4DRWA

Crystal structure of the ternary complex between s100a10, an annexin a2 n-terminal peptide and an ahnak peptide
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
112
structure length
103
Chain Sequence
PSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPLAVDKIMKDLDQCRDGKVGFQSFFSLIAGLTIACNDYFVVHMKSTVHEILSKLSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of an asymmetric ternary protein complex provides insight for membrane interaction.
pubmed doi rcsb
molecule keywords Protein S100-A10/Annexin A2 chimeric protein
molecule tags Exocytosis/protein binding
source organism Homo sapiens
total genus 24
structure length 103
sequence length 112
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4drwA00
1KK8B 2BBNA 2MA2A 2ZNDA 3NXAA 5CPVA 1QASA 2K7BA 3MSEB 2FOTA 2NLNA 1A75B 1ALVA 2BCAA 5CSNA 1RROA 1J7RA 1K90D 1RFJA 2F2PA 1QTXA 4XJKA 1PVAA 2M7NA 1NP8A 1IJ6A 1K9KA 3WNXB 1V1GA 2KI4C 1CFFA 2I2RE 3WHTB 2K2AA 1BT6A 3VRRA 5AANA 1SY9A 4MRXA 3DVKA 1HQVA 4I5JA 2M97A 3I5HB 3H4SE 5D69A 3EK4A 4OVNF 1TN4A 1CKKA 3ZWHA 2WOSA 3PM8A 1M39A 1DJZA 3EK7A 5GQQC 1QLSA 1CM4A 1JFJA 2LLUA 4N1FA 2AAOA 4L9MA 1JWDA 1KWOB 2KHNA 5DKNA 4GGFA 2M1KB 2WCBA 1H8BA 2BE6A 4C0KA 4JWQA 5HYDA 1YRTB 3C1VA 4QJ4B 1WRZA 1FBVA 2D8NA 2MRDA 4OCIA 2I18A 4MZJA 1B9AA 1GGZA 1IQ3A 2L2EA 1KSOA 1YUUA 1KK7Z 1S5GZ 1K2HA 2MHHA 4YI9A 1R6PA 1Y1UA 1EL4A 2H2KA 2JZIA 1DVIA 3CGAA 2L5XB 1M63B 1IQ5A 1M45A 1DTLA 1MXLC 1SBJA 2QACA 1SKTA 4ETOA 3GOFA 2JT3A 1NSHA 1WLZA 4CLNA 1XA5A 4YGEB 1K8UA 1PSRA 5CSFA 1R2UA 2K8MB 5AEQA 1YUTA 2BKHB 2KNEA 3PN7B 4GGFC 3BUMB 2ZRTA 2K2FA 4ZCVA 1XYDA 2ISDA 5DKRA 1K9UA 1U5IB 2BBMA 1AK8A 1OMVA 1RJVA 1SL8A 1JUOA 1XK4C 1LVCD 2LMVA 4CIDA 3TDUA 2V53A 3SG5A 3SG2A 2I7AA 3SG3A 4AOMA 1PALA 1WY9A 1KQMC 2LANA 4TNCA 1B8RA 1AP4A 2LP3A 4ZCUA 1SPYA 4YGAA 1W7JB 1SR6B 3SIBA 1LINA 5PALA 1G8IA 1J1EA 1DF0B 2BCXA 1EJ3A 1QV1A 1RWYA 1WRLA 2LAPA 2CNPA 4USLA 3O4YA 2HF5A 3AAJA 2K7OA 5I2OA 3LK0A 4MLWA 1CNPA 1J1DA 2EC6C 4YI8A 3KPXA 5G08A 1C7VA 1AJ4A 1IGVA 1MHOA 2LUXA 2M29A 2Y1MA 3EKHA 4MN0A 4MZLA 3VRPA 2M7LA 1EG4A 3EVRA 3CS1A 1SCMB 1Y1AA 2AMIA 2KI6D 2L4IA 2SCPA 1QV0A 2JWWA 2H61A 3E3RA 1GGWA 2LC5A 1OZOA 1LA0A 4QJ3B 1TCFA 5KU1A 3SJSA 2OPOA 1QX5B 1XFYO 2JU0A 3JVTB 1UURA 5I2LA 1QJTA 1RECA 1UHKA 3FWCA 2KAYA 4OR9B 4MSPA 4ORCB 3HX4A 5ER5A 1S6JA 5I2QA 2HQWA 3RLZA 3D0YB 3VROA 3BUNB 1A2XA 4PE4A 2KAVA 3ZNIA 1S6IA 4WRIA 1MR8A 1D1OA 3KO0A 4AQJA 3TUYC 1L7ZA 3F45A 2KBIA 2LM5A 3BOWB 4C0JA 1CMGA 4MEWA 1CDLA 5F6TA 2F3ZA 1DJIA 1PULA 2L0PA 1EG3A 1Y1XA 2OS8B 1MQ1A 2GGZA 1YRUB 3OX6A 1B8LA 1B1GA 3NSOA 1A75A 5J3XA 3CR5X 2ZKMX 5D7FA 2JQ6A 5JOLA 1KSMA 1B8CA 1F70A 4JQ0D 2WCFA 4ORBB 2M8UA 3GK4X 4ORAB 3RM1A 1S3PA 1J7OA 2FCEA 1BG1A 4BY4A 1K94A 2LVKA 3PFVA 2B1UA 4OV2A 2MLEC 2EHBA 1OMDA 1DGUA 3D10A 1GQMA 4I5KA 1SYMA 1BLQA 1IRJA 1SCVA 1X02A 1M31A 2CCMA 1CDNA 1A4PA 3KHEA 1QX2A 4M2PA 1WRKA 3TDZA 1XFWO 2FCDA 1JBAA 4MVFA 4DRWA 2F8PA 4WQ3A 1QVIY 3PATA 1DJYA 3PALA 2LE9B 2LP2A 1M46A 1CB1A 2KQ6A 3WHUB 1DGVA 2FJUB 3DF0B 3OX5A 4NDDA 2M9GA 5K89A 1PVBA 1OOJA 4YGCB 1LKJA 5HLVA 5JJGA 1BF5A 4AQIA 1UHJA 1AHRA 1QLKA 4DS7A 4YBHB 4FTGA 3VRQA 1RTP1 1ZMZA 2Y5IA 1TNXA 1FI6A 1B47A 2CT9A 2ZN9A 1MXEA 2JRFA 4FQOA 4GUKA 1JSAA 2RGIA 2JNFA 2JXLA 2LUCA 3CZTX 1QIVA 4UPGA 3FS7A 3LK1A 1NCYA 3O6BA 4GAOA 2MLFC 3GK2A 1TNPA 1NIWA 3SG4A 1OQPA 1WLMA 1NPQA 1V1FA 1S36A 1U5IA 2G2BA 1ZUZA 1TNQA 1CMFA 3HCMA 4ICBA 3TDIA 4Q04A 1F4QA 2O5GA 4NQGA 5CSJA 1KQMB 1BOCA 3VGOA 2NCPA 1NYAA 3TZ1A 4N1GA 1E8AA 4PHKA 2LLSA 1DF0A 1S26D 1N65A 3SIAA 2ZN8A 5AFPA 2WORA 1QX7A 1A03A 1K9PA 2JTTA 2O60A 1EH2A 2JC2A 2LHIA 2OTGC 2EC6B 2P6BB 1SMGA 4JPZB 1CM1A 3EVUA 2KGRA 3NSKA 1NUBA 3SG6A 3TS5C 3GK1A 3WXAA 2JULA 2BKIB 5DKQA 2M3WA 3BXKA 1AVSA 2LVVA 1J7QA 1TTXA 3JTDC 3PN7C 4GGNA 1MWNA 4WQ2A 2L4HA 3LCPC 2BCBA 4PE7A 1K95A 3SG7A 1KFUL 1TNWA 4CFRA 3EK8A 4PHNA 4DCKA 1J7PA 1WDCC 1KK7Y 2LNKA 1BR4B 4MRYA 1IKUA 1F71A 5BPJA 2LHLA 1YX7A 1L2OC 2ZRSA 3D0YA 1KCYA 3BUXB 1CFDA 2K0JA 2WC8A 2JPTA 3BUOB 4NDCA 1NCXA 3TUYB 2LMTA 1KFUS 3BUWB 3BOWA 1SRAA 3I5FC 2NZ0A 2K7DA 5AERA 1CDPA 5HKWA 3O2PA 1PRWA 3EKJA 3I5GB 1TIZA 2F3YA 1UUSA 1CLMA 1OSAA 3CR4X 1EXRA 1UHNA 1Y6WA 3A8RA 1FI5A 3PLFB 1BJFA 1NX0A 3AKAA 1F55A 1SCMC 5HLOA 1XFXO 1AUIB 1S6CA 1RK9A 1N2DA 1CLLA 2KFHA 2ZFDA 3OB2B 2PASA 1CFPA 2KFGA 3IF7A 1J55A 1G33A 5HKZA 2MBXA 1YVLA 2WNDA 1FW4A 2H61C 2HQ8A 3DD4A 1YTZC 3JVTC 3NSIA 1ALWA 4CPVA 2KI4B 1UP5A 1ZOTB 2BE4A 1TRFA 3KEVA 2JT0A 3CTNA 1MUXA 1NX3A 3IQOA 3I5IC 3FWBA 2L98A 3PSRA 1FPWA 2KSPA 4XYNA 1S1EA 1NCZA 1NWDA 2CBLA 3CLNA 4P5OE 3CR2A 2E6WA 2F2OA 2JOJA 2PSRA 2L51A 2BL0C 1MF8B 1FF1A 1IWQA 3DF0A 1DT7B 1QS7A 2M1UA 1QATA 2CXJA 1KK8C 3KF9A 1YUSA 4A4BA 2HETA 5ER4X 1DMOA 2EGDA 2Q4UA 4U8DA 1F8HA 4E68A 4YRUA 1B7TY 4XJKB 3BQ3A 5CSIA 1UHHA 4DIRA 1Y0VH 1SK6D 2JT8A 4PHJA 1QIWA 1JFKA 4HRGA 2KOTA 2A4JA 1JF0A 2WCEA 3LL8B 3NSLA 3DVMA 3I5HC 1LA3A 1KFXL 2NCOA 2PVBA 2M49B 3OHMB 1DJHA 2KDHA 1TOPA 1K93D 1KWOC 1XK4A 4C0LA 1KFXS 1NX2A 3AKBA 1XFVO 2NXQA 3OB1B 1IH0A 4MBEA 4GBAA 1QXPA 4YGDB 4HRHA 4P2YB 1DJWA 2KGBC 4IL1A 5I8NA 3O78A 4PE1A 2IS9A 2LCPA 4BY5A 2LLTA 3A4UB 2KFFA 3OP0A 1OMRA 3AAKA 2COLB 4PE0A 2OTGB 4GNKB 2MAZA 4HREE 1DJGA 1UWOA 1LXFC 2PALA 2JNXA 4M2OA 1VRKA 3TS5B 5HKYA 1YVHA 2DOQA 1F54A 1Q80A 1DJXA 1HT9A 2TN4A 3JTDB 4YGBB 2GGMA 1IG5A 4D1EA 3LLEA 4A4CA 4DUQA 1GJYA 2LVIA 2AUCA 4NDBA 1YURA 4I5NB 2GV5A 1W7IB 1SL7A 3FIAA 1WDCB 4HSZA 5TNCA 3CWGA 1L2OB 1IJ5A 1XO5A 1C7WA 1KQVA 3K21A 3DVJA 1K96A 2Q91A 4MZKA 4R1EA 1S5GY 2BECA 2LV7A 4M2QA 1UHIA 3DVEA 1A29A 2PRUA 3I5FB 4GFTA 4QJ5B 1SW8A 4F0ZB 3ICBA 5KTYA 1NX1A 1XFUO 1G4YR 2L50A 5KSZA 1SR6C 2Y4QA 1YR5A 1CTRA 2KAXA 1BMOA 5AXIA 4PHMA 3VRNA 4N5XA 1ZFSA 1XVJA 4PCWA 2G9BA 1XFZO 2KQYA 2HPSA 1JC2A 4GPLB 2MJWB 1QVIZ 2M0RA 2SASA 5B8IB 4CFQA 2JXCA 2KYFA 1YX8A 1CLBA 4OKHA 3M0WA 2KBMA 4PALA 1F4OA 1ZACA 2LMUA 1BR1B 1AJ5A 3BYAA 1B7TZ 1JF2A 2E30A 1SL9A 3QRXA 1OE9B 2PMYA 1B4CA 2ZNEA 1BU3A 4PDZA 1PSBA 1PK0D 5FYXA 2VRGA 3IQQA 1CDMA 1N0YA 4I5LB 1ODBA 1OZSA 2F33A 2I94A 3I5IB 1BODA 1SNLA 5IBWA 3I5GC 2KI6C 2JTZA 2Y1NA 3EVVA 1TCOB 1CFCA 2KYCA 2BL0B 1C07A 2QPTA 2CTNA 2LVJA 2R2IA 1H4BA 2OS8C 2K61A 2K7CA
chains in the Genus database with same CATH superfamily
3CABA 1KK8B 2BBNA 2MA2A 2ZNDA 3NXAA 5CPVA 1QASA 3V2LA 2K7BA 3MSEB 2FOTA 2NLNA 1A75B 2KLDA 1OOFA 1ALVA 2BCAA 5CSNA 1RROA 1J7RA 1K90D 1RFJA 2F2PA 1QTXA 4XJKA 1PVAA 2M7NA 1NP8A 1IJ6A 1K9KA 3CYZA 3WNXB 1V1GA 2KI4C 1CFFA 2I2RE 3WHTB 2K2AA 1BT6A 3VRRA 5AANA 1SY9A 2L2CA 4MRXA 3DVKA 1HQVA 4I5JA 2M97A 3I5HB 3H4SE 5D69A 3EK4A 4OVNF 1TN4A 1CKKA 3ZWHA 2WOSA 3PM8A 1M39A 1DJZA 3EK7A 2BAPA 5GQQC 1QLSA 1CM4A 1JFJA 2LLUA 4N1FA 2AAOA 4L9MA 1JWDA 1KWOB 2KHNA 5DKNA 4GGFA 2M1KB 2WCBA 1H8BA 5D3OA 2WCJA 2BE6A 4C0KA 4JWQA 5HYDA 1YRTB 3C1VA 4QJ4B 3PM2A 1WRZA 1FBVA 2D8NA 2MRDA 4OCIA 2I18A 4MZJA 2FJYA 1B9AA 1GGZA 1IQ3A 2L2EA 3S0BA 2P71A 1KSOA 1YUUA 1KK7Z 1S5GZ 1K2HA 2MHHA 1C3ZA 3B88A 4YI9A 1R6PA 1Y1UA 1EL4A 2H2KA 1OW4A 2JZIA 1DVIA 3CGAA 2L5XB 1M63B 1IQ5A 1M45A 1DTLA 1MXLC 1SBJA 2QACA 1SKTA 4ETOA 3GOFA 2JT3A 1NSHA 1WLZA 4CLNA 3DY9A 2JPOA 1XA5A 4YGEB 1GM0A 3DXLA 1K8UA 1PSRA 5CSFA 1R2UA 2K8MB 5AEQA 1YUTA 2BKHB 2KNEA 3PN7B 4GGFC 3BUMB 2ZRTA 2K2FA 5DICA 4ZCVA 1XYDA 2ISDA 5DKRA 1K9UA 1U5IB 2BBMA 1AK8A 1OMVA 1RJVA 1SL8A 1JUOA 1XK4C 1LVCD 2LMVA 3OBVA 4OZDA 3TDUA 4CIDA 2V53A 3QMEA 3SG5A 3SG2A 2I7AA 3SG3A 4AOMA 2WCHA 1PALA 1WY9A 1KQMC 2LANA 4TNCA 1B8RA 1AP4A 3CZ2A 2LP3A 3BJHA 4ZCUA 1SPYA 4YGAA 1W7JB 1SR6B 3SIBA 2QEHA 3B6XA 1LINA 5PALA 1G8IA 1J1EA 1DF0B 2BCXA 1EJ3A 1QV1A 1RWYA 1WRLA 2LAPA 2CNPA 3L4AA 4USLA 3O4YA 2HF5A 3AAJA 2K7OA 5I2OA 3O4XA 3LK0A 4MLWA 1CNPA 1J1DA 2EC6C 4YI8A 3KPXA 5G08A 1C7VA 1AJ4A 1IGVA 1MHOA 2LUXA 2M29A 2Y1MA 3EKHA 4MN0A 4MZLA 3VRPA 2M7LA 1EG4A 3EVRA 3CS1A 1SCMB 1Y1AA 2AMIA 2ERBA 2KI6D 2L4IA 2SCPA 1QV0A 2WCLA 2JWWA 2H61A 2PQLA 3E3RA 1GGWA 3S0AA 2LC5A 1OZOA 1LA0A 4QJ3B 1TCFA 1Z4HA 3S0EA 3SJSA 5KU1A 2OPOA 1QX5B 1XFYO 2JU0A 3UO9A 3JVTB 1UURA 5I2LA 1QJTA 1RECA 1UHKA 3FWCA 2KAYA 4OR9B 4MSPA 2KPHA 4ORCB 3HX4A 5ER5A 1S6JA 3EG5B 5I2QA 2HQWA 3RLZA 3D0YB 3VROA 3BUNB 1A2XA 3K1EA 4PE4A 2KAVA 3R1PA 3ZNIA 1S6IA 4WRIA 1MR8A 2QEVA 3KO0A 1D1OA 4AQJA 3TUYC 1L7ZA 3F45A 2KBIA 1ORGA 3R1OA 2LM5A 3BOWB 1TWOA 4C0JA 1CMGA 4MEWA 1CDLA 5F6TA 3S0GA 2F3ZA 1DJIA 1PULA 2L0PA 1EG3A 1Y1XA 2OS8B 1MQ1A 4KYNA 2GGZA 1YRUB 3OX6A 1B8LA 4F7FA 1B1GA 3NSOA 3R72A 1A75A 5J3XA 3CR5X 2ZKMX 5D7FA 2JQ6A 5JOLA 3SS3A 3PJIA 1KSMA 1B8CA 1F70A 4JQ0D 2WCFA 4ORBB 2M8UA 3FE8A 3GK4X 4ORAB 3RM1A 1S3PA 1J7OA 2FCEA 1BG1A 4BY4A 1K94A 2LVKA 3PFVA 2B1UA 4OV2A 5HL1A 2MLEC 2EHBA 1OMDA 1DGUA 3D10A 3DYEA 1GQMA 4I5KA 1SYMA 1BLQA 1IRJA 1P28A 1SCVA 1M31A 1X02A 2CCMA 3BFAA 1CDNA 1A4PA 3KHEA 1QX2A 4M2PA 1WRKA 3TDZA 1XFWO 2FCDA 1JBAA 2WC6A 4MVFA 4DRWA 2F8PA 1W9ZA 4WQ3A 1QVIY 3PATA 1DJYA 3PALA 2LE9B 2LP2A 1M46A 1CB1A 2WC5A 2KQ6A 3WHUB 1QWVA 3B7AA 1DGVA 2FJUB 3DF0B 3OX5A 4NDDA 2M9GA 4JD9A 5K89A 1PVBA 1OOJA 2L5YA 1LKJA 4YGCB 5HLVA 5JJGA 1BF5A 4AQIA 1UHJA 3NGVA 1AHRA 1QLKA 4DS7A 4YBHB 4FTGA 3VRQA 1RTP1 1ZMZA 2Y5IA 1TUZA 1TNXA 2P70A 1FI6A 1B47A 2CT9A 2ZN9A 1MXEA 2JRFA 4FQOA 4GUKA 2H8VA 1JSAA 2RGIA 2JNFA 2JXLA 2LUCA 3CZTX 1QIVA 4UPGA 3D78A 3FS7A 3LK1A 1NCYA 3O6BA 4GAOA 2MLFC 3GK2A 1TNPA 1NIWA 3SG4A 1OQPA 1WLMA 1NPQA 1V1FA 1S36A 1U5IA 2G2BA 1ZUZA 1TNQA 1CMFA 3HCMA 4ICBA 3TDIA 4Q04A 1F4QA 2O5GA 4NQGA 5CSJA 1KQMB 3CZ1A 1BOCA 3VGOA 3B87A 2NCPA 1NYAA 3TZ1A 2YGUA 4N1GA 1E8AA 4PHKA 2LLSA 1DF0A 1DELA 1S26D 1N65A 3SIAA 2ZN8A 3OGNA 2WORA 1QX7A 5AFPA 1A03A 1K9PA 2JTTA 2O60A 1EH2A 2JC2A 2LHIA 2PYQA 2OTGC 2EC6B 2P6BB 1SMGA 4JPZB 1CM1A 3EVUA 2KGRA 3NSKA 1NUBA 3SG6A 1DEKA 3TS5C 3GK1A 3FE9A 3WXAA 2JULA 2BKIB 5DKQA 2M3WA 3BXKA 1AVSA 2LVVA 1J7QA 1TTXA 3JTDC 3PN7C 4GGNA 1MWNA 4WQ2A 2L4HA 3LCPC 2BCBA 4PE7A 1K95A 3SG7A 1SSEB 1KFUL 1TNWA 4CFRA 3EK8A 4PHNA 4DCKA 1J7PA 1WDCC 1KK7Y 2LNKA 1BR4B 4MRYA 1IKUA 1F71A 5BPJA 2LHLA 1TUJA 3RZSA 1YX7A 1L2OC 2ZRSA 3D0YA 1KCYA 3BFHA 3BUXB 1CFDA 2K0JA 2WC8A 2JPTA 3BUOB 1T14A 4NDCA 1NCXA 3TUYB 2LMTA 1KFUS 3L4LA 3BUWB 2GTEA 3BOWA 1SRAA 3I5FC 2NZ0A 2K7DA 5AERA 3D74A 1CDPA 5HKWA 3D73A 3O2PA 1PRWA 3EKJA 3I5GB 4FQTA 1TIZA 2F3YA 2QEBA 1UUSA 2K60A 1CLMA 1OSAA 3CR4X 1EXRA 1UHNA 1Y6WA 3A8RA 1FI5A 3PLFB 1BJFA 1NX0A 3AKAA 1F55A 1SCMC 5HLOA 1XFXO 1AUIB 1S6CA 1RK9A 1N2DA 1CLLA 2KFHA 2ZFDA 3Q8IA 3OB2B 2PASA 3S0DA 1CFPA 2KFGA 3IF7A 1J55A 1G33A 5HKZA 2MBXA 1YVLA 2WNDA 3SS5A 1FW4A 2H61C 2HQ8A 3DD4A 1YTZC 1OOGA 3JVTC 1ALWA 3NSIA 4CPVA 2KI4B 3S0FA 1UP5A 1ZOTB 2BE4A 1TRFA 2BNXA 3KEVA 3NHTA 2JT0A 3CTNA 1MUXA 1NX3A 3IQOA 5FI2A 3I5IC 1LS8A 3FWBA 2L98A 3PSRA 3VB1A 1FPWA 2KSPA 4XYNA 1S1EA 1NCZA 1NWDA 2CBLA 3CLNA 4P5OE 3CR2A 2E6WA 2F2OA 2JOJA 2PSRA 2L51A 2BL0C 1MF8B 1FF1A 1IWQA 3DF0A 1DT7B 1QS7A 2M1UA 1QATA 2CXJA 1KK8C 3KF9A 1YUSA 1OOIX 4A4BA 2HETA 5ER4X 1DMOA 2EGDA 2Q4UA 4U8DA 1F8HA 4E68A 4YRUA 1B7TY 4XJKB 3BQ3A 5CSIA 1IIOA 1UHHA 4DIRA 1Y0VH 1SK6D 2JT8A 3FE6A 4PHJA 1QIWA 1JFKA 4HRGA 2KOTA 2A4JA 1JF0A 2WCEA 3LL8B 3NSLA 3DVMA 3I5HC 1LA3A 1KFXL 2NCOA 2PVBA 2WCKA 3D77A 3CDNA 2M49B 4IJ7A 3OHMB 4JKTA 1DJHA 2KDHA 1TOPA 1K93D 3BFBA 1KWOC 1XK4A 4C0LA 2QEOA 1KFXS 1NX2A 3AKBA 1XFVO 2NXQA 3OB1B 4INXA 1IH0A 4MBEA 4GBAA 1QXPA 4YGDB 4HRHA 4P2YB 1DJWA 2KGBC 4IL1A 5I8NA 3O78A 5EL2A 4PE1A 2IS9A 2LCPA 4BY5A 2LLTA 3A4UB 2KFFA 3OP0A 1OMRA 3CZ0A 3AAKA 2COLB 3IVTA 4PE0A 2OTGB 4GNKB 2MAZA 4HREE 1DJGA 1UWOA 1LXFC 2PALA 2JNXA 4M2OA 1VRKA 3TS5B 3R1VA 4INWA 5HKYA 1YVHA 2DOQA 3SS4A 1F54A 1Q80A 1DJXA 1HT9A 2TN4A 3JTDB 4YGBB 2GGMA 1IG5A 4D1EA 3LLEA 4A4CA 4DUQA 1GJYA 2LVIA 2AUCA 4NDBA 1YURA 4I5NB 1C3YA 2GV5A 1W7IB 1SL7A 3FIAA 1WDCB 4HSZA 5TNCA 2WCMA 3CWGA 1L2OB 3UNWA 1IJ5A 1XO5A 1C7WA 1DC1A 1KQVA 3K21A 3DVJA 3D75A 1K96A 2Q91A 4MZKA 4R1EA 5FI6A 1S5GY 2BECA 2LV7A 4M2QA 1UHIA 3DVEA 1A29A 2PRUA 3I5FB 4GFTA 4QJ5B 1SW8A 4F0ZB 3ICBA 5KTYA 1NX1A 1XFUO 1G4YR 2L50A 5KSZA 1SR6C 2Y4QA 1YR5A 1CTRA 2KAXA 1BMOA 3NHIA 4PHMA 5AXIA 3VRNA 4N5XA 1ZFSA 1XVJA 4PCWA 2G9BA 1XFZO 5I94A 2KQYA 2HPSA 1JC2A 4GPLB 4PT1A 2MJWB 1QVIZ 2M0RA 5FI7A 2SASA 5B8IB 4CFQA 2JXCA 2KYFA 1XFRA 1YX8A 1CLBA 4OKHA 3M0WA 2KBMA 4PALA 1F4OA 1ZACA 2LMUA 3N7HA 1BR1B 1AJ5A 3BYAA 1B7TZ 1JF2A 2E30A 1SL9A 2KLEA 3QRXA 1OE9B 2PMYA 1B4CA 2ZNEA 3B86A 1BU3A 3DZTA 4PDZA 1PSBA 3L47A 1PK0D 5FYXA 1OOHA 2VRGA 3IQQA 1CDMA 1N0YA 4I5LB 1ODBA 1OZSA 2F33A 1Z2CB 2I94A 3I5IB 1BODA 1DQEA 1SNLA 5IBWA 3I5GC 2KI6C 2JTZA 2Y1NA 3EVVA 1TCOB 3D76A 2KYCA 2BL0B 1CFCA 1C07A 2QDIA 2QPTA 2CTNA 2LVJA 2R2IA 1H4BA 2OS8C 2K61A 2K7CA
chains in the Genus database with same CATH topology
1KK8B 2BBNA 2MA2A 2ZNDA 3NXAA 5CPVA 1QASA 2K7BA 3MSEB 2FOTA 2NLNA 1A75B 1ALVA 2BCAA 5CSNA 1RROA 1J7RA 1K90D 1RFJA 2F2PA 1QTXA 4XJKA 1PVAA 2M7NA 1NP8A 1IJ6A 1K9KA 3WNXB 1V1GA 2KI4C 1CFFA 2I2RE 3WHTB 2K2AA 1BT6A 3VRRA 5AANA 1SY9A 4MRXA 3DVKA 1HQVA 4I5JA 2M97A 3I5HB 3H4SE 5D69A 3EK4A 4OVNF 1TN4A 1CKKA 3ZWHA 2WOSA 3PM8A 1M39A 1DJZA 3EK7A 5GQQC 1QLSA 1CM4A 1JFJA 2LLUA 4N1FA 2AAOA 4L9MA 1JWDA 1KWOB 2KHNA 5DKNA 4GGFA 2M1KB 2WCBA 1H8BA 2BE6A 4C0KA 4JWQA 5HYDA 1YRTB 3C1VA 4QJ4B 1WRZA 1FBVA 2D8NA 2MRDA 4OCIA 2I18A 4MZJA 1B9AA 1GGZA 1IQ3A 2L2EA 1KSOA 1YUUA 1KK7Z 1S5GZ 1K2HA 2MHHA 4YI9A 1R6PA 1Y1UA 1EL4A 2H2KA 2JZIA 1DVIA 3CGAA 2L5XB 1M63B 1IQ5A 1M45A 1DTLA 1MXLC 1SBJA 2QACA 1SKTA 4ETOA 3GOFA 2JT3A 1NSHA 1WLZA 4CLNA 1XA5A 4YGEB 1K8UA 1PSRA 5CSFA 1R2UA 2K8MB 5AEQA 1YUTA 2BKHB 2KNEA 3PN7B 4GGFC 3BUMB 2ZRTA 2K2FA 4ZCVA 1XYDA 2ISDA 5DKRA 1K9UA 1U5IB 2BBMA 1AK8A 1OMVA 1RJVA 1SL8A 1JUOA 1XK4C 1LVCD 2LMVA 4CIDA 3TDUA 2V53A 3SG5A 3SG2A 2I7AA 3SG3A 4AOMA 1PALA 1WY9A 1KQMC 2LANA 4TNCA 1B8RA 1AP4A 2LP3A 4ZCUA 1SPYA 4YGAA 1W7JB 1SR6B 3SIBA 1LINA 5PALA 1G8IA 1J1EA 1DF0B 2BCXA 1EJ3A 1QV1A 1RWYA 1WRLA 2LAPA 2CNPA 4USLA 3O4YA 2HF5A 3AAJA 2K7OA 5I2OA 3LK0A 4MLWA 1CNPA 1J1DA 2EC6C 4YI8A 3KPXA 5G08A 1C7VA 1AJ4A 1IGVA 1MHOA 2LUXA 2M29A 2Y1MA 3EKHA 4MN0A 4MZLA 3VRPA 2M7LA 1EG4A 3EVRA 3CS1A 1SCMB 1Y1AA 2AMIA 2KI6D 2L4IA 2SCPA 1QV0A 2JWWA 2H61A 3E3RA 1GGWA 2LC5A 1OZOA 1LA0A 4QJ3B 1TCFA 5KU1A 3SJSA 2OPOA 1QX5B 1XFYO 2JU0A 3JVTB 1UURA 5I2LA 1QJTA 1RECA 1UHKA 3FWCA 2KAYA 4OR9B 4MSPA 4ORCB 3HX4A 5ER5A 1S6JA 5I2QA 2HQWA 3RLZA 3D0YB 3VROA 3BUNB 1A2XA 4PE4A 2KAVA 3ZNIA 1S6IA 4WRIA 1MR8A 1D1OA 3KO0A 4AQJA 3TUYC 1L7ZA 3F45A 2KBIA 2LM5A 3BOWB 4C0JA 1CMGA 4MEWA 1CDLA 5F6TA 2F3ZA 1DJIA 1PULA 2L0PA 1EG3A 1Y1XA 2OS8B 1MQ1A 2GGZA 1YRUB 3OX6A 1B8LA 1B1GA 3NSOA 1A75A 5J3XA 3CR5X 2ZKMX 5D7FA 2JQ6A 5JOLA 1KSMA 1B8CA 1F70A 4JQ0D 2WCFA 4ORBB 2M8UA 3GK4X 4ORAB 3RM1A 1S3PA 1J7OA 2FCEA 1BG1A 4BY4A 1K94A 2LVKA 3PFVA 2B1UA 4OV2A 2MLEC 2EHBA 1OMDA 1DGUA 3D10A 1GQMA 4I5KA 1SYMA 1BLQA 1IRJA 1SCVA 1X02A 1M31A 2CCMA 1CDNA 1A4PA 3KHEA 1QX2A 4M2PA 1WRKA 3TDZA 1XFWO 2FCDA 1JBAA 4MVFA 4DRWA 2F8PA 4WQ3A 1QVIY 3PATA 1DJYA 3PALA 2LE9B 2LP2A 1M46A 1CB1A 2KQ6A 3WHUB 1DGVA 2FJUB 3DF0B 3OX5A 4NDDA 2M9GA 5K89A 1PVBA 1OOJA 4YGCB 1LKJA 5HLVA 5JJGA 1BF5A 4AQIA 1UHJA 1AHRA 1QLKA 4DS7A 4YBHB 4FTGA 3VRQA 1RTP1 1ZMZA 2Y5IA 1TNXA 1FI6A 1B47A 2CT9A 2ZN9A 1MXEA 2JRFA 4FQOA 4GUKA 1JSAA 2RGIA 2JNFA 2JXLA 2LUCA 3CZTX 1QIVA 4UPGA 3FS7A 3LK1A 1NCYA 3O6BA 4GAOA 2MLFC 3GK2A 1TNPA 1NIWA 3SG4A 1OQPA 1WLMA 1NPQA 1V1FA 1S36A 1U5IA 2G2BA 1ZUZA 1TNQA 1CMFA 3HCMA 4ICBA 3TDIA 4Q04A 1F4QA 2O5GA 4NQGA 5CSJA 1KQMB 1BOCA 3VGOA 2NCPA 1NYAA 3TZ1A 4N1GA 1E8AA 4PHKA 2LLSA 1DF0A 1S26D 1N65A 3SIAA 2ZN8A 5AFPA 2WORA 1QX7A 1A03A 1K9PA 2JTTA 2O60A 1EH2A 2JC2A 2LHIA 2OTGC 2EC6B 2P6BB 1SMGA 4JPZB 1CM1A 3EVUA 2KGRA 3NSKA 1NUBA 3SG6A 3TS5C 3GK1A 3WXAA 2JULA 2BKIB 5DKQA 2M3WA 3BXKA 1AVSA 2LVVA 1J7QA 1TTXA 3JTDC 3PN7C 4GGNA 1MWNA 4WQ2A 2L4HA 3LCPC 2BCBA 4PE7A 1K95A 3SG7A 1KFUL 1TNWA 4CFRA 3EK8A 4PHNA 4DCKA 1J7PA 1WDCC 1KK7Y 2LNKA 1BR4B 4MRYA 1IKUA 1F71A 5BPJA 2LHLA 1YX7A 1L2OC 2ZRSA 3D0YA 1KCYA 3BUXB 1CFDA 2K0JA 2WC8A 2JPTA 3BUOB 4NDCA 1NCXA 3TUYB 2LMTA 1KFUS 3BUWB 3BOWA 1SRAA 3I5FC 2NZ0A 2K7DA 5AERA 1CDPA 5HKWA 3O2PA 1PRWA 3EKJA 3I5GB 1TIZA 2F3YA 1UUSA 1CLMA 1OSAA 3CR4X 1EXRA 1UHNA 1Y6WA 3A8RA 1FI5A 3PLFB 1BJFA 1NX0A 3AKAA 1F55A 1SCMC 5HLOA 1XFXO 1AUIB 1S6CA 1RK9A 1N2DA 1CLLA 2KFHA 2ZFDA 3OB2B 2PASA 1CFPA 2KFGA 3IF7A 1J55A 1G33A 5HKZA 2MBXA 1YVLA 2WNDA 1FW4A 2H61C 2HQ8A 3DD4A 1YTZC 3JVTC 3NSIA 1ALWA 4CPVA 2KI4B 1UP5A 1ZOTB 2BE4A 1TRFA 3KEVA 2JT0A 3CTNA 1MUXA 1NX3A 3IQOA 3I5IC 3FWBA 2L98A 3PSRA 1FPWA 2KSPA 4XYNA 1S1EA 1NCZA 1NWDA 2CBLA 3CLNA 4P5OE 3CR2A 2E6WA 2F2OA 2JOJA 2PSRA 2L51A 2BL0C 1MF8B 1FF1A 1IWQA 3DF0A 1DT7B 1QS7A 2M1UA 1QATA 2CXJA 1KK8C 3KF9A 1YUSA 4A4BA 2HETA 5ER4X 1DMOA 2EGDA 2Q4UA 4U8DA 1F8HA 4E68A 4YRUA 1B7TY 4XJKB 3BQ3A 5CSIA 1UHHA 4DIRA 1Y0VH 1SK6D 2JT8A 4PHJA 1QIWA 1JFKA 4HRGA 2KOTA 2A4JA 1JF0A 2WCEA 3LL8B 3NSLA 3DVMA 3I5HC 1LA3A 1KFXL 2NCOA 2PVBA 2M49B 3OHMB 1DJHA 2KDHA 1TOPA 1K93D 1KWOC 1XK4A 4C0LA 1KFXS 1NX2A 3AKBA 1XFVO 2NXQA 3OB1B 1IH0A 4MBEA 4GBAA 1QXPA 4YGDB 4HRHA 4P2YB 1DJWA 2KGBC 4IL1A 5I8NA 3O78A 4PE1A 2IS9A 2LCPA 4BY5A 2LLTA 3A4UB 2KFFA 3OP0A 1OMRA 3AAKA 2COLB 4PE0A 2OTGB 4GNKB 2MAZA 4HREE 1DJGA 1UWOA 1LXFC 2PALA 2JNXA 4M2OA 1VRKA 3TS5B 5HKYA 1YVHA 2DOQA 1F54A 1Q80A 1DJXA 1HT9A 2TN4A 3JTDB 4YGBB 2GGMA 1IG5A 4D1EA 3LLEA 4A4CA 4DUQA 1GJYA 2LVIA 2AUCA 4NDBA 1YURA 4I5NB 2GV5A 1W7IB 1SL7A 3FIAA 1WDCB 4HSZA 5TNCA 3CWGA 1L2OB 1IJ5A 1XO5A 1C7WA 1KQVA 3K21A 3DVJA 1K96A 2Q91A 4MZKA 4R1EA 1S5GY 2BECA 2LV7A 4M2QA 1UHIA 3DVEA 1A29A 2PRUA 3I5FB 4GFTA 4QJ5B 1SW8A 4F0ZB 3ICBA 5KTYA 1NX1A 1XFUO 1G4YR 2L50A 5KSZA 1SR6C 2Y4QA 1YR5A 1CTRA 2KAXA 1BMOA 5AXIA 4PHMA 3VRNA 4N5XA 1ZFSA 1XVJA 4PCWA 2G9BA 1XFZO 2KQYA 2HPSA 1JC2A 4GPLB 2MJWB 1QVIZ 2M0RA 2SASA 5B8IB 4CFQA 2JXCA 2KYFA 1YX8A 1CLBA 4OKHA 3M0WA 2KBMA 4PALA 1F4OA 1ZACA 2LMUA 1BR1B 1AJ5A 3BYAA 1B7TZ 1JF2A 2E30A 1SL9A 3QRXA 1OE9B 2PMYA 1B4CA 2ZNEA 1BU3A 4PDZA 1PSBA 1PK0D 5FYXA 2VRGA 3IQQA 1CDMA 1N0YA 4I5LB 1ODBA 1OZSA 2F33A 2I94A 3I5IB 1BODA 1SNLA 5IBWA 3I5GC 2KI6C 2JTZA 2Y1NA 3EVVA 1TCOB 1CFCA 2KYCA 2BL0B 1C07A 2QPTA 2CTNA 2LVJA 2R2IA 1H4BA 2OS8C 2K61A 2K7CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KK8 B;  2BBN A;  2MA2 A;  2ZND A;  3NXA A;  5CPV A;  1QAS A;  2K7B A;  3MSE B;  2FOT A;  2NLN A;  1A75 B;  1ALV A;  2BCA A;  5CSN A;  1RRO A;  1J7R A;  1K90 D;  1RFJ A;  2F2P A;  1QTX A;  4XJK A;  1PVA A;  2M7N A;  1NP8 A;  1IJ6 A;  1K9K A;  3WNX B;  1V1G A;  2KI4 C;  1CFF A;  2I2R E;  3WHT B;  2K2A A;  1BT6 A;  3VRR A;  5AAN A;  1SY9 A;  4MRX A;  3DVK A;  1HQV A;  4I5J A;  2M97 A;  3I5H B;  3H4S E;  5D69 A;  3EK4 A;  4OVN F;  1TN4 A;  1CKK A;  3ZWH A;  2WOS A;  3PM8 A;  1M39 A;  1DJZ A;  3EK7 A;  5GQQ C;  1QLS A;  1CM4 A;  1JFJ A;  2LLU A;  4N1F A;  2AAO A;  4L9M A;  1JWD A;  1KWO B;  2KHN A;  5DKN A;  4GGF A;  2M1K B;  2WCB A;  1H8B A;  2BE6 A;  4C0K A;  4JWQ A;  5HYD A;  1YRT B;  3C1V A;  4QJ4 B;  1WRZ A;  1FBV A;  2D8N A;  2MRD A;  4OCI A;  2I18 A;  4MZJ A;  1B9A A;  1GGZ A;  1IQ3 A;  2L2E A;  1KSO A;  1YUU A;  1KK7 Z;  1S5G Z;  1K2H A;  2MHH A;  4YI9 A;  1R6P A;  1Y1U A;  1EL4 A;  2H2K A;  2JZI A;  1DVI A;  3CGA A;  2L5X B;  1M63 B;  1IQ5 A;  1M45 A;  1DTL A;  1MXL C;  1SBJ A;  2QAC A;  1SKT A;  4ETO A;  3GOF A;  2JT3 A;  1NSH A;  1WLZ A;  4CLN A;  1XA5 A;  4YGE B;  1K8U A;  1PSR A;  5CSF A;  1R2U A;  2K8M B;  5AEQ A;  1YUT A;  2BKH B;  2KNE A;  3PN7 B;  4GGF C;  3BUM B;  2ZRT A;  2K2F A;  4ZCV A;  1XYD A;  2ISD A;  5DKR A;  1K9U A;  1U5I B;  2BBM A;  1AK8 A;  1OMV A;  1RJV A;  1SL8 A;  1JUO A;  1XK4 C;  1LVC D;  2LMV A;  4CID A;  3TDU A;  2V53 A;  3SG5 A;  3SG2 A;  2I7A A;  3SG3 A;  4AOM A;  1PAL A;  1WY9 A;  1KQM C;  2LAN A;  4TNC A;  1B8R A;  1AP4 A;  2LP3 A;  4ZCU A;  1SPY A;  4YGA A;  1W7J B;  1SR6 B;  3SIB A;  1LIN A;  5PAL A;  1G8I A;  1J1E A;  1DF0 B;  2BCX A;  1EJ3 A;  1QV1 A;  1RWY A;  1WRL A;  2LAP A;  2CNP A;  4USL A;  3O4Y A;  2HF5 A;  3AAJ A;  2K7O A;  5I2O A;  3LK0 A;  4MLW A;  1CNP A;  1J1D A;  2EC6 C;  4YI8 A;  3KPX A;  5G08 A;  1C7V A;  1AJ4 A;  1IGV A;  1MHO A;  2LUX A;  2M29 A;  2Y1M A;  3EKH A;  4MN0 A;  4MZL A;  3VRP A;  2M7L A;  1EG4 A;  3EVR A;  3CS1 A;  1SCM B;  1Y1A A;  2AMI A;  2KI6 D;  2L4I A;  2SCP A;  1QV0 A;  2JWW A;  2H61 A;  3E3R A;  1GGW A;  2LC5 A;  1OZO A;  1LA0 A;  4QJ3 B;  1TCF A;  5KU1 A;  3SJS A;  2OPO A;  1QX5 B;  1XFY O;  2JU0 A;  3JVT B;  1UUR A;  5I2L A;  1QJT A;  1REC A;  1UHK A;  3FWC A;  2KAY A;  4OR9 B;  4MSP A;  4ORC B;  3HX4 A;  5ER5 A;  1S6J A;  5I2Q A;  2HQW A;  3RLZ A;  3D0Y B;  3VRO A;  3BUN B;  1A2X A;  4PE4 A;  2KAV A;  3ZNI A;  1S6I A;  4WRI A;  1MR8 A;  1D1O A;  3KO0 A;  4AQJ A;  3TUY C;  1L7Z A;  3F45 A;  2KBI A;  2LM5 A;  3BOW B;  4C0J A;  1CMG A;  4MEW A;  1CDL A;  5F6T A;  2F3Z A;  1DJI A;  1PUL A;  2L0P A;  1EG3 A;  1Y1X A;  2OS8 B;  1MQ1 A;  2GGZ A;  1YRU B;  3OX6 A;  1B8L A;  1B1G A;  3NSO A;  1A75 A;  5J3X A;  3CR5 X;  2ZKM X;  5D7F A;  2JQ6 A;  5JOL A;  1KSM A;  1B8C A;  1F70 A;  4JQ0 D;  2WCF A;  4ORB B;  2M8U A;  3GK4 X;  4ORA B;  3RM1 A;  1S3P A;  1J7O A;  2FCE A;  1BG1 A;  4BY4 A;  1K94 A;  2LVK A;  3PFV A;  2B1U A;  4OV2 A;  2MLE C;  2EHB A;  1OMD A;  1DGU A;  3D10 A;  1GQM A;  4I5K A;  1SYM A;  1BLQ A;  1IRJ A;  1SCV A;  1X02 A;  1M31 A;  2CCM A;  1CDN A;  1A4P A;  3KHE A;  1QX2 A;  4M2P A;  1WRK A;  3TDZ A;  1XFW O;  2FCD A;  1JBA A;  4MVF A;  4DRW A;  2F8P A;  4WQ3 A;  1QVI Y;  3PAT A;  1DJY A;  3PAL A;  2LE9 B;  2LP2 A;  1M46 A;  1CB1 A;  2KQ6 A;  3WHU B;  1DGV A;  2FJU B;  3DF0 B;  3OX5 A;  4NDD A;  2M9G A;  5K89 A;  1PVB A;  1OOJ A;  4YGC B;  1LKJ A;  5HLV A;  5JJG A;  1BF5 A;  4AQI A;  1UHJ A;  1AHR A;  1QLK A;  4DS7 A;  4YBH B;  4FTG A;  3VRQ A;  1RTP 1;  1ZMZ A;  2Y5I A;  1TNX A;  1FI6 A;  1B47 A;  2CT9 A;  2ZN9 A;  1MXE A;  2JRF A;  4FQO A;  4GUK A;  1JSA A;  2RGI A;  2JNF A;  2JXL A;  2LUC A;  3CZT X;  1QIV A;  4UPG A;  3FS7 A;  3LK1 A;  1NCY A;  3O6B A;  4GAO A;  2MLF C;  3GK2 A;  1TNP A;  1NIW A;  3SG4 A;  1OQP A;  1WLM A;  1NPQ A;  1V1F A;  1S36 A;  1U5I A;  2G2B A;  1ZUZ A;  1TNQ A;  1CMF A;  3HCM A;  4ICB A;  3TDI A;  4Q04 A;  1F4Q A;  2O5G A;  4NQG A;  5CSJ A;  1KQM B;  1BOC A;  3VGO A;  2NCP A;  1NYA A;  3TZ1 A;  4N1G A;  1E8A A;  4PHK A;  2LLS A;  1DF0 A;  1S26 D;  1N65 A;  3SIA A;  2ZN8 A;  5AFP A;  2WOR A;  1QX7 A;  1A03 A;  1K9P A;  2JTT A;  2O60 A;  1EH2 A;  2JC2 A;  2LHI A;  2OTG C;  2EC6 B;  2P6B B;  1SMG A;  4JPZ B;  1CM1 A;  3EVU A;  2KGR A;  3NSK A;  1NUB A;  3SG6 A;  3TS5 C;  3GK1 A;  3WXA A;  2JUL A;  2BKI B;  5DKQ A;  2M3W A;  3BXK A;  1AVS A;  2LVV A;  1J7Q A;  1TTX A;  3JTD C;  3PN7 C;  4GGN A;  1MWN A;  4WQ2 A;  2L4H A;  3LCP C;  2BCB A;  4PE7 A;  1K95 A;  3SG7 A;  1KFU L;  1TNW A;  4CFR A;  3EK8 A;  4PHN A;  4DCK A;  1J7P A;  1WDC C;  1KK7 Y;  2LNK A;  1BR4 B;  4MRY A;  1IKU A;  1F71 A;  5BPJ A;  2LHL A;  1YX7 A;  1L2O C;  2ZRS A;  3D0Y A;  1KCY A;  3BUX B;  1CFD A;  2K0J A;  2WC8 A;  2JPT A;  3BUO B;  4NDC A;  1NCX A;  3TUY B;  2LMT A;  1KFU S;  3BUW B;  3BOW A;  1SRA A;  3I5F C;  2NZ0 A;  2K7D A;  5AER A;  1CDP A;  5HKW A;  3O2P A;  1PRW A;  3EKJ A;  3I5G B;  1TIZ A;  2F3Y A;  1UUS A;  1CLM A;  1OSA A;  3CR4 X;  1EXR A;  1UHN A;  1Y6W A;  3A8R A;  1FI5 A;  3PLF B;  1BJF A;  1NX0 A;  3AKA A;  1F55 A;  1SCM C;  5HLO A;  1XFX O;  1AUI B;  1S6C A;  1RK9 A;  1N2D A;  1CLL A;  2KFH A;  2ZFD A;  3OB2 B;  2PAS A;  1CFP A;  2KFG A;  3IF7 A;  1J55 A;  1G33 A;  5HKZ A;  2MBX A;  1YVL A;  2WND A;  1FW4 A;  2H61 C;  2HQ8 A;  3DD4 A;  1YTZ C;  3JVT C;  3NSI A;  1ALW A;  4CPV A;  2KI4 B;  1UP5 A;  1ZOT B;  2BE4 A;  1TRF A;  3KEV A;  2JT0 A;  3CTN A;  1MUX A;  1NX3 A;  3IQO A;  3I5I C;  3FWB A;  2L98 A;  3PSR A;  1FPW A;  2KSP A;  4XYN A;  1S1E A;  1NCZ A;  1NWD A;  2CBL A;  3CLN A;  4P5O E;  3CR2 A;  2E6W A;  2F2O A;  2JOJ A;  2PSR A;  2L51 A;  2BL0 C;  1MF8 B;  1FF1 A;  1IWQ A;  3DF0 A;  1DT7 B;  1QS7 A;  2M1U A;  1QAT A;  2CXJ A;  1KK8 C;  3KF9 A;  1YUS A;  4A4B A;  2HET A;  5ER4 X;  1DMO A;  2EGD A;  2Q4U A;  4U8D A;  1F8H A;  4E68 A;  4YRU A;  1B7T Y;  4XJK B;  3BQ3 A;  5CSI A;  1UHH A;  4DIR A;  1Y0V H;  1SK6 D;  2JT8 A;  4PHJ A;  1QIW A;  1JFK A;  4HRG A;  2KOT A;  2A4J A;  1JF0 A;  2WCE A;  3LL8 B;  3NSL A;  3DVM A;  3I5H C;  1LA3 A;  1KFX L;  2NCO A;  2PVB A;  2M49 B;  3OHM B;  1DJH A;  2KDH A;  1TOP A;  1K93 D;  1KWO C;  1XK4 A;  4C0L A;  1KFX S;  1NX2 A;  3AKB A;  1XFV O;  2NXQ A;  3OB1 B;  1IH0 A;  4MBE A;  4GBA A;  1QXP A;  4YGD B;  4HRH A;  4P2Y B;  1DJW A;  2KGB C;  4IL1 A;  5I8N A;  3O78 A;  4PE1 A;  2IS9 A;  2LCP A;  4BY5 A;  2LLT A;  3A4U B;  2KFF A;  3OP0 A;  1OMR A;  3AAK A;  2COL B;  4PE0 A;  2OTG B;  4GNK B;  2MAZ A;  4HRE E;  1DJG A;  1UWO A;  1LXF C;  2PAL A;  2JNX A;  4M2O A;  1VRK A;  3TS5 B;  5HKY A;  1YVH A;  2DOQ A;  1F54 A;  1Q80 A;  1DJX A;  1HT9 A;  2TN4 A;  3JTD B;  4YGB B;  2GGM A;  1IG5 A;  4D1E A;  3LLE A;  4A4C A;  4DUQ A;  1GJY A;  2LVI A;  2AUC A;  4NDB A;  1YUR A;  4I5N B;  2GV5 A;  1W7I B;  1SL7 A;  3FIA A;  1WDC B;  4HSZ A;  5TNC A;  3CWG A;  1L2O B;  1IJ5 A;  1XO5 A;  1C7W A;  1KQV A;  3K21 A;  3DVJ A;  1K96 A;  2Q91 A;  4MZK A;  4R1E A;  1S5G Y;  2BEC A;  2LV7 A;  4M2Q A;  1UHI A;  3DVE A;  1A29 A;  2PRU A;  3I5F B;  4GFT A;  4QJ5 B;  1SW8 A;  4F0Z B;  3ICB A;  5KTY A;  1NX1 A;  1XFU O;  1G4Y R;  2L50 A;  5KSZ A;  1SR6 C;  2Y4Q A;  1YR5 A;  1CTR A;  2KAX A;  1BMO A;  5AXI A;  4PHM A;  3VRN A;  4N5X A;  1ZFS A;  1XVJ A;  4PCW A;  2G9B A;  1XFZ O;  2KQY A;  2HPS A;  1JC2 A;  4GPL B;  2MJW B;  1QVI Z;  2M0R A;  2SAS A;  5B8I B;  4CFQ A;  2JXC A;  2KYF A;  1YX8 A;  1CLB A;  4OKH A;  3M0W A;  2KBM A;  4PAL A;  1F4O A;  1ZAC A;  2LMU A;  1BR1 B;  1AJ5 A;  3BYA A;  1B7T Z;  1JF2 A;  2E30 A;  1SL9 A;  3QRX A;  1OE9 B;  2PMY A;  1B4C A;  2ZNE A;  1BU3 A;  4PDZ A;  1PSB A;  1PK0 D;  5FYX A;  2VRG A;  3IQQ A;  1CDM A;  1N0Y A;  4I5L B;  1ODB A;  1OZS A;  2F33 A;  2I94 A;  3I5I B;  1BOD A;  1SNL A;  5IBW A;  3I5G C;  2KI6 C;  2JTZ A;  2Y1N A;  3EVV A;  1TCO B;  1CFC A;  2KYC A;  2BL0 B;  1C07 A;  2QPT A;  2CTN A;  2LVJ A;  2R2I A;  1H4B A;  2OS8 C;  2K61 A;  2K7C A; 
#chains in the Genus database with same CATH topology
 3CAB A;  1KK8 B;  2BBN A;  2MA2 A;  2ZND A;  3NXA A;  5CPV A;  1QAS A;  3V2L A;  2K7B A;  3MSE B;  2FOT A;  2NLN A;  1A75 B;  2KLD A;  1OOF A;  1ALV A;  2BCA A;  5CSN A;  1RRO A;  1J7R A;  1K90 D;  1RFJ A;  2F2P A;  1QTX A;  4XJK A;  1PVA A;  2M7N A;  1NP8 A;  1IJ6 A;  1K9K A;  3CYZ A;  3WNX B;  1V1G A;  2KI4 C;  1CFF A;  2I2R E;  3WHT B;  2K2A A;  1BT6 A;  3VRR A;  5AAN A;  1SY9 A;  2L2C A;  4MRX A;  3DVK A;  1HQV A;  4I5J A;  2M97 A;  3I5H B;  3H4S E;  5D69 A;  3EK4 A;  4OVN F;  1TN4 A;  1CKK A;  3ZWH A;  2WOS A;  3PM8 A;  1M39 A;  1DJZ A;  3EK7 A;  2BAP A;  5GQQ C;  1QLS A;  1CM4 A;  1JFJ A;  2LLU A;  4N1F A;  2AAO A;  4L9M A;  1JWD A;  1KWO B;  2KHN A;  5DKN A;  4GGF A;  2M1K B;  2WCB A;  1H8B A;  5D3O A;  2WCJ A;  2BE6 A;  4C0K A;  4JWQ A;  5HYD A;  1YRT B;  3C1V A;  4QJ4 B;  3PM2 A;  1WRZ A;  1FBV A;  2D8N A;  2MRD A;  4OCI A;  2I18 A;  4MZJ A;  2FJY A;  1B9A A;  1GGZ A;  1IQ3 A;  2L2E A;  3S0B A;  2P71 A;  1KSO A;  1YUU A;  1KK7 Z;  1S5G Z;  1K2H A;  2MHH A;  1C3Z A;  3B88 A;  4YI9 A;  1R6P A;  1Y1U A;  1EL4 A;  2H2K A;  1OW4 A;  2JZI A;  1DVI A;  3CGA A;  2L5X B;  1M63 B;  1IQ5 A;  1M45 A;  1DTL A;  1MXL C;  1SBJ A;  2QAC A;  1SKT A;  4ETO A;  3GOF A;  2JT3 A;  1NSH A;  1WLZ A;  4CLN A;  3DY9 A;  2JPO A;  1XA5 A;  4YGE B;  1GM0 A;  3DXL A;  1K8U A;  1PSR A;  5CSF A;  1R2U A;  2K8M B;  5AEQ A;  1YUT A;  2BKH B;  2KNE A;  3PN7 B;  4GGF C;  3BUM B;  2ZRT A;  2K2F A;  5DIC A;  4ZCV A;  1XYD A;  2ISD A;  5DKR A;  1K9U A;  1U5I B;  2BBM A;  1AK8 A;  1OMV A;  1RJV A;  1SL8 A;  1JUO A;  1XK4 C;  1LVC D;  2LMV A;  3OBV A;  4OZD A;  3TDU A;  4CID A;  2V53 A;  3QME A;  3SG5 A;  3SG2 A;  2I7A A;  3SG3 A;  4AOM A;  2WCH A;  1PAL A;  1WY9 A;  1KQM C;  2LAN A;  4TNC A;  1B8R A;  1AP4 A;  3CZ2 A;  2LP3 A;  3BJH A;  4ZCU A;  1SPY A;  4YGA A;  1W7J B;  1SR6 B;  3SIB A;  2QEH A;  3B6X A;  1LIN A;  5PAL A;  1G8I A;  1J1E A;  1DF0 B;  2BCX A;  1EJ3 A;  1QV1 A;  1RWY A;  1WRL A;  2LAP A;  2CNP A;  3L4A A;  4USL A;  3O4Y A;  2HF5 A;  3AAJ A;  2K7O A;  5I2O A;  3O4X A;  3LK0 A;  4MLW A;  1CNP A;  1J1D A;  2EC6 C;  4YI8 A;  3KPX A;  5G08 A;  1C7V A;  1AJ4 A;  1IGV A;  1MHO A;  2LUX A;  2M29 A;  2Y1M A;  3EKH A;  4MN0 A;  4MZL A;  3VRP A;  2M7L A;  1EG4 A;  3EVR A;  3CS1 A;  1SCM B;  1Y1A A;  2AMI A;  2ERB A;  2KI6 D;  2L4I A;  2SCP A;  1QV0 A;  2WCL A;  2JWW A;  2H61 A;  2PQL A;  3E3R A;  1GGW A;  3S0A A;  2LC5 A;  1OZO A;  1LA0 A;  4QJ3 B;  1TCF A;  1Z4H A;  3S0E A;  3SJS A;  5KU1 A;  2OPO A;  1QX5 B;  1XFY O;  2JU0 A;  3UO9 A;  3JVT B;  1UUR A;  5I2L A;  1QJT A;  1REC A;  1UHK A;  3FWC A;  2KAY A;  4OR9 B;  4MSP A;  2KPH A;  4ORC B;  3HX4 A;  5ER5 A;  1S6J A;  3EG5 B;  5I2Q A;  2HQW A;  3RLZ A;  3D0Y B;  3VRO A;  3BUN B;  1A2X A;  3K1E A;  4PE4 A;  2KAV A;  3R1P A;  3ZNI A;  1S6I A;  4WRI A;  1MR8 A;  2QEV A;  3KO0 A;  1D1O A;  4AQJ A;  3TUY C;  1L7Z A;  3F45 A;  2KBI A;  1ORG A;  3R1O A;  2LM5 A;  3BOW B;  1TWO A;  4C0J A;  1CMG A;  4MEW A;  1CDL A;  5F6T A;  3S0G A;  2F3Z A;  1DJI A;  1PUL A;  2L0P A;  1EG3 A;  1Y1X A;  2OS8 B;  1MQ1 A;  4KYN A;  2GGZ A;  1YRU B;  3OX6 A;  1B8L A;  4F7F A;  1B1G A;  3NSO A;  3R72 A;  1A75 A;  5J3X A;  3CR5 X;  2ZKM X;  5D7F A;  2JQ6 A;  5JOL A;  3SS3 A;  3PJI A;  1KSM A;  1B8C A;  1F70 A;  4JQ0 D;  2WCF A;  4ORB B;  2M8U A;  3FE8 A;  3GK4 X;  4ORA B;  3RM1 A;  1S3P A;  1J7O A;  2FCE A;  1BG1 A;  4BY4 A;  1K94 A;  2LVK A;  3PFV A;  2B1U A;  4OV2 A;  5HL1 A;  2MLE C;  2EHB A;  1OMD A;  1DGU A;  3D10 A;  3DYE A;  1GQM A;  4I5K A;  1SYM A;  1BLQ A;  1IRJ A;  1P28 A;  1SCV A;  1M31 A;  1X02 A;  2CCM A;  3BFA A;  1CDN A;  1A4P A;  3KHE A;  1QX2 A;  4M2P A;  1WRK A;  3TDZ A;  1XFW O;  2FCD A;  1JBA A;  2WC6 A;  4MVF A;  4DRW A;  2F8P A;  1W9Z A;  4WQ3 A;  1QVI Y;  3PAT A;  1DJY A;  3PAL A;  2LE9 B;  2LP2 A;  1M46 A;  1CB1 A;  2WC5 A;  2KQ6 A;  3WHU B;  1QWV A;  3B7A A;  1DGV A;  2FJU B;  3DF0 B;  3OX5 A;  4NDD A;  2M9G A;  4JD9 A;  5K89 A;  1PVB A;  1OOJ A;  2L5Y A;  1LKJ A;  4YGC B;  5HLV A;  5JJG A;  1BF5 A;  4AQI A;  1UHJ A;  3NGV A;  1AHR A;  1QLK A;  4DS7 A;  4YBH B;  4FTG A;  3VRQ A;  1RTP 1;  1ZMZ A;  2Y5I A;  1TUZ A;  1TNX A;  2P70 A;  1FI6 A;  1B47 A;  2CT9 A;  2ZN9 A;  1MXE A;  2JRF A;  4FQO A;  4GUK A;  2H8V A;  1JSA A;  2RGI A;  2JNF A;  2JXL A;  2LUC A;  3CZT X;  1QIV A;  4UPG A;  3D78 A;  3FS7 A;  3LK1 A;  1NCY A;  3O6B A;  4GAO A;  2MLF C;  3GK2 A;  1TNP A;  1NIW A;  3SG4 A;  1OQP A;  1WLM A;  1NPQ A;  1V1F A;  1S36 A;  1U5I A;  2G2B A;  1ZUZ A;  1TNQ A;  1CMF A;  3HCM A;  4ICB A;  3TDI A;  4Q04 A;  1F4Q A;  2O5G A;  4NQG A;  5CSJ A;  1KQM B;  3CZ1 A;  1BOC A;  3VGO A;  3B87 A;  2NCP A;  1NYA A;  3TZ1 A;  2YGU A;  4N1G A;  1E8A A;  4PHK A;  2LLS A;  1DF0 A;  1DEL A;  1S26 D;  1N65 A;  3SIA A;  2ZN8 A;  3OGN A;  2WOR A;  1QX7 A;  5AFP A;  1A03 A;  1K9P A;  2JTT A;  2O60 A;  1EH2 A;  2JC2 A;  2LHI A;  2PYQ A;  2OTG C;  2EC6 B;  2P6B B;  1SMG A;  4JPZ B;  1CM1 A;  3EVU A;  2KGR A;  3NSK A;  1NUB A;  3SG6 A;  1DEK A;  3TS5 C;  3GK1 A;  3FE9 A;  3WXA A;  2JUL A;  2BKI B;  5DKQ A;  2M3W A;  3BXK A;  1AVS A;  2LVV A;  1J7Q A;  1TTX A;  3JTD C;  3PN7 C;  4GGN A;  1MWN A;  4WQ2 A;  2L4H A;  3LCP C;  2BCB A;  4PE7 A;  1K95 A;  3SG7 A;  1SSE B;  1KFU L;  1TNW A;  4CFR A;  3EK8 A;  4PHN A;  4DCK A;  1J7P A;  1WDC C;  1KK7 Y;  2LNK A;  1BR4 B;  4MRY A;  1IKU A;  1F71 A;  5BPJ A;  2LHL A;  1TUJ A;  3RZS A;  1YX7 A;  1L2O C;  2ZRS A;  3D0Y A;  1KCY A;  3BFH A;  3BUX B;  1CFD A;  2K0J A;  2WC8 A;  2JPT A;  3BUO B;  1T14 A;  4NDC A;  1NCX A;  3TUY B;  2LMT A;  1KFU S;  3L4L A;  3BUW B;  2GTE A;  3BOW A;  1SRA A;  3I5F C;  2NZ0 A;  2K7D A;  5AER A;  3D74 A;  1CDP A;  5HKW A;  3D73 A;  3O2P A;  1PRW A;  3EKJ A;  3I5G B;  4FQT A;  1TIZ A;  2F3Y A;  2QEB A;  1UUS A;  2K60 A;  1CLM A;  1OSA A;  3CR4 X;  1EXR A;  1UHN A;  1Y6W A;  3A8R A;  1FI5 A;  3PLF B;  1BJF A;  1NX0 A;  3AKA A;  1F55 A;  1SCM C;  5HLO A;  1XFX O;  1AUI B;  1S6C A;  1RK9 A;  1N2D A;  1CLL A;  2KFH A;  2ZFD A;  3Q8I A;  3OB2 B;  2PAS A;  3S0D A;  1CFP A;  2KFG A;  3IF7 A;  1J55 A;  1G33 A;  5HKZ A;  2MBX A;  1YVL A;  2WND A;  3SS5 A;  1FW4 A;  2H61 C;  2HQ8 A;  3DD4 A;  1YTZ C;  1OOG A;  3JVT C;  1ALW A;  3NSI A;  4CPV A;  2KI4 B;  3S0F A;  1UP5 A;  1ZOT B;  2BE4 A;  1TRF A;  2BNX A;  3KEV A;  3NHT A;  2JT0 A;  3CTN A;  1MUX A;  1NX3 A;  3IQO A;  5FI2 A;  3I5I C;  1LS8 A;  3FWB A;  2L98 A;  3PSR A;  3VB1 A;  1FPW A;  2KSP A;  4XYN A;  1S1E A;  1NCZ A;  1NWD A;  2CBL A;  3CLN A;  4P5O E;  3CR2 A;  2E6W A;  2F2O A;  2JOJ A;  2PSR A;  2L51 A;  2BL0 C;  1MF8 B;  1FF1 A;  1IWQ A;  3DF0 A;  1DT7 B;  1QS7 A;  2M1U A;  1QAT A;  2CXJ A;  1KK8 C;  3KF9 A;  1YUS A;  1OOI X;  4A4B A;  2HET A;  5ER4 X;  1DMO A;  2EGD A;  2Q4U A;  4U8D A;  1F8H A;  4E68 A;  4YRU A;  1B7T Y;  4XJK B;  3BQ3 A;  5CSI A;  1IIO A;  1UHH A;  4DIR A;  1Y0V H;  1SK6 D;  2JT8 A;  3FE6 A;  4PHJ A;  1QIW A;  1JFK A;  4HRG A;  2KOT A;  2A4J A;  1JF0 A;  2WCE A;  3LL8 B;  3NSL A;  3DVM A;  3I5H C;  1LA3 A;  1KFX L;  2NCO A;  2PVB A;  2WCK A;  3D77 A;  3CDN A;  2M49 B;  4IJ7 A;  3OHM B;  4JKT A;  1DJH A;  2KDH A;  1TOP A;  1K93 D;  3BFB A;  1KWO C;  1XK4 A;  4C0L A;  2QEO A;  1KFX S;  1NX2 A;  3AKB A;  1XFV O;  2NXQ A;  3OB1 B;  4INX A;  1IH0 A;  4MBE A;  4GBA A;  1QXP A;  4YGD B;  4HRH A;  4P2Y B;  1DJW A;  2KGB C;  4IL1 A;  5I8N A;  3O78 A;  5EL2 A;  4PE1 A;  2IS9 A;  2LCP A;  4BY5 A;  2LLT A;  3A4U B;  2KFF A;  3OP0 A;  1OMR A;  3CZ0 A;  3AAK A;  2COL B;  3IVT A;  4PE0 A;  2OTG B;  4GNK B;  2MAZ A;  4HRE E;  1DJG A;  1UWO A;  1LXF C;  2PAL A;  2JNX A;  4M2O A;  1VRK A;  3TS5 B;  3R1V A;  4INW A;  5HKY A;  1YVH A;  2DOQ A;  3SS4 A;  1F54 A;  1Q80 A;  1DJX A;  1HT9 A;  2TN4 A;  3JTD B;  4YGB B;  2GGM A;  1IG5 A;  4D1E A;  3LLE A;  4A4C A;  4DUQ A;  1GJY A;  2LVI A;  2AUC A;  4NDB A;  1YUR A;  4I5N B;  1C3Y A;  2GV5 A;  1W7I B;  1SL7 A;  3FIA A;  1WDC B;  4HSZ A;  5TNC A;  2WCM A;  3CWG A;  1L2O B;  3UNW A;  1IJ5 A;  1XO5 A;  1C7W A;  1DC1 A;  1KQV A;  3K21 A;  3DVJ A;  3D75 A;  1K96 A;  2Q91 A;  4MZK A;  4R1E A;  5FI6 A;  1S5G Y;  2BEC A;  2LV7 A;  4M2Q A;  1UHI A;  3DVE A;  1A29 A;  2PRU A;  3I5F B;  4GFT A;  4QJ5 B;  1SW8 A;  4F0Z B;  3ICB A;  5KTY A;  1NX1 A;  1XFU O;  1G4Y R;  2L50 A;  5KSZ A;  1SR6 C;  2Y4Q A;  1YR5 A;  1CTR A;  2KAX A;  1BMO A;  3NHI A;  4PHM A;  5AXI A;  3VRN A;  4N5X A;  1ZFS A;  1XVJ A;  4PCW A;  2G9B A;  1XFZ O;  5I94 A;  2KQY A;  2HPS A;  1JC2 A;  4GPL B;  4PT1 A;  2MJW B;  1QVI Z;  2M0R A;  5FI7 A;  2SAS A;  5B8I B;  4CFQ A;  2JXC A;  2KYF A;  1XFR A;  1YX8 A;  1CLB A;  4OKH A;  3M0W A;  2KBM A;  4PAL A;  1F4O A;  1ZAC A;  2LMU A;  3N7H A;  1BR1 B;  1AJ5 A;  3BYA A;  1B7T Z;  1JF2 A;  2E30 A;  1SL9 A;  2KLE A;  3QRX A;  1OE9 B;  2PMY A;  1B4C A;  2ZNE A;  3B86 A;  1BU3 A;  3DZT A;  4PDZ A;  1PSB A;  3L47 A;  1PK0 D;  5FYX A;  1OOH A;  2VRG A;  3IQQ A;  1CDM A;  1N0Y A;  4I5L B;  1ODB A;  1OZS A;  2F33 A;  1Z2C B;  2I94 A;  3I5I B;  1BOD A;  1DQE A;  1SNL A;  5IBW A;  3I5G C;  2KI6 C;  2JTZ A;  2Y1N A;  3EVV A;  1TCO B;  3D76 A;  2KYC A;  2BL0 B;  1CFC A;  1C07 A;  2QDI A;  2QPT A;  2CTN A;  2LVJ A;  2R2I A;  1H4B A;  2OS8 C;  2K61 A;  2K7C A; 
#chains in the Genus database with same CATH homology
 1KK8 B;  2BBN A;  2MA2 A;  2ZND A;  3NXA A;  5CPV A;  1QAS A;  2K7B A;  3MSE B;  2FOT A;  2NLN A;  1A75 B;  1ALV A;  2BCA A;  5CSN A;  1RRO A;  1J7R A;  1K90 D;  1RFJ A;  2F2P A;  1QTX A;  4XJK A;  1PVA A;  2M7N A;  1NP8 A;  1IJ6 A;  1K9K A;  3WNX B;  1V1G A;  2KI4 C;  1CFF A;  2I2R E;  3WHT B;  2K2A A;  1BT6 A;  3VRR A;  5AAN A;  1SY9 A;  4MRX A;  3DVK A;  1HQV A;  4I5J A;  2M97 A;  3I5H B;  3H4S E;  5D69 A;  3EK4 A;  4OVN F;  1TN4 A;  1CKK A;  3ZWH A;  2WOS A;  3PM8 A;  1M39 A;  1DJZ A;  3EK7 A;  5GQQ C;  1QLS A;  1CM4 A;  1JFJ A;  2LLU A;  4N1F A;  2AAO A;  4L9M A;  1JWD A;  1KWO B;  2KHN A;  5DKN A;  4GGF A;  2M1K B;  2WCB A;  1H8B A;  2BE6 A;  4C0K A;  4JWQ A;  5HYD A;  1YRT B;  3C1V A;  4QJ4 B;  1WRZ A;  1FBV A;  2D8N A;  2MRD A;  4OCI A;  2I18 A;  4MZJ A;  1B9A A;  1GGZ A;  1IQ3 A;  2L2E A;  1KSO A;  1YUU A;  1KK7 Z;  1S5G Z;  1K2H A;  2MHH A;  4YI9 A;  1R6P A;  1Y1U A;  1EL4 A;  2H2K A;  2JZI A;  1DVI A;  3CGA A;  2L5X B;  1M63 B;  1IQ5 A;  1M45 A;  1DTL A;  1MXL C;  1SBJ A;  2QAC A;  1SKT A;  4ETO A;  3GOF A;  2JT3 A;  1NSH A;  1WLZ A;  4CLN A;  1XA5 A;  4YGE B;  1K8U A;  1PSR A;  5CSF A;  1R2U A;  2K8M B;  5AEQ A;  1YUT A;  2BKH B;  2KNE A;  3PN7 B;  4GGF C;  3BUM B;  2ZRT A;  2K2F A;  4ZCV A;  1XYD A;  2ISD A;  5DKR A;  1K9U A;  1U5I B;  2BBM A;  1AK8 A;  1OMV A;  1RJV A;  1SL8 A;  1JUO A;  1XK4 C;  1LVC D;  2LMV A;  4CID A;  3TDU A;  2V53 A;  3SG5 A;  3SG2 A;  2I7A A;  3SG3 A;  4AOM A;  1PAL A;  1WY9 A;  1KQM C;  2LAN A;  4TNC A;  1B8R A;  1AP4 A;  2LP3 A;  4ZCU A;  1SPY A;  4YGA A;  1W7J B;  1SR6 B;  3SIB A;  1LIN A;  5PAL A;  1G8I A;  1J1E A;  1DF0 B;  2BCX A;  1EJ3 A;  1QV1 A;  1RWY A;  1WRL A;  2LAP A;  2CNP A;  4USL A;  3O4Y A;  2HF5 A;  3AAJ A;  2K7O A;  5I2O A;  3LK0 A;  4MLW A;  1CNP A;  1J1D A;  2EC6 C;  4YI8 A;  3KPX A;  5G08 A;  1C7V A;  1AJ4 A;  1IGV A;  1MHO A;  2LUX A;  2M29 A;  2Y1M A;  3EKH A;  4MN0 A;  4MZL A;  3VRP A;  2M7L A;  1EG4 A;  3EVR A;  3CS1 A;  1SCM B;  1Y1A A;  2AMI A;  2KI6 D;  2L4I A;  2SCP A;  1QV0 A;  2JWW A;  2H61 A;  3E3R A;  1GGW A;  2LC5 A;  1OZO A;  1LA0 A;  4QJ3 B;  1TCF A;  5KU1 A;  3SJS A;  2OPO A;  1QX5 B;  1XFY O;  2JU0 A;  3JVT B;  1UUR A;  5I2L A;  1QJT A;  1REC A;  1UHK A;  3FWC A;  2KAY A;  4OR9 B;  4MSP A;  4ORC B;  3HX4 A;  5ER5 A;  1S6J A;  5I2Q A;  2HQW A;  3RLZ A;  3D0Y B;  3VRO A;  3BUN B;  1A2X A;  4PE4 A;  2KAV A;  3ZNI A;  1S6I A;  4WRI A;  1MR8 A;  1D1O A;  3KO0 A;  4AQJ A;  3TUY C;  1L7Z A;  3F45 A;  2KBI A;  2LM5 A;  3BOW B;  4C0J A;  1CMG A;  4MEW A;  1CDL A;  5F6T A;  2F3Z A;  1DJI A;  1PUL A;  2L0P A;  1EG3 A;  1Y1X A;  2OS8 B;  1MQ1 A;  2GGZ A;  1YRU B;  3OX6 A;  1B8L A;  1B1G A;  3NSO A;  1A75 A;  5J3X A;  3CR5 X;  2ZKM X;  5D7F A;  2JQ6 A;  5JOL A;  1KSM A;  1B8C A;  1F70 A;  4JQ0 D;  2WCF A;  4ORB B;  2M8U A;  3GK4 X;  4ORA B;  3RM1 A;  1S3P A;  1J7O A;  2FCE A;  1BG1 A;  4BY4 A;  1K94 A;  2LVK A;  3PFV A;  2B1U A;  4OV2 A;  2MLE C;  2EHB A;  1OMD A;  1DGU A;  3D10 A;  1GQM A;  4I5K A;  1SYM A;  1BLQ A;  1IRJ A;  1SCV A;  1X02 A;  1M31 A;  2CCM A;  1CDN A;  1A4P A;  3KHE A;  1QX2 A;  4M2P A;  1WRK A;  3TDZ A;  1XFW O;  2FCD A;  1JBA A;  4MVF A;  4DRW A;  2F8P A;  4WQ3 A;  1QVI Y;  3PAT A;  1DJY A;  3PAL A;  2LE9 B;  2LP2 A;  1M46 A;  1CB1 A;  2KQ6 A;  3WHU B;  1DGV A;  2FJU B;  3DF0 B;  3OX5 A;  4NDD A;  2M9G A;  5K89 A;  1PVB A;  1OOJ A;  4YGC B;  1LKJ A;  5HLV A;  5JJG A;  1BF5 A;  4AQI A;  1UHJ A;  1AHR A;  1QLK A;  4DS7 A;  4YBH B;  4FTG A;  3VRQ A;  1RTP 1;  1ZMZ A;  2Y5I A;  1TNX A;  1FI6 A;  1B47 A;  2CT9 A;  2ZN9 A;  1MXE A;  2JRF A;  4FQO A;  4GUK A;  1JSA A;  2RGI A;  2JNF A;  2JXL A;  2LUC A;  3CZT X;  1QIV A;  4UPG A;  3FS7 A;  3LK1 A;  1NCY A;  3O6B A;  4GAO A;  2MLF C;  3GK2 A;  1TNP A;  1NIW A;  3SG4 A;  1OQP A;  1WLM A;  1NPQ A;  1V1F A;  1S36 A;  1U5I A;  2G2B A;  1ZUZ A;  1TNQ A;  1CMF A;  3HCM A;  4ICB A;  3TDI A;  4Q04 A;  1F4Q A;  2O5G A;  4NQG A;  5CSJ A;  1KQM B;  1BOC A;  3VGO A;  2NCP A;  1NYA A;  3TZ1 A;  4N1G A;  1E8A A;  4PHK A;  2LLS A;  1DF0 A;  1S26 D;  1N65 A;  3SIA A;  2ZN8 A;  5AFP A;  2WOR A;  1QX7 A;  1A03 A;  1K9P A;  2JTT A;  2O60 A;  1EH2 A;  2JC2 A;  2LHI A;  2OTG C;  2EC6 B;  2P6B B;  1SMG A;  4JPZ B;  1CM1 A;  3EVU A;  2KGR A;  3NSK A;  1NUB A;  3SG6 A;  3TS5 C;  3GK1 A;  3WXA A;  2JUL A;  2BKI B;  5DKQ A;  2M3W A;  3BXK A;  1AVS A;  2LVV A;  1J7Q A;  1TTX A;  3JTD C;  3PN7 C;  4GGN A;  1MWN A;  4WQ2 A;  2L4H A;  3LCP C;  2BCB A;  4PE7 A;  1K95 A;  3SG7 A;  1KFU L;  1TNW A;  4CFR A;  3EK8 A;  4PHN A;  4DCK A;  1J7P A;  1WDC C;  1KK7 Y;  2LNK A;  1BR4 B;  4MRY A;  1IKU A;  1F71 A;  5BPJ A;  2LHL A;  1YX7 A;  1L2O C;  2ZRS A;  3D0Y A;  1KCY A;  3BUX B;  1CFD A;  2K0J A;  2WC8 A;  2JPT A;  3BUO B;  4NDC A;  1NCX A;  3TUY B;  2LMT A;  1KFU S;  3BUW B;  3BOW A;  1SRA A;  3I5F C;  2NZ0 A;  2K7D A;  5AER A;  1CDP A;  5HKW A;  3O2P A;  1PRW A;  3EKJ A;  3I5G B;  1TIZ A;  2F3Y A;  1UUS A;  1CLM A;  1OSA A;  3CR4 X;  1EXR A;  1UHN A;  1Y6W A;  3A8R A;  1FI5 A;  3PLF B;  1BJF A;  1NX0 A;  3AKA A;  1F55 A;  1SCM C;  5HLO A;  1XFX O;  1AUI B;  1S6C A;  1RK9 A;  1N2D A;  1CLL A;  2KFH A;  2ZFD A;  3OB2 B;  2PAS A;  1CFP A;  2KFG A;  3IF7 A;  1J55 A;  1G33 A;  5HKZ A;  2MBX A;  1YVL A;  2WND A;  1FW4 A;  2H61 C;  2HQ8 A;  3DD4 A;  1YTZ C;  3JVT C;  3NSI A;  1ALW A;  4CPV A;  2KI4 B;  1UP5 A;  1ZOT B;  2BE4 A;  1TRF A;  3KEV A;  2JT0 A;  3CTN A;  1MUX A;  1NX3 A;  3IQO A;  3I5I C;  3FWB A;  2L98 A;  3PSR A;  1FPW A;  2KSP A;  4XYN A;  1S1E A;  1NCZ A;  1NWD A;  2CBL A;  3CLN A;  4P5O E;  3CR2 A;  2E6W A;  2F2O A;  2JOJ A;  2PSR A;  2L51 A;  2BL0 C;  1MF8 B;  1FF1 A;  1IWQ A;  3DF0 A;  1DT7 B;  1QS7 A;  2M1U A;  1QAT A;  2CXJ A;  1KK8 C;  3KF9 A;  1YUS A;  4A4B A;  2HET A;  5ER4 X;  1DMO A;  2EGD A;  2Q4U A;  4U8D A;  1F8H A;  4E68 A;  4YRU A;  1B7T Y;  4XJK B;  3BQ3 A;  5CSI A;  1UHH A;  4DIR A;  1Y0V H;  1SK6 D;  2JT8 A;  4PHJ A;  1QIW A;  1JFK A;  4HRG A;  2KOT A;  2A4J A;  1JF0 A;  2WCE A;  3LL8 B;  3NSL A;  3DVM A;  3I5H C;  1LA3 A;  1KFX L;  2NCO A;  2PVB A;  2M49 B;  3OHM B;  1DJH A;  2KDH A;  1TOP A;  1K93 D;  1KWO C;  1XK4 A;  4C0L A;  1KFX S;  1NX2 A;  3AKB A;  1XFV O;  2NXQ A;  3OB1 B;  1IH0 A;  4MBE A;  4GBA A;  1QXP A;  4YGD B;  4HRH A;  4P2Y B;  1DJW A;  2KGB C;  4IL1 A;  5I8N A;  3O78 A;  4PE1 A;  2IS9 A;  2LCP A;  4BY5 A;  2LLT A;  3A4U B;  2KFF A;  3OP0 A;  1OMR A;  3AAK A;  2COL B;  4PE0 A;  2OTG B;  4GNK B;  2MAZ A;  4HRE E;  1DJG A;  1UWO A;  1LXF C;  2PAL A;  2JNX A;  4M2O A;  1VRK A;  3TS5 B;  5HKY A;  1YVH A;  2DOQ A;  1F54 A;  1Q80 A;  1DJX A;  1HT9 A;  2TN4 A;  3JTD B;  4YGB B;  2GGM A;  1IG5 A;  4D1E A;  3LLE A;  4A4C A;  4DUQ A;  1GJY A;  2LVI A;  2AUC A;  4NDB A;  1YUR A;  4I5N B;  2GV5 A;  1W7I B;  1SL7 A;  3FIA A;  1WDC B;  4HSZ A;  5TNC A;  3CWG A;  1L2O B;  1IJ5 A;  1XO5 A;  1C7W A;  1KQV A;  3K21 A;  3DVJ A;  1K96 A;  2Q91 A;  4MZK A;  4R1E A;  1S5G Y;  2BEC A;  2LV7 A;  4M2Q A;  1UHI A;  3DVE A;  1A29 A;  2PRU A;  3I5F B;  4GFT A;  4QJ5 B;  1SW8 A;  4F0Z B;  3ICB A;  5KTY A;  1NX1 A;  1XFU O;  1G4Y R;  2L50 A;  5KSZ A;  1SR6 C;  2Y4Q A;  1YR5 A;  1CTR A;  2KAX A;  1BMO A;  5AXI A;  4PHM A;  3VRN A;  4N5X A;  1ZFS A;  1XVJ A;  4PCW A;  2G9B A;  1XFZ O;  2KQY A;  2HPS A;  1JC2 A;  4GPL B;  2MJW B;  1QVI Z;  2M0R A;  2SAS A;  5B8I B;  4CFQ A;  2JXC A;  2KYF A;  1YX8 A;  1CLB A;  4OKH A;  3M0W A;  2KBM A;  4PAL A;  1F4O A;  1ZAC A;  2LMU A;  1BR1 B;  1AJ5 A;  3BYA A;  1B7T Z;  1JF2 A;  2E30 A;  1SL9 A;  3QRX A;  1OE9 B;  2PMY A;  1B4C A;  2ZNE A;  1BU3 A;  4PDZ A;  1PSB A;  1PK0 D;  5FYX A;  2VRG A;  3IQQ A;  1CDM A;  1N0Y A;  4I5L B;  1ODB A;  1OZS A;  2F33 A;  2I94 A;  3I5I B;  1BOD A;  1SNL A;  5IBW A;  3I5G C;  2KI6 C;  2JTZ A;  2Y1N A;  3EVV A;  1TCO B;  1CFC A;  2KYC A;  2BL0 B;  1C07 A;  2QPT A;  2CTN A;  2LVJ A;  2R2I A;  1H4B A;  2OS8 C;  2K61 A;  2K7C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...