4CFRA

Ca-bound s100a4 c3s, c81s, c86s and f45w mutant complexed with non- muscle myosin iia
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
94
structure length
94
Chain Sequence
ASPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSWLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSSIAMMSNEFFEGFPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The C-Terminal Random Coil Region Tunes the Ca2+-Binding Affinity of S100A4 Through Conformational Activation.
pubmed doi rcsb
molecule keywords PROTEIN S100-A4
molecule tags Ca-binding protein/motor protein
source organism Homo sapiens
total genus 35
structure length 94
sequence length 94
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4cfrA00
3KHEA 2FCDA 1SRAA 1YVHA 3JTDB 1IKUA 1SL9A 2L0PA 2OTGB 2NLNA 1V1FA 2KHNA 1ZFSA 1N65A 2PVBA 4AOMA 1C7WA 4U8DA 4PE7A 2ISDA 1AJ4A 3DVJA 4ORCB 1NX1A 2K7CA 1PULA 2MRDA 2ZFDA 2FJUB 5IBWA 1SYMA 1IJ5A 2MHHA 3D0YA 1TTXA 2LCPA 4ETOA 2OPOA 1SK6D 5CSJA 4I5NB 1DT7B 4WQ2A 1JWDA 1KQVA 1A75A 2M7LA 5ER4X 2OS8B 2GGMA 1IH0A 1BT6A 1NX0A 2JC2A 3BUXB 1MWNA 2E30A 1QLSA 2F2OA 2L51A 3VRPA 1IJ6A 1LINA 2DOQA 2PSRA 1IGVA 1C07A 1OQPA 3SIBA 1Q80A 2P6BB 1WDCB 1UHHA 2Y4QA 1UURA 5JOLA 2KAXA 2KFFA 1BLQA 1LXFC 3CWGA 2KBIA 1TOPA 2L5XB 3CGAA 2JNXA 2LMVA 2KOTA 4WQ3A 1TN4A 1DJZA 1RTP1 4GGFC 2CT9A 1CTRA 1UHKA 1RK9A 3DF0B 1OMRA 1XYDA 1BODA 2CXJA 2KGRA 3NXAA 4MN0A 3ZNIA 1S6JA 2MLFC 4ZCUA 1M46A 1XVJA 4CFQA 5TNCA 2AMIA 2WCEA 3I5FB 1WRLA 1YR5A 3JTDC 4MZKA 3SG2A 4AQIA 1BJFA 1F55A 4NDBA 4HRGA 4NQGA 2OTGC 1MXLC 1J7OA 3WHUB 1R6PA 1H4BA 2KI6D 5I2LA 4GGFA 2I18A 2VRGA 3H4SE 1BF5A 1DJWA 4I5KA 2BBMA 3BUOB 1FW4A 3O78A 2BCAA 1J1EA 3A4UB 1J1DA 4PHJA 4L9MA 2JXLA 5DKRA 1TNXA 1WRZA 2M3WA 3TUYB 2EGDA 1YX7A 3NSLA 1KSOA 4GFTA 2OS8C 1QXPA 3EVRA 2LE9B 5AERA 4CLNA 1YRTB 4PDZA 1TRFA 5KU1A 1UP5A 3BYAA 1JFJA 1RECA 5F6TA 1DJYA 1LVCD 4MSPA 5AANA 5I8NA 1JSAA 2LANA 4YGBB 1K9KA 2KI4B 3IQOA 2WCBA 3IQQA 2CBLA 2L98A 4M2QA 5CSNA 1WDCC 1GGWA 2K2AA 1UUSA 3PLFB 3PATA 2GV5A 1ZUZA 2LVVA 1KSMA 3TS5B 4DCKA 1J7PA 1QX5B 1DJGA 3OB1B 2BBNA 5HYDA 4R1EA 2BL0B 3E3RA 1CFFA 1C7VA 3RLZA 1B7TY 4OV2A 2KSPA 1PRWA 2ZKMX 2L4HA 1A4PA 4YBHB 3I5IB 1VRKA 4NDCA 1Y6WA 3CR4X 2JWWA 3I5FC 4GUKA 4PHNA 3KF9A 2Y1MA 1QS7A 1K94A 1X02A 3BUMB 4OCIA 4PE4A 3VGOA 3JVTB 5AXIA 2K8MB 3DF0A 2V53A 1JUOA 3SG5A 4YGDB 4IL1A 2HQ8A 5D69A 4GNKB 1YUTA 2M0RA 2ZRSA 3WNXB 2F3ZA 3IF7A 2M7NA 2M9GA 5HLOA 1DGVA 1DVIA 1M39A 3TUYC 1QTXA 4YGCB 1KWOC 3VROA 4FTGA 1GQMA 1QV0A 4DS7A 1OOJA 3EK8A 1KK7Y 2M49B 1XA5A 3EK7A 2LP2A 1A03A 1F4QA 2E6WA 2EC6B 1S5GY 4UPGA 1NSHA 3MSEB 4YI9A 1A29A 4XJKB 3RM1A 1OMVA 4YGEB 5AFPA 1Y1AA 2AAOA 2KI4C 1K9UA 1AVSA 5K89A 1B8LA 4MVFA 3SG4A 5KSZA 3LLEA 3HCMA 3TS5C 4C0JA 4F0ZB 1NWDA 4OVNF 4GAOA 2L50A 2O5GA 3BUWB 2BL0C 4PHMA 1NX3A 2WOSA 5DKNA 1YUUA 1FPWA 2CCMA 1BR1B 4MZLA 1QV1A 3I5IC 3CR2A 3PSRA 2KDHA 4YGAA 1R2UA 2K7BA 3PFVA 2LLUA 1AHRA 1OMDA 1ODBA 2WCFA 4HSZA 4I5LB 3PM8A 2LNKA 4QJ5B 3LL8B 3NSKA 2FCEA 2KAYA 4OKHA 3OB2B 1EJ3A 1PK0D 1YURA 3JVTC 1W7JB 2COLB 2BCBA 2ZN9A 3SG7A 2LUCA 3HX4A 1K93D 4CFRA 2WORA 2M1KB 2JT0A 1YRUB 1MUXA 3DVKA 1QX7A 3SG3A 4MRYA 1TIZA 2JT3A 3BXKA 1YTZC 3I5GC 4P2YB 5B8IB 3I5HB 1IQ5A 1EXRA 1KQMC 1DJXA 4NDDA 2F3YA 1SPYA 1NCYA 1W7IB 1TNWA 1IG5A 1YX8A 3A8RA 1SBJA 2JTZA 5HKYA 2KQ6A 1NIWA 1K8UA 2EC6C 2ZN8A 1CLMA 1HT9A 4PE0A 1CDMA 1SL8A 1HQVA 1Y1UA 3FWCA 2CTNA 1V1GA 1DJHA 1KFXS 1ZMZA 2Q4UA 5CSIA 1DTLA 1FBVA 3DVMA 3C1VA 1EH2A 1KWOB 1S6IA 3TDZA 3SG6A 1B1GA 1UHJA 1B47A 4N1GA 3EVVA 4DUQA 2R2IA 4MLWA 2KAVA 2L2EA 1BU3A 2M1UA 3QRXA 1XFXO 4AQJA 1S6CA 3PALA 3FWBA 1S1EA 4JQ0D 1UHIA 4XJKA 5KTYA 1UWOA 2LLSA 3AKBA 3WXAA 1B8RA 4MZJA 1F70A 2O60A 4CPVA 1B9AA 2LC5A 4DRWA 1DGUA 2KYFA 3OX5A 1BR4B 2LV7A 4ICBA 1RFJA 3CR5X 3O4YA 3TZ1A 1QVIY 3WHTB 4HRHA 1DJIA 1OZSA 3BUNB 1M63B 2QACA 1ALWA 2KNEA 3GK2A 5GQQC 2K7DA 2ZNDA 5PALA 1XFWO 5J3XA 2HETA 4OR9B 1G33A 2KBMA 3I5HC 3SIAA 1QIVA 2JT8A 5BPJA 2NCOA 1BMOA 3LK1A 1L2OB 3SJSA 2MA2A 1EG3A 1PVBA 5CPVA 1K95A 1CDPA 1OZOA 1U5IA 3PN7C 2KYCA 1IQ3A 3CTNA 1MQ1A 1XO5A 1XFYO 3EKJA 4ORBB 3D10A 1LKJA 1F4OA 4FQOA 2KI6C 1QASA 3I5GB 4PE1A 1A2XA 1B4CA 1IWQA 3GOFA 2B1UA 4GPLB 2JPTA 1KQMB 2JRFA 1PSRA 1NYAA 1PALA 2NXQA 2I7AA 4XYNA 1Y1XA 5HLVA 1KFUS 1S26D 2G9BA 4HREE 2IS9A 2QPTA 4MRXA 2M8UA 1L7ZA 2BECA 1K9PA 4QJ3B 2PMYA 2F2PA 5HKWA 4N5XA 4YI8A 2H61C 2D8NA 4WRIA 1JFKA 3VRNA 4JWQA 5ER5A 1B8CA 1NCXA 3TDIA 3ICBA 4PCWA 2NCPA 1QLKA 2FOTA 2JOJA 2BKIB 1N2DA 1MF8B 1FI6A 3FIAA 4BY5A 1CM1A 2H61A 4C0LA 2Y5IA 1NUBA 1QX2A 2LLTA 1YVLA 1NPQA 1SCVA 2BCXA 2K2FA 1DF0B 1KK8B 3ZWHA 2CNPA 1D1OA 3BQ3A 1ZACA 1FF1A 3BOWB 2JZIA 1MR8A 2K7OA 3VRQA 2HF5A 5I2QA 1AP4A 1CFCA 1TNPA 1MXEA 1XFUO 5AEQA 1TNQA 3DVEA 4D1EA 1WLMA 1RJVA 1YUSA 3KPXA 3OP0A 1L2OC 1ZOTB 4E68A 2PASA 1SW8A 3VRRA 1S36A 3F45A 1SMGA 2MBXA 1KK7Z 3AAKA 1UHNA 1J7QA 1KFXL 1U5IB 5FYXA 2BKHB 2KGBC 2KFGA 1S5GZ 1MHOA 1SR6B 4MEWA 1XFZO 1OSAA 2LP3A 3M0WA 1NX2A 2ZNEA 1CM4A 1WRKA 4P5OE 2BE6A 1CFDA 4MBEA 4YRUA 4C0KA 2G2BA 3PN7B 3GK4X 1EL4A 1XFVO 4TNCA 1BOCA 4M2PA 1CDNA 1JF0A 1F54A 1J7RA 1CFPA 2LAPA 1SKTA 1G4YR 2JNFA 1RWYA 3O6BA 1DMOA 1S3PA 1K90D 1CDLA 1SL7A 2ZRTA 3KO0A 1LA0A 2GGZA 2JULA 2Y1NA 1CB1A 1QIWA 2RGIA 1SCMB 1K96A 2F33A 2LMTA 2SASA 5G08A 2KQYA 5DKQA 2BE4A 4PHKA 1JBAA 2L4IA 2HPSA 3AKAA 3NSIA 2JTTA 1KK8C 1KCYA 3OHMB 4GBAA 1GGZA 3EKHA 2PALA 4GGNA 2JXCA 1SY9A 3D0YB 1AUIB 4I5JA 4BY4A 2MAZA 3CLNA 3K21A 1NP8A 1FI5A 4PALA 3OX6A 1ALVA 5D7FA 2JQ6A 1XK4C 1AK8A 3EK4A 4USLA 2PRUA 1A75B 2I94A 1G8IA 4A4BA 4CIDA 2LMUA 2M29A 1IRJA 3NSOA 1DF0A 5JJGA 4QJ4B 3BOWA 2H2KA 3KEVA 3CZTX 1GJYA 2WNDA 3TDUA 4A4CA 4Q04A 1XK4A 1SR6C 5HKZA 1RROA 1KFUL 3CS1A 2SCPA 5CSFA 2LUXA 1NCZA 2Q91A 4DIRA 1F71A 4ZCVA 1BG1A 1WLZA 1Y0VH 1J55A 1N0YA 2LVKA 3AAJA 1H8BA 3DD4A 3LCPC 1E8AA 1JC2A 3EVUA 2K0JA 4N1FA 1AJ5A 3O2PA 5I2OA 4ORAB 2EHBA 2M97A 2LM5A 1CLLA 2LVJA 1LA3A 1EG4A 3GK1A 2KFHA 2F8PA 1F8HA 3LK0A 2LVIA 1TCFA 2MLEC 1QJTA 4JPZB 3FS7A 1M45A 2HQWA 1CMFA 1PSBA 1PVAA 2NZ0A 2K61A 1SCMC 2A4JA 2MJWB 2LHLA 2JU0A 2WC8A 1TCOB 1M31A 2AUCA 1QVIZ 1CNPA 1CMGA 1JF2A 1OE9B 2I2RE 2TN4A 1CKKA 4M2OA 1B7TZ 1QATA 1WY9A 1CLBA 1K2HA 1SNLA 2LHIA
chains in the Genus database with same CATH superfamily
3KHEA 2FCDA 1SRAA 1YVHA 1QWVA 3JTDB 1IKUA 2QEBA 1SL9A 1GM0A 2L0PA 2OTGB 2NLNA 1V1FA 2KHNA 1ZFSA 1N65A 2PVBA 4AOMA 1C7WA 4U8DA 4PE7A 2ISDA 1AJ4A 3DVJA 4ORCB 1NX1A 3UNWA 1ORGA 2K7CA 3S0AA 1PULA 2YGUA 2MRDA 2ZFDA 2FJUB 5IBWA 1OW4A 1SYMA 1IJ5A 2MHHA 3D0YA 3NHTA 1TTXA 3SS5A 2LCPA 4ETOA 2OPOA 3DXLA 2L5YA 1SK6D 5CSJA 4I5NB 1DC1A 1DT7B 4WQ2A 1JWDA 1KQVA 1A75A 2M7LA 5ER4X 2OS8B 2P71A 2GGMA 4FQTA 1IH0A 1BT6A 1NX0A 4PT1A 2JC2A 3BUXB 1MWNA 2E30A 1QLSA 2F2OA 3OGNA 2L51A 2PQLA 3VRPA 2K60A 1IJ6A 1LINA 2DOQA 2PSRA 2WC5A 1IGVA 3L47A 1C07A 2BNXA 1OQPA 3SIBA 1Q80A 2QEOA 1OOGA 2P6BB 1WDCB 1UHHA 3B87A 1DQEA 2Y4QA 1UURA 5JOLA 2KAXA 2KFFA 1BLQA 1LXFC 3CWGA 2KBIA 1TOPA 2KLDA 2L5XB 3CGAA 2JNXA 3S0BA 2LMVA 5D3OA 2KOTA 4WQ3A 1TN4A 1DJZA 1RTP1 4GGFC 2CT9A 1CTRA 1UHKA 1RK9A 3DF0B 1OMRA 1XYDA 1BODA 2CXJA 2KGRA 3NXAA 4MN0A 3ZNIA 1S6JA 2MLFC 4ZCUA 1M46A 1XVJA 4CFQA 5TNCA 2AMIA 2WCEA 2GTEA 3I5FB 1WRLA 1YR5A 3JTDC 4MZKA 3SG2A 4AQIA 1BJFA 1F55A 4NDBA 4HRGA 4NQGA 3S0FA 2OTGC 1MXLC 1OOHA 1J7OA 3WHUB 1R6PA 1H4BA 2KI6D 5I2LA 4GGFA 2I18A 2VRGA 3H4SE 2WCKA 3S0EA 1BF5A 1DJWA 1T14A 1Z2CB 4I5KA 2BBMA 2WCMA 3BUOB 1FW4A 3BFHA 3O78A 4INWA 2BCAA 1J1EA 3A4UB 1J1DA 4PHJA 4L9MA 2JXLA 1XFRA 5DKRA 1TNXA 1WRZA 2M3WA 3TUYB 2EGDA 1YX7A 3NSLA 1KSOA 4GFTA 2OS8C 3D75A 3DY9A 1QXPA 3EVRA 2LE9B 5FI7A 5AERA 4CLNA 1YRTB 4PDZA 1TRFA 3DYEA 5KU1A 1UP5A 3BYAA 1JFJA 1RECA 5F6TA 1DJYA 1LVCD 4MSPA 5AANA 5I8NA 1JSAA 4JKTA 2LANA 4YGBB 1K9KA 2KI4B 3IQOA 2WCBA 3IQQA 2CBLA 2L98A 4M2QA 5CSNA 1WDCC 1GGWA 2K2AA 5I94A 3B7AA 1UUSA 3PLFB 3PATA 2GV5A 1ZUZA 2LVVA 1KSMA 3IVTA 3TS5B 4DCKA 1J7PA 1QX5B 1DJGA 3OB1B 2BBNA 5HYDA 4R1EA 2BL0B 3E3RA 1CFFA 4KYNA 1C7VA 3RLZA 3EG5B 1B7TY 3D77A 3VB1A 4OV2A 2KSPA 1PRWA 2ZKMX 2L4HA 1A4PA 4YBHB 3I5IB 1VRKA 3CZ1A 4NDCA 1Y6WA 3CR4X 2JWWA 3I5FC 4GUKA 4PHNA 3KF9A 2Y1MA 1QS7A 1K94A 1X02A 5FI2A 3BUMB 3FE8A 4OCIA 4PE4A 3VGOA 3JVTB 5AXIA 2K8MB 3DF0A 2V53A 1JUOA 3NGVA 3SG5A 4YGDB 4IL1A 2HQ8A 5D69A 4GNKB 2QDIA 3PM2A 1YUTA 2M0RA 2ZRSA 3WNXB 2F3ZA 3IF7A 2M7NA 2M9GA 5HLOA 1DGVA 1DVIA 1M39A 3TUYC 1QTXA 4YGCB 1KWOC 3VROA 3L4LA 1GQMA 1QV0A 4FTGA 4DS7A 1OOJA 3EK8A 1KK7Y 2M49B 1XA5A 3EK7A 2LP2A 1A03A 1F4QA 2E6WA 2EC6B 5HL1A 1S5GY 4UPGA 1NSHA 3MSEB 4YI9A 1A29A 2QEVA 4XJKB 1OMVA 4YGEB 3RM1A 1Y1AA 2AAOA 2KI4C 3CDNA 1K9UA 1AVSA 5AFPA 5K89A 1B8LA 4MVFA 3SG4A 5KSZA 3LLEA 3HCMA 3TS5C 3N7HA 4C0JA 4F0ZB 1NWDA 4OVNF 4GAOA 2L50A 2O5GA 3BUWB 2BL0C 4PHMA 3Q8IA 3BJHA 1NX3A 1TUJA 2WOSA 5FI6A 5DKNA 1YUUA 3CYZA 1FPWA 1Z4HA 2CCMA 1BR1B 4MZLA 1QV1A 3I5IC 3CR2A 3PSRA 2KDHA 3PJIA 4YGAA 1R2UA 2K7BA 3PFVA 2LLUA 1AHRA 1OMDA 1ODBA 2WCFA 4HSZA 4I5LB 3PM8A 2LNKA 4QJ5B 3LL8B 3NSKA 2FCEA 2KAYA 4OKHA 3OB2B 1EJ3A 1PK0D 2BAPA 1YURA 3JVTC 1W7JB 2COLB 2BCBA 2ZN9A 3SG7A 2LUCA 3HX4A 1K93D 4CFRA 2WORA 3D76A 2M1KB 2JT0A 2P70A 1YRUB 1MUXA 3V2LA 3DVKA 1QX7A 3SG3A 4MRYA 1TIZA 2JT3A 3BXKA 1YTZC 3I5GC 3UO9A 4P2YB 3RZSA 5B8IB 1LS8A 3I5HB 1IQ5A 1EXRA 1KQMC 2L2CA 1DJXA 4NDDA 2F3YA 1SPYA 3S0GA 1NCYA 1W7IB 1TNWA 1IG5A 1YX8A 3A8RA 1SBJA 2JTZA 5HKYA 2KQ6A 1NIWA 1K8UA 2EC6C 2ZN8A 4IJ7A 1CLMA 1HT9A 4PE0A 1CDMA 1SL8A 3FE9A 1HQVA 1Y1UA 3FWCA 2CTNA 1V1GA 1DJHA 1KFXS 1ZMZA 2Q4UA 5CSIA 1DTLA 1FBVA 3DVMA 3C1VA 1EH2A 1KWOB 1S6IA 3TDZA 3SG6A 1B1GA 1UHJA 1B47A 4N1GA 3EVVA 4DUQA 2R2IA 4MLWA 2KAVA 2L2EA 1BU3A 2M1UA 3QRXA 1XFXO 4AQJA 1S6CA 3PALA 3FWBA 1S1EA 4JQ0D 1P28A 1UHIA 4XJKA 5KTYA 1UWOA 2LLSA 3AKBA 3WXAA 1B8RA 4MZJA 1F70A 2O60A 4CPVA 1B9AA 2LC5A 4DRWA 1DGUA 2KYFA 3OX5A 5DICA 1BR4B 2LV7A 4ICBA 1RFJA 3CR5X 3O4YA 3TZ1A 1QVIY 3WHTB 3DZTA 4OZDA 4HRHA 1DJIA 1OZSA 3BUNB 3R1PA 1M63B 3SS4A 2QACA 1ALWA 2KNEA 3GK2A 5GQQC 2K7DA 2ZNDA 5EL2A 5PALA 1XFWO 5J3XA 2HETA 4OR9B 1G33A 3B88A 2KBMA 3I5HC 3SIAA 1QIVA 2JT8A 5BPJA 2NCOA 1BMOA 3LK1A 1IIOA 1L2OB 2WCHA 3SJSA 2MA2A 1EG3A 1PVBA 5CPVA 1K95A 1CDPA 1OZOA 3QMEA 1U5IA 3PN7C 2KYCA 1IQ3A 3CTNA 1MQ1A 1XO5A 1XFYO 3EKJA 4ORBB 3D10A 1LKJA 1F4OA 4FQOA 2H8VA 2KI6C 1QASA 2KLEA 3I5GB 4PE1A 1A2XA 1C3ZA 1B4CA 1IWQA 3GOFA 2B1UA 4GPLB 2JPTA 1KQMB 2JRFA 1PSRA 1NYAA 1PALA 1TUZA 2I7AA 2NXQA 1Y1XA 4XYNA 1KFUS 1S26D 2G9BA 4HREE 2IS9A 2QPTA 4MRXA 2M8UA 1L7ZA 2BECA 1K9PA 4QJ3B 2PMYA 2F2PA 4INXA 4N5XA 5HKWA 4YI8A 2H61C 1W9ZA 2D8NA 4WRIA 1JFKA 3VRNA 3OBVA 4JWQA 5ER5A 1B8CA 1NCXA 3TDIA 2WCLA 3ICBA 3R1OA 4PCWA 2NCPA 1QLKA 2FOTA 2JOJA 2BKIB 1N2DA 1MF8B 1FI6A 3FIAA 3K1EA 4BY5A 1CM1A 2H61A 4C0LA 2Y5IA 1NUBA 1QX2A 2LLTA 1YVLA 1NPQA 3S0DA 1SCVA 2BCXA 2K2FA 1DF0B 1KK8B 3ZWHA 2CNPA 1D1OA 3BQ3A 1ZACA 1FF1A 3BOWB 2JZIA 1MR8A 2K7OA 3VRQA 2HF5A 5I2QA 1AP4A 1DELA 1CFCA 1TNPA 1MXEA 1XFUO 5AEQA 1TNQA 3D73A 3DVEA 4D1EA 1WLMA 1RJVA 1YUSA 3KPXA 3OP0A 1L2OC 1ZOTB 4E68A 1SSEB 2PASA 1SW8A 3O4XA 3VRRA 1S36A 3F45A 3R1VA 3L4AA 1SMGA 2MBXA 1KK7Z 3CZ2A 3AAKA 1UHNA 1J7QA 1KFXL 1U5IB 5FYXA 2BKHB 2KGBC 2KFGA 1S5GZ 1MHOA 1SR6B 4MEWA 1XFZO 1OSAA 2LP3A 3M0WA 1NX2A 2ZNEA 1CM4A 1WRKA 3NHIA 4P5OE 4JD9A 2BE6A 1CFDA 4MBEA 2QEHA 4C0KA 4YRUA 2G2BA 4F7FA 3PN7B 3GK4X 1EL4A 1XFVO 4TNCA 1BOCA 4M2PA 1CDNA 1JF0A 1F54A 1J7RA 1CFPA 2LAPA 1SKTA 1G4YR 2JNFA 1RWYA 3O6BA 1DMOA 1S3PA 1K90D 1CDLA 1OOFA 1SL7A 2ZRTA 1LA0A 2GGZA 2JULA 2Y1NA 3KO0A 5HLVA 1CB1A 1QIWA 2RGIA 1SCMB 1K96A 2F33A 2LMTA 2SASA 5G08A 2KQYA 5DKQA 3D78A 2BE4A 4PHKA 1JBAA 2JPOA 2L4IA 2HPSA 3BFBA 3AKAA 3NSIA 2JTTA 1KK8C 1KCYA 3OHMB 1TWOA 3B6XA 4GBAA 1GGZA 3EKHA 2PALA 4GGNA 2ERBA 1SY9A 2JXCA 3D0YB 1AUIB 4I5JA 4BY4A 3CZ0A 2MAZA 3CLNA 3K21A 1NP8A 1FI5A 4PALA 3OX6A 1ALVA 5D7FA 2JQ6A 1XK4C 1AK8A 3EK4A 4USLA 2PRUA 1A75B 2I94A 1G8IA 4A4BA 4CIDA 2LMUA 2M29A 1IRJA 3NSOA 1DF0A 3R72A 5JJGA 4QJ4B 3BOWA 2H2KA 3KEVA 3CZTX 2WCJA 3FE6A 1GJYA 2WNDA 3TDUA 4A4CA 4Q04A 1C3YA 1OOIX 1XK4A 1SR6C 5HKZA 1RROA 1KFUL 3CS1A 2SCPA 5CSFA 2LUXA 1NCZA 2Q91A 4DIRA 1F71A 4ZCVA 1BG1A 1WLZA 1Y0VH 1J55A 1N0YA 2LVKA 3AAJA 1H8BA 3DD4A 3LCPC 1E8AA 1JC2A 3EVUA 2K0JA 4N1FA 1AJ5A 3O2PA 5I2OA 4ORAB 3SS3A 2EHBA 2KPHA 2M97A 2LM5A 1CLLA 2LVJA 3BFAA 1LA3A 1EG4A 3GK1A 2KFHA 2F8PA 1F8HA 3LK0A 2LVIA 1TCFA 2MLEC 1QJTA 4JPZB 3FS7A 1M45A 2HQWA 1CMFA 1PSBA 1PVAA 2NZ0A 2K61A 1SCMC 1DEKA 2A4JA 3D74A 2MJWB 3CABA 2LHLA 2JU0A 2WC8A 1TCOB 1M31A 2AUCA 1QVIZ 2WC6A 3B86A 1CMGA 1CNPA 1JF2A 1OE9B 2PYQA 2I2RE 2TN4A 1CKKA 4M2OA 1B7TZ 1QATA 1WY9A 1CLBA 1K2HA 1SNLA 2FJYA 2LHIA
chains in the Genus database with same CATH topology
3KHEA 2FCDA 1SRAA 1YVHA 3JTDB 1IKUA 1SL9A 2L0PA 2OTGB 2NLNA 1V1FA 2KHNA 1ZFSA 1N65A 2PVBA 4AOMA 1C7WA 4U8DA 4PE7A 2ISDA 1AJ4A 3DVJA 4ORCB 1NX1A 2K7CA 1PULA 2MRDA 2ZFDA 2FJUB 5IBWA 1SYMA 1IJ5A 2MHHA 3D0YA 1TTXA 2LCPA 4ETOA 2OPOA 1SK6D 5CSJA 4I5NB 1DT7B 4WQ2A 1JWDA 1KQVA 1A75A 2M7LA 5ER4X 2OS8B 2GGMA 1IH0A 1BT6A 1NX0A 2JC2A 3BUXB 1MWNA 2E30A 1QLSA 2F2OA 2L51A 3VRPA 1IJ6A 1LINA 2DOQA 2PSRA 1IGVA 1C07A 1OQPA 3SIBA 1Q80A 2P6BB 1WDCB 1UHHA 2Y4QA 1UURA 5JOLA 2KAXA 2KFFA 1BLQA 1LXFC 3CWGA 2KBIA 1TOPA 2L5XB 3CGAA 2JNXA 2LMVA 2KOTA 4WQ3A 1TN4A 1DJZA 1RTP1 4GGFC 2CT9A 1CTRA 1UHKA 1RK9A 3DF0B 1OMRA 1XYDA 1BODA 2CXJA 2KGRA 3NXAA 4MN0A 3ZNIA 1S6JA 2MLFC 4ZCUA 1M46A 1XVJA 4CFQA 5TNCA 2AMIA 2WCEA 3I5FB 1WRLA 1YR5A 3JTDC 4MZKA 3SG2A 4AQIA 1BJFA 1F55A 4NDBA 4HRGA 4NQGA 2OTGC 1MXLC 1J7OA 3WHUB 1R6PA 1H4BA 2KI6D 5I2LA 4GGFA 2I18A 2VRGA 3H4SE 1BF5A 1DJWA 4I5KA 2BBMA 3BUOB 1FW4A 3O78A 2BCAA 1J1EA 3A4UB 1J1DA 4PHJA 4L9MA 2JXLA 5DKRA 1TNXA 1WRZA 2M3WA 3TUYB 2EGDA 1YX7A 3NSLA 1KSOA 4GFTA 2OS8C 1QXPA 3EVRA 2LE9B 5AERA 4CLNA 1YRTB 4PDZA 1TRFA 5KU1A 1UP5A 3BYAA 1JFJA 1RECA 5F6TA 1DJYA 1LVCD 4MSPA 5AANA 5I8NA 1JSAA 2LANA 4YGBB 1K9KA 2KI4B 3IQOA 2WCBA 3IQQA 2CBLA 2L98A 4M2QA 5CSNA 1WDCC 1GGWA 2K2AA 1UUSA 3PLFB 3PATA 2GV5A 1ZUZA 2LVVA 1KSMA 3TS5B 4DCKA 1J7PA 1QX5B 1DJGA 3OB1B 2BBNA 5HYDA 4R1EA 2BL0B 3E3RA 1CFFA 1C7VA 3RLZA 1B7TY 4OV2A 2KSPA 1PRWA 2ZKMX 2L4HA 1A4PA 4YBHB 3I5IB 1VRKA 4NDCA 1Y6WA 3CR4X 2JWWA 3I5FC 4GUKA 4PHNA 3KF9A 2Y1MA 1QS7A 1K94A 1X02A 3BUMB 4OCIA 4PE4A 3VGOA 3JVTB 5AXIA 2K8MB 3DF0A 2V53A 1JUOA 3SG5A 4YGDB 4IL1A 2HQ8A 5D69A 4GNKB 1YUTA 2M0RA 2ZRSA 3WNXB 2F3ZA 3IF7A 2M7NA 2M9GA 5HLOA 1DGVA 1DVIA 1M39A 3TUYC 1QTXA 4YGCB 1KWOC 3VROA 4FTGA 1GQMA 1QV0A 4DS7A 1OOJA 3EK8A 1KK7Y 2M49B 1XA5A 3EK7A 2LP2A 1A03A 1F4QA 2E6WA 2EC6B 1S5GY 4UPGA 1NSHA 3MSEB 4YI9A 1A29A 4XJKB 3RM1A 1OMVA 4YGEB 5AFPA 1Y1AA 2AAOA 2KI4C 1K9UA 1AVSA 5K89A 1B8LA 4MVFA 3SG4A 5KSZA 3LLEA 3HCMA 3TS5C 4C0JA 4F0ZB 1NWDA 4OVNF 4GAOA 2L50A 2O5GA 3BUWB 2BL0C 4PHMA 1NX3A 2WOSA 5DKNA 1YUUA 1FPWA 2CCMA 1BR1B 4MZLA 1QV1A 3I5IC 3CR2A 3PSRA 2KDHA 4YGAA 1R2UA 2K7BA 3PFVA 2LLUA 1AHRA 1OMDA 1ODBA 2WCFA 4HSZA 4I5LB 3PM8A 2LNKA 4QJ5B 3LL8B 3NSKA 2FCEA 2KAYA 4OKHA 3OB2B 1EJ3A 1PK0D 1YURA 3JVTC 1W7JB 2COLB 2BCBA 2ZN9A 3SG7A 2LUCA 3HX4A 1K93D 4CFRA 2WORA 2M1KB 2JT0A 1YRUB 1MUXA 3DVKA 1QX7A 3SG3A 4MRYA 1TIZA 2JT3A 3BXKA 1YTZC 3I5GC 4P2YB 5B8IB 3I5HB 1IQ5A 1EXRA 1KQMC 1DJXA 4NDDA 2F3YA 1SPYA 1NCYA 1W7IB 1TNWA 1IG5A 1YX8A 3A8RA 1SBJA 2JTZA 5HKYA 2KQ6A 1NIWA 1K8UA 2EC6C 2ZN8A 1CLMA 1HT9A 4PE0A 1CDMA 1SL8A 1HQVA 1Y1UA 3FWCA 2CTNA 1V1GA 1DJHA 1KFXS 1ZMZA 2Q4UA 5CSIA 1DTLA 1FBVA 3DVMA 3C1VA 1EH2A 1KWOB 1S6IA 3TDZA 3SG6A 1B1GA 1UHJA 1B47A 4N1GA 3EVVA 4DUQA 2R2IA 4MLWA 2KAVA 2L2EA 1BU3A 2M1UA 3QRXA 1XFXO 4AQJA 1S6CA 3PALA 3FWBA 1S1EA 4JQ0D 1UHIA 4XJKA 5KTYA 1UWOA 2LLSA 3AKBA 3WXAA 1B8RA 4MZJA 1F70A 2O60A 4CPVA 1B9AA 2LC5A 4DRWA 1DGUA 2KYFA 3OX5A 1BR4B 2LV7A 4ICBA 1RFJA 3CR5X 3O4YA 3TZ1A 1QVIY 3WHTB 4HRHA 1DJIA 1OZSA 3BUNB 1M63B 2QACA 1ALWA 2KNEA 3GK2A 5GQQC 2K7DA 2ZNDA 5PALA 1XFWO 5J3XA 2HETA 4OR9B 1G33A 2KBMA 3I5HC 3SIAA 1QIVA 2JT8A 5BPJA 2NCOA 1BMOA 3LK1A 1L2OB 3SJSA 2MA2A 1EG3A 1PVBA 5CPVA 1K95A 1CDPA 1OZOA 1U5IA 3PN7C 2KYCA 1IQ3A 3CTNA 1MQ1A 1XO5A 1XFYO 3EKJA 4ORBB 3D10A 1LKJA 1F4OA 4FQOA 2KI6C 1QASA 3I5GB 4PE1A 1A2XA 1B4CA 1IWQA 3GOFA 2B1UA 4GPLB 2JPTA 1KQMB 2JRFA 1PSRA 1NYAA 1PALA 2NXQA 2I7AA 4XYNA 1Y1XA 5HLVA 1KFUS 1S26D 2G9BA 4HREE 2IS9A 2QPTA 4MRXA 2M8UA 1L7ZA 2BECA 1K9PA 4QJ3B 2PMYA 2F2PA 5HKWA 4N5XA 4YI8A 2H61C 2D8NA 4WRIA 1JFKA 3VRNA 4JWQA 5ER5A 1B8CA 1NCXA 3TDIA 3ICBA 4PCWA 2NCPA 1QLKA 2FOTA 2JOJA 2BKIB 1N2DA 1MF8B 1FI6A 3FIAA 4BY5A 1CM1A 2H61A 4C0LA 2Y5IA 1NUBA 1QX2A 2LLTA 1YVLA 1NPQA 1SCVA 2BCXA 2K2FA 1DF0B 1KK8B 3ZWHA 2CNPA 1D1OA 3BQ3A 1ZACA 1FF1A 3BOWB 2JZIA 1MR8A 2K7OA 3VRQA 2HF5A 5I2QA 1AP4A 1CFCA 1TNPA 1MXEA 1XFUO 5AEQA 1TNQA 3DVEA 4D1EA 1WLMA 1RJVA 1YUSA 3KPXA 3OP0A 1L2OC 1ZOTB 4E68A 2PASA 1SW8A 3VRRA 1S36A 3F45A 1SMGA 2MBXA 1KK7Z 3AAKA 1UHNA 1J7QA 1KFXL 1U5IB 5FYXA 2BKHB 2KGBC 2KFGA 1S5GZ 1MHOA 1SR6B 4MEWA 1XFZO 1OSAA 2LP3A 3M0WA 1NX2A 2ZNEA 1CM4A 1WRKA 4P5OE 2BE6A 1CFDA 4MBEA 4YRUA 4C0KA 2G2BA 3PN7B 3GK4X 1EL4A 1XFVO 4TNCA 1BOCA 4M2PA 1CDNA 1JF0A 1F54A 1J7RA 1CFPA 2LAPA 1SKTA 1G4YR 2JNFA 1RWYA 3O6BA 1DMOA 1S3PA 1K90D 1CDLA 1SL7A 2ZRTA 3KO0A 1LA0A 2GGZA 2JULA 2Y1NA 1CB1A 1QIWA 2RGIA 1SCMB 1K96A 2F33A 2LMTA 2SASA 5G08A 2KQYA 5DKQA 2BE4A 4PHKA 1JBAA 2L4IA 2HPSA 3AKAA 3NSIA 2JTTA 1KK8C 1KCYA 3OHMB 4GBAA 1GGZA 3EKHA 2PALA 4GGNA 2JXCA 1SY9A 3D0YB 1AUIB 4I5JA 4BY4A 2MAZA 3CLNA 3K21A 1NP8A 1FI5A 4PALA 3OX6A 1ALVA 5D7FA 2JQ6A 1XK4C 1AK8A 3EK4A 4USLA 2PRUA 1A75B 2I94A 1G8IA 4A4BA 4CIDA 2LMUA 2M29A 1IRJA 3NSOA 1DF0A 5JJGA 4QJ4B 3BOWA 2H2KA 3KEVA 3CZTX 1GJYA 2WNDA 3TDUA 4A4CA 4Q04A 1XK4A 1SR6C 5HKZA 1RROA 1KFUL 3CS1A 2SCPA 5CSFA 2LUXA 1NCZA 2Q91A 4DIRA 1F71A 4ZCVA 1BG1A 1WLZA 1Y0VH 1J55A 1N0YA 2LVKA 3AAJA 1H8BA 3DD4A 3LCPC 1E8AA 1JC2A 3EVUA 2K0JA 4N1FA 1AJ5A 3O2PA 5I2OA 4ORAB 2EHBA 2M97A 2LM5A 1CLLA 2LVJA 1LA3A 1EG4A 3GK1A 2KFHA 2F8PA 1F8HA 3LK0A 2LVIA 1TCFA 2MLEC 1QJTA 4JPZB 3FS7A 1M45A 2HQWA 1CMFA 1PSBA 1PVAA 2NZ0A 2K61A 1SCMC 2A4JA 2MJWB 2LHLA 2JU0A 2WC8A 1TCOB 1M31A 2AUCA 1QVIZ 1CNPA 1CMGA 1JF2A 1OE9B 2I2RE 2TN4A 1CKKA 4M2OA 1B7TZ 1QATA 1WY9A 1CLBA 1K2HA 1SNLA 2LHIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KHE A;  2FCD A;  1SRA A;  1YVH A;  3JTD B;  1IKU A;  1SL9 A;  2L0P A;  2OTG B;  2NLN A;  1V1F A;  2KHN A;  1ZFS A;  1N65 A;  2PVB A;  4AOM A;  1C7W A;  4U8D A;  4PE7 A;  2ISD A;  1AJ4 A;  3DVJ A;  4ORC B;  1NX1 A;  2K7C A;  1PUL A;  2MRD A;  2ZFD A;  2FJU B;  5IBW A;  1SYM A;  1IJ5 A;  2MHH A;  3D0Y A;  1TTX A;  2LCP A;  4ETO A;  2OPO A;  1SK6 D;  5CSJ A;  4I5N B;  1DT7 B;  4WQ2 A;  1JWD A;  1KQV A;  1A75 A;  2M7L A;  5ER4 X;  2OS8 B;  2GGM A;  1IH0 A;  1BT6 A;  1NX0 A;  2JC2 A;  3BUX B;  1MWN A;  2E30 A;  1QLS A;  2F2O A;  2L51 A;  3VRP A;  1IJ6 A;  1LIN A;  2DOQ A;  2PSR A;  1IGV A;  1C07 A;  1OQP A;  3SIB A;  1Q80 A;  2P6B B;  1WDC B;  1UHH A;  2Y4Q A;  1UUR A;  5JOL A;  2KAX A;  2KFF A;  1BLQ A;  1LXF C;  3CWG A;  2KBI A;  1TOP A;  2L5X B;  3CGA A;  2JNX A;  2LMV A;  2KOT A;  4WQ3 A;  1TN4 A;  1DJZ A;  1RTP 1;  4GGF C;  2CT9 A;  1CTR A;  1UHK A;  1RK9 A;  3DF0 B;  1OMR A;  1XYD A;  1BOD A;  2CXJ A;  2KGR A;  3NXA A;  4MN0 A;  3ZNI A;  1S6J A;  2MLF C;  4ZCU A;  1M46 A;  1XVJ A;  4CFQ A;  5TNC A;  2AMI A;  2WCE A;  3I5F B;  1WRL A;  1YR5 A;  3JTD C;  4MZK A;  3SG2 A;  4AQI A;  1BJF A;  1F55 A;  4NDB A;  4HRG A;  4NQG A;  2OTG C;  1MXL C;  1J7O A;  3WHU B;  1R6P A;  1H4B A;  2KI6 D;  5I2L A;  4GGF A;  2I18 A;  2VRG A;  3H4S E;  1BF5 A;  1DJW A;  4I5K A;  2BBM A;  3BUO B;  1FW4 A;  3O78 A;  2BCA A;  1J1E A;  3A4U B;  1J1D A;  4PHJ A;  4L9M A;  2JXL A;  5DKR A;  1TNX A;  1WRZ A;  2M3W A;  3TUY B;  2EGD A;  1YX7 A;  3NSL A;  1KSO A;  4GFT A;  2OS8 C;  1QXP A;  3EVR A;  2LE9 B;  5AER A;  4CLN A;  1YRT B;  4PDZ A;  1TRF A;  5KU1 A;  1UP5 A;  3BYA A;  1JFJ A;  1REC A;  5F6T A;  1DJY A;  1LVC D;  4MSP A;  5AAN A;  5I8N A;  1JSA A;  2LAN A;  4YGB B;  1K9K A;  2KI4 B;  3IQO A;  2WCB A;  3IQQ A;  2CBL A;  2L98 A;  4M2Q A;  5CSN A;  1WDC C;  1GGW A;  2K2A A;  1UUS A;  3PLF B;  3PAT A;  2GV5 A;  1ZUZ A;  2LVV A;  1KSM A;  3TS5 B;  4DCK A;  1J7P A;  1QX5 B;  1DJG A;  3OB1 B;  2BBN A;  5HYD A;  4R1E A;  2BL0 B;  3E3R A;  1CFF A;  1C7V A;  3RLZ A;  1B7T Y;  4OV2 A;  2KSP A;  1PRW A;  2ZKM X;  2L4H A;  1A4P A;  4YBH B;  3I5I B;  1VRK A;  4NDC A;  1Y6W A;  3CR4 X;  2JWW A;  3I5F C;  4GUK A;  4PHN A;  3KF9 A;  2Y1M A;  1QS7 A;  1K94 A;  1X02 A;  3BUM B;  4OCI A;  4PE4 A;  3VGO A;  3JVT B;  5AXI A;  2K8M B;  3DF0 A;  2V53 A;  1JUO A;  3SG5 A;  4YGD B;  4IL1 A;  2HQ8 A;  5D69 A;  4GNK B;  1YUT A;  2M0R A;  2ZRS A;  3WNX B;  2F3Z A;  3IF7 A;  2M7N A;  2M9G A;  5HLO A;  1DGV A;  1DVI A;  1M39 A;  3TUY C;  1QTX A;  4YGC B;  1KWO C;  3VRO A;  4FTG A;  1GQM A;  1QV0 A;  4DS7 A;  1OOJ A;  3EK8 A;  1KK7 Y;  2M49 B;  1XA5 A;  3EK7 A;  2LP2 A;  1A03 A;  1F4Q A;  2E6W A;  2EC6 B;  1S5G Y;  4UPG A;  1NSH A;  3MSE B;  4YI9 A;  1A29 A;  4XJK B;  3RM1 A;  1OMV A;  4YGE B;  5AFP A;  1Y1A A;  2AAO A;  2KI4 C;  1K9U A;  1AVS A;  5K89 A;  1B8L A;  4MVF A;  3SG4 A;  5KSZ A;  3LLE A;  3HCM A;  3TS5 C;  4C0J A;  4F0Z B;  1NWD A;  4OVN F;  4GAO A;  2L50 A;  2O5G A;  3BUW B;  2BL0 C;  4PHM A;  1NX3 A;  2WOS A;  5DKN A;  1YUU A;  1FPW A;  2CCM A;  1BR1 B;  4MZL A;  1QV1 A;  3I5I C;  3CR2 A;  3PSR A;  2KDH A;  4YGA A;  1R2U A;  2K7B A;  3PFV A;  2LLU A;  1AHR A;  1OMD A;  1ODB A;  2WCF A;  4HSZ A;  4I5L B;  3PM8 A;  2LNK A;  4QJ5 B;  3LL8 B;  3NSK A;  2FCE A;  2KAY A;  4OKH A;  3OB2 B;  1EJ3 A;  1PK0 D;  1YUR A;  3JVT C;  1W7J B;  2COL B;  2BCB A;  2ZN9 A;  3SG7 A;  2LUC A;  3HX4 A;  1K93 D;  4CFR A;  2WOR A;  2M1K B;  2JT0 A;  1YRU B;  1MUX A;  3DVK A;  1QX7 A;  3SG3 A;  4MRY A;  1TIZ A;  2JT3 A;  3BXK A;  1YTZ C;  3I5G C;  4P2Y B;  5B8I B;  3I5H B;  1IQ5 A;  1EXR A;  1KQM C;  1DJX A;  4NDD A;  2F3Y A;  1SPY A;  1NCY A;  1W7I B;  1TNW A;  1IG5 A;  1YX8 A;  3A8R A;  1SBJ A;  2JTZ A;  5HKY A;  2KQ6 A;  1NIW A;  1K8U A;  2EC6 C;  2ZN8 A;  1CLM A;  1HT9 A;  4PE0 A;  1CDM A;  1SL8 A;  1HQV A;  1Y1U A;  3FWC A;  2CTN A;  1V1G A;  1DJH A;  1KFX S;  1ZMZ A;  2Q4U A;  5CSI A;  1DTL A;  1FBV A;  3DVM A;  3C1V A;  1EH2 A;  1KWO B;  1S6I A;  3TDZ A;  3SG6 A;  1B1G A;  1UHJ A;  1B47 A;  4N1G A;  3EVV A;  4DUQ A;  2R2I A;  4MLW A;  2KAV A;  2L2E A;  1BU3 A;  2M1U A;  3QRX A;  1XFX O;  4AQJ A;  1S6C A;  3PAL A;  3FWB A;  1S1E A;  4JQ0 D;  1UHI A;  4XJK A;  5KTY A;  1UWO A;  2LLS A;  3AKB A;  3WXA A;  1B8R A;  4MZJ A;  1F70 A;  2O60 A;  4CPV A;  1B9A A;  2LC5 A;  4DRW A;  1DGU A;  2KYF A;  3OX5 A;  1BR4 B;  2LV7 A;  4ICB A;  1RFJ A;  3CR5 X;  3O4Y A;  3TZ1 A;  1QVI Y;  3WHT B;  4HRH A;  1DJI A;  1OZS A;  3BUN B;  1M63 B;  2QAC A;  1ALW A;  2KNE A;  3GK2 A;  5GQQ C;  2K7D A;  2ZND A;  5PAL A;  1XFW O;  5J3X A;  2HET A;  4OR9 B;  1G33 A;  2KBM A;  3I5H C;  3SIA A;  1QIV A;  2JT8 A;  5BPJ A;  2NCO A;  1BMO A;  3LK1 A;  1L2O B;  3SJS A;  2MA2 A;  1EG3 A;  1PVB A;  5CPV A;  1K95 A;  1CDP A;  1OZO A;  1U5I A;  3PN7 C;  2KYC A;  1IQ3 A;  3CTN A;  1MQ1 A;  1XO5 A;  1XFY O;  3EKJ A;  4ORB B;  3D10 A;  1LKJ A;  1F4O A;  4FQO A;  2KI6 C;  1QAS A;  3I5G B;  4PE1 A;  1A2X A;  1B4C A;  1IWQ A;  3GOF A;  2B1U A;  4GPL B;  2JPT A;  1KQM B;  2JRF A;  1PSR A;  1NYA A;  1PAL A;  2NXQ A;  2I7A A;  4XYN A;  1Y1X A;  5HLV A;  1KFU S;  1S26 D;  2G9B A;  4HRE E;  2IS9 A;  2QPT A;  4MRX A;  2M8U A;  1L7Z A;  2BEC A;  1K9P A;  4QJ3 B;  2PMY A;  2F2P A;  5HKW A;  4N5X A;  4YI8 A;  2H61 C;  2D8N A;  4WRI A;  1JFK A;  3VRN A;  4JWQ A;  5ER5 A;  1B8C A;  1NCX A;  3TDI A;  3ICB A;  4PCW A;  2NCP A;  1QLK A;  2FOT A;  2JOJ A;  2BKI B;  1N2D A;  1MF8 B;  1FI6 A;  3FIA A;  4BY5 A;  1CM1 A;  2H61 A;  4C0L A;  2Y5I A;  1NUB A;  1QX2 A;  2LLT A;  1YVL A;  1NPQ A;  1SCV A;  2BCX A;  2K2F A;  1DF0 B;  1KK8 B;  3ZWH A;  2CNP A;  1D1O A;  3BQ3 A;  1ZAC A;  1FF1 A;  3BOW B;  2JZI A;  1MR8 A;  2K7O A;  3VRQ A;  2HF5 A;  5I2Q A;  1AP4 A;  1CFC A;  1TNP A;  1MXE A;  1XFU O;  5AEQ A;  1TNQ A;  3DVE A;  4D1E A;  1WLM A;  1RJV A;  1YUS A;  3KPX A;  3OP0 A;  1L2O C;  1ZOT B;  4E68 A;  2PAS A;  1SW8 A;  3VRR A;  1S36 A;  3F45 A;  1SMG A;  2MBX A;  1KK7 Z;  3AAK A;  1UHN A;  1J7Q A;  1KFX L;  1U5I B;  5FYX A;  2BKH B;  2KGB C;  2KFG A;  1S5G Z;  1MHO A;  1SR6 B;  4MEW A;  1XFZ O;  1OSA A;  2LP3 A;  3M0W A;  1NX2 A;  2ZNE A;  1CM4 A;  1WRK A;  4P5O E;  2BE6 A;  1CFD A;  4MBE A;  4YRU A;  4C0K A;  2G2B A;  3PN7 B;  3GK4 X;  1EL4 A;  1XFV O;  4TNC A;  1BOC A;  4M2P A;  1CDN A;  1JF0 A;  1F54 A;  1J7R A;  1CFP A;  2LAP A;  1SKT A;  1G4Y R;  2JNF A;  1RWY A;  3O6B A;  1DMO A;  1S3P A;  1K90 D;  1CDL A;  1SL7 A;  2ZRT A;  3KO0 A;  1LA0 A;  2GGZ A;  2JUL A;  2Y1N A;  1CB1 A;  1QIW A;  2RGI A;  1SCM B;  1K96 A;  2F33 A;  2LMT A;  2SAS A;  5G08 A;  2KQY A;  5DKQ A;  2BE4 A;  4PHK A;  1JBA A;  2L4I A;  2HPS A;  3AKA A;  3NSI A;  2JTT A;  1KK8 C;  1KCY A;  3OHM B;  4GBA A;  1GGZ A;  3EKH A;  2PAL A;  4GGN A;  2JXC A;  1SY9 A;  3D0Y B;  1AUI B;  4I5J A;  4BY4 A;  2MAZ A;  3CLN A;  3K21 A;  1NP8 A;  1FI5 A;  4PAL A;  3OX6 A;  1ALV A;  5D7F A;  2JQ6 A;  1XK4 C;  1AK8 A;  3EK4 A;  4USL A;  2PRU A;  1A75 B;  2I94 A;  1G8I A;  4A4B A;  4CID A;  2LMU A;  2M29 A;  1IRJ A;  3NSO A;  1DF0 A;  5JJG A;  4QJ4 B;  3BOW A;  2H2K A;  3KEV A;  3CZT X;  1GJY A;  2WND A;  3TDU A;  4A4C A;  4Q04 A;  1XK4 A;  1SR6 C;  5HKZ A;  1RRO A;  1KFU L;  3CS1 A;  2SCP A;  5CSF A;  2LUX A;  1NCZ A;  2Q91 A;  4DIR A;  1F71 A;  4ZCV A;  1BG1 A;  1WLZ A;  1Y0V H;  1J55 A;  1N0Y A;  2LVK A;  3AAJ A;  1H8B A;  3DD4 A;  3LCP C;  1E8A A;  1JC2 A;  3EVU A;  2K0J A;  4N1F A;  1AJ5 A;  3O2P A;  5I2O A;  4ORA B;  2EHB A;  2M97 A;  2LM5 A;  1CLL A;  2LVJ A;  1LA3 A;  1EG4 A;  3GK1 A;  2KFH A;  2F8P A;  1F8H A;  3LK0 A;  2LVI A;  1TCF A;  2MLE C;  1QJT A;  4JPZ B;  3FS7 A;  1M45 A;  2HQW A;  1CMF A;  1PSB A;  1PVA A;  2NZ0 A;  2K61 A;  1SCM C;  2A4J A;  2MJW B;  2LHL A;  2JU0 A;  2WC8 A;  1TCO B;  1M31 A;  2AUC A;  1QVI Z;  1CNP A;  1CMG A;  1JF2 A;  1OE9 B;  2I2R E;  2TN4 A;  1CKK A;  4M2O A;  1B7T Z;  1QAT A;  1WY9 A;  1CLB A;  1K2H A;  1SNL A;  2LHI A; 
#chains in the Genus database with same CATH topology
 3KHE A;  2FCD A;  1SRA A;  1YVH A;  1QWV A;  3JTD B;  1IKU A;  2QEB A;  1SL9 A;  1GM0 A;  2L0P A;  2OTG B;  2NLN A;  1V1F A;  2KHN A;  1ZFS A;  1N65 A;  2PVB A;  4AOM A;  1C7W A;  4U8D A;  4PE7 A;  2ISD A;  1AJ4 A;  3DVJ A;  4ORC B;  1NX1 A;  3UNW A;  1ORG A;  2K7C A;  3S0A A;  1PUL A;  2YGU A;  2MRD A;  2ZFD A;  2FJU B;  5IBW A;  1OW4 A;  1SYM A;  1IJ5 A;  2MHH A;  3D0Y A;  3NHT A;  1TTX A;  3SS5 A;  2LCP A;  4ETO A;  2OPO A;  3DXL A;  2L5Y A;  1SK6 D;  5CSJ A;  4I5N B;  1DC1 A;  1DT7 B;  4WQ2 A;  1JWD A;  1KQV A;  1A75 A;  2M7L A;  5ER4 X;  2OS8 B;  2P71 A;  2GGM A;  4FQT A;  1IH0 A;  1BT6 A;  1NX0 A;  4PT1 A;  2JC2 A;  3BUX B;  1MWN A;  2E30 A;  1QLS A;  2F2O A;  3OGN A;  2L51 A;  2PQL A;  3VRP A;  2K60 A;  1IJ6 A;  1LIN A;  2DOQ A;  2PSR A;  2WC5 A;  1IGV A;  3L47 A;  1C07 A;  2BNX A;  1OQP A;  3SIB A;  1Q80 A;  2QEO A;  1OOG A;  2P6B B;  1WDC B;  1UHH A;  3B87 A;  1DQE A;  2Y4Q A;  1UUR A;  5JOL A;  2KAX A;  2KFF A;  1BLQ A;  1LXF C;  3CWG A;  2KBI A;  1TOP A;  2KLD A;  2L5X B;  3CGA A;  2JNX A;  3S0B A;  2LMV A;  5D3O A;  2KOT A;  4WQ3 A;  1TN4 A;  1DJZ A;  1RTP 1;  4GGF C;  2CT9 A;  1CTR A;  1UHK A;  1RK9 A;  3DF0 B;  1OMR A;  1XYD A;  1BOD A;  2CXJ A;  2KGR A;  3NXA A;  4MN0 A;  3ZNI A;  1S6J A;  2MLF C;  4ZCU A;  1M46 A;  1XVJ A;  4CFQ A;  5TNC A;  2AMI A;  2WCE A;  2GTE A;  3I5F B;  1WRL A;  1YR5 A;  3JTD C;  4MZK A;  3SG2 A;  4AQI A;  1BJF A;  1F55 A;  4NDB A;  4HRG A;  4NQG A;  3S0F A;  2OTG C;  1MXL C;  1OOH A;  1J7O A;  3WHU B;  1R6P A;  1H4B A;  2KI6 D;  5I2L A;  4GGF A;  2I18 A;  2VRG A;  3H4S E;  2WCK A;  3S0E A;  1BF5 A;  1DJW A;  1T14 A;  1Z2C B;  4I5K A;  2BBM A;  2WCM A;  3BUO B;  1FW4 A;  3BFH A;  3O78 A;  4INW A;  2BCA A;  1J1E A;  3A4U B;  1J1D A;  4PHJ A;  4L9M A;  2JXL A;  1XFR A;  5DKR A;  1TNX A;  1WRZ A;  2M3W A;  3TUY B;  2EGD A;  1YX7 A;  3NSL A;  1KSO A;  4GFT A;  2OS8 C;  3D75 A;  3DY9 A;  1QXP A;  3EVR A;  2LE9 B;  5FI7 A;  5AER A;  4CLN A;  1YRT B;  4PDZ A;  1TRF A;  3DYE A;  5KU1 A;  1UP5 A;  3BYA A;  1JFJ A;  1REC A;  5F6T A;  1DJY A;  1LVC D;  4MSP A;  5AAN A;  5I8N A;  1JSA A;  4JKT A;  2LAN A;  4YGB B;  1K9K A;  2KI4 B;  3IQO A;  2WCB A;  3IQQ A;  2CBL A;  2L98 A;  4M2Q A;  5CSN A;  1WDC C;  1GGW A;  2K2A A;  5I94 A;  3B7A A;  1UUS A;  3PLF B;  3PAT A;  2GV5 A;  1ZUZ A;  2LVV A;  1KSM A;  3IVT A;  3TS5 B;  4DCK A;  1J7P A;  1QX5 B;  1DJG A;  3OB1 B;  2BBN A;  5HYD A;  4R1E A;  2BL0 B;  3E3R A;  1CFF A;  4KYN A;  1C7V A;  3RLZ A;  3EG5 B;  1B7T Y;  3D77 A;  3VB1 A;  4OV2 A;  2KSP A;  1PRW A;  2ZKM X;  2L4H A;  1A4P A;  4YBH B;  3I5I B;  1VRK A;  3CZ1 A;  4NDC A;  1Y6W A;  3CR4 X;  2JWW A;  3I5F C;  4GUK A;  4PHN A;  3KF9 A;  2Y1M A;  1QS7 A;  1K94 A;  1X02 A;  5FI2 A;  3BUM B;  3FE8 A;  4OCI A;  4PE4 A;  3VGO A;  3JVT B;  5AXI A;  2K8M B;  3DF0 A;  2V53 A;  1JUO A;  3NGV A;  3SG5 A;  4YGD B;  4IL1 A;  2HQ8 A;  5D69 A;  4GNK B;  2QDI A;  3PM2 A;  1YUT A;  2M0R A;  2ZRS A;  3WNX B;  2F3Z A;  3IF7 A;  2M7N A;  2M9G A;  5HLO A;  1DGV A;  1DVI A;  1M39 A;  3TUY C;  1QTX A;  4YGC B;  1KWO C;  3VRO A;  3L4L A;  1GQM A;  1QV0 A;  4FTG A;  4DS7 A;  1OOJ A;  3EK8 A;  1KK7 Y;  2M49 B;  1XA5 A;  3EK7 A;  2LP2 A;  1A03 A;  1F4Q A;  2E6W A;  2EC6 B;  5HL1 A;  1S5G Y;  4UPG A;  1NSH A;  3MSE B;  4YI9 A;  1A29 A;  2QEV A;  4XJK B;  1OMV A;  4YGE B;  3RM1 A;  1Y1A A;  2AAO A;  2KI4 C;  3CDN A;  1K9U A;  1AVS A;  5AFP A;  5K89 A;  1B8L A;  4MVF A;  3SG4 A;  5KSZ A;  3LLE A;  3HCM A;  3TS5 C;  3N7H A;  4C0J A;  4F0Z B;  1NWD A;  4OVN F;  4GAO A;  2L50 A;  2O5G A;  3BUW B;  2BL0 C;  4PHM A;  3Q8I A;  3BJH A;  1NX3 A;  1TUJ A;  2WOS A;  5FI6 A;  5DKN A;  1YUU A;  3CYZ A;  1FPW A;  1Z4H A;  2CCM A;  1BR1 B;  4MZL A;  1QV1 A;  3I5I C;  3CR2 A;  3PSR A;  2KDH A;  3PJI A;  4YGA A;  1R2U A;  2K7B A;  3PFV A;  2LLU A;  1AHR A;  1OMD A;  1ODB A;  2WCF A;  4HSZ A;  4I5L B;  3PM8 A;  2LNK A;  4QJ5 B;  3LL8 B;  3NSK A;  2FCE A;  2KAY A;  4OKH A;  3OB2 B;  1EJ3 A;  1PK0 D;  2BAP A;  1YUR A;  3JVT C;  1W7J B;  2COL B;  2BCB A;  2ZN9 A;  3SG7 A;  2LUC A;  3HX4 A;  1K93 D;  4CFR A;  2WOR A;  3D76 A;  2M1K B;  2JT0 A;  2P70 A;  1YRU B;  1MUX A;  3V2L A;  3DVK A;  1QX7 A;  3SG3 A;  4MRY A;  1TIZ A;  2JT3 A;  3BXK A;  1YTZ C;  3I5G C;  3UO9 A;  4P2Y B;  3RZS A;  5B8I B;  1LS8 A;  3I5H B;  1IQ5 A;  1EXR A;  1KQM C;  2L2C A;  1DJX A;  4NDD A;  2F3Y A;  1SPY A;  3S0G A;  1NCY A;  1W7I B;  1TNW A;  1IG5 A;  1YX8 A;  3A8R A;  1SBJ A;  2JTZ A;  5HKY A;  2KQ6 A;  1NIW A;  1K8U A;  2EC6 C;  2ZN8 A;  4IJ7 A;  1CLM A;  1HT9 A;  4PE0 A;  1CDM A;  1SL8 A;  3FE9 A;  1HQV A;  1Y1U A;  3FWC A;  2CTN A;  1V1G A;  1DJH A;  1KFX S;  1ZMZ A;  2Q4U A;  5CSI A;  1DTL A;  1FBV A;  3DVM A;  3C1V A;  1EH2 A;  1KWO B;  1S6I A;  3TDZ A;  3SG6 A;  1B1G A;  1UHJ A;  1B47 A;  4N1G A;  3EVV A;  4DUQ A;  2R2I A;  4MLW A;  2KAV A;  2L2E A;  1BU3 A;  2M1U A;  3QRX A;  1XFX O;  4AQJ A;  1S6C A;  3PAL A;  3FWB A;  1S1E A;  4JQ0 D;  1P28 A;  1UHI A;  4XJK A;  5KTY A;  1UWO A;  2LLS A;  3AKB A;  3WXA A;  1B8R A;  4MZJ A;  1F70 A;  2O60 A;  4CPV A;  1B9A A;  2LC5 A;  4DRW A;  1DGU A;  2KYF A;  3OX5 A;  5DIC A;  1BR4 B;  2LV7 A;  4ICB A;  1RFJ A;  3CR5 X;  3O4Y A;  3TZ1 A;  1QVI Y;  3WHT B;  3DZT A;  4OZD A;  4HRH A;  1DJI A;  1OZS A;  3BUN B;  3R1P A;  1M63 B;  3SS4 A;  2QAC A;  1ALW A;  2KNE A;  3GK2 A;  5GQQ C;  2K7D A;  2ZND A;  5EL2 A;  5PAL A;  1XFW O;  5J3X A;  2HET A;  4OR9 B;  1G33 A;  3B88 A;  2KBM A;  3I5H C;  3SIA A;  1QIV A;  2JT8 A;  5BPJ A;  2NCO A;  1BMO A;  3LK1 A;  1IIO A;  1L2O B;  2WCH A;  3SJS A;  2MA2 A;  1EG3 A;  1PVB A;  5CPV A;  1K95 A;  1CDP A;  1OZO A;  3QME A;  1U5I A;  3PN7 C;  2KYC A;  1IQ3 A;  3CTN A;  1MQ1 A;  1XO5 A;  1XFY O;  3EKJ A;  4ORB B;  3D10 A;  1LKJ A;  1F4O A;  4FQO A;  2H8V A;  2KI6 C;  1QAS A;  2KLE A;  3I5G B;  4PE1 A;  1A2X A;  1C3Z A;  1B4C A;  1IWQ A;  3GOF A;  2B1U A;  4GPL B;  2JPT A;  1KQM B;  2JRF A;  1PSR A;  1NYA A;  1PAL A;  1TUZ A;  2I7A A;  2NXQ A;  1Y1X A;  4XYN A;  1KFU S;  1S26 D;  2G9B A;  4HRE E;  2IS9 A;  2QPT A;  4MRX A;  2M8U A;  1L7Z A;  2BEC A;  1K9P A;  4QJ3 B;  2PMY A;  2F2P A;  4INX A;  4N5X A;  5HKW A;  4YI8 A;  2H61 C;  1W9Z A;  2D8N A;  4WRI A;  1JFK A;  3VRN A;  3OBV A;  4JWQ A;  5ER5 A;  1B8C A;  1NCX A;  3TDI A;  2WCL A;  3ICB A;  3R1O A;  4PCW A;  2NCP A;  1QLK A;  2FOT A;  2JOJ A;  2BKI B;  1N2D A;  1MF8 B;  1FI6 A;  3FIA A;  3K1E A;  4BY5 A;  1CM1 A;  2H61 A;  4C0L A;  2Y5I A;  1NUB A;  1QX2 A;  2LLT A;  1YVL A;  1NPQ A;  3S0D A;  1SCV A;  2BCX A;  2K2F A;  1DF0 B;  1KK8 B;  3ZWH A;  2CNP A;  1D1O A;  3BQ3 A;  1ZAC A;  1FF1 A;  3BOW B;  2JZI A;  1MR8 A;  2K7O A;  3VRQ A;  2HF5 A;  5I2Q A;  1AP4 A;  1DEL A;  1CFC A;  1TNP A;  1MXE A;  1XFU O;  5AEQ A;  1TNQ A;  3D73 A;  3DVE A;  4D1E A;  1WLM A;  1RJV A;  1YUS A;  3KPX A;  3OP0 A;  1L2O C;  1ZOT B;  4E68 A;  1SSE B;  2PAS A;  1SW8 A;  3O4X A;  3VRR A;  1S36 A;  3F45 A;  3R1V A;  3L4A A;  1SMG A;  2MBX A;  1KK7 Z;  3CZ2 A;  3AAK A;  1UHN A;  1J7Q A;  1KFX L;  1U5I B;  5FYX A;  2BKH B;  2KGB C;  2KFG A;  1S5G Z;  1MHO A;  1SR6 B;  4MEW A;  1XFZ O;  1OSA A;  2LP3 A;  3M0W A;  1NX2 A;  2ZNE A;  1CM4 A;  1WRK A;  3NHI A;  4P5O E;  4JD9 A;  2BE6 A;  1CFD A;  4MBE A;  2QEH A;  4C0K A;  4YRU A;  2G2B A;  4F7F A;  3PN7 B;  3GK4 X;  1EL4 A;  1XFV O;  4TNC A;  1BOC A;  4M2P A;  1CDN A;  1JF0 A;  1F54 A;  1J7R A;  1CFP A;  2LAP A;  1SKT A;  1G4Y R;  2JNF A;  1RWY A;  3O6B A;  1DMO A;  1S3P A;  1K90 D;  1CDL A;  1OOF A;  1SL7 A;  2ZRT A;  1LA0 A;  2GGZ A;  2JUL A;  2Y1N A;  3KO0 A;  5HLV A;  1CB1 A;  1QIW A;  2RGI A;  1SCM B;  1K96 A;  2F33 A;  2LMT A;  2SAS A;  5G08 A;  2KQY A;  5DKQ A;  3D78 A;  2BE4 A;  4PHK A;  1JBA A;  2JPO A;  2L4I A;  2HPS A;  3BFB A;  3AKA A;  3NSI A;  2JTT A;  1KK8 C;  1KCY A;  3OHM B;  1TWO A;  3B6X A;  4GBA A;  1GGZ A;  3EKH A;  2PAL A;  4GGN A;  2ERB A;  1SY9 A;  2JXC A;  3D0Y B;  1AUI B;  4I5J A;  4BY4 A;  3CZ0 A;  2MAZ A;  3CLN A;  3K21 A;  1NP8 A;  1FI5 A;  4PAL A;  3OX6 A;  1ALV A;  5D7F A;  2JQ6 A;  1XK4 C;  1AK8 A;  3EK4 A;  4USL A;  2PRU A;  1A75 B;  2I94 A;  1G8I A;  4A4B A;  4CID A;  2LMU A;  2M29 A;  1IRJ A;  3NSO A;  1DF0 A;  3R72 A;  5JJG A;  4QJ4 B;  3BOW A;  2H2K A;  3KEV A;  3CZT X;  2WCJ A;  3FE6 A;  1GJY A;  2WND A;  3TDU A;  4A4C A;  4Q04 A;  1C3Y A;  1OOI X;  1XK4 A;  1SR6 C;  5HKZ A;  1RRO A;  1KFU L;  3CS1 A;  2SCP A;  5CSF A;  2LUX A;  1NCZ A;  2Q91 A;  4DIR A;  1F71 A;  4ZCV A;  1BG1 A;  1WLZ A;  1Y0V H;  1J55 A;  1N0Y A;  2LVK A;  3AAJ A;  1H8B A;  3DD4 A;  3LCP C;  1E8A A;  1JC2 A;  3EVU A;  2K0J A;  4N1F A;  1AJ5 A;  3O2P A;  5I2O A;  4ORA B;  3SS3 A;  2EHB A;  2KPH A;  2M97 A;  2LM5 A;  1CLL A;  2LVJ A;  3BFA A;  1LA3 A;  1EG4 A;  3GK1 A;  2KFH A;  2F8P A;  1F8H A;  3LK0 A;  2LVI A;  1TCF A;  2MLE C;  1QJT A;  4JPZ B;  3FS7 A;  1M45 A;  2HQW A;  1CMF A;  1PSB A;  1PVA A;  2NZ0 A;  2K61 A;  1SCM C;  1DEK A;  2A4J A;  3D74 A;  2MJW B;  3CAB A;  2LHL A;  2JU0 A;  2WC8 A;  1TCO B;  1M31 A;  2AUC A;  1QVI Z;  2WC6 A;  3B86 A;  1CMG A;  1CNP A;  1JF2 A;  1OE9 B;  2PYQ A;  2I2R E;  2TN4 A;  1CKK A;  4M2O A;  1B7T Z;  1QAT A;  1WY9 A;  1CLB A;  1K2H A;  1SNL A;  2FJY A;  2LHI A; 
#chains in the Genus database with same CATH homology
 3KHE A;  2FCD A;  1SRA A;  1YVH A;  3JTD B;  1IKU A;  1SL9 A;  2L0P A;  2OTG B;  2NLN A;  1V1F A;  2KHN A;  1ZFS A;  1N65 A;  2PVB A;  4AOM A;  1C7W A;  4U8D A;  4PE7 A;  2ISD A;  1AJ4 A;  3DVJ A;  4ORC B;  1NX1 A;  2K7C A;  1PUL A;  2MRD A;  2ZFD A;  2FJU B;  5IBW A;  1SYM A;  1IJ5 A;  2MHH A;  3D0Y A;  1TTX A;  2LCP A;  4ETO A;  2OPO A;  1SK6 D;  5CSJ A;  4I5N B;  1DT7 B;  4WQ2 A;  1JWD A;  1KQV A;  1A75 A;  2M7L A;  5ER4 X;  2OS8 B;  2GGM A;  1IH0 A;  1BT6 A;  1NX0 A;  2JC2 A;  3BUX B;  1MWN A;  2E30 A;  1QLS A;  2F2O A;  2L51 A;  3VRP A;  1IJ6 A;  1LIN A;  2DOQ A;  2PSR A;  1IGV A;  1C07 A;  1OQP A;  3SIB A;  1Q80 A;  2P6B B;  1WDC B;  1UHH A;  2Y4Q A;  1UUR A;  5JOL A;  2KAX A;  2KFF A;  1BLQ A;  1LXF C;  3CWG A;  2KBI A;  1TOP A;  2L5X B;  3CGA A;  2JNX A;  2LMV A;  2KOT A;  4WQ3 A;  1TN4 A;  1DJZ A;  1RTP 1;  4GGF C;  2CT9 A;  1CTR A;  1UHK A;  1RK9 A;  3DF0 B;  1OMR A;  1XYD A;  1BOD A;  2CXJ A;  2KGR A;  3NXA A;  4MN0 A;  3ZNI A;  1S6J A;  2MLF C;  4ZCU A;  1M46 A;  1XVJ A;  4CFQ A;  5TNC A;  2AMI A;  2WCE A;  3I5F B;  1WRL A;  1YR5 A;  3JTD C;  4MZK A;  3SG2 A;  4AQI A;  1BJF A;  1F55 A;  4NDB A;  4HRG A;  4NQG A;  2OTG C;  1MXL C;  1J7O A;  3WHU B;  1R6P A;  1H4B A;  2KI6 D;  5I2L A;  4GGF A;  2I18 A;  2VRG A;  3H4S E;  1BF5 A;  1DJW A;  4I5K A;  2BBM A;  3BUO B;  1FW4 A;  3O78 A;  2BCA A;  1J1E A;  3A4U B;  1J1D A;  4PHJ A;  4L9M A;  2JXL A;  5DKR A;  1TNX A;  1WRZ A;  2M3W A;  3TUY B;  2EGD A;  1YX7 A;  3NSL A;  1KSO A;  4GFT A;  2OS8 C;  1QXP A;  3EVR A;  2LE9 B;  5AER A;  4CLN A;  1YRT B;  4PDZ A;  1TRF A;  5KU1 A;  1UP5 A;  3BYA A;  1JFJ A;  1REC A;  5F6T A;  1DJY A;  1LVC D;  4MSP A;  5AAN A;  5I8N A;  1JSA A;  2LAN A;  4YGB B;  1K9K A;  2KI4 B;  3IQO A;  2WCB A;  3IQQ A;  2CBL A;  2L98 A;  4M2Q A;  5CSN A;  1WDC C;  1GGW A;  2K2A A;  1UUS A;  3PLF B;  3PAT A;  2GV5 A;  1ZUZ A;  2LVV A;  1KSM A;  3TS5 B;  4DCK A;  1J7P A;  1QX5 B;  1DJG A;  3OB1 B;  2BBN A;  5HYD A;  4R1E A;  2BL0 B;  3E3R A;  1CFF A;  1C7V A;  3RLZ A;  1B7T Y;  4OV2 A;  2KSP A;  1PRW A;  2ZKM X;  2L4H A;  1A4P A;  4YBH B;  3I5I B;  1VRK A;  4NDC A;  1Y6W A;  3CR4 X;  2JWW A;  3I5F C;  4GUK A;  4PHN A;  3KF9 A;  2Y1M A;  1QS7 A;  1K94 A;  1X02 A;  3BUM B;  4OCI A;  4PE4 A;  3VGO A;  3JVT B;  5AXI A;  2K8M B;  3DF0 A;  2V53 A;  1JUO A;  3SG5 A;  4YGD B;  4IL1 A;  2HQ8 A;  5D69 A;  4GNK B;  1YUT A;  2M0R A;  2ZRS A;  3WNX B;  2F3Z A;  3IF7 A;  2M7N A;  2M9G A;  5HLO A;  1DGV A;  1DVI A;  1M39 A;  3TUY C;  1QTX A;  4YGC B;  1KWO C;  3VRO A;  4FTG A;  1GQM A;  1QV0 A;  4DS7 A;  1OOJ A;  3EK8 A;  1KK7 Y;  2M49 B;  1XA5 A;  3EK7 A;  2LP2 A;  1A03 A;  1F4Q A;  2E6W A;  2EC6 B;  1S5G Y;  4UPG A;  1NSH A;  3MSE B;  4YI9 A;  1A29 A;  4XJK B;  3RM1 A;  1OMV A;  4YGE B;  5AFP A;  1Y1A A;  2AAO A;  2KI4 C;  1K9U A;  1AVS A;  5K89 A;  1B8L A;  4MVF A;  3SG4 A;  5KSZ A;  3LLE A;  3HCM A;  3TS5 C;  4C0J A;  4F0Z B;  1NWD A;  4OVN F;  4GAO A;  2L50 A;  2O5G A;  3BUW B;  2BL0 C;  4PHM A;  1NX3 A;  2WOS A;  5DKN A;  1YUU A;  1FPW A;  2CCM A;  1BR1 B;  4MZL A;  1QV1 A;  3I5I C;  3CR2 A;  3PSR A;  2KDH A;  4YGA A;  1R2U A;  2K7B A;  3PFV A;  2LLU A;  1AHR A;  1OMD A;  1ODB A;  2WCF A;  4HSZ A;  4I5L B;  3PM8 A;  2LNK A;  4QJ5 B;  3LL8 B;  3NSK A;  2FCE A;  2KAY A;  4OKH A;  3OB2 B;  1EJ3 A;  1PK0 D;  1YUR A;  3JVT C;  1W7J B;  2COL B;  2BCB A;  2ZN9 A;  3SG7 A;  2LUC A;  3HX4 A;  1K93 D;  4CFR A;  2WOR A;  2M1K B;  2JT0 A;  1YRU B;  1MUX A;  3DVK A;  1QX7 A;  3SG3 A;  4MRY A;  1TIZ A;  2JT3 A;  3BXK A;  1YTZ C;  3I5G C;  4P2Y B;  5B8I B;  3I5H B;  1IQ5 A;  1EXR A;  1KQM C;  1DJX A;  4NDD A;  2F3Y A;  1SPY A;  1NCY A;  1W7I B;  1TNW A;  1IG5 A;  1YX8 A;  3A8R A;  1SBJ A;  2JTZ A;  5HKY A;  2KQ6 A;  1NIW A;  1K8U A;  2EC6 C;  2ZN8 A;  1CLM A;  1HT9 A;  4PE0 A;  1CDM A;  1SL8 A;  1HQV A;  1Y1U A;  3FWC A;  2CTN A;  1V1G A;  1DJH A;  1KFX S;  1ZMZ A;  2Q4U A;  5CSI A;  1DTL A;  1FBV A;  3DVM A;  3C1V A;  1EH2 A;  1KWO B;  1S6I A;  3TDZ A;  3SG6 A;  1B1G A;  1UHJ A;  1B47 A;  4N1G A;  3EVV A;  4DUQ A;  2R2I A;  4MLW A;  2KAV A;  2L2E A;  1BU3 A;  2M1U A;  3QRX A;  1XFX O;  4AQJ A;  1S6C A;  3PAL A;  3FWB A;  1S1E A;  4JQ0 D;  1UHI A;  4XJK A;  5KTY A;  1UWO A;  2LLS A;  3AKB A;  3WXA A;  1B8R A;  4MZJ A;  1F70 A;  2O60 A;  4CPV A;  1B9A A;  2LC5 A;  4DRW A;  1DGU A;  2KYF A;  3OX5 A;  1BR4 B;  2LV7 A;  4ICB A;  1RFJ A;  3CR5 X;  3O4Y A;  3TZ1 A;  1QVI Y;  3WHT B;  4HRH A;  1DJI A;  1OZS A;  3BUN B;  1M63 B;  2QAC A;  1ALW A;  2KNE A;  3GK2 A;  5GQQ C;  2K7D A;  2ZND A;  5PAL A;  1XFW O;  5J3X A;  2HET A;  4OR9 B;  1G33 A;  2KBM A;  3I5H C;  3SIA A;  1QIV A;  2JT8 A;  5BPJ A;  2NCO A;  1BMO A;  3LK1 A;  1L2O B;  3SJS A;  2MA2 A;  1EG3 A;  1PVB A;  5CPV A;  1K95 A;  1CDP A;  1OZO A;  1U5I A;  3PN7 C;  2KYC A;  1IQ3 A;  3CTN A;  1MQ1 A;  1XO5 A;  1XFY O;  3EKJ A;  4ORB B;  3D10 A;  1LKJ A;  1F4O A;  4FQO A;  2KI6 C;  1QAS A;  3I5G B;  4PE1 A;  1A2X A;  1B4C A;  1IWQ A;  3GOF A;  2B1U A;  4GPL B;  2JPT A;  1KQM B;  2JRF A;  1PSR A;  1NYA A;  1PAL A;  2NXQ A;  2I7A A;  4XYN A;  1Y1X A;  5HLV A;  1KFU S;  1S26 D;  2G9B A;  4HRE E;  2IS9 A;  2QPT A;  4MRX A;  2M8U A;  1L7Z A;  2BEC A;  1K9P A;  4QJ3 B;  2PMY A;  2F2P A;  5HKW A;  4N5X A;  4YI8 A;  2H61 C;  2D8N A;  4WRI A;  1JFK A;  3VRN A;  4JWQ A;  5ER5 A;  1B8C A;  1NCX A;  3TDI A;  3ICB A;  4PCW A;  2NCP A;  1QLK A;  2FOT A;  2JOJ A;  2BKI B;  1N2D A;  1MF8 B;  1FI6 A;  3FIA A;  4BY5 A;  1CM1 A;  2H61 A;  4C0L A;  2Y5I A;  1NUB A;  1QX2 A;  2LLT A;  1YVL A;  1NPQ A;  1SCV A;  2BCX A;  2K2F A;  1DF0 B;  1KK8 B;  3ZWH A;  2CNP A;  1D1O A;  3BQ3 A;  1ZAC A;  1FF1 A;  3BOW B;  2JZI A;  1MR8 A;  2K7O A;  3VRQ A;  2HF5 A;  5I2Q A;  1AP4 A;  1CFC A;  1TNP A;  1MXE A;  1XFU O;  5AEQ A;  1TNQ A;  3DVE A;  4D1E A;  1WLM A;  1RJV A;  1YUS A;  3KPX A;  3OP0 A;  1L2O C;  1ZOT B;  4E68 A;  2PAS A;  1SW8 A;  3VRR A;  1S36 A;  3F45 A;  1SMG A;  2MBX A;  1KK7 Z;  3AAK A;  1UHN A;  1J7Q A;  1KFX L;  1U5I B;  5FYX A;  2BKH B;  2KGB C;  2KFG A;  1S5G Z;  1MHO A;  1SR6 B;  4MEW A;  1XFZ O;  1OSA A;  2LP3 A;  3M0W A;  1NX2 A;  2ZNE A;  1CM4 A;  1WRK A;  4P5O E;  2BE6 A;  1CFD A;  4MBE A;  4YRU A;  4C0K A;  2G2B A;  3PN7 B;  3GK4 X;  1EL4 A;  1XFV O;  4TNC A;  1BOC A;  4M2P A;  1CDN A;  1JF0 A;  1F54 A;  1J7R A;  1CFP A;  2LAP A;  1SKT A;  1G4Y R;  2JNF A;  1RWY A;  3O6B A;  1DMO A;  1S3P A;  1K90 D;  1CDL A;  1SL7 A;  2ZRT A;  3KO0 A;  1LA0 A;  2GGZ A;  2JUL A;  2Y1N A;  1CB1 A;  1QIW A;  2RGI A;  1SCM B;  1K96 A;  2F33 A;  2LMT A;  2SAS A;  5G08 A;  2KQY A;  5DKQ A;  2BE4 A;  4PHK A;  1JBA A;  2L4I A;  2HPS A;  3AKA A;  3NSI A;  2JTT A;  1KK8 C;  1KCY A;  3OHM B;  4GBA A;  1GGZ A;  3EKH A;  2PAL A;  4GGN A;  2JXC A;  1SY9 A;  3D0Y B;  1AUI B;  4I5J A;  4BY4 A;  2MAZ A;  3CLN A;  3K21 A;  1NP8 A;  1FI5 A;  4PAL A;  3OX6 A;  1ALV A;  5D7F A;  2JQ6 A;  1XK4 C;  1AK8 A;  3EK4 A;  4USL A;  2PRU A;  1A75 B;  2I94 A;  1G8I A;  4A4B A;  4CID A;  2LMU A;  2M29 A;  1IRJ A;  3NSO A;  1DF0 A;  5JJG A;  4QJ4 B;  3BOW A;  2H2K A;  3KEV A;  3CZT X;  1GJY A;  2WND A;  3TDU A;  4A4C A;  4Q04 A;  1XK4 A;  1SR6 C;  5HKZ A;  1RRO A;  1KFU L;  3CS1 A;  2SCP A;  5CSF A;  2LUX A;  1NCZ A;  2Q91 A;  4DIR A;  1F71 A;  4ZCV A;  1BG1 A;  1WLZ A;  1Y0V H;  1J55 A;  1N0Y A;  2LVK A;  3AAJ A;  1H8B A;  3DD4 A;  3LCP C;  1E8A A;  1JC2 A;  3EVU A;  2K0J A;  4N1F A;  1AJ5 A;  3O2P A;  5I2O A;  4ORA B;  2EHB A;  2M97 A;  2LM5 A;  1CLL A;  2LVJ A;  1LA3 A;  1EG4 A;  3GK1 A;  2KFH A;  2F8P A;  1F8H A;  3LK0 A;  2LVI A;  1TCF A;  2MLE C;  1QJT A;  4JPZ B;  3FS7 A;  1M45 A;  2HQW A;  1CMF A;  1PSB A;  1PVA A;  2NZ0 A;  2K61 A;  1SCM C;  2A4J A;  2MJW B;  2LHL A;  2JU0 A;  2WC8 A;  1TCO B;  1M31 A;  2AUC A;  1QVI Z;  1CNP A;  1CMG A;  1JF2 A;  1OE9 B;  2I2R E;  2TN4 A;  1CKK A;  4M2O A;  1B7T Z;  1QAT A;  1WY9 A;  1CLB A;  1K2H A;  1SNL A;  2LHI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...