4DUQA

The structure of ca2+-loaded s100a2 at 1.3a resolution
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
88
structure length
88
Chain Sequence
SSSLEQALAVLVTTFHKYSSQEGDKFKLSKGEMKELLHKELPSFVGEKVDEEGLKKLMGSLDENSDQQVDFQEYAVFLALITVMSNDF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of Ca2+-loaded S100A2 at 1.3- angstrom resolution.
pubmed doi rcsb
molecule keywords Protein S100-A2
molecule tags Metal binding protein
source organism Homo sapiens
total genus 35
structure length 88
sequence length 88
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4duqA00
2LMUA 3I5GB 2KGBC 2LV7A 2Q91A 1S26D 2ZRSA 1PSRA 4N1GA 5ER5A 2KI6D 1FI6A 2BL0C 1BMOA 1S6JA 5HYDA 2JT3A 1EG3A 1PULA 3BUXB 1CFPA 1OMDA 4M2PA 2ZFDA 1K8UA 1PSBA 2K8MB 3TUYB 1BT6A 2LLSA 1KFXS 1OSAA 5BPJA 1A29A 2PASA 1DVIA 1IWQA 2LUCA 3I5FC 2LMVA 2AUCA 2L98A 1XYDA 4GPLB 4MRXA 2JTTA 3BOWA 1JBAA 2BBNA 3ZNIA 3JVTC 2NLNA 1EH2A 3PM8A 1UHIA 1S6CA 4GGFA 4PE7A 3WXAA 3ZWHA 2L2EA 1M39A 1QX2A 2M7LA 2F3YA 1J7RA 1TNQA 3KPXA 1B1GA 1DT7B 1CMGA 2PALA 2OTGB 1FF1A 1DJWA 3I5IB 2L51A 2I7AA 4PCWA 3CS1A 1V1GA 1J55A 3OP0A 3CR2A 1KFUL 2M0RA 2BCBA 2V53A 3EK4A 4NDDA 2CT9A 1FI5A 2M9GA 1SCVA 1IKUA 3A8RA 4WQ3A 3CR4X 3D10A 2L4IA 2MLFC 1SR6B 2I18A 1K9PA 1AUIB 4MEWA 2ZNDA 2Y5IA 4CFQA 1WDCC 1NCYA 2M3WA 5CSJA 4C0LA 1KK8B 1Q80A 2JC2A 3FS7A 1YUUA 1LVCD 1SK6D 1DJHA 4DRWA 1H4BA 2KYFA 2NCOA 1DJYA 2I2RE 1CMFA 1QV1A 5TNCA 4PDZA 2RGIA 1YR5A 4YGDB 4YGCB 3WHTB 2M49B 2LUXA 1JF2A 1SL9A 3OX5A 3TS5B 1F4OA 2JU0A 2O5GA 2ZKMX 2MJWB 1SBJA 1ZOTB 2LP2A 4GGNA 3PFVA 1AVSA 2LP3A 2WOSA 3SG6A 3SG7A 4YI8A 1XFUO 3RLZA 3DF0A 3KEVA 4N1FA 4GGFC 1PRWA 4OR9B 3QRXA 4FTGA 5CSNA 2H61A 3OB1B 2JQ6A 1S1EA 2F2OA 3CLNA 2KFHA 5D7FA 1VRKA 1L2OC 2BKHB 3TZ1A 3AAJA 5CSIA 1QLSA 1OQPA 2F33A 4CIDA 4HREE 1MWNA 1AHRA 1PK0D 4E68A 1MXLC 2KAYA 3TDZA 1SCMC 3FWCA 2QACA 1J1EA 4MRYA 1K9KA 1ZUZA 1ODBA 1YX7A 3OX6A 4MLWA 1KCYA 1IQ3A 3ICBA 4HRGA 4WQ2A 1KSMA 3VGOA 4U8DA 2EC6B 3EVRA 2JOJA 4F0ZB 4XYNA 3SIAA 5HKYA 5GQQC 4MZLA 4C0JA 1RK9A 1IJ6A 4GAOA 3CTNA 1CFFA 1MR8A 2CCMA 3AKBA 1IG5A 2M7NA 1XVJA 2BL0B 2JWWA 1U5IA 3AAKA 2EHBA 4MVFA 4P2YB 3SG4A 3H4SE 2JNXA 2FJUB 3TDUA 1MXEA 1M63B 1IQ5A 3SG2A 1TN4A 1ALWA 3O78A 1EL4A 2CBLA 2JULA 1F4QA 1NX2A 3I5FB 2H61C 3SJSA 1PALA 1R6PA 4BY5A 1CM4A 1MQ1A 1SL8A 4GUKA 4QJ4B 3JVTB 2WORA 1OZOA 1YVHA 1M31A 1X02A 2KAXA 4ETOA 1UURA 4YGAA 1XFXO 1QIVA 1PVBA 1QIWA 1WLMA 1AJ5A 1JFJA 1UWOA 1FBVA 2CNPA 3NXAA 1B9AA 2BCAA 1UUSA 1KWOC 2M29A 3DD4A 2NZ0A 1ALVA 2ZNEA 1ZMZA 5HLVA 3M0WA 1C7VA 4ORBB 2MRDA 4R1EA 2BE4A 1JFKA 2VRGA 3BQ3A 5I2LA 1LA3A 1CDLA 2K7DA 2A4JA 1JC2A 1G4YR 2JT0A 1CDMA 4D1EA 4L9MA 1BR4B 1WDCB 1XFYO 3WHUB 2KAVA 3PSRA 4I5KA 4USLA 1CLMA 1E8AA 1NYAA 2K7CA 2MHHA 2O60A 2PVBA 2Q4UA 5AANA 1A4PA 1KK7Y 2KQ6A 3SG5A 1QV0A 1QX7A 2MAZA 2GV5A 1M45A 3VROA 4NDCA 1SW8A 1MHOA 3RM1A 1QATA 1YTZC 1S5GZ 1UP5A 5ER4X 3DVJA 1G8IA 1YURA 3BYAA 1MF8B 2G2BA 4OCIA 1SL7A 1L7ZA 3BOWB 3KO0A 2K7OA 1K95A 4I5LB 2LANA 1RROA 3PLFB 2FCDA 2KFFA 3NSKA 3O4YA 1W7JB 4ORAB 3I5HC 3PN7C 2Y4QA 1Y1UA 1KFUS 1B47A 1A75A 2H2KA 1BJFA 2KGRA 2E6WA 1BF5A 1Y6WA 1L2OB 2CTNA 2KSPA 1KQMC 3BUWB 4OV2A 2LAPA 4PE1A 4PALA 1OMVA 1MUXA 1SCMB 3CGAA 3NSLA 4PHKA 1NX1A 3BXKA 2AMIA 2LLUA 2PRUA 2ISDA 5HKZA 1QASA 3LK0A 1FPWA 1DF0A 1DJGA 5KU1A 1UHNA 1LINA 2L5XB 4PHJA 4M2QA 2MLEC 3O2PA 5G08A 1NSHA 1ZFSA 1IJ5A 4TNCA 3EKHA 1EJ3A 1B8CA 4JPZB 5HLOA 2KI4C 2HETA 1GQMA 2ZRTA 1J7OA 1C07A 1CKKA 5FYXA 1QVIY 1DJZA 1CLLA 2K2FA 1NX0A 1SYMA 3SIBA 1BU3A 5KSZA 1IGVA 1FW4A 1TCOB 3D0YA 4HRHA 2LVIA 4PHMA 4AOMA 5IBWA 1XA5A 4C0KA 2LHLA 2TN4A 2F2PA 3O6BA 1KK7Z 3DF0B 1BLQA 3MSEB 2GGMA 4XJKA 3FIAA 2LMTA 2KHNA 5I2QA 4YGEB 3EK8A 5K89A 2M97A 1QS7A 4N5XA 2JZIA 3IF7A 3FWBA 1F55A 1NCZA 3C1VA 2FCEA 3GK4X 3JTDC 2K2AA 2DOQA 2F8PA 1OMRA 1S5GY 2SASA 2P6BB 2ZN9A 3HX4A 2B1UA 2KFGA 2FOTA 3EK7A 1KWOB 1H8BA 1XO5A 3NSOA 1NWDA 2KNEA 1DMOA 2KBMA 2EGDA 1R2UA 1LA0A 2GGZA 1K2HA 1Y1XA 1QTXA 1M46A 1K93D 1SRAA 2QPTA 5HKWA 2M1KB 1TIZA 2OS8C 3VRRA 2LC5A 1JWDA 1B7TZ 1TRFA 4HSZA 1LXFC 1QJTA 1TNXA 1U5IB 2MA2A 2BE6A 2F3ZA 3CWGA 5DKQA 1RECA 2CXJA 2LCPA 1N65A 1F54A 1EXRA 1SMGA 2KQYA 1DTLA 4DS7A 1NPQA 4PHNA 5DKRA 3DVMA 1BG1A 4GNKB 1A2XA 1KSOA 4A4CA 1CNPA 3PALA 1S3PA 4UPGA 2K61A 2HPSA 1QVIZ 1XFZO 1Y0VH 1TCFA 3OHMB 2JT8A 1AJ4A 3EKJA 1SNLA 1XFVO 2BKIB 5I8NA 1KFXL 4WRIA 1NIWA 5DKNA 1PVAA 1WRLA 3I5HB 3PN7B 1DJXA 1B8LA 2BCXA 2NXQA 1YRUB 3KHEA 3OB2B 4ORCB 3IQQA 5F6TA 1J7QA 1KQMB 1WRZA 1DGVA 2WCFA 1CB1A 5CPVA 3DVEA 2BBMA 1IRJA 1TNPA 2PSRA 3LLEA 2OPOA 5D69A 3VRNA 3LCPC 2JNFA 1CFDA 3BUOB 1K96A 4M2OA 2L50A 3I5GC 1WLZA 1K94A 1CTRA 1NP8A 2SCPA 3GOFA 1JF0A 1JSAA 4YRUA 2Y1NA 1XK4A 4YI9A 2MBXA 1BOCA 1S6IA 1AK8A 1CFCA 1OE9B 5AERA 5B8IB 5JOLA 1TTXA 4NDBA 3TUYC 1CDPA 2KI4B 5JJGA 1SKTA 1SY9A 4IL1A 2Y1MA 1SPYA 2JRFA 1A03A 1F8HA 2AAOA 2LE9B 2HQ8A 5J3XA 5I2OA 2WC8A 3SG3A 1F71A 1B7TY 1GJYA 1YRTB 2LVJA 4A4BA 1NCXA 1YUTA 3CR5X 4Q04A 2PMYA 4ICBA 1CLBA 1UHKA 3K21A 1W7IB 4I5NB 1G33A 1KQVA 1RJVA 3WNXB 1DJIA 1A75B 2BECA 1D1OA 1B8RA 1YVLA 5PALA 2OTGC 2LVKA 3PATA 3AKAA 3F45A 3I5IC 1BR1B 3JTDB 4NQGA 4AQIA 3VRPA 1QX5B 2G9BA 1NX3A 4MBEA 2KYCA 5CSFA 1WRKA 2JXCA 2KBIA 1RFJA 2KI6C 4QJ5B 2WCBA 3IQOA 1QLKA 2JTZA 1LKJA 3VRQA 1CDNA 1SR6C 2NCPA 4MZJA 4MN0A 1DF0B 2WNDA 2COLB 4FQOA 1XK4C 3BUMB 2LVVA 3CZTX 2WCEA 4JQ0D 1HT9A 2IS9A 5AFPA 1KK8C 1UHHA 4JWQA 4AQJA 1B4CA 1NUBA 4I5JA 3GK2A 2JXLA 2OS8B 4DIRA 2K0JA 5AEQA 1WY9A 3BUNB 3EVVA 1N2DA 2E30A 1OOJA 4GBAA 1J7PA 3LL8B 2HF5A 4GFTA 2LM5A 1TNWA 1TOPA 1YX8A 3TS5C 1N0YA 2LLTA 3D0YB 1OZSA 4YBHB 4CLNA 1BODA 3KF9A 2KOTA 4OKHA 5AXIA 4ZCUA 1Y1AA 1ZACA 2LNKA 3EVUA 1K90D 2M1UA 4DUQA 4XJKB 1HQVA 2KDHA 5KTYA 1V1FA 2D8NA 1QXPA 3NSIA 4MZKA 1K9UA 4CFRA 1AP4A 4OVNF 3E3RA 2L4HA 4QJ3B 1JUOA 1C7WA 3TDIA 1GGZA 1DGUA 2I94A 3HCMA 4CPVA 3GK1A 1XFWO 1UHJA 2K7BA 2ZN8A 4ZCVA 3DVKA 1RWYA 4YGBB 1CM1A 2JPTA 2M8UA 4P5OE 2L0PA 4DCKA 1RTP1 4PE0A 2EC6C 1F70A 1S36A 3LK1A 1GGWA 2R2IA 4PE4A 2LHIA 2HQWA 1YUSA 4MSPA 4BY4A 3A4UB 1J1DA 1EG4A 1IH0A
chains in the Genus database with same CATH superfamily
2LMUA 3I5GB 2KGBC 2LV7A 2Q91A 1S26D 2ZRSA 1PSRA 4N1GA 5ER5A 2KI6D 1FI6A 2BL0C 1BMOA 1S6JA 5HYDA 3D76A 2JT3A 1EG3A 1PULA 3BUXB 1CFPA 1OMDA 2BAPA 4M2PA 2ZFDA 1K8UA 1PSBA 2K8MB 3TUYB 1BT6A 2LLSA 1KFXS 1OSAA 2WCMA 5BPJA 1A29A 2PASA 1IIOA 1DVIA 1IWQA 2LUCA 3I5FC 2LMVA 2AUCA 1DELA 2L98A 1XYDA 4GPLB 2KLEA 4MRXA 2JTTA 3BOWA 1JBAA 2BBNA 3ZNIA 3JVTC 2NLNA 1EH2A 3PM8A 1UHIA 1S6CA 4GGFA 4PE7A 3WXAA 3ZWHA 4F7FA 3UNWA 2L2EA 3BFAA 1M39A 3DY9A 1QX2A 2KLDA 2M7LA 2F3YA 1J7RA 1C3ZA 1TNQA 3KPXA 4JD9A 1DT7B 1B1GA 1CMGA 2PALA 2OTGB 3L4LA 1FF1A 1DJWA 3I5IB 2L51A 2I7AA 4PCWA 3CS1A 1V1GA 1J55A 3OP0A 3CR2A 1KFUL 2M0RA 2BCBA 2V53A 3EK4A 3NHIA 4NDDA 2CT9A 1FI5A 2M9GA 1SCVA 1IKUA 3A8RA 4WQ3A 3CR4X 3D10A 2L4IA 2MLFC 1SR6B 2I18A 3SS4A 1K9PA 1AUIB 4MEWA 2ZNDA 2Y5IA 4CFQA 5FI6A 1WDCC 2KPHA 1NCYA 2M3WA 5CSJA 4C0LA 1KK8B 1Q80A 2JC2A 3FS7A 1YUUA 1LVCD 1SK6D 1DJHA 4DRWA 1DQEA 3S0AA 1H4BA 2KYFA 2NCOA 1DJYA 2I2RE 3SS3A 1CMFA 1QV1A 3BJHA 5TNCA 4PDZA 2RGIA 1YR5A 2P71A 3K1EA 4YGDB 4YGCB 3WHTB 2M49B 2LUXA 2QEHA 1JF2A 1SL9A 3OX5A 3TS5B 1F4OA 2JU0A 2O5GA 2ZKMX 2MJWB 1SBJA 1ZOTB 2LP2A 4GGNA 4OZDA 2JPOA 3PFVA 1AVSA 2LP3A 2WOSA 3SG6A 3SG7A 4YI8A 1XFUO 3RLZA 3DF0A 3KEVA 4N1FA 3B7AA 4GGFC 1PRWA 4OR9B 3QRXA 4FTGA 5CSNA 2H61A 3OB1B 2JQ6A 1S1EA 2F2OA 2GTEA 2KFHA 3CLNA 5D7FA 4KYNA 1VRKA 1L2OC 2BKHB 3TZ1A 3AAJA 2QEOA 5CSIA 1QLSA 1OQPA 2F33A 4CIDA 4HREE 1MWNA 1AHRA 1PK0D 4E68A 1MXLC 2KAYA 3TDZA 1SCMC 3FWCA 2QACA 3S0DA 1J1EA 4MRYA 3CZ1A 1K9KA 1ZUZA 1ODBA 5FI2A 1YX7A 3OX6A 4MLWA 1KCYA 1IQ3A 3ICBA 4HRGA 3PM2A 3OGNA 4WQ2A 1KSMA 3VGOA 4PT1A 4U8DA 2EC6B 3D73A 3EVRA 2JOJA 4F0ZB 4XYNA 3SIAA 5HKYA 2WCLA 5GQQC 4MZLA 4C0JA 1RK9A 1IJ6A 4GAOA 3CTNA 1CFFA 1MR8A 2CCMA 3AKBA 1IG5A 2M7NA 1XVJA 2BL0B 2JWWA 1U5IA 3AAKA 2EHBA 2P70A 4MVFA 4P2YB 3SG4A 3H4SE 2JNXA 2FJUB 3TDUA 1MXEA 1M63B 3EG5B 1IQ5A 3SG2A 1TN4A 1ALWA 3O78A 1EL4A 2CBLA 2JULA 1F4QA 1NX2A 3I5FB 2H61C 3SJSA 1PALA 1R6PA 4BY5A 1CM4A 1MQ1A 1SL8A 1W9ZA 4GUKA 4QJ4B 3JVTB 2WORA 1OZOA 1YVHA 3B88A 1M31A 2WCKA 1X02A 2KAXA 4ETOA 1UURA 2FJYA 4YGAA 1XFXO 1QIVA 1PVBA 1QIWA 1WLMA 1AJ5A 1JFJA 1UWOA 1FBVA 2CNPA 2ERBA 3NXAA 1B9AA 2BCAA 1UUSA 1KWOC 2M29A 1Z2CB 2NZ0A 3DD4A 1ALVA 2ZNEA 1ZMZA 5HLVA 3M0WA 1C7VA 4ORBB 2MRDA 4R1EA 2BE4A 1JFKA 2VRGA 3BQ3A 3FE9A 5I2LA 1LA3A 1CDLA 3CYZA 2K7DA 2A4JA 1JC2A 1G4YR 2QDIA 2JT0A 3NGVA 5I94A 1CDMA 4D1EA 3CABA 4L9MA 3SS5A 1BR4B 1WDCB 1XFYO 3WHUB 2KAVA 3PSRA 4I5KA 4USLA 1CLMA 1E8AA 1NYAA 2K7CA 2MHHA 2O60A 2PVBA 2Q4UA 4INWA 5AANA 5KSZA 1A4PA 1KK7Y 2KQ6A 3SG5A 1QV0A 1QX7A 2MAZA 2GV5A 1M45A 3VROA 4NDCA 1SW8A 1MHOA 3RM1A 1QATA 1YTZC 1S5GZ 1UP5A 5ER4X 3DVJA 1G8IA 5D3OA 1YURA 3BYAA 5HL1A 1MF8B 2G2BA 1TUJA 1SL7A 1L7ZA 3BOWB 4OCIA 3KO0A 2K7OA 1K95A 4I5LB 2LANA 1RROA 3PLFB 2FCDA 2KFFA 3NSKA 3O4YA 1W7JB 4FQTA 3I5HC 3PN7C 2Y4QA 4ORAB 1Y1UA 1KFUS 1B47A 1A75A 2H2KA 1BJFA 2KGRA 4IJ7A 2E6WA 1BF5A 1Y6WA 1L2OB 2CTNA 2PYQA 2KSPA 1KQMC 3BUWB 4OV2A 2LAPA 4PE1A 5EL2A 4PALA 1OMVA 5DICA 1MUXA 2H8VA 1SCMB 3CGAA 3NSLA 4PHKA 1NX1A 3BXKA 2AMIA 2LLUA 2PRUA 2ISDA 5HKZA 1QASA 3LK0A 1FPWA 3D74A 1OOGA 1DF0A 1DJGA 5KU1A 1UHNA 1LINA 2L5XB 4PHJA 4M2QA 3B6XA 2MLEC 3O2PA 5G08A 1NSHA 2WCJA 1ZFSA 1IJ5A 4TNCA 3EKHA 1EJ3A 1B8CA 4JPZB 5HLOA 2KI4C 2HETA 1GQMA 1ORGA 2ZRTA 1J7OA 1C07A 1CKKA 5FYXA 1QVIY 1DJZA 1CLLA 2K2FA 1NX0A 1SYMA 3SIBA 1BU3A 2WC6A 1IGVA 1FW4A 1TCOB 3D0YA 4HRHA 2LVIA 4PHMA 4AOMA 5IBWA 1XA5A 4C0KA 2LHLA 2TN4A 2F2PA 3O6BA 1KK7Z 3DF0B 1BLQA 3MSEB 2GGMA 4XJKA 3FIAA 2LMTA 3V2LA 2KHNA 5I2QA 4YGEB 3EK8A 3BFHA 3S0GA 5K89A 2M97A 1QS7A 3CDNA 4N5XA 2JZIA 3IF7A 3FWBA 1F55A 1NCZA 3C1VA 2FCEA 3DZTA 3GK4X 3JTDC 2K2AA 2DOQA 2F8PA 1OMRA 1S5GY 2SASA 3S0FA 2P6BB 2ZN9A 3HX4A 2B1UA 3D77A 1C3YA 2KFGA 2FOTA 3EK7A 1KWOB 1H8BA 2BNXA 1XO5A 3NSOA 3S0BA 1NWDA 2KNEA 1DMOA 2KBMA 2EGDA 2QEBA 1R2UA 1LA0A 2GGZA 4INXA 1Y1XA 1QTXA 1K2HA 1M46A 1K93D 1SRAA 2QPTA 5HKWA 2M1KB 3B86A 1TIZA 2OS8C 3VRRA 3D75A 2LC5A 1JWDA 1B7TZ 1TRFA 4HSZA 2WC5A 1LXFC 1QJTA 1TNXA 1U5IB 2MA2A 1OW4A 2BE6A 3DYEA 2F3ZA 3CWGA 5DKQA 1RECA 2CXJA 2LCPA 1N65A 1F54A 3IVTA 1EXRA 1SMGA 2KQYA 5FI7A 1DTLA 4DS7A 1NPQA 3R72A 4PHNA 3DVMA 2YGUA 5DKRA 1BG1A 4GNKB 1A2XA 1KSOA 4A4CA 1DC1A 3PALA 1CNPA 3VB1A 1S3PA 4UPGA 2K61A 2HPSA 1QVIZ 1XFZO 3R1OA 1Y0VH 1TCFA 2L2CA 3OHMB 2JT8A 1AJ4A 3EKJA 1SNLA 1XFVO 2BKIB 5I8NA 1KFXL 4WRIA 1NIWA 5DKNA 1PVAA 1WRLA 3I5HB 3PN7B 1DJXA 1B8LA 2BCXA 2NXQA 1YRUB 3KHEA 3OB2B 4ORCB 3QMEA 3IQQA 5F6TA 1J7QA 1TUZA 1KQMB 1WRZA 1DGVA 2WCFA 1OOIX 1CB1A 5CPVA 3DVEA 2BBMA 1IRJA 1LS8A 1TNPA 2PSRA 3LLEA 2OPOA 5D69A 3VRNA 3BFBA 3LCPC 2JNFA 1CFDA 3BUOB 1K96A 1OOHA 4M2OA 2L50A 3I5GC 1WLZA 1K94A 1CTRA 1NP8A 2SCPA 3D78A 3GOFA 1XFRA 1JF0A 1JSAA 4YRUA 2Y1NA 1XK4A 4YI9A 2MBXA 1BOCA 1S6IA 1AK8A 1CFCA 1OE9B 5AERA 5B8IB 5JOLA 1TTXA 1QWVA 4NDBA 3TUYC 1CDPA 2KI4B 5JJGA 1SKTA 1SY9A 4IL1A 2Y1MA 3B87A 1SPYA 2JRFA 1A03A 1F8HA 2AAOA 2LE9B 2HQ8A 3O4XA 1OOFA 5J3XA 5I2OA 2WC8A 3SG3A 1F71A 1B7TY 1GJYA 1YRTB 2LVJA 4A4BA 1NCXA 1YUTA 3CR5X 3PJIA 2PMYA 2WCHA 4ICBA 1Z4HA 4Q04A 1CLBA 1UHKA 3NHTA 3K21A 1W7IB 4I5NB 1G33A 1KQVA 1RJVA 3WNXB 1DJIA 1A75B 2BECA 3FE8A 3L4AA 1B8RA 1D1OA 1YVLA 5PALA 2OTGC 2LVKA 3PATA 3AKAA 3F45A 3I5IC 1BR1B 3JTDB 4NQGA 4AQIA 3VRPA 1QX5B 2G9BA 1NX3A 4MBEA 1T14A 2KYCA 5CSFA 1WRKA 2JXCA 2KBIA 1RFJA 2KI6C 4QJ5B 2WCBA 3IQOA 1QLKA 2JTZA 3S0EA 1LKJA 3VRQA 3L47A 3OBVA 1CDNA 1SR6C 2NCPA 4MZJA 4MN0A 1DF0B 2WNDA 3CZ2A 2COLB 4FQOA 1XK4C 3RZSA 3BUMB 2LVVA 3CZTX 2WCEA 4JQ0D 1HT9A 2IS9A 5AFPA 1KK8C 1UHHA 4JWQA 4AQJA 1SSEB 3Q8IA 1NUBA 1B4CA 4I5JA 3GK2A 2JXLA 2OS8B 4DIRA 2K0JA 5AEQA 1WY9A 3BUNB 3EVVA 1N2DA 2E30A 1OOJA 4GBAA 1J7PA 3DXLA 3LL8B 2HF5A 4GFTA 2LM5A 1TNWA 1TOPA 1YX8A 3TS5C 1N0YA 3CZ0A 2LLTA 3FE6A 2L5YA 3D0YB 1OZSA 2K60A 4YBHB 1P28A 4CLNA 1BODA 3KF9A 2KOTA 4OKHA 5AXIA 4ZCUA 1Y1AA 1ZACA 2LNKA 3EVUA 1K90D 2M1UA 4DUQA 4XJKB 1HQVA 2KDHA 5KTYA 1V1FA 2D8NA 1QXPA 4JKTA 3NSIA 4MZKA 1K9UA 1TWOA 4CFRA 1AP4A 4OVNF 3E3RA 2L4HA 4QJ3B 1GM0A 1JUOA 1C7WA 3TDIA 1GGZA 1DGUA 2I94A 3HCMA 4CPVA 3GK1A 1XFWO 1UHJA 2K7BA 2ZN8A 4ZCVA 2PQLA 3DVKA 1RWYA 4YGBB 1CM1A 2JPTA 1DEKA 2M8UA 4P5OE 2L0PA 4DCKA 1RTP1 4PE0A 2EC6C 3R1PA 3UO9A 1S36A 3LK1A 3N7HA 2R2IA 1F70A 1GGWA 4PE4A 2LHIA 3R1VA 2HQWA 1YUSA 4MSPA 4BY4A 2QEVA 1J1DA 3A4UB 1EG4A 1IH0A
chains in the Genus database with same CATH topology
2LMUA 3I5GB 2KGBC 2LV7A 2Q91A 1S26D 2ZRSA 1PSRA 4N1GA 5ER5A 2KI6D 1FI6A 2BL0C 1BMOA 1S6JA 5HYDA 2JT3A 1EG3A 1PULA 3BUXB 1CFPA 1OMDA 4M2PA 2ZFDA 1K8UA 1PSBA 2K8MB 3TUYB 1BT6A 2LLSA 1KFXS 1OSAA 5BPJA 1A29A 2PASA 1DVIA 1IWQA 2LUCA 3I5FC 2LMVA 2AUCA 2L98A 1XYDA 4GPLB 4MRXA 2JTTA 3BOWA 1JBAA 2BBNA 3ZNIA 3JVTC 2NLNA 1EH2A 3PM8A 1UHIA 1S6CA 4GGFA 4PE7A 3WXAA 3ZWHA 2L2EA 1M39A 1QX2A 2M7LA 2F3YA 1J7RA 1TNQA 3KPXA 1B1GA 1DT7B 1CMGA 2PALA 2OTGB 1FF1A 1DJWA 3I5IB 2L51A 2I7AA 4PCWA 3CS1A 1V1GA 1J55A 3OP0A 3CR2A 1KFUL 2M0RA 2BCBA 2V53A 3EK4A 4NDDA 2CT9A 1FI5A 2M9GA 1SCVA 1IKUA 3A8RA 4WQ3A 3CR4X 3D10A 2L4IA 2MLFC 1SR6B 2I18A 1K9PA 1AUIB 4MEWA 2ZNDA 2Y5IA 4CFQA 1WDCC 1NCYA 2M3WA 5CSJA 4C0LA 1KK8B 1Q80A 2JC2A 3FS7A 1YUUA 1LVCD 1SK6D 1DJHA 4DRWA 1H4BA 2KYFA 2NCOA 1DJYA 2I2RE 1CMFA 1QV1A 5TNCA 4PDZA 2RGIA 1YR5A 4YGDB 4YGCB 3WHTB 2M49B 2LUXA 1JF2A 1SL9A 3OX5A 3TS5B 1F4OA 2JU0A 2O5GA 2ZKMX 2MJWB 1SBJA 1ZOTB 2LP2A 4GGNA 3PFVA 1AVSA 2LP3A 2WOSA 3SG6A 3SG7A 4YI8A 1XFUO 3RLZA 3DF0A 3KEVA 4N1FA 4GGFC 1PRWA 4OR9B 3QRXA 4FTGA 5CSNA 2H61A 3OB1B 2JQ6A 1S1EA 2F2OA 3CLNA 2KFHA 5D7FA 1VRKA 1L2OC 2BKHB 3TZ1A 3AAJA 5CSIA 1QLSA 1OQPA 2F33A 4CIDA 4HREE 1MWNA 1AHRA 1PK0D 4E68A 1MXLC 2KAYA 3TDZA 1SCMC 3FWCA 2QACA 1J1EA 4MRYA 1K9KA 1ZUZA 1ODBA 1YX7A 3OX6A 4MLWA 1KCYA 1IQ3A 3ICBA 4HRGA 4WQ2A 1KSMA 3VGOA 4U8DA 2EC6B 3EVRA 2JOJA 4F0ZB 4XYNA 3SIAA 5HKYA 5GQQC 4MZLA 4C0JA 1RK9A 1IJ6A 4GAOA 3CTNA 1CFFA 1MR8A 2CCMA 3AKBA 1IG5A 2M7NA 1XVJA 2BL0B 2JWWA 1U5IA 3AAKA 2EHBA 4MVFA 4P2YB 3SG4A 3H4SE 2JNXA 2FJUB 3TDUA 1MXEA 1M63B 1IQ5A 3SG2A 1TN4A 1ALWA 3O78A 1EL4A 2CBLA 2JULA 1F4QA 1NX2A 3I5FB 2H61C 3SJSA 1PALA 1R6PA 4BY5A 1CM4A 1MQ1A 1SL8A 4GUKA 4QJ4B 3JVTB 2WORA 1OZOA 1YVHA 1M31A 1X02A 2KAXA 4ETOA 1UURA 4YGAA 1XFXO 1QIVA 1PVBA 1QIWA 1WLMA 1AJ5A 1JFJA 1UWOA 1FBVA 2CNPA 3NXAA 1B9AA 2BCAA 1UUSA 1KWOC 2M29A 3DD4A 2NZ0A 1ALVA 2ZNEA 1ZMZA 5HLVA 3M0WA 1C7VA 4ORBB 2MRDA 4R1EA 2BE4A 1JFKA 2VRGA 3BQ3A 5I2LA 1LA3A 1CDLA 2K7DA 2A4JA 1JC2A 1G4YR 2JT0A 1CDMA 4D1EA 4L9MA 1BR4B 1WDCB 1XFYO 3WHUB 2KAVA 3PSRA 4I5KA 4USLA 1CLMA 1E8AA 1NYAA 2K7CA 2MHHA 2O60A 2PVBA 2Q4UA 5AANA 1A4PA 1KK7Y 2KQ6A 3SG5A 1QV0A 1QX7A 2MAZA 2GV5A 1M45A 3VROA 4NDCA 1SW8A 1MHOA 3RM1A 1QATA 1YTZC 1S5GZ 1UP5A 5ER4X 3DVJA 1G8IA 1YURA 3BYAA 1MF8B 2G2BA 4OCIA 1SL7A 1L7ZA 3BOWB 3KO0A 2K7OA 1K95A 4I5LB 2LANA 1RROA 3PLFB 2FCDA 2KFFA 3NSKA 3O4YA 1W7JB 4ORAB 3I5HC 3PN7C 2Y4QA 1Y1UA 1KFUS 1B47A 1A75A 2H2KA 1BJFA 2KGRA 2E6WA 1BF5A 1Y6WA 1L2OB 2CTNA 2KSPA 1KQMC 3BUWB 4OV2A 2LAPA 4PE1A 4PALA 1OMVA 1MUXA 1SCMB 3CGAA 3NSLA 4PHKA 1NX1A 3BXKA 2AMIA 2LLUA 2PRUA 2ISDA 5HKZA 1QASA 3LK0A 1FPWA 1DF0A 1DJGA 5KU1A 1UHNA 1LINA 2L5XB 4PHJA 4M2QA 2MLEC 3O2PA 5G08A 1NSHA 1ZFSA 1IJ5A 4TNCA 3EKHA 1EJ3A 1B8CA 4JPZB 5HLOA 2KI4C 2HETA 1GQMA 2ZRTA 1J7OA 1C07A 1CKKA 5FYXA 1QVIY 1DJZA 1CLLA 2K2FA 1NX0A 1SYMA 3SIBA 1BU3A 5KSZA 1IGVA 1FW4A 1TCOB 3D0YA 4HRHA 2LVIA 4PHMA 4AOMA 5IBWA 1XA5A 4C0KA 2LHLA 2TN4A 2F2PA 3O6BA 1KK7Z 3DF0B 1BLQA 3MSEB 2GGMA 4XJKA 3FIAA 2LMTA 2KHNA 5I2QA 4YGEB 3EK8A 5K89A 2M97A 1QS7A 4N5XA 2JZIA 3IF7A 3FWBA 1F55A 1NCZA 3C1VA 2FCEA 3GK4X 3JTDC 2K2AA 2DOQA 2F8PA 1OMRA 1S5GY 2SASA 2P6BB 2ZN9A 3HX4A 2B1UA 2KFGA 2FOTA 3EK7A 1KWOB 1H8BA 1XO5A 3NSOA 1NWDA 2KNEA 1DMOA 2KBMA 2EGDA 1R2UA 1LA0A 2GGZA 1K2HA 1Y1XA 1QTXA 1M46A 1K93D 1SRAA 2QPTA 5HKWA 2M1KB 1TIZA 2OS8C 3VRRA 2LC5A 1JWDA 1B7TZ 1TRFA 4HSZA 1LXFC 1QJTA 1TNXA 1U5IB 2MA2A 2BE6A 2F3ZA 3CWGA 5DKQA 1RECA 2CXJA 2LCPA 1N65A 1F54A 1EXRA 1SMGA 2KQYA 1DTLA 4DS7A 1NPQA 4PHNA 5DKRA 3DVMA 1BG1A 4GNKB 1A2XA 1KSOA 4A4CA 1CNPA 3PALA 1S3PA 4UPGA 2K61A 2HPSA 1QVIZ 1XFZO 1Y0VH 1TCFA 3OHMB 2JT8A 1AJ4A 3EKJA 1SNLA 1XFVO 2BKIB 5I8NA 1KFXL 4WRIA 1NIWA 5DKNA 1PVAA 1WRLA 3I5HB 3PN7B 1DJXA 1B8LA 2BCXA 2NXQA 1YRUB 3KHEA 3OB2B 4ORCB 3IQQA 5F6TA 1J7QA 1KQMB 1WRZA 1DGVA 2WCFA 1CB1A 5CPVA 3DVEA 2BBMA 1IRJA 1TNPA 2PSRA 3LLEA 2OPOA 5D69A 3VRNA 3LCPC 2JNFA 1CFDA 3BUOB 1K96A 4M2OA 2L50A 3I5GC 1WLZA 1K94A 1CTRA 1NP8A 2SCPA 3GOFA 1JF0A 1JSAA 4YRUA 2Y1NA 1XK4A 4YI9A 2MBXA 1BOCA 1S6IA 1AK8A 1CFCA 1OE9B 5AERA 5B8IB 5JOLA 1TTXA 4NDBA 3TUYC 1CDPA 2KI4B 5JJGA 1SKTA 1SY9A 4IL1A 2Y1MA 1SPYA 2JRFA 1A03A 1F8HA 2AAOA 2LE9B 2HQ8A 5J3XA 5I2OA 2WC8A 3SG3A 1F71A 1B7TY 1GJYA 1YRTB 2LVJA 4A4BA 1NCXA 1YUTA 3CR5X 4Q04A 2PMYA 4ICBA 1CLBA 1UHKA 3K21A 1W7IB 4I5NB 1G33A 1KQVA 1RJVA 3WNXB 1DJIA 1A75B 2BECA 1D1OA 1B8RA 1YVLA 5PALA 2OTGC 2LVKA 3PATA 3AKAA 3F45A 3I5IC 1BR1B 3JTDB 4NQGA 4AQIA 3VRPA 1QX5B 2G9BA 1NX3A 4MBEA 2KYCA 5CSFA 1WRKA 2JXCA 2KBIA 1RFJA 2KI6C 4QJ5B 2WCBA 3IQOA 1QLKA 2JTZA 1LKJA 3VRQA 1CDNA 1SR6C 2NCPA 4MZJA 4MN0A 1DF0B 2WNDA 2COLB 4FQOA 1XK4C 3BUMB 2LVVA 3CZTX 2WCEA 4JQ0D 1HT9A 2IS9A 5AFPA 1KK8C 1UHHA 4JWQA 4AQJA 1B4CA 1NUBA 4I5JA 3GK2A 2JXLA 2OS8B 4DIRA 2K0JA 5AEQA 1WY9A 3BUNB 3EVVA 1N2DA 2E30A 1OOJA 4GBAA 1J7PA 3LL8B 2HF5A 4GFTA 2LM5A 1TNWA 1TOPA 1YX8A 3TS5C 1N0YA 2LLTA 3D0YB 1OZSA 4YBHB 4CLNA 1BODA 3KF9A 2KOTA 4OKHA 5AXIA 4ZCUA 1Y1AA 1ZACA 2LNKA 3EVUA 1K90D 2M1UA 4DUQA 4XJKB 1HQVA 2KDHA 5KTYA 1V1FA 2D8NA 1QXPA 3NSIA 4MZKA 1K9UA 4CFRA 1AP4A 4OVNF 3E3RA 2L4HA 4QJ3B 1JUOA 1C7WA 3TDIA 1GGZA 1DGUA 2I94A 3HCMA 4CPVA 3GK1A 1XFWO 1UHJA 2K7BA 2ZN8A 4ZCVA 3DVKA 1RWYA 4YGBB 1CM1A 2JPTA 2M8UA 4P5OE 2L0PA 4DCKA 1RTP1 4PE0A 2EC6C 1F70A 1S36A 3LK1A 1GGWA 2R2IA 4PE4A 2LHIA 2HQWA 1YUSA 4MSPA 4BY4A 3A4UB 1J1DA 1EG4A 1IH0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LMU A;  3I5G B;  2KGB C;  2LV7 A;  2Q91 A;  1S26 D;  2ZRS A;  1PSR A;  4N1G A;  5ER5 A;  2KI6 D;  1FI6 A;  2BL0 C;  1BMO A;  1S6J A;  5HYD A;  2JT3 A;  1EG3 A;  1PUL A;  3BUX B;  1CFP A;  1OMD A;  4M2P A;  2ZFD A;  1K8U A;  1PSB A;  2K8M B;  3TUY B;  1BT6 A;  2LLS A;  1KFX S;  1OSA A;  5BPJ A;  1A29 A;  2PAS A;  1DVI A;  1IWQ A;  2LUC A;  3I5F C;  2LMV A;  2AUC A;  2L98 A;  1XYD A;  4GPL B;  4MRX A;  2JTT A;  3BOW A;  1JBA A;  2BBN A;  3ZNI A;  3JVT C;  2NLN A;  1EH2 A;  3PM8 A;  1UHI A;  1S6C A;  4GGF A;  4PE7 A;  3WXA A;  3ZWH A;  2L2E A;  1M39 A;  1QX2 A;  2M7L A;  2F3Y A;  1J7R A;  1TNQ A;  3KPX A;  1B1G A;  1DT7 B;  1CMG A;  2PAL A;  2OTG B;  1FF1 A;  1DJW A;  3I5I B;  2L51 A;  2I7A A;  4PCW A;  3CS1 A;  1V1G A;  1J55 A;  3OP0 A;  3CR2 A;  1KFU L;  2M0R A;  2BCB A;  2V53 A;  3EK4 A;  4NDD A;  2CT9 A;  1FI5 A;  2M9G A;  1SCV A;  1IKU A;  3A8R A;  4WQ3 A;  3CR4 X;  3D10 A;  2L4I A;  2MLF C;  1SR6 B;  2I18 A;  1K9P A;  1AUI B;  4MEW A;  2ZND A;  2Y5I A;  4CFQ A;  1WDC C;  1NCY A;  2M3W A;  5CSJ A;  4C0L A;  1KK8 B;  1Q80 A;  2JC2 A;  3FS7 A;  1YUU A;  1LVC D;  1SK6 D;  1DJH A;  4DRW A;  1H4B A;  2KYF A;  2NCO A;  1DJY A;  2I2R E;  1CMF A;  1QV1 A;  5TNC A;  4PDZ A;  2RGI A;  1YR5 A;  4YGD B;  4YGC B;  3WHT B;  2M49 B;  2LUX A;  1JF2 A;  1SL9 A;  3OX5 A;  3TS5 B;  1F4O A;  2JU0 A;  2O5G A;  2ZKM X;  2MJW B;  1SBJ A;  1ZOT B;  2LP2 A;  4GGN A;  3PFV A;  1AVS A;  2LP3 A;  2WOS A;  3SG6 A;  3SG7 A;  4YI8 A;  1XFU O;  3RLZ A;  3DF0 A;  3KEV A;  4N1F A;  4GGF C;  1PRW A;  4OR9 B;  3QRX A;  4FTG A;  5CSN A;  2H61 A;  3OB1 B;  2JQ6 A;  1S1E A;  2F2O A;  3CLN A;  2KFH A;  5D7F A;  1VRK A;  1L2O C;  2BKH B;  3TZ1 A;  3AAJ A;  5CSI A;  1QLS A;  1OQP A;  2F33 A;  4CID A;  4HRE E;  1MWN A;  1AHR A;  1PK0 D;  4E68 A;  1MXL C;  2KAY A;  3TDZ A;  1SCM C;  3FWC A;  2QAC A;  1J1E A;  4MRY A;  1K9K A;  1ZUZ A;  1ODB A;  1YX7 A;  3OX6 A;  4MLW A;  1KCY A;  1IQ3 A;  3ICB A;  4HRG A;  4WQ2 A;  1KSM A;  3VGO A;  4U8D A;  2EC6 B;  3EVR A;  2JOJ A;  4F0Z B;  4XYN A;  3SIA A;  5HKY A;  5GQQ C;  4MZL A;  4C0J A;  1RK9 A;  1IJ6 A;  4GAO A;  3CTN A;  1CFF A;  1MR8 A;  2CCM A;  3AKB A;  1IG5 A;  2M7N A;  1XVJ A;  2BL0 B;  2JWW A;  1U5I A;  3AAK A;  2EHB A;  4MVF A;  4P2Y B;  3SG4 A;  3H4S E;  2JNX A;  2FJU B;  3TDU A;  1MXE A;  1M63 B;  1IQ5 A;  3SG2 A;  1TN4 A;  1ALW A;  3O78 A;  1EL4 A;  2CBL A;  2JUL A;  1F4Q A;  1NX2 A;  3I5F B;  2H61 C;  3SJS A;  1PAL A;  1R6P A;  4BY5 A;  1CM4 A;  1MQ1 A;  1SL8 A;  4GUK A;  4QJ4 B;  3JVT B;  2WOR A;  1OZO A;  1YVH A;  1M31 A;  1X02 A;  2KAX A;  4ETO A;  1UUR A;  4YGA A;  1XFX O;  1QIV A;  1PVB A;  1QIW A;  1WLM A;  1AJ5 A;  1JFJ A;  1UWO A;  1FBV A;  2CNP A;  3NXA A;  1B9A A;  2BCA A;  1UUS A;  1KWO C;  2M29 A;  3DD4 A;  2NZ0 A;  1ALV A;  2ZNE A;  1ZMZ A;  5HLV A;  3M0W A;  1C7V A;  4ORB B;  2MRD A;  4R1E A;  2BE4 A;  1JFK A;  2VRG A;  3BQ3 A;  5I2L A;  1LA3 A;  1CDL A;  2K7D A;  2A4J A;  1JC2 A;  1G4Y R;  2JT0 A;  1CDM A;  4D1E A;  4L9M A;  1BR4 B;  1WDC B;  1XFY O;  3WHU B;  2KAV A;  3PSR A;  4I5K A;  4USL A;  1CLM A;  1E8A A;  1NYA A;  2K7C A;  2MHH A;  2O60 A;  2PVB A;  2Q4U A;  5AAN A;  1A4P A;  1KK7 Y;  2KQ6 A;  3SG5 A;  1QV0 A;  1QX7 A;  2MAZ A;  2GV5 A;  1M45 A;  3VRO A;  4NDC A;  1SW8 A;  1MHO A;  3RM1 A;  1QAT A;  1YTZ C;  1S5G Z;  1UP5 A;  5ER4 X;  3DVJ A;  1G8I A;  1YUR A;  3BYA A;  1MF8 B;  2G2B A;  4OCI A;  1SL7 A;  1L7Z A;  3BOW B;  3KO0 A;  2K7O A;  1K95 A;  4I5L B;  2LAN A;  1RRO A;  3PLF B;  2FCD A;  2KFF A;  3NSK A;  3O4Y A;  1W7J B;  4ORA B;  3I5H C;  3PN7 C;  2Y4Q A;  1Y1U A;  1KFU S;  1B47 A;  1A75 A;  2H2K A;  1BJF A;  2KGR A;  2E6W A;  1BF5 A;  1Y6W A;  1L2O B;  2CTN A;  2KSP A;  1KQM C;  3BUW B;  4OV2 A;  2LAP A;  4PE1 A;  4PAL A;  1OMV A;  1MUX A;  1SCM B;  3CGA A;  3NSL A;  4PHK A;  1NX1 A;  3BXK A;  2AMI A;  2LLU A;  2PRU A;  2ISD A;  5HKZ A;  1QAS A;  3LK0 A;  1FPW A;  1DF0 A;  1DJG A;  5KU1 A;  1UHN A;  1LIN A;  2L5X B;  4PHJ A;  4M2Q A;  2MLE C;  3O2P A;  5G08 A;  1NSH A;  1ZFS A;  1IJ5 A;  4TNC A;  3EKH A;  1EJ3 A;  1B8C A;  4JPZ B;  5HLO A;  2KI4 C;  2HET A;  1GQM A;  2ZRT A;  1J7O A;  1C07 A;  1CKK A;  5FYX A;  1QVI Y;  1DJZ A;  1CLL A;  2K2F A;  1NX0 A;  1SYM A;  3SIB A;  1BU3 A;  5KSZ A;  1IGV A;  1FW4 A;  1TCO B;  3D0Y A;  4HRH A;  2LVI A;  4PHM A;  4AOM A;  5IBW A;  1XA5 A;  4C0K A;  2LHL A;  2TN4 A;  2F2P A;  3O6B A;  1KK7 Z;  3DF0 B;  1BLQ A;  3MSE B;  2GGM A;  4XJK A;  3FIA A;  2LMT A;  2KHN A;  5I2Q A;  4YGE B;  3EK8 A;  5K89 A;  2M97 A;  1QS7 A;  4N5X A;  2JZI A;  3IF7 A;  3FWB A;  1F55 A;  1NCZ A;  3C1V A;  2FCE A;  3GK4 X;  3JTD C;  2K2A A;  2DOQ A;  2F8P A;  1OMR A;  1S5G Y;  2SAS A;  2P6B B;  2ZN9 A;  3HX4 A;  2B1U A;  2KFG A;  2FOT A;  3EK7 A;  1KWO B;  1H8B A;  1XO5 A;  3NSO A;  1NWD A;  2KNE A;  1DMO A;  2KBM A;  2EGD A;  1R2U A;  1LA0 A;  2GGZ A;  1K2H A;  1Y1X A;  1QTX A;  1M46 A;  1K93 D;  1SRA A;  2QPT A;  5HKW A;  2M1K B;  1TIZ A;  2OS8 C;  3VRR A;  2LC5 A;  1JWD A;  1B7T Z;  1TRF A;  4HSZ A;  1LXF C;  1QJT A;  1TNX A;  1U5I B;  2MA2 A;  2BE6 A;  2F3Z A;  3CWG A;  5DKQ A;  1REC A;  2CXJ A;  2LCP A;  1N65 A;  1F54 A;  1EXR A;  1SMG A;  2KQY A;  1DTL A;  4DS7 A;  1NPQ A;  4PHN A;  5DKR A;  3DVM A;  1BG1 A;  4GNK B;  1A2X A;  1KSO A;  4A4C A;  1CNP A;  3PAL A;  1S3P A;  4UPG A;  2K61 A;  2HPS A;  1QVI Z;  1XFZ O;  1Y0V H;  1TCF A;  3OHM B;  2JT8 A;  1AJ4 A;  3EKJ A;  1SNL A;  1XFV O;  2BKI B;  5I8N A;  1KFX L;  4WRI A;  1NIW A;  5DKN A;  1PVA A;  1WRL A;  3I5H B;  3PN7 B;  1DJX A;  1B8L A;  2BCX A;  2NXQ A;  1YRU B;  3KHE A;  3OB2 B;  4ORC B;  3IQQ A;  5F6T A;  1J7Q A;  1KQM B;  1WRZ A;  1DGV A;  2WCF A;  1CB1 A;  5CPV A;  3DVE A;  2BBM A;  1IRJ A;  1TNP A;  2PSR A;  3LLE A;  2OPO A;  5D69 A;  3VRN A;  3LCP C;  2JNF A;  1CFD A;  3BUO B;  1K96 A;  4M2O A;  2L50 A;  3I5G C;  1WLZ A;  1K94 A;  1CTR A;  1NP8 A;  2SCP A;  3GOF A;  1JF0 A;  1JSA A;  4YRU A;  2Y1N A;  1XK4 A;  4YI9 A;  2MBX A;  1BOC A;  1S6I A;  1AK8 A;  1CFC A;  1OE9 B;  5AER A;  5B8I B;  5JOL A;  1TTX A;  4NDB A;  3TUY C;  1CDP A;  2KI4 B;  5JJG A;  1SKT A;  1SY9 A;  4IL1 A;  2Y1M A;  1SPY A;  2JRF A;  1A03 A;  1F8H A;  2AAO A;  2LE9 B;  2HQ8 A;  5J3X A;  5I2O A;  2WC8 A;  3SG3 A;  1F71 A;  1B7T Y;  1GJY A;  1YRT B;  2LVJ A;  4A4B A;  1NCX A;  1YUT A;  3CR5 X;  4Q04 A;  2PMY A;  4ICB A;  1CLB A;  1UHK A;  3K21 A;  1W7I B;  4I5N B;  1G33 A;  1KQV A;  1RJV A;  3WNX B;  1DJI A;  1A75 B;  2BEC A;  1D1O A;  1B8R A;  1YVL A;  5PAL A;  2OTG C;  2LVK A;  3PAT A;  3AKA A;  3F45 A;  3I5I C;  1BR1 B;  3JTD B;  4NQG A;  4AQI A;  3VRP A;  1QX5 B;  2G9B A;  1NX3 A;  4MBE A;  2KYC A;  5CSF A;  1WRK A;  2JXC A;  2KBI A;  1RFJ A;  2KI6 C;  4QJ5 B;  2WCB A;  3IQO A;  1QLK A;  2JTZ A;  1LKJ A;  3VRQ A;  1CDN A;  1SR6 C;  2NCP A;  4MZJ A;  4MN0 A;  1DF0 B;  2WND A;  2COL B;  4FQO A;  1XK4 C;  3BUM B;  2LVV A;  3CZT X;  2WCE A;  4JQ0 D;  1HT9 A;  2IS9 A;  5AFP A;  1KK8 C;  1UHH A;  4JWQ A;  4AQJ A;  1B4C A;  1NUB A;  4I5J A;  3GK2 A;  2JXL A;  2OS8 B;  4DIR A;  2K0J A;  5AEQ A;  1WY9 A;  3BUN B;  3EVV A;  1N2D A;  2E30 A;  1OOJ A;  4GBA A;  1J7P A;  3LL8 B;  2HF5 A;  4GFT A;  2LM5 A;  1TNW A;  1TOP A;  1YX8 A;  3TS5 C;  1N0Y A;  2LLT A;  3D0Y B;  1OZS A;  4YBH B;  4CLN A;  1BOD A;  3KF9 A;  2KOT A;  4OKH A;  5AXI A;  4ZCU A;  1Y1A A;  1ZAC A;  2LNK A;  3EVU A;  1K90 D;  2M1U A;  4DUQ A;  4XJK B;  1HQV A;  2KDH A;  5KTY A;  1V1F A;  2D8N A;  1QXP A;  3NSI A;  4MZK A;  1K9U A;  4CFR A;  1AP4 A;  4OVN F;  3E3R A;  2L4H A;  4QJ3 B;  1JUO A;  1C7W A;  3TDI A;  1GGZ A;  1DGU A;  2I94 A;  3HCM A;  4CPV A;  3GK1 A;  1XFW O;  1UHJ A;  2K7B A;  2ZN8 A;  4ZCV A;  3DVK A;  1RWY A;  4YGB B;  1CM1 A;  2JPT A;  2M8U A;  4P5O E;  2L0P A;  4DCK A;  1RTP 1;  4PE0 A;  2EC6 C;  1F70 A;  1S36 A;  3LK1 A;  1GGW A;  2R2I A;  4PE4 A;  2LHI A;  2HQW A;  1YUS A;  4MSP A;  4BY4 A;  3A4U B;  1J1D A;  1EG4 A;  1IH0 A; 
#chains in the Genus database with same CATH topology
 2LMU A;  3I5G B;  2KGB C;  2LV7 A;  2Q91 A;  1S26 D;  2ZRS A;  1PSR A;  4N1G A;  5ER5 A;  2KI6 D;  1FI6 A;  2BL0 C;  1BMO A;  1S6J A;  5HYD A;  3D76 A;  2JT3 A;  1EG3 A;  1PUL A;  3BUX B;  1CFP A;  1OMD A;  2BAP A;  4M2P A;  2ZFD A;  1K8U A;  1PSB A;  2K8M B;  3TUY B;  1BT6 A;  2LLS A;  1KFX S;  1OSA A;  2WCM A;  5BPJ A;  1A29 A;  2PAS A;  1IIO A;  1DVI A;  1IWQ A;  2LUC A;  3I5F C;  2LMV A;  2AUC A;  1DEL A;  2L98 A;  1XYD A;  4GPL B;  2KLE A;  4MRX A;  2JTT A;  3BOW A;  1JBA A;  2BBN A;  3ZNI A;  3JVT C;  2NLN A;  1EH2 A;  3PM8 A;  1UHI A;  1S6C A;  4GGF A;  4PE7 A;  3WXA A;  3ZWH A;  4F7F A;  3UNW A;  2L2E A;  3BFA A;  1M39 A;  3DY9 A;  1QX2 A;  2KLD A;  2M7L A;  2F3Y A;  1J7R A;  1C3Z A;  1TNQ A;  3KPX A;  4JD9 A;  1DT7 B;  1B1G A;  1CMG A;  2PAL A;  2OTG B;  3L4L A;  1FF1 A;  1DJW A;  3I5I B;  2L51 A;  2I7A A;  4PCW A;  3CS1 A;  1V1G A;  1J55 A;  3OP0 A;  3CR2 A;  1KFU L;  2M0R A;  2BCB A;  2V53 A;  3EK4 A;  3NHI A;  4NDD A;  2CT9 A;  1FI5 A;  2M9G A;  1SCV A;  1IKU A;  3A8R A;  4WQ3 A;  3CR4 X;  3D10 A;  2L4I A;  2MLF C;  1SR6 B;  2I18 A;  3SS4 A;  1K9P A;  1AUI B;  4MEW A;  2ZND A;  2Y5I A;  4CFQ A;  5FI6 A;  1WDC C;  2KPH A;  1NCY A;  2M3W A;  5CSJ A;  4C0L A;  1KK8 B;  1Q80 A;  2JC2 A;  3FS7 A;  1YUU A;  1LVC D;  1SK6 D;  1DJH A;  4DRW A;  1DQE A;  3S0A A;  1H4B A;  2KYF A;  2NCO A;  1DJY A;  2I2R E;  3SS3 A;  1CMF A;  1QV1 A;  3BJH A;  5TNC A;  4PDZ A;  2RGI A;  1YR5 A;  2P71 A;  3K1E A;  4YGD B;  4YGC B;  3WHT B;  2M49 B;  2LUX A;  2QEH A;  1JF2 A;  1SL9 A;  3OX5 A;  3TS5 B;  1F4O A;  2JU0 A;  2O5G A;  2ZKM X;  2MJW B;  1SBJ A;  1ZOT B;  2LP2 A;  4GGN A;  4OZD A;  2JPO A;  3PFV A;  1AVS A;  2LP3 A;  2WOS A;  3SG6 A;  3SG7 A;  4YI8 A;  1XFU O;  3RLZ A;  3DF0 A;  3KEV A;  4N1F A;  3B7A A;  4GGF C;  1PRW A;  4OR9 B;  3QRX A;  4FTG A;  5CSN A;  2H61 A;  3OB1 B;  2JQ6 A;  1S1E A;  2F2O A;  2GTE A;  2KFH A;  3CLN A;  5D7F A;  4KYN A;  1VRK A;  1L2O C;  2BKH B;  3TZ1 A;  3AAJ A;  2QEO A;  5CSI A;  1QLS A;  1OQP A;  2F33 A;  4CID A;  4HRE E;  1MWN A;  1AHR A;  1PK0 D;  4E68 A;  1MXL C;  2KAY A;  3TDZ A;  1SCM C;  3FWC A;  2QAC A;  3S0D A;  1J1E A;  4MRY A;  3CZ1 A;  1K9K A;  1ZUZ A;  1ODB A;  5FI2 A;  1YX7 A;  3OX6 A;  4MLW A;  1KCY A;  1IQ3 A;  3ICB A;  4HRG A;  3PM2 A;  3OGN A;  4WQ2 A;  1KSM A;  3VGO A;  4PT1 A;  4U8D A;  2EC6 B;  3D73 A;  3EVR A;  2JOJ A;  4F0Z B;  4XYN A;  3SIA A;  5HKY A;  2WCL A;  5GQQ C;  4MZL A;  4C0J A;  1RK9 A;  1IJ6 A;  4GAO A;  3CTN A;  1CFF A;  1MR8 A;  2CCM A;  3AKB A;  1IG5 A;  2M7N A;  1XVJ A;  2BL0 B;  2JWW A;  1U5I A;  3AAK A;  2EHB A;  2P70 A;  4MVF A;  4P2Y B;  3SG4 A;  3H4S E;  2JNX A;  2FJU B;  3TDU A;  1MXE A;  1M63 B;  3EG5 B;  1IQ5 A;  3SG2 A;  1TN4 A;  1ALW A;  3O78 A;  1EL4 A;  2CBL A;  2JUL A;  1F4Q A;  1NX2 A;  3I5F B;  2H61 C;  3SJS A;  1PAL A;  1R6P A;  4BY5 A;  1CM4 A;  1MQ1 A;  1SL8 A;  1W9Z A;  4GUK A;  4QJ4 B;  3JVT B;  2WOR A;  1OZO A;  1YVH A;  3B88 A;  1M31 A;  2WCK A;  1X02 A;  2KAX A;  4ETO A;  1UUR A;  2FJY A;  4YGA A;  1XFX O;  1QIV A;  1PVB A;  1QIW A;  1WLM A;  1AJ5 A;  1JFJ A;  1UWO A;  1FBV A;  2CNP A;  2ERB A;  3NXA A;  1B9A A;  2BCA A;  1UUS A;  1KWO C;  2M29 A;  1Z2C B;  2NZ0 A;  3DD4 A;  1ALV A;  2ZNE A;  1ZMZ A;  5HLV A;  3M0W A;  1C7V A;  4ORB B;  2MRD A;  4R1E A;  2BE4 A;  1JFK A;  2VRG A;  3BQ3 A;  3FE9 A;  5I2L A;  1LA3 A;  1CDL A;  3CYZ A;  2K7D A;  2A4J A;  1JC2 A;  1G4Y R;  2QDI A;  2JT0 A;  3NGV A;  5I94 A;  1CDM A;  4D1E A;  3CAB A;  4L9M A;  3SS5 A;  1BR4 B;  1WDC B;  1XFY O;  3WHU B;  2KAV A;  3PSR A;  4I5K A;  4USL A;  1CLM A;  1E8A A;  1NYA A;  2K7C A;  2MHH A;  2O60 A;  2PVB A;  2Q4U A;  4INW A;  5AAN A;  5KSZ A;  1A4P A;  1KK7 Y;  2KQ6 A;  3SG5 A;  1QV0 A;  1QX7 A;  2MAZ A;  2GV5 A;  1M45 A;  3VRO A;  4NDC A;  1SW8 A;  1MHO A;  3RM1 A;  1QAT A;  1YTZ C;  1S5G Z;  1UP5 A;  5ER4 X;  3DVJ A;  1G8I A;  5D3O A;  1YUR A;  3BYA A;  5HL1 A;  1MF8 B;  2G2B A;  1TUJ A;  1SL7 A;  1L7Z A;  3BOW B;  4OCI A;  3KO0 A;  2K7O A;  1K95 A;  4I5L B;  2LAN A;  1RRO A;  3PLF B;  2FCD A;  2KFF A;  3NSK A;  3O4Y A;  1W7J B;  4FQT A;  3I5H C;  3PN7 C;  2Y4Q A;  4ORA B;  1Y1U A;  1KFU S;  1B47 A;  1A75 A;  2H2K A;  1BJF A;  2KGR A;  4IJ7 A;  2E6W A;  1BF5 A;  1Y6W A;  1L2O B;  2CTN A;  2PYQ A;  2KSP A;  1KQM C;  3BUW B;  4OV2 A;  2LAP A;  4PE1 A;  5EL2 A;  4PAL A;  1OMV A;  5DIC A;  1MUX A;  2H8V A;  1SCM B;  3CGA A;  3NSL A;  4PHK A;  1NX1 A;  3BXK A;  2AMI A;  2LLU A;  2PRU A;  2ISD A;  5HKZ A;  1QAS A;  3LK0 A;  1FPW A;  3D74 A;  1OOG A;  1DF0 A;  1DJG A;  5KU1 A;  1UHN A;  1LIN A;  2L5X B;  4PHJ A;  4M2Q A;  3B6X A;  2MLE C;  3O2P A;  5G08 A;  1NSH A;  2WCJ A;  1ZFS A;  1IJ5 A;  4TNC A;  3EKH A;  1EJ3 A;  1B8C A;  4JPZ B;  5HLO A;  2KI4 C;  2HET A;  1GQM A;  1ORG A;  2ZRT A;  1J7O A;  1C07 A;  1CKK A;  5FYX A;  1QVI Y;  1DJZ A;  1CLL A;  2K2F A;  1NX0 A;  1SYM A;  3SIB A;  1BU3 A;  2WC6 A;  1IGV A;  1FW4 A;  1TCO B;  3D0Y A;  4HRH A;  2LVI A;  4PHM A;  4AOM A;  5IBW A;  1XA5 A;  4C0K A;  2LHL A;  2TN4 A;  2F2P A;  3O6B A;  1KK7 Z;  3DF0 B;  1BLQ A;  3MSE B;  2GGM A;  4XJK A;  3FIA A;  2LMT A;  3V2L A;  2KHN A;  5I2Q A;  4YGE B;  3EK8 A;  3BFH A;  3S0G A;  5K89 A;  2M97 A;  1QS7 A;  3CDN A;  4N5X A;  2JZI A;  3IF7 A;  3FWB A;  1F55 A;  1NCZ A;  3C1V A;  2FCE A;  3DZT A;  3GK4 X;  3JTD C;  2K2A A;  2DOQ A;  2F8P A;  1OMR A;  1S5G Y;  2SAS A;  3S0F A;  2P6B B;  2ZN9 A;  3HX4 A;  2B1U A;  3D77 A;  1C3Y A;  2KFG A;  2FOT A;  3EK7 A;  1KWO B;  1H8B A;  2BNX A;  1XO5 A;  3NSO A;  3S0B A;  1NWD A;  2KNE A;  1DMO A;  2KBM A;  2EGD A;  2QEB A;  1R2U A;  1LA0 A;  2GGZ A;  4INX A;  1Y1X A;  1QTX A;  1K2H A;  1M46 A;  1K93 D;  1SRA A;  2QPT A;  5HKW A;  2M1K B;  3B86 A;  1TIZ A;  2OS8 C;  3VRR A;  3D75 A;  2LC5 A;  1JWD A;  1B7T Z;  1TRF A;  4HSZ A;  2WC5 A;  1LXF C;  1QJT A;  1TNX A;  1U5I B;  2MA2 A;  1OW4 A;  2BE6 A;  3DYE A;  2F3Z A;  3CWG A;  5DKQ A;  1REC A;  2CXJ A;  2LCP A;  1N65 A;  1F54 A;  3IVT A;  1EXR A;  1SMG A;  2KQY A;  5FI7 A;  1DTL A;  4DS7 A;  1NPQ A;  3R72 A;  4PHN A;  3DVM A;  2YGU A;  5DKR A;  1BG1 A;  4GNK B;  1A2X A;  1KSO A;  4A4C A;  1DC1 A;  3PAL A;  1CNP A;  3VB1 A;  1S3P A;  4UPG A;  2K61 A;  2HPS A;  1QVI Z;  1XFZ O;  3R1O A;  1Y0V H;  1TCF A;  2L2C A;  3OHM B;  2JT8 A;  1AJ4 A;  3EKJ A;  1SNL A;  1XFV O;  2BKI B;  5I8N A;  1KFX L;  4WRI A;  1NIW A;  5DKN A;  1PVA A;  1WRL A;  3I5H B;  3PN7 B;  1DJX A;  1B8L A;  2BCX A;  2NXQ A;  1YRU B;  3KHE A;  3OB2 B;  4ORC B;  3QME A;  3IQQ A;  5F6T A;  1J7Q A;  1TUZ A;  1KQM B;  1WRZ A;  1DGV A;  2WCF A;  1OOI X;  1CB1 A;  5CPV A;  3DVE A;  2BBM A;  1IRJ A;  1LS8 A;  1TNP A;  2PSR A;  3LLE A;  2OPO A;  5D69 A;  3VRN A;  3BFB A;  3LCP C;  2JNF A;  1CFD A;  3BUO B;  1K96 A;  1OOH A;  4M2O A;  2L50 A;  3I5G C;  1WLZ A;  1K94 A;  1CTR A;  1NP8 A;  2SCP A;  3D78 A;  3GOF A;  1XFR A;  1JF0 A;  1JSA A;  4YRU A;  2Y1N A;  1XK4 A;  4YI9 A;  2MBX A;  1BOC A;  1S6I A;  1AK8 A;  1CFC A;  1OE9 B;  5AER A;  5B8I B;  5JOL A;  1TTX A;  1QWV A;  4NDB A;  3TUY C;  1CDP A;  2KI4 B;  5JJG A;  1SKT A;  1SY9 A;  4IL1 A;  2Y1M A;  3B87 A;  1SPY A;  2JRF A;  1A03 A;  1F8H A;  2AAO A;  2LE9 B;  2HQ8 A;  3O4X A;  1OOF A;  5J3X A;  5I2O A;  2WC8 A;  3SG3 A;  1F71 A;  1B7T Y;  1GJY A;  1YRT B;  2LVJ A;  4A4B A;  1NCX A;  1YUT A;  3CR5 X;  3PJI A;  2PMY A;  2WCH A;  4ICB A;  1Z4H A;  4Q04 A;  1CLB A;  1UHK A;  3NHT A;  3K21 A;  1W7I B;  4I5N B;  1G33 A;  1KQV A;  1RJV A;  3WNX B;  1DJI A;  1A75 B;  2BEC A;  3FE8 A;  3L4A A;  1B8R A;  1D1O A;  1YVL A;  5PAL A;  2OTG C;  2LVK A;  3PAT A;  3AKA A;  3F45 A;  3I5I C;  1BR1 B;  3JTD B;  4NQG A;  4AQI A;  3VRP A;  1QX5 B;  2G9B A;  1NX3 A;  4MBE A;  1T14 A;  2KYC A;  5CSF A;  1WRK A;  2JXC A;  2KBI A;  1RFJ A;  2KI6 C;  4QJ5 B;  2WCB A;  3IQO A;  1QLK A;  2JTZ A;  3S0E A;  1LKJ A;  3VRQ A;  3L47 A;  3OBV A;  1CDN A;  1SR6 C;  2NCP A;  4MZJ A;  4MN0 A;  1DF0 B;  2WND A;  3CZ2 A;  2COL B;  4FQO A;  1XK4 C;  3RZS A;  3BUM B;  2LVV A;  3CZT X;  2WCE A;  4JQ0 D;  1HT9 A;  2IS9 A;  5AFP A;  1KK8 C;  1UHH A;  4JWQ A;  4AQJ A;  1SSE B;  3Q8I A;  1NUB A;  1B4C A;  4I5J A;  3GK2 A;  2JXL A;  2OS8 B;  4DIR A;  2K0J A;  5AEQ A;  1WY9 A;  3BUN B;  3EVV A;  1N2D A;  2E30 A;  1OOJ A;  4GBA A;  1J7P A;  3DXL A;  3LL8 B;  2HF5 A;  4GFT A;  2LM5 A;  1TNW A;  1TOP A;  1YX8 A;  3TS5 C;  1N0Y A;  3CZ0 A;  2LLT A;  3FE6 A;  2L5Y A;  3D0Y B;  1OZS A;  2K60 A;  4YBH B;  1P28 A;  4CLN A;  1BOD A;  3KF9 A;  2KOT A;  4OKH A;  5AXI A;  4ZCU A;  1Y1A A;  1ZAC A;  2LNK A;  3EVU A;  1K90 D;  2M1U A;  4DUQ A;  4XJK B;  1HQV A;  2KDH A;  5KTY A;  1V1F A;  2D8N A;  1QXP A;  4JKT A;  3NSI A;  4MZK A;  1K9U A;  1TWO A;  4CFR A;  1AP4 A;  4OVN F;  3E3R A;  2L4H A;  4QJ3 B;  1GM0 A;  1JUO A;  1C7W A;  3TDI A;  1GGZ A;  1DGU A;  2I94 A;  3HCM A;  4CPV A;  3GK1 A;  1XFW O;  1UHJ A;  2K7B A;  2ZN8 A;  4ZCV A;  2PQL A;  3DVK A;  1RWY A;  4YGB B;  1CM1 A;  2JPT A;  1DEK A;  2M8U A;  4P5O E;  2L0P A;  4DCK A;  1RTP 1;  4PE0 A;  2EC6 C;  3R1P A;  3UO9 A;  1S36 A;  3LK1 A;  3N7H A;  2R2I A;  1F70 A;  1GGW A;  4PE4 A;  2LHI A;  3R1V A;  2HQW A;  1YUS A;  4MSP A;  4BY4 A;  2QEV A;  1J1D A;  3A4U B;  1EG4 A;  1IH0 A; 
#chains in the Genus database with same CATH homology
 2LMU A;  3I5G B;  2KGB C;  2LV7 A;  2Q91 A;  1S26 D;  2ZRS A;  1PSR A;  4N1G A;  5ER5 A;  2KI6 D;  1FI6 A;  2BL0 C;  1BMO A;  1S6J A;  5HYD A;  2JT3 A;  1EG3 A;  1PUL A;  3BUX B;  1CFP A;  1OMD A;  4M2P A;  2ZFD A;  1K8U A;  1PSB A;  2K8M B;  3TUY B;  1BT6 A;  2LLS A;  1KFX S;  1OSA A;  5BPJ A;  1A29 A;  2PAS A;  1DVI A;  1IWQ A;  2LUC A;  3I5F C;  2LMV A;  2AUC A;  2L98 A;  1XYD A;  4GPL B;  4MRX A;  2JTT A;  3BOW A;  1JBA A;  2BBN A;  3ZNI A;  3JVT C;  2NLN A;  1EH2 A;  3PM8 A;  1UHI A;  1S6C A;  4GGF A;  4PE7 A;  3WXA A;  3ZWH A;  2L2E A;  1M39 A;  1QX2 A;  2M7L A;  2F3Y A;  1J7R A;  1TNQ A;  3KPX A;  1B1G A;  1DT7 B;  1CMG A;  2PAL A;  2OTG B;  1FF1 A;  1DJW A;  3I5I B;  2L51 A;  2I7A A;  4PCW A;  3CS1 A;  1V1G A;  1J55 A;  3OP0 A;  3CR2 A;  1KFU L;  2M0R A;  2BCB A;  2V53 A;  3EK4 A;  4NDD A;  2CT9 A;  1FI5 A;  2M9G A;  1SCV A;  1IKU A;  3A8R A;  4WQ3 A;  3CR4 X;  3D10 A;  2L4I A;  2MLF C;  1SR6 B;  2I18 A;  1K9P A;  1AUI B;  4MEW A;  2ZND A;  2Y5I A;  4CFQ A;  1WDC C;  1NCY A;  2M3W A;  5CSJ A;  4C0L A;  1KK8 B;  1Q80 A;  2JC2 A;  3FS7 A;  1YUU A;  1LVC D;  1SK6 D;  1DJH A;  4DRW A;  1H4B A;  2KYF A;  2NCO A;  1DJY A;  2I2R E;  1CMF A;  1QV1 A;  5TNC A;  4PDZ A;  2RGI A;  1YR5 A;  4YGD B;  4YGC B;  3WHT B;  2M49 B;  2LUX A;  1JF2 A;  1SL9 A;  3OX5 A;  3TS5 B;  1F4O A;  2JU0 A;  2O5G A;  2ZKM X;  2MJW B;  1SBJ A;  1ZOT B;  2LP2 A;  4GGN A;  3PFV A;  1AVS A;  2LP3 A;  2WOS A;  3SG6 A;  3SG7 A;  4YI8 A;  1XFU O;  3RLZ A;  3DF0 A;  3KEV A;  4N1F A;  4GGF C;  1PRW A;  4OR9 B;  3QRX A;  4FTG A;  5CSN A;  2H61 A;  3OB1 B;  2JQ6 A;  1S1E A;  2F2O A;  3CLN A;  2KFH A;  5D7F A;  1VRK A;  1L2O C;  2BKH B;  3TZ1 A;  3AAJ A;  5CSI A;  1QLS A;  1OQP A;  2F33 A;  4CID A;  4HRE E;  1MWN A;  1AHR A;  1PK0 D;  4E68 A;  1MXL C;  2KAY A;  3TDZ A;  1SCM C;  3FWC A;  2QAC A;  1J1E A;  4MRY A;  1K9K A;  1ZUZ A;  1ODB A;  1YX7 A;  3OX6 A;  4MLW A;  1KCY A;  1IQ3 A;  3ICB A;  4HRG A;  4WQ2 A;  1KSM A;  3VGO A;  4U8D A;  2EC6 B;  3EVR A;  2JOJ A;  4F0Z B;  4XYN A;  3SIA A;  5HKY A;  5GQQ C;  4MZL A;  4C0J A;  1RK9 A;  1IJ6 A;  4GAO A;  3CTN A;  1CFF A;  1MR8 A;  2CCM A;  3AKB A;  1IG5 A;  2M7N A;  1XVJ A;  2BL0 B;  2JWW A;  1U5I A;  3AAK A;  2EHB A;  4MVF A;  4P2Y B;  3SG4 A;  3H4S E;  2JNX A;  2FJU B;  3TDU A;  1MXE A;  1M63 B;  1IQ5 A;  3SG2 A;  1TN4 A;  1ALW A;  3O78 A;  1EL4 A;  2CBL A;  2JUL A;  1F4Q A;  1NX2 A;  3I5F B;  2H61 C;  3SJS A;  1PAL A;  1R6P A;  4BY5 A;  1CM4 A;  1MQ1 A;  1SL8 A;  4GUK A;  4QJ4 B;  3JVT B;  2WOR A;  1OZO A;  1YVH A;  1M31 A;  1X02 A;  2KAX A;  4ETO A;  1UUR A;  4YGA A;  1XFX O;  1QIV A;  1PVB A;  1QIW A;  1WLM A;  1AJ5 A;  1JFJ A;  1UWO A;  1FBV A;  2CNP A;  3NXA A;  1B9A A;  2BCA A;  1UUS A;  1KWO C;  2M29 A;  3DD4 A;  2NZ0 A;  1ALV A;  2ZNE A;  1ZMZ A;  5HLV A;  3M0W A;  1C7V A;  4ORB B;  2MRD A;  4R1E A;  2BE4 A;  1JFK A;  2VRG A;  3BQ3 A;  5I2L A;  1LA3 A;  1CDL A;  2K7D A;  2A4J A;  1JC2 A;  1G4Y R;  2JT0 A;  1CDM A;  4D1E A;  4L9M A;  1BR4 B;  1WDC B;  1XFY O;  3WHU B;  2KAV A;  3PSR A;  4I5K A;  4USL A;  1CLM A;  1E8A A;  1NYA A;  2K7C A;  2MHH A;  2O60 A;  2PVB A;  2Q4U A;  5AAN A;  1A4P A;  1KK7 Y;  2KQ6 A;  3SG5 A;  1QV0 A;  1QX7 A;  2MAZ A;  2GV5 A;  1M45 A;  3VRO A;  4NDC A;  1SW8 A;  1MHO A;  3RM1 A;  1QAT A;  1YTZ C;  1S5G Z;  1UP5 A;  5ER4 X;  3DVJ A;  1G8I A;  1YUR A;  3BYA A;  1MF8 B;  2G2B A;  4OCI A;  1SL7 A;  1L7Z A;  3BOW B;  3KO0 A;  2K7O A;  1K95 A;  4I5L B;  2LAN A;  1RRO A;  3PLF B;  2FCD A;  2KFF A;  3NSK A;  3O4Y A;  1W7J B;  4ORA B;  3I5H C;  3PN7 C;  2Y4Q A;  1Y1U A;  1KFU S;  1B47 A;  1A75 A;  2H2K A;  1BJF A;  2KGR A;  2E6W A;  1BF5 A;  1Y6W A;  1L2O B;  2CTN A;  2KSP A;  1KQM C;  3BUW B;  4OV2 A;  2LAP A;  4PE1 A;  4PAL A;  1OMV A;  1MUX A;  1SCM B;  3CGA A;  3NSL A;  4PHK A;  1NX1 A;  3BXK A;  2AMI A;  2LLU A;  2PRU A;  2ISD A;  5HKZ A;  1QAS A;  3LK0 A;  1FPW A;  1DF0 A;  1DJG A;  5KU1 A;  1UHN A;  1LIN A;  2L5X B;  4PHJ A;  4M2Q A;  2MLE C;  3O2P A;  5G08 A;  1NSH A;  1ZFS A;  1IJ5 A;  4TNC A;  3EKH A;  1EJ3 A;  1B8C A;  4JPZ B;  5HLO A;  2KI4 C;  2HET A;  1GQM A;  2ZRT A;  1J7O A;  1C07 A;  1CKK A;  5FYX A;  1QVI Y;  1DJZ A;  1CLL A;  2K2F A;  1NX0 A;  1SYM A;  3SIB A;  1BU3 A;  5KSZ A;  1IGV A;  1FW4 A;  1TCO B;  3D0Y A;  4HRH A;  2LVI A;  4PHM A;  4AOM A;  5IBW A;  1XA5 A;  4C0K A;  2LHL A;  2TN4 A;  2F2P A;  3O6B A;  1KK7 Z;  3DF0 B;  1BLQ A;  3MSE B;  2GGM A;  4XJK A;  3FIA A;  2LMT A;  2KHN A;  5I2Q A;  4YGE B;  3EK8 A;  5K89 A;  2M97 A;  1QS7 A;  4N5X A;  2JZI A;  3IF7 A;  3FWB A;  1F55 A;  1NCZ A;  3C1V A;  2FCE A;  3GK4 X;  3JTD C;  2K2A A;  2DOQ A;  2F8P A;  1OMR A;  1S5G Y;  2SAS A;  2P6B B;  2ZN9 A;  3HX4 A;  2B1U A;  2KFG A;  2FOT A;  3EK7 A;  1KWO B;  1H8B A;  1XO5 A;  3NSO A;  1NWD A;  2KNE A;  1DMO A;  2KBM A;  2EGD A;  1R2U A;  1LA0 A;  2GGZ A;  1K2H A;  1Y1X A;  1QTX A;  1M46 A;  1K93 D;  1SRA A;  2QPT A;  5HKW A;  2M1K B;  1TIZ A;  2OS8 C;  3VRR A;  2LC5 A;  1JWD A;  1B7T Z;  1TRF A;  4HSZ A;  1LXF C;  1QJT A;  1TNX A;  1U5I B;  2MA2 A;  2BE6 A;  2F3Z A;  3CWG A;  5DKQ A;  1REC A;  2CXJ A;  2LCP A;  1N65 A;  1F54 A;  1EXR A;  1SMG A;  2KQY A;  1DTL A;  4DS7 A;  1NPQ A;  4PHN A;  5DKR A;  3DVM A;  1BG1 A;  4GNK B;  1A2X A;  1KSO A;  4A4C A;  1CNP A;  3PAL A;  1S3P A;  4UPG A;  2K61 A;  2HPS A;  1QVI Z;  1XFZ O;  1Y0V H;  1TCF A;  3OHM B;  2JT8 A;  1AJ4 A;  3EKJ A;  1SNL A;  1XFV O;  2BKI B;  5I8N A;  1KFX L;  4WRI A;  1NIW A;  5DKN A;  1PVA A;  1WRL A;  3I5H B;  3PN7 B;  1DJX A;  1B8L A;  2BCX A;  2NXQ A;  1YRU B;  3KHE A;  3OB2 B;  4ORC B;  3IQQ A;  5F6T A;  1J7Q A;  1KQM B;  1WRZ A;  1DGV A;  2WCF A;  1CB1 A;  5CPV A;  3DVE A;  2BBM A;  1IRJ A;  1TNP A;  2PSR A;  3LLE A;  2OPO A;  5D69 A;  3VRN A;  3LCP C;  2JNF A;  1CFD A;  3BUO B;  1K96 A;  4M2O A;  2L50 A;  3I5G C;  1WLZ A;  1K94 A;  1CTR A;  1NP8 A;  2SCP A;  3GOF A;  1JF0 A;  1JSA A;  4YRU A;  2Y1N A;  1XK4 A;  4YI9 A;  2MBX A;  1BOC A;  1S6I A;  1AK8 A;  1CFC A;  1OE9 B;  5AER A;  5B8I B;  5JOL A;  1TTX A;  4NDB A;  3TUY C;  1CDP A;  2KI4 B;  5JJG A;  1SKT A;  1SY9 A;  4IL1 A;  2Y1M A;  1SPY A;  2JRF A;  1A03 A;  1F8H A;  2AAO A;  2LE9 B;  2HQ8 A;  5J3X A;  5I2O A;  2WC8 A;  3SG3 A;  1F71 A;  1B7T Y;  1GJY A;  1YRT B;  2LVJ A;  4A4B A;  1NCX A;  1YUT A;  3CR5 X;  4Q04 A;  2PMY A;  4ICB A;  1CLB A;  1UHK A;  3K21 A;  1W7I B;  4I5N B;  1G33 A;  1KQV A;  1RJV A;  3WNX B;  1DJI A;  1A75 B;  2BEC A;  1D1O A;  1B8R A;  1YVL A;  5PAL A;  2OTG C;  2LVK A;  3PAT A;  3AKA A;  3F45 A;  3I5I C;  1BR1 B;  3JTD B;  4NQG A;  4AQI A;  3VRP A;  1QX5 B;  2G9B A;  1NX3 A;  4MBE A;  2KYC A;  5CSF A;  1WRK A;  2JXC A;  2KBI A;  1RFJ A;  2KI6 C;  4QJ5 B;  2WCB A;  3IQO A;  1QLK A;  2JTZ A;  1LKJ A;  3VRQ A;  1CDN A;  1SR6 C;  2NCP A;  4MZJ A;  4MN0 A;  1DF0 B;  2WND A;  2COL B;  4FQO A;  1XK4 C;  3BUM B;  2LVV A;  3CZT X;  2WCE A;  4JQ0 D;  1HT9 A;  2IS9 A;  5AFP A;  1KK8 C;  1UHH A;  4JWQ A;  4AQJ A;  1B4C A;  1NUB A;  4I5J A;  3GK2 A;  2JXL A;  2OS8 B;  4DIR A;  2K0J A;  5AEQ A;  1WY9 A;  3BUN B;  3EVV A;  1N2D A;  2E30 A;  1OOJ A;  4GBA A;  1J7P A;  3LL8 B;  2HF5 A;  4GFT A;  2LM5 A;  1TNW A;  1TOP A;  1YX8 A;  3TS5 C;  1N0Y A;  2LLT A;  3D0Y B;  1OZS A;  4YBH B;  4CLN A;  1BOD A;  3KF9 A;  2KOT A;  4OKH A;  5AXI A;  4ZCU A;  1Y1A A;  1ZAC A;  2LNK A;  3EVU A;  1K90 D;  2M1U A;  4DUQ A;  4XJK B;  1HQV A;  2KDH A;  5KTY A;  1V1F A;  2D8N A;  1QXP A;  3NSI A;  4MZK A;  1K9U A;  4CFR A;  1AP4 A;  4OVN F;  3E3R A;  2L4H A;  4QJ3 B;  1JUO A;  1C7W A;  3TDI A;  1GGZ A;  1DGU A;  2I94 A;  3HCM A;  4CPV A;  3GK1 A;  1XFW O;  1UHJ A;  2K7B A;  2ZN8 A;  4ZCV A;  3DVK A;  1RWY A;  4YGB B;  1CM1 A;  2JPT A;  2M8U A;  4P5O E;  2L0P A;  4DCK A;  1RTP 1;  4PE0 A;  2EC6 C;  1F70 A;  1S36 A;  3LK1 A;  1GGW A;  2R2I A;  4PE4 A;  2LHI A;  2HQW A;  1YUS A;  4MSP A;  4BY4 A;  3A4U B;  1J1D A;  1EG4 A;  1IH0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...