4DS7A

Crystal structure of yeast calmodulin bound to the c-terminal fragment of spindle pole body protein spc110
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
144
structure length
144
Chain Sequence
NLTEEQIAEFKEAFALFDKDNSGSISASELATVMRSLGLSPSEAEVADLMNEIDVDGNHAIEFSEFLALMSRQLKCNDSEQELLEAFKVFDKNGDGLISAAELKHVLTSIGEKLTDAEVDEMLREVSDGSGEINIKQFAALLSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The molecular architecture of the yeast spindle pole body core determined by Bayesian integrative modeling.
pubmed doi rcsb
molecule keywords Calmodulin
molecule tags Protein binding
source organism Kluyveromyces lactis
total genus 50
structure length 144
sequence length 144
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4ds7A02
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4ds7A01
1SYMA 3EKJA 3JTDC 1V1FA 4C0LA 1GGWA 1K8UA 1NIWA 2EC6C 4PDZA 2PSRA 4MZLA 1A29A 1SMGA 1R2UA 1QX5B 2KQYA 2M7NA 1FF1A 2CTNA 3NSLA 1SKTA 2COLB 1SR6C 3WHTB 1AJ4A 1OQPA 2KOTA 2KQ6A 1K96A 5JOLA 1K95A 5ER4X 1SRAA 2PASA 3PFVA 1M45A 1L2OB 3KPXA 1NPQA 1B7TY 2BCAA 1MXEA 4YGAA 4AQJA 1UHIA 3LK1A 2JNXA 2K0JA 4HREE 2K61A 2PVBA 2M1UA 4MEWA 4GFTA 5AXIA 4I5LB 2OTGC 2K2FA 1GJYA 1OZOA 2M9GA 4PHKA 3DVMA 1YX7A 3NSIA 4YRUA 1KFUS 2BE6A 5AFPA 2EC6B 1B7TZ 1CDPA 1PVAA 5HKZA 4N1FA 1WDCC 1GGZA 3CR5X 1WRKA 1IQ3A 1LINA 1TTXA 1NYAA 1YTZC 2NXQA 1MQ1A 1OOJA 1SCMB 1UURA 1YX8A 2GV5A 5KU1A 4MLWA 1XFZO 3PLFB 5HLVA 3SG6A 1JUOA 2KI4C 4C0KA 2LM5A 4PE4A 1A2XA 1S36A 1UHJA 4ETOA 1WLMA 2JULA 2PALA 1KQMC 2MBXA 2JXCA 2AMIA 2E30A 2MRDA 1CB1A 3BUXB 4MRXA 1QV1A 4OV2A 2DOQA 1TOPA 4M2OA 4WQ2A 4AQIA 1DJIA 1BOCA 2OTGB 1RK9A 1CMFA 2KBIA 1QTXA 2ZRTA 1OMRA 3O2PA 1IRJA 3RLZA 2Y1NA 4YGCB 5ER5A 5TNCA 2JC2A 2LAPA 4JWQA 4NDCA 2I18A 2ZKMX 1MF8B 3PN7C 3EVVA 1BT6A 1RTP1 4ORAB 1KK7Y 2I2RE 4JQ0D 3TS5C 1WRLA 3IF7A 1CFPA 3DVJA 1XFWO 5I8NA 1KQMB 3OHMB 2KFGA 2LHIA 3D0YA 1QS7A 1ODBA 1XA5A 1YUTA 1KK7Z 3I5FC 4XJKB 4CIDA 1DF0B 1LA0A 1QLSA 2JXLA 2JRFA 2Y5IA 4GBAA 3TDIA 5CPVA 2NCOA 2PRUA 4DS7A 3SIAA 1IGVA 1CFDA 1DJZA 3O6BA 1YRTB 3KF9A 1A75A 1BJFA 1E8AA 1WLZA 2F2PA 3C1VA 2RGIA 2NZ0A 1BU3A 1NP8A 4WQ3A 1XO5A 1Y1UA 1IWQA 2KYCA 1J55A 2D8NA 2LLSA 2B1UA 2ZFDA 1DJWA 1BLQA 1TCFA 2ZNDA 1M39A 2F33A 3I5FB 4OKHA 1AP4A 2OS8C 3IQQA 1BR4B 2KYFA 1M63B 4M2PA 4A4CA 1SW8A 3SG7A 1MUXA 2MAZA 2L2EA 2ZN8A 5I2LA 3ICBA 1Y6WA 1AHRA 1QATA 3SG3A 1MR8A 1XFYO 4PHMA 1SY9A 4ORCB 1AJ5A 2ZN9A 3DVKA 1JSAA 2LV7A 1DGUA 3BOWB 2KFHA 1KSMA 2L4IA 3SG5A 1BODA 4PHJA 2P6BB 3PM8A 1SK6D 4ICBA 1QVIY 4CFQA 1ALVA 1L2OC 4HSZA 1TNXA 3I5HB 1IQ5A 3VRQA 2CBLA 1CM4A 1FI6A 1DJYA 1TIZA 3EVRA 3I5GC 1F8HA 4QJ4B 1PALA 4MN0A 1LVCD 2LHLA 2ZRSA 5F6TA 4FQOA 4ZCVA 2G9BA 4YGBB 1QVIZ 2LVKA 2OPOA 4XYNA 1VRKA 2KGRA 4GUKA 1IKUA 2GGMA 1JC2A 3PATA 2KI6C 1KFXL 1SCMC 4DUQA 3SJSA 3CTNA 1G8IA 1K94A 3NXAA 3WXAA 1KCYA 3TZ1A 1DJGA 1MXLC 1CKKA 1YRUB 1Q80A 5G08A 1QV0A 1TNQA 2M1KB 1U5IB 2H61C 2M97A 1AK8A 2QACA 3I5GB 2BBNA 4QJ5B 4U8DA 1J7QA 2JTTA 2F3ZA 1OMVA 1K93D 1SBJA 2JT3A 4OVNF 3CR4X 1S5GY 3E3RA 4GGNA 4BY4A 2HPSA 1KWOC 2MLEC 2FOTA 3VGOA 1DJXA 3HCMA 1RECA 1DGVA 2LMTA 5J3XA 1PK0D 4PHNA 1A03A 2IS9A 2LUXA 2KGBC 3CR2A 4MBEA 2H2KA 1IJ6A 3OX6A 2VRGA 2M8UA 3I5IC 1S5GZ 2CXJA 4PCWA 3ZWHA 1YUSA 1PRWA 1ZOTB 2HQWA 4USLA 2Q91A 3GK2A 3GK1A 2WORA 2HQ8A 5BPJA 2L98A 2E6WA 2JWWA 3MSEB 4A4BA 2L5XB 1OSAA 2BCXA 2H61A 3SG2A 3A4UB 5PALA 1KWOB 1B8CA 2FCEA 2LUCA 1KFUL 2MHHA 1HQVA 2KFFA 1QX2A 1CDMA 3KO0A 1F4OA 5DKRA 2MJWB 2LVVA 3EVUA 2LANA 3I5IB 2CNPA 4CLNA 1AVSA 1S3PA 1K9UA 2WOSA 1SNLA 5KTYA 4OR9B 2JU0A 2LCPA 2Y4QA 1YR5A 1IG5A 1UUSA 2JZIA 2KSPA 4FTGA 4GAOA 3LL8B 4I5KA 1CLLA 1CFCA 1NCYA 1KK8B 3NSOA 4I5NB 2O60A 1Y1AA 1CLMA 2BKIB 4P2YB 2L50A 2JOJA 2LC5A 1OE9B 3FIAA 3KHEA 2ISDA 2M3WA 3BUOB 3SIBA 5JJGA 3WNXB 1NUBA 3TUYC 1J7OA 4XJKA 1Y1XA 1OZSA 1DF0A 1JFKA 1XVJA 2BL0B 3CGAA 1NX2A 1QASA 5B8IB 2R2IA 1FPWA 4UPGA 1CDLA 3CLNA 3EK8A 3NSKA 1F55A 1XK4C 2QPTA 4YI9A 1FI5A 5I2QA 2BBMA 1WY9A 4P5OE 2LP3A 3I5HC 3VRPA 2WCEA 1AUIB 1LA3A 2HETA 1DTLA 3BUNB 2FCDA 1CMGA 2BE4A 2M49B 4YI8A 3TUYB 4CFRA 4N5XA 1EL4A 3TDZA 1TNWA 1CNPA 1OMDA 1XFXO 3AAJA 1C7WA 1ZMZA 3OB1B 2L4HA 4GNKB 3GOFA 1M46A 1S6IA 3OX5A 3DF0B 2SASA 1UHKA 2GGZA 4HRGA 1W7JB 5AEQA 2JQ6A 1EXRA 5HLOA 4GGFC 1S1EA 1J7RA 1TCOB 1RJVA 2AAOA 4DRWA 2KAYA 3BOWA 1S6CA 1NX1A 5CSIA 3FS7A 1CFFA 1N2DA 2LMUA 1XK4A 2K7DA 3IQOA 3SG4A 1C07A 2K7OA 1JF0A 1CM1A 1K2HA 2K7CA 1YUUA 4PE0A 2LNKA 1NX0A 4QJ3B 4YGDB 2AUCA 4MZKA 1KFXS 1RROA 1DMOA 1B4CA 2BKHB 2JT0A 3FWBA 1DVIA 1JF2A 3D10A 1EG3A 1XFUO 1KQVA 1PSBA 1D1OA 2NCPA 1S26D 2CCMA 2WC8A 4DCKA 3EK4A 2EHBA 1NCXA 2MLFC 4N1GA 1QLKA 4D1EA 4F0ZB 2KBMA 3O4YA 1ZUZA 1WRZA 4M2QA 4PE7A 2KNEA 1PULA 1JWDA 4GGFA 2I7AA 1LXFC 1EH2A 4HRHA 2L51A 4AOMA 3CZTX 3M0WA 1XFVO 1U5IA 2MA2A 1QIVA 1UHNA 4TNCA 4YGEB 1M31A 1RWYA 3A8RA 1HT9A 1ALWA 1BF5A 2LVJA 1F4QA 4E68A 1DT7B 2JT8A 1B47A 1K9KA 1K9PA 1L7ZA 1QIWA 1EG4A 1TRFA 4MRYA 1J1DA 3EK7A 5CSJA 3AKAA 2K2AA 1YVHA 2JTZA 1YURA 2EGDA 1NCZA 1UHHA 1SCVA 1MHOA 3WHUB 2JNFA 3KEVA 2O5GA 2NLNA 2A4JA 3EKHA 1DJHA 2M0RA 3JTDB 3AAKA 3OP0A 1KK8C 4OCIA 4YBHB 2WCFA 1F71A 5KSZA 2HF5A 1QXPA 1XYDA 1V1GA 3BXKA 4MZJA 2KAXA 2Q4UA 5I2OA 1CLBA 1SR6B 1QX7A 1RFJA 3JVTC 1TN4A 2BL0C 1NWDA 1QJTA 4I5JA 2ZNEA 3FWCA 5AANA 3H4SE 4NDDA 1C7VA 4PE1A 1W7IB 3RM1A 3GK4X 3VRRA 5DKQA 2G2BA 3O78A 4JPZB 1CDNA 2BCBA 5IBWA 1JBAA 2SCPA 3BQ3A 1MWNA 1BR1B 4WRIA 2F8PA 1ZFSA 2LLUA 2L0PA 3CWGA 1H4BA 2FJUB 1F70A 1JFJA 1WDCB 3ZNIA 2M7LA 3K21A 2LP2A 2TN4A 3VRNA 1IH0A 1F54A 2LE9B 3JVTB 1LKJA 5DKNA 3D0YB 2KI4B 5AERA 4IL1A 1N0YA 1J7PA 2KAVA 2BECA 1BMOA 2I94A 5HKWA 3LLEA 1KSOA 1PVBA 1SL9A 3TDUA 4GPLB 4CPVA 2M29A 2WCBA 2WNDA 1A75B 3BUWB 2LVIA 4BY5A 2V53A 4Q04A 4C0JA 2LLTA 1PSRA 5D69A 3QRXA 1BG1A 2KHNA 3PN7B 3BYAA 5D7FA 1N65A 1GQMA 2F2OA 1UP5A 3CS1A 3TS5B 2K8MB 2Y1MA 3OB2B 2F3YA 2LMVA 5CSFA 3BUMB 1ZACA 4L9MA 1R6PA 2KI6D 4DIRA 1K90D 3LCPC 4NQGA 3PSRA 4ORBB 3DF0A 2JPTA 2K7BA 5CSNA 1H8BA 1A4PA 3VROA 5FYXA 4R1EA 1NX3A 1S6JA 1B8LA 1SL7A 5HKYA 1J1EA 1Y0VH 1SL8A 1YVLA 1G33A 3F45A 4MVFA 1IJ5A 4PALA 1G4YR 3AKBA 3DVEA 3LK0A 4MSPA 3DD4A 1EJ3A 2KDHA 2PMYA 1SPYA 1FBVA 4NDBA 1CTRA 5K89A 3HX4A 5HYDA 1X02A 3PALA 2CT9A 1B8RA 1TNPA 1NSHA 2OS8B 1FW4A 5GQQC 1B1GA 4ZCUA 1B9AA 1UWOA
chains in the Genus database with same CATH superfamily
1Z2CB 1SYMA 3EKJA 3JTDC 1V1FA 4C0LA 1GGWA 1GM0A 1K8UA 1NIWA 2EC6C 1SSEB 4PDZA 2PSRA 4MZLA 1A29A 1SMGA 1R2UA 1QX5B 3CABA 2KQYA 2M7NA 1FF1A 2CTNA 3NSLA 1SKTA 2COLB 1SR6C 3D74A 1AJ4A 3WHTB 1OQPA 2KOTA 2KQ6A 1K96A 5JOLA 1K95A 5ER4X 1SRAA 2PASA 3PFVA 1M45A 1L2OB 3KPXA 1NPQA 3R1VA 1B7TY 2BCAA 1MXEA 4YGAA 4AQJA 1UHIA 3LK1A 2JNXA 2K0JA 4HREE 2K61A 2PVBA 2M1UA 4MEWA 4GFTA 5AXIA 3R72A 2OTGC 4I5LB 2K2FA 1GJYA 1OZOA 2M9GA 4PHKA 3DVMA 1YX7A 3NSIA 4YRUA 1KFUS 2BE6A 5AFPA 2EC6B 1B7TZ 1CDPA 1PVAA 3R1OA 4N1FA 1WDCC 1GGZA 3CR5X 1WRKA 5DICA 5HKZA 1LINA 1TTXA 1NYAA 1YTZC 3S0FA 2NXQA 1MQ1A 1OOJA 1SCMB 1UURA 1YX8A 2GV5A 5KU1A 4MLWA 1XFZO 3PLFB 5HLVA 3SG6A 1JUOA 2KI4C 4C0KA 2LM5A 3PJIA 1A2XA 4PE4A 1S36A 1UHJA 4ETOA 1WLMA 2JULA 2PALA 1KQMC 2MBXA 3S0AA 2JXCA 2AMIA 2E30A 2MRDA 1CB1A 3BUXB 4MRXA 1QV1A 4OV2A 2DOQA 1TOPA 4M2OA 4WQ2A 3S0BA 1DJIA 4AQIA 1BOCA 2OTGB 1RK9A 3FE9A 1CMFA 1W9ZA 2KBIA 1C3ZA 1QTXA 1OMRA 2ZRTA 3O2PA 1IRJA 3RLZA 2Y1NA 4YGCB 5ER5A 5TNCA 2JC2A 2LAPA 4JWQA 4NDCA 2I18A 2ZKMX 1MF8B 3PN7C 3EVVA 1BT6A 1RTP1 4ORAB 1KK7Y 2I2RE 4JQ0D 3TS5C 1WRLA 3IF7A 1CFPA 2WC6A 5D3OA 3DVJA 1XFWO 1DQEA 5I8NA 1KQMB 3OHMB 3UNWA 2KFGA 2LHIA 3D0YA 1QS7A 1ODBA 1XA5A 1YUTA 1KK7Z 3B88A 3I5FC 4XJKB 4CIDA 1DF0B 1LA0A 1QLSA 2JXLA 2JRFA 2Y5IA 4GBAA 3TDIA 5CPVA 2NCOA 2PRUA 3R1PA 3UO9A 4DS7A 4JKTA 3SIAA 1IGVA 1CFDA 1DJZA 3O6BA 3OBVA 1YRTB 3S0DA 3KF9A 1A75A 3NGVA 1WLZA 1BJFA 1E8AA 2ERBA 2F2PA 3C1VA 2RGIA 2NZ0A 1BU3A 1NP8A 4WQ3A 2YGUA 1XO5A 1Y1UA 1IWQA 2KYCA 1J55A 2D8NA 2LLSA 2B1UA 2ZFDA 1DJWA 1BLQA 3CZ1A 1TCFA 2ZNDA 1M39A 2WCJA 2F33A 3EG5B 3I5FB 4OKHA 3SS3A 2QEBA 3V2LA 1AP4A 2OS8C 3IQQA 3B86A 1BR4B 2KYFA 1M63B 4M2PA 4A4CA 1SW8A 3SG7A 1MUXA 1XFRA 2MAZA 2L2EA 2ZN8A 5I2LA 3ICBA 4FQTA 1Y6WA 1AHRA 3D77A 1QATA 3SG3A 1MR8A 1XFYO 2H8VA 2KLEA 3O4XA 4PHMA 1SY9A 4ORCB 1AJ5A 2ZN9A 3DVKA 1JSAA 2LV7A 1DGUA 3BOWB 2KFHA 1KSMA 2L4IA 3SG5A 1BODA 4PHJA 2P6BB 3NHTA 3PM8A 1SK6D 4ICBA 1QVIY 4CFQA 1ALVA 1L2OC 2PQLA 4HSZA 1TNXA 3I5HB 1IQ5A 3SS4A 2CBLA 1CM4A 3VRQA 1FI6A 1DJYA 1TIZA 3VB1A 3EVRA 3I5GC 1F8HA 4QJ4B 1PALA 4MN0A 1LVCD 2LHLA 2ZRSA 5F6TA 4FQOA 4ZCVA 2G9BA 4YGBB 1QVIZ 2LVKA 2OPOA 4XYNA 1VRKA 2KGRA 4GUKA 1IKUA 2GGMA 1JC2A 3PATA 5FI6A 2KI6C 1KFXL 1SCMC 4DUQA 3SJSA 3CTNA 1G8IA 1K94A 1ORGA 3NXAA 3DZTA 3WXAA 1KCYA 3TZ1A 1DJGA 1MXLC 1OW4A 1CKKA 1YRUB 1Q80A 5G08A 1QV0A 1TNQA 2KPHA 2M1KB 1U5IB 2H61C 2M97A 1AK8A 2QACA 3I5GB 2BBNA 4QJ5B 4U8DA 1J7QA 2P70A 2JTTA 3FE8A 3FE6A 2F3ZA 1OMVA 1K93D 1SBJA 2JT3A 4OVNF 3CR4X 1S5GY 3E3RA 1P28A 4GGNA 2BNXA 4BY4A 2BAPA 2HPSA 1KWOC 2MLEC 2FOTA 3VGOA 1DJXA 3HCMA 1RECA 1DGVA 2LMTA 5J3XA 5I94A 1PK0D 4PHNA 1A03A 2IS9A 2LUXA 2KGBC 3CR2A 3IVTA 4MBEA 2H2KA 1IJ6A 3OX6A 4F7FA 2VRGA 2M8UA 3I5IC 1S5GZ 2CXJA 4PCWA 5FI7A 3ZWHA 1YUSA 1PRWA 1ZOTB 2HQWA 4USLA 2Q91A 3GK2A 3GK1A 2WORA 2HQ8A 5BPJA 2L98A 2E6WA 2JWWA 3MSEB 4JD9A 4A4BA 2L5XB 1OSAA 2BCXA 3DY9A 2H61A 3L47A 3SG2A 3CZ2A 3A4UB 5PALA 1KWOB 1IQ3A 1B8CA 2FCEA 2LUCA 1KFUL 2MHHA 1HQVA 2KFFA 1T14A 1QX2A 1CDMA 3KO0A 1F4OA 3D78A 5DKRA 2MJWB 2LVVA 3EVUA 2LANA 3I5IB 2CNPA 4CLNA 1AVSA 1S3PA 1K9UA 2WOSA 1SNLA 5KTYA 4OR9B 2JU0A 2LCPA 2Y4QA 1YR5A 1IG5A 1OOFA 1UUSA 2JZIA 2KSPA 4FTGA 3LL8B 4GAOA 4KYNA 4PT1A 4I5KA 1CLLA 3L4AA 1CFCA 3NHIA 1NCYA 1C3YA 1KK8B 3NSOA 2QEVA 4I5NB 2O60A 1Y1AA 1CLMA 2BKIB 4P2YB 2L50A 2JOJA 2LC5A 1OE9B 3FIAA 3KHEA 2ISDA 2M3WA 3BUOB 3SIBA 5JJGA 3WNXB 1NUBA 3TUYC 1J7OA 4XJKA 1Y1XA 1OZSA 1DF0A 1JFKA 1XVJA 2BL0B 3CYZA 3CGAA 1NX2A 1QASA 5B8IB 2R2IA 1FPWA 4UPGA 1CDLA 3DYEA 3CLNA 3EK8A 3NSKA 1F55A 1XK4C 2QPTA 4INXA 4YI9A 1FI5A 5I2QA 2BBMA 1WY9A 4P5OE 2LP3A 3I5HC 1OOIX 3VRPA 2WCEA 1AUIB 1LA3A 2HETA 1DTLA 3BUNB 1DC1A 2FCDA 3B7AA 3SS5A 1CMGA 2BE4A 2M49B 4YI8A 3TUYB 4CFRA 4N5XA 1EL4A 3TDZA 1TNWA 1CNPA 1OMDA 1DELA 1XFXO 3AAJA 1C7WA 1ZMZA 3OB1B 2L4HA 4GNKB 3GOFA 1M46A 1S6IA 3OX5A 3DF0B 2SASA 1UHKA 2GGZA 4HRGA 1W7JB 3DXLA 5AEQA 2JQ6A 2KLDA 1EXRA 5HLOA 4GGFC 1S1EA 1J7RA 1TCOB 1RJVA 2AAOA 4DRWA 2KAYA 3BOWA 1S6CA 1NX1A 5CSIA 3FS7A 2QDIA 1CFFA 1N2DA 2LMUA 1XK4A 2K7DA 2WCMA 3IQOA 3SG4A 1C07A 2K7OA 2PYQA 1JF0A 1CM1A 1K2HA 2K7CA 1YUUA 4PE0A 2LNKA 1NX0A 4QJ3B 4YGDB 1OOGA 2AUCA 4MZKA 1KFXS 1RROA 1DMOA 1B4CA 2BKHB 2JT0A 3FWBA 1DVIA 1JF2A 3D10A 1EG3A 1XFUO 2L5YA 1KQVA 1PSBA 1D1OA 2NCPA 1S26D 2CCMA 2WC8A 4DCKA 3EK4A 3N7HA 2EHBA 3BFBA 1NCXA 2MLFC 4N1GA 1QLKA 4D1EA 4F0ZB 3BFAA 2KBMA 3O4YA 3CDNA 1ZUZA 1WRZA 4M2QA 4PE7A 2KNEA 3S0GA 1PULA 1JWDA 4GGFA 2WC5A 2I7AA 1LXFC 1EH2A 4HRHA 2L51A 4AOMA 3CZTX 3M0WA 1XFVO 1U5IA 2MA2A 1QIVA 1UHNA 4TNCA 4YGEB 1M31A 1RWYA 3A8RA 1HT9A 1ALWA 1BF5A 2LVJA 1F4QA 4E68A 1DT7B 2JT8A 1B47A 1K9KA 1K9PA 1L7ZA 1QIWA 1EG4A 1TRFA 4MRYA 1J1DA 3EK7A 5CSJA 3D75A 3AKAA 2K2AA 1YVHA 2JTZA 3QMEA 1YURA 2EGDA 1NCZA 1UHHA 1SCVA 1MHOA 3WHUB 2JNFA 3KEVA 2O5GA 3BJHA 2NLNA 2A4JA 4OZDA 3EKHA 1DJHA 2M0RA 3JTDB 3AAKA 3OP0A 1KK8C 4OCIA 4YBHB 3BFHA 2WCFA 1F71A 3L4LA 2WCKA 2HF5A 1QXPA 5KSZA 1XYDA 1V1GA 2P71A 3BXKA 4MZJA 2KAXA 2Q4UA 5I2OA 1CLBA 1SR6B 1QX7A 1RFJA 3JVTC 1TN4A 2BL0C 2K60A 1NWDA 1QJTA 4I5JA 2ZNEA 3FWCA 5AANA 3S0EA 3H4SE 4NDDA 1C7VA 4PE1A 1W7IB 3RM1A 3GK4X 3VRRA 5DKQA 2G2BA 3O78A 4JPZB 1CDNA 4INWA 2BCBA 5IBWA 1JBAA 2SCPA 3BQ3A 5FI2A 1MWNA 1BR1B 4WRIA 2F8PA 1ZFSA 2LLUA 2L0PA 3CWGA 3CZ0A 1H4BA 2FJUB 1F70A 1JFJA 1WDCB 3ZNIA 2M7LA 3K21A 2LP2A 2TN4A 3VRNA 1IH0A 1TUZA 3B87A 5EL2A 2LE9B 3JVTB 1F54A 1LKJA 5DKNA 3D0YB 2KI4B 1DEKA 4IJ7A 5AERA 4IL1A 1Z4HA 1N0YA 2GTEA 5HL1A 1J7PA 2KAVA 3OGNA 2BECA 1BMOA 2I94A 5HKWA 3LLEA 1KSOA 1PVBA 1SL9A 3TDUA 4GPLB 4CPVA 1OOHA 2M29A 2WCBA 2WNDA 1A75B 3BUWB 2LVIA 4BY5A 2V53A 4Q04A 4C0JA 2LLTA 1PSRA 5D69A 3QRXA 1BG1A 2KHNA 3PN7B 3BYAA 5D7FA 1N65A 3K1EA 1GQMA 2F2OA 1UP5A 2QEOA 3CS1A 2K8MB 2Y1MA 3D73A 3OB2B 3TS5B 2F3YA 3Q8IA 3D76A 2LMVA 5CSFA 3BUMB 1ZACA 4L9MA 1R6PA 2KI6D 4DIRA 1K90D 3LCPC 4NQGA 3PSRA 2JPOA 4ORBB 1TWOA 3DF0A 2JPTA 2K7BA 5CSNA 1H8BA 1A4PA 3VROA 5FYXA 4R1EA 1LS8A 1NX3A 1S6JA 1B8LA 1SL7A 2QEHA 5HKYA 1J1EA 1Y0VH 1SL8A 1YVLA 1G33A 3B6XA 3F45A 4MVFA 1IJ5A 4PALA 3PM2A 2FJYA 1G4YR 3AKBA 3DVEA 3LK0A 4MSPA 1TUJA 3DD4A 1EJ3A 2KDHA 2PMYA 1SPYA 1FBVA 4NDBA 1IIOA 1CTRA 2WCLA 5K89A 3HX4A 5HYDA 1X02A 3PALA 2CT9A 2L2CA 1B8RA 3RZSA 1QWVA 2WCHA 1TNPA 1NSHA 2OS8B 1FW4A 5GQQC 1B1GA 4ZCUA 1B9AA 1UWOA
chains in the Genus database with same CATH topology
1SYMA 3EKJA 3JTDC 1V1FA 4C0LA 1GGWA 1K8UA 1NIWA 2EC6C 4PDZA 2PSRA 4MZLA 1A29A 1SMGA 1R2UA 1QX5B 2KQYA 2M7NA 1FF1A 2CTNA 3NSLA 1SKTA 2COLB 1SR6C 3WHTB 1AJ4A 1OQPA 2KOTA 2KQ6A 1K96A 5JOLA 1K95A 5ER4X 1SRAA 2PASA 3PFVA 1M45A 1L2OB 3KPXA 1NPQA 1B7TY 2BCAA 1MXEA 4YGAA 4AQJA 1UHIA 3LK1A 2JNXA 2K0JA 4HREE 2K61A 2PVBA 2M1UA 4MEWA 4GFTA 5AXIA 4I5LB 2OTGC 2K2FA 1GJYA 1OZOA 2M9GA 4PHKA 3DVMA 1YX7A 3NSIA 4YRUA 1KFUS 2BE6A 5AFPA 2EC6B 1B7TZ 1CDPA 1PVAA 5HKZA 4N1FA 1WDCC 1GGZA 3CR5X 1WRKA 1IQ3A 1LINA 1TTXA 1NYAA 1YTZC 2NXQA 1MQ1A 1OOJA 1SCMB 1UURA 1YX8A 2GV5A 5KU1A 4MLWA 1XFZO 3PLFB 5HLVA 3SG6A 1JUOA 2KI4C 4C0KA 2LM5A 4PE4A 1A2XA 1S36A 1UHJA 4ETOA 1WLMA 2JULA 2PALA 1KQMC 2MBXA 2JXCA 2AMIA 2E30A 2MRDA 1CB1A 3BUXB 4MRXA 1QV1A 4OV2A 2DOQA 1TOPA 4M2OA 4WQ2A 4AQIA 1DJIA 1BOCA 2OTGB 1RK9A 1CMFA 2KBIA 1QTXA 2ZRTA 1OMRA 3O2PA 1IRJA 3RLZA 2Y1NA 4YGCB 5ER5A 5TNCA 2JC2A 2LAPA 4JWQA 4NDCA 2I18A 2ZKMX 1MF8B 3PN7C 3EVVA 1BT6A 1RTP1 4ORAB 1KK7Y 2I2RE 4JQ0D 3TS5C 1WRLA 3IF7A 1CFPA 3DVJA 1XFWO 5I8NA 1KQMB 3OHMB 2KFGA 2LHIA 3D0YA 1QS7A 1ODBA 1XA5A 1YUTA 1KK7Z 3I5FC 4XJKB 4CIDA 1DF0B 1LA0A 1QLSA 2JXLA 2JRFA 2Y5IA 4GBAA 3TDIA 5CPVA 2NCOA 2PRUA 4DS7A 3SIAA 1IGVA 1CFDA 1DJZA 3O6BA 1YRTB 3KF9A 1A75A 1BJFA 1E8AA 1WLZA 2F2PA 3C1VA 2RGIA 2NZ0A 1BU3A 1NP8A 4WQ3A 1XO5A 1Y1UA 1IWQA 2KYCA 1J55A 2D8NA 2LLSA 2B1UA 2ZFDA 1DJWA 1BLQA 1TCFA 2ZNDA 1M39A 2F33A 3I5FB 4OKHA 1AP4A 2OS8C 3IQQA 1BR4B 2KYFA 1M63B 4M2PA 4A4CA 1SW8A 3SG7A 1MUXA 2MAZA 2L2EA 2ZN8A 5I2LA 3ICBA 1Y6WA 1AHRA 1QATA 3SG3A 1MR8A 1XFYO 4PHMA 1SY9A 4ORCB 1AJ5A 2ZN9A 3DVKA 1JSAA 2LV7A 1DGUA 3BOWB 2KFHA 1KSMA 2L4IA 3SG5A 1BODA 4PHJA 2P6BB 3PM8A 1SK6D 4ICBA 1QVIY 4CFQA 1ALVA 1L2OC 4HSZA 1TNXA 3I5HB 1IQ5A 3VRQA 2CBLA 1CM4A 1FI6A 1DJYA 1TIZA 3EVRA 3I5GC 1F8HA 4QJ4B 1PALA 4MN0A 1LVCD 2LHLA 2ZRSA 5F6TA 4FQOA 4ZCVA 2G9BA 4YGBB 1QVIZ 2LVKA 2OPOA 4XYNA 1VRKA 2KGRA 4GUKA 1IKUA 2GGMA 1JC2A 3PATA 2KI6C 1KFXL 1SCMC 4DUQA 3SJSA 3CTNA 1G8IA 1K94A 3NXAA 3WXAA 1KCYA 3TZ1A 1DJGA 1MXLC 1CKKA 1YRUB 1Q80A 5G08A 1QV0A 1TNQA 2M1KB 1U5IB 2H61C 2M97A 1AK8A 2QACA 3I5GB 2BBNA 4QJ5B 4U8DA 1J7QA 2JTTA 2F3ZA 1OMVA 1K93D 1SBJA 2JT3A 4OVNF 3CR4X 1S5GY 3E3RA 4GGNA 4BY4A 2HPSA 1KWOC 2MLEC 2FOTA 3VGOA 1DJXA 3HCMA 1RECA 1DGVA 2LMTA 5J3XA 1PK0D 4PHNA 1A03A 2IS9A 2LUXA 2KGBC 3CR2A 4MBEA 2H2KA 1IJ6A 3OX6A 2VRGA 2M8UA 3I5IC 1S5GZ 2CXJA 4PCWA 3ZWHA 1YUSA 1PRWA 1ZOTB 2HQWA 4USLA 2Q91A 3GK2A 3GK1A 2WORA 2HQ8A 5BPJA 2L98A 2E6WA 2JWWA 3MSEB 4A4BA 2L5XB 1OSAA 2BCXA 2H61A 3SG2A 3A4UB 5PALA 1KWOB 1B8CA 2FCEA 2LUCA 1KFUL 2MHHA 1HQVA 2KFFA 1QX2A 1CDMA 3KO0A 1F4OA 5DKRA 2MJWB 2LVVA 3EVUA 2LANA 3I5IB 2CNPA 4CLNA 1AVSA 1S3PA 1K9UA 2WOSA 1SNLA 5KTYA 4OR9B 2JU0A 2LCPA 2Y4QA 1YR5A 1IG5A 1UUSA 2JZIA 2KSPA 4FTGA 4GAOA 3LL8B 4I5KA 1CLLA 1CFCA 1NCYA 1KK8B 3NSOA 4I5NB 2O60A 1Y1AA 1CLMA 2BKIB 4P2YB 2L50A 2JOJA 2LC5A 1OE9B 3FIAA 3KHEA 2ISDA 2M3WA 3BUOB 3SIBA 5JJGA 3WNXB 1NUBA 3TUYC 1J7OA 4XJKA 1Y1XA 1OZSA 1DF0A 1JFKA 1XVJA 2BL0B 3CGAA 1NX2A 1QASA 5B8IB 2R2IA 1FPWA 4UPGA 1CDLA 3CLNA 3EK8A 3NSKA 1F55A 1XK4C 2QPTA 4YI9A 1FI5A 5I2QA 2BBMA 1WY9A 4P5OE 2LP3A 3I5HC 3VRPA 2WCEA 1AUIB 1LA3A 2HETA 1DTLA 3BUNB 2FCDA 1CMGA 2BE4A 2M49B 4YI8A 3TUYB 4CFRA 4N5XA 1EL4A 3TDZA 1TNWA 1CNPA 1OMDA 1XFXO 3AAJA 1C7WA 1ZMZA 3OB1B 2L4HA 4GNKB 3GOFA 1M46A 1S6IA 3OX5A 3DF0B 2SASA 1UHKA 2GGZA 4HRGA 1W7JB 5AEQA 2JQ6A 1EXRA 5HLOA 4GGFC 1S1EA 1J7RA 1TCOB 1RJVA 2AAOA 4DRWA 2KAYA 3BOWA 1S6CA 1NX1A 5CSIA 3FS7A 1CFFA 1N2DA 2LMUA 1XK4A 2K7DA 3IQOA 3SG4A 1C07A 2K7OA 1JF0A 1CM1A 1K2HA 2K7CA 1YUUA 4PE0A 2LNKA 1NX0A 4QJ3B 4YGDB 2AUCA 4MZKA 1KFXS 1RROA 1DMOA 1B4CA 2BKHB 2JT0A 3FWBA 1DVIA 1JF2A 3D10A 1EG3A 1XFUO 1KQVA 1PSBA 1D1OA 2NCPA 1S26D 2CCMA 2WC8A 4DCKA 3EK4A 2EHBA 1NCXA 2MLFC 4N1GA 1QLKA 4D1EA 4F0ZB 2KBMA 3O4YA 1ZUZA 1WRZA 4M2QA 4PE7A 2KNEA 1PULA 1JWDA 4GGFA 2I7AA 1LXFC 1EH2A 4HRHA 2L51A 4AOMA 3CZTX 3M0WA 1XFVO 1U5IA 2MA2A 1QIVA 1UHNA 4TNCA 4YGEB 1M31A 1RWYA 3A8RA 1HT9A 1ALWA 1BF5A 2LVJA 1F4QA 4E68A 1DT7B 2JT8A 1B47A 1K9KA 1K9PA 1L7ZA 1QIWA 1EG4A 1TRFA 4MRYA 1J1DA 3EK7A 5CSJA 3AKAA 2K2AA 1YVHA 2JTZA 1YURA 2EGDA 1NCZA 1UHHA 1SCVA 1MHOA 3WHUB 2JNFA 3KEVA 2O5GA 2NLNA 2A4JA 3EKHA 1DJHA 2M0RA 3JTDB 3AAKA 3OP0A 1KK8C 4OCIA 4YBHB 2WCFA 1F71A 5KSZA 2HF5A 1QXPA 1XYDA 1V1GA 3BXKA 4MZJA 2KAXA 2Q4UA 5I2OA 1CLBA 1SR6B 1QX7A 1RFJA 3JVTC 1TN4A 2BL0C 1NWDA 1QJTA 4I5JA 2ZNEA 3FWCA 5AANA 3H4SE 4NDDA 1C7VA 4PE1A 1W7IB 3RM1A 3GK4X 3VRRA 5DKQA 2G2BA 3O78A 4JPZB 1CDNA 2BCBA 5IBWA 1JBAA 2SCPA 3BQ3A 1MWNA 1BR1B 4WRIA 2F8PA 1ZFSA 2LLUA 2L0PA 3CWGA 1H4BA 2FJUB 1F70A 1JFJA 1WDCB 3ZNIA 2M7LA 3K21A 2LP2A 2TN4A 3VRNA 1IH0A 1F54A 2LE9B 3JVTB 1LKJA 5DKNA 3D0YB 2KI4B 5AERA 4IL1A 1N0YA 1J7PA 2KAVA 2BECA 1BMOA 2I94A 5HKWA 3LLEA 1KSOA 1PVBA 1SL9A 3TDUA 4GPLB 4CPVA 2M29A 2WCBA 2WNDA 1A75B 3BUWB 2LVIA 4BY5A 2V53A 4Q04A 4C0JA 2LLTA 1PSRA 5D69A 3QRXA 1BG1A 2KHNA 3PN7B 3BYAA 5D7FA 1N65A 1GQMA 2F2OA 1UP5A 3CS1A 3TS5B 2K8MB 2Y1MA 3OB2B 2F3YA 2LMVA 5CSFA 3BUMB 1ZACA 4L9MA 1R6PA 2KI6D 4DIRA 1K90D 3LCPC 4NQGA 3PSRA 4ORBB 3DF0A 2JPTA 2K7BA 5CSNA 1H8BA 1A4PA 3VROA 5FYXA 4R1EA 1NX3A 1S6JA 1B8LA 1SL7A 5HKYA 1J1EA 1Y0VH 1SL8A 1YVLA 1G33A 3F45A 4MVFA 1IJ5A 4PALA 1G4YR 3AKBA 3DVEA 3LK0A 4MSPA 3DD4A 1EJ3A 2KDHA 2PMYA 1SPYA 1FBVA 4NDBA 1CTRA 5K89A 3HX4A 5HYDA 1X02A 3PALA 2CT9A 1B8RA 1TNPA 1NSHA 2OS8B 1FW4A 5GQQC 1B1GA 4ZCUA 1B9AA 1UWOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SYM A;  3EKJ A;  3JTD C;  1V1F A;  4C0L A;  1GGW A;  1K8U A;  1NIW A;  2EC6 C;  4PDZ A;  2PSR A;  4MZL A;  1A29 A;  1SMG A;  1R2U A;  1QX5 B;  2KQY A;  2M7N A;  1FF1 A;  2CTN A;  3NSL A;  1SKT A;  2COL B;  1SR6 C;  3WHT B;  1AJ4 A;  1OQP A;  2KOT A;  2KQ6 A;  1K96 A;  5JOL A;  1K95 A;  5ER4 X;  1SRA A;  2PAS A;  3PFV A;  1M45 A;  1L2O B;  3KPX A;  1NPQ A;  1B7T Y;  2BCA A;  1MXE A;  4YGA A;  4AQJ A;  1UHI A;  3LK1 A;  2JNX A;  2K0J A;  4HRE E;  2K61 A;  2PVB A;  2M1U A;  4MEW A;  4GFT A;  5AXI A;  4I5L B;  2OTG C;  2K2F A;  1GJY A;  1OZO A;  2M9G A;  4PHK A;  3DVM A;  1YX7 A;  3NSI A;  4YRU A;  1KFU S;  2BE6 A;  5AFP A;  2EC6 B;  1B7T Z;  1CDP A;  1PVA A;  5HKZ A;  4N1F A;  1WDC C;  1GGZ A;  3CR5 X;  1WRK A;  1IQ3 A;  1LIN A;  1TTX A;  1NYA A;  1YTZ C;  2NXQ A;  1MQ1 A;  1OOJ A;  1SCM B;  1UUR A;  1YX8 A;  2GV5 A;  5KU1 A;  4MLW A;  1XFZ O;  3PLF B;  5HLV A;  3SG6 A;  1JUO A;  2KI4 C;  4C0K A;  2LM5 A;  4PE4 A;  1A2X A;  1S36 A;  1UHJ A;  4ETO A;  1WLM A;  2JUL A;  2PAL A;  1KQM C;  2MBX A;  2JXC A;  2AMI A;  2E30 A;  2MRD A;  1CB1 A;  3BUX B;  4MRX A;  1QV1 A;  4OV2 A;  2DOQ A;  1TOP A;  4M2O A;  4WQ2 A;  4AQI A;  1DJI A;  1BOC A;  2OTG B;  1RK9 A;  1CMF A;  2KBI A;  1QTX A;  2ZRT A;  1OMR A;  3O2P A;  1IRJ A;  3RLZ A;  2Y1N A;  4YGC B;  5ER5 A;  5TNC A;  2JC2 A;  2LAP A;  4JWQ A;  4NDC A;  2I18 A;  2ZKM X;  1MF8 B;  3PN7 C;  3EVV A;  1BT6 A;  1RTP 1;  4ORA B;  1KK7 Y;  2I2R E;  4JQ0 D;  3TS5 C;  1WRL A;  3IF7 A;  1CFP A;  3DVJ A;  1XFW O;  5I8N A;  1KQM B;  3OHM B;  2KFG A;  2LHI A;  3D0Y A;  1QS7 A;  1ODB A;  1XA5 A;  1YUT A;  1KK7 Z;  3I5F C;  4XJK B;  4CID A;  1DF0 B;  1LA0 A;  1QLS A;  2JXL A;  2JRF A;  2Y5I A;  4GBA A;  3TDI A;  5CPV A;  2NCO A;  2PRU A;  4DS7 A;  3SIA A;  1IGV A;  1CFD A;  1DJZ A;  3O6B A;  1YRT B;  3KF9 A;  1A75 A;  1BJF A;  1E8A A;  1WLZ A;  2F2P A;  3C1V A;  2RGI A;  2NZ0 A;  1BU3 A;  1NP8 A;  4WQ3 A;  1XO5 A;  1Y1U A;  1IWQ A;  2KYC A;  1J55 A;  2D8N A;  2LLS A;  2B1U A;  2ZFD A;  1DJW A;  1BLQ A;  1TCF A;  2ZND A;  1M39 A;  2F33 A;  3I5F B;  4OKH A;  1AP4 A;  2OS8 C;  3IQQ A;  1BR4 B;  2KYF A;  1M63 B;  4M2P A;  4A4C A;  1SW8 A;  3SG7 A;  1MUX A;  2MAZ A;  2L2E A;  2ZN8 A;  5I2L A;  3ICB A;  1Y6W A;  1AHR A;  1QAT A;  3SG3 A;  1MR8 A;  1XFY O;  4PHM A;  1SY9 A;  4ORC B;  1AJ5 A;  2ZN9 A;  3DVK A;  1JSA A;  2LV7 A;  1DGU A;  3BOW B;  2KFH A;  1KSM A;  2L4I A;  3SG5 A;  1BOD A;  4PHJ A;  2P6B B;  3PM8 A;  1SK6 D;  4ICB A;  1QVI Y;  4CFQ A;  1ALV A;  1L2O C;  4HSZ A;  1TNX A;  3I5H B;  1IQ5 A;  3VRQ A;  2CBL A;  1CM4 A;  1FI6 A;  1DJY A;  1TIZ A;  3EVR A;  3I5G C;  1F8H A;  4QJ4 B;  1PAL A;  4MN0 A;  1LVC D;  2LHL A;  2ZRS A;  5F6T A;  4FQO A;  4ZCV A;  2G9B A;  4YGB B;  1QVI Z;  2LVK A;  2OPO A;  4XYN A;  1VRK A;  2KGR A;  4GUK A;  1IKU A;  2GGM A;  1JC2 A;  3PAT A;  2KI6 C;  1KFX L;  1SCM C;  4DUQ A;  3SJS A;  3CTN A;  1G8I A;  1K94 A;  3NXA A;  3WXA A;  1KCY A;  3TZ1 A;  1DJG A;  1MXL C;  1CKK A;  1YRU B;  1Q80 A;  5G08 A;  1QV0 A;  1TNQ A;  2M1K B;  1U5I B;  2H61 C;  2M97 A;  1AK8 A;  2QAC A;  3I5G B;  2BBN A;  4QJ5 B;  4U8D A;  1J7Q A;  2JTT A;  2F3Z A;  1OMV A;  1K93 D;  1SBJ A;  2JT3 A;  4OVN F;  3CR4 X;  1S5G Y;  3E3R A;  4GGN A;  4BY4 A;  2HPS A;  1KWO C;  2MLE C;  2FOT A;  3VGO A;  1DJX A;  3HCM A;  1REC A;  1DGV A;  2LMT A;  5J3X A;  1PK0 D;  4PHN A;  1A03 A;  2IS9 A;  2LUX A;  2KGB C;  3CR2 A;  4MBE A;  2H2K A;  1IJ6 A;  3OX6 A;  2VRG A;  2M8U A;  3I5I C;  1S5G Z;  2CXJ A;  4PCW A;  3ZWH A;  1YUS A;  1PRW A;  1ZOT B;  2HQW A;  4USL A;  2Q91 A;  3GK2 A;  3GK1 A;  2WOR A;  2HQ8 A;  5BPJ A;  2L98 A;  2E6W A;  2JWW A;  3MSE B;  4A4B A;  2L5X B;  1OSA A;  2BCX A;  2H61 A;  3SG2 A;  3A4U B;  5PAL A;  1KWO B;  1B8C A;  2FCE A;  2LUC A;  1KFU L;  2MHH A;  1HQV A;  2KFF A;  1QX2 A;  1CDM A;  3KO0 A;  1F4O A;  5DKR A;  2MJW B;  2LVV A;  3EVU A;  2LAN A;  3I5I B;  2CNP A;  4CLN A;  1AVS A;  1S3P A;  1K9U A;  2WOS A;  1SNL A;  5KTY A;  4OR9 B;  2JU0 A;  2LCP A;  2Y4Q A;  1YR5 A;  1IG5 A;  1UUS A;  2JZI A;  2KSP A;  4FTG A;  4GAO A;  3LL8 B;  4I5K A;  1CLL A;  1CFC A;  1NCY A;  1KK8 B;  3NSO A;  4I5N B;  2O60 A;  1Y1A A;  1CLM A;  2BKI B;  4P2Y B;  2L50 A;  2JOJ A;  2LC5 A;  1OE9 B;  3FIA A;  3KHE A;  2ISD A;  2M3W A;  3BUO B;  3SIB A;  5JJG A;  3WNX B;  1NUB A;  3TUY C;  1J7O A;  4XJK A;  1Y1X A;  1OZS A;  1DF0 A;  1JFK A;  1XVJ A;  2BL0 B;  3CGA A;  1NX2 A;  1QAS A;  5B8I B;  2R2I A;  1FPW A;  4UPG A;  1CDL A;  3CLN A;  3EK8 A;  3NSK A;  1F55 A;  1XK4 C;  2QPT A;  4YI9 A;  1FI5 A;  5I2Q A;  2BBM A;  1WY9 A;  4P5O E;  2LP3 A;  3I5H C;  3VRP A;  2WCE A;  1AUI B;  1LA3 A;  2HET A;  1DTL A;  3BUN B;  2FCD A;  1CMG A;  2BE4 A;  2M49 B;  4YI8 A;  3TUY B;  4CFR A;  4N5X A;  1EL4 A;  3TDZ A;  1TNW A;  1CNP A;  1OMD A;  1XFX O;  3AAJ A;  1C7W A;  1ZMZ A;  3OB1 B;  2L4H A;  4GNK B;  3GOF A;  1M46 A;  1S6I A;  3OX5 A;  3DF0 B;  2SAS A;  1UHK A;  2GGZ A;  4HRG A;  1W7J B;  5AEQ A;  2JQ6 A;  1EXR A;  5HLO A;  4GGF C;  1S1E A;  1J7R A;  1TCO B;  1RJV A;  2AAO A;  4DRW A;  2KAY A;  3BOW A;  1S6C A;  1NX1 A;  5CSI A;  3FS7 A;  1CFF A;  1N2D A;  2LMU A;  1XK4 A;  2K7D A;  3IQO A;  3SG4 A;  1C07 A;  2K7O A;  1JF0 A;  1CM1 A;  1K2H A;  2K7C A;  1YUU A;  4PE0 A;  2LNK A;  1NX0 A;  4QJ3 B;  4YGD B;  2AUC A;  4MZK A;  1KFX S;  1RRO A;  1DMO A;  1B4C A;  2BKH B;  2JT0 A;  3FWB A;  1DVI A;  1JF2 A;  3D10 A;  1EG3 A;  1XFU O;  1KQV A;  1PSB A;  1D1O A;  2NCP A;  1S26 D;  2CCM A;  2WC8 A;  4DCK A;  3EK4 A;  2EHB A;  1NCX A;  2MLF C;  4N1G A;  1QLK A;  4D1E A;  4F0Z B;  2KBM A;  3O4Y A;  1ZUZ A;  1WRZ A;  4M2Q A;  4PE7 A;  2KNE A;  1PUL A;  1JWD A;  4GGF A;  2I7A A;  1LXF C;  1EH2 A;  4HRH A;  2L51 A;  4AOM A;  3CZT X;  3M0W A;  1XFV O;  1U5I A;  2MA2 A;  1QIV A;  1UHN A;  4TNC A;  4YGE B;  1M31 A;  1RWY A;  3A8R A;  1HT9 A;  1ALW A;  1BF5 A;  2LVJ A;  1F4Q A;  4E68 A;  1DT7 B;  2JT8 A;  1B47 A;  1K9K A;  1K9P A;  1L7Z A;  1QIW A;  1EG4 A;  1TRF A;  4MRY A;  1J1D A;  3EK7 A;  5CSJ A;  3AKA A;  2K2A A;  1YVH A;  2JTZ A;  1YUR A;  2EGD A;  1NCZ A;  1UHH A;  1SCV A;  1MHO A;  3WHU B;  2JNF A;  3KEV A;  2O5G A;  2NLN A;  2A4J A;  3EKH A;  1DJH A;  2M0R A;  3JTD B;  3AAK A;  3OP0 A;  1KK8 C;  4OCI A;  4YBH B;  2WCF A;  1F71 A;  5KSZ A;  2HF5 A;  1QXP A;  1XYD A;  1V1G A;  3BXK A;  4MZJ A;  2KAX A;  2Q4U A;  5I2O A;  1CLB A;  1SR6 B;  1QX7 A;  1RFJ A;  3JVT C;  1TN4 A;  2BL0 C;  1NWD A;  1QJT A;  4I5J A;  2ZNE A;  3FWC A;  5AAN A;  3H4S E;  4NDD A;  1C7V A;  4PE1 A;  1W7I B;  3RM1 A;  3GK4 X;  3VRR A;  5DKQ A;  2G2B A;  3O78 A;  4JPZ B;  1CDN A;  2BCB A;  5IBW A;  1JBA A;  2SCP A;  3BQ3 A;  1MWN A;  1BR1 B;  4WRI A;  2F8P A;  1ZFS A;  2LLU A;  2L0P A;  3CWG A;  1H4B A;  2FJU B;  1F70 A;  1JFJ A;  1WDC B;  3ZNI A;  2M7L A;  3K21 A;  2LP2 A;  2TN4 A;  3VRN A;  1IH0 A;  1F54 A;  2LE9 B;  3JVT B;  1LKJ A;  5DKN A;  3D0Y B;  2KI4 B;  5AER A;  4IL1 A;  1N0Y A;  1J7P A;  2KAV A;  2BEC A;  1BMO A;  2I94 A;  5HKW A;  3LLE A;  1KSO A;  1PVB A;  1SL9 A;  3TDU A;  4GPL B;  4CPV A;  2M29 A;  2WCB A;  2WND A;  1A75 B;  3BUW B;  2LVI A;  4BY5 A;  2V53 A;  4Q04 A;  4C0J A;  2LLT A;  1PSR A;  5D69 A;  3QRX A;  1BG1 A;  2KHN A;  3PN7 B;  3BYA A;  5D7F A;  1N65 A;  1GQM A;  2F2O A;  1UP5 A;  3CS1 A;  3TS5 B;  2K8M B;  2Y1M A;  3OB2 B;  2F3Y A;  2LMV A;  5CSF A;  3BUM B;  1ZAC A;  4L9M A;  1R6P A;  2KI6 D;  4DIR A;  1K90 D;  3LCP C;  4NQG A;  3PSR A;  4ORB B;  3DF0 A;  2JPT A;  2K7B A;  5CSN A;  1H8B A;  1A4P A;  3VRO A;  5FYX A;  4R1E A;  1NX3 A;  1S6J A;  1B8L A;  1SL7 A;  5HKY A;  1J1E A;  1Y0V H;  1SL8 A;  1YVL A;  1G33 A;  3F45 A;  4MVF A;  1IJ5 A;  4PAL A;  1G4Y R;  3AKB A;  3DVE A;  3LK0 A;  4MSP A;  3DD4 A;  1EJ3 A;  2KDH A;  2PMY A;  1SPY A;  1FBV A;  4NDB A;  1CTR A;  5K89 A;  3HX4 A;  5HYD A;  1X02 A;  3PAL A;  2CT9 A;  1B8R A;  1TNP A;  1NSH A;  2OS8 B;  1FW4 A;  5GQQ C;  1B1G A;  4ZCU A;  1B9A A;  1UWO A; 
#chains in the Genus database with same CATH topology
 1Z2C B;  1SYM A;  3EKJ A;  3JTD C;  1V1F A;  4C0L A;  1GGW A;  1GM0 A;  1K8U A;  1NIW A;  2EC6 C;  1SSE B;  4PDZ A;  2PSR A;  4MZL A;  1A29 A;  1SMG A;  1R2U A;  1QX5 B;  3CAB A;  2KQY A;  2M7N A;  1FF1 A;  2CTN A;  3NSL A;  1SKT A;  2COL B;  1SR6 C;  3D74 A;  1AJ4 A;  3WHT B;  1OQP A;  2KOT A;  2KQ6 A;  1K96 A;  5JOL A;  1K95 A;  5ER4 X;  1SRA A;  2PAS A;  3PFV A;  1M45 A;  1L2O B;  3KPX A;  1NPQ A;  3R1V A;  1B7T Y;  2BCA A;  1MXE A;  4YGA A;  4AQJ A;  1UHI A;  3LK1 A;  2JNX A;  2K0J A;  4HRE E;  2K61 A;  2PVB A;  2M1U A;  4MEW A;  4GFT A;  5AXI A;  3R72 A;  2OTG C;  4I5L B;  2K2F A;  1GJY A;  1OZO A;  2M9G A;  4PHK A;  3DVM A;  1YX7 A;  3NSI A;  4YRU A;  1KFU S;  2BE6 A;  5AFP A;  2EC6 B;  1B7T Z;  1CDP A;  1PVA A;  3R1O A;  4N1F A;  1WDC C;  1GGZ A;  3CR5 X;  1WRK A;  5DIC A;  5HKZ A;  1LIN A;  1TTX A;  1NYA A;  1YTZ C;  3S0F A;  2NXQ A;  1MQ1 A;  1OOJ A;  1SCM B;  1UUR A;  1YX8 A;  2GV5 A;  5KU1 A;  4MLW A;  1XFZ O;  3PLF B;  5HLV A;  3SG6 A;  1JUO A;  2KI4 C;  4C0K A;  2LM5 A;  3PJI A;  1A2X A;  4PE4 A;  1S36 A;  1UHJ A;  4ETO A;  1WLM A;  2JUL A;  2PAL A;  1KQM C;  2MBX A;  3S0A A;  2JXC A;  2AMI A;  2E30 A;  2MRD A;  1CB1 A;  3BUX B;  4MRX A;  1QV1 A;  4OV2 A;  2DOQ A;  1TOP A;  4M2O A;  4WQ2 A;  3S0B A;  1DJI A;  4AQI A;  1BOC A;  2OTG B;  1RK9 A;  3FE9 A;  1CMF A;  1W9Z A;  2KBI A;  1C3Z A;  1QTX A;  1OMR A;  2ZRT A;  3O2P A;  1IRJ A;  3RLZ A;  2Y1N A;  4YGC B;  5ER5 A;  5TNC A;  2JC2 A;  2LAP A;  4JWQ A;  4NDC A;  2I18 A;  2ZKM X;  1MF8 B;  3PN7 C;  3EVV A;  1BT6 A;  1RTP 1;  4ORA B;  1KK7 Y;  2I2R E;  4JQ0 D;  3TS5 C;  1WRL A;  3IF7 A;  1CFP A;  2WC6 A;  5D3O A;  3DVJ A;  1XFW O;  1DQE A;  5I8N A;  1KQM B;  3OHM B;  3UNW A;  2KFG A;  2LHI A;  3D0Y A;  1QS7 A;  1ODB A;  1XA5 A;  1YUT A;  1KK7 Z;  3B88 A;  3I5F C;  4XJK B;  4CID A;  1DF0 B;  1LA0 A;  1QLS A;  2JXL A;  2JRF A;  2Y5I A;  4GBA A;  3TDI A;  5CPV A;  2NCO A;  2PRU A;  3R1P A;  3UO9 A;  4DS7 A;  4JKT A;  3SIA A;  1IGV A;  1CFD A;  1DJZ A;  3O6B A;  3OBV A;  1YRT B;  3S0D A;  3KF9 A;  1A75 A;  3NGV A;  1WLZ A;  1BJF A;  1E8A A;  2ERB A;  2F2P A;  3C1V A;  2RGI A;  2NZ0 A;  1BU3 A;  1NP8 A;  4WQ3 A;  2YGU A;  1XO5 A;  1Y1U A;  1IWQ A;  2KYC A;  1J55 A;  2D8N A;  2LLS A;  2B1U A;  2ZFD A;  1DJW A;  1BLQ A;  3CZ1 A;  1TCF A;  2ZND A;  1M39 A;  2WCJ A;  2F33 A;  3EG5 B;  3I5F B;  4OKH A;  3SS3 A;  2QEB A;  3V2L A;  1AP4 A;  2OS8 C;  3IQQ A;  3B86 A;  1BR4 B;  2KYF A;  1M63 B;  4M2P A;  4A4C A;  1SW8 A;  3SG7 A;  1MUX A;  1XFR A;  2MAZ A;  2L2E A;  2ZN8 A;  5I2L A;  3ICB A;  4FQT A;  1Y6W A;  1AHR A;  3D77 A;  1QAT A;  3SG3 A;  1MR8 A;  1XFY O;  2H8V A;  2KLE A;  3O4X A;  4PHM A;  1SY9 A;  4ORC B;  1AJ5 A;  2ZN9 A;  3DVK A;  1JSA A;  2LV7 A;  1DGU A;  3BOW B;  2KFH A;  1KSM A;  2L4I A;  3SG5 A;  1BOD A;  4PHJ A;  2P6B B;  3NHT A;  3PM8 A;  1SK6 D;  4ICB A;  1QVI Y;  4CFQ A;  1ALV A;  1L2O C;  2PQL A;  4HSZ A;  1TNX A;  3I5H B;  1IQ5 A;  3SS4 A;  2CBL A;  1CM4 A;  3VRQ A;  1FI6 A;  1DJY A;  1TIZ A;  3VB1 A;  3EVR A;  3I5G C;  1F8H A;  4QJ4 B;  1PAL A;  4MN0 A;  1LVC D;  2LHL A;  2ZRS A;  5F6T A;  4FQO A;  4ZCV A;  2G9B A;  4YGB B;  1QVI Z;  2LVK A;  2OPO A;  4XYN A;  1VRK A;  2KGR A;  4GUK A;  1IKU A;  2GGM A;  1JC2 A;  3PAT A;  5FI6 A;  2KI6 C;  1KFX L;  1SCM C;  4DUQ A;  3SJS A;  3CTN A;  1G8I A;  1K94 A;  1ORG A;  3NXA A;  3DZT A;  3WXA A;  1KCY A;  3TZ1 A;  1DJG A;  1MXL C;  1OW4 A;  1CKK A;  1YRU B;  1Q80 A;  5G08 A;  1QV0 A;  1TNQ A;  2KPH A;  2M1K B;  1U5I B;  2H61 C;  2M97 A;  1AK8 A;  2QAC A;  3I5G B;  2BBN A;  4QJ5 B;  4U8D A;  1J7Q A;  2P70 A;  2JTT A;  3FE8 A;  3FE6 A;  2F3Z A;  1OMV A;  1K93 D;  1SBJ A;  2JT3 A;  4OVN F;  3CR4 X;  1S5G Y;  3E3R A;  1P28 A;  4GGN A;  2BNX A;  4BY4 A;  2BAP A;  2HPS A;  1KWO C;  2MLE C;  2FOT A;  3VGO A;  1DJX A;  3HCM A;  1REC A;  1DGV A;  2LMT A;  5J3X A;  5I94 A;  1PK0 D;  4PHN A;  1A03 A;  2IS9 A;  2LUX A;  2KGB C;  3CR2 A;  3IVT A;  4MBE A;  2H2K A;  1IJ6 A;  3OX6 A;  4F7F A;  2VRG A;  2M8U A;  3I5I C;  1S5G Z;  2CXJ A;  4PCW A;  5FI7 A;  3ZWH A;  1YUS A;  1PRW A;  1ZOT B;  2HQW A;  4USL A;  2Q91 A;  3GK2 A;  3GK1 A;  2WOR A;  2HQ8 A;  5BPJ A;  2L98 A;  2E6W A;  2JWW A;  3MSE B;  4JD9 A;  4A4B A;  2L5X B;  1OSA A;  2BCX A;  3DY9 A;  2H61 A;  3L47 A;  3SG2 A;  3CZ2 A;  3A4U B;  5PAL A;  1KWO B;  1IQ3 A;  1B8C A;  2FCE A;  2LUC A;  1KFU L;  2MHH A;  1HQV A;  2KFF A;  1T14 A;  1QX2 A;  1CDM A;  3KO0 A;  1F4O A;  3D78 A;  5DKR A;  2MJW B;  2LVV A;  3EVU A;  2LAN A;  3I5I B;  2CNP A;  4CLN A;  1AVS A;  1S3P A;  1K9U A;  2WOS A;  1SNL A;  5KTY A;  4OR9 B;  2JU0 A;  2LCP A;  2Y4Q A;  1YR5 A;  1IG5 A;  1OOF A;  1UUS A;  2JZI A;  2KSP A;  4FTG A;  3LL8 B;  4GAO A;  4KYN A;  4PT1 A;  4I5K A;  1CLL A;  3L4A A;  1CFC A;  3NHI A;  1NCY A;  1C3Y A;  1KK8 B;  3NSO A;  2QEV A;  4I5N B;  2O60 A;  1Y1A A;  1CLM A;  2BKI B;  4P2Y B;  2L50 A;  2JOJ A;  2LC5 A;  1OE9 B;  3FIA A;  3KHE A;  2ISD A;  2M3W A;  3BUO B;  3SIB A;  5JJG A;  3WNX B;  1NUB A;  3TUY C;  1J7O A;  4XJK A;  1Y1X A;  1OZS A;  1DF0 A;  1JFK A;  1XVJ A;  2BL0 B;  3CYZ A;  3CGA A;  1NX2 A;  1QAS A;  5B8I B;  2R2I A;  1FPW A;  4UPG A;  1CDL A;  3DYE A;  3CLN A;  3EK8 A;  3NSK A;  1F55 A;  1XK4 C;  2QPT A;  4INX A;  4YI9 A;  1FI5 A;  5I2Q A;  2BBM A;  1WY9 A;  4P5O E;  2LP3 A;  3I5H C;  1OOI X;  3VRP A;  2WCE A;  1AUI B;  1LA3 A;  2HET A;  1DTL A;  3BUN B;  1DC1 A;  2FCD A;  3B7A A;  3SS5 A;  1CMG A;  2BE4 A;  2M49 B;  4YI8 A;  3TUY B;  4CFR A;  4N5X A;  1EL4 A;  3TDZ A;  1TNW A;  1CNP A;  1OMD A;  1DEL A;  1XFX O;  3AAJ A;  1C7W A;  1ZMZ A;  3OB1 B;  2L4H A;  4GNK B;  3GOF A;  1M46 A;  1S6I A;  3OX5 A;  3DF0 B;  2SAS A;  1UHK A;  2GGZ A;  4HRG A;  1W7J B;  3DXL A;  5AEQ A;  2JQ6 A;  2KLD A;  1EXR A;  5HLO A;  4GGF C;  1S1E A;  1J7R A;  1TCO B;  1RJV A;  2AAO A;  4DRW A;  2KAY A;  3BOW A;  1S6C A;  1NX1 A;  5CSI A;  3FS7 A;  2QDI A;  1CFF A;  1N2D A;  2LMU A;  1XK4 A;  2K7D A;  2WCM A;  3IQO A;  3SG4 A;  1C07 A;  2K7O A;  2PYQ A;  1JF0 A;  1CM1 A;  1K2H A;  2K7C A;  1YUU A;  4PE0 A;  2LNK A;  1NX0 A;  4QJ3 B;  4YGD B;  1OOG A;  2AUC A;  4MZK A;  1KFX S;  1RRO A;  1DMO A;  1B4C A;  2BKH B;  2JT0 A;  3FWB A;  1DVI A;  1JF2 A;  3D10 A;  1EG3 A;  1XFU O;  2L5Y A;  1KQV A;  1PSB A;  1D1O A;  2NCP A;  1S26 D;  2CCM A;  2WC8 A;  4DCK A;  3EK4 A;  3N7H A;  2EHB A;  3BFB A;  1NCX A;  2MLF C;  4N1G A;  1QLK A;  4D1E A;  4F0Z B;  3BFA A;  2KBM A;  3O4Y A;  3CDN A;  1ZUZ A;  1WRZ A;  4M2Q A;  4PE7 A;  2KNE A;  3S0G A;  1PUL A;  1JWD A;  4GGF A;  2WC5 A;  2I7A A;  1LXF C;  1EH2 A;  4HRH A;  2L51 A;  4AOM A;  3CZT X;  3M0W A;  1XFV O;  1U5I A;  2MA2 A;  1QIV A;  1UHN A;  4TNC A;  4YGE B;  1M31 A;  1RWY A;  3A8R A;  1HT9 A;  1ALW A;  1BF5 A;  2LVJ A;  1F4Q A;  4E68 A;  1DT7 B;  2JT8 A;  1B47 A;  1K9K A;  1K9P A;  1L7Z A;  1QIW A;  1EG4 A;  1TRF A;  4MRY A;  1J1D A;  3EK7 A;  5CSJ A;  3D75 A;  3AKA A;  2K2A A;  1YVH A;  2JTZ A;  3QME A;  1YUR A;  2EGD A;  1NCZ A;  1UHH A;  1SCV A;  1MHO A;  3WHU B;  2JNF A;  3KEV A;  2O5G A;  3BJH A;  2NLN A;  2A4J A;  4OZD A;  3EKH A;  1DJH A;  2M0R A;  3JTD B;  3AAK A;  3OP0 A;  1KK8 C;  4OCI A;  4YBH B;  3BFH A;  2WCF A;  1F71 A;  3L4L A;  2WCK A;  2HF5 A;  1QXP A;  5KSZ A;  1XYD A;  1V1G A;  2P71 A;  3BXK A;  4MZJ A;  2KAX A;  2Q4U A;  5I2O A;  1CLB A;  1SR6 B;  1QX7 A;  1RFJ A;  3JVT C;  1TN4 A;  2BL0 C;  2K60 A;  1NWD A;  1QJT A;  4I5J A;  2ZNE A;  3FWC A;  5AAN A;  3S0E A;  3H4S E;  4NDD A;  1C7V A;  4PE1 A;  1W7I B;  3RM1 A;  3GK4 X;  3VRR A;  5DKQ A;  2G2B A;  3O78 A;  4JPZ B;  1CDN A;  4INW A;  2BCB A;  5IBW A;  1JBA A;  2SCP A;  3BQ3 A;  5FI2 A;  1MWN A;  1BR1 B;  4WRI A;  2F8P A;  1ZFS A;  2LLU A;  2L0P A;  3CWG A;  3CZ0 A;  1H4B A;  2FJU B;  1F70 A;  1JFJ A;  1WDC B;  3ZNI A;  2M7L A;  3K21 A;  2LP2 A;  2TN4 A;  3VRN A;  1IH0 A;  1TUZ A;  3B87 A;  5EL2 A;  2LE9 B;  3JVT B;  1F54 A;  1LKJ A;  5DKN A;  3D0Y B;  2KI4 B;  1DEK A;  4IJ7 A;  5AER A;  4IL1 A;  1Z4H A;  1N0Y A;  2GTE A;  5HL1 A;  1J7P A;  2KAV A;  3OGN A;  2BEC A;  1BMO A;  2I94 A;  5HKW A;  3LLE A;  1KSO A;  1PVB A;  1SL9 A;  3TDU A;  4GPL B;  4CPV A;  1OOH A;  2M29 A;  2WCB A;  2WND A;  1A75 B;  3BUW B;  2LVI A;  4BY5 A;  2V53 A;  4Q04 A;  4C0J A;  2LLT A;  1PSR A;  5D69 A;  3QRX A;  1BG1 A;  2KHN A;  3PN7 B;  3BYA A;  5D7F A;  1N65 A;  3K1E A;  1GQM A;  2F2O A;  1UP5 A;  2QEO A;  3CS1 A;  2K8M B;  2Y1M A;  3D73 A;  3OB2 B;  3TS5 B;  2F3Y A;  3Q8I A;  3D76 A;  2LMV A;  5CSF A;  3BUM B;  1ZAC A;  4L9M A;  1R6P A;  2KI6 D;  4DIR A;  1K90 D;  3LCP C;  4NQG A;  3PSR A;  2JPO A;  4ORB B;  1TWO A;  3DF0 A;  2JPT A;  2K7B A;  5CSN A;  1H8B A;  1A4P A;  3VRO A;  5FYX A;  4R1E A;  1LS8 A;  1NX3 A;  1S6J A;  1B8L A;  1SL7 A;  2QEH A;  5HKY A;  1J1E A;  1Y0V H;  1SL8 A;  1YVL A;  1G33 A;  3B6X A;  3F45 A;  4MVF A;  1IJ5 A;  4PAL A;  3PM2 A;  2FJY A;  1G4Y R;  3AKB A;  3DVE A;  3LK0 A;  4MSP A;  1TUJ A;  3DD4 A;  1EJ3 A;  2KDH A;  2PMY A;  1SPY A;  1FBV A;  4NDB A;  1IIO A;  1CTR A;  2WCL A;  5K89 A;  3HX4 A;  5HYD A;  1X02 A;  3PAL A;  2CT9 A;  2L2C A;  1B8R A;  3RZS A;  1QWV A;  2WCH A;  1TNP A;  1NSH A;  2OS8 B;  1FW4 A;  5GQQ C;  1B1G A;  4ZCU A;  1B9A A;  1UWO A; 
#chains in the Genus database with same CATH homology
 1SYM A;  3EKJ A;  3JTD C;  1V1F A;  4C0L A;  1GGW A;  1K8U A;  1NIW A;  2EC6 C;  4PDZ A;  2PSR A;  4MZL A;  1A29 A;  1SMG A;  1R2U A;  1QX5 B;  2KQY A;  2M7N A;  1FF1 A;  2CTN A;  3NSL A;  1SKT A;  2COL B;  1SR6 C;  3WHT B;  1AJ4 A;  1OQP A;  2KOT A;  2KQ6 A;  1K96 A;  5JOL A;  1K95 A;  5ER4 X;  1SRA A;  2PAS A;  3PFV A;  1M45 A;  1L2O B;  3KPX A;  1NPQ A;  1B7T Y;  2BCA A;  1MXE A;  4YGA A;  4AQJ A;  1UHI A;  3LK1 A;  2JNX A;  2K0J A;  4HRE E;  2K61 A;  2PVB A;  2M1U A;  4MEW A;  4GFT A;  5AXI A;  4I5L B;  2OTG C;  2K2F A;  1GJY A;  1OZO A;  2M9G A;  4PHK A;  3DVM A;  1YX7 A;  3NSI A;  4YRU A;  1KFU S;  2BE6 A;  5AFP A;  2EC6 B;  1B7T Z;  1CDP A;  1PVA A;  5HKZ A;  4N1F A;  1WDC C;  1GGZ A;  3CR5 X;  1WRK A;  1IQ3 A;  1LIN A;  1TTX A;  1NYA A;  1YTZ C;  2NXQ A;  1MQ1 A;  1OOJ A;  1SCM B;  1UUR A;  1YX8 A;  2GV5 A;  5KU1 A;  4MLW A;  1XFZ O;  3PLF B;  5HLV A;  3SG6 A;  1JUO A;  2KI4 C;  4C0K A;  2LM5 A;  4PE4 A;  1A2X A;  1S36 A;  1UHJ A;  4ETO A;  1WLM A;  2JUL A;  2PAL A;  1KQM C;  2MBX A;  2JXC A;  2AMI A;  2E30 A;  2MRD A;  1CB1 A;  3BUX B;  4MRX A;  1QV1 A;  4OV2 A;  2DOQ A;  1TOP A;  4M2O A;  4WQ2 A;  4AQI A;  1DJI A;  1BOC A;  2OTG B;  1RK9 A;  1CMF A;  2KBI A;  1QTX A;  2ZRT A;  1OMR A;  3O2P A;  1IRJ A;  3RLZ A;  2Y1N A;  4YGC B;  5ER5 A;  5TNC A;  2JC2 A;  2LAP A;  4JWQ A;  4NDC A;  2I18 A;  2ZKM X;  1MF8 B;  3PN7 C;  3EVV A;  1BT6 A;  1RTP 1;  4ORA B;  1KK7 Y;  2I2R E;  4JQ0 D;  3TS5 C;  1WRL A;  3IF7 A;  1CFP A;  3DVJ A;  1XFW O;  5I8N A;  1KQM B;  3OHM B;  2KFG A;  2LHI A;  3D0Y A;  1QS7 A;  1ODB A;  1XA5 A;  1YUT A;  1KK7 Z;  3I5F C;  4XJK B;  4CID A;  1DF0 B;  1LA0 A;  1QLS A;  2JXL A;  2JRF A;  2Y5I A;  4GBA A;  3TDI A;  5CPV A;  2NCO A;  2PRU A;  4DS7 A;  3SIA A;  1IGV A;  1CFD A;  1DJZ A;  3O6B A;  1YRT B;  3KF9 A;  1A75 A;  1BJF A;  1E8A A;  1WLZ A;  2F2P A;  3C1V A;  2RGI A;  2NZ0 A;  1BU3 A;  1NP8 A;  4WQ3 A;  1XO5 A;  1Y1U A;  1IWQ A;  2KYC A;  1J55 A;  2D8N A;  2LLS A;  2B1U A;  2ZFD A;  1DJW A;  1BLQ A;  1TCF A;  2ZND A;  1M39 A;  2F33 A;  3I5F B;  4OKH A;  1AP4 A;  2OS8 C;  3IQQ A;  1BR4 B;  2KYF A;  1M63 B;  4M2P A;  4A4C A;  1SW8 A;  3SG7 A;  1MUX A;  2MAZ A;  2L2E A;  2ZN8 A;  5I2L A;  3ICB A;  1Y6W A;  1AHR A;  1QAT A;  3SG3 A;  1MR8 A;  1XFY O;  4PHM A;  1SY9 A;  4ORC B;  1AJ5 A;  2ZN9 A;  3DVK A;  1JSA A;  2LV7 A;  1DGU A;  3BOW B;  2KFH A;  1KSM A;  2L4I A;  3SG5 A;  1BOD A;  4PHJ A;  2P6B B;  3PM8 A;  1SK6 D;  4ICB A;  1QVI Y;  4CFQ A;  1ALV A;  1L2O C;  4HSZ A;  1TNX A;  3I5H B;  1IQ5 A;  3VRQ A;  2CBL A;  1CM4 A;  1FI6 A;  1DJY A;  1TIZ A;  3EVR A;  3I5G C;  1F8H A;  4QJ4 B;  1PAL A;  4MN0 A;  1LVC D;  2LHL A;  2ZRS A;  5F6T A;  4FQO A;  4ZCV A;  2G9B A;  4YGB B;  1QVI Z;  2LVK A;  2OPO A;  4XYN A;  1VRK A;  2KGR A;  4GUK A;  1IKU A;  2GGM A;  1JC2 A;  3PAT A;  2KI6 C;  1KFX L;  1SCM C;  4DUQ A;  3SJS A;  3CTN A;  1G8I A;  1K94 A;  3NXA A;  3WXA A;  1KCY A;  3TZ1 A;  1DJG A;  1MXL C;  1CKK A;  1YRU B;  1Q80 A;  5G08 A;  1QV0 A;  1TNQ A;  2M1K B;  1U5I B;  2H61 C;  2M97 A;  1AK8 A;  2QAC A;  3I5G B;  2BBN A;  4QJ5 B;  4U8D A;  1J7Q A;  2JTT A;  2F3Z A;  1OMV A;  1K93 D;  1SBJ A;  2JT3 A;  4OVN F;  3CR4 X;  1S5G Y;  3E3R A;  4GGN A;  4BY4 A;  2HPS A;  1KWO C;  2MLE C;  2FOT A;  3VGO A;  1DJX A;  3HCM A;  1REC A;  1DGV A;  2LMT A;  5J3X A;  1PK0 D;  4PHN A;  1A03 A;  2IS9 A;  2LUX A;  2KGB C;  3CR2 A;  4MBE A;  2H2K A;  1IJ6 A;  3OX6 A;  2VRG A;  2M8U A;  3I5I C;  1S5G Z;  2CXJ A;  4PCW A;  3ZWH A;  1YUS A;  1PRW A;  1ZOT B;  2HQW A;  4USL A;  2Q91 A;  3GK2 A;  3GK1 A;  2WOR A;  2HQ8 A;  5BPJ A;  2L98 A;  2E6W A;  2JWW A;  3MSE B;  4A4B A;  2L5X B;  1OSA A;  2BCX A;  2H61 A;  3SG2 A;  3A4U B;  5PAL A;  1KWO B;  1B8C A;  2FCE A;  2LUC A;  1KFU L;  2MHH A;  1HQV A;  2KFF A;  1QX2 A;  1CDM A;  3KO0 A;  1F4O A;  5DKR A;  2MJW B;  2LVV A;  3EVU A;  2LAN A;  3I5I B;  2CNP A;  4CLN A;  1AVS A;  1S3P A;  1K9U A;  2WOS A;  1SNL A;  5KTY A;  4OR9 B;  2JU0 A;  2LCP A;  2Y4Q A;  1YR5 A;  1IG5 A;  1UUS A;  2JZI A;  2KSP A;  4FTG A;  4GAO A;  3LL8 B;  4I5K A;  1CLL A;  1CFC A;  1NCY A;  1KK8 B;  3NSO A;  4I5N B;  2O60 A;  1Y1A A;  1CLM A;  2BKI B;  4P2Y B;  2L50 A;  2JOJ A;  2LC5 A;  1OE9 B;  3FIA A;  3KHE A;  2ISD A;  2M3W A;  3BUO B;  3SIB A;  5JJG A;  3WNX B;  1NUB A;  3TUY C;  1J7O A;  4XJK A;  1Y1X A;  1OZS A;  1DF0 A;  1JFK A;  1XVJ A;  2BL0 B;  3CGA A;  1NX2 A;  1QAS A;  5B8I B;  2R2I A;  1FPW A;  4UPG A;  1CDL A;  3CLN A;  3EK8 A;  3NSK A;  1F55 A;  1XK4 C;  2QPT A;  4YI9 A;  1FI5 A;  5I2Q A;  2BBM A;  1WY9 A;  4P5O E;  2LP3 A;  3I5H C;  3VRP A;  2WCE A;  1AUI B;  1LA3 A;  2HET A;  1DTL A;  3BUN B;  2FCD A;  1CMG A;  2BE4 A;  2M49 B;  4YI8 A;  3TUY B;  4CFR A;  4N5X A;  1EL4 A;  3TDZ A;  1TNW A;  1CNP A;  1OMD A;  1XFX O;  3AAJ A;  1C7W A;  1ZMZ A;  3OB1 B;  2L4H A;  4GNK B;  3GOF A;  1M46 A;  1S6I A;  3OX5 A;  3DF0 B;  2SAS A;  1UHK A;  2GGZ A;  4HRG A;  1W7J B;  5AEQ A;  2JQ6 A;  1EXR A;  5HLO A;  4GGF C;  1S1E A;  1J7R A;  1TCO B;  1RJV A;  2AAO A;  4DRW A;  2KAY A;  3BOW A;  1S6C A;  1NX1 A;  5CSI A;  3FS7 A;  1CFF A;  1N2D A;  2LMU A;  1XK4 A;  2K7D A;  3IQO A;  3SG4 A;  1C07 A;  2K7O A;  1JF0 A;  1CM1 A;  1K2H A;  2K7C A;  1YUU A;  4PE0 A;  2LNK A;  1NX0 A;  4QJ3 B;  4YGD B;  2AUC A;  4MZK A;  1KFX S;  1RRO A;  1DMO A;  1B4C A;  2BKH B;  2JT0 A;  3FWB A;  1DVI A;  1JF2 A;  3D10 A;  1EG3 A;  1XFU O;  1KQV A;  1PSB A;  1D1O A;  2NCP A;  1S26 D;  2CCM A;  2WC8 A;  4DCK A;  3EK4 A;  2EHB A;  1NCX A;  2MLF C;  4N1G A;  1QLK A;  4D1E A;  4F0Z B;  2KBM A;  3O4Y A;  1ZUZ A;  1WRZ A;  4M2Q A;  4PE7 A;  2KNE A;  1PUL A;  1JWD A;  4GGF A;  2I7A A;  1LXF C;  1EH2 A;  4HRH A;  2L51 A;  4AOM A;  3CZT X;  3M0W A;  1XFV O;  1U5I A;  2MA2 A;  1QIV A;  1UHN A;  4TNC A;  4YGE B;  1M31 A;  1RWY A;  3A8R A;  1HT9 A;  1ALW A;  1BF5 A;  2LVJ A;  1F4Q A;  4E68 A;  1DT7 B;  2JT8 A;  1B47 A;  1K9K A;  1K9P A;  1L7Z A;  1QIW A;  1EG4 A;  1TRF A;  4MRY A;  1J1D A;  3EK7 A;  5CSJ A;  3AKA A;  2K2A A;  1YVH A;  2JTZ A;  1YUR A;  2EGD A;  1NCZ A;  1UHH A;  1SCV A;  1MHO A;  3WHU B;  2JNF A;  3KEV A;  2O5G A;  2NLN A;  2A4J A;  3EKH A;  1DJH A;  2M0R A;  3JTD B;  3AAK A;  3OP0 A;  1KK8 C;  4OCI A;  4YBH B;  2WCF A;  1F71 A;  5KSZ A;  2HF5 A;  1QXP A;  1XYD A;  1V1G A;  3BXK A;  4MZJ A;  2KAX A;  2Q4U A;  5I2O A;  1CLB A;  1SR6 B;  1QX7 A;  1RFJ A;  3JVT C;  1TN4 A;  2BL0 C;  1NWD A;  1QJT A;  4I5J A;  2ZNE A;  3FWC A;  5AAN A;  3H4S E;  4NDD A;  1C7V A;  4PE1 A;  1W7I B;  3RM1 A;  3GK4 X;  3VRR A;  5DKQ A;  2G2B A;  3O78 A;  4JPZ B;  1CDN A;  2BCB A;  5IBW A;  1JBA A;  2SCP A;  3BQ3 A;  1MWN A;  1BR1 B;  4WRI A;  2F8P A;  1ZFS A;  2LLU A;  2L0P A;  3CWG A;  1H4B A;  2FJU B;  1F70 A;  1JFJ A;  1WDC B;  3ZNI A;  2M7L A;  3K21 A;  2LP2 A;  2TN4 A;  3VRN A;  1IH0 A;  1F54 A;  2LE9 B;  3JVT B;  1LKJ A;  5DKN A;  3D0Y B;  2KI4 B;  5AER A;  4IL1 A;  1N0Y A;  1J7P A;  2KAV A;  2BEC A;  1BMO A;  2I94 A;  5HKW A;  3LLE A;  1KSO A;  1PVB A;  1SL9 A;  3TDU A;  4GPL B;  4CPV A;  2M29 A;  2WCB A;  2WND A;  1A75 B;  3BUW B;  2LVI A;  4BY5 A;  2V53 A;  4Q04 A;  4C0J A;  2LLT A;  1PSR A;  5D69 A;  3QRX A;  1BG1 A;  2KHN A;  3PN7 B;  3BYA A;  5D7F A;  1N65 A;  1GQM A;  2F2O A;  1UP5 A;  3CS1 A;  3TS5 B;  2K8M B;  2Y1M A;  3OB2 B;  2F3Y A;  2LMV A;  5CSF A;  3BUM B;  1ZAC A;  4L9M A;  1R6P A;  2KI6 D;  4DIR A;  1K90 D;  3LCP C;  4NQG A;  3PSR A;  4ORB B;  3DF0 A;  2JPT A;  2K7B A;  5CSN A;  1H8B A;  1A4P A;  3VRO A;  5FYX A;  4R1E A;  1NX3 A;  1S6J A;  1B8L A;  1SL7 A;  5HKY A;  1J1E A;  1Y0V H;  1SL8 A;  1YVL A;  1G33 A;  3F45 A;  4MVF A;  1IJ5 A;  4PAL A;  1G4Y R;  3AKB A;  3DVE A;  3LK0 A;  4MSP A;  3DD4 A;  1EJ3 A;  2KDH A;  2PMY A;  1SPY A;  1FBV A;  4NDB A;  1CTR A;  5K89 A;  3HX4 A;  5HYD A;  1X02 A;  3PAL A;  2CT9 A;  1B8R A;  1TNP A;  1NSH A;  2OS8 B;  1FW4 A;  5GQQ C;  1B1G A;  4ZCU A;  1B9A A;  1UWO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...