 3OHMB 2HQWA 4DIRA 2F33A 1DF0A 1MWNA 3TS5B 1CMGA 2KBIA 1RROA 5G08A 1Q80A 2F2OA 1W7IB 2LM5A 1TNQA 2WCBA 4I5KA 2M0RA 1KSOA 1NCYA 1SNLA 3GOFA 1F55A 1KCYA 1MR8A 1DJIA 1FW4A 5CSNA 5ER4X 3VGOA 1YUUA 1UUSA 4TNCA 1AVSA 2AUCA 4XYNA 3ZNIA 4I5JA 1DVIA 1AJ5A 4A4BA 2EGDA 1UURA 2LMTA 2LANA 5J3XA 2PMYA 2AAOA 3JVTC 3TUYB 4ORBB 3CTNA 4YGEB 1DJHA 1WRLA 1NCZA 1L2OC 1JBAA 4WQ2A 1A4PA 2K61A 2LV7A 1M46A 2JXCA 1SW8A 3BUWB 4OCIA 1A03A 1UHIA 2Y5IA 2CCMA 1QJTA 2JC2A 1U5IA 1IQ5A 4C0KA 2H61A 4I5LB 2BCBA 2KAXA 1B7TZ 3RM1A 4UPGA 1CM1A 3PLFB 4JWQA 1C07A 1JSAA 1SR6B 1IRJA 1LXFC 1ZACA 2LP3A 1H4BA 2OPOA 1B8CA 2FCDA 3FWBA 3C1VA 5I2LA 2SCPA 3CR4X 3PATA 1GGWA 3H4SE 1LA3A 2BE4A 3OB2B 1C7WA 1N2DA 1SCVA 4HSZA 1TTXA 1PSBA 2Y4QA 1NCXA 3K21A 4F0ZB 2FJUB 3PFVA 4PE0A 1XO5A 2BKIB 2I2RE 4ORAB 3BUMB 2JU0A 3AAKA 3BOWA 1WRKA 2LVVA 2WC8A 1BF5A 2L4HA 4MLWA 2LLUA 3EKHA 2HF5A 1WRZA 1S3PA 1BJFA 1OE9B 1J1EA 1QVIY 1OSAA 2K0JA 4PDZA 5HKZA 1CLBA 1FI5A 1YX7A 2M7LA 1MXEA 4NQGA 2BBNA 1QX7A 2BBMA 3GK2A 2LAPA 3I5HC 1XK4A 1L7ZA 1HQVA 1F70A 1CLMA 1DT7B 2KQYA 1YUSA 1CNPA 5AXIA 4OV2A 5GQQC 1DJXA 2PASA 3BXKA 2LVJA 1G4YR 5CSIA 2ZFDA 4IL1A 5FYXA 3VROA 1PULA 2Y1NA 2FOTA 2KI4C 1XFVO 2E6WA 3SG4A 3O6BA 2L5XB 5TNCA 1YRTB 1GGZA 2JWWA 1OQPA 3I5FB 1WDCB 3SG7A 1SMGA 2OS8C 4MRXA 2H61C 2Q4UA 1QASA 4M2PA 2WORA 1SYMA 2I18A 2BE6A 4YI9A 2K2FA 3DF0B 1DJZA 1SL9A 5JOLA 1DJYA 2F2PA 2MA2A 2L4IA 1RFJA 1S5GY 2HPSA 2LP2A 2KGBC 3JTDB 1DTLA 1MHOA 1NP8A 1QLKA 3LK0A 4DS7A 1B9AA 1XA5A 2M7NA 3GK4X 5HYDA 1BOCA 2JT8A 4CFQA 1PRWA 4MZLA 5PALA 2CNPA 1K90D 3CWGA 1BODA 1CDNA 1KQMC 1SCMC 1XFUO 5B8IB 4GGNA 4QJ5B 1OMRA 2MBXA 2JTTA 3PN7C 1V1FA 1EG4A 1MUXA 1DJWA 3KHEA 5KSZA 2GGZA 4FQOA 4ZCVA 2LCPA 3CS1A 1YVHA 1XK4C 1IGVA 3WHTB 3EK7A 2AMIA 1HT9A 5BPJA 4ZCUA 1ZMZA 2O5GA 4PE7A 1J55A 3NSLA 2GGMA 2ZN9A 2BCXA 2G9BA 5CSFA 1FF1A 2KI6D 1YR5A 1SY9A 3I5GC 5K89A 3A4UB 4PE4A 1RWYA 2EC6B 2VRGA 2JULA 3D0YA 1YVLA 1IKUA 1SL8A 2ZNEA 4YRUA 2F3ZA 3KPXA 3OX5A 3VRPA 2B1UA 4GAOA 4YGCB 1F4OA 1DJGA 3SG3A 3I5IB 1CFFA 4HREE 1J1DA 1B8LA 3OX6A 2JTZA 2L2EA 2JZIA 1KSMA 3SG5A 2OTGB 2WCFA 3EK8A 3KF9A 4XJKB 3SG2A 1Y0VH 3HCMA 1UP5A 5AANA 1V1GA 2NLNA 3EKJA 1KFUS 1ZUZA 1R2UA 4R1EA 2NZ0A 1H8BA 1WLZA 4P5OE 2I94A 2O60A 3EVRA 4C0JA 2PVBA 1KK8B 1NYAA 1QXPA 2KSPA 2LHIA 1EG3A 1JF0A 1JFKA 3KEVA 1KFXL 2BL0C 3DD4A 3WHUB 1UHNA 4M2OA 1YX8A 3EVUA 1B8RA 1Y1XA 2ZN8A 2V53A 1PVBA 1UHKA 1NX3A 4OKHA 4AQIA 3F45A 2K2AA 3TS5C 1CLLA 2F3YA 3ICBA 1TRFA 1QS7A 1SRAA 3BUXB 1B1GA 1S6JA 1QLSA 4GBAA 1SK6D 2LMUA 3AKAA 1GQMA 2FCEA 3SIBA 1F71A 4I5NB 2GV5A 1EL4A 1N65A 4NDDA 2KFGA 4HRHA 4ICBA 2NXQA 1XFWO 1TOPA 2KAVA 3HX4A 3E3RA 1XYDA 3M0WA 5JJGA 5I2OA 3TUYC 1AUIB 4MBEA 1SPYA 4PCWA 1TNXA 2KFHA 2MJWB 4HRGA 3BQ3A 1ALVA 3KO0A 2KFFA 1KWOB 3CLNA 1K93D 3IQQA 1J7OA 1B7TY 1IJ6A 1TCOB 4L9MA 1CMFA 1QATA 3PALA 1K96A 3TDZA 1XVJA 2M1KB 1OOJA 3BUNB 2PALA 4YGAA 1X02A 1JF2A 2ZKMX 4GGFA 1DGVA 1AHRA 2M8UA 2BCAA 2RGIA 5CPVA 1B47A 1SR6C 1LVCD 1KFXS 1K94A 3FIAA 1JWDA 3LLEA 4PHJA 3DF0A 4N1FA 1W7JB 2L0PA 3RLZA 3AAJA 1WY9A 1YRUB 2I7AA 2JXLA 1A75B 4CIDA 1SBJA 3NSIA 4DCKA 1S26D 3JVTB 1B4CA 3VRRA 4MN0A 1PVAA 2QPTA 4D1EA 1L2OB 2M3WA 1RECA 2JQ6A 1KFUL 2MLEC 3IF7A 4OVNF 1BMOA 1XFXO 2PSRA 4YGDB 3SIAA 3DVJA 1S1EA 1ZFSA 1KK7Z 1R6PA 4MRYA 4AQJA 2L50A 1CFCA 3ZWHA 4DRWA 3VRNA 5IBWA 4C0LA 4NDBA 1FI6A 1JFJA 2LHLA 3TDUA 3WXAA 1IQ3A 1AK8A 1LA0A 2CBLA 1D1OA 1J7QA 1QX5B 3A8RA 4MVFA 1QV0A 3OB1B 1S6IA 1MF8B
chains in the Genus database with same CATH superfamily
4AOMA 1JC2A 2P6BB 1CDLA 2JOJA 2LLSA 2WCHA 1CM4A 4GNKB 2LUCA 3FWCA 2QDIA 1SSEB 4USLA 4QJ4B 2MHHA 3QRXA 3L4AA 4MSPA 1NPQA 2KDHA 1EH2A 2NCPA 1LINA 1C3YA 2JNXA 3CZTX 1GJYA 1K9KA 1QV1A 1FPWA 5F6TA 1J7PA 2LVKA 4INXA 3BUOB 3QMEA 1CDMA 1G33A 1DF0B 1OW4A 2JT3A 4U8DA 5I2QA 1F54A 3I5FC 1WDCC 1CFPA 1M63B 1F4QA 4GGFC 1TUJA 3CR5X 2QACA 3NSOA 4M2QA 5AFPA 3SG6A 3UO9A 1TCFA 1J7RA 3O2PA 4QJ3B 2MRDA 2KYCA 1K9PA 2K7OA 2QEOA 2WCKA 1IG5A 1QWVA 4XJKA 1TN4A 1FBVA 2CT9A 3R1VA 5DICA 3EK4A 1YTZC 3I5HB 1PALA 4FTGA 5EL2A 1S36A 2KNEA 5HLOA 1QVIZ 2BAPA 4GPLB 2ZRTA 1KK7Y 4ETOA 3JTDC 1PSRA 3D0YB 3VRQA 2DOQA 2JPOA 3BFBA 3B87A 1TIZA 2KBMA 1OMDA 1MXLC 1E8AA 3LCPC 5AEQA 2WCJA 4MZJA 2CTNA 3D74A 4PHKA 2KHNA 3NSKA 1TNWA 4YGBB 5FI2A 2KAYA 5DKQA 3D75A 3S0BA 1NIWA 1YURA 2WOSA 2KI4B 5DKNA 4GFTA 2JRFA 4PE1A 4N5XA 4N1GA 1M39A 1NX2A 2HQ8A 3CR2A 1BLQA 1VRKA 1TNPA 1U5IB 2OS8B 1IWQA 2KI6C 1DMOA 1IH0A 3CZ0A 5D69A 1M31A 2L98A 2NCOA 1QIWA 1UHJA 1CB1A 3AKBA 3CDNA 3CZ1A 1SL7A 4MEWA 3K1EA 1LKJA 1F8HA 1DGUA 2LC5A 2HETA 3B6XA 2K7BA 3O4YA 1M45A 1Y1AA 1K9UA 3FS7A 1BR1B 3PM8A 1BG1A 2A4JA 2M1UA 2IS9A 5FI7A 3FE8A 4MZKA 1OZOA 1K95A 4YBHB 3TZ1A 1RK9A 3DVKA 1A2XA 3MSEB 2LLTA 3D10A 2EC6C 1BT6A 2KQ6A 3BOWB 4BY4A 2BKHB 4GUKA 5D7FA 1BR4B 1RJVA 3TDIA 1K2HA 1S5GZ 2L51A 1CDPA 2TN4A 1RTP1 3WNXB 5HKYA 1OZSA 1NX1A 3IQOA 1UWOA 3NXAA 4CLNA 1YUTA 1KQMB 1SCMB 1CKKA 4A4CA 3O78A 3I5IC 3PN7B 3S0GA 3OBVA 2CXJA 5KU1A 1SKTA 2COLB 1G8IA 1BU3A 2SASA 4CPVA 2KGRA 1NSHA 1EJ3A 2OTGC 4E68A 4CFRA 1C7VA 1EXRA 1Z2CB 2LVIA 2K7DA 1DQEA 2M29A 5CSJA 2WCEA 2M49B 1N0YA 5HLVA 2LMVA 1NUBA 1AP4A 2LE9B 4PHMA 5ER5A 1WLMA 4PALA 1Y1UA 2BECA 1IJ5A 1NWDA 1KK8C 3O4XA 4Q04A 3CGAA 3PSRA 1A75A 3I5GB 2JT0A 2EHBA 2R2IA 4BY5A 2G2BA 5AERA 2M9GA 1PK0D 5I8NA 1CFDA 4ORCB 1C3ZA 5HKWA 1Y6WA 1ALWA 1XFYO 2K7CA 1NX0A 2ZNDA 2WNDA 1JUOA 1K8UA 2F8PA 5DKRA 4WQ3A 2M97A 4P2YB 2ISDA 2KYFA 3DVMA 1CTRA 2KOTA 1QTXA 5KTYA 2ZRSA 1QIVA 3R1PA 4YI8A 3BYAA 2PRUA 1XFZO 1AJ4A 1UHHA 4JPZB 3SS4A 2H2KA 2K8MB 3DVEA 2MLFC 1DC1A 2LNKA 1QX2A 2QEVA 3GK1A 4PHNA 4DUQA 4OR9B 2JNFA 1OOIX 1ZOTB 2D8NA 4JQ0D 3LL8B 4KYNA 1A29A 2JPTA 3L4LA 1ODBA 3SJSA 1MQ1A 1KQVA 2Q91A 2BL0B 2Y1MA 3LK1A 4NDCA 1KWOC 3OP0A 4WRIA 2MAZA 1S6CA 2E30A 3EVVA 1OMVA 2LUXA 3OHMB 2HQWA 4DIRA 3CZ2A 2F33A 1DF0A 2L2CA 1MWNA 3B7AA 3Q8IA 3TS5B 1CMGA 2KBIA 1RROA 5G08A 1Q80A 2F2OA 1W7IB 2LM5A 1TNQA 2WCBA 4I5KA 4FQTA 2L5YA 1KSOA 1NCYA 1SNLA 2M0RA 3GOFA 1F55A 1KCYA 1MR8A 1DJIA 1FW4A 2KLEA 5CSNA 5ER4X 1YUUA 1UUSA 4TNCA 3VGOA 1DELA 1AVSA 2AUCA 4XYNA 3B88A 3ZNIA 4I5JA 1DVIA 3S0AA 1AJ5A 4A4BA 2EGDA 3IVTA 1UURA 2LMTA 1TUZA 2LANA 5J3XA 2PMYA 2AAOA 3JVTC 3TUYB 4ORBB 3CTNA 4YGEB 1DJHA 1WRLA 1NCZA 1L2OC 3D77A 1JBAA 4WQ2A 1A4PA 2K61A 2LV7A 1M46A 2JXCA 1SW8A 3BUWB 4OCIA 1A03A 1GM0A 2P71A 1UHIA 2Y5IA 2CCMA 1QJTA 2JC2A 1U5IA 1IQ5A 4C0KA 2H61A 4I5LB 2BCBA 2KAXA 1B7TZ 3RM1A 2FJYA 4UPGA 1CM1A 3PLFB 4JWQA 4INWA 1C07A 1SR6B 1JSAA 1IRJA 1LXFC 1ZACA 2LP3A 1H4BA 2OPOA 1B8CA 2FCDA 3FWBA 3C1VA 5I2LA 2SCPA 3CR4X 3PATA 1GGWA 3H4SE 1LA3A 2BE4A 3OB2B 1C7WA 1N2DA 1SCVA 3BJHA 2ERBA 4HSZA 4OZDA 1TTXA 1PSBA 2Y4QA 1NCXA 3K21A 4F0ZB 2FJUB 3PFVA 3N7HA 4PE0A 1XO5A 3BFAA 2BKIB 2I2RE 4ORAB 3BUMB 2JU0A 3AAKA 3BOWA 1WRKA 2LVVA 2WC8A 1BF5A 2L4HA 3FE6A 4MLWA 2LLUA 3EKHA 3NGVA 2HF5A 2PQLA 1WRZA 1S3PA 3S0DA 3S0FA 1ORGA 1BJFA 1OE9B 1J1EA 1QVIY 1OSAA 2WC6A 2WCLA 2K0JA 4PDZA 5HKZA 1CLBA 1FI5A 1YX7A 2M7LA 1P28A 1MXEA 4NQGA 2BBNA 1QX7A 2BBMA 3GK2A 2KPHA 2LAPA 3I5HC 3RZSA 1XK4A 1L7ZA 1HQVA 1F70A 1CLMA 1DT7B 2KQYA 1YUSA 3B86A 5AXIA 1CNPA 4OV2A 5GQQC 1DJXA 2PASA 3BXKA 2LVJA 1W9ZA 1G4YR 3D76A 5CSIA 2ZFDA 4IL1A 5FYXA 3VROA 1PULA 2WCMA 2Y1NA 2FOTA 2KI4C 1XFVO 2E6WA 3SG4A 3O6BA 2L5XB 5TNCA 1XFRA 1YRTB 1GGZA 2JWWA 1OQPA 3I5FB 1WDCB 3SG7A 1SMGA 2OS8C 4MRXA 2H61C 2Q4UA 3OGNA 3PJIA 4PT1A 1QASA 4M2PA 2WORA 1SYMA 2I18A 2BE6A 1OOHA 4YI9A 2K2FA 3DF0B 1DJZA 1SL9A 5JOLA 1DJYA 2F2PA 2MA2A 2L4IA 1RFJA 1S5GY 2HPSA 2LP2A 2KGBC 3JTDB 1DTLA 1MHOA 1NP8A 1QLKA 3LK0A 3EG5B 3R72A 4DS7A 1B9AA 1XA5A 2M7NA 3GK4X 5HYDA 1BOCA 2JT8A 4CFQA 1OOFA 1PRWA 4MZLA 5PALA 2CNPA 1K90D 3CWGA 1BODA 1CDNA 2PYQA 1KQMC 1SCMC 1XFUO 5B8IB 4GGNA 2YGUA 4QJ5B 1OMRA 2MBXA 2JTTA 3PN7C 3D73A 1V1FA 1EG4A 1MUXA 4JKTA 2QEHA 1DJWA 3KHEA 5KSZA 2GGZA 4FQOA 4ZCVA 2LCPA 3CS1A 1YVHA 1XK4C 1IGVA 3WHTB 3EK7A 3DYEA 2AMIA 3FE9A 1HT9A 3R1OA 5BPJA 4ZCUA 1ZMZA 2O5GA 4PE7A 1J55A 3SS5A 3NSLA 2GGMA 2ZN9A 2BCXA 2G9BA 5CSFA 1FF1A 3V2LA 2KI6D 1YR5A 1SY9A 3I5GC 5K89A 3A4UB 4PE4A 1RWYA 2EC6B 2VRGA 4IJ7A 2JULA 3D0YA 3DZTA 1YVLA 1IKUA 1SL8A 2ZNEA 4YRUA 2F3ZA 3KPXA 3OX5A 3VRPA 2B1UA 4GAOA 4YGCB 1F4OA 1DJGA 3SG3A 3I5IB 1DEKA 1CFFA 3PM2A 4HREE 1J1DA 1B8LA 3OX6A 2JTZA 2L2EA 2JZIA 1KSMA 3SG5A 2OTGB 2WCFA 3EK8A 3KF9A 4XJKB 3SG2A 1Y0VH 3HCMA 1UP5A 5AANA 1V1GA 2KLDA 2NLNA 3EKJA 1KFUS 1ZUZA 1R2UA 4R1EA 2NZ0A 1H8BA 1WLZA 4P5OE 2I94A 2O60A 3EVRA 4C0JA 2PVBA 1KK8B 1T14A 1NYAA 4JD9A 1QXPA 2KSPA 2LHIA 3UNWA 1EG3A 1JF0A 1JFKA 3KEVA 1KFXL 2BNXA 2BL0C 3DD4A 3WHUB 1UHNA 4M2OA 1YX8A 3EVUA 1B8RA 1Y1XA 2ZN8A 2V53A 1PVBA 1UHKA 1NX3A 4OKHA 4AQIA 3F45A 1Z4HA 2K2AA 3TS5C 1CLLA 1TWOA 2F3YA 3ICBA 1TRFA 1QS7A 1SRAA 3BUXB 1B1GA 1S6JA 3VB1A 1QLSA 4GBAA 1SK6D 2LMUA 3AKAA 1GQMA 2FCEA 3SIBA 5D3OA 4I5NB 5I94A 1F71A 2GV5A 1EL4A 1N65A 4NDDA 2KFGA 4HRHA 4ICBA 2NXQA 1XFWO 1TOPA 2KAVA 3HX4A 3E3RA 1XYDA 3M0WA 5JJGA 5I2OA 3TUYC 1AUIB 4MBEA 1SPYA 4PCWA 1TNXA 3L47A 2KFHA 2MJWB 4HRGA 3BQ3A 5HL1A 1ALVA 3KO0A 2QEBA 3NHIA 1LS8A 2KFFA 1KWOB 3CLNA 1K93D 3IQQA 1J7OA 1B7TY 1IJ6A 1TCOB 4L9MA 1CMFA 1QATA 2GTEA 3PALA 1K96A 3TDZA 1XVJA 2M1KB 1OOJA 3BUNB 2PALA 4YGAA 1X02A 1JF2A 2ZKMX 4GGFA 1DGVA 1AHRA 2M8UA 2BCAA 2RGIA 5FI6A 5CPVA 1B47A 1SR6C 1LVCD 1KFXS 1OOGA 3S0EA 1K94A 2WC5A 3FIAA 3NHTA 3LLEA 2P70A 4PHJA 1JWDA 3DF0A 3SS3A 4N1FA 1W7JB 2L0PA 3RLZA 2K60A 1WY9A 1YRUB 2I7AA 2JXLA 1A75B 3AAJA 1SBJA 3NSIA 4CIDA 4DCKA 1S26D 3D78A 3JVTB 1B4CA 3VRRA 3DXLA 4MN0A 1PVAA 2QPTA 4D1EA 1L2OB 2M3WA 3BFHA 1RECA 2JQ6A 1KFUL 2MLEC 3IF7A 4OVNF 1BMOA 1XFXO 2PSRA 4YGDB 4F7FA 3CABA 3DVJA 3SIAA 1S1EA 1ZFSA 1KK7Z 1R6PA 4MRYA 4AQJA 2L50A 1CFCA 3ZWHA 4DRWA 3VRNA 3CYZA 5IBWA 4C0LA 1IIOA 4NDBA 1FI6A 1JFJA 2LHLA 3TDUA 3WXAA 1IQ3A 1AK8A 1LA0A 2CBLA 1D1OA 3DY9A 1J7QA 1QX5B 2H8VA 3A8RA 4MVFA 1QV0A 3OB1B 1S6IA 1MF8B
chains in the Genus database with same CATH topology
4AOMA 1JC2A 2P6BB 1CDLA 2JOJA 2LLSA 1CM4A 4GNKB 2LUCA 3FWCA 4QJ4B 4USLA 2MHHA 3QRXA 4MSPA 1NPQA 2KDHA 1EH2A 2NCPA 1LINA 2JNXA 3CZTX 1GJYA 1K9KA 1QV1A 1FPWA 5F6TA 1J7PA 2LVKA 3BUOB 4U8DA 1CDMA 1G33A 1DF0B 5I2QA 2JT3A 1F54A 3I5FC 1WDCC 1CFPA 1M63B 1F4QA 4GGFC 3CR5X 2QACA 3NSOA 4M2QA 3SG6A 1TCFA 1J7RA 3O2PA 4QJ3B 2MRDA 2KYCA 1K9PA 2K7OA 1IG5A 4XJKA 1TN4A 1FBVA 2CT9A 3EK4A 1YTZC 3I5HB 1PALA 4FTGA 1S36A 2KNEA 5HLOA 1QVIZ 4GPLB 2ZRTA 1KK7Y 4ETOA 3JTDC 1PSRA 3D0YB 3VRQA 2DOQA 1TIZA 2KBMA 1OMDA 1MXLC 1E8AA 3LCPC 5AEQA 4MZJA 2CTNA 4PHKA 5AFPA 2KHNA 3NSKA 1TNWA 4YGBB 2KAYA 5DKQA 1NIWA 1YURA 2WOSA 2KI4B 5DKNA 4GFTA 2JRFA 4PE1A 4N5XA 4N1GA 1M39A 1NX2A 2HQ8A 3CR2A 1BLQA 1VRKA 1TNPA 1U5IB 2OS8B 1IWQA 2KI6C 1DMOA 1IH0A 5D69A 1M31A 2L98A 2NCOA 1QIWA 1UHJA 1CB1A 3AKBA 1SL7A 4MEWA 1LKJA 1F8HA 1DGUA 2LC5A 2HETA 2K7BA 3O4YA 1M45A 1Y1AA 1K9UA 3FS7A 1BR1B 3PM8A 1BG1A 2A4JA 2M1UA 2IS9A 4MZKA 1OZOA 1K95A 4YBHB 3TZ1A 1RK9A 3DVKA 1A2XA 3MSEB 2LLTA 3D10A 2EC6C 1BT6A 2KQ6A 3BOWB 4BY4A 2BKHB 4GUKA 5D7FA 1BR4B 1RJVA 3TDIA 1K2HA 1S5GZ 2L51A 1CDPA 2TN4A 1RTP1 3WNXB 5HKYA 1OZSA 1NX1A 3IQOA 1UWOA 3NXAA 4CLNA 1YUTA 1KQMB 1SCMB 1CKKA 4A4CA 3O78A 3I5IC 3PN7B 2CXJA 5KU1A 1SKTA 2COLB 1G8IA 1BU3A 2SASA 4CPVA 2KGRA 1NSHA 1EJ3A 2OTGC 4E68A 4CFRA 1C7VA 1EXRA 2LVIA 2K7DA 2M29A 5CSJA 2WCEA 2M49B 1N0YA 5HLVA 2LMVA 1NUBA 1AP4A 2LE9B 4PHMA 5ER5A 1WLMA 4PALA 1Y1UA 2BECA 1IJ5A 1NWDA 1KK8C 4Q04A 3CGAA 3PSRA 1A75A 3I5GB 2JT0A 2EHBA 2R2IA 4BY5A 2G2BA 5AERA 2M9GA 1PK0D 5I8NA 1CFDA 4ORCB 5HKWA 1Y6WA 1ALWA 1XFYO 2K7CA 1NX0A 2ZNDA 2WNDA 1JUOA 1K8UA 2F8PA 5DKRA 4WQ3A 2M97A 4P2YB 2ISDA 2KYFA 3DVMA 1CTRA 2KOTA 1QTXA 5KTYA 2ZRSA 1QIVA 4YI8A 3BYAA 2PRUA 1XFZO 1AJ4A 1UHHA 4JPZB 2H2KA 2K8MB 3DVEA 2MLFC 2LNKA 1QX2A 3GK1A 4PHNA 4DUQA 4OR9B 2JNFA 1ZOTB 2D8NA 4JQ0D 3LL8B 1A29A 2JPTA 1ODBA 3SJSA 1MQ1A 1KQVA 2Q91A 2BL0B 2Y1MA 3LK1A 4NDCA 1KWOC 3OP0A 4WRIA 2MAZA 1S6CA 2E30A 3EVVA 1OMVA 2LUXA 3OHMB 2HQWA 4DIRA 2F33A 1DF0A 1MWNA 3TS5B 1CMGA 2KBIA 1RROA 5G08A 1Q80A 2F2OA 1W7IB 2LM5A 1TNQA 2WCBA 4I5KA 2M0RA 1KSOA 1NCYA 1SNLA 3GOFA 1F55A 1KCYA 1MR8A 1DJIA 1FW4A 5CSNA 5ER4X 3VGOA 1YUUA 1UUSA 4TNCA 1AVSA 2AUCA 4XYNA 3ZNIA 4I5JA 1DVIA 1AJ5A 4A4BA 2EGDA 1UURA 2LMTA 2LANA 5J3XA 2PMYA 2AAOA 3JVTC 3TUYB 4ORBB 3CTNA 4YGEB 1DJHA 1WRLA 1NCZA 1L2OC 1JBAA 4WQ2A 1A4PA 2K61A 2LV7A 1M46A 2JXCA 1SW8A 3BUWB 4OCIA 1A03A 1UHIA 2Y5IA 2CCMA 1QJTA 2JC2A 1U5IA 1IQ5A 4C0KA 2H61A 4I5LB 2BCBA 2KAXA 1B7TZ 3RM1A 4UPGA 1CM1A 3PLFB 4JWQA 1C07A 1JSAA 1SR6B 1IRJA 1LXFC 1ZACA 2LP3A 1H4BA 2OPOA 1B8CA 2FCDA 3FWBA 3C1VA 5I2LA 2SCPA 3CR4X 3PATA 1GGWA 3H4SE 1LA3A 2BE4A 3OB2B 1C7WA 1N2DA 1SCVA 4HSZA 1TTXA 1PSBA 2Y4QA 1NCXA 3K21A 4F0ZB 2FJUB 3PFVA 4PE0A 1XO5A 2BKIB 2I2RE 4ORAB 3BUMB 2JU0A 3AAKA 3BOWA 1WRKA 2LVVA 2WC8A 1BF5A 2L4HA 4MLWA 2LLUA 3EKHA 2HF5A 1WRZA 1S3PA 1BJFA 1OE9B 1J1EA 1QVIY 1OSAA 2K0JA 4PDZA 5HKZA 1CLBA 1FI5A 1YX7A 2M7LA 1MXEA 4NQGA 2BBNA 1QX7A 2BBMA 3GK2A 2LAPA 3I5HC 1XK4A 1L7ZA 1HQVA 1F70A 1CLMA 1DT7B 2KQYA 1YUSA 1CNPA 5AXIA 4OV2A 5GQQC 1DJXA 2PASA 3BXKA 2LVJA 1G4YR 5CSIA 2ZFDA 4IL1A 5FYXA 3VROA 1PULA 2Y1NA 2FOTA 2KI4C 1XFVO 2E6WA 3SG4A 3O6BA 2L5XB 5TNCA 1YRTB 1GGZA 2JWWA 1OQPA 3I5FB 1WDCB 3SG7A 1SMGA 2OS8C 4MRXA 2H61C 2Q4UA 1QASA 4M2PA 2WORA 1SYMA 2I18A 2BE6A 4YI9A 2K2FA 3DF0B 1DJZA 1SL9A 5JOLA 1DJYA 2F2PA 2MA2A 2L4IA 1RFJA 1S5GY 2HPSA 2LP2A 2KGBC 3JTDB 1DTLA 1MHOA 1NP8A 1QLKA 3LK0A 4DS7A 1B9AA 1XA5A 2M7NA 3GK4X 5HYDA 1BOCA 2JT8A 4CFQA 1PRWA 4MZLA 5PALA 2CNPA 1K90D 3CWGA 1BODA 1CDNA 1KQMC 1SCMC 1XFUO 5B8IB 4GGNA 4QJ5B 1OMRA 2MBXA 2JTTA 3PN7C 1V1FA 1EG4A 1MUXA 1DJWA 3KHEA 5KSZA 2GGZA 4FQOA 4ZCVA 2LCPA 3CS1A 1YVHA 1XK4C 1IGVA 3WHTB 3EK7A 2AMIA 1HT9A 5BPJA 4ZCUA 1ZMZA 2O5GA 4PE7A 1J55A 3NSLA 2GGMA 2ZN9A 2BCXA 2G9BA 5CSFA 1FF1A 2KI6D 1YR5A 1SY9A 3I5GC 5K89A 3A4UB 4PE4A 1RWYA 2EC6B 2VRGA 2JULA 3D0YA 1YVLA 1IKUA 1SL8A 2ZNEA 4YRUA 2F3ZA 3KPXA 3OX5A 3VRPA 2B1UA 4GAOA 4YGCB 1F4OA 1DJGA 3SG3A 3I5IB 1CFFA 4HREE 1J1DA 1B8LA 3OX6A 2JTZA 2L2EA 2JZIA 1KSMA 3SG5A 2OTGB 2WCFA 3EK8A 3KF9A 4XJKB 3SG2A 1Y0VH 3HCMA 1UP5A 5AANA 1V1GA 2NLNA 3EKJA 1KFUS 1ZUZA 1R2UA 4R1EA 2NZ0A 1H8BA 1WLZA 4P5OE 2I94A 2O60A 3EVRA 4C0JA 2PVBA 1KK8B 1NYAA 1QXPA 2KSPA 2LHIA 1EG3A 1JF0A 1JFKA 3KEVA 1KFXL 2BL0C 3DD4A 3WHUB 1UHNA 4M2OA 1YX8A 3EVUA 1B8RA 1Y1XA 2ZN8A 2V53A 1PVBA 1UHKA 1NX3A 4OKHA 4AQIA 3F45A 2K2AA 3TS5C 1CLLA 2F3YA 3ICBA 1TRFA 1QS7A 1SRAA 3BUXB 1B1GA 1S6JA 1QLSA 4GBAA 1SK6D 2LMUA 3AKAA 1GQMA 2FCEA 3SIBA 1F71A 4I5NB 2GV5A 1EL4A 1N65A 4NDDA 2KFGA 4HRHA 4ICBA 2NXQA 1XFWO 1TOPA 2KAVA 3HX4A 3E3RA 1XYDA 3M0WA 5JJGA 5I2OA 3TUYC 1AUIB 4MBEA 1SPYA 4PCWA 1TNXA 2KFHA 2MJWB 4HRGA 3BQ3A 1ALVA 3KO0A 2KFFA 1KWOB 3CLNA 1K93D 3IQQA 1J7OA 1B7TY 1IJ6A 1TCOB 4L9MA 1CMFA 1QATA 3PALA 1K96A 3TDZA 1XVJA 2M1KB 1OOJA 3BUNB 2PALA 4YGAA 1X02A 1JF2A 2ZKMX 4GGFA 1DGVA 1AHRA 2M8UA 2BCAA 2RGIA 5CPVA 1B47A 1SR6C 1LVCD 1KFXS 1K94A 3FIAA 1JWDA 3LLEA 4PHJA 3DF0A 4N1FA 1W7JB 2L0PA 3RLZA 3AAJA 1WY9A 1YRUB 2I7AA 2JXLA 1A75B 4CIDA 1SBJA 3NSIA 4DCKA 1S26D 3JVTB 1B4CA 3VRRA 4MN0A 1PVAA 2QPTA 4D1EA 1L2OB 2M3WA 1RECA 2JQ6A 1KFUL 2MLEC 3IF7A 4OVNF 1BMOA 1XFXO 2PSRA 4YGDB 3SIAA 3DVJA 1S1EA 1ZFSA 1KK7Z 1R6PA 4MRYA 4AQJA 2L50A 1CFCA 3ZWHA 4DRWA 3VRNA 5IBWA 4C0LA 4NDBA 1FI6A 1JFJA 2LHLA 3TDUA 3WXAA 1IQ3A 1AK8A 1LA0A 2CBLA 1D1OA 1J7QA 1QX5B 3A8RA 4MVFA 1QV0A 3OB1B 1S6IA 1MF8B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AOM A;  1JC2 A;  2P6B B;  1CDL A;  2JOJ A;  2LLS A;  1CM4 A;  4GNK B;  2LUC A;  3FWC A;  4QJ4 B;  4USL A;  2MHH A;  3QRX A;  4MSP A;  1NPQ A;  2KDH A;  1EH2 A;  2NCP A;  1LIN A;  2JNX A;  3CZT X;  1GJY A;  1K9K A;  1QV1 A;  1FPW A;  5F6T A;  1J7P A;  2LVK A;  3BUO B;  4U8D A;  1CDM A;  1G33 A;  1DF0 B;  5I2Q A;  2JT3 A;  1F54 A;  3I5F C;  1WDC C;  1CFP A;  1M63 B;  1F4Q A;  4GGF C;  3CR5 X;  2QAC A;  3NSO A;  4M2Q A;  3SG6 A;  1TCF A;  1J7R A;  3O2P A;  4QJ3 B;  2MRD A;  2KYC A;  1K9P A;  2K7O A;  1IG5 A;  4XJK A;  1TN4 A;  1FBV A;  2CT9 A;  3EK4 A;  1YTZ C;  3I5H B;  1PAL A;  4FTG A;  1S36 A;  2KNE A;  5HLO A;  1QVI Z;  4GPL B;  2ZRT A;  1KK7 Y;  4ETO A;  3JTD C;  1PSR A;  3D0Y B;  3VRQ A;  2DOQ A;  1TIZ A;  2KBM A;  1OMD A;  1MXL C;  1E8A A;  3LCP C;  5AEQ A;  4MZJ A;  2CTN A;  4PHK A;  5AFP A;  2KHN A;  3NSK A;  1TNW A;  4YGB B;  2KAY A;  5DKQ A;  1NIW A;  1YUR A;  2WOS A;  2KI4 B;  5DKN A;  4GFT A;  2JRF A;  4PE1 A;  4N5X A;  4N1G A;  1M39 A;  1NX2 A;  2HQ8 A;  3CR2 A;  1BLQ A;  1VRK A;  1TNP A;  1U5I B;  2OS8 B;  1IWQ A;  2KI6 C;  1DMO A;  1IH0 A;  5D69 A;  1M31 A;  2L98 A;  2NCO A;  1QIW A;  1UHJ A;  1CB1 A;  3AKB A;  1SL7 A;  4MEW A;  1LKJ A;  1F8H A;  1DGU A;  2LC5 A;  2HET A;  2K7B A;  3O4Y A;  1M45 A;  1Y1A A;  1K9U A;  3FS7 A;  1BR1 B;  3PM8 A;  1BG1 A;  2A4J A;  2M1U A;  2IS9 A;  4MZK A;  1OZO A;  1K95 A;  4YBH B;  3TZ1 A;  1RK9 A;  3DVK A;  1A2X A;  3MSE B;  2LLT A;  3D10 A;  2EC6 C;  1BT6 A;  2KQ6 A;  3BOW B;  4BY4 A;  2BKH B;  4GUK A;  5D7F A;  1BR4 B;  1RJV A;  3TDI A;  1K2H A;  1S5G Z;  2L51 A;  1CDP A;  2TN4 A;  1RTP 1;  3WNX B;  5HKY A;  1OZS A;  1NX1 A;  3IQO A;  1UWO A;  3NXA A;  4CLN A;  1YUT A;  1KQM B;  1SCM B;  1CKK A;  4A4C A;  3O78 A;  3I5I C;  3PN7 B;  2CXJ A;  5KU1 A;  1SKT A;  2COL B;  1G8I A;  1BU3 A;  2SAS A;  4CPV A;  2KGR A;  1NSH A;  1EJ3 A;  2OTG C;  4E68 A;  4CFR A;  1C7V A;  1EXR A;  2LVI A;  2K7D A;  2M29 A;  5CSJ A;  2WCE A;  2M49 B;  1N0Y A;  5HLV A;  2LMV A;  1NUB A;  1AP4 A;  2LE9 B;  4PHM A;  5ER5 A;  1WLM A;  4PAL A;  1Y1U A;  2BEC A;  1IJ5 A;  1NWD A;  1KK8 C;  4Q04 A;  3CGA A;  3PSR A;  1A75 A;  3I5G B;  2JT0 A;  2EHB A;  2R2I A;  4BY5 A;  2G2B A;  5AER A;  2M9G A;  1PK0 D;  5I8N A;  1CFD A;  4ORC B;  5HKW A;  1Y6W A;  1ALW A;  1XFY O;  2K7C A;  1NX0 A;  2ZND A;  2WND A;  1JUO A;  1K8U A;  2F8P A;  5DKR A;  4WQ3 A;  2M97 A;  4P2Y B;  2ISD A;  2KYF A;  3DVM A;  1CTR A;  2KOT A;  1QTX A;  5KTY A;  2ZRS A;  1QIV A;  4YI8 A;  3BYA A;  2PRU A;  1XFZ O;  1AJ4 A;  1UHH A;  4JPZ B;  2H2K A;  2K8M B;  3DVE A;  2MLF C;  2LNK A;  1QX2 A;  3GK1 A;  4PHN A;  4DUQ A;  4OR9 B;  2JNF A;  1ZOT B;  2D8N A;  4JQ0 D;  3LL8 B;  1A29 A;  2JPT A;  1ODB A;  3SJS A;  1MQ1 A;  1KQV A;  2Q91 A;  2BL0 B;  2Y1M A;  3LK1 A;  4NDC A;  1KWO C;  3OP0 A;  4WRI A;  2MAZ A;  1S6C A;  2E30 A;  3EVV A;  1OMV A;  2LUX A;  3OHM B;  2HQW A;  4DIR A;  2F33 A;  1DF0 A;  1MWN A;  3TS5 B;  1CMG A;  2KBI A;  1RRO A;  5G08 A;  1Q80 A;  2F2O A;  1W7I B;  2LM5 A;  1TNQ A;  2WCB A;  4I5K A;  2M0R A;  1KSO A;  1NCY A;  1SNL A;  3GOF A;  1F55 A;  1KCY A;  1MR8 A;  1DJI A;  1FW4 A;  5CSN A;  5ER4 X;  3VGO A;  1YUU A;  1UUS A;  4TNC A;  1AVS A;  2AUC A;  4XYN A;  3ZNI A;  4I5J A;  1DVI A;  1AJ5 A;  4A4B A;  2EGD A;  1UUR A;  2LMT A;  2LAN A;  5J3X A;  2PMY A;  2AAO A;  3JVT C;  3TUY B;  4ORB B;  3CTN A;  4YGE B;  1DJH A;  1WRL A;  1NCZ A;  1L2O C;  1JBA A;  4WQ2 A;  1A4P A;  2K61 A;  2LV7 A;  1M46 A;  2JXC A;  1SW8 A;  3BUW B;  4OCI A;  1A03 A;  1UHI A;  2Y5I A;  2CCM A;  1QJT A;  2JC2 A;  1U5I A;  1IQ5 A;  4C0K A;  2H61 A;  4I5L B;  2BCB A;  2KAX A;  1B7T Z;  3RM1 A;  4UPG A;  1CM1 A;  3PLF B;  4JWQ A;  1C07 A;  1JSA A;  1SR6 B;  1IRJ A;  1LXF C;  1ZAC A;  2LP3 A;  1H4B A;  2OPO A;  1B8C A;  2FCD A;  3FWB A;  3C1V A;  5I2L A;  2SCP A;  3CR4 X;  3PAT A;  1GGW A;  3H4S E;  1LA3 A;  2BE4 A;  3OB2 B;  1C7W A;  1N2D A;  1SCV A;  4HSZ A;  1TTX A;  1PSB A;  2Y4Q A;  1NCX A;  3K21 A;  4F0Z B;  2FJU B;  3PFV A;  4PE0 A;  1XO5 A;  2BKI B;  2I2R E;  4ORA B;  3BUM B;  2JU0 A;  3AAK A;  3BOW A;  1WRK A;  2LVV A;  2WC8 A;  1BF5 A;  2L4H A;  4MLW A;  2LLU A;  3EKH A;  2HF5 A;  1WRZ A;  1S3P A;  1BJF A;  1OE9 B;  1J1E A;  1QVI Y;  1OSA A;  2K0J A;  4PDZ A;  5HKZ A;  1CLB A;  1FI5 A;  1YX7 A;  2M7L A;  1MXE A;  4NQG A;  2BBN A;  1QX7 A;  2BBM A;  3GK2 A;  2LAP A;  3I5H C;  1XK4 A;  1L7Z A;  1HQV A;  1F70 A;  1CLM A;  1DT7 B;  2KQY A;  1YUS A;  1CNP A;  5AXI A;  4OV2 A;  5GQQ C;  1DJX A;  2PAS A;  3BXK A;  2LVJ A;  1G4Y R;  5CSI A;  2ZFD A;  4IL1 A;  5FYX A;  3VRO A;  1PUL A;  2Y1N A;  2FOT A;  2KI4 C;  1XFV O;  2E6W A;  3SG4 A;  3O6B A;  2L5X B;  5TNC A;  1YRT B;  1GGZ A;  2JWW A;  1OQP A;  3I5F B;  1WDC B;  3SG7 A;  1SMG A;  2OS8 C;  4MRX A;  2H61 C;  2Q4U A;  1QAS A;  4M2P A;  2WOR A;  1SYM A;  2I18 A;  2BE6 A;  4YI9 A;  2K2F A;  3DF0 B;  1DJZ A;  1SL9 A;  5JOL A;  1DJY A;  2F2P A;  2MA2 A;  2L4I A;  1RFJ A;  1S5G Y;  2HPS A;  2LP2 A;  2KGB C;  3JTD B;  1DTL A;  1MHO A;  1NP8 A;  1QLK A;  3LK0 A;  4DS7 A;  1B9A A;  1XA5 A;  2M7N A;  3GK4 X;  5HYD A;  1BOC A;  2JT8 A;  4CFQ A;  1PRW A;  4MZL A;  5PAL A;  2CNP A;  1K90 D;  3CWG A;  1BOD A;  1CDN A;  1KQM C;  1SCM C;  1XFU O;  5B8I B;  4GGN A;  4QJ5 B;  1OMR A;  2MBX A;  2JTT A;  3PN7 C;  1V1F A;  1EG4 A;  1MUX A;  1DJW A;  3KHE A;  5KSZ A;  2GGZ A;  4FQO A;  4ZCV A;  2LCP A;  3CS1 A;  1YVH A;  1XK4 C;  1IGV A;  3WHT B;  3EK7 A;  2AMI A;  1HT9 A;  5BPJ A;  4ZCU A;  1ZMZ A;  2O5G A;  4PE7 A;  1J55 A;  3NSL A;  2GGM A;  2ZN9 A;  2BCX A;  2G9B A;  5CSF A;  1FF1 A;  2KI6 D;  1YR5 A;  1SY9 A;  3I5G C;  5K89 A;  3A4U B;  4PE4 A;  1RWY A;  2EC6 B;  2VRG A;  2JUL A;  3D0Y A;  1YVL A;  1IKU A;  1SL8 A;  2ZNE A;  4YRU A;  2F3Z A;  3KPX A;  3OX5 A;  3VRP A;  2B1U A;  4GAO A;  4YGC B;  1F4O A;  1DJG A;  3SG3 A;  3I5I B;  1CFF A;  4HRE E;  1J1D A;  1B8L A;  3OX6 A;  2JTZ A;  2L2E A;  2JZI A;  1KSM A;  3SG5 A;  2OTG B;  2WCF A;  3EK8 A;  3KF9 A;  4XJK B;  3SG2 A;  1Y0V H;  3HCM A;  1UP5 A;  5AAN A;  1V1G A;  2NLN A;  3EKJ A;  1KFU S;  1ZUZ A;  1R2U A;  4R1E A;  2NZ0 A;  1H8B A;  1WLZ A;  4P5O E;  2I94 A;  2O60 A;  3EVR A;  4C0J A;  2PVB A;  1KK8 B;  1NYA A;  1QXP A;  2KSP A;  2LHI A;  1EG3 A;  1JF0 A;  1JFK A;  3KEV A;  1KFX L;  2BL0 C;  3DD4 A;  3WHU B;  1UHN A;  4M2O A;  1YX8 A;  3EVU A;  1B8R A;  1Y1X A;  2ZN8 A;  2V53 A;  1PVB A;  1UHK A;  1NX3 A;  4OKH A;  4AQI A;  3F45 A;  2K2A A;  3TS5 C;  1CLL A;  2F3Y A;  3ICB A;  1TRF A;  1QS7 A;  1SRA A;  3BUX B;  1B1G A;  1S6J A;  1QLS A;  4GBA A;  1SK6 D;  2LMU A;  3AKA A;  1GQM A;  2FCE A;  3SIB A;  1F71 A;  4I5N B;  2GV5 A;  1EL4 A;  1N65 A;  4NDD A;  2KFG A;  4HRH A;  4ICB A;  2NXQ A;  1XFW O;  1TOP A;  2KAV A;  3HX4 A;  3E3R A;  1XYD A;  3M0W A;  5JJG A;  5I2O A;  3TUY C;  1AUI B;  4MBE A;  1SPY A;  4PCW A;  1TNX A;  2KFH A;  2MJW B;  4HRG A;  3BQ3 A;  1ALV A;  3KO0 A;  2KFF A;  1KWO B;  3CLN A;  1K93 D;  3IQQ A;  1J7O A;  1B7T Y;  1IJ6 A;  1TCO B;  4L9M A;  1CMF A;  1QAT A;  3PAL A;  1K96 A;  3TDZ A;  1XVJ A;  2M1K B;  1OOJ A;  3BUN B;  2PAL A;  4YGA A;  1X02 A;  1JF2 A;  2ZKM X;  4GGF A;  1DGV A;  1AHR A;  2M8U A;  2BCA A;  2RGI A;  5CPV A;  1B47 A;  1SR6 C;  1LVC D;  1KFX S;  1K94 A;  3FIA A;  1JWD A;  3LLE A;  4PHJ A;  3DF0 A;  4N1F A;  1W7J B;  2L0P A;  3RLZ A;  3AAJ A;  1WY9 A;  1YRU B;  2I7A A;  2JXL A;  1A75 B;  4CID A;  1SBJ A;  3NSI A;  4DCK A;  1S26 D;  3JVT B;  1B4C A;  3VRR A;  4MN0 A;  1PVA A;  2QPT A;  4D1E A;  1L2O B;  2M3W A;  1REC A;  2JQ6 A;  1KFU L;  2MLE C;  3IF7 A;  4OVN F;  1BMO A;  1XFX O;  2PSR A;  4YGD B;  3SIA A;  3DVJ A;  1S1E A;  1ZFS A;  1KK7 Z;  1R6P A;  4MRY A;  4AQJ A;  2L50 A;  1CFC A;  3ZWH A;  4DRW A;  3VRN A;  5IBW A;  4C0L A;  4NDB A;  1FI6 A;  1JFJ A;  2LHL A;  3TDU A;  3WXA A;  1IQ3 A;  1AK8 A;  1LA0 A;  2CBL A;  1D1O A;  1J7Q A;  1QX5 B;  3A8R A;  4MVF A;  1QV0 A;  3OB1 B;  1S6I A;  1MF8 B; 
#chains in the Genus database with same CATH topology
 4AOM A;  1JC2 A;  2P6B B;  1CDL A;  2JOJ A;  2LLS A;  2WCH A;  1CM4 A;  4GNK B;  2LUC A;  3FWC A;  2QDI A;  1SSE B;  4USL A;  4QJ4 B;  2MHH A;  3QRX A;  3L4A A;  4MSP A;  1NPQ A;  2KDH A;  1EH2 A;  2NCP A;  1LIN A;  1C3Y A;  2JNX A;  3CZT X;  1GJY A;  1K9K A;  1QV1 A;  1FPW A;  5F6T A;  1J7P A;  2LVK A;  4INX A;  3BUO B;  3QME A;  1CDM A;  1G33 A;  1DF0 B;  1OW4 A;  2JT3 A;  4U8D A;  5I2Q A;  1F54 A;  3I5F C;  1WDC C;  1CFP A;  1M63 B;  1F4Q A;  4GGF C;  1TUJ A;  3CR5 X;  2QAC A;  3NSO A;  4M2Q A;  5AFP A;  3SG6 A;  3UO9 A;  1TCF A;  1J7R A;  3O2P A;  4QJ3 B;  2MRD A;  2KYC A;  1K9P A;  2K7O A;  2QEO A;  2WCK A;  1IG5 A;  1QWV A;  4XJK A;  1TN4 A;  1FBV A;  2CT9 A;  3R1V A;  5DIC A;  3EK4 A;  1YTZ C;  3I5H B;  1PAL A;  4FTG A;  5EL2 A;  1S36 A;  2KNE A;  5HLO A;  1QVI Z;  2BAP A;  4GPL B;  2ZRT A;  1KK7 Y;  4ETO A;  3JTD C;  1PSR A;  3D0Y B;  3VRQ A;  2DOQ A;  2JPO A;  3BFB A;  3B87 A;  1TIZ A;  2KBM A;  1OMD A;  1MXL C;  1E8A A;  3LCP C;  5AEQ A;  2WCJ A;  4MZJ A;  2CTN A;  3D74 A;  4PHK A;  2KHN A;  3NSK A;  1TNW A;  4YGB B;  5FI2 A;  2KAY A;  5DKQ A;  3D75 A;  3S0B A;  1NIW A;  1YUR A;  2WOS A;  2KI4 B;  5DKN A;  4GFT A;  2JRF A;  4PE1 A;  4N5X A;  4N1G A;  1M39 A;  1NX2 A;  2HQ8 A;  3CR2 A;  1BLQ A;  1VRK A;  1TNP A;  1U5I B;  2OS8 B;  1IWQ A;  2KI6 C;  1DMO A;  1IH0 A;  3CZ0 A;  5D69 A;  1M31 A;  2L98 A;  2NCO A;  1QIW A;  1UHJ A;  1CB1 A;  3AKB A;  3CDN A;  3CZ1 A;  1SL7 A;  4MEW A;  3K1E A;  1LKJ A;  1F8H A;  1DGU A;  2LC5 A;  2HET A;  3B6X A;  2K7B A;  3O4Y A;  1M45 A;  1Y1A A;  1K9U A;  3FS7 A;  1BR1 B;  3PM8 A;  1BG1 A;  2A4J A;  2M1U A;  2IS9 A;  5FI7 A;  3FE8 A;  4MZK A;  1OZO A;  1K95 A;  4YBH B;  3TZ1 A;  1RK9 A;  3DVK A;  1A2X A;  3MSE B;  2LLT A;  3D10 A;  2EC6 C;  1BT6 A;  2KQ6 A;  3BOW B;  4BY4 A;  2BKH B;  4GUK A;  5D7F A;  1BR4 B;  1RJV A;  3TDI A;  1K2H A;  1S5G Z;  2L51 A;  1CDP A;  2TN4 A;  1RTP 1;  3WNX B;  5HKY A;  1OZS A;  1NX1 A;  3IQO A;  1UWO A;  3NXA A;  4CLN A;  1YUT A;  1KQM B;  1SCM B;  1CKK A;  4A4C A;  3O78 A;  3I5I C;  3PN7 B;  3S0G A;  3OBV A;  2CXJ A;  5KU1 A;  1SKT A;  2COL B;  1G8I A;  1BU3 A;  2SAS A;  4CPV A;  2KGR A;  1NSH A;  1EJ3 A;  2OTG C;  4E68 A;  4CFR A;  1C7V A;  1EXR A;  1Z2C B;  2LVI A;  2K7D A;  1DQE A;  2M29 A;  5CSJ A;  2WCE A;  2M49 B;  1N0Y A;  5HLV A;  2LMV A;  1NUB A;  1AP4 A;  2LE9 B;  4PHM A;  5ER5 A;  1WLM A;  4PAL A;  1Y1U A;  2BEC A;  1IJ5 A;  1NWD A;  1KK8 C;  3O4X A;  4Q04 A;  3CGA A;  3PSR A;  1A75 A;  3I5G B;  2JT0 A;  2EHB A;  2R2I A;  4BY5 A;  2G2B A;  5AER A;  2M9G A;  1PK0 D;  5I8N A;  1CFD A;  4ORC B;  1C3Z A;  5HKW A;  1Y6W A;  1ALW A;  1XFY O;  2K7C A;  1NX0 A;  2ZND A;  2WND A;  1JUO A;  1K8U A;  2F8P A;  5DKR A;  4WQ3 A;  2M97 A;  4P2Y B;  2ISD A;  2KYF A;  3DVM A;  1CTR A;  2KOT A;  1QTX A;  5KTY A;  2ZRS A;  1QIV A;  3R1P A;  4YI8 A;  3BYA A;  2PRU A;  1XFZ O;  1AJ4 A;  1UHH A;  4JPZ B;  3SS4 A;  2H2K A;  2K8M B;  3DVE A;  2MLF C;  1DC1 A;  2LNK A;  1QX2 A;  2QEV A;  3GK1 A;  4PHN A;  4DUQ A;  4OR9 B;  2JNF A;  1OOI X;  1ZOT B;  2D8N A;  4JQ0 D;  3LL8 B;  4KYN A;  1A29 A;  2JPT A;  3L4L A;  1ODB A;  3SJS A;  1MQ1 A;  1KQV A;  2Q91 A;  2BL0 B;  2Y1M A;  3LK1 A;  4NDC A;  1KWO C;  3OP0 A;  4WRI A;  2MAZ A;  1S6C A;  2E30 A;  3EVV A;  1OMV A;  2LUX A;  3OHM B;  2HQW A;  4DIR A;  3CZ2 A;  2F33 A;  1DF0 A;  2L2C A;  1MWN A;  3B7A A;  3Q8I A;  3TS5 B;  1CMG A;  2KBI A;  1RRO A;  5G08 A;  1Q80 A;  2F2O A;  1W7I B;  2LM5 A;  1TNQ A;  2WCB A;  4I5K A;  4FQT A;  2L5Y A;  1KSO A;  1NCY A;  1SNL A;  2M0R A;  3GOF A;  1F55 A;  1KCY A;  1MR8 A;  1DJI A;  1FW4 A;  2KLE A;  5CSN A;  5ER4 X;  1YUU A;  1UUS A;  4TNC A;  3VGO A;  1DEL A;  1AVS A;  2AUC A;  4XYN A;  3B88 A;  3ZNI A;  4I5J A;  1DVI A;  3S0A A;  1AJ5 A;  4A4B A;  2EGD A;  3IVT A;  1UUR A;  2LMT A;  1TUZ A;  2LAN A;  5J3X A;  2PMY A;  2AAO A;  3JVT C;  3TUY B;  4ORB B;  3CTN A;  4YGE B;  1DJH A;  1WRL A;  1NCZ A;  1L2O C;  3D77 A;  1JBA A;  4WQ2 A;  1A4P A;  2K61 A;  2LV7 A;  1M46 A;  2JXC A;  1SW8 A;  3BUW B;  4OCI A;  1A03 A;  1GM0 A;  2P71 A;  1UHI A;  2Y5I A;  2CCM A;  1QJT A;  2JC2 A;  1U5I A;  1IQ5 A;  4C0K A;  2H61 A;  4I5L B;  2BCB A;  2KAX A;  1B7T Z;  3RM1 A;  2FJY A;  4UPG A;  1CM1 A;  3PLF B;  4JWQ A;  4INW A;  1C07 A;  1SR6 B;  1JSA A;  1IRJ A;  1LXF C;  1ZAC A;  2LP3 A;  1H4B A;  2OPO A;  1B8C A;  2FCD A;  3FWB A;  3C1V A;  5I2L A;  2SCP A;  3CR4 X;  3PAT A;  1GGW A;  3H4S E;  1LA3 A;  2BE4 A;  3OB2 B;  1C7W A;  1N2D A;  1SCV A;  3BJH A;  2ERB A;  4HSZ A;  4OZD A;  1TTX A;  1PSB A;  2Y4Q A;  1NCX A;  3K21 A;  4F0Z B;  2FJU B;  3PFV A;  3N7H A;  4PE0 A;  1XO5 A;  3BFA A;  2BKI B;  2I2R E;  4ORA B;  3BUM B;  2JU0 A;  3AAK A;  3BOW A;  1WRK A;  2LVV A;  2WC8 A;  1BF5 A;  2L4H A;  3FE6 A;  4MLW A;  2LLU A;  3EKH A;  3NGV A;  2HF5 A;  2PQL A;  1WRZ A;  1S3P A;  3S0D A;  3S0F A;  1ORG A;  1BJF A;  1OE9 B;  1J1E A;  1QVI Y;  1OSA A;  2WC6 A;  2WCL A;  2K0J A;  4PDZ A;  5HKZ A;  1CLB A;  1FI5 A;  1YX7 A;  2M7L A;  1P28 A;  1MXE A;  4NQG A;  2BBN A;  1QX7 A;  2BBM A;  3GK2 A;  2KPH A;  2LAP A;  3I5H C;  3RZS A;  1XK4 A;  1L7Z A;  1HQV A;  1F70 A;  1CLM A;  1DT7 B;  2KQY A;  1YUS A;  3B86 A;  5AXI A;  1CNP A;  4OV2 A;  5GQQ C;  1DJX A;  2PAS A;  3BXK A;  2LVJ A;  1W9Z A;  1G4Y R;  3D76 A;  5CSI A;  2ZFD A;  4IL1 A;  5FYX A;  3VRO A;  1PUL A;  2WCM A;  2Y1N A;  2FOT A;  2KI4 C;  1XFV O;  2E6W A;  3SG4 A;  3O6B A;  2L5X B;  5TNC A;  1XFR A;  1YRT B;  1GGZ A;  2JWW A;  1OQP A;  3I5F B;  1WDC B;  3SG7 A;  1SMG A;  2OS8 C;  4MRX A;  2H61 C;  2Q4U A;  3OGN A;  3PJI A;  4PT1 A;  1QAS A;  4M2P A;  2WOR A;  1SYM A;  2I18 A;  2BE6 A;  1OOH A;  4YI9 A;  2K2F A;  3DF0 B;  1DJZ A;  1SL9 A;  5JOL A;  1DJY A;  2F2P A;  2MA2 A;  2L4I A;  1RFJ A;  1S5G Y;  2HPS A;  2LP2 A;  2KGB C;  3JTD B;  1DTL A;  1MHO A;  1NP8 A;  1QLK A;  3LK0 A;  3EG5 B;  3R72 A;  4DS7 A;  1B9A A;  1XA5 A;  2M7N A;  3GK4 X;  5HYD A;  1BOC A;  2JT8 A;  4CFQ A;  1OOF A;  1PRW A;  4MZL A;  5PAL A;  2CNP A;  1K90 D;  3CWG A;  1BOD A;  1CDN A;  2PYQ A;  1KQM C;  1SCM C;  1XFU O;  5B8I B;  4GGN A;  2YGU A;  4QJ5 B;  1OMR A;  2MBX A;  2JTT A;  3PN7 C;  3D73 A;  1V1F A;  1EG4 A;  1MUX A;  4JKT A;  2QEH A;  1DJW A;  3KHE A;  5KSZ A;  2GGZ A;  4FQO A;  4ZCV A;  2LCP A;  3CS1 A;  1YVH A;  1XK4 C;  1IGV A;  3WHT B;  3EK7 A;  3DYE A;  2AMI A;  3FE9 A;  1HT9 A;  3R1O A;  5BPJ A;  4ZCU A;  1ZMZ A;  2O5G A;  4PE7 A;  1J55 A;  3SS5 A;  3NSL A;  2GGM A;  2ZN9 A;  2BCX A;  2G9B A;  5CSF A;  1FF1 A;  3V2L A;  2KI6 D;  1YR5 A;  1SY9 A;  3I5G C;  5K89 A;  3A4U B;  4PE4 A;  1RWY A;  2EC6 B;  2VRG A;  4IJ7 A;  2JUL A;  3D0Y A;  3DZT A;  1YVL A;  1IKU A;  1SL8 A;  2ZNE A;  4YRU A;  2F3Z A;  3KPX A;  3OX5 A;  3VRP A;  2B1U A;  4GAO A;  4YGC B;  1F4O A;  1DJG A;  3SG3 A;  3I5I B;  1DEK A;  1CFF A;  3PM2 A;  4HRE E;  1J1D A;  1B8L A;  3OX6 A;  2JTZ A;  2L2E A;  2JZI A;  1KSM A;  3SG5 A;  2OTG B;  2WCF A;  3EK8 A;  3KF9 A;  4XJK B;  3SG2 A;  1Y0V H;  3HCM A;  1UP5 A;  5AAN A;  1V1G A;  2KLD A;  2NLN A;  3EKJ A;  1KFU S;  1ZUZ A;  1R2U A;  4R1E A;  2NZ0 A;  1H8B A;  1WLZ A;  4P5O E;  2I94 A;  2O60 A;  3EVR A;  4C0J A;  2PVB A;  1KK8 B;  1T14 A;  1NYA A;  4JD9 A;  1QXP A;  2KSP A;  2LHI A;  3UNW A;  1EG3 A;  1JF0 A;  1JFK A;  3KEV A;  1KFX L;  2BNX A;  2BL0 C;  3DD4 A;  3WHU B;  1UHN A;  4M2O A;  1YX8 A;  3EVU A;  1B8R A;  1Y1X A;  2ZN8 A;  2V53 A;  1PVB A;  1UHK A;  1NX3 A;  4OKH A;  4AQI A;  3F45 A;  1Z4H A;  2K2A A;  3TS5 C;  1CLL A;  1TWO A;  2F3Y A;  3ICB A;  1TRF A;  1QS7 A;  1SRA A;  3BUX B;  1B1G A;  1S6J A;  3VB1 A;  1QLS A;  4GBA A;  1SK6 D;  2LMU A;  3AKA A;  1GQM A;  2FCE A;  3SIB A;  5D3O A;  4I5N B;  5I94 A;  1F71 A;  2GV5 A;  1EL4 A;  1N65 A;  4NDD A;  2KFG A;  4HRH A;  4ICB A;  2NXQ A;  1XFW O;  1TOP A;  2KAV A;  3HX4 A;  3E3R A;  1XYD A;  3M0W A;  5JJG A;  5I2O A;  3TUY C;  1AUI B;  4MBE A;  1SPY A;  4PCW A;  1TNX A;  3L47 A;  2KFH A;  2MJW B;  4HRG A;  3BQ3 A;  5HL1 A;  1ALV A;  3KO0 A;  2QEB A;  3NHI A;  1LS8 A;  2KFF A;  1KWO B;  3CLN A;  1K93 D;  3IQQ A;  1J7O A;  1B7T Y;  1IJ6 A;  1TCO B;  4L9M A;  1CMF A;  1QAT A;  2GTE A;  3PAL A;  1K96 A;  3TDZ A;  1XVJ A;  2M1K B;  1OOJ A;  3BUN B;  2PAL A;  4YGA A;  1X02 A;  1JF2 A;  2ZKM X;  4GGF A;  1DGV A;  1AHR A;  2M8U A;  2BCA A;  2RGI A;  5FI6 A;  5CPV A;  1B47 A;  1SR6 C;  1LVC D;  1KFX S;  1OOG A;  3S0E A;  1K94 A;  2WC5 A;  3FIA A;  3NHT A;  3LLE A;  2P70 A;  4PHJ A;  1JWD A;  3DF0 A;  3SS3 A;  4N1F A;  1W7J B;  2L0P A;  3RLZ A;  2K60 A;  1WY9 A;  1YRU B;  2I7A A;  2JXL A;  1A75 B;  3AAJ A;  1SBJ A;  3NSI A;  4CID A;  4DCK A;  1S26 D;  3D78 A;  3JVT B;  1B4C A;  3VRR A;  3DXL A;  4MN0 A;  1PVA A;  2QPT A;  4D1E A;  1L2O B;  2M3W A;  3BFH A;  1REC A;  2JQ6 A;  1KFU L;  2MLE C;  3IF7 A;  4OVN F;  1BMO A;  1XFX O;  2PSR A;  4YGD B;  4F7F A;  3CAB A;  3DVJ A;  3SIA A;  1S1E A;  1ZFS A;  1KK7 Z;  1R6P A;  4MRY A;  4AQJ A;  2L50 A;  1CFC A;  3ZWH A;  4DRW A;  3VRN A;  3CYZ A;  5IBW A;  4C0L A;  1IIO A;  4NDB A;  1FI6 A;  1JFJ A;  2LHL A;  3TDU A;  3WXA A;  1IQ3 A;  1AK8 A;  1LA0 A;  2CBL A;  1D1O A;  3DY9 A;  1J7Q A;  1QX5 B;  2H8V A;  3A8R A;  4MVF A;  1QV0 A;  3OB1 B;  1S6I A;  1MF8 B; 
#chains in the Genus database with same CATH homology
 4AOM A;  1JC2 A;  2P6B B;  1CDL A;  2JOJ A;  2LLS A;  1CM4 A;  4GNK B;  2LUC A;  3FWC A;  4QJ4 B;  4USL A;  2MHH A;  3QRX A;  4MSP A;  1NPQ A;  2KDH A;  1EH2 A;  2NCP A;  1LIN A;  2JNX A;  3CZT X;  1GJY A;  1K9K A;  1QV1 A;  1FPW A;  5F6T A;  1J7P A;  2LVK A;  3BUO B;  4U8D A;  1CDM A;  1G33 A;  1DF0 B;  5I2Q A;  2JT3 A;  1F54 A;  3I5F C;  1WDC C;  1CFP A;  1M63 B;  1F4Q A;  4GGF C;  3CR5 X;  2QAC A;  3NSO A;  4M2Q A;  3SG6 A;  1TCF A;  1J7R A;  3O2P A;  4QJ3 B;  2MRD A;  2KYC A;  1K9P A;  2K7O A;  1IG5 A;  4XJK A;  1TN4 A;  1FBV A;  2CT9 A;  3EK4 A;  1YTZ C;  3I5H B;  1PAL A;  4FTG A;  1S36 A;  2KNE A;  5HLO A;  1QVI Z;  4GPL B;  2ZRT A;  1KK7 Y;  4ETO A;  3JTD C;  1PSR A;  3D0Y B;  3VRQ A;  2DOQ A;  1TIZ A;  2KBM A;  1OMD A;  1MXL C;  1E8A A;  3LCP C;  5AEQ A;  4MZJ A;  2CTN A;  4PHK A;  5AFP A;  2KHN A;  3NSK A;  1TNW A;  4YGB B;  2KAY A;  5DKQ A;  1NIW A;  1YUR A;  2WOS A;  2KI4 B;  5DKN A;  4GFT A;  2JRF A;  4PE1 A;  4N5X A;  4N1G A;  1M39 A;  1NX2 A;  2HQ8 A;  3CR2 A;  1BLQ A;  1VRK A;  1TNP A;  1U5I B;  2OS8 B;  1IWQ A;  2KI6 C;  1DMO A;  1IH0 A;  5D69 A;  1M31 A;  2L98 A;  2NCO A;  1QIW A;  1UHJ A;  1CB1 A;  3AKB A;  1SL7 A;  4MEW A;  1LKJ A;  1F8H A;  1DGU A;  2LC5 A;  2HET A;  2K7B A;  3O4Y A;  1M45 A;  1Y1A A;  1K9U A;  3FS7 A;  1BR1 B;  3PM8 A;  1BG1 A;  2A4J A;  2M1U A;  2IS9 A;  4MZK A;  1OZO A;  1K95 A;  4YBH B;  3TZ1 A;  1RK9 A;  3DVK A;  1A2X A;  3MSE B;  2LLT A;  3D10 A;  2EC6 C;  1BT6 A;  2KQ6 A;  3BOW B;  4BY4 A;  2BKH B;  4GUK A;  5D7F A;  1BR4 B;  1RJV A;  3TDI A;  1K2H A;  1S5G Z;  2L51 A;  1CDP A;  2TN4 A;  1RTP 1;  3WNX B;  5HKY A;  1OZS A;  1NX1 A;  3IQO A;  1UWO A;  3NXA A;  4CLN A;  1YUT A;  1KQM B;  1SCM B;  1CKK A;  4A4C A;  3O78 A;  3I5I C;  3PN7 B;  2CXJ A;  5KU1 A;  1SKT A;  2COL B;  1G8I A;  1BU3 A;  2SAS A;  4CPV A;  2KGR A;  1NSH A;  1EJ3 A;  2OTG C;  4E68 A;  4CFR A;  1C7V A;  1EXR A;  2LVI A;  2K7D A;  2M29 A;  5CSJ A;  2WCE A;  2M49 B;  1N0Y A;  5HLV A;  2LMV A;  1NUB A;  1AP4 A;  2LE9 B;  4PHM A;  5ER5 A;  1WLM A;  4PAL A;  1Y1U A;  2BEC A;  1IJ5 A;  1NWD A;  1KK8 C;  4Q04 A;  3CGA A;  3PSR A;  1A75 A;  3I5G B;  2JT0 A;  2EHB A;  2R2I A;  4BY5 A;  2G2B A;  5AER A;  2M9G A;  1PK0 D;  5I8N A;  1CFD A;  4ORC B;  5HKW A;  1Y6W A;  1ALW A;  1XFY O;  2K7C A;  1NX0 A;  2ZND A;  2WND A;  1JUO A;  1K8U A;  2F8P A;  5DKR A;  4WQ3 A;  2M97 A;  4P2Y B;  2ISD A;  2KYF A;  3DVM A;  1CTR A;  2KOT A;  1QTX A;  5KTY A;  2ZRS A;  1QIV A;  4YI8 A;  3BYA A;  2PRU A;  1XFZ O;  1AJ4 A;  1UHH A;  4JPZ B;  2H2K A;  2K8M B;  3DVE A;  2MLF C;  2LNK A;  1QX2 A;  3GK1 A;  4PHN A;  4DUQ A;  4OR9 B;  2JNF A;  1ZOT B;  2D8N A;  4JQ0 D;  3LL8 B;  1A29 A;  2JPT A;  1ODB A;  3SJS A;  1MQ1 A;  1KQV A;  2Q91 A;  2BL0 B;  2Y1M A;  3LK1 A;  4NDC A;  1KWO C;  3OP0 A;  4WRI A;  2MAZ A;  1S6C A;  2E30 A;  3EVV A;  1OMV A;  2LUX A;  3OHM B;  2HQW A;  4DIR A;  2F33 A;  1DF0 A;  1MWN A;  3TS5 B;  1CMG A;  2KBI A;  1RRO A;  5G08 A;  1Q80 A;  2F2O A;  1W7I B;  2LM5 A;  1TNQ A;  2WCB A;  4I5K A;  2M0R A;  1KSO A;  1NCY A;  1SNL A;  3GOF A;  1F55 A;  1KCY A;  1MR8 A;  1DJI A;  1FW4 A;  5CSN A;  5ER4 X;  3VGO A;  1YUU A;  1UUS A;  4TNC A;  1AVS A;  2AUC A;  4XYN A;  3ZNI A;  4I5J A;  1DVI A;  1AJ5 A;  4A4B A;  2EGD A;  1UUR A;  2LMT A;  2LAN A;  5J3X A;  2PMY A;  2AAO A;  3JVT C;  3TUY B;  4ORB B;  3CTN A;  4YGE B;  1DJH A;  1WRL A;  1NCZ A;  1L2O C;  1JBA A;  4WQ2 A;  1A4P A;  2K61 A;  2LV7 A;  1M46 A;  2JXC A;  1SW8 A;  3BUW B;  4OCI A;  1A03 A;  1UHI A;  2Y5I A;  2CCM A;  1QJT A;  2JC2 A;  1U5I A;  1IQ5 A;  4C0K A;  2H61 A;  4I5L B;  2BCB A;  2KAX A;  1B7T Z;  3RM1 A;  4UPG A;  1CM1 A;  3PLF B;  4JWQ A;  1C07 A;  1JSA A;  1SR6 B;  1IRJ A;  1LXF C;  1ZAC A;  2LP3 A;  1H4B A;  2OPO A;  1B8C A;  2FCD A;  3FWB A;  3C1V A;  5I2L A;  2SCP A;  3CR4 X;  3PAT A;  1GGW A;  3H4S E;  1LA3 A;  2BE4 A;  3OB2 B;  1C7W A;  1N2D A;  1SCV A;  4HSZ A;  1TTX A;  1PSB A;  2Y4Q A;  1NCX A;  3K21 A;  4F0Z B;  2FJU B;  3PFV A;  4PE0 A;  1XO5 A;  2BKI B;  2I2R E;  4ORA B;  3BUM B;  2JU0 A;  3AAK A;  3BOW A;  1WRK A;  2LVV A;  2WC8 A;  1BF5 A;  2L4H A;  4MLW A;  2LLU A;  3EKH A;  2HF5 A;  1WRZ A;  1S3P A;  1BJF A;  1OE9 B;  1J1E A;  1QVI Y;  1OSA A;  2K0J A;  4PDZ A;  5HKZ A;  1CLB A;  1FI5 A;  1YX7 A;  2M7L A;  1MXE A;  4NQG A;  2BBN A;  1QX7 A;  2BBM A;  3GK2 A;  2LAP A;  3I5H C;  1XK4 A;  1L7Z A;  1HQV A;  1F70 A;  1CLM A;  1DT7 B;  2KQY A;  1YUS A;  1CNP A;  5AXI A;  4OV2 A;  5GQQ C;  1DJX A;  2PAS A;  3BXK A;  2LVJ A;  1G4Y R;  5CSI A;  2ZFD A;  4IL1 A;  5FYX A;  3VRO A;  1PUL A;  2Y1N A;  2FOT A;  2KI4 C;  1XFV O;  2E6W A;  3SG4 A;  3O6B A;  2L5X B;  5TNC A;  1YRT B;  1GGZ A;  2JWW A;  1OQP A;  3I5F B;  1WDC B;  3SG7 A;  1SMG A;  2OS8 C;  4MRX A;  2H61 C;  2Q4U A;  1QAS A;  4M2P A;  2WOR A;  1SYM A;  2I18 A;  2BE6 A;  4YI9 A;  2K2F A;  3DF0 B;  1DJZ A;  1SL9 A;  5JOL A;  1DJY A;  2F2P A;  2MA2 A;  2L4I A;  1RFJ A;  1S5G Y;  2HPS A;  2LP2 A;  2KGB C;  3JTD B;  1DTL A;  1MHO A;  1NP8 A;  1QLK A;  3LK0 A;  4DS7 A;  1B9A A;  1XA5 A;  2M7N A;  3GK4 X;  5HYD A;  1BOC A;  2JT8 A;  4CFQ A;  1PRW A;  4MZL A;  5PAL A;  2CNP A;  1K90 D;  3CWG A;  1BOD A;  1CDN A;  1KQM C;  1SCM C;  1XFU O;  5B8I B;  4GGN A;  4QJ5 B;  1OMR A;  2MBX A;  2JTT A;  3PN7 C;  1V1F A;  1EG4 A;  1MUX A;  1DJW A;  3KHE A;  5KSZ A;  2GGZ A;  4FQO A;  4ZCV A;  2LCP A;  3CS1 A;  1YVH A;  1XK4 C;  1IGV A;  3WHT B;  3EK7 A;  2AMI A;  1HT9 A;  5BPJ A;  4ZCU A;  1ZMZ A;  2O5G A;  4PE7 A;  1J55 A;  3NSL A;  2GGM A;  2ZN9 A;  2BCX A;  2G9B A;  5CSF A;  1FF1 A;  2KI6 D;  1YR5 A;  1SY9 A;  3I5G C;  5K89 A;  3A4U B;  4PE4 A;  1RWY A;  2EC6 B;  2VRG A;  2JUL A;  3D0Y A;  1YVL A;  1IKU A;  1SL8 A;  2ZNE A;  4YRU A;  2F3Z A;  3KPX A;  3OX5 A;  3VRP A;  2B1U A;  4GAO A;  4YGC B;  1F4O A;  1DJG A;  3SG3 A;  3I5I B;  1CFF A;  4HRE E;  1J1D A;  1B8L A;  3OX6 A;  2JTZ A;  2L2E A;  2JZI A;  1KSM A;  3SG5 A;  2OTG B;  2WCF A;  3EK8 A;  3KF9 A;  4XJK B;  3SG2 A;  1Y0V H;  3HCM A;  1UP5 A;  5AAN A;  1V1G A;  2NLN A;  3EKJ A;  1KFU S;  1ZUZ A;  1R2U A;  4R1E A;  2NZ0 A;  1H8B A;  1WLZ A;  4P5O E;  2I94 A;  2O60 A;  3EVR A;  4C0J A;  2PVB A;  1KK8 B;  1NYA A;  1QXP A;  2KSP A;  2LHI A;  1EG3 A;  1JF0 A;  1JFK A;  3KEV A;  1KFX L;  2BL0 C;  3DD4 A;  3WHU B;  1UHN A;  4M2O A;  1YX8 A;  3EVU A;  1B8R A;  1Y1X A;  2ZN8 A;  2V53 A;  1PVB A;  1UHK A;  1NX3 A;  4OKH A;  4AQI A;  3F45 A;  2K2A A;  3TS5 C;  1CLL A;  2F3Y A;  3ICB A;  1TRF A;  1QS7 A;  1SRA A;  3BUX B;  1B1G A;  1S6J A;  1QLS A;  4GBA A;  1SK6 D;  2LMU A;  3AKA A;  1GQM A;  2FCE A;  3SIB A;  1F71 A;  4I5N B;  2GV5 A;  1EL4 A;  1N65 A;  4NDD A;  2KFG A;  4HRH A;  4ICB A;  2NXQ A;  1XFW O;  1TOP A;  2KAV A;  3HX4 A;  3E3R A;  1XYD A;  3M0W A;  5JJG A;  5I2O A;  3TUY C;  1AUI B;  4MBE A;  1SPY A;  4PCW A;  1TNX A;  2KFH A;  2MJW B;  4HRG A;  3BQ3 A;  1ALV A;  3KO0 A;  2KFF A;  1KWO B;  3CLN A;  1K93 D;  3IQQ A;  1J7O A;  1B7T Y;  1IJ6 A;  1TCO B;  4L9M A;  1CMF A;  1QAT A;  3PAL A;  1K96 A;  3TDZ A;  1XVJ A;  2M1K B;  1OOJ A;  3BUN B;  2PAL A;  4YGA A;  1X02 A;  1JF2 A;  2ZKM X;  4GGF A;  1DGV A;  1AHR A;  2M8U A;  2BCA A;  2RGI A;  5CPV A;  1B47 A;  1SR6 C;  1LVC D;  1KFX S;  1K94 A;  3FIA A;  1JWD A;  3LLE A;  4PHJ A;  3DF0 A;  4N1F A;  1W7J B;  2L0P A;  3RLZ A;  3AAJ A;  1WY9 A;  1YRU B;  2I7A A;  2JXL A;  1A75 B;  4CID A;  1SBJ A;  3NSI A;  4DCK A;  1S26 D;  3JVT B;  1B4C A;  3VRR A;  4MN0 A;  1PVA A;  2QPT A;  4D1E A;  1L2O B;  2M3W A;  1REC A;  2JQ6 A;  1KFU L;  2MLE C;  3IF7 A;  4OVN F;  1BMO A;  1XFX O;  2PSR A;  4YGD B;  3SIA A;  3DVJ A;  1S1E A;  1ZFS A;  1KK7 Z;  1R6P A;  4MRY A;  4AQJ A;  2L50 A;  1CFC A;  3ZWH A;  4DRW A;  3VRN A;  5IBW A;  4C0L A;  4NDB A;  1FI6 A;  1JFJ A;  2LHL A;  3TDU A;  3WXA A;  1IQ3 A;  1AK8 A;  1LA0 A;  2CBL A;  1D1O A;  1J7Q A;  1QX5 B;  3A8R A;  4MVF A;  1QV0 A;  3OB1 B;  1S6I A;  1MF8 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...