4DIRA

2.6 angstrom x-ray structure of human ca(2+)-s100a5
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
86
structure length
78
Chain Sequence
TPLEKALTTMVTTFHKYSGREGSKLTLSRKELKELIKKELSIDDLMKSLDKNSDQEIDFKEYSVFLTMLCMAYNDFFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Target-binding to S100A5 changes Ca(2+)-binding affinity and dynamics.
rcsb
molecule keywords Protein S100-A5
molecule tags Metal binding protein
source organism Homo sapiens
total genus 30
structure length 78
sequence length 86
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4dirA00
1KFXS 2LANA 1DJHA 1RJVA 1QTXA 3CLNA 3SIAA 4JPZB 1DJXA 1BR4B 1YRTB 1U5IB 1EG3A 1EL4A 1B8LA 1S6JA 2DOQA 3IF7A 1OZSA 1KQMB 1XVJA 3EVRA 3LL8B 1AK8A 1K9UA 3KO0A 1TNWA 2CT9A 1KFUL 4MLWA 4MZLA 5K89A 4YGEB 4CFRA 1SCVA 2LUCA 2MRDA 2TN4A 1IGVA 2I18A 2M3WA 1CDLA 1QV0A 3RLZA 1QIVA 3JVTC 1C07A 1F4OA 1OZOA 2JULA 4JWQA 1MQ1A 1Y1AA 2EGDA 1V1FA 2L50A 3PFVA 2FOTA 2KGRA 4NQGA 1BMOA 1UHJA 1SYMA 1XFXO 1S6CA 4E68A 1D1OA 1TNPA 2QPTA 1MUXA 4ORCB 3SG5A 3VGOA 1IH0A 4GGNA 5KSZA 1RROA 2OPOA 2QACA 1WLMA 2KQYA 2KOTA 1TOPA 1F54A 2L4IA 2Y1NA 1H4BA 1K8UA 2V53A 3DVEA 3CS1A 3IQOA 1XK4A 4PDZA 1DGUA 1QX2A 1N2DA 2JNXA 3BUXB 3TZ1A 3IQQA 1CDPA 3BUWB 1SL8A 2BL0C 2H61A 1XFUO 1F55A 1QLSA 3D0YB 5D69A 3GK4X 5HKYA 2K8MB 1JSAA 1DJGA 2JT0A 1K90D 1VRKA 2K2AA 3MSEB 3JTDC 5KTYA 2MLEC 3DF0A 1K96A 3AKBA 1ALVA 2M8UA 4YI8A 1XYDA 1EXRA 3HX4A 3I5HC 1A03A 1DF0B 2WCEA 4GFTA 1AUIB 4WQ2A 1OQPA 3TS5B 1AJ5A 3H4SE 4U8DA 1C7WA 1J1EA 3WHTB 2M1UA 1CLLA 2K0JA 1ZFSA 4GNKB 3NSKA 1B8RA 2FCDA 1J55A 4OV2A 4R1EA 2ISDA 1M63B 1JFJA 2GGMA 2MJWB 5AXIA 1UHKA 5CSIA 1SCMC 2LLTA 2E30A 2LMUA 3VRRA 1MWNA 4YGDB 4N1FA 1HT9A 5FYXA 1UUSA 3D10A 3WNXB 2GGZA 1ALWA 1KK8C 2M1KB 2SASA 3DD4A 2F2OA 4D1EA 3PSRA 1QS7A 1IJ5A 1TNQA 1SR6C 1YUSA 2CNPA 5G08A 4MZKA 2L0PA 1XFZO 3EK7A 1YX8A 2FJUB 3D0YA 1ZUZA 3JVTB 2JPTA 2R2IA 1TRFA 1W7IB 3GK1A 1K94A 1WRKA 2B1UA 2Q91A 2M7NA 3I5IC 1CFCA 1J7QA 3I5FC 1OMVA 4UPGA 2KQ6A 2D8NA 5PALA 1YRUB 2LVIA 4AQJA 2MA2A 1SPYA 1DF0A 1K2HA 1LVCD 2JC2A 2JWWA 1NCZA 1NPQA 4PHKA 1BLQA 4XYNA 4QJ5B 3EKHA 1UURA 2JOJA 1BJFA 2PRUA 3EVUA 4PE4A 4IL1A 1TCOB 5I2LA 3DVKA 3C1VA 1JBAA 2BCAA 2JXLA 3WXAA 2JXCA 3CR4X 3CWGA 1KSOA 1SBJA 2BL0B 1IG5A 2Q4UA 1NUBA 2WC8A 1RK9A 1WRZA 1F70A 2EC6C 4GUKA 1ZOTB 1XFYO 2KAYA 4DCKA 1B7TZ 2BE4A 1CLMA 1J1DA 1S3PA 3JTDB 1PVAA 1MHOA 3AAJA 3LLEA 2F2PA 2KDHA 2LLUA 3VRPA 3I5HB 2NXQA 4BY4A 1QATA 1NX3A 1J7RA 4HREE 4PE0A 4CIDA 1IQ3A 3LK1A 2HQWA 3OX5A 5I8NA 1SY9A 2JZIA 2BCBA 1F71A 4CFQA 2PSRA 1CDNA 2CTNA 1OSAA 3FIAA 1OMDA 4USLA 2MLFC 2LE9B 2BBMA 4N5XA 2PASA 4YGCB 2I2RE 1FI6A 1QASA 5CSFA 4PHNA 3PALA 1SCMB 1NX0A 1X02A 5AANA 3OHMB 2Y5IA 1OE9B 1QJTA 3HCMA 3AKAA 1OOJA 1KK8B 2JQ6A 1QIWA 5KU1A 2M7LA 1MR8A 3BXKA 2M49B 4P2YB 1TNXA 1SR6B 2H2KA 1YX7A 1B7TY 1KCYA 2KI6D 1B8CA 1J7OA 5GQQC 1SW8A 1G8IA 1JFKA 1LKJA 2M9GA 1SL9A 5I2QA 3I5IB 2CCMA 3I5FB 3OB1B 2LC5A 1U5IA 1QV1A 1FPWA 1EG4A 1YUUA 3TDUA 1YVLA 3LK0A 4DIRA 1Y1XA 4FQOA 4YBHB 3SG7A 3DVMA 1FF1A 1PSRA 1K93D 2G2BA 2LCPA 1JUOA 1OMRA 2HPSA 1KFXL 1CMFA 1B4CA 1EH2A 1SK6D 2COLB 1UHHA 1DVIA 1CLBA 1XFWO 2JNFA 4WRIA 1UWOA 2ZFDA 1GGZA 4NDCA 1IQ5A 3NSIA 1S1EA 1AJ4A 1V1GA 1ZACA 2K2FA 3O6BA 1NYAA 4ETOA 2LHIA 3CZTX 2JT3A 1XK4C 2EC6B 3TDZA 4C0JA 1SKTA 5B8IB 1AVSA 1DJWA 4PE7A 2VRGA 2KHNA 2F3ZA 4CPVA 2M97A 1A4PA 2WORA 4ORAB 1DT7B 2KAVA 4MSPA 2K61A 1Y0VH 1IRJA 1KWOC 3A4UB 3AAKA 3EVVA 4ICBA 1LA3A 4I5NB 4PALA 1K95A 3BOWB 1KK7Z 2Y4QA 3I5GC 2NZ0A 1CFDA 1NWDA 2F3YA 5AERA 5D7FA 4I5JA 4YGBB 3CTNA 3LCPC 3CR5X 2LM5A 3NXAA 2LVVA 5HKZA 5J3XA 4GGFA 1A75B 4ORBB 1QX5B 1NSHA 3KF9A 4OVNF 1CB1A 3PN7C 3VRNA 1DMOA 2KSPA 3VRQA 2LMTA 4M2PA 2PMYA 2FCEA 2LV7A 1QLKA 3BQ3A 1CKKA 5JOLA 1RTP1 1R6PA 2F8PA 2SCPA 1A2XA 2BKHB 3TUYC 1H8BA 1KQVA 2ZRTA 5CSNA 3F45A 2HETA 1KSMA 1CMGA 3SJSA 2NCOA 2MBXA 1SNLA 1MXEA 4TNCA 2KI6C 1F8HA 1XFVO 4MRYA 1S5GY 1Y1UA 2K7OA 3KHEA 1AP4A 2BECA 3DVJA 2CXJA 4OKHA 3O2PA 2KI4C 4L9MA 4OR9B 1IJ6A 2ZRSA 4BY5A 3NSOA 1KK7Y 3O4YA 3OP0A 1BOCA 4JQ0D 1L7ZA 1DTLA 2L2EA 5DKQA 1NCYA 2JU0A 2AMIA 3BOWA 4C0LA 2JRFA 2LNKA 2LVKA 3GK2A 5F6TA 1PK0D 3SG2A 3NSLA 1C7VA 2WOSA 2Y1MA 2IS9A 2LHLA 1DJIA 4QJ3B 2ZKMX 2K7CA 2M29A 4GAOA 4HRHA 1PULA 2JTTA 1FBVA 1Y6WA 1NIWA 2WCFA 1M39A 5HYDA 2LVJA 5CSJA 4YRUA 1WDCC 2K7DA 3EKJA 1K9PA 1BF5A 1YVHA 1CDMA 1PALA 5DKRA 3QRXA 1CM4A 2O5GA 5IBWA 4XJKB 3EK4A 2M0RA 4PHJA 3SIBA 4Q04A 3SG3A 1YR5A 1KWOB 1JC2A 2KFHA 1CM1A 3EK8A 1NX1A 5AEQA 2NCPA 1R2UA 2K7BA 5CPVA 1BR1B 3TDIA 1S36A 3I5GB 2WCBA 2AUCA 2ZNEA 3DF0B 4NDBA 2L5XB 3M0WA 1QVIY 1IWQA 1GJYA 2LAPA 2OTGC 2PALA 3CR2A 4GPLB 4A4CA 1IKUA 4PE1A 3OB2B 1DJYA 3PN7B 3KPXA 4I5KA 4MN0A 2KFFA 4YI9A 2KGBC 1XO5A 2MHHA 1FI5A 2LLSA 1SMGA 1YUTA 3TUYB 3BYAA 1E8AA 3PLFB 2HF5A 1YTZC 2KNEA 2HQ8A 2L4HA 2P6BB 2GV5A 2ZN8A 1FW4A 4F0ZB 5ER5A 5TNCA 1L2OC 1W7JB 1A29A 3VROA 2PVBA 2LP3A 4MEWA 4FTGA 2BCXA 2KI4B 3CGAA 4XJKA 2CBLA 1QX7A 3RM1A 1RECA 2F33A 2BE6A 1BG1A 2OS8C 5HKWA 4GBAA 3A8RA 3WHUB 1S5GZ 2H61C 5ER4X 4MZJA 4AOMA 1KQMC 1DGVA 2ZNDA 2BKIB 3PATA 1K9KA 2WNDA 1CFPA 1B1GA 4M2QA 1UHNA 2KBIA 2O60A 4QJ4B 5AFPA 1G33A 5DKNA 3BUMB 1EJ3A 1YURA 4P5OE 2EHBA 2RGIA 1JWDA 4OCIA 4MRXA 1WDCB 1HQVA 1B9AA 1B47A 1CFFA 1LA0A 2LUXA 1J7PA 1LINA 5BPJA 1S26D 2L51A 4N1GA 4DUQA 2KYFA 1CNPA 5HLVA 1UP5A 1N65A 1KFUS 4ZCUA 2MAZA 4CLNA 1N0YA 1PSBA 4YGAA 2NLNA 1SRAA 1ODBA 1BT6A 4MVFA 3ZWHA 2A4JA 1JF2A 1RFJA 1F4QA 1SL7A 1XA5A 2L98A 1M46A 2BBNA 1AHRA 2I7AA 1DJZA 1WY9A 2E6WA 3ICBA 1QXPA 3O78A 4DRWA 4C0KA 4HSZA 1NP8A 2OTGB 4AQIA 3SG4A 4DS7A 4PCWA 1TTXA 2KBMA 1MXLC 1PRWA 1WLZA 4ZCVA 1BODA 1BU3A 1MF8B 4PHMA 4WQ3A 3ZNIA 1M31A 1TCFA 4M2OA 4HRGA 1TN4A 1ZMZA 2I94A 3BUOB 1NCXA 4GGFC 4A4BA 3BUNB 2KYCA 2G9BA 3FS7A 3KEVA 1Q80A 1QVIZ 1GQMA 4NDDA 2KFGA 5I2OA 2JTZA 2LMVA 3SG6A 1GGWA 1PVBA 1CTRA 1NX2A 1LXFC 1L2OB 1G4YR 4I5LB 1A75A 2LP2A 2KAXA 1RWYA 2ZN9A 3OX6A 3TS5C 3FWCA 1WRLA 1TIZA 3K21A 5JJGA 4MBEA 1UHIA 2JT8A 1JF0A 1M45A 3FWBA 5HLOA 2OS8B 3GOFA 3E3RA 1S6IA 2AAOA 3PM8A
chains in the Genus database with same CATH superfamily
1KFXS 2LANA 1DJHA 1RJVA 1QTXA 2QEHA 3CLNA 4JPZB 3SIAA 1DJXA 4JD9A 1BR4B 1YRTB 1U5IB 1EG3A 1EL4A 1B8LA 1S6JA 2DOQA 3IF7A 1OZSA 1KQMB 1XVJA 3EVRA 3LL8B 1AK8A 1K9UA 3S0DA 3KO0A 1TNWA 2CT9A 1KFUL 4MLWA 4MZLA 5K89A 4YGEB 4CFRA 1SCVA 2LUCA 2MRDA 2TN4A 1IGVA 2I18A 2WCHA 2M3WA 1CDLA 1QV0A 3RLZA 3S0GA 1QIVA 3JVTC 1C07A 1F4OA 1OZOA 2JULA 4JWQA 1MQ1A 1Y1AA 2EGDA 1V1FA 2L50A 3PFVA 2FOTA 2KGRA 2WCLA 4NQGA 1BMOA 1UHJA 1SYMA 1XFXO 1S6CA 2PQLA 3B6XA 1TNPA 2QPTA 3S0BA 1MUXA 4ORCB 3SG5A 4E68A 1D1OA 2BAPA 3VGOA 1IH0A 4GGNA 5KSZA 1RROA 2OPOA 2QACA 1WLMA 2KQYA 2KOTA 1TOPA 1F54A 2L4IA 2Y1NA 1H4BA 1K8UA 2V53A 3DVEA 3CS1A 3PM2A 3NHTA 3IQOA 1XK4A 4PDZA 1DGUA 1QX2A 1N2DA 2JNXA 3BUXB 3TZ1A 1OOFA 3IQQA 1CDPA 3BUWB 1SL8A 2BL0C 2H61A 1XFUO 1F55A 1QLSA 2FJYA 3D0YB 5D69A 3GK4X 5HKYA 2K8MB 3D74A 1JSAA 1DJGA 2JT0A 1K90D 3CZ1A 1VRKA 2K2AA 3MSEB 3JTDC 5KTYA 2MLEC 3DF0A 1K96A 3AKBA 1ALVA 2M8UA 4YI8A 1XYDA 1EXRA 3HX4A 3I5HC 1A03A 1DF0B 2WCEA 3L4LA 4GFTA 3DYEA 1AUIB 4WQ2A 1OQPA 3TS5B 1AJ5A 3H4SE 4U8DA 1C7WA 1J1EA 3WHTB 2M1UA 1CLLA 2K0JA 1ZFSA 4GNKB 3NSKA 1B8RA 2FCDA 1J55A 4OV2A 4R1EA 5FI7A 1M63B 2ISDA 1JFJA 2GGMA 2WCMA 2MJWB 5AXIA 1UHKA 5CSIA 1SCMC 2LLTA 2E30A 2LMUA 3VRRA 1MWNA 4YGDB 4N1FA 1HT9A 5FYXA 1UUSA 3D10A 3WNXB 2GGZA 1ALWA 1KK8C 2M1KB 2SASA 3DD4A 2F2OA 4D1EA 3RZSA 3PSRA 1QS7A 1IJ5A 1TNQA 1SR6C 1YUSA 2CNPA 5G08A 4MZKA 2L0PA 1XFZO 3EK7A 1YX8A 2FJUB 3D0YA 1ZUZA 3JVTB 2JPTA 2R2IA 1TRFA 1W7IB 3NHIA 3GK1A 3IVTA 1K94A 5FI6A 1WRKA 2B1UA 2Q91A 2M7NA 3I5IC 1CFCA 1J7QA 3I5FC 2KLEA 1OMVA 4UPGA 1DEKA 2D8NA 2KQ6A 1YRUB 3K1EA 2LVIA 3OGNA 5PALA 1C3YA 4AQJA 2MA2A 1SPYA 1DF0A 1K2HA 1LVCD 3SS4A 2JC2A 2JWWA 1NCZA 1NPQA 4PHKA 1BLQA 4XYNA 4QJ5B 3EKHA 1UURA 2JOJA 1BJFA 2PRUA 3EVUA 4PE4A 4IL1A 1TCOB 3BJHA 5I2LA 3DVKA 3C1VA 3UNWA 1JBAA 2BCAA 1C3ZA 2JXLA 3WXAA 3B88A 2JXCA 3CR4X 5HL1A 3CWGA 1KSOA 1SBJA 2BL0B 1IG5A 2Q4UA 1NUBA 5EL2A 2WC8A 2WCJA 1RK9A 1WRZA 1F70A 2EC6C 4GUKA 1ZOTB 1XFYO 1SSEB 2KAYA 4DCKA 1B7TZ 2BE4A 1CLMA 1J1DA 1S3PA 3JTDB 1PVAA 1MHOA 2P70A 3AAJA 3LLEA 2F2PA 2KDHA 2LLUA 3VRPA 3I5HB 2NXQA 4BY4A 1QATA 1NX3A 1J7RA 4HREE 4PE0A 4CIDA 1IQ3A 3LK1A 2HQWA 3OX5A 5I8NA 1SY9A 1T14A 2JZIA 2BCBA 1F71A 4CFQA 2PSRA 1CDNA 3L4AA 2CTNA 1OSAA 3FIAA 1OMDA 4USLA 2MLFC 2LE9B 2BBMA 4N5XA 2PASA 4YGCB 2I2RE 1FI6A 1QASA 5CSFA 4PHNA 3PALA 1SCMB 1NX0A 1X02A 5AANA 3OHMB 2Y5IA 1OE9B 1QJTA 3HCMA 3AKAA 1OOJA 3VB1A 1KK8B 2JQ6A 1QIWA 5KU1A 2M7LA 1MR8A 3BXKA 2M49B 1OOIX 4P2YB 1TNXA 1SR6B 2H2KA 3CZ2A 1YX7A 1B7TY 1KCYA 2KI6D 1B8CA 1J7OA 4IJ7A 5GQQC 3B87A 1SW8A 1G8IA 1JFKA 1LKJA 2M9GA 1SL9A 5I2QA 3I5IB 2CCMA 3I5FB 3OB1B 2LC5A 2KLDA 1U5IA 1QV1A 1FPWA 1EG4A 1YUUA 3TDUA 1YVLA 3LK0A 3R1VA 2H8VA 4FQTA 2WC5A 4DIRA 1Y1XA 3FE8A 4FQOA 4YBHB 3SG7A 3DVMA 1FF1A 1PSRA 1K93D 2G2BA 2LCPA 1JUOA 1OMRA 2HPSA 1KFXL 1CMFA 1B4CA 1EH2A 1SK6D 2COLB 1QWVA 1UHHA 4JKTA 1DVIA 3N7HA 1CLBA 4OZDA 1XFWO 2JNFA 4WRIA 1UWOA 2ZFDA 1IIOA 1GGZA 4NDCA 1IQ5A 3NSIA 1S1EA 1AJ4A 1V1GA 1ZACA 2JPOA 2K2FA 1NYAA 3O6BA 4ETOA 2LHIA 3CZTX 2JT3A 1XK4C 2EC6B 3TDZA 4C0JA 1SKTA 5B8IB 1AVSA 1DJWA 4PE7A 2VRGA 2KHNA 2F3ZA 3QMEA 4CPVA 3D76A 2M97A 1A4PA 2WORA 4ORAB 1DT7B 2KAVA 4MSPA 2K61A 3CABA 1Y0VH 1IRJA 1KWOC 3A4UB 3AAKA 3EVVA 4ICBA 1LA3A 4I5NB 4PALA 1K95A 3BOWB 1KK7Z 2Y4QA 3I5GC 2NZ0A 1CFDA 1NWDA 2F3YA 5AERA 3O4XA 3V2LA 5D7FA 4I5JA 4YGBB 1OOHA 3CTNA 3LCPC 3CR5X 2LM5A 3NXAA 2LVVA 5HKZA 5J3XA 4GGFA 1A75B 4ORBB 1QX5B 2QEBA 1NSHA 1XFRA 1ORGA 3EG5B 3DY9A 3KF9A 4OVNF 1CB1A 3PN7C 3VRNA 1DMOA 2KSPA 3VRQA 2LMTA 4M2PA 2PMYA 2FCEA 2LV7A 1QLKA 3BQ3A 1CKKA 5JOLA 1RTP1 1R6PA 2F8PA 2SCPA 1A2XA 2BKHB 3DZTA 3TUYC 1H8BA 1KQVA 2ZRTA 5CSNA 3F45A 2HETA 1KSMA 2WC6A 3SJSA 4F7FA 2NCOA 2MBXA 1CMGA 1SNLA 1GM0A 1MXEA 4TNCA 1DC1A 2KI6C 3R72A 1F8HA 1XFVO 4MRYA 1S5GY 1Y1UA 2K7OA 1P28A 3KHEA 1AP4A 2BECA 1LS8A 3DVJA 3FE6A 2CXJA 4OKHA 3O2PA 2KI4C 4L9MA 4OR9B 1IJ6A 3SS3A 2KPHA 2ZRSA 4BY5A 3NSOA 1KK7Y 3O4YA 3OP0A 1BOCA 4JQ0D 1L7ZA 1DTLA 2L2EA 5DKQA 1NCYA 2JU0A 2AMIA 3BOWA 4C0LA 2JRFA 2LNKA 2LVKA 3D78A 3GK2A 1PK0D 5F6TA 3NSLA 3SG2A 1C7VA 2BNXA 2QEVA 3BFBA 1Z4HA 2WOSA 1W9ZA 2Y1MA 2IS9A 2LHLA 1DJIA 4QJ3B 3SS5A 2ZKMX 2K7CA 2M29A 4GAOA 4HRHA 1PULA 2JTTA 1FBVA 3CDNA 1Y6WA 1NIWA 2WCFA 1M39A 3B86A 5HYDA 2LVJA 4INWA 5FI2A 5CSJA 4YRUA 1WDCC 4PT1A 2K7DA 3EKJA 1K9PA 1BF5A 1YVHA 1CDMA 1PALA 5DKRA 3BFHA 3QRXA 1TWOA 1CM4A 2O5GA 5IBWA 4XJKB 1OW4A 3EK4A 4KYNA 1OOGA 2M0RA 4PHJA 3SIBA 2L5YA 4Q04A 3SG3A 1YR5A 1KWOB 1JC2A 2KFHA 1CM1A 3EK8A 1NX1A 5AEQA 2NCPA 1R2UA 2K7BA 5CPVA 1BR1B 3TDIA 1S36A 3I5GB 2WCBA 2AUCA 2ZNEA 2GTEA 3DF0B 4NDBA 2L5XB 3M0WA 1QVIY 1IWQA 2QEOA 1GJYA 2LAPA 2OTGC 2PALA 1DQEA 3CR2A 4GPLB 4A4CA 5DICA 4PE1A 3OB2B 1IKUA 1DJYA 2ERBA 3PN7B 3KPXA 4I5KA 4MN0A 2KFFA 4YI9A 3S0EA 2KGBC 1XO5A 2MHHA 1FI5A 2LLSA 1SMGA 1YUTA 3TUYB 3BYAA 1E8AA 3DXLA 2HF5A 3PLFB 1YTZC 2KNEA 2HQ8A 2L4HA 2P6BB 2GV5A 2ZN8A 1FW4A 4F0ZB 5ER5A 3UO9A 5TNCA 1TUZA 2PYQA 3L47A 1L2OC 1W7JB 3S0AA 1A29A 3VROA 2PVBA 2LP3A 4MEWA 4FTGA 2BCXA 2KI4B 3CGAA 4XJKA 2CBLA 1QX7A 3RM1A 1RECA 2F33A 2BE6A 1BG1A 2K60A 2OS8C 5HKWA 4GBAA 3D77A 3A8RA 3WHUB 3NGVA 2YGUA 1S5GZ 2H61C 5ER4X 3B7AA 4MZJA 5D3OA 4AOMA 1KQMC 1DGVA 2ZNDA 2BKIB 3PATA 1K9KA 2WNDA 3FE9A 3Q8IA 1CFPA 1B1GA 4M2QA 1UHNA 2KBIA 2O60A 4QJ4B 5AFPA 1G33A 3CYZA 5DKNA 3BUMB 1EJ3A 1YURA 4P5OE 2EHBA 2RGIA 1JWDA 1Z2CB 4OCIA 4MRXA 3CZ0A 1WDCB 1HQVA 3OBVA 2WCKA 1B9AA 1B47A 3D73A 1CFFA 1LA0A 2LUXA 1J7PA 1LINA 5BPJA 1S26D 2L51A 4N1GA 4DUQA 2KYFA 1CNPA 5HLVA 1UP5A 1N65A 1KFUS 4ZCUA 2MAZA 4CLNA 1N0YA 1PSBA 4YGAA 1DELA 2NLNA 1SRAA 3BFAA 1ODBA 1BT6A 4MVFA 2P71A 2A4JA 1JF2A 1RFJA 3ZWHA 2L2CA 1F4QA 1SL7A 1XA5A 2L98A 3R1OA 1M46A 2BBNA 1AHRA 2I7AA 1DJZA 1WY9A 2E6WA 3ICBA 1QXPA 3O78A 4DRWA 4C0KA 4HSZA 1NP8A 2OTGB 4AQIA 3SG4A 4DS7A 4PCWA 1TTXA 2KBMA 3PJIA 1MXLC 1PRWA 1WLZA 4ZCVA 1BODA 1BU3A 1MF8B 4PHMA 4WQ3A 3ZNIA 1M31A 1TCFA 4M2OA 4HRGA 1TN4A 1ZMZA 2I94A 3BUOB 1NCXA 4GGFC 4A4BA 3BUNB 2KYCA 2G9BA 3D75A 3FS7A 3KEVA 3S0FA 1Q80A 1QVIZ 1GQMA 4NDDA 2KFGA 5I2OA 2JTZA 2LMVA 3SG6A 1GGWA 1PVBA 1TUJA 1CTRA 1NX2A 4INXA 1LXFC 1L2OB 1G4YR 4I5LB 1A75A 2LP2A 2KAXA 1RWYA 2ZN9A 3OX6A 3TS5C 3FWCA 1WRLA 5I94A 1TIZA 3K21A 5JJGA 4MBEA 3R1PA 1UHIA 2JT8A 1JF0A 1M45A 3FWBA 5HLOA 2OS8B 3GOFA 2QDIA 3E3RA 1S6IA 2AAOA 3PM8A
chains in the Genus database with same CATH topology
1KFXS 2LANA 1DJHA 1RJVA 1QTXA 3CLNA 3SIAA 4JPZB 1DJXA 1BR4B 1YRTB 1U5IB 1EG3A 1EL4A 1B8LA 1S6JA 2DOQA 3IF7A 1OZSA 1KQMB 1XVJA 3EVRA 3LL8B 1AK8A 1K9UA 3KO0A 1TNWA 2CT9A 1KFUL 4MLWA 4MZLA 5K89A 4YGEB 4CFRA 1SCVA 2LUCA 2MRDA 2TN4A 1IGVA 2I18A 2M3WA 1CDLA 1QV0A 3RLZA 1QIVA 3JVTC 1C07A 1F4OA 1OZOA 2JULA 4JWQA 1MQ1A 1Y1AA 2EGDA 1V1FA 2L50A 3PFVA 2FOTA 2KGRA 4NQGA 1BMOA 1UHJA 1SYMA 1XFXO 1S6CA 4E68A 1D1OA 1TNPA 2QPTA 1MUXA 4ORCB 3SG5A 3VGOA 1IH0A 4GGNA 5KSZA 1RROA 2OPOA 2QACA 1WLMA 2KQYA 2KOTA 1TOPA 1F54A 2L4IA 2Y1NA 1H4BA 1K8UA 2V53A 3DVEA 3CS1A 3IQOA 1XK4A 4PDZA 1DGUA 1QX2A 1N2DA 2JNXA 3BUXB 3TZ1A 3IQQA 1CDPA 3BUWB 1SL8A 2BL0C 2H61A 1XFUO 1F55A 1QLSA 3D0YB 5D69A 3GK4X 5HKYA 2K8MB 1JSAA 1DJGA 2JT0A 1K90D 1VRKA 2K2AA 3MSEB 3JTDC 5KTYA 2MLEC 3DF0A 1K96A 3AKBA 1ALVA 2M8UA 4YI8A 1XYDA 1EXRA 3HX4A 3I5HC 1A03A 1DF0B 2WCEA 4GFTA 1AUIB 4WQ2A 1OQPA 3TS5B 1AJ5A 3H4SE 4U8DA 1C7WA 1J1EA 3WHTB 2M1UA 1CLLA 2K0JA 1ZFSA 4GNKB 3NSKA 1B8RA 2FCDA 1J55A 4OV2A 4R1EA 2ISDA 1M63B 1JFJA 2GGMA 2MJWB 5AXIA 1UHKA 5CSIA 1SCMC 2LLTA 2E30A 2LMUA 3VRRA 1MWNA 4YGDB 4N1FA 1HT9A 5FYXA 1UUSA 3D10A 3WNXB 2GGZA 1ALWA 1KK8C 2M1KB 2SASA 3DD4A 2F2OA 4D1EA 3PSRA 1QS7A 1IJ5A 1TNQA 1SR6C 1YUSA 2CNPA 5G08A 4MZKA 2L0PA 1XFZO 3EK7A 1YX8A 2FJUB 3D0YA 1ZUZA 3JVTB 2JPTA 2R2IA 1TRFA 1W7IB 3GK1A 1K94A 1WRKA 2B1UA 2Q91A 2M7NA 3I5IC 1CFCA 1J7QA 3I5FC 1OMVA 4UPGA 2KQ6A 2D8NA 5PALA 1YRUB 2LVIA 4AQJA 2MA2A 1SPYA 1DF0A 1K2HA 1LVCD 2JC2A 2JWWA 1NCZA 1NPQA 4PHKA 1BLQA 4XYNA 4QJ5B 3EKHA 1UURA 2JOJA 1BJFA 2PRUA 3EVUA 4PE4A 4IL1A 1TCOB 5I2LA 3DVKA 3C1VA 1JBAA 2BCAA 2JXLA 3WXAA 2JXCA 3CR4X 3CWGA 1KSOA 1SBJA 2BL0B 1IG5A 2Q4UA 1NUBA 2WC8A 1RK9A 1WRZA 1F70A 2EC6C 4GUKA 1ZOTB 1XFYO 2KAYA 4DCKA 1B7TZ 2BE4A 1CLMA 1J1DA 1S3PA 3JTDB 1PVAA 1MHOA 3AAJA 3LLEA 2F2PA 2KDHA 2LLUA 3VRPA 3I5HB 2NXQA 4BY4A 1QATA 1NX3A 1J7RA 4HREE 4PE0A 4CIDA 1IQ3A 3LK1A 2HQWA 3OX5A 5I8NA 1SY9A 2JZIA 2BCBA 1F71A 4CFQA 2PSRA 1CDNA 2CTNA 1OSAA 3FIAA 1OMDA 4USLA 2MLFC 2LE9B 2BBMA 4N5XA 2PASA 4YGCB 2I2RE 1FI6A 1QASA 5CSFA 4PHNA 3PALA 1SCMB 1NX0A 1X02A 5AANA 3OHMB 2Y5IA 1OE9B 1QJTA 3HCMA 3AKAA 1OOJA 1KK8B 2JQ6A 1QIWA 5KU1A 2M7LA 1MR8A 3BXKA 2M49B 4P2YB 1TNXA 1SR6B 2H2KA 1YX7A 1B7TY 1KCYA 2KI6D 1B8CA 1J7OA 5GQQC 1SW8A 1G8IA 1JFKA 1LKJA 2M9GA 1SL9A 5I2QA 3I5IB 2CCMA 3I5FB 3OB1B 2LC5A 1U5IA 1QV1A 1FPWA 1EG4A 1YUUA 3TDUA 1YVLA 3LK0A 4DIRA 1Y1XA 4FQOA 4YBHB 3SG7A 3DVMA 1FF1A 1PSRA 1K93D 2G2BA 2LCPA 1JUOA 1OMRA 2HPSA 1KFXL 1CMFA 1B4CA 1EH2A 1SK6D 2COLB 1UHHA 1DVIA 1CLBA 1XFWO 2JNFA 4WRIA 1UWOA 2ZFDA 1GGZA 4NDCA 1IQ5A 3NSIA 1S1EA 1AJ4A 1V1GA 1ZACA 2K2FA 3O6BA 1NYAA 4ETOA 2LHIA 3CZTX 2JT3A 1XK4C 2EC6B 3TDZA 4C0JA 1SKTA 5B8IB 1AVSA 1DJWA 4PE7A 2VRGA 2KHNA 2F3ZA 4CPVA 2M97A 1A4PA 2WORA 4ORAB 1DT7B 2KAVA 4MSPA 2K61A 1Y0VH 1IRJA 1KWOC 3A4UB 3AAKA 3EVVA 4ICBA 1LA3A 4I5NB 4PALA 1K95A 3BOWB 1KK7Z 2Y4QA 3I5GC 2NZ0A 1CFDA 1NWDA 2F3YA 5AERA 5D7FA 4I5JA 4YGBB 3CTNA 3LCPC 3CR5X 2LM5A 3NXAA 2LVVA 5HKZA 5J3XA 4GGFA 1A75B 4ORBB 1QX5B 1NSHA 3KF9A 4OVNF 1CB1A 3PN7C 3VRNA 1DMOA 2KSPA 3VRQA 2LMTA 4M2PA 2PMYA 2FCEA 2LV7A 1QLKA 3BQ3A 1CKKA 5JOLA 1RTP1 1R6PA 2F8PA 2SCPA 1A2XA 2BKHB 3TUYC 1H8BA 1KQVA 2ZRTA 5CSNA 3F45A 2HETA 1KSMA 1CMGA 3SJSA 2NCOA 2MBXA 1SNLA 1MXEA 4TNCA 2KI6C 1F8HA 1XFVO 4MRYA 1S5GY 1Y1UA 2K7OA 3KHEA 1AP4A 2BECA 3DVJA 2CXJA 4OKHA 3O2PA 2KI4C 4L9MA 4OR9B 1IJ6A 2ZRSA 4BY5A 3NSOA 1KK7Y 3O4YA 3OP0A 1BOCA 4JQ0D 1L7ZA 1DTLA 2L2EA 5DKQA 1NCYA 2JU0A 2AMIA 3BOWA 4C0LA 2JRFA 2LNKA 2LVKA 3GK2A 5F6TA 1PK0D 3SG2A 3NSLA 1C7VA 2WOSA 2Y1MA 2IS9A 2LHLA 1DJIA 4QJ3B 2ZKMX 2K7CA 2M29A 4GAOA 4HRHA 1PULA 2JTTA 1FBVA 1Y6WA 1NIWA 2WCFA 1M39A 5HYDA 2LVJA 5CSJA 4YRUA 1WDCC 2K7DA 3EKJA 1K9PA 1BF5A 1YVHA 1CDMA 1PALA 5DKRA 3QRXA 1CM4A 2O5GA 5IBWA 4XJKB 3EK4A 2M0RA 4PHJA 3SIBA 4Q04A 3SG3A 1YR5A 1KWOB 1JC2A 2KFHA 1CM1A 3EK8A 1NX1A 5AEQA 2NCPA 1R2UA 2K7BA 5CPVA 1BR1B 3TDIA 1S36A 3I5GB 2WCBA 2AUCA 2ZNEA 3DF0B 4NDBA 2L5XB 3M0WA 1QVIY 1IWQA 1GJYA 2LAPA 2OTGC 2PALA 3CR2A 4GPLB 4A4CA 1IKUA 4PE1A 3OB2B 1DJYA 3PN7B 3KPXA 4I5KA 4MN0A 2KFFA 4YI9A 2KGBC 1XO5A 2MHHA 1FI5A 2LLSA 1SMGA 1YUTA 3TUYB 3BYAA 1E8AA 3PLFB 2HF5A 1YTZC 2KNEA 2HQ8A 2L4HA 2P6BB 2GV5A 2ZN8A 1FW4A 4F0ZB 5ER5A 5TNCA 1L2OC 1W7JB 1A29A 3VROA 2PVBA 2LP3A 4MEWA 4FTGA 2BCXA 2KI4B 3CGAA 4XJKA 2CBLA 1QX7A 3RM1A 1RECA 2F33A 2BE6A 1BG1A 2OS8C 5HKWA 4GBAA 3A8RA 3WHUB 1S5GZ 2H61C 5ER4X 4MZJA 4AOMA 1KQMC 1DGVA 2ZNDA 2BKIB 3PATA 1K9KA 2WNDA 1CFPA 1B1GA 4M2QA 1UHNA 2KBIA 2O60A 4QJ4B 5AFPA 1G33A 5DKNA 3BUMB 1EJ3A 1YURA 4P5OE 2EHBA 2RGIA 1JWDA 4OCIA 4MRXA 1WDCB 1HQVA 1B9AA 1B47A 1CFFA 1LA0A 2LUXA 1J7PA 1LINA 5BPJA 1S26D 2L51A 4N1GA 4DUQA 2KYFA 1CNPA 5HLVA 1UP5A 1N65A 1KFUS 4ZCUA 2MAZA 4CLNA 1N0YA 1PSBA 4YGAA 2NLNA 1SRAA 1ODBA 1BT6A 4MVFA 3ZWHA 2A4JA 1JF2A 1RFJA 1F4QA 1SL7A 1XA5A 2L98A 1M46A 2BBNA 1AHRA 2I7AA 1DJZA 1WY9A 2E6WA 3ICBA 1QXPA 3O78A 4DRWA 4C0KA 4HSZA 1NP8A 2OTGB 4AQIA 3SG4A 4DS7A 4PCWA 1TTXA 2KBMA 1MXLC 1PRWA 1WLZA 4ZCVA 1BODA 1BU3A 1MF8B 4PHMA 4WQ3A 3ZNIA 1M31A 1TCFA 4M2OA 4HRGA 1TN4A 1ZMZA 2I94A 3BUOB 1NCXA 4GGFC 4A4BA 3BUNB 2KYCA 2G9BA 3FS7A 3KEVA 1Q80A 1QVIZ 1GQMA 4NDDA 2KFGA 5I2OA 2JTZA 2LMVA 3SG6A 1GGWA 1PVBA 1CTRA 1NX2A 1LXFC 1L2OB 1G4YR 4I5LB 1A75A 2LP2A 2KAXA 1RWYA 2ZN9A 3OX6A 3TS5C 3FWCA 1WRLA 1TIZA 3K21A 5JJGA 4MBEA 1UHIA 2JT8A 1JF0A 1M45A 3FWBA 5HLOA 2OS8B 3GOFA 3E3RA 1S6IA 2AAOA 3PM8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KFX S;  2LAN A;  1DJH A;  1RJV A;  1QTX A;  3CLN A;  3SIA A;  4JPZ B;  1DJX A;  1BR4 B;  1YRT B;  1U5I B;  1EG3 A;  1EL4 A;  1B8L A;  1S6J A;  2DOQ A;  3IF7 A;  1OZS A;  1KQM B;  1XVJ A;  3EVR A;  3LL8 B;  1AK8 A;  1K9U A;  3KO0 A;  1TNW A;  2CT9 A;  1KFU L;  4MLW A;  4MZL A;  5K89 A;  4YGE B;  4CFR A;  1SCV A;  2LUC A;  2MRD A;  2TN4 A;  1IGV A;  2I18 A;  2M3W A;  1CDL A;  1QV0 A;  3RLZ A;  1QIV A;  3JVT C;  1C07 A;  1F4O A;  1OZO A;  2JUL A;  4JWQ A;  1MQ1 A;  1Y1A A;  2EGD A;  1V1F A;  2L50 A;  3PFV A;  2FOT A;  2KGR A;  4NQG A;  1BMO A;  1UHJ A;  1SYM A;  1XFX O;  1S6C A;  4E68 A;  1D1O A;  1TNP A;  2QPT A;  1MUX A;  4ORC B;  3SG5 A;  3VGO A;  1IH0 A;  4GGN A;  5KSZ A;  1RRO A;  2OPO A;  2QAC A;  1WLM A;  2KQY A;  2KOT A;  1TOP A;  1F54 A;  2L4I A;  2Y1N A;  1H4B A;  1K8U A;  2V53 A;  3DVE A;  3CS1 A;  3IQO A;  1XK4 A;  4PDZ A;  1DGU A;  1QX2 A;  1N2D A;  2JNX A;  3BUX B;  3TZ1 A;  3IQQ A;  1CDP A;  3BUW B;  1SL8 A;  2BL0 C;  2H61 A;  1XFU O;  1F55 A;  1QLS A;  3D0Y B;  5D69 A;  3GK4 X;  5HKY A;  2K8M B;  1JSA A;  1DJG A;  2JT0 A;  1K90 D;  1VRK A;  2K2A A;  3MSE B;  3JTD C;  5KTY A;  2MLE C;  3DF0 A;  1K96 A;  3AKB A;  1ALV A;  2M8U A;  4YI8 A;  1XYD A;  1EXR A;  3HX4 A;  3I5H C;  1A03 A;  1DF0 B;  2WCE A;  4GFT A;  1AUI B;  4WQ2 A;  1OQP A;  3TS5 B;  1AJ5 A;  3H4S E;  4U8D A;  1C7W A;  1J1E A;  3WHT B;  2M1U A;  1CLL A;  2K0J A;  1ZFS A;  4GNK B;  3NSK A;  1B8R A;  2FCD A;  1J55 A;  4OV2 A;  4R1E A;  2ISD A;  1M63 B;  1JFJ A;  2GGM A;  2MJW B;  5AXI A;  1UHK A;  5CSI A;  1SCM C;  2LLT A;  2E30 A;  2LMU A;  3VRR A;  1MWN A;  4YGD B;  4N1F A;  1HT9 A;  5FYX A;  1UUS A;  3D10 A;  3WNX B;  2GGZ A;  1ALW A;  1KK8 C;  2M1K B;  2SAS A;  3DD4 A;  2F2O A;  4D1E A;  3PSR A;  1QS7 A;  1IJ5 A;  1TNQ A;  1SR6 C;  1YUS A;  2CNP A;  5G08 A;  4MZK A;  2L0P A;  1XFZ O;  3EK7 A;  1YX8 A;  2FJU B;  3D0Y A;  1ZUZ A;  3JVT B;  2JPT A;  2R2I A;  1TRF A;  1W7I B;  3GK1 A;  1K94 A;  1WRK A;  2B1U A;  2Q91 A;  2M7N A;  3I5I C;  1CFC A;  1J7Q A;  3I5F C;  1OMV A;  4UPG A;  2KQ6 A;  2D8N A;  5PAL A;  1YRU B;  2LVI A;  4AQJ A;  2MA2 A;  1SPY A;  1DF0 A;  1K2H A;  1LVC D;  2JC2 A;  2JWW A;  1NCZ A;  1NPQ A;  4PHK A;  1BLQ A;  4XYN A;  4QJ5 B;  3EKH A;  1UUR A;  2JOJ A;  1BJF A;  2PRU A;  3EVU A;  4PE4 A;  4IL1 A;  1TCO B;  5I2L A;  3DVK A;  3C1V A;  1JBA A;  2BCA A;  2JXL A;  3WXA A;  2JXC A;  3CR4 X;  3CWG A;  1KSO A;  1SBJ A;  2BL0 B;  1IG5 A;  2Q4U A;  1NUB A;  2WC8 A;  1RK9 A;  1WRZ A;  1F70 A;  2EC6 C;  4GUK A;  1ZOT B;  1XFY O;  2KAY A;  4DCK A;  1B7T Z;  2BE4 A;  1CLM A;  1J1D A;  1S3P A;  3JTD B;  1PVA A;  1MHO A;  3AAJ A;  3LLE A;  2F2P A;  2KDH A;  2LLU A;  3VRP A;  3I5H B;  2NXQ A;  4BY4 A;  1QAT A;  1NX3 A;  1J7R A;  4HRE E;  4PE0 A;  4CID A;  1IQ3 A;  3LK1 A;  2HQW A;  3OX5 A;  5I8N A;  1SY9 A;  2JZI A;  2BCB A;  1F71 A;  4CFQ A;  2PSR A;  1CDN A;  2CTN A;  1OSA A;  3FIA A;  1OMD A;  4USL A;  2MLF C;  2LE9 B;  2BBM A;  4N5X A;  2PAS A;  4YGC B;  2I2R E;  1FI6 A;  1QAS A;  5CSF A;  4PHN A;  3PAL A;  1SCM B;  1NX0 A;  1X02 A;  5AAN A;  3OHM B;  2Y5I A;  1OE9 B;  1QJT A;  3HCM A;  3AKA A;  1OOJ A;  1KK8 B;  2JQ6 A;  1QIW A;  5KU1 A;  2M7L A;  1MR8 A;  3BXK A;  2M49 B;  4P2Y B;  1TNX A;  1SR6 B;  2H2K A;  1YX7 A;  1B7T Y;  1KCY A;  2KI6 D;  1B8C A;  1J7O A;  5GQQ C;  1SW8 A;  1G8I A;  1JFK A;  1LKJ A;  2M9G A;  1SL9 A;  5I2Q A;  3I5I B;  2CCM A;  3I5F B;  3OB1 B;  2LC5 A;  1U5I A;  1QV1 A;  1FPW A;  1EG4 A;  1YUU A;  3TDU A;  1YVL A;  3LK0 A;  4DIR A;  1Y1X A;  4FQO A;  4YBH B;  3SG7 A;  3DVM A;  1FF1 A;  1PSR A;  1K93 D;  2G2B A;  2LCP A;  1JUO A;  1OMR A;  2HPS A;  1KFX L;  1CMF A;  1B4C A;  1EH2 A;  1SK6 D;  2COL B;  1UHH A;  1DVI A;  1CLB A;  1XFW O;  2JNF A;  4WRI A;  1UWO A;  2ZFD A;  1GGZ A;  4NDC A;  1IQ5 A;  3NSI A;  1S1E A;  1AJ4 A;  1V1G A;  1ZAC A;  2K2F A;  3O6B A;  1NYA A;  4ETO A;  2LHI A;  3CZT X;  2JT3 A;  1XK4 C;  2EC6 B;  3TDZ A;  4C0J A;  1SKT A;  5B8I B;  1AVS A;  1DJW A;  4PE7 A;  2VRG A;  2KHN A;  2F3Z A;  4CPV A;  2M97 A;  1A4P A;  2WOR A;  4ORA B;  1DT7 B;  2KAV A;  4MSP A;  2K61 A;  1Y0V H;  1IRJ A;  1KWO C;  3A4U B;  3AAK A;  3EVV A;  4ICB A;  1LA3 A;  4I5N B;  4PAL A;  1K95 A;  3BOW B;  1KK7 Z;  2Y4Q A;  3I5G C;  2NZ0 A;  1CFD A;  1NWD A;  2F3Y A;  5AER A;  5D7F A;  4I5J A;  4YGB B;  3CTN A;  3LCP C;  3CR5 X;  2LM5 A;  3NXA A;  2LVV A;  5HKZ A;  5J3X A;  4GGF A;  1A75 B;  4ORB B;  1QX5 B;  1NSH A;  3KF9 A;  4OVN F;  1CB1 A;  3PN7 C;  3VRN A;  1DMO A;  2KSP A;  3VRQ A;  2LMT A;  4M2P A;  2PMY A;  2FCE A;  2LV7 A;  1QLK A;  3BQ3 A;  1CKK A;  5JOL A;  1RTP 1;  1R6P A;  2F8P A;  2SCP A;  1A2X A;  2BKH B;  3TUY C;  1H8B A;  1KQV A;  2ZRT A;  5CSN A;  3F45 A;  2HET A;  1KSM A;  1CMG A;  3SJS A;  2NCO A;  2MBX A;  1SNL A;  1MXE A;  4TNC A;  2KI6 C;  1F8H A;  1XFV O;  4MRY A;  1S5G Y;  1Y1U A;  2K7O A;  3KHE A;  1AP4 A;  2BEC A;  3DVJ A;  2CXJ A;  4OKH A;  3O2P A;  2KI4 C;  4L9M A;  4OR9 B;  1IJ6 A;  2ZRS A;  4BY5 A;  3NSO A;  1KK7 Y;  3O4Y A;  3OP0 A;  1BOC A;  4JQ0 D;  1L7Z A;  1DTL A;  2L2E A;  5DKQ A;  1NCY A;  2JU0 A;  2AMI A;  3BOW A;  4C0L A;  2JRF A;  2LNK A;  2LVK A;  3GK2 A;  5F6T A;  1PK0 D;  3SG2 A;  3NSL A;  1C7V A;  2WOS A;  2Y1M A;  2IS9 A;  2LHL A;  1DJI A;  4QJ3 B;  2ZKM X;  2K7C A;  2M29 A;  4GAO A;  4HRH A;  1PUL A;  2JTT A;  1FBV A;  1Y6W A;  1NIW A;  2WCF A;  1M39 A;  5HYD A;  2LVJ A;  5CSJ A;  4YRU A;  1WDC C;  2K7D A;  3EKJ A;  1K9P A;  1BF5 A;  1YVH A;  1CDM A;  1PAL A;  5DKR A;  3QRX A;  1CM4 A;  2O5G A;  5IBW A;  4XJK B;  3EK4 A;  2M0R A;  4PHJ A;  3SIB A;  4Q04 A;  3SG3 A;  1YR5 A;  1KWO B;  1JC2 A;  2KFH A;  1CM1 A;  3EK8 A;  1NX1 A;  5AEQ A;  2NCP A;  1R2U A;  2K7B A;  5CPV A;  1BR1 B;  3TDI A;  1S36 A;  3I5G B;  2WCB A;  2AUC A;  2ZNE A;  3DF0 B;  4NDB A;  2L5X B;  3M0W A;  1QVI Y;  1IWQ A;  1GJY A;  2LAP A;  2OTG C;  2PAL A;  3CR2 A;  4GPL B;  4A4C A;  1IKU A;  4PE1 A;  3OB2 B;  1DJY A;  3PN7 B;  3KPX A;  4I5K A;  4MN0 A;  2KFF A;  4YI9 A;  2KGB C;  1XO5 A;  2MHH A;  1FI5 A;  2LLS A;  1SMG A;  1YUT A;  3TUY B;  3BYA A;  1E8A A;  3PLF B;  2HF5 A;  1YTZ C;  2KNE A;  2HQ8 A;  2L4H A;  2P6B B;  2GV5 A;  2ZN8 A;  1FW4 A;  4F0Z B;  5ER5 A;  5TNC A;  1L2O C;  1W7J B;  1A29 A;  3VRO A;  2PVB A;  2LP3 A;  4MEW A;  4FTG A;  2BCX A;  2KI4 B;  3CGA A;  4XJK A;  2CBL A;  1QX7 A;  3RM1 A;  1REC A;  2F33 A;  2BE6 A;  1BG1 A;  2OS8 C;  5HKW A;  4GBA A;  3A8R A;  3WHU B;  1S5G Z;  2H61 C;  5ER4 X;  4MZJ A;  4AOM A;  1KQM C;  1DGV A;  2ZND A;  2BKI B;  3PAT A;  1K9K A;  2WND A;  1CFP A;  1B1G A;  4M2Q A;  1UHN A;  2KBI A;  2O60 A;  4QJ4 B;  5AFP A;  1G33 A;  5DKN A;  3BUM B;  1EJ3 A;  1YUR A;  4P5O E;  2EHB A;  2RGI A;  1JWD A;  4OCI A;  4MRX A;  1WDC B;  1HQV A;  1B9A A;  1B47 A;  1CFF A;  1LA0 A;  2LUX A;  1J7P A;  1LIN A;  5BPJ A;  1S26 D;  2L51 A;  4N1G A;  4DUQ A;  2KYF A;  1CNP A;  5HLV A;  1UP5 A;  1N65 A;  1KFU S;  4ZCU A;  2MAZ A;  4CLN A;  1N0Y A;  1PSB A;  4YGA A;  2NLN A;  1SRA A;  1ODB A;  1BT6 A;  4MVF A;  3ZWH A;  2A4J A;  1JF2 A;  1RFJ A;  1F4Q A;  1SL7 A;  1XA5 A;  2L98 A;  1M46 A;  2BBN A;  1AHR A;  2I7A A;  1DJZ A;  1WY9 A;  2E6W A;  3ICB A;  1QXP A;  3O78 A;  4DRW A;  4C0K A;  4HSZ A;  1NP8 A;  2OTG B;  4AQI A;  3SG4 A;  4DS7 A;  4PCW A;  1TTX A;  2KBM A;  1MXL C;  1PRW A;  1WLZ A;  4ZCV A;  1BOD A;  1BU3 A;  1MF8 B;  4PHM A;  4WQ3 A;  3ZNI A;  1M31 A;  1TCF A;  4M2O A;  4HRG A;  1TN4 A;  1ZMZ A;  2I94 A;  3BUO B;  1NCX A;  4GGF C;  4A4B A;  3BUN B;  2KYC A;  2G9B A;  3FS7 A;  3KEV A;  1Q80 A;  1QVI Z;  1GQM A;  4NDD A;  2KFG A;  5I2O A;  2JTZ A;  2LMV A;  3SG6 A;  1GGW A;  1PVB A;  1CTR A;  1NX2 A;  1LXF C;  1L2O B;  1G4Y R;  4I5L B;  1A75 A;  2LP2 A;  2KAX A;  1RWY A;  2ZN9 A;  3OX6 A;  3TS5 C;  3FWC A;  1WRL A;  1TIZ A;  3K21 A;  5JJG A;  4MBE A;  1UHI A;  2JT8 A;  1JF0 A;  1M45 A;  3FWB A;  5HLO A;  2OS8 B;  3GOF A;  3E3R A;  1S6I A;  2AAO A;  3PM8 A; 
#chains in the Genus database with same CATH topology
 1KFX S;  2LAN A;  1DJH A;  1RJV A;  1QTX A;  2QEH A;  3CLN A;  4JPZ B;  3SIA A;  1DJX A;  4JD9 A;  1BR4 B;  1YRT B;  1U5I B;  1EG3 A;  1EL4 A;  1B8L A;  1S6J A;  2DOQ A;  3IF7 A;  1OZS A;  1KQM B;  1XVJ A;  3EVR A;  3LL8 B;  1AK8 A;  1K9U A;  3S0D A;  3KO0 A;  1TNW A;  2CT9 A;  1KFU L;  4MLW A;  4MZL A;  5K89 A;  4YGE B;  4CFR A;  1SCV A;  2LUC A;  2MRD A;  2TN4 A;  1IGV A;  2I18 A;  2WCH A;  2M3W A;  1CDL A;  1QV0 A;  3RLZ A;  3S0G A;  1QIV A;  3JVT C;  1C07 A;  1F4O A;  1OZO A;  2JUL A;  4JWQ A;  1MQ1 A;  1Y1A A;  2EGD A;  1V1F A;  2L50 A;  3PFV A;  2FOT A;  2KGR A;  2WCL A;  4NQG A;  1BMO A;  1UHJ A;  1SYM A;  1XFX O;  1S6C A;  2PQL A;  3B6X A;  1TNP A;  2QPT A;  3S0B A;  1MUX A;  4ORC B;  3SG5 A;  4E68 A;  1D1O A;  2BAP A;  3VGO A;  1IH0 A;  4GGN A;  5KSZ A;  1RRO A;  2OPO A;  2QAC A;  1WLM A;  2KQY A;  2KOT A;  1TOP A;  1F54 A;  2L4I A;  2Y1N A;  1H4B A;  1K8U A;  2V53 A;  3DVE A;  3CS1 A;  3PM2 A;  3NHT A;  3IQO A;  1XK4 A;  4PDZ A;  1DGU A;  1QX2 A;  1N2D A;  2JNX A;  3BUX B;  3TZ1 A;  1OOF A;  3IQQ A;  1CDP A;  3BUW B;  1SL8 A;  2BL0 C;  2H61 A;  1XFU O;  1F55 A;  1QLS A;  2FJY A;  3D0Y B;  5D69 A;  3GK4 X;  5HKY A;  2K8M B;  3D74 A;  1JSA A;  1DJG A;  2JT0 A;  1K90 D;  3CZ1 A;  1VRK A;  2K2A A;  3MSE B;  3JTD C;  5KTY A;  2MLE C;  3DF0 A;  1K96 A;  3AKB A;  1ALV A;  2M8U A;  4YI8 A;  1XYD A;  1EXR A;  3HX4 A;  3I5H C;  1A03 A;  1DF0 B;  2WCE A;  3L4L A;  4GFT A;  3DYE A;  1AUI B;  4WQ2 A;  1OQP A;  3TS5 B;  1AJ5 A;  3H4S E;  4U8D A;  1C7W A;  1J1E A;  3WHT B;  2M1U A;  1CLL A;  2K0J A;  1ZFS A;  4GNK B;  3NSK A;  1B8R A;  2FCD A;  1J55 A;  4OV2 A;  4R1E A;  5FI7 A;  1M63 B;  2ISD A;  1JFJ A;  2GGM A;  2WCM A;  2MJW B;  5AXI A;  1UHK A;  5CSI A;  1SCM C;  2LLT A;  2E30 A;  2LMU A;  3VRR A;  1MWN A;  4YGD B;  4N1F A;  1HT9 A;  5FYX A;  1UUS A;  3D10 A;  3WNX B;  2GGZ A;  1ALW A;  1KK8 C;  2M1K B;  2SAS A;  3DD4 A;  2F2O A;  4D1E A;  3RZS A;  3PSR A;  1QS7 A;  1IJ5 A;  1TNQ A;  1SR6 C;  1YUS A;  2CNP A;  5G08 A;  4MZK A;  2L0P A;  1XFZ O;  3EK7 A;  1YX8 A;  2FJU B;  3D0Y A;  1ZUZ A;  3JVT B;  2JPT A;  2R2I A;  1TRF A;  1W7I B;  3NHI A;  3GK1 A;  3IVT A;  1K94 A;  5FI6 A;  1WRK A;  2B1U A;  2Q91 A;  2M7N A;  3I5I C;  1CFC A;  1J7Q A;  3I5F C;  2KLE A;  1OMV A;  4UPG A;  1DEK A;  2D8N A;  2KQ6 A;  1YRU B;  3K1E A;  2LVI A;  3OGN A;  5PAL A;  1C3Y A;  4AQJ A;  2MA2 A;  1SPY A;  1DF0 A;  1K2H A;  1LVC D;  3SS4 A;  2JC2 A;  2JWW A;  1NCZ A;  1NPQ A;  4PHK A;  1BLQ A;  4XYN A;  4QJ5 B;  3EKH A;  1UUR A;  2JOJ A;  1BJF A;  2PRU A;  3EVU A;  4PE4 A;  4IL1 A;  1TCO B;  3BJH A;  5I2L A;  3DVK A;  3C1V A;  3UNW A;  1JBA A;  2BCA A;  1C3Z A;  2JXL A;  3WXA A;  3B88 A;  2JXC A;  3CR4 X;  5HL1 A;  3CWG A;  1KSO A;  1SBJ A;  2BL0 B;  1IG5 A;  2Q4U A;  1NUB A;  5EL2 A;  2WC8 A;  2WCJ A;  1RK9 A;  1WRZ A;  1F70 A;  2EC6 C;  4GUK A;  1ZOT B;  1XFY O;  1SSE B;  2KAY A;  4DCK A;  1B7T Z;  2BE4 A;  1CLM A;  1J1D A;  1S3P A;  3JTD B;  1PVA A;  1MHO A;  2P70 A;  3AAJ A;  3LLE A;  2F2P A;  2KDH A;  2LLU A;  3VRP A;  3I5H B;  2NXQ A;  4BY4 A;  1QAT A;  1NX3 A;  1J7R A;  4HRE E;  4PE0 A;  4CID A;  1IQ3 A;  3LK1 A;  2HQW A;  3OX5 A;  5I8N A;  1SY9 A;  1T14 A;  2JZI A;  2BCB A;  1F71 A;  4CFQ A;  2PSR A;  1CDN A;  3L4A A;  2CTN A;  1OSA A;  3FIA A;  1OMD A;  4USL A;  2MLF C;  2LE9 B;  2BBM A;  4N5X A;  2PAS A;  4YGC B;  2I2R E;  1FI6 A;  1QAS A;  5CSF A;  4PHN A;  3PAL A;  1SCM B;  1NX0 A;  1X02 A;  5AAN A;  3OHM B;  2Y5I A;  1OE9 B;  1QJT A;  3HCM A;  3AKA A;  1OOJ A;  3VB1 A;  1KK8 B;  2JQ6 A;  1QIW A;  5KU1 A;  2M7L A;  1MR8 A;  3BXK A;  2M49 B;  1OOI X;  4P2Y B;  1TNX A;  1SR6 B;  2H2K A;  3CZ2 A;  1YX7 A;  1B7T Y;  1KCY A;  2KI6 D;  1B8C A;  1J7O A;  4IJ7 A;  5GQQ C;  3B87 A;  1SW8 A;  1G8I A;  1JFK A;  1LKJ A;  2M9G A;  1SL9 A;  5I2Q A;  3I5I B;  2CCM A;  3I5F B;  3OB1 B;  2LC5 A;  2KLD A;  1U5I A;  1QV1 A;  1FPW A;  1EG4 A;  1YUU A;  3TDU A;  1YVL A;  3LK0 A;  3R1V A;  2H8V A;  4FQT A;  2WC5 A;  4DIR A;  1Y1X A;  3FE8 A;  4FQO A;  4YBH B;  3SG7 A;  3DVM A;  1FF1 A;  1PSR A;  1K93 D;  2G2B A;  2LCP A;  1JUO A;  1OMR A;  2HPS A;  1KFX L;  1CMF A;  1B4C A;  1EH2 A;  1SK6 D;  2COL B;  1QWV A;  1UHH A;  4JKT A;  1DVI A;  3N7H A;  1CLB A;  4OZD A;  1XFW O;  2JNF A;  4WRI A;  1UWO A;  2ZFD A;  1IIO A;  1GGZ A;  4NDC A;  1IQ5 A;  3NSI A;  1S1E A;  1AJ4 A;  1V1G A;  1ZAC A;  2JPO A;  2K2F A;  1NYA A;  3O6B A;  4ETO A;  2LHI A;  3CZT X;  2JT3 A;  1XK4 C;  2EC6 B;  3TDZ A;  4C0J A;  1SKT A;  5B8I B;  1AVS A;  1DJW A;  4PE7 A;  2VRG A;  2KHN A;  2F3Z A;  3QME A;  4CPV A;  3D76 A;  2M97 A;  1A4P A;  2WOR A;  4ORA B;  1DT7 B;  2KAV A;  4MSP A;  2K61 A;  3CAB A;  1Y0V H;  1IRJ A;  1KWO C;  3A4U B;  3AAK A;  3EVV A;  4ICB A;  1LA3 A;  4I5N B;  4PAL A;  1K95 A;  3BOW B;  1KK7 Z;  2Y4Q A;  3I5G C;  2NZ0 A;  1CFD A;  1NWD A;  2F3Y A;  5AER A;  3O4X A;  3V2L A;  5D7F A;  4I5J A;  4YGB B;  1OOH A;  3CTN A;  3LCP C;  3CR5 X;  2LM5 A;  3NXA A;  2LVV A;  5HKZ A;  5J3X A;  4GGF A;  1A75 B;  4ORB B;  1QX5 B;  2QEB A;  1NSH A;  1XFR A;  1ORG A;  3EG5 B;  3DY9 A;  3KF9 A;  4OVN F;  1CB1 A;  3PN7 C;  3VRN A;  1DMO A;  2KSP A;  3VRQ A;  2LMT A;  4M2P A;  2PMY A;  2FCE A;  2LV7 A;  1QLK A;  3BQ3 A;  1CKK A;  5JOL A;  1RTP 1;  1R6P A;  2F8P A;  2SCP A;  1A2X A;  2BKH B;  3DZT A;  3TUY C;  1H8B A;  1KQV A;  2ZRT A;  5CSN A;  3F45 A;  2HET A;  1KSM A;  2WC6 A;  3SJS A;  4F7F A;  2NCO A;  2MBX A;  1CMG A;  1SNL A;  1GM0 A;  1MXE A;  4TNC A;  1DC1 A;  2KI6 C;  3R72 A;  1F8H A;  1XFV O;  4MRY A;  1S5G Y;  1Y1U A;  2K7O A;  1P28 A;  3KHE A;  1AP4 A;  2BEC A;  1LS8 A;  3DVJ A;  3FE6 A;  2CXJ A;  4OKH A;  3O2P A;  2KI4 C;  4L9M A;  4OR9 B;  1IJ6 A;  3SS3 A;  2KPH A;  2ZRS A;  4BY5 A;  3NSO A;  1KK7 Y;  3O4Y A;  3OP0 A;  1BOC A;  4JQ0 D;  1L7Z A;  1DTL A;  2L2E A;  5DKQ A;  1NCY A;  2JU0 A;  2AMI A;  3BOW A;  4C0L A;  2JRF A;  2LNK A;  2LVK A;  3D78 A;  3GK2 A;  1PK0 D;  5F6T A;  3NSL A;  3SG2 A;  1C7V A;  2BNX A;  2QEV A;  3BFB A;  1Z4H A;  2WOS A;  1W9Z A;  2Y1M A;  2IS9 A;  2LHL A;  1DJI A;  4QJ3 B;  3SS5 A;  2ZKM X;  2K7C A;  2M29 A;  4GAO A;  4HRH A;  1PUL A;  2JTT A;  1FBV A;  3CDN A;  1Y6W A;  1NIW A;  2WCF A;  1M39 A;  3B86 A;  5HYD A;  2LVJ A;  4INW A;  5FI2 A;  5CSJ A;  4YRU A;  1WDC C;  4PT1 A;  2K7D A;  3EKJ A;  1K9P A;  1BF5 A;  1YVH A;  1CDM A;  1PAL A;  5DKR A;  3BFH A;  3QRX A;  1TWO A;  1CM4 A;  2O5G A;  5IBW A;  4XJK B;  1OW4 A;  3EK4 A;  4KYN A;  1OOG A;  2M0R A;  4PHJ A;  3SIB A;  2L5Y A;  4Q04 A;  3SG3 A;  1YR5 A;  1KWO B;  1JC2 A;  2KFH A;  1CM1 A;  3EK8 A;  1NX1 A;  5AEQ A;  2NCP A;  1R2U A;  2K7B A;  5CPV A;  1BR1 B;  3TDI A;  1S36 A;  3I5G B;  2WCB A;  2AUC A;  2ZNE A;  2GTE A;  3DF0 B;  4NDB A;  2L5X B;  3M0W A;  1QVI Y;  1IWQ A;  2QEO A;  1GJY A;  2LAP A;  2OTG C;  2PAL A;  1DQE A;  3CR2 A;  4GPL B;  4A4C A;  5DIC A;  4PE1 A;  3OB2 B;  1IKU A;  1DJY A;  2ERB A;  3PN7 B;  3KPX A;  4I5K A;  4MN0 A;  2KFF A;  4YI9 A;  3S0E A;  2KGB C;  1XO5 A;  2MHH A;  1FI5 A;  2LLS A;  1SMG A;  1YUT A;  3TUY B;  3BYA A;  1E8A A;  3DXL A;  2HF5 A;  3PLF B;  1YTZ C;  2KNE A;  2HQ8 A;  2L4H A;  2P6B B;  2GV5 A;  2ZN8 A;  1FW4 A;  4F0Z B;  5ER5 A;  3UO9 A;  5TNC A;  1TUZ A;  2PYQ A;  3L47 A;  1L2O C;  1W7J B;  3S0A A;  1A29 A;  3VRO A;  2PVB A;  2LP3 A;  4MEW A;  4FTG A;  2BCX A;  2KI4 B;  3CGA A;  4XJK A;  2CBL A;  1QX7 A;  3RM1 A;  1REC A;  2F33 A;  2BE6 A;  1BG1 A;  2K60 A;  2OS8 C;  5HKW A;  4GBA A;  3D77 A;  3A8R A;  3WHU B;  3NGV A;  2YGU A;  1S5G Z;  2H61 C;  5ER4 X;  3B7A A;  4MZJ A;  5D3O A;  4AOM A;  1KQM C;  1DGV A;  2ZND A;  2BKI B;  3PAT A;  1K9K A;  2WND A;  3FE9 A;  3Q8I A;  1CFP A;  1B1G A;  4M2Q A;  1UHN A;  2KBI A;  2O60 A;  4QJ4 B;  5AFP A;  1G33 A;  3CYZ A;  5DKN A;  3BUM B;  1EJ3 A;  1YUR A;  4P5O E;  2EHB A;  2RGI A;  1JWD A;  1Z2C B;  4OCI A;  4MRX A;  3CZ0 A;  1WDC B;  1HQV A;  3OBV A;  2WCK A;  1B9A A;  1B47 A;  3D73 A;  1CFF A;  1LA0 A;  2LUX A;  1J7P A;  1LIN A;  5BPJ A;  1S26 D;  2L51 A;  4N1G A;  4DUQ A;  2KYF A;  1CNP A;  5HLV A;  1UP5 A;  1N65 A;  1KFU S;  4ZCU A;  2MAZ A;  4CLN A;  1N0Y A;  1PSB A;  4YGA A;  1DEL A;  2NLN A;  1SRA A;  3BFA A;  1ODB A;  1BT6 A;  4MVF A;  2P71 A;  2A4J A;  1JF2 A;  1RFJ A;  3ZWH A;  2L2C A;  1F4Q A;  1SL7 A;  1XA5 A;  2L98 A;  3R1O A;  1M46 A;  2BBN A;  1AHR A;  2I7A A;  1DJZ A;  1WY9 A;  2E6W A;  3ICB A;  1QXP A;  3O78 A;  4DRW A;  4C0K A;  4HSZ A;  1NP8 A;  2OTG B;  4AQI A;  3SG4 A;  4DS7 A;  4PCW A;  1TTX A;  2KBM A;  3PJI A;  1MXL C;  1PRW A;  1WLZ A;  4ZCV A;  1BOD A;  1BU3 A;  1MF8 B;  4PHM A;  4WQ3 A;  3ZNI A;  1M31 A;  1TCF A;  4M2O A;  4HRG A;  1TN4 A;  1ZMZ A;  2I94 A;  3BUO B;  1NCX A;  4GGF C;  4A4B A;  3BUN B;  2KYC A;  2G9B A;  3D75 A;  3FS7 A;  3KEV A;  3S0F A;  1Q80 A;  1QVI Z;  1GQM A;  4NDD A;  2KFG A;  5I2O A;  2JTZ A;  2LMV A;  3SG6 A;  1GGW A;  1PVB A;  1TUJ A;  1CTR A;  1NX2 A;  4INX A;  1LXF C;  1L2O B;  1G4Y R;  4I5L B;  1A75 A;  2LP2 A;  2KAX A;  1RWY A;  2ZN9 A;  3OX6 A;  3TS5 C;  3FWC A;  1WRL A;  5I94 A;  1TIZ A;  3K21 A;  5JJG A;  4MBE A;  3R1P A;  1UHI A;  2JT8 A;  1JF0 A;  1M45 A;  3FWB A;  5HLO A;  2OS8 B;  3GOF A;  2QDI A;  3E3R A;  1S6I A;  2AAO A;  3PM8 A; 
#chains in the Genus database with same CATH homology
 1KFX S;  2LAN A;  1DJH A;  1RJV A;  1QTX A;  3CLN A;  3SIA A;  4JPZ B;  1DJX A;  1BR4 B;  1YRT B;  1U5I B;  1EG3 A;  1EL4 A;  1B8L A;  1S6J A;  2DOQ A;  3IF7 A;  1OZS A;  1KQM B;  1XVJ A;  3EVR A;  3LL8 B;  1AK8 A;  1K9U A;  3KO0 A;  1TNW A;  2CT9 A;  1KFU L;  4MLW A;  4MZL A;  5K89 A;  4YGE B;  4CFR A;  1SCV A;  2LUC A;  2MRD A;  2TN4 A;  1IGV A;  2I18 A;  2M3W A;  1CDL A;  1QV0 A;  3RLZ A;  1QIV A;  3JVT C;  1C07 A;  1F4O A;  1OZO A;  2JUL A;  4JWQ A;  1MQ1 A;  1Y1A A;  2EGD A;  1V1F A;  2L50 A;  3PFV A;  2FOT A;  2KGR A;  4NQG A;  1BMO A;  1UHJ A;  1SYM A;  1XFX O;  1S6C A;  4E68 A;  1D1O A;  1TNP A;  2QPT A;  1MUX A;  4ORC B;  3SG5 A;  3VGO A;  1IH0 A;  4GGN A;  5KSZ A;  1RRO A;  2OPO A;  2QAC A;  1WLM A;  2KQY A;  2KOT A;  1TOP A;  1F54 A;  2L4I A;  2Y1N A;  1H4B A;  1K8U A;  2V53 A;  3DVE A;  3CS1 A;  3IQO A;  1XK4 A;  4PDZ A;  1DGU A;  1QX2 A;  1N2D A;  2JNX A;  3BUX B;  3TZ1 A;  3IQQ A;  1CDP A;  3BUW B;  1SL8 A;  2BL0 C;  2H61 A;  1XFU O;  1F55 A;  1QLS A;  3D0Y B;  5D69 A;  3GK4 X;  5HKY A;  2K8M B;  1JSA A;  1DJG A;  2JT0 A;  1K90 D;  1VRK A;  2K2A A;  3MSE B;  3JTD C;  5KTY A;  2MLE C;  3DF0 A;  1K96 A;  3AKB A;  1ALV A;  2M8U A;  4YI8 A;  1XYD A;  1EXR A;  3HX4 A;  3I5H C;  1A03 A;  1DF0 B;  2WCE A;  4GFT A;  1AUI B;  4WQ2 A;  1OQP A;  3TS5 B;  1AJ5 A;  3H4S E;  4U8D A;  1C7W A;  1J1E A;  3WHT B;  2M1U A;  1CLL A;  2K0J A;  1ZFS A;  4GNK B;  3NSK A;  1B8R A;  2FCD A;  1J55 A;  4OV2 A;  4R1E A;  2ISD A;  1M63 B;  1JFJ A;  2GGM A;  2MJW B;  5AXI A;  1UHK A;  5CSI A;  1SCM C;  2LLT A;  2E30 A;  2LMU A;  3VRR A;  1MWN A;  4YGD B;  4N1F A;  1HT9 A;  5FYX A;  1UUS A;  3D10 A;  3WNX B;  2GGZ A;  1ALW A;  1KK8 C;  2M1K B;  2SAS A;  3DD4 A;  2F2O A;  4D1E A;  3PSR A;  1QS7 A;  1IJ5 A;  1TNQ A;  1SR6 C;  1YUS A;  2CNP A;  5G08 A;  4MZK A;  2L0P A;  1XFZ O;  3EK7 A;  1YX8 A;  2FJU B;  3D0Y A;  1ZUZ A;  3JVT B;  2JPT A;  2R2I A;  1TRF A;  1W7I B;  3GK1 A;  1K94 A;  1WRK A;  2B1U A;  2Q91 A;  2M7N A;  3I5I C;  1CFC A;  1J7Q A;  3I5F C;  1OMV A;  4UPG A;  2KQ6 A;  2D8N A;  5PAL A;  1YRU B;  2LVI A;  4AQJ A;  2MA2 A;  1SPY A;  1DF0 A;  1K2H A;  1LVC D;  2JC2 A;  2JWW A;  1NCZ A;  1NPQ A;  4PHK A;  1BLQ A;  4XYN A;  4QJ5 B;  3EKH A;  1UUR A;  2JOJ A;  1BJF A;  2PRU A;  3EVU A;  4PE4 A;  4IL1 A;  1TCO B;  5I2L A;  3DVK A;  3C1V A;  1JBA A;  2BCA A;  2JXL A;  3WXA A;  2JXC A;  3CR4 X;  3CWG A;  1KSO A;  1SBJ A;  2BL0 B;  1IG5 A;  2Q4U A;  1NUB A;  2WC8 A;  1RK9 A;  1WRZ A;  1F70 A;  2EC6 C;  4GUK A;  1ZOT B;  1XFY O;  2KAY A;  4DCK A;  1B7T Z;  2BE4 A;  1CLM A;  1J1D A;  1S3P A;  3JTD B;  1PVA A;  1MHO A;  3AAJ A;  3LLE A;  2F2P A;  2KDH A;  2LLU A;  3VRP A;  3I5H B;  2NXQ A;  4BY4 A;  1QAT A;  1NX3 A;  1J7R A;  4HRE E;  4PE0 A;  4CID A;  1IQ3 A;  3LK1 A;  2HQW A;  3OX5 A;  5I8N A;  1SY9 A;  2JZI A;  2BCB A;  1F71 A;  4CFQ A;  2PSR A;  1CDN A;  2CTN A;  1OSA A;  3FIA A;  1OMD A;  4USL A;  2MLF C;  2LE9 B;  2BBM A;  4N5X A;  2PAS A;  4YGC B;  2I2R E;  1FI6 A;  1QAS A;  5CSF A;  4PHN A;  3PAL A;  1SCM B;  1NX0 A;  1X02 A;  5AAN A;  3OHM B;  2Y5I A;  1OE9 B;  1QJT A;  3HCM A;  3AKA A;  1OOJ A;  1KK8 B;  2JQ6 A;  1QIW A;  5KU1 A;  2M7L A;  1MR8 A;  3BXK A;  2M49 B;  4P2Y B;  1TNX A;  1SR6 B;  2H2K A;  1YX7 A;  1B7T Y;  1KCY A;  2KI6 D;  1B8C A;  1J7O A;  5GQQ C;  1SW8 A;  1G8I A;  1JFK A;  1LKJ A;  2M9G A;  1SL9 A;  5I2Q A;  3I5I B;  2CCM A;  3I5F B;  3OB1 B;  2LC5 A;  1U5I A;  1QV1 A;  1FPW A;  1EG4 A;  1YUU A;  3TDU A;  1YVL A;  3LK0 A;  4DIR A;  1Y1X A;  4FQO A;  4YBH B;  3SG7 A;  3DVM A;  1FF1 A;  1PSR A;  1K93 D;  2G2B A;  2LCP A;  1JUO A;  1OMR A;  2HPS A;  1KFX L;  1CMF A;  1B4C A;  1EH2 A;  1SK6 D;  2COL B;  1UHH A;  1DVI A;  1CLB A;  1XFW O;  2JNF A;  4WRI A;  1UWO A;  2ZFD A;  1GGZ A;  4NDC A;  1IQ5 A;  3NSI A;  1S1E A;  1AJ4 A;  1V1G A;  1ZAC A;  2K2F A;  3O6B A;  1NYA A;  4ETO A;  2LHI A;  3CZT X;  2JT3 A;  1XK4 C;  2EC6 B;  3TDZ A;  4C0J A;  1SKT A;  5B8I B;  1AVS A;  1DJW A;  4PE7 A;  2VRG A;  2KHN A;  2F3Z A;  4CPV A;  2M97 A;  1A4P A;  2WOR A;  4ORA B;  1DT7 B;  2KAV A;  4MSP A;  2K61 A;  1Y0V H;  1IRJ A;  1KWO C;  3A4U B;  3AAK A;  3EVV A;  4ICB A;  1LA3 A;  4I5N B;  4PAL A;  1K95 A;  3BOW B;  1KK7 Z;  2Y4Q A;  3I5G C;  2NZ0 A;  1CFD A;  1NWD A;  2F3Y A;  5AER A;  5D7F A;  4I5J A;  4YGB B;  3CTN A;  3LCP C;  3CR5 X;  2LM5 A;  3NXA A;  2LVV A;  5HKZ A;  5J3X A;  4GGF A;  1A75 B;  4ORB B;  1QX5 B;  1NSH A;  3KF9 A;  4OVN F;  1CB1 A;  3PN7 C;  3VRN A;  1DMO A;  2KSP A;  3VRQ A;  2LMT A;  4M2P A;  2PMY A;  2FCE A;  2LV7 A;  1QLK A;  3BQ3 A;  1CKK A;  5JOL A;  1RTP 1;  1R6P A;  2F8P A;  2SCP A;  1A2X A;  2BKH B;  3TUY C;  1H8B A;  1KQV A;  2ZRT A;  5CSN A;  3F45 A;  2HET A;  1KSM A;  1CMG A;  3SJS A;  2NCO A;  2MBX A;  1SNL A;  1MXE A;  4TNC A;  2KI6 C;  1F8H A;  1XFV O;  4MRY A;  1S5G Y;  1Y1U A;  2K7O A;  3KHE A;  1AP4 A;  2BEC A;  3DVJ A;  2CXJ A;  4OKH A;  3O2P A;  2KI4 C;  4L9M A;  4OR9 B;  1IJ6 A;  2ZRS A;  4BY5 A;  3NSO A;  1KK7 Y;  3O4Y A;  3OP0 A;  1BOC A;  4JQ0 D;  1L7Z A;  1DTL A;  2L2E A;  5DKQ A;  1NCY A;  2JU0 A;  2AMI A;  3BOW A;  4C0L A;  2JRF A;  2LNK A;  2LVK A;  3GK2 A;  5F6T A;  1PK0 D;  3SG2 A;  3NSL A;  1C7V A;  2WOS A;  2Y1M A;  2IS9 A;  2LHL A;  1DJI A;  4QJ3 B;  2ZKM X;  2K7C A;  2M29 A;  4GAO A;  4HRH A;  1PUL A;  2JTT A;  1FBV A;  1Y6W A;  1NIW A;  2WCF A;  1M39 A;  5HYD A;  2LVJ A;  5CSJ A;  4YRU A;  1WDC C;  2K7D A;  3EKJ A;  1K9P A;  1BF5 A;  1YVH A;  1CDM A;  1PAL A;  5DKR A;  3QRX A;  1CM4 A;  2O5G A;  5IBW A;  4XJK B;  3EK4 A;  2M0R A;  4PHJ A;  3SIB A;  4Q04 A;  3SG3 A;  1YR5 A;  1KWO B;  1JC2 A;  2KFH A;  1CM1 A;  3EK8 A;  1NX1 A;  5AEQ A;  2NCP A;  1R2U A;  2K7B A;  5CPV A;  1BR1 B;  3TDI A;  1S36 A;  3I5G B;  2WCB A;  2AUC A;  2ZNE A;  3DF0 B;  4NDB A;  2L5X B;  3M0W A;  1QVI Y;  1IWQ A;  1GJY A;  2LAP A;  2OTG C;  2PAL A;  3CR2 A;  4GPL B;  4A4C A;  1IKU A;  4PE1 A;  3OB2 B;  1DJY A;  3PN7 B;  3KPX A;  4I5K A;  4MN0 A;  2KFF A;  4YI9 A;  2KGB C;  1XO5 A;  2MHH A;  1FI5 A;  2LLS A;  1SMG A;  1YUT A;  3TUY B;  3BYA A;  1E8A A;  3PLF B;  2HF5 A;  1YTZ C;  2KNE A;  2HQ8 A;  2L4H A;  2P6B B;  2GV5 A;  2ZN8 A;  1FW4 A;  4F0Z B;  5ER5 A;  5TNC A;  1L2O C;  1W7J B;  1A29 A;  3VRO A;  2PVB A;  2LP3 A;  4MEW A;  4FTG A;  2BCX A;  2KI4 B;  3CGA A;  4XJK A;  2CBL A;  1QX7 A;  3RM1 A;  1REC A;  2F33 A;  2BE6 A;  1BG1 A;  2OS8 C;  5HKW A;  4GBA A;  3A8R A;  3WHU B;  1S5G Z;  2H61 C;  5ER4 X;  4MZJ A;  4AOM A;  1KQM C;  1DGV A;  2ZND A;  2BKI B;  3PAT A;  1K9K A;  2WND A;  1CFP A;  1B1G A;  4M2Q A;  1UHN A;  2KBI A;  2O60 A;  4QJ4 B;  5AFP A;  1G33 A;  5DKN A;  3BUM B;  1EJ3 A;  1YUR A;  4P5O E;  2EHB A;  2RGI A;  1JWD A;  4OCI A;  4MRX A;  1WDC B;  1HQV A;  1B9A A;  1B47 A;  1CFF A;  1LA0 A;  2LUX A;  1J7P A;  1LIN A;  5BPJ A;  1S26 D;  2L51 A;  4N1G A;  4DUQ A;  2KYF A;  1CNP A;  5HLV A;  1UP5 A;  1N65 A;  1KFU S;  4ZCU A;  2MAZ A;  4CLN A;  1N0Y A;  1PSB A;  4YGA A;  2NLN A;  1SRA A;  1ODB A;  1BT6 A;  4MVF A;  3ZWH A;  2A4J A;  1JF2 A;  1RFJ A;  1F4Q A;  1SL7 A;  1XA5 A;  2L98 A;  1M46 A;  2BBN A;  1AHR A;  2I7A A;  1DJZ A;  1WY9 A;  2E6W A;  3ICB A;  1QXP A;  3O78 A;  4DRW A;  4C0K A;  4HSZ A;  1NP8 A;  2OTG B;  4AQI A;  3SG4 A;  4DS7 A;  4PCW A;  1TTX A;  2KBM A;  1MXL C;  1PRW A;  1WLZ A;  4ZCV A;  1BOD A;  1BU3 A;  1MF8 B;  4PHM A;  4WQ3 A;  3ZNI A;  1M31 A;  1TCF A;  4M2O A;  4HRG A;  1TN4 A;  1ZMZ A;  2I94 A;  3BUO B;  1NCX A;  4GGF C;  4A4B A;  3BUN B;  2KYC A;  2G9B A;  3FS7 A;  3KEV A;  1Q80 A;  1QVI Z;  1GQM A;  4NDD A;  2KFG A;  5I2O A;  2JTZ A;  2LMV A;  3SG6 A;  1GGW A;  1PVB A;  1CTR A;  1NX2 A;  1LXF C;  1L2O B;  1G4Y R;  4I5L B;  1A75 A;  2LP2 A;  2KAX A;  1RWY A;  2ZN9 A;  3OX6 A;  3TS5 C;  3FWC A;  1WRL A;  1TIZ A;  3K21 A;  5JJG A;  4MBE A;  1UHI A;  2JT8 A;  1JF0 A;  1M45 A;  3FWB A;  5HLO A;  2OS8 B;  3GOF A;  3E3R A;  1S6I A;  2AAO A;  3PM8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...