4UPGA

X-ray structure of calcium-free human sorcin
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
169
structure length
169
Chain Sequence
QTQDPLYGYFAAVAGQDGQIDADELQRCLTQSGIAGGYKPFNLETCRLMVSMLDRDMSGTMGFNEFKELWAVLNGWRQHFISFDTDRSGTVDPQELQKALTTMGFRLSPQAVNSIAKRYSTNGKITFDDYIACCVKLRALTDSFRRRDTAQQGVVNFPYDDFIQCVMSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis of Sorcin-Mediated Calcium-Dependent Signal Transduction.
pubmed doi rcsb
molecule keywords SORCIN
molecule tags Metal binding protein
source organism Homo sapiens
total genus 59
structure length 169
sequence length 169
ec nomenclature
pdb deposition date 2014-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13405 EF-hand_6 EF-hand domain
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4upgA00
1K9UA 4E68A 2L4HA 3EVRA 1OMVA 1KSOA 3KPXA 2MJWB 2Y4QA 1S6JA 1XFUO 1N65A 1CTRA 1W7JB 1PULA 1SL8A 4YGAA 3AAJA 1LXFC 1YURA 1C07A 2OTGB 1IQ5A 1CKKA 4GFTA 4NDDA 1IQ3A 1FPWA 4NDCA 1LA3A 1U5IB 3PFVA 4CFQA 1AJ5A 3WHTB 2WORA 3BUNB 2O60A 3I5GC 1CM1A 1RWYA 3NSOA 3BQ3A 1Y1XA 2L0PA 2L4IA 2Y1MA 2G9BA 3VRQA 2QPTA 3H4SE 2EC6C 1XK4A 4ZCUA 1B4CA 4F0ZB 5D69A 1IWQA 1K94A 1R6PA 1QV1A 3GOFA 3K21A 3DVMA 2LVIA 1M45A 1B8RA 1NX1A 1KFUS 2LP3A 1RK9A 2NZ0A 4P2YB 1G33A 1WLMA 2DOQA 4ORBB 4BY4A 3FS7A 1BT6A 2HF5A 1QX2A 3JTDB 2LUXA 3CR5X 1JF0A 4CFRA 1KWOC 3WNXB 1MWNA 4ETOA 1SBJA 2KGRA 1DJWA 1SCMC 1KCYA 5G08A 1NX3A 1NPQA 1KSMA 1DVIA 5JOLA 1F70A 1BR4B 1TTXA 2M0RA 3SG3A 4MN0A 4TNCA 3EVUA 2MRDA 2LC5A 3A8RA 3PN7B 4N1FA 1CB1A 1SNLA 1UHKA 1WLZA 1CDPA 1KFXS 3D10A 1HT9A 1S6CA 3LK1A 2JU0A 1S6IA 1U5IA 2WC8A 1WY9A 1ZFSA 3GK4X 5HLOA 1J7OA 2JWWA 4MBEA 1XYDA 2KNEA 4PHKA 4PHMA 4XJKB 1KQMB 2BL0C 1SKTA 2A4JA 1BU3A 1NX2A 1DJIA 1BG1A 4PE7A 1TCOB 2JT3A 1TNQA 1Q80A 2KFGA 1J7PA 4YI9A 1XFWO 1JSAA 2EHBA 3LL8B 1GQMA 3O6BA 2PVBA 3WXAA 1QIVA 1ZACA 2LHIA 3SG5A 2VRGA 4GGFA 1W7IB 1CDLA 1GGWA 1SW8A 1XFZO 4D1EA 3SG4A 1J1EA 1A03A 1K93D 1JFJA 2BCXA 4OVNF 2TN4A 1A4PA 1A75A 1YRUB 5DKNA 5HLVA 1EJ3A 3RLZA 2H61A 3D0YB 5CSFA 2WOSA 1QS7A 1CFFA 1BOCA 3IF7A 2M1KB 1M39A 4AQIA 3BXKA 2BCBA 2F2PA 1V1GA 2KI4B 1PRWA 4MRXA 4UPGA 1AP4A 1KK8C 2JOJA 3PLFB 1S36A 1KFUL 1MXEA 2M49B 1DTLA 2K7OA 5AFPA 2QACA 3CS1A 5K89A 1PSBA 5KU1A 4ICBA 4HREE 5B8IB 2KBMA 1CDMA 1UHHA 4C0KA 5AXIA 1SPYA 1UHJA 3E3RA 1FBVA 4PE4A 2BBMA 2KOTA 2OS8C 1G4YR 1PALA 3BUOB 1NP8A 1YTZC 4ORAB 5I2LA 1DMOA 1M31A 1K90D 1MR8A 1TNWA 2F8PA 1IRJA 2Q91A 4FQOA 3TUYB 5I8NA 2I7AA 1YVHA 1S26D 1JFKA 1GGZA 3OP0A 3F45A 1TNXA 2LVJA 4AOMA 3A4UB 1NWDA 2K2FA 3I5IC 4PHJA 3C1VA 1YUUA 2LLTA 3RM1A 2I94A 3I5HB 2Q4UA 2FCDA 2HQWA 4A4BA 2K61A 1Y1AA 2LAPA 1AUIB 1PK0D 1DGVA 1N0YA 5CSIA 2JQ6A 3KEVA 2R2IA 4JWQA 2JT8A 1B47A 5J3XA 3BUWB 2MLEC 1V1FA 5GQQC 1QLKA 4PDZA 2KYFA 1EH2A 2HETA 3EVVA 4CIDA 1AVSA 3KF9A 4YGDB 2ZNDA 4CPVA 2K2AA 1SCVA 2MA2A 1JC2A 1QLSA 5HYDA 1SR6B 1DJZA 4YI8A 3KO0A 1BF5A 2GGZA 2K7BA 1JUOA 2I2RE 2WCEA 2PSRA 5DKRA 1YRTB 2G2BA 2NLNA 3CR4X 4CLNA 2L51A 2GV5A 3WHUB 1D1OA 3IQQA 3BYAA 1H8BA 1CLBA 1OSAA 1HQVA 1DF0B 4YBHB 1WDCB 4MZKA 2KAVA 1CFDA 2E30A 1F71A 3VGOA 1ZMZA 3SG6A 1DGUA 1KK8B 4NDBA 2MBXA 2F3ZA 1ZOTB 3TS5B 2BE4A 1BJFA 2KDHA 1XFYO 3M0WA 4Q04A 1JBAA 1VRKA 3BOWB 4MRYA 2WCBA 1PVBA 4YGEB 5BPJA 1K95A 3VROA 5PALA 4USLA 1CFCA 1AHRA 1TCFA 1WRLA 1F4QA 1XK4C 1A29A 1SL9A 2MAZA 1LINA 2JTZA 2Y1NA 2LMVA 2CT9A 3OB2B 1RFJA 1J7QA 1IG5A 1MQ1A 1KK7Z 1TN4A 2F33A 2V53A 3PALA 2AUCA 3ICBA 1ALVA 3TDIA 1A2XA 2JZIA 2K8MB 1YX8A 2JTTA 2SCPA 3O4YA 4P5OE 2KAYA 3I5FC 1FI6A 3IQOA 1B8CA 1KK7Y 5AERA 1JF2A 3DF0B 1QJTA 1F55A 3DD4A 2ZN9A 3PSRA 1ALWA 3OB1B 1EL4A 1UURA 1YUSA 3OHMB 1PSRA 3LLEA 2KQ6A 2E6WA 3CGAA 3KHEA 2JNXA 1FW4A 3QRXA 1K2HA 1DF0A 1OOJA 3I5GB 2K7DA 4GUKA 2LVVA 4R1EA 2L5XB 2KYCA 4GBAA 4DRWA 3FWBA 4WQ2A 1SL7A 1XFXO 2BKIB 4MZLA 4HRHA 4ZCVA 4I5LB 2EC6B 4GNKB 4OKHA 1MHOA 4BY5A 3BOWA 1RECA 1IKUA 1TRFA 2PMYA 1IJ6A 1XVJA 1M63B 1TOPA 1YUTA 3EKJA 1OQPA 2BE6A 2KAXA 2KFFA 2L98A 4PE1A 2PRUA 3NXAA 2KI6C 2LUCA 3CZTX 2M97A 1MF8B 1UP5A 4PCWA 1OZOA 4GAOA 1NUBA 4GGFC 3O2PA 1KWOB 1Y6WA 4XJKA 4MEWA 4DUQA 1SCMB 2BECA 5IBWA 2LM5A 1NYAA 1XA5A 4M2OA 3VRPA 4A4CA 2NCPA 3JTDC 1EG4A 3TDUA 1UHIA 1CMFA 1CFPA 1WRZA 2RGIA 1NCXA 2H61C 2OPOA 3EKHA 1Y1UA 1ZUZA 4PHNA 5CPVA 3PATA 4FTGA 1QATA 2F2OA 1NSHA 1BMOA 2ZKMX 1AJ4A 4N1GA 1KFXL 1IJ5A 1OMRA 2BCAA 2KFHA 3TZ1A 4U8DA 1QXPA 1SY9A 2BL0B 1QTXA 3FWCA 2LNKA 4PE0A 3PN7C 2JPTA 3GK2A 4GGNA 5DKQA 3TDZA 1LKJA 2D8NA 2JRFA 2SASA 1K8UA 2NXQA 3D0YA 3NSLA 4M2PA 1L2OC 2JC2A 2KQYA 1B1GA 2CXJA 1DJXA 1K96A 1RJVA 2PALA 3SG2A 1R2UA 5ER4X 1SK6D 1PVAA 2K0JA 1CMGA 4MVFA 5FYXA 2LVKA 3ZNIA 1EXRA 1G8IA 3PM8A 5F6TA 1QV0A 4MZJA 3EK8A 2KHNA 2MHHA 5KSZA 4MLWA 1B8LA 1J55A 1M46A 1SRAA 1F8HA 1X02A 4C0JA 1BR1B 1EG3A 1LVCD 3OX5A 1K9PA 1CDNA 1LA0A 1N2DA 1NX0A 3EK7A 1IGVA 2ISDA 1BODA 4NQGA 1OZSA 1DJYA 2FOTA 1OE9B 4M2QA 5AANA 1L7ZA 2LLUA 3NSKA 1NIWA 2KI4C 2IS9A 3BUMB 2KBIA 2KGBC 3AKBA 2WNDA 5CSNA 2ZRSA 1KQVA 2B1UA 2FJUB 2OS8B 3AAKA 2JT0A 4I5JA 2CCMA 2CBLA 1J1DA 1UUSA 3SG7A 1A75B 4OCIA 3VRNA 2ZN8A 5D7FA 4OR9B 2L50A 2LMTA 1S1EA 4HSZA 3CWGA 2LCPA 1CLMA 3DVEA 4IL1A 3EK4A 3I5IB 3SJSA 3BUXB 4C0LA 4GPLB 1DT7B 3TUYC 1WRKA 1B7TZ 1QX5B 5I2QA 1XO5A 1QVIZ 1S5GZ 3SIAA 1SMGA 3LK0A 3MSEB 3JVTC 2P6BB 1AK8A 1ODBA 2M8UA 2LLSA 1Y0VH 2JXLA 1L2OB 4N5XA 1SYMA 2LV7A 2COLB 2KI6D 3I5HC 3O78A 1B7TY 1CM4A 2CTNA 3FIAA 4PALA 1QVIY 1S5GY 2OTGC 2ZNEA 3CTNA 1YR5A 1TIZA 4DS7A 2F3YA 1S3PA 2AAOA 2K7CA 2LP2A 3DVJA 1UWOA 3GK1A 5HKYA 3VRRA 2O5GA 5KTYA 5HKWA 4YGBB 2WCFA 2M7NA 1DJHA 2GGMA 1C7VA 3CR2A 1NCZA 4OV2A 5HKZA 2NCOA 2HQ8A 2M3WA 2Y5IA 4HRGA 1E8AA 2JXCA 4WRIA 5CSJA 3AKAA 1FI5A 1SR6C 1FF1A 1BLQA 4I5KA 2CNPA 2BBNA 1XFVO 5AEQA 2HPSA 5TNCA 1QIWA 2FCEA 2I18A 2PASA 4L9MA 4DCKA 1F54A 3LCPC 4YGCB 3CLNA 1WDCC 1CLLA 1TNPA 4XYNA 2ZRTA 1OMDA 4QJ3B 4YRUA 2ZFDA 1NCYA 3HX4A 2LANA 4QJ5B 1F4OA 3TS5C 2H2KA 2BKHB 3DF0A 2KSPA 1J7RA 2M7LA 2JULA 2LHLA 3HCMA 4WQ3A 2LMUA 3OX6A 3ZWHA 1DJGA 1K9KA 1YVLA 4JQ0D 1B9AA 2MLFC 4AQJA 1QASA 1RROA 4JPZB 1YX7A 2LE9B 1JWDA 1MXLC 2M9GA 3I5FB 1QX7A 4QJ4B 3DVKA 5ER5A 4I5NB 1UHNA 2AMIA 1IH0A 4DIRA 2JNFA 2EGDA 5JJGA 1H4BA 1RTP1 1KQMC 3NSIA 2M1UA 1MUXA 1CNPA 1C7WA 4MSPA 4ORCB 2L2EA 5I2OA 1GJYA 2M29A 3SIBA 3JVTB
chains in the Genus database with same CATH superfamily
1K9UA 4E68A 2L4HA 3EVRA 1OMVA 1KSOA 3KPXA 2MJWB 2Y4QA 1S6JA 1XFUO 3S0FA 1N65A 1CTRA 1W7JB 1PULA 1SL8A 4YGAA 3AAJA 1LXFC 1YURA 1C07A 2OTGB 1IQ5A 1CKKA 4GFTA 4NDDA 1IQ3A 1FPWA 4NDCA 1LA3A 1U5IB 3PFVA 4CFQA 1AJ5A 3WHTB 2WORA 3BUNB 2O60A 3I5GC 1CM1A 1RWYA 2WCMA 1OOHA 3NSOA 3BQ3A 3PM2A 3QMEA 1Y1XA 2L0PA 2L4IA 2Y1MA 2G9BA 3VRQA 1OOFA 2QPTA 3H4SE 2EC6C 1XK4A 4ZCUA 1B4CA 4F0ZB 5D69A 1IWQA 1K94A 1R6PA 1QV1A 3GOFA 3K21A 3DVMA 3SS5A 2LVIA 1M45A 1B8RA 1NX1A 1OOGA 1KFUS 2LP3A 1RK9A 2NZ0A 3D78A 4IJ7A 4P2YB 1G33A 1WLMA 2DOQA 4ORBB 4BY4A 2WC6A 3FS7A 1BT6A 2HF5A 1QX2A 3JTDB 2LUXA 3CR5X 1JF0A 4CFRA 1KWOC 3WNXB 1MWNA 4ETOA 1SBJA 2KGRA 1DJWA 1SCMC 1KCYA 5G08A 1NX3A 1NPQA 1KSMA 1DVIA 5JOLA 1F70A 1BR4B 1TTXA 2M0RA 2QEOA 3SG3A 1TWOA 2FJYA 4MN0A 3S0DA 3D76A 4TNCA 3EVUA 2MRDA 2LC5A 3A8RA 3PN7B 4N1FA 1CB1A 1SNLA 1UHKA 1DELA 1WLZA 1CDPA 1KFXS 3D10A 1HT9A 1S6CA 3LK1A 2JU0A 1S6IA 1U5IA 2WC8A 1WY9A 1ZFSA 3EG5B 3GK4X 5HLOA 1J7OA 2JWWA 4MBEA 1XYDA 2KNEA 4PHKA 5HL1A 4PHMA 4XJKB 1KQMB 2BL0C 3CZ1A 1SKTA 2A4JA 5D3OA 3NHIA 3NGVA 1BU3A 1NX2A 1DJIA 1BG1A 4PE7A 1TCOB 2JT3A 1TNQA 1Q80A 3SS4A 1P28A 2KFGA 1J7PA 4YI9A 1XFWO 1JSAA 2EHBA 3LL8B 1GQMA 3O6BA 2PVBA 4OZDA 3WXAA 1QIVA 1ZACA 2LHIA 3BFHA 2VRGA 3SG5A 4F7FA 4GGFA 3FE8A 2WCLA 1W7IB 1CDLA 1GGWA 3R72A 1SW8A 1XFZO 4D1EA 1QWVA 3SG4A 1J1EA 1Z2CB 1A03A 1K93D 1JFJA 5FI2A 3O4XA 2BCXA 4OVNF 2TN4A 1A4PA 1A75A 1YRUB 5DKNA 5HLVA 1EJ3A 3RLZA 2H61A 3D0YB 5CSFA 2WOSA 1QS7A 1SSEB 1CFFA 1BOCA 3IF7A 2M1KB 1M39A 4AQIA 3BXKA 2BCBA 2F2PA 1V1GA 2KI4B 1PRWA 4MRXA 4UPGA 1AP4A 1KK8C 1TUJA 2JOJA 3PLFB 1S36A 1KFUL 1DC1A 1MXEA 2M49B 1DTLA 2K7OA 3S0GA 5AFPA 2QEBA 2QACA 3CS1A 5K89A 1PSBA 5KU1A 4ICBA 4HREE 5B8IB 3S0AA 2KBMA 1CDMA 1UHHA 4C0KA 5AXIA 1SPYA 1UHJA 3E3RA 1FBVA 4PE4A 2BBMA 2KOTA 2OS8C 1G4YR 3CYZA 1PALA 3BUOB 1NP8A 1YTZC 4ORAB 5I2LA 1DMOA 1M31A 1K90D 1MR8A 1TNWA 1DEKA 1IRJA 2F8PA 2Q91A 4FQOA 3TUYB 3CZ0A 2I7AA 5I8NA 1YVHA 1S26D 1JFKA 1GGZA 3OP0A 3F45A 1TNXA 2LVJA 4AOMA 3A4UB 1NWDA 2K2FA 3I5IC 4PHJA 3C1VA 1YUUA 1DQEA 2LLTA 3RM1A 2I94A 2WCKA 3I5HB 2Q4UA 2FCDA 2HQWA 4A4BA 2K61A 1Y1AA 2LAPA 1AUIB 1PK0D 1DGVA 1N0YA 5CSIA 2JQ6A 3KEVA 2R2IA 4JWQA 2JT8A 1B47A 5J3XA 3BUWB 2MLEC 1V1FA 5DICA 5GQQC 1QLKA 4PDZA 2KYFA 1EH2A 2HETA 3EVVA 4CIDA 1AVSA 3KF9A 4YGDB 2ZNDA 2L2CA 2K2AA 1SCVA 2MA2A 4CPVA 1JC2A 1QLSA 5HYDA 3UNWA 1SR6B 1C3YA 1DJZA 4YI8A 3KO0A 1BF5A 2GGZA 2K7BA 1JUOA 2I2RE 2WCEA 3S0BA 2PSRA 5DKRA 1YRTB 2G2BA 2NLNA 3CR4X 4CLNA 2L51A 2GV5A 3WHUB 1D1OA 3IQQA 3BYAA 1H8BA 1CLBA 2ERBA 1OSAA 1HQVA 1DF0B 4KYNA 4YBHB 1WDCB 4MZKA 2KAVA 1CFDA 2E30A 1F71A 3VGOA 1GM0A 1ZMZA 3SG6A 1DGUA 1KK8B 4NDBA 3BFBA 2MBXA 2F3ZA 1ZOTB 3TS5B 2BE4A 1BJFA 2KDHA 1XFYO 3M0WA 4Q04A 1JBAA 1VRKA 3BOWB 4MRYA 2WCBA 1PVBA 3R1OA 4YGEB 5BPJA 1K95A 3VROA 5PALA 4USLA 1CFCA 1AHRA 1TCFA 1WRLA 1F4QA 1XK4C 1A29A 1SL9A 2MAZA 1LINA 2JTZA 2Y1NA 2LMVA 3SS3A 2CT9A 3OB2B 1RFJA 1J7QA 1IG5A 1MQ1A 1KK7Z 1TN4A 2F33A 3B7AA 2V53A 3PALA 2AUCA 3ICBA 1ALVA 3TDIA 1A2XA 2JZIA 2K8MB 2KLEA 3D77A 1YX8A 3L4LA 2JTTA 2SCPA 3D74A 3O4YA 4P5OE 2KAYA 3I5FC 2PYQA 1FI6A 3IQOA 1B8CA 1KK7Y 5AERA 1JF2A 3DF0B 1QJTA 1F55A 3DD4A 2ZN9A 3PSRA 3V2LA 1ALWA 5EL2A 3OB1B 1EL4A 1UURA 1YUSA 3OHMB 1PSRA 3LLEA 2KQ6A 2E6WA 3CGAA 3KHEA 2JNXA 1FW4A 3QRXA 1K2HA 1DF0A 1OOJA 3I5GB 2K7DA 4GUKA 2LVVA 4R1EA 2L5XB 2KYCA 3Q8IA 4GBAA 4DRWA 3FWBA 4WQ2A 1SL7A 1XFXO 2BKIB 4MZLA 4HRHA 4ZCVA 4I5LB 2EC6B 5FI6A 4GNKB 4OKHA 1MHOA 4BY5A 3FE6A 3BOWA 1RECA 1IKUA 1TRFA 2PMYA 1IJ6A 1XVJA 1M63B 1TOPA 1YUTA 3EKJA 1OQPA 2BE6A 2KAXA 1T14A 2KFFA 2L98A 4PE1A 2PRUA 3NXAA 1W9ZA 2KI6C 3S0EA 2LUCA 3CZTX 2M97A 2QEHA 1MF8B 1UP5A 4PCWA 1OZOA 4GAOA 1NUBA 4GGFC 3B86A 3O2PA 1KWOB 1TUZA 1Y6WA 4XJKA 1Z4HA 4MEWA 4DUQA 1SCMB 2BECA 3IVTA 3VB1A 5IBWA 2LM5A 1NYAA 1XA5A 4M2OA 3VRPA 4A4CA 2NCPA 3JTDC 1EG4A 3TDUA 1UHIA 1CMFA 1CFPA 1WRZA 2RGIA 1NCXA 2H61C 2OPOA 3EKHA 1Y1UA 1ZUZA 4PHNA 5CPVA 3PATA 4FTGA 1QATA 2F2OA 3OBVA 3B87A 1NSHA 1BMOA 2ZKMX 1AJ4A 2P70A 1KFXL 1IJ5A 4N1GA 3CZ2A 1OMRA 2BCAA 2KFHA 3TZ1A 4U8DA 1QXPA 1SY9A 2BL0B 1QTXA 3FWCA 2LNKA 4PE0A 1LS8A 3PN7C 2JPTA 3GK2A 4GGNA 5DKQA 3TDZA 1LKJA 2D8NA 2JRFA 2SASA 3BFAA 3N7HA 1K8UA 4JKTA 4INWA 2NXQA 3D0YA 3NSLA 4M2PA 1L2OC 2JC2A 2KQYA 1B1GA 2CXJA 2PQLA 1DJXA 1K96A 1RJVA 2JPOA 2PALA 3SG2A 1R2UA 5ER4X 1SK6D 1XFRA 3L47A 1PVAA 2K0JA 2L5YA 1CMGA 4MVFA 5FYXA 2LVKA 3ZNIA 1EXRA 1G8IA 3PM8A 5F6TA 1QV0A 4MZJA 3EK8A 2KHNA 2MHHA 5KSZA 2BNXA 4MLWA 1B8LA 2WCJA 3DZTA 1J55A 1M46A 1SRAA 1ORGA 1X02A 1F8HA 1C3ZA 3L4AA 4C0JA 1BR1B 1EG3A 1LVCD 3OX5A 3CABA 1K9PA 1CDNA 4PT1A 1LA0A 1N2DA 1NX0A 3EK7A 1IGVA 2ISDA 1BODA 4NQGA 4JD9A 1OZSA 1DJYA 2KPHA 2FOTA 1OE9B 4M2QA 5AANA 1L7ZA 2LLUA 2QEVA 3NSKA 1NIWA 2KI4C 2IS9A 3BUMB 2H8VA 2KBIA 2KGBC 3AKBA 2GTEA 2WNDA 5CSNA 2ZRSA 3RZSA 1KQVA 2B1UA 2FJUB 2OS8B 3AAKA 2JT0A 4I5JA 2CCMA 2YGUA 2CBLA 1J1DA 3B6XA 1UUSA 3R1VA 3R1PA 3SG7A 1A75B 4OCIA 3VRNA 2ZN8A 5D7FA 4OR9B 2L50A 2LMTA 1S1EA 4HSZA 3CWGA 2LCPA 1CLMA 3DVEA 4IL1A 3EK4A 3I5IB 3DYEA 3SJSA 3BUXB 4C0LA 4GPLB 1DT7B 3TUYC 1WRKA 1B7TZ 1QX5B 5I2QA 1XO5A 1QVIZ 1S5GZ 3SIAA 1SMGA 3LK0A 3DXLA 3MSEB 3JVTC 2P6BB 1AK8A 1ODBA 2M8UA 2LLSA 1Y0VH 2JXLA 1L2OB 4N5XA 1SYMA 2LV7A 2COLB 2KI6D 3I5HC 3O78A 1B7TY 1CM4A 2CTNA 3FIAA 4PALA 3K1EA 1QVIY 1S5GY 2OTGC 2ZNEA 3CTNA 1YR5A 1OOIX 1TIZA 4DS7A 2F3YA 1S3PA 2AAOA 2K7CA 2LP2A 3DVJA 1UWOA 3GK1A 5HKYA 3D75A 3VRRA 4FQTA 2O5GA 5KTYA 5HKWA 4YGBB 2WCFA 2M7NA 1DJHA 2GGMA 1C7VA 3CR2A 1NCZA 2QDIA 4OV2A 5HKZA 2NCOA 2HQ8A 2M3WA 2Y5IA 4HRGA 1E8AA 2JXCA 4WRIA 5CSJA 3AKAA 1FI5A 1SR6C 1FF1A 1BLQA 4I5KA 2KLDA 3D73A 2CNPA 2BBNA 1XFVO 2K60A 5AEQA 2HPSA 1OW4A 5TNCA 3BJHA 1QIWA 2FCEA 2I18A 2PASA 4L9MA 4INXA 4DCKA 1F54A 3LCPC 4YGCB 3CLNA 1WDCC 1CLLA 1TNPA 4XYNA 2ZRTA 1OMDA 4QJ3B 4YRUA 2ZFDA 1NCYA 3HX4A 2LANA 4QJ5B 1F4OA 3TS5C 2H2KA 2BKHB 3DF0A 5I94A 2KSPA 2BAPA 1J7RA 2M7LA 2JULA 2WC5A 3B88A 2LHLA 3HCMA 4WQ3A 3FE9A 2LMUA 3OX6A 3ZWHA 1DJGA 1K9KA 1YVLA 4JQ0D 1B9AA 2MLFC 4AQJA 1IIOA 3PJIA 1QASA 1RROA 4JPZB 1YX7A 2LE9B 1JWDA 1MXLC 2M9GA 3I5FB 1QX7A 4QJ4B 3DVKA 5ER5A 4I5NB 3CDNA 1UHNA 2AMIA 1IH0A 4DIRA 2JNFA 2EGDA 5FI7A 5JJGA 1H4BA 3DY9A 1RTP1 1KQMC 2WCHA 3NHTA 3NSIA 2M1UA 1MUXA 1CNPA 1C7WA 4MSPA 4ORCB 3OGNA 2L2EA 2P71A 5I2OA 1GJYA 2M29A 3SIBA 3JVTB 3UO9A
chains in the Genus database with same CATH topology
1K9UA 4E68A 2L4HA 3EVRA 1OMVA 1KSOA 3KPXA 2MJWB 2Y4QA 1S6JA 1XFUO 1N65A 1CTRA 1W7JB 1PULA 1SL8A 4YGAA 3AAJA 1LXFC 1YURA 1C07A 2OTGB 1IQ5A 1CKKA 4GFTA 4NDDA 1IQ3A 1FPWA 4NDCA 1LA3A 1U5IB 3PFVA 4CFQA 1AJ5A 3WHTB 2WORA 3BUNB 2O60A 3I5GC 1CM1A 1RWYA 3NSOA 3BQ3A 1Y1XA 2L0PA 2L4IA 2Y1MA 2G9BA 3VRQA 2QPTA 3H4SE 2EC6C 1XK4A 4ZCUA 1B4CA 4F0ZB 5D69A 1IWQA 1K94A 1R6PA 1QV1A 3GOFA 3K21A 3DVMA 2LVIA 1M45A 1B8RA 1NX1A 1KFUS 2LP3A 1RK9A 2NZ0A 4P2YB 1G33A 1WLMA 2DOQA 4ORBB 4BY4A 3FS7A 1BT6A 2HF5A 1QX2A 3JTDB 2LUXA 3CR5X 1JF0A 4CFRA 1KWOC 3WNXB 1MWNA 4ETOA 1SBJA 2KGRA 1DJWA 1SCMC 1KCYA 5G08A 1NX3A 1NPQA 1KSMA 1DVIA 5JOLA 1F70A 1BR4B 1TTXA 2M0RA 3SG3A 4MN0A 4TNCA 3EVUA 2MRDA 2LC5A 3A8RA 3PN7B 4N1FA 1CB1A 1SNLA 1UHKA 1WLZA 1CDPA 1KFXS 3D10A 1HT9A 1S6CA 3LK1A 2JU0A 1S6IA 1U5IA 2WC8A 1WY9A 1ZFSA 3GK4X 5HLOA 1J7OA 2JWWA 4MBEA 1XYDA 2KNEA 4PHKA 4PHMA 4XJKB 1KQMB 2BL0C 1SKTA 2A4JA 1BU3A 1NX2A 1DJIA 1BG1A 4PE7A 1TCOB 2JT3A 1TNQA 1Q80A 2KFGA 1J7PA 4YI9A 1XFWO 1JSAA 2EHBA 3LL8B 1GQMA 3O6BA 2PVBA 3WXAA 1QIVA 1ZACA 2LHIA 3SG5A 2VRGA 4GGFA 1W7IB 1CDLA 1GGWA 1SW8A 1XFZO 4D1EA 3SG4A 1J1EA 1A03A 1K93D 1JFJA 2BCXA 4OVNF 2TN4A 1A4PA 1A75A 1YRUB 5DKNA 5HLVA 1EJ3A 3RLZA 2H61A 3D0YB 5CSFA 2WOSA 1QS7A 1CFFA 1BOCA 3IF7A 2M1KB 1M39A 4AQIA 3BXKA 2BCBA 2F2PA 1V1GA 2KI4B 1PRWA 4MRXA 4UPGA 1AP4A 1KK8C 2JOJA 3PLFB 1S36A 1KFUL 1MXEA 2M49B 1DTLA 2K7OA 5AFPA 2QACA 3CS1A 5K89A 1PSBA 5KU1A 4ICBA 4HREE 5B8IB 2KBMA 1CDMA 1UHHA 4C0KA 5AXIA 1SPYA 1UHJA 3E3RA 1FBVA 4PE4A 2BBMA 2KOTA 2OS8C 1G4YR 1PALA 3BUOB 1NP8A 1YTZC 4ORAB 5I2LA 1DMOA 1M31A 1K90D 1MR8A 1TNWA 2F8PA 1IRJA 2Q91A 4FQOA 3TUYB 5I8NA 2I7AA 1YVHA 1S26D 1JFKA 1GGZA 3OP0A 3F45A 1TNXA 2LVJA 4AOMA 3A4UB 1NWDA 2K2FA 3I5IC 4PHJA 3C1VA 1YUUA 2LLTA 3RM1A 2I94A 3I5HB 2Q4UA 2FCDA 2HQWA 4A4BA 2K61A 1Y1AA 2LAPA 1AUIB 1PK0D 1DGVA 1N0YA 5CSIA 2JQ6A 3KEVA 2R2IA 4JWQA 2JT8A 1B47A 5J3XA 3BUWB 2MLEC 1V1FA 5GQQC 1QLKA 4PDZA 2KYFA 1EH2A 2HETA 3EVVA 4CIDA 1AVSA 3KF9A 4YGDB 2ZNDA 4CPVA 2K2AA 1SCVA 2MA2A 1JC2A 1QLSA 5HYDA 1SR6B 1DJZA 4YI8A 3KO0A 1BF5A 2GGZA 2K7BA 1JUOA 2I2RE 2WCEA 2PSRA 5DKRA 1YRTB 2G2BA 2NLNA 3CR4X 4CLNA 2L51A 2GV5A 3WHUB 1D1OA 3IQQA 3BYAA 1H8BA 1CLBA 1OSAA 1HQVA 1DF0B 4YBHB 1WDCB 4MZKA 2KAVA 1CFDA 2E30A 1F71A 3VGOA 1ZMZA 3SG6A 1DGUA 1KK8B 4NDBA 2MBXA 2F3ZA 1ZOTB 3TS5B 2BE4A 1BJFA 2KDHA 1XFYO 3M0WA 4Q04A 1JBAA 1VRKA 3BOWB 4MRYA 2WCBA 1PVBA 4YGEB 5BPJA 1K95A 3VROA 5PALA 4USLA 1CFCA 1AHRA 1TCFA 1WRLA 1F4QA 1XK4C 1A29A 1SL9A 2MAZA 1LINA 2JTZA 2Y1NA 2LMVA 2CT9A 3OB2B 1RFJA 1J7QA 1IG5A 1MQ1A 1KK7Z 1TN4A 2F33A 2V53A 3PALA 2AUCA 3ICBA 1ALVA 3TDIA 1A2XA 2JZIA 2K8MB 1YX8A 2JTTA 2SCPA 3O4YA 4P5OE 2KAYA 3I5FC 1FI6A 3IQOA 1B8CA 1KK7Y 5AERA 1JF2A 3DF0B 1QJTA 1F55A 3DD4A 2ZN9A 3PSRA 1ALWA 3OB1B 1EL4A 1UURA 1YUSA 3OHMB 1PSRA 3LLEA 2KQ6A 2E6WA 3CGAA 3KHEA 2JNXA 1FW4A 3QRXA 1K2HA 1DF0A 1OOJA 3I5GB 2K7DA 4GUKA 2LVVA 4R1EA 2L5XB 2KYCA 4GBAA 4DRWA 3FWBA 4WQ2A 1SL7A 1XFXO 2BKIB 4MZLA 4HRHA 4ZCVA 4I5LB 2EC6B 4GNKB 4OKHA 1MHOA 4BY5A 3BOWA 1RECA 1IKUA 1TRFA 2PMYA 1IJ6A 1XVJA 1M63B 1TOPA 1YUTA 3EKJA 1OQPA 2BE6A 2KAXA 2KFFA 2L98A 4PE1A 2PRUA 3NXAA 2KI6C 2LUCA 3CZTX 2M97A 1MF8B 1UP5A 4PCWA 1OZOA 4GAOA 1NUBA 4GGFC 3O2PA 1KWOB 1Y6WA 4XJKA 4MEWA 4DUQA 1SCMB 2BECA 5IBWA 2LM5A 1NYAA 1XA5A 4M2OA 3VRPA 4A4CA 2NCPA 3JTDC 1EG4A 3TDUA 1UHIA 1CMFA 1CFPA 1WRZA 2RGIA 1NCXA 2H61C 2OPOA 3EKHA 1Y1UA 1ZUZA 4PHNA 5CPVA 3PATA 4FTGA 1QATA 2F2OA 1NSHA 1BMOA 2ZKMX 1AJ4A 4N1GA 1KFXL 1IJ5A 1OMRA 2BCAA 2KFHA 3TZ1A 4U8DA 1QXPA 1SY9A 2BL0B 1QTXA 3FWCA 2LNKA 4PE0A 3PN7C 2JPTA 3GK2A 4GGNA 5DKQA 3TDZA 1LKJA 2D8NA 2JRFA 2SASA 1K8UA 2NXQA 3D0YA 3NSLA 4M2PA 1L2OC 2JC2A 2KQYA 1B1GA 2CXJA 1DJXA 1K96A 1RJVA 2PALA 3SG2A 1R2UA 5ER4X 1SK6D 1PVAA 2K0JA 1CMGA 4MVFA 5FYXA 2LVKA 3ZNIA 1EXRA 1G8IA 3PM8A 5F6TA 1QV0A 4MZJA 3EK8A 2KHNA 2MHHA 5KSZA 4MLWA 1B8LA 1J55A 1M46A 1SRAA 1F8HA 1X02A 4C0JA 1BR1B 1EG3A 1LVCD 3OX5A 1K9PA 1CDNA 1LA0A 1N2DA 1NX0A 3EK7A 1IGVA 2ISDA 1BODA 4NQGA 1OZSA 1DJYA 2FOTA 1OE9B 4M2QA 5AANA 1L7ZA 2LLUA 3NSKA 1NIWA 2KI4C 2IS9A 3BUMB 2KBIA 2KGBC 3AKBA 2WNDA 5CSNA 2ZRSA 1KQVA 2B1UA 2FJUB 2OS8B 3AAKA 2JT0A 4I5JA 2CCMA 2CBLA 1J1DA 1UUSA 3SG7A 1A75B 4OCIA 3VRNA 2ZN8A 5D7FA 4OR9B 2L50A 2LMTA 1S1EA 4HSZA 3CWGA 2LCPA 1CLMA 3DVEA 4IL1A 3EK4A 3I5IB 3SJSA 3BUXB 4C0LA 4GPLB 1DT7B 3TUYC 1WRKA 1B7TZ 1QX5B 5I2QA 1XO5A 1QVIZ 1S5GZ 3SIAA 1SMGA 3LK0A 3MSEB 3JVTC 2P6BB 1AK8A 1ODBA 2M8UA 2LLSA 1Y0VH 2JXLA 1L2OB 4N5XA 1SYMA 2LV7A 2COLB 2KI6D 3I5HC 3O78A 1B7TY 1CM4A 2CTNA 3FIAA 4PALA 1QVIY 1S5GY 2OTGC 2ZNEA 3CTNA 1YR5A 1TIZA 4DS7A 2F3YA 1S3PA 2AAOA 2K7CA 2LP2A 3DVJA 1UWOA 3GK1A 5HKYA 3VRRA 2O5GA 5KTYA 5HKWA 4YGBB 2WCFA 2M7NA 1DJHA 2GGMA 1C7VA 3CR2A 1NCZA 4OV2A 5HKZA 2NCOA 2HQ8A 2M3WA 2Y5IA 4HRGA 1E8AA 2JXCA 4WRIA 5CSJA 3AKAA 1FI5A 1SR6C 1FF1A 1BLQA 4I5KA 2CNPA 2BBNA 1XFVO 5AEQA 2HPSA 5TNCA 1QIWA 2FCEA 2I18A 2PASA 4L9MA 4DCKA 1F54A 3LCPC 4YGCB 3CLNA 1WDCC 1CLLA 1TNPA 4XYNA 2ZRTA 1OMDA 4QJ3B 4YRUA 2ZFDA 1NCYA 3HX4A 2LANA 4QJ5B 1F4OA 3TS5C 2H2KA 2BKHB 3DF0A 2KSPA 1J7RA 2M7LA 2JULA 2LHLA 3HCMA 4WQ3A 2LMUA 3OX6A 3ZWHA 1DJGA 1K9KA 1YVLA 4JQ0D 1B9AA 2MLFC 4AQJA 1QASA 1RROA 4JPZB 1YX7A 2LE9B 1JWDA 1MXLC 2M9GA 3I5FB 1QX7A 4QJ4B 3DVKA 5ER5A 4I5NB 1UHNA 2AMIA 1IH0A 4DIRA 2JNFA 2EGDA 5JJGA 1H4BA 1RTP1 1KQMC 3NSIA 2M1UA 1MUXA 1CNPA 1C7WA 4MSPA 4ORCB 2L2EA 5I2OA 1GJYA 2M29A 3SIBA 3JVTB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K9U A;  4E68 A;  2L4H A;  3EVR A;  1OMV A;  1KSO A;  3KPX A;  2MJW B;  2Y4Q A;  1S6J A;  1XFU O;  1N65 A;  1CTR A;  1W7J B;  1PUL A;  1SL8 A;  4YGA A;  3AAJ A;  1LXF C;  1YUR A;  1C07 A;  2OTG B;  1IQ5 A;  1CKK A;  4GFT A;  4NDD A;  1IQ3 A;  1FPW A;  4NDC A;  1LA3 A;  1U5I B;  3PFV A;  4CFQ A;  1AJ5 A;  3WHT B;  2WOR A;  3BUN B;  2O60 A;  3I5G C;  1CM1 A;  1RWY A;  3NSO A;  3BQ3 A;  1Y1X A;  2L0P A;  2L4I A;  2Y1M A;  2G9B A;  3VRQ A;  2QPT A;  3H4S E;  2EC6 C;  1XK4 A;  4ZCU A;  1B4C A;  4F0Z B;  5D69 A;  1IWQ A;  1K94 A;  1R6P A;  1QV1 A;  3GOF A;  3K21 A;  3DVM A;  2LVI A;  1M45 A;  1B8R A;  1NX1 A;  1KFU S;  2LP3 A;  1RK9 A;  2NZ0 A;  4P2Y B;  1G33 A;  1WLM A;  2DOQ A;  4ORB B;  4BY4 A;  3FS7 A;  1BT6 A;  2HF5 A;  1QX2 A;  3JTD B;  2LUX A;  3CR5 X;  1JF0 A;  4CFR A;  1KWO C;  3WNX B;  1MWN A;  4ETO A;  1SBJ A;  2KGR A;  1DJW A;  1SCM C;  1KCY A;  5G08 A;  1NX3 A;  1NPQ A;  1KSM A;  1DVI A;  5JOL A;  1F70 A;  1BR4 B;  1TTX A;  2M0R A;  3SG3 A;  4MN0 A;  4TNC A;  3EVU A;  2MRD A;  2LC5 A;  3A8R A;  3PN7 B;  4N1F A;  1CB1 A;  1SNL A;  1UHK A;  1WLZ A;  1CDP A;  1KFX S;  3D10 A;  1HT9 A;  1S6C A;  3LK1 A;  2JU0 A;  1S6I A;  1U5I A;  2WC8 A;  1WY9 A;  1ZFS A;  3GK4 X;  5HLO A;  1J7O A;  2JWW A;  4MBE A;  1XYD A;  2KNE A;  4PHK A;  4PHM A;  4XJK B;  1KQM B;  2BL0 C;  1SKT A;  2A4J A;  1BU3 A;  1NX2 A;  1DJI A;  1BG1 A;  4PE7 A;  1TCO B;  2JT3 A;  1TNQ A;  1Q80 A;  2KFG A;  1J7P A;  4YI9 A;  1XFW O;  1JSA A;  2EHB A;  3LL8 B;  1GQM A;  3O6B A;  2PVB A;  3WXA A;  1QIV A;  1ZAC A;  2LHI A;  3SG5 A;  2VRG A;  4GGF A;  1W7I B;  1CDL A;  1GGW A;  1SW8 A;  1XFZ O;  4D1E A;  3SG4 A;  1J1E A;  1A03 A;  1K93 D;  1JFJ A;  2BCX A;  4OVN F;  2TN4 A;  1A4P A;  1A75 A;  1YRU B;  5DKN A;  5HLV A;  1EJ3 A;  3RLZ A;  2H61 A;  3D0Y B;  5CSF A;  2WOS A;  1QS7 A;  1CFF A;  1BOC A;  3IF7 A;  2M1K B;  1M39 A;  4AQI A;  3BXK A;  2BCB A;  2F2P A;  1V1G A;  2KI4 B;  1PRW A;  4MRX A;  4UPG A;  1AP4 A;  1KK8 C;  2JOJ A;  3PLF B;  1S36 A;  1KFU L;  1MXE A;  2M49 B;  1DTL A;  2K7O A;  5AFP A;  2QAC A;  3CS1 A;  5K89 A;  1PSB A;  5KU1 A;  4ICB A;  4HRE E;  5B8I B;  2KBM A;  1CDM A;  1UHH A;  4C0K A;  5AXI A;  1SPY A;  1UHJ A;  3E3R A;  1FBV A;  4PE4 A;  2BBM A;  2KOT A;  2OS8 C;  1G4Y R;  1PAL A;  3BUO B;  1NP8 A;  1YTZ C;  4ORA B;  5I2L A;  1DMO A;  1M31 A;  1K90 D;  1MR8 A;  1TNW A;  2F8P A;  1IRJ A;  2Q91 A;  4FQO A;  3TUY B;  5I8N A;  2I7A A;  1YVH A;  1S26 D;  1JFK A;  1GGZ A;  3OP0 A;  3F45 A;  1TNX A;  2LVJ A;  4AOM A;  3A4U B;  1NWD A;  2K2F A;  3I5I C;  4PHJ A;  3C1V A;  1YUU A;  2LLT A;  3RM1 A;  2I94 A;  3I5H B;  2Q4U A;  2FCD A;  2HQW A;  4A4B A;  2K61 A;  1Y1A A;  2LAP A;  1AUI B;  1PK0 D;  1DGV A;  1N0Y A;  5CSI A;  2JQ6 A;  3KEV A;  2R2I A;  4JWQ A;  2JT8 A;  1B47 A;  5J3X A;  3BUW B;  2MLE C;  1V1F A;  5GQQ C;  1QLK A;  4PDZ A;  2KYF A;  1EH2 A;  2HET A;  3EVV A;  4CID A;  1AVS A;  3KF9 A;  4YGD B;  2ZND A;  4CPV A;  2K2A A;  1SCV A;  2MA2 A;  1JC2 A;  1QLS A;  5HYD A;  1SR6 B;  1DJZ A;  4YI8 A;  3KO0 A;  1BF5 A;  2GGZ A;  2K7B A;  1JUO A;  2I2R E;  2WCE A;  2PSR A;  5DKR A;  1YRT B;  2G2B A;  2NLN A;  3CR4 X;  4CLN A;  2L51 A;  2GV5 A;  3WHU B;  1D1O A;  3IQQ A;  3BYA A;  1H8B A;  1CLB A;  1OSA A;  1HQV A;  1DF0 B;  4YBH B;  1WDC B;  4MZK A;  2KAV A;  1CFD A;  2E30 A;  1F71 A;  3VGO A;  1ZMZ A;  3SG6 A;  1DGU A;  1KK8 B;  4NDB A;  2MBX A;  2F3Z A;  1ZOT B;  3TS5 B;  2BE4 A;  1BJF A;  2KDH A;  1XFY O;  3M0W A;  4Q04 A;  1JBA A;  1VRK A;  3BOW B;  4MRY A;  2WCB A;  1PVB A;  4YGE B;  5BPJ A;  1K95 A;  3VRO A;  5PAL A;  4USL A;  1CFC A;  1AHR A;  1TCF A;  1WRL A;  1F4Q A;  1XK4 C;  1A29 A;  1SL9 A;  2MAZ A;  1LIN A;  2JTZ A;  2Y1N A;  2LMV A;  2CT9 A;  3OB2 B;  1RFJ A;  1J7Q A;  1IG5 A;  1MQ1 A;  1KK7 Z;  1TN4 A;  2F33 A;  2V53 A;  3PAL A;  2AUC A;  3ICB A;  1ALV A;  3TDI A;  1A2X A;  2JZI A;  2K8M B;  1YX8 A;  2JTT A;  2SCP A;  3O4Y A;  4P5O E;  2KAY A;  3I5F C;  1FI6 A;  3IQO A;  1B8C A;  1KK7 Y;  5AER A;  1JF2 A;  3DF0 B;  1QJT A;  1F55 A;  3DD4 A;  2ZN9 A;  3PSR A;  1ALW A;  3OB1 B;  1EL4 A;  1UUR A;  1YUS A;  3OHM B;  1PSR A;  3LLE A;  2KQ6 A;  2E6W A;  3CGA A;  3KHE A;  2JNX A;  1FW4 A;  3QRX A;  1K2H A;  1DF0 A;  1OOJ A;  3I5G B;  2K7D A;  4GUK A;  2LVV A;  4R1E A;  2L5X B;  2KYC A;  4GBA A;  4DRW A;  3FWB A;  4WQ2 A;  1SL7 A;  1XFX O;  2BKI B;  4MZL A;  4HRH A;  4ZCV A;  4I5L B;  2EC6 B;  4GNK B;  4OKH A;  1MHO A;  4BY5 A;  3BOW A;  1REC A;  1IKU A;  1TRF A;  2PMY A;  1IJ6 A;  1XVJ A;  1M63 B;  1TOP A;  1YUT A;  3EKJ A;  1OQP A;  2BE6 A;  2KAX A;  2KFF A;  2L98 A;  4PE1 A;  2PRU A;  3NXA A;  2KI6 C;  2LUC A;  3CZT X;  2M97 A;  1MF8 B;  1UP5 A;  4PCW A;  1OZO A;  4GAO A;  1NUB A;  4GGF C;  3O2P A;  1KWO B;  1Y6W A;  4XJK A;  4MEW A;  4DUQ A;  1SCM B;  2BEC A;  5IBW A;  2LM5 A;  1NYA A;  1XA5 A;  4M2O A;  3VRP A;  4A4C A;  2NCP A;  3JTD C;  1EG4 A;  3TDU A;  1UHI A;  1CMF A;  1CFP A;  1WRZ A;  2RGI A;  1NCX A;  2H61 C;  2OPO A;  3EKH A;  1Y1U A;  1ZUZ A;  4PHN A;  5CPV A;  3PAT A;  4FTG A;  1QAT A;  2F2O A;  1NSH A;  1BMO A;  2ZKM X;  1AJ4 A;  4N1G A;  1KFX L;  1IJ5 A;  1OMR A;  2BCA A;  2KFH A;  3TZ1 A;  4U8D A;  1QXP A;  1SY9 A;  2BL0 B;  1QTX A;  3FWC A;  2LNK A;  4PE0 A;  3PN7 C;  2JPT A;  3GK2 A;  4GGN A;  5DKQ A;  3TDZ A;  1LKJ A;  2D8N A;  2JRF A;  2SAS A;  1K8U A;  2NXQ A;  3D0Y A;  3NSL A;  4M2P A;  1L2O C;  2JC2 A;  2KQY A;  1B1G A;  2CXJ A;  1DJX A;  1K96 A;  1RJV A;  2PAL A;  3SG2 A;  1R2U A;  5ER4 X;  1SK6 D;  1PVA A;  2K0J A;  1CMG A;  4MVF A;  5FYX A;  2LVK A;  3ZNI A;  1EXR A;  1G8I A;  3PM8 A;  5F6T A;  1QV0 A;  4MZJ A;  3EK8 A;  2KHN A;  2MHH A;  5KSZ A;  4MLW A;  1B8L A;  1J55 A;  1M46 A;  1SRA A;  1F8H A;  1X02 A;  4C0J A;  1BR1 B;  1EG3 A;  1LVC D;  3OX5 A;  1K9P A;  1CDN A;  1LA0 A;  1N2D A;  1NX0 A;  3EK7 A;  1IGV A;  2ISD A;  1BOD A;  4NQG A;  1OZS A;  1DJY A;  2FOT A;  1OE9 B;  4M2Q A;  5AAN A;  1L7Z A;  2LLU A;  3NSK A;  1NIW A;  2KI4 C;  2IS9 A;  3BUM B;  2KBI A;  2KGB C;  3AKB A;  2WND A;  5CSN A;  2ZRS A;  1KQV A;  2B1U A;  2FJU B;  2OS8 B;  3AAK A;  2JT0 A;  4I5J A;  2CCM A;  2CBL A;  1J1D A;  1UUS A;  3SG7 A;  1A75 B;  4OCI A;  3VRN A;  2ZN8 A;  5D7F A;  4OR9 B;  2L50 A;  2LMT A;  1S1E A;  4HSZ A;  3CWG A;  2LCP A;  1CLM A;  3DVE A;  4IL1 A;  3EK4 A;  3I5I B;  3SJS A;  3BUX B;  4C0L A;  4GPL B;  1DT7 B;  3TUY C;  1WRK A;  1B7T Z;  1QX5 B;  5I2Q A;  1XO5 A;  1QVI Z;  1S5G Z;  3SIA A;  1SMG A;  3LK0 A;  3MSE B;  3JVT C;  2P6B B;  1AK8 A;  1ODB A;  2M8U A;  2LLS A;  1Y0V H;  2JXL A;  1L2O B;  4N5X A;  1SYM A;  2LV7 A;  2COL B;  2KI6 D;  3I5H C;  3O78 A;  1B7T Y;  1CM4 A;  2CTN A;  3FIA A;  4PAL A;  1QVI Y;  1S5G Y;  2OTG C;  2ZNE A;  3CTN A;  1YR5 A;  1TIZ A;  4DS7 A;  2F3Y A;  1S3P A;  2AAO A;  2K7C A;  2LP2 A;  3DVJ A;  1UWO A;  3GK1 A;  5HKY A;  3VRR A;  2O5G A;  5KTY A;  5HKW A;  4YGB B;  2WCF A;  2M7N A;  1DJH A;  2GGM A;  1C7V A;  3CR2 A;  1NCZ A;  4OV2 A;  5HKZ A;  2NCO A;  2HQ8 A;  2M3W A;  2Y5I A;  4HRG A;  1E8A A;  2JXC A;  4WRI A;  5CSJ A;  3AKA A;  1FI5 A;  1SR6 C;  1FF1 A;  1BLQ A;  4I5K A;  2CNP A;  2BBN A;  1XFV O;  5AEQ A;  2HPS A;  5TNC A;  1QIW A;  2FCE A;  2I18 A;  2PAS A;  4L9M A;  4DCK A;  1F54 A;  3LCP C;  4YGC B;  3CLN A;  1WDC C;  1CLL A;  1TNP A;  4XYN A;  2ZRT A;  1OMD A;  4QJ3 B;  4YRU A;  2ZFD A;  1NCY A;  3HX4 A;  2LAN A;  4QJ5 B;  1F4O A;  3TS5 C;  2H2K A;  2BKH B;  3DF0 A;  2KSP A;  1J7R A;  2M7L A;  2JUL A;  2LHL A;  3HCM A;  4WQ3 A;  2LMU A;  3OX6 A;  3ZWH A;  1DJG A;  1K9K A;  1YVL A;  4JQ0 D;  1B9A A;  2MLF C;  4AQJ A;  1QAS A;  1RRO A;  4JPZ B;  1YX7 A;  2LE9 B;  1JWD A;  1MXL C;  2M9G A;  3I5F B;  1QX7 A;  4QJ4 B;  3DVK A;  5ER5 A;  4I5N B;  1UHN A;  2AMI A;  1IH0 A;  4DIR A;  2JNF A;  2EGD A;  5JJG A;  1H4B A;  1RTP 1;  1KQM C;  3NSI A;  2M1U A;  1MUX A;  1CNP A;  1C7W A;  4MSP A;  4ORC B;  2L2E A;  5I2O A;  1GJY A;  2M29 A;  3SIB A;  3JVT B; 
#chains in the Genus database with same CATH topology
 1K9U A;  4E68 A;  2L4H A;  3EVR A;  1OMV A;  1KSO A;  3KPX A;  2MJW B;  2Y4Q A;  1S6J A;  1XFU O;  3S0F A;  1N65 A;  1CTR A;  1W7J B;  1PUL A;  1SL8 A;  4YGA A;  3AAJ A;  1LXF C;  1YUR A;  1C07 A;  2OTG B;  1IQ5 A;  1CKK A;  4GFT A;  4NDD A;  1IQ3 A;  1FPW A;  4NDC A;  1LA3 A;  1U5I B;  3PFV A;  4CFQ A;  1AJ5 A;  3WHT B;  2WOR A;  3BUN B;  2O60 A;  3I5G C;  1CM1 A;  1RWY A;  2WCM A;  1OOH A;  3NSO A;  3BQ3 A;  3PM2 A;  3QME A;  1Y1X A;  2L0P A;  2L4I A;  2Y1M A;  2G9B A;  3VRQ A;  1OOF A;  2QPT A;  3H4S E;  2EC6 C;  1XK4 A;  4ZCU A;  1B4C A;  4F0Z B;  5D69 A;  1IWQ A;  1K94 A;  1R6P A;  1QV1 A;  3GOF A;  3K21 A;  3DVM A;  3SS5 A;  2LVI A;  1M45 A;  1B8R A;  1NX1 A;  1OOG A;  1KFU S;  2LP3 A;  1RK9 A;  2NZ0 A;  3D78 A;  4IJ7 A;  4P2Y B;  1G33 A;  1WLM A;  2DOQ A;  4ORB B;  4BY4 A;  2WC6 A;  3FS7 A;  1BT6 A;  2HF5 A;  1QX2 A;  3JTD B;  2LUX A;  3CR5 X;  1JF0 A;  4CFR A;  1KWO C;  3WNX B;  1MWN A;  4ETO A;  1SBJ A;  2KGR A;  1DJW A;  1SCM C;  1KCY A;  5G08 A;  1NX3 A;  1NPQ A;  1KSM A;  1DVI A;  5JOL A;  1F70 A;  1BR4 B;  1TTX A;  2M0R A;  2QEO A;  3SG3 A;  1TWO A;  2FJY A;  4MN0 A;  3S0D A;  3D76 A;  4TNC A;  3EVU A;  2MRD A;  2LC5 A;  3A8R A;  3PN7 B;  4N1F A;  1CB1 A;  1SNL A;  1UHK A;  1DEL A;  1WLZ A;  1CDP A;  1KFX S;  3D10 A;  1HT9 A;  1S6C A;  3LK1 A;  2JU0 A;  1S6I A;  1U5I A;  2WC8 A;  1WY9 A;  1ZFS A;  3EG5 B;  3GK4 X;  5HLO A;  1J7O A;  2JWW A;  4MBE A;  1XYD A;  2KNE A;  4PHK A;  5HL1 A;  4PHM A;  4XJK B;  1KQM B;  2BL0 C;  3CZ1 A;  1SKT A;  2A4J A;  5D3O A;  3NHI A;  3NGV A;  1BU3 A;  1NX2 A;  1DJI A;  1BG1 A;  4PE7 A;  1TCO B;  2JT3 A;  1TNQ A;  1Q80 A;  3SS4 A;  1P28 A;  2KFG A;  1J7P A;  4YI9 A;  1XFW O;  1JSA A;  2EHB A;  3LL8 B;  1GQM A;  3O6B A;  2PVB A;  4OZD A;  3WXA A;  1QIV A;  1ZAC A;  2LHI A;  3BFH A;  2VRG A;  3SG5 A;  4F7F A;  4GGF A;  3FE8 A;  2WCL A;  1W7I B;  1CDL A;  1GGW A;  3R72 A;  1SW8 A;  1XFZ O;  4D1E A;  1QWV A;  3SG4 A;  1J1E A;  1Z2C B;  1A03 A;  1K93 D;  1JFJ A;  5FI2 A;  3O4X A;  2BCX A;  4OVN F;  2TN4 A;  1A4P A;  1A75 A;  1YRU B;  5DKN A;  5HLV A;  1EJ3 A;  3RLZ A;  2H61 A;  3D0Y B;  5CSF A;  2WOS A;  1QS7 A;  1SSE B;  1CFF A;  1BOC A;  3IF7 A;  2M1K B;  1M39 A;  4AQI A;  3BXK A;  2BCB A;  2F2P A;  1V1G A;  2KI4 B;  1PRW A;  4MRX A;  4UPG A;  1AP4 A;  1KK8 C;  1TUJ A;  2JOJ A;  3PLF B;  1S36 A;  1KFU L;  1DC1 A;  1MXE A;  2M49 B;  1DTL A;  2K7O A;  3S0G A;  5AFP A;  2QEB A;  2QAC A;  3CS1 A;  5K89 A;  1PSB A;  5KU1 A;  4ICB A;  4HRE E;  5B8I B;  3S0A A;  2KBM A;  1CDM A;  1UHH A;  4C0K A;  5AXI A;  1SPY A;  1UHJ A;  3E3R A;  1FBV A;  4PE4 A;  2BBM A;  2KOT A;  2OS8 C;  1G4Y R;  3CYZ A;  1PAL A;  3BUO B;  1NP8 A;  1YTZ C;  4ORA B;  5I2L A;  1DMO A;  1M31 A;  1K90 D;  1MR8 A;  1TNW A;  1DEK A;  1IRJ A;  2F8P A;  2Q91 A;  4FQO A;  3TUY B;  3CZ0 A;  2I7A A;  5I8N A;  1YVH A;  1S26 D;  1JFK A;  1GGZ A;  3OP0 A;  3F45 A;  1TNX A;  2LVJ A;  4AOM A;  3A4U B;  1NWD A;  2K2F A;  3I5I C;  4PHJ A;  3C1V A;  1YUU A;  1DQE A;  2LLT A;  3RM1 A;  2I94 A;  2WCK A;  3I5H B;  2Q4U A;  2FCD A;  2HQW A;  4A4B A;  2K61 A;  1Y1A A;  2LAP A;  1AUI B;  1PK0 D;  1DGV A;  1N0Y A;  5CSI A;  2JQ6 A;  3KEV A;  2R2I A;  4JWQ A;  2JT8 A;  1B47 A;  5J3X A;  3BUW B;  2MLE C;  1V1F A;  5DIC A;  5GQQ C;  1QLK A;  4PDZ A;  2KYF A;  1EH2 A;  2HET A;  3EVV A;  4CID A;  1AVS A;  3KF9 A;  4YGD B;  2ZND A;  2L2C A;  2K2A A;  1SCV A;  2MA2 A;  4CPV A;  1JC2 A;  1QLS A;  5HYD A;  3UNW A;  1SR6 B;  1C3Y A;  1DJZ A;  4YI8 A;  3KO0 A;  1BF5 A;  2GGZ A;  2K7B A;  1JUO A;  2I2R E;  2WCE A;  3S0B A;  2PSR A;  5DKR A;  1YRT B;  2G2B A;  2NLN A;  3CR4 X;  4CLN A;  2L51 A;  2GV5 A;  3WHU B;  1D1O A;  3IQQ A;  3BYA A;  1H8B A;  1CLB A;  2ERB A;  1OSA A;  1HQV A;  1DF0 B;  4KYN A;  4YBH B;  1WDC B;  4MZK A;  2KAV A;  1CFD A;  2E30 A;  1F71 A;  3VGO A;  1GM0 A;  1ZMZ A;  3SG6 A;  1DGU A;  1KK8 B;  4NDB A;  3BFB A;  2MBX A;  2F3Z A;  1ZOT B;  3TS5 B;  2BE4 A;  1BJF A;  2KDH A;  1XFY O;  3M0W A;  4Q04 A;  1JBA A;  1VRK A;  3BOW B;  4MRY A;  2WCB A;  1PVB A;  3R1O A;  4YGE B;  5BPJ A;  1K95 A;  3VRO A;  5PAL A;  4USL A;  1CFC A;  1AHR A;  1TCF A;  1WRL A;  1F4Q A;  1XK4 C;  1A29 A;  1SL9 A;  2MAZ A;  1LIN A;  2JTZ A;  2Y1N A;  2LMV A;  3SS3 A;  2CT9 A;  3OB2 B;  1RFJ A;  1J7Q A;  1IG5 A;  1MQ1 A;  1KK7 Z;  1TN4 A;  2F33 A;  3B7A A;  2V53 A;  3PAL A;  2AUC A;  3ICB A;  1ALV A;  3TDI A;  1A2X A;  2JZI A;  2K8M B;  2KLE A;  3D77 A;  1YX8 A;  3L4L A;  2JTT A;  2SCP A;  3D74 A;  3O4Y A;  4P5O E;  2KAY A;  3I5F C;  2PYQ A;  1FI6 A;  3IQO A;  1B8C A;  1KK7 Y;  5AER A;  1JF2 A;  3DF0 B;  1QJT A;  1F55 A;  3DD4 A;  2ZN9 A;  3PSR A;  3V2L A;  1ALW A;  5EL2 A;  3OB1 B;  1EL4 A;  1UUR A;  1YUS A;  3OHM B;  1PSR A;  3LLE A;  2KQ6 A;  2E6W A;  3CGA A;  3KHE A;  2JNX A;  1FW4 A;  3QRX A;  1K2H A;  1DF0 A;  1OOJ A;  3I5G B;  2K7D A;  4GUK A;  2LVV A;  4R1E A;  2L5X B;  2KYC A;  3Q8I A;  4GBA A;  4DRW A;  3FWB A;  4WQ2 A;  1SL7 A;  1XFX O;  2BKI B;  4MZL A;  4HRH A;  4ZCV A;  4I5L B;  2EC6 B;  5FI6 A;  4GNK B;  4OKH A;  1MHO A;  4BY5 A;  3FE6 A;  3BOW A;  1REC A;  1IKU A;  1TRF A;  2PMY A;  1IJ6 A;  1XVJ A;  1M63 B;  1TOP A;  1YUT A;  3EKJ A;  1OQP A;  2BE6 A;  2KAX A;  1T14 A;  2KFF A;  2L98 A;  4PE1 A;  2PRU A;  3NXA A;  1W9Z A;  2KI6 C;  3S0E A;  2LUC A;  3CZT X;  2M97 A;  2QEH A;  1MF8 B;  1UP5 A;  4PCW A;  1OZO A;  4GAO A;  1NUB A;  4GGF C;  3B86 A;  3O2P A;  1KWO B;  1TUZ A;  1Y6W A;  4XJK A;  1Z4H A;  4MEW A;  4DUQ A;  1SCM B;  2BEC A;  3IVT A;  3VB1 A;  5IBW A;  2LM5 A;  1NYA A;  1XA5 A;  4M2O A;  3VRP A;  4A4C A;  2NCP A;  3JTD C;  1EG4 A;  3TDU A;  1UHI A;  1CMF A;  1CFP A;  1WRZ A;  2RGI A;  1NCX A;  2H61 C;  2OPO A;  3EKH A;  1Y1U A;  1ZUZ A;  4PHN A;  5CPV A;  3PAT A;  4FTG A;  1QAT A;  2F2O A;  3OBV A;  3B87 A;  1NSH A;  1BMO A;  2ZKM X;  1AJ4 A;  2P70 A;  1KFX L;  1IJ5 A;  4N1G A;  3CZ2 A;  1OMR A;  2BCA A;  2KFH A;  3TZ1 A;  4U8D A;  1QXP A;  1SY9 A;  2BL0 B;  1QTX A;  3FWC A;  2LNK A;  4PE0 A;  1LS8 A;  3PN7 C;  2JPT A;  3GK2 A;  4GGN A;  5DKQ A;  3TDZ A;  1LKJ A;  2D8N A;  2JRF A;  2SAS A;  3BFA A;  3N7H A;  1K8U A;  4JKT A;  4INW A;  2NXQ A;  3D0Y A;  3NSL A;  4M2P A;  1L2O C;  2JC2 A;  2KQY A;  1B1G A;  2CXJ A;  2PQL A;  1DJX A;  1K96 A;  1RJV A;  2JPO A;  2PAL A;  3SG2 A;  1R2U A;  5ER4 X;  1SK6 D;  1XFR A;  3L47 A;  1PVA A;  2K0J A;  2L5Y A;  1CMG A;  4MVF A;  5FYX A;  2LVK A;  3ZNI A;  1EXR A;  1G8I A;  3PM8 A;  5F6T A;  1QV0 A;  4MZJ A;  3EK8 A;  2KHN A;  2MHH A;  5KSZ A;  2BNX A;  4MLW A;  1B8L A;  2WCJ A;  3DZT A;  1J55 A;  1M46 A;  1SRA A;  1ORG A;  1X02 A;  1F8H A;  1C3Z A;  3L4A A;  4C0J A;  1BR1 B;  1EG3 A;  1LVC D;  3OX5 A;  3CAB A;  1K9P A;  1CDN A;  4PT1 A;  1LA0 A;  1N2D A;  1NX0 A;  3EK7 A;  1IGV A;  2ISD A;  1BOD A;  4NQG A;  4JD9 A;  1OZS A;  1DJY A;  2KPH A;  2FOT A;  1OE9 B;  4M2Q A;  5AAN A;  1L7Z A;  2LLU A;  2QEV A;  3NSK A;  1NIW A;  2KI4 C;  2IS9 A;  3BUM B;  2H8V A;  2KBI A;  2KGB C;  3AKB A;  2GTE A;  2WND A;  5CSN A;  2ZRS A;  3RZS A;  1KQV A;  2B1U A;  2FJU B;  2OS8 B;  3AAK A;  2JT0 A;  4I5J A;  2CCM A;  2YGU A;  2CBL A;  1J1D A;  3B6X A;  1UUS A;  3R1V A;  3R1P A;  3SG7 A;  1A75 B;  4OCI A;  3VRN A;  2ZN8 A;  5D7F A;  4OR9 B;  2L50 A;  2LMT A;  1S1E A;  4HSZ A;  3CWG A;  2LCP A;  1CLM A;  3DVE A;  4IL1 A;  3EK4 A;  3I5I B;  3DYE A;  3SJS A;  3BUX B;  4C0L A;  4GPL B;  1DT7 B;  3TUY C;  1WRK A;  1B7T Z;  1QX5 B;  5I2Q A;  1XO5 A;  1QVI Z;  1S5G Z;  3SIA A;  1SMG A;  3LK0 A;  3DXL A;  3MSE B;  3JVT C;  2P6B B;  1AK8 A;  1ODB A;  2M8U A;  2LLS A;  1Y0V H;  2JXL A;  1L2O B;  4N5X A;  1SYM A;  2LV7 A;  2COL B;  2KI6 D;  3I5H C;  3O78 A;  1B7T Y;  1CM4 A;  2CTN A;  3FIA A;  4PAL A;  3K1E A;  1QVI Y;  1S5G Y;  2OTG C;  2ZNE A;  3CTN A;  1YR5 A;  1OOI X;  1TIZ A;  4DS7 A;  2F3Y A;  1S3P A;  2AAO A;  2K7C A;  2LP2 A;  3DVJ A;  1UWO A;  3GK1 A;  5HKY A;  3D75 A;  3VRR A;  4FQT A;  2O5G A;  5KTY A;  5HKW A;  4YGB B;  2WCF A;  2M7N A;  1DJH A;  2GGM A;  1C7V A;  3CR2 A;  1NCZ A;  2QDI A;  4OV2 A;  5HKZ A;  2NCO A;  2HQ8 A;  2M3W A;  2Y5I A;  4HRG A;  1E8A A;  2JXC A;  4WRI A;  5CSJ A;  3AKA A;  1FI5 A;  1SR6 C;  1FF1 A;  1BLQ A;  4I5K A;  2KLD A;  3D73 A;  2CNP A;  2BBN A;  1XFV O;  2K60 A;  5AEQ A;  2HPS A;  1OW4 A;  5TNC A;  3BJH A;  1QIW A;  2FCE A;  2I18 A;  2PAS A;  4L9M A;  4INX A;  4DCK A;  1F54 A;  3LCP C;  4YGC B;  3CLN A;  1WDC C;  1CLL A;  1TNP A;  4XYN A;  2ZRT A;  1OMD A;  4QJ3 B;  4YRU A;  2ZFD A;  1NCY A;  3HX4 A;  2LAN A;  4QJ5 B;  1F4O A;  3TS5 C;  2H2K A;  2BKH B;  3DF0 A;  5I94 A;  2KSP A;  2BAP A;  1J7R A;  2M7L A;  2JUL A;  2WC5 A;  3B88 A;  2LHL A;  3HCM A;  4WQ3 A;  3FE9 A;  2LMU A;  3OX6 A;  3ZWH A;  1DJG A;  1K9K A;  1YVL A;  4JQ0 D;  1B9A A;  2MLF C;  4AQJ A;  1IIO A;  3PJI A;  1QAS A;  1RRO A;  4JPZ B;  1YX7 A;  2LE9 B;  1JWD A;  1MXL C;  2M9G A;  3I5F B;  1QX7 A;  4QJ4 B;  3DVK A;  5ER5 A;  4I5N B;  3CDN A;  1UHN A;  2AMI A;  1IH0 A;  4DIR A;  2JNF A;  2EGD A;  5FI7 A;  5JJG A;  1H4B A;  3DY9 A;  1RTP 1;  1KQM C;  2WCH A;  3NHT A;  3NSI A;  2M1U A;  1MUX A;  1CNP A;  1C7W A;  4MSP A;  4ORC B;  3OGN A;  2L2E A;  2P71 A;  5I2O A;  1GJY A;  2M29 A;  3SIB A;  3JVT B;  3UO9 A; 
#chains in the Genus database with same CATH homology
 1K9U A;  4E68 A;  2L4H A;  3EVR A;  1OMV A;  1KSO A;  3KPX A;  2MJW B;  2Y4Q A;  1S6J A;  1XFU O;  1N65 A;  1CTR A;  1W7J B;  1PUL A;  1SL8 A;  4YGA A;  3AAJ A;  1LXF C;  1YUR A;  1C07 A;  2OTG B;  1IQ5 A;  1CKK A;  4GFT A;  4NDD A;  1IQ3 A;  1FPW A;  4NDC A;  1LA3 A;  1U5I B;  3PFV A;  4CFQ A;  1AJ5 A;  3WHT B;  2WOR A;  3BUN B;  2O60 A;  3I5G C;  1CM1 A;  1RWY A;  3NSO A;  3BQ3 A;  1Y1X A;  2L0P A;  2L4I A;  2Y1M A;  2G9B A;  3VRQ A;  2QPT A;  3H4S E;  2EC6 C;  1XK4 A;  4ZCU A;  1B4C A;  4F0Z B;  5D69 A;  1IWQ A;  1K94 A;  1R6P A;  1QV1 A;  3GOF A;  3K21 A;  3DVM A;  2LVI A;  1M45 A;  1B8R A;  1NX1 A;  1KFU S;  2LP3 A;  1RK9 A;  2NZ0 A;  4P2Y B;  1G33 A;  1WLM A;  2DOQ A;  4ORB B;  4BY4 A;  3FS7 A;  1BT6 A;  2HF5 A;  1QX2 A;  3JTD B;  2LUX A;  3CR5 X;  1JF0 A;  4CFR A;  1KWO C;  3WNX B;  1MWN A;  4ETO A;  1SBJ A;  2KGR A;  1DJW A;  1SCM C;  1KCY A;  5G08 A;  1NX3 A;  1NPQ A;  1KSM A;  1DVI A;  5JOL A;  1F70 A;  1BR4 B;  1TTX A;  2M0R A;  3SG3 A;  4MN0 A;  4TNC A;  3EVU A;  2MRD A;  2LC5 A;  3A8R A;  3PN7 B;  4N1F A;  1CB1 A;  1SNL A;  1UHK A;  1WLZ A;  1CDP A;  1KFX S;  3D10 A;  1HT9 A;  1S6C A;  3LK1 A;  2JU0 A;  1S6I A;  1U5I A;  2WC8 A;  1WY9 A;  1ZFS A;  3GK4 X;  5HLO A;  1J7O A;  2JWW A;  4MBE A;  1XYD A;  2KNE A;  4PHK A;  4PHM A;  4XJK B;  1KQM B;  2BL0 C;  1SKT A;  2A4J A;  1BU3 A;  1NX2 A;  1DJI A;  1BG1 A;  4PE7 A;  1TCO B;  2JT3 A;  1TNQ A;  1Q80 A;  2KFG A;  1J7P A;  4YI9 A;  1XFW O;  1JSA A;  2EHB A;  3LL8 B;  1GQM A;  3O6B A;  2PVB A;  3WXA A;  1QIV A;  1ZAC A;  2LHI A;  3SG5 A;  2VRG A;  4GGF A;  1W7I B;  1CDL A;  1GGW A;  1SW8 A;  1XFZ O;  4D1E A;  3SG4 A;  1J1E A;  1A03 A;  1K93 D;  1JFJ A;  2BCX A;  4OVN F;  2TN4 A;  1A4P A;  1A75 A;  1YRU B;  5DKN A;  5HLV A;  1EJ3 A;  3RLZ A;  2H61 A;  3D0Y B;  5CSF A;  2WOS A;  1QS7 A;  1CFF A;  1BOC A;  3IF7 A;  2M1K B;  1M39 A;  4AQI A;  3BXK A;  2BCB A;  2F2P A;  1V1G A;  2KI4 B;  1PRW A;  4MRX A;  4UPG A;  1AP4 A;  1KK8 C;  2JOJ A;  3PLF B;  1S36 A;  1KFU L;  1MXE A;  2M49 B;  1DTL A;  2K7O A;  5AFP A;  2QAC A;  3CS1 A;  5K89 A;  1PSB A;  5KU1 A;  4ICB A;  4HRE E;  5B8I B;  2KBM A;  1CDM A;  1UHH A;  4C0K A;  5AXI A;  1SPY A;  1UHJ A;  3E3R A;  1FBV A;  4PE4 A;  2BBM A;  2KOT A;  2OS8 C;  1G4Y R;  1PAL A;  3BUO B;  1NP8 A;  1YTZ C;  4ORA B;  5I2L A;  1DMO A;  1M31 A;  1K90 D;  1MR8 A;  1TNW A;  2F8P A;  1IRJ A;  2Q91 A;  4FQO A;  3TUY B;  5I8N A;  2I7A A;  1YVH A;  1S26 D;  1JFK A;  1GGZ A;  3OP0 A;  3F45 A;  1TNX A;  2LVJ A;  4AOM A;  3A4U B;  1NWD A;  2K2F A;  3I5I C;  4PHJ A;  3C1V A;  1YUU A;  2LLT A;  3RM1 A;  2I94 A;  3I5H B;  2Q4U A;  2FCD A;  2HQW A;  4A4B A;  2K61 A;  1Y1A A;  2LAP A;  1AUI B;  1PK0 D;  1DGV A;  1N0Y A;  5CSI A;  2JQ6 A;  3KEV A;  2R2I A;  4JWQ A;  2JT8 A;  1B47 A;  5J3X A;  3BUW B;  2MLE C;  1V1F A;  5GQQ C;  1QLK A;  4PDZ A;  2KYF A;  1EH2 A;  2HET A;  3EVV A;  4CID A;  1AVS A;  3KF9 A;  4YGD B;  2ZND A;  4CPV A;  2K2A A;  1SCV A;  2MA2 A;  1JC2 A;  1QLS A;  5HYD A;  1SR6 B;  1DJZ A;  4YI8 A;  3KO0 A;  1BF5 A;  2GGZ A;  2K7B A;  1JUO A;  2I2R E;  2WCE A;  2PSR A;  5DKR A;  1YRT B;  2G2B A;  2NLN A;  3CR4 X;  4CLN A;  2L51 A;  2GV5 A;  3WHU B;  1D1O A;  3IQQ A;  3BYA A;  1H8B A;  1CLB A;  1OSA A;  1HQV A;  1DF0 B;  4YBH B;  1WDC B;  4MZK A;  2KAV A;  1CFD A;  2E30 A;  1F71 A;  3VGO A;  1ZMZ A;  3SG6 A;  1DGU A;  1KK8 B;  4NDB A;  2MBX A;  2F3Z A;  1ZOT B;  3TS5 B;  2BE4 A;  1BJF A;  2KDH A;  1XFY O;  3M0W A;  4Q04 A;  1JBA A;  1VRK A;  3BOW B;  4MRY A;  2WCB A;  1PVB A;  4YGE B;  5BPJ A;  1K95 A;  3VRO A;  5PAL A;  4USL A;  1CFC A;  1AHR A;  1TCF A;  1WRL A;  1F4Q A;  1XK4 C;  1A29 A;  1SL9 A;  2MAZ A;  1LIN A;  2JTZ A;  2Y1N A;  2LMV A;  2CT9 A;  3OB2 B;  1RFJ A;  1J7Q A;  1IG5 A;  1MQ1 A;  1KK7 Z;  1TN4 A;  2F33 A;  2V53 A;  3PAL A;  2AUC A;  3ICB A;  1ALV A;  3TDI A;  1A2X A;  2JZI A;  2K8M B;  1YX8 A;  2JTT A;  2SCP A;  3O4Y A;  4P5O E;  2KAY A;  3I5F C;  1FI6 A;  3IQO A;  1B8C A;  1KK7 Y;  5AER A;  1JF2 A;  3DF0 B;  1QJT A;  1F55 A;  3DD4 A;  2ZN9 A;  3PSR A;  1ALW A;  3OB1 B;  1EL4 A;  1UUR A;  1YUS A;  3OHM B;  1PSR A;  3LLE A;  2KQ6 A;  2E6W A;  3CGA A;  3KHE A;  2JNX A;  1FW4 A;  3QRX A;  1K2H A;  1DF0 A;  1OOJ A;  3I5G B;  2K7D A;  4GUK A;  2LVV A;  4R1E A;  2L5X B;  2KYC A;  4GBA A;  4DRW A;  3FWB A;  4WQ2 A;  1SL7 A;  1XFX O;  2BKI B;  4MZL A;  4HRH A;  4ZCV A;  4I5L B;  2EC6 B;  4GNK B;  4OKH A;  1MHO A;  4BY5 A;  3BOW A;  1REC A;  1IKU A;  1TRF A;  2PMY A;  1IJ6 A;  1XVJ A;  1M63 B;  1TOP A;  1YUT A;  3EKJ A;  1OQP A;  2BE6 A;  2KAX A;  2KFF A;  2L98 A;  4PE1 A;  2PRU A;  3NXA A;  2KI6 C;  2LUC A;  3CZT X;  2M97 A;  1MF8 B;  1UP5 A;  4PCW A;  1OZO A;  4GAO A;  1NUB A;  4GGF C;  3O2P A;  1KWO B;  1Y6W A;  4XJK A;  4MEW A;  4DUQ A;  1SCM B;  2BEC A;  5IBW A;  2LM5 A;  1NYA A;  1XA5 A;  4M2O A;  3VRP A;  4A4C A;  2NCP A;  3JTD C;  1EG4 A;  3TDU A;  1UHI A;  1CMF A;  1CFP A;  1WRZ A;  2RGI A;  1NCX A;  2H61 C;  2OPO A;  3EKH A;  1Y1U A;  1ZUZ A;  4PHN A;  5CPV A;  3PAT A;  4FTG A;  1QAT A;  2F2O A;  1NSH A;  1BMO A;  2ZKM X;  1AJ4 A;  4N1G A;  1KFX L;  1IJ5 A;  1OMR A;  2BCA A;  2KFH A;  3TZ1 A;  4U8D A;  1QXP A;  1SY9 A;  2BL0 B;  1QTX A;  3FWC A;  2LNK A;  4PE0 A;  3PN7 C;  2JPT A;  3GK2 A;  4GGN A;  5DKQ A;  3TDZ A;  1LKJ A;  2D8N A;  2JRF A;  2SAS A;  1K8U A;  2NXQ A;  3D0Y A;  3NSL A;  4M2P A;  1L2O C;  2JC2 A;  2KQY A;  1B1G A;  2CXJ A;  1DJX A;  1K96 A;  1RJV A;  2PAL A;  3SG2 A;  1R2U A;  5ER4 X;  1SK6 D;  1PVA A;  2K0J A;  1CMG A;  4MVF A;  5FYX A;  2LVK A;  3ZNI A;  1EXR A;  1G8I A;  3PM8 A;  5F6T A;  1QV0 A;  4MZJ A;  3EK8 A;  2KHN A;  2MHH A;  5KSZ A;  4MLW A;  1B8L A;  1J55 A;  1M46 A;  1SRA A;  1F8H A;  1X02 A;  4C0J A;  1BR1 B;  1EG3 A;  1LVC D;  3OX5 A;  1K9P A;  1CDN A;  1LA0 A;  1N2D A;  1NX0 A;  3EK7 A;  1IGV A;  2ISD A;  1BOD A;  4NQG A;  1OZS A;  1DJY A;  2FOT A;  1OE9 B;  4M2Q A;  5AAN A;  1L7Z A;  2LLU A;  3NSK A;  1NIW A;  2KI4 C;  2IS9 A;  3BUM B;  2KBI A;  2KGB C;  3AKB A;  2WND A;  5CSN A;  2ZRS A;  1KQV A;  2B1U A;  2FJU B;  2OS8 B;  3AAK A;  2JT0 A;  4I5J A;  2CCM A;  2CBL A;  1J1D A;  1UUS A;  3SG7 A;  1A75 B;  4OCI A;  3VRN A;  2ZN8 A;  5D7F A;  4OR9 B;  2L50 A;  2LMT A;  1S1E A;  4HSZ A;  3CWG A;  2LCP A;  1CLM A;  3DVE A;  4IL1 A;  3EK4 A;  3I5I B;  3SJS A;  3BUX B;  4C0L A;  4GPL B;  1DT7 B;  3TUY C;  1WRK A;  1B7T Z;  1QX5 B;  5I2Q A;  1XO5 A;  1QVI Z;  1S5G Z;  3SIA A;  1SMG A;  3LK0 A;  3MSE B;  3JVT C;  2P6B B;  1AK8 A;  1ODB A;  2M8U A;  2LLS A;  1Y0V H;  2JXL A;  1L2O B;  4N5X A;  1SYM A;  2LV7 A;  2COL B;  2KI6 D;  3I5H C;  3O78 A;  1B7T Y;  1CM4 A;  2CTN A;  3FIA A;  4PAL A;  1QVI Y;  1S5G Y;  2OTG C;  2ZNE A;  3CTN A;  1YR5 A;  1TIZ A;  4DS7 A;  2F3Y A;  1S3P A;  2AAO A;  2K7C A;  2LP2 A;  3DVJ A;  1UWO A;  3GK1 A;  5HKY A;  3VRR A;  2O5G A;  5KTY A;  5HKW A;  4YGB B;  2WCF A;  2M7N A;  1DJH A;  2GGM A;  1C7V A;  3CR2 A;  1NCZ A;  4OV2 A;  5HKZ A;  2NCO A;  2HQ8 A;  2M3W A;  2Y5I A;  4HRG A;  1E8A A;  2JXC A;  4WRI A;  5CSJ A;  3AKA A;  1FI5 A;  1SR6 C;  1FF1 A;  1BLQ A;  4I5K A;  2CNP A;  2BBN A;  1XFV O;  5AEQ A;  2HPS A;  5TNC A;  1QIW A;  2FCE A;  2I18 A;  2PAS A;  4L9M A;  4DCK A;  1F54 A;  3LCP C;  4YGC B;  3CLN A;  1WDC C;  1CLL A;  1TNP A;  4XYN A;  2ZRT A;  1OMD A;  4QJ3 B;  4YRU A;  2ZFD A;  1NCY A;  3HX4 A;  2LAN A;  4QJ5 B;  1F4O A;  3TS5 C;  2H2K A;  2BKH B;  3DF0 A;  2KSP A;  1J7R A;  2M7L A;  2JUL A;  2LHL A;  3HCM A;  4WQ3 A;  2LMU A;  3OX6 A;  3ZWH A;  1DJG A;  1K9K A;  1YVL A;  4JQ0 D;  1B9A A;  2MLF C;  4AQJ A;  1QAS A;  1RRO A;  4JPZ B;  1YX7 A;  2LE9 B;  1JWD A;  1MXL C;  2M9G A;  3I5F B;  1QX7 A;  4QJ4 B;  3DVK A;  5ER5 A;  4I5N B;  1UHN A;  2AMI A;  1IH0 A;  4DIR A;  2JNF A;  2EGD A;  5JJG A;  1H4B A;  1RTP 1;  1KQM C;  3NSI A;  2M1U A;  1MUX A;  1CNP A;  1C7W A;  4MSP A;  4ORC B;  2L2E A;  5I2O A;  1GJY A;  2M29 A;  3SIB A;  3JVT B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...