5I2OA

Structure of ef-hand containing protein
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
105
structure length
102
Chain Sequence
FNPYTEFKEFSRKQIKDMEKMFKQYDDGFIDLMALKLMMEKLGAPQTHLGLKNMIKEVDEDFDSKLSFREFLLIFRKAAAGELQEDSGLCVLARLSEIDVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural implications of Ca(2+)-dependent actin-bundling function of human EFhd2/Swiprosin-1.
pubmed doi rcsb
molecule keywords EF-hand domain-containing protein D2
molecule tags Metal binding protein
source organism Homo sapiens
total genus 30
structure length 102
sequence length 105
ec nomenclature
pdb deposition date 2016-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13405 EF-hand_6 EF-hand domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 5i2oA00
1KWOC 1JUOA 1CFCA 2PVBA 1Y1AA 1YURA 5HKWA 1GGZA 2Y5IA 2COLB 3VGOA 1S5GZ 1B47A 1NCZA 3OB1B 3SIAA 4YGEB 1NX3A 1QS7A 1M39A 2SCPA 5CSFA 1ALWA 2KDHA 1N0YA 1TRFA 2H61C 1TNWA 1SL7A 1NPQA 3OX5A 3TUYB 1BR4B 1NIWA 2LC5A 1RK9A 1YX7A 2ZKMX 1AP4A 1S3PA 4ICBA 1M45A 1XK4C 2HQWA 2KAVA 4GGFC 1NX1A 2M7LA 2HF5A 2DOQA 1YX8A 3I5HB 4A4BA 3WHTB 1F54A 1PVAA 1S5GY 1X02A 2JT0A 1XK4A 2K7CA 2RGIA 1SY9A 1JF0A 1CLBA 2JC2A 5KU1A 1OMVA 4R1EA 3VRRA 4DUQA 1CFFA 4I5LB 2MAZA 4E68A 2PALA 1WRLA 4JPZB 1EH2A 1FI6A 1ZMZA 1B7TZ 1IG5A 1OMDA 2MHHA 1IQ5A 2OS8B 3JTDB 1K94A 2JTTA 3TDIA 1CDPA 4MN0A 4OVNF 1UHIA 4ORCB 4PCWA 1PALA 2K8MB 1PVBA 2FCDA 3KO0A 4PDZA 3BYAA 2H2KA 1TNXA 3VRPA 2KFHA 5AERA 3KHEA 2LANA 3BUXB 4XJKB 3DD4A 2I2RE 2K2FA 2BE4A 1H4BA 4F0ZB 1SRAA 1XFWO 1A75A 1B7TY 3NSOA 3OX6A 2LNKA 1RTP1 2LVIA 3FIAA 1A03A 1SR6C 1M31A 1MUXA 3BUNB 4JWQA 2Y1NA 2JXCA 4MRYA 1QX5B 1FPWA 2F3ZA 4YGCB 2F33A 1SBJA 1GQMA 3E3RA 1CB1A 2LAPA 3DF0A 3A4UB 1Y1UA 1NSHA 3TUYC 1QVIZ 2F3YA 1B8LA 3BUOB 2MLFC 4WQ3A 1QATA 2CCMA 1BMOA 1WLMA 2JOJA 4CIDA 4NDDA 1SCVA 1WRZA 2FCEA 2M0RA 3I5HC 1QX2A 4I5JA 2Q4UA 2JWWA 2AUCA 4MRXA 3EKJA 3PSRA 2Y1MA 1XO5A 3TZ1A 2KGRA 4I5KA 3BQ3A 4M2OA 3FS7A 3SJSA 1IGVA 5ER4X 4ORBB 2LVJA 1DF0A 2LLTA 1QVIY 1K96A 1S6IA 3CR2A 3WXAA 1F4OA 3D10A 1CKKA 1UHHA 4I5NB 5J3XA 3O4YA 4N5XA 2GGZA 5CPVA 3JTDC 1B9AA 1C7WA 1QIVA 2LUXA 1JWDA 3IQOA 2I94A 4P2YB 1L7ZA 1PULA 3FWBA 1U5IA 1YR5A 1A2XA 2JRFA 2KOTA 1NP8A 5CSJA 2KQ6A 2M1KB 1OZSA 1SMGA 1G4YR 1MF8B 2K7OA 5AANA 1CDNA 1UHNA 1FF1A 2AMIA 1A75B 3SG5A 1S26D 2AAOA 1MR8A 2NXQA 2L5XB 3TS5B 2F8PA 1B8CA 1BG1A 1SW8A 4OR9B 2CNPA 2JXLA 3TDZA 2FOTA 1IWQA 1SR6B 1OMRA 3PALA 4HRHA 2LHLA 2CXJA 2JULA 2LVVA 1IJ6A 2NCPA 3EK4A 3GK1A 2MJWB 3DF0B 4D1EA 4N1FA 4GPLB 4DCKA 3CWGA 4MZLA 1CDLA 4GFTA 1KK8B 1N2DA 3OHMB 1BLQA 1V1FA 3O2PA 1DJZA 4OV2A 1CM1A 1KFUL 3EKHA 2BBMA 1HQVA 1YUTA 2PASA 5JJGA 3LK0A 2F2PA 2O5GA 1EG3A 4HRGA 1YVHA 4Q04A 1ALVA 1BU3A 1A4PA 3FWCA 1XFUO 5FYXA 1Y0VH 1QJTA 1CLMA 2MA2A 3I5FB 2JU0A 1PRWA 4M2QA 4MZKA 1DF0B 1L2OB 1B4CA 1WDCB 3PLFB 1IQ3A 1OSAA 2WNDA 2VRGA 1M46A 1CMGA 3VROA 1F70A 4ZCUA 5I2OA 1CDMA 1V1GA 1U5IB 3K21A 2M3WA 1W7IB 5G08A 1PSRA 4MVFA 1EXRA 1CFPA 1CM4A 4PALA 4GUKA 1GGWA 5BPJA 1S36A 2K0JA 2P6BB 4NQGA 1Y6WA 5TNCA 1LVCD 1YVLA 2E30A 2KYCA 3A8RA 1XA5A 1NX0A 3I5IB 2JT8A 1CFDA 1WY9A 4FTGA 5D69A 1QV1A 3TS5C 4GNKB 1DJXA 1FW4A 3CR5X 1QLSA 5KSZA 2B1UA 1LXFC 4YI8A 3NSKA 4MSPA 4TNCA 1EG4A 4XYNA 1KQVA 1LINA 5I8NA 1MWNA 1J55A 1NYAA 1DTLA 2PRUA 4L9MA 2L50A 3SG4A 4CLNA 5PALA 4CPVA 1JBAA 1QLKA 1CMFA 2QPTA 1D1OA 1KK8C 1MQ1A 2I7AA 3BUWB 4AQJA 4MEWA 1OQPA 1DJYA 1Q80A 1UP5A 2KFGA 1AVSA 4MBEA 4YGDB 1M63B 3PN7B 3SG6A 4C0LA 5HYDA 1BF5A 2LP3A 2GV5A 3BOWB 1DVIA 2IS9A 3KPXA 4ORAB 3ZWHA 3HX4A 2KBMA 3SIBA 3OP0A 5I2QA 2G2BA 1NCYA 4GBAA 2WCEA 3C1VA 3GK4X 4U8DA 3CLNA 1ZFSA 3I5FC 1KQMB 1G8IA 2KQYA 1R2UA 1YTZC 2JQ6A 1S6CA 3LL8B 1C07A 3NSIA 1AUIB 1A29A 1L2OC 4NDBA 1WDCC 3F45A 2ZRSA 1S1EA 2D8NA 5B8IB 4GGNA 5DKRA 2WORA 4PE4A 1F55A 2EGDA 1MHOA 2JZIA 1DGUA 4HSZA 5JOLA 1KFUS 2K61A 1XYDA 1TNPA 2TN4A 1SNLA 2KGBC 2WCBA 3D0YA 1AJ5A 4P5OE 3HCMA 1HT9A 3IQQA 2HETA 1PSBA 1XFVO 1TCOB 2WC8A 1VRKA 2M49B 3AAKA 1AK8A 5CSNA 1QX7A 2HPSA 2LVKA 1MXLC 2KI4B 2BBNA 3DVEA 2BCBA 3WNXB 2CT9A 4AOMA 3GOFA 2F2OA 1TCFA 1IKUA 1SL9A 3I5IC 3SG7A 3LLEA 3KEVA 1XFZO 2MLEC 4CFRA 2L51A 1WRKA 2EC6B 4WQ2A 3LCPC 1J7QA 2ISDA 2NZ0A 5HKYA 1J1DA 2JTZA 2FJUB 3DVMA 2KSPA 1ZOTB 3AKBA 3ICBA 2JPTA 3M0WA 1NX2A 1OE9B 2L0PA 2LE9B 1QTXA 2BECA 3O78A 1C7VA 1ZUZA 1K90D 1J1EA 4UPGA 1UHKA 4PE7A 3SG2A 4YGAA 3EK7A 2K7DA 1F8HA 3CR4X 1KSMA 3JVTB 2WCFA 3PN7C 2MRDA 1XFXO 3PFVA 4BY5A 1JC2A 4C0JA 5AFPA 2BCAA 2KI6D 1H8BA 1FI5A 3CTNA 4OKHA 3BOWA 2OTGB 3OB2B 1BODA 1YUUA 1KQMC 3DVJA 2BKHB 4YBHB 2LV7A 1QXPA 1J7RA 2PSRA 3D0YB 1J7PA 5HLOA 1TOPA 1N65A 3I5GB 1KSOA 1IH0A 2M29A 1ODBA 2KBIA 2LUCA 1RROA 2JNXA 4MLWA 1K95A 2H61A 2KNEA 3TDUA 1WLZA 3RLZA 1KK7Z 4PHMA 4PHNA 1SK6D 5KTYA 1DT7B 3PM8A 1LA0A 1MXEA 1EL4A 2KI4C 1IRJA 3KF9A 1BT6A 1LKJA 4ETOA 2LCPA 1JSAA 2A4JA 2M7NA 4C0KA 4GGFA 2CBLA 2K7BA 4OCIA 4QJ4B 2BE6A 2GGMA 5AEQA 5K89A 2CTNA 2BL0B 3LK1A 3WHUB 1K2HA 3MSEB 1KFXL 4YI9A 5F6TA 1RWYA 1RFJA 2EC6C 2ZN9A 5AXIA 3RM1A 2KI6C 4N1GA 1GJYA 1TNQA 3O6BA 1KK7Y 3CS1A 4QJ5B 1B8RA 1EJ3A 2O60A 5I2LA 4A4CA 1AJ4A 2LMTA 2M97A 1UHJA 4PHJA 1YUSA 1PK0D 2L98A 1NUBA 2L4IA 3AAJA 1XVJA 2LP2A 2LLSA 5CSIA 1LA3A 1SCMB 1DJGA 3EK8A 3VRNA 4DIRA 2L4HA 1G33A 3BUMB 4GAOA 1UUSA 1SYMA 3JVTC 1DGVA 1QIWA 1B1GA 1AHRA 2LMVA 1XFYO 2NLNA 1J7OA 2ZNEA 2SASA 2LLUA 1BOCA 1KWOB 1DJHA 2K2AA 1S6JA 4WRIA 1SPYA 1SL8A 2OTGC 3NXAA 1TN4A 3CGAA 3H4SE 3SG3A 1DJWA 2ZN8A 2LMUA 2PMYA 1DMOA 1OZOA 3I5GC 4IL1A 4AQIA 3EVUA 1IJ5A 1K9UA 1TIZA 4QJ3B 2JT3A 1JFKA 2MBXA 1E8AA 1JF2A 2R2IA 5D7FA 1RECA 2I18A 1BJFA 1K93D 1UURA 1BR1B 4ZCVA 1K8UA 3GK2A 1SKTA 1CLLA 1OOJA 2HQ8A 1CTRA 1YRTB 4YGBB 2M9GA 4MZJA 1DJIA 3EVVA 2BKIB 5HLVA 3NSLA 1ZACA 4JQ0D 4PE1A 2BL0C 2KAXA 1UWOA 1F4QA 2G9BA 2KAYA 2QACA 2L2EA 3AKAA 2M1UA 4PHKA 2OPOA 1R6PA 4FQOA 1JFJA 1K9PA 2BCXA 2OS8C 4PE0A 1YRUB 4BY4A 2M8UA 2LHIA 1Y1XA 2ZNDA 3EVRA 1F71A 3PATA 4USLA 2KYFA 1QASA 5IBWA 2E6WA 1K9KA 2KFFA 2Y4QA 5GQQC 4DS7A 3BXKA 2V53A 1TTXA 5HKZA 2ZFDA 1SCMC 3ZNIA 1NWDA 3DVKA 1FBVA 4HREE 2JNFA 2ZRTA 2KHNA 2LM5A 2WOSA 1KCYA 4DRWA 2Q91A 1W7JB 1CNPA 1RJVA 1KFXS 4CFQA 3QRXA 5DKQA 3CZTX 4YRUA 2NCOA 2EHBA 3IF7A 5DKNA 4XJKA 5ER5A 3VRQA 1QV0A 4NDCA 4M2PA 1NCXA
chains in the Genus database with same CATH superfamily
1KWOC 1JUOA 1CFCA 2PVBA 3CABA 1Y1AA 1YURA 5HKWA 1GGZA 2Y5IA 2COLB 3VGOA 1S5GZ 3V2LA 1B47A 1NCZA 3OB1B 3SIAA 4YGEB 1NX3A 1QS7A 1M39A 2SCPA 5CSFA 3PM2A 1ALWA 2KDHA 1N0YA 1TRFA 2PQLA 2H61C 1TNWA 1SL7A 1NPQA 3OX5A 3TUYB 1BR4B 1NIWA 2LC5A 1CKKA 1RK9A 1YX7A 2ZKMX 1AP4A 1S3PA 4ICBA 1M45A 1XK4C 2HQWA 2KAVA 4GGFC 1NX1A 2M7LA 2HF5A 2DOQA 1YX8A 3I5HB 4A4BA 3WHTB 1F54A 1PVAA 1S5GY 1X02A 2JT0A 1XK4A 2K7CA 2RGIA 1SY9A 1JF0A 4OZDA 3SS4A 1CLBA 2JC2A 5KU1A 1OMVA 3NGVA 4R1EA 3VRRA 4DUQA 1CFFA 4I5LB 5DICA 2MAZA 4E68A 2PALA 1WRLA 4JPZB 4F7FA 1EH2A 1FI6A 1ZMZA 1B7TZ 1IG5A 1OMDA 2MHHA 1IQ5A 2OS8B 3JTDB 1K94A 2JTTA 3TDIA 1CDPA 4MN0A 4OVNF 1UHIA 4ORCB 4PCWA 1PALA 2K8MB 1PVBA 2FCDA 2GTEA 3KO0A 4PDZA 3S0BA 3BYAA 2H2KA 1TNXA 3VRPA 2KFHA 5AERA 3KHEA 3SG6A 2LANA 3BUXB 4XJKB 3D76A 3DD4A 2I2RE 2K2FA 2BE4A 3B87A 1H4BA 4F0ZB 1SRAA 1XFWO 1A75A 1B7TY 3NSOA 3OX6A 2LNKA 1RTP1 2LVIA 3FIAA 1A03A 1SR6C 1M31A 1MUXA 3R72A 3BUNB 4JWQA 2Y1NA 3S0FA 2JXCA 3D75A 1QX5B 4MRYA 1FPWA 4FQTA 2F3ZA 2K60A 4YGCB 2F33A 1SBJA 1GQMA 3E3RA 1CB1A 2LAPA 3BFHA 3DF0A 3A4UB 1Y1UA 1NSHA 3TUYC 1QVIZ 2F3YA 1B8LA 3BUOB 2MLFC 4WQ3A 1QATA 2CCMA 1DELA 1BMOA 1WLMA 2JOJA 4CIDA 4NDDA 1SCVA 1WRZA 2FCEA 1OOGA 2M0RA 1QX2A 3I5HC 2Q4UA 2JWWA 4I5JA 2AUCA 4MRXA 1LS8A 3EKJA 3PSRA 2Y1MA 1XO5A 3TZ1A 2KGRA 4I5KA 3BQ3A 4M2OA 3FS7A 3SJSA 1IGVA 5ER4X 4ORBB 2LVJA 1DF0A 2LLTA 3IVTA 1QVIY 1K96A 1S6IA 3CR2A 3SS5A 1F4OA 3D10A 3WXAA 1UHHA 2QEHA 4I5NB 5J3XA 3O4YA 4N5XA 2GGZA 5CPVA 3JTDC 1B9AA 1C7WA 1QIVA 2LUXA 1JWDA 3IQOA 2I94A 4P2YB 1L7ZA 1PULA 3FWBA 1U5IA 1YR5A 1A2XA 2JRFA 2KOTA 1NP8A 5CSJA 2KQ6A 2M1KB 3CYZA 1OZSA 3S0GA 1SMGA 1G4YR 2WCHA 1MF8B 2K7OA 5AANA 1CDNA 1UHNA 1FF1A 2AMIA 1A75B 3SG5A 1S26D 2AAOA 1MR8A 2NXQA 1DEKA 2L5XB 2L5YA 3TS5B 2F8PA 1B8CA 1BG1A 1SW8A 4OR9B 2CNPA 5FI6A 2JXLA 2WC6A 3TDZA 2FOTA 1IWQA 1SR6B 3SS3A 1OMRA 3PALA 4HRHA 2LHLA 3OBVA 2CXJA 2JULA 2LVVA 1IJ6A 1DC1A 2NCPA 3EK4A 3GK1A 2MJWB 2H8VA 3DF0B 4D1EA 4N1FA 4GPLB 4DCKA 2WCJA 3CWGA 4MZLA 1CDLA 4GFTA 1KK8B 1N2DA 1SSEB 3OHMB 1BLQA 1T14A 1V1FA 3O2PA 1DJZA 4OV2A 1OOFA 1CM1A 1KFUL 3EKHA 2BBMA 5FI7A 1HQVA 1YUTA 2PASA 5HL1A 3LK0A 5JJGA 2F2PA 2O5GA 1EG3A 3BJHA 4HRGA 1YVHA 4Q04A 1ALVA 1BU3A 1A4PA 3QMEA 3FWCA 1XFUO 5FYXA 4JKTA 1Y0VH 1QJTA 1CLMA 2MA2A 3I5FB 2JU0A 1PRWA 4M2QA 4MZKA 1DF0B 2QEVA 1L2OB 1B4CA 1WDCB 3PLFB 1IQ3A 1OSAA 2WNDA 2VRGA 1M46A 1CMGA 3VROA 1F70A 4ZCUA 1XFRA 5I2OA 1CDMA 1V1GA 1U5IB 2WCMA 3FE6A 3B88A 3K21A 2M3WA 4IJ7A 1W7IB 2WC5A 5G08A 1PSRA 4MVFA 1EXRA 1CFPA 1CM4A 4PALA 4GUKA 1GGWA 5BPJA 1S36A 2K0JA 2P6BB 4NQGA 1Y6WA 5TNCA 1LVCD 1YVLA 2E30A 2KYCA 3A8RA 1XA5A 1NX0A 3I5IB 2JT8A 3PJIA 1CFDA 1WY9A 4FTGA 5D69A 1QV1A 3TS5C 3B6XA 4GNKB 1DJXA 1FW4A 3CR5X 1QLSA 5KSZA 2B1UA 1LXFC 5D3OA 4YI8A 3NSKA 4MSPA 4TNCA 1EG4A 4XYNA 1KQVA 1LINA 3D73A 1MWNA 5I8NA 1J55A 1NYAA 4PT1A 1DTLA 2PRUA 3BFBA 4L9MA 2L50A 3SG4A 3S0DA 4CLNA 5PALA 4CPVA 1JBAA 1QLKA 1CMFA 2QPTA 1D1OA 1KK8C 1MQ1A 2I7AA 3BUWB 4JD9A 4AQJA 4MEWA 1OQPA 1DJYA 1Q80A 1UP5A 2KFGA 1AVSA 4MBEA 4YGDB 1M63B 2FJYA 2PYQA 2WCKA 3PN7B 5EL2A 2LP3A 2GV5A 3BOWB 1DVIA 2IS9A 3KPXA 4ORAB 3UO9A 3ZWHA 3HX4A 2KBMA 3SIBA 3OP0A 1GM0A 5I2QA 2G2BA 1NCYA 4GBAA 2WCEA 3C1VA 3GK4X 4U8DA 3CLNA 1ZFSA 3I5FC 1KQMB 1G8IA 2KQYA 1R2UA 1YTZC 2JQ6A 1S6CA 3LL8B 1IIOA 1C07A 3NSIA 1AUIB 1A29A 1L2OC 4NDBA 1WDCC 3F45A 2ZRSA 1S1EA 2D8NA 3R1PA 4GGNA 5DKRA 5B8IB 2WORA 3DY9A 4PE4A 2EGDA 1MHOA 2JZIA 1F55A 1DGUA 4HSZA 5JOLA 1OW4A 1KFUS 2K61A 1XYDA 1TNPA 2TN4A 1SNLA 2KGBC 2WCBA 3D0YA 1AJ5A 4P5OE 3HCMA 1HT9A 3IQQA 2HETA 3DZTA 1PSBA 1XFVO 1TCOB 2WC8A 1VRKA 2M49B 3AAKA 2BNXA 1AK8A 5CSNA 1QX7A 2HPSA 2LVKA 1MXLC 2KI4B 3N7HA 2BBNA 3DVEA 2BCBA 3WNXB 2CT9A 4AOMA 3GOFA 2F2OA 1TCFA 1IKUA 3L47A 1SL9A 3CDNA 3I5IC 2QDIA 3SG7A 3VB1A 3LLEA 3KEVA 1XFZO 2MLEC 1OOIX 4CFRA 2L51A 1WRKA 2EC6B 4WQ2A 3LCPC 1J7QA 2ISDA 1ORGA 2NZ0A 5HKYA 1J1DA 2JTZA 3CZ2A 2FJUB 3DVMA 2KSPA 1ZOTB 3AKBA 3ICBA 2JPTA 3M0WA 1TWOA 1NX2A 2YGUA 1OE9B 2L0PA 2LE9B 2QEOA 3B7AA 3D78A 3K1EA 3FE9A 1QTXA 2BECA 3O78A 1C7VA 1ZUZA 1K90D 3BFAA 1J1EA 4UPGA 5I94A 1UHKA 3R1VA 4PE7A 3SG2A 4YGAA 3EK7A 2K7DA 3NHTA 3CR4X 1KSMA 1F8HA 3JVTB 2WCFA 1QWVA 3PN7C 1BF5A 2MRDA 1XFXO 3PFVA 4BY5A 1JC2A 4C0JA 5AFPA 2BCAA 2KI6D 2QEBA 4INWA 2KLEA 1FI5A 3CTNA 1H8BA 4OKHA 3BOWA 2OTGB 3OB2B 1P28A 1BODA 1YUUA 1KQMC 3DVJA 3L4AA 2BKHB 3EG5B 2KLDA 4YBHB 2LV7A 1QXPA 1J7RA 3S0AA 2PSRA 3D0YB 1J7PA 5HLOA 1TOPA 1N65A 3CZ0A 1KSOA 3I5GB 1IH0A 2M29A 1ODBA 2KBIA 2LUCA 1RROA 2JNXA 4MLWA 1K95A 2H61A 2KNEA 3TDUA 1WLZA 3RLZA 4KYNA 1KK7Z 3D74A 4PHMA 4PHNA 1SK6D 4INXA 5KTYA 1DT7B 3PM8A 1LA0A 1MXEA 1EL4A 2KI4C 1IRJA 3KF9A 3DXLA 1BT6A 1LKJA 4ETOA 2LCPA 1JSAA 2A4JA 2M7NA 4C0KA 4GGFA 2CBLA 2K7BA 4OCIA 4QJ4B 2BE6A 2ERBA 2GGMA 5AEQA 5K89A 2CTNA 1OOHA 2BL0B 3LK1A 3WHUB 1K2HA 3MSEB 1KFXL 4YI9A 5F6TA 1RWYA 3CZ1A 1RFJA 2EC6C 2ZN9A 5AXIA 3RZSA 3RM1A 2KI6C 2KPHA 4N1GA 1GJYA 1TNQA 3O6BA 1KK7Y 3CS1A 4QJ5B 1B8RA 1EJ3A 2O60A 2JPOA 5I2LA 4A4CA 1AJ4A 2LMTA 2M97A 1UHJA 4PHJA 1YUSA 1PK0D 1TUZA 2L98A 1NUBA 2L4IA 2P70A 3AAJA 1XVJA 2LP2A 2LLSA 5CSIA 1LA3A 1SCMB 1DJGA 3EK8A 1TUJA 3VRNA 4DIRA 2L4HA 1G33A 3BUMB 3B86A 1UUSA 1SYMA 3O4XA 4GAOA 3JVTC 1DGVA 1QIWA 1B1GA 1AHRA 2LMVA 1XFYO 2NLNA 1J7OA 2ZNEA 3NHIA 2SASA 2LLUA 1BOCA 2BAPA 1KWOB 3DYEA 1DJHA 2K2AA 1S6JA 4WRIA 1SPYA 1SL8A 2OTGC 3NXAA 1TN4A 3CGAA 3H4SE 5FI2A 1DJWA 3SG3A 2ZN8A 2LMUA 2PMYA 1DMOA 3R1OA 1OZOA 3I5GC 4IL1A 4AQIA 3EVUA 1IJ5A 1K9UA 1TIZA 4QJ3B 2JT3A 1JFKA 2L2CA 2MBXA 1E8AA 3L4LA 3UNWA 1JF2A 2R2IA 5D7FA 1RECA 2I18A 1BJFA 3S0EA 1K93D 1UURA 1BR1B 4ZCVA 1K8UA 3GK2A 1SKTA 1CLLA 1OOJA 2HQ8A 1CTRA 1YRTB 4YGBB 3OGNA 5HYDA 2M9GA 2WCLA 4C0LA 1C3YA 4MZJA 1DJIA 1DQEA 3EVVA 2BKIB 5HLVA 3NSLA 1ZACA 4JQ0D 4PE1A 2BL0C 2KAXA 1UWOA 1F4QA 2G9BA 2KAYA 2QACA 2L2EA 3Q8IA 2P71A 3AKAA 2M1UA 4PHKA 2OPOA 1R6PA 4FQOA 1JFJA 1K9PA 2BCXA 2OS8C 4PE0A 1YRUB 4BY4A 1Z4HA 2LHIA 1Y1XA 2M8UA 2ZNDA 3EVRA 1F71A 3PATA 4USLA 2KYFA 1QASA 5IBWA 2E6WA 1K9KA 2KFFA 2Y4QA 5GQQC 4DS7A 3BXKA 2V53A 1TTXA 5HKZA 2ZFDA 1SCMC 3ZNIA 1NWDA 3DVKA 1C3ZA 1FBVA 4HREE 2JNFA 2ZRTA 2KHNA 2LM5A 2WOSA 1KCYA 4DRWA 2Q91A 1W7JB 1CNPA 1RJVA 1KFXS 4CFQA 3QRXA 5DKQA 3CZTX 1Z2CB 4YRUA 2NCOA 2EHBA 3FE8A 3IF7A 5DKNA 4XJKA 3D77A 5ER5A 3VRQA 1QV0A 4NDCA 4M2PA 1NCXA 1W9ZA
chains in the Genus database with same CATH topology
1KWOC 1JUOA 1CFCA 2PVBA 1Y1AA 1YURA 5HKWA 1GGZA 2Y5IA 2COLB 3VGOA 1S5GZ 1B47A 1NCZA 3OB1B 3SIAA 4YGEB 1NX3A 1QS7A 1M39A 2SCPA 5CSFA 1ALWA 2KDHA 1N0YA 1TRFA 2H61C 1TNWA 1SL7A 1NPQA 3OX5A 3TUYB 1BR4B 1NIWA 2LC5A 1RK9A 1YX7A 2ZKMX 1AP4A 1S3PA 4ICBA 1M45A 1XK4C 2HQWA 2KAVA 4GGFC 1NX1A 2M7LA 2HF5A 2DOQA 1YX8A 3I5HB 4A4BA 3WHTB 1F54A 1PVAA 1S5GY 1X02A 2JT0A 1XK4A 2K7CA 2RGIA 1SY9A 1JF0A 1CLBA 2JC2A 5KU1A 1OMVA 4R1EA 3VRRA 4DUQA 1CFFA 4I5LB 2MAZA 4E68A 2PALA 1WRLA 4JPZB 1EH2A 1FI6A 1ZMZA 1B7TZ 1IG5A 1OMDA 2MHHA 1IQ5A 2OS8B 3JTDB 1K94A 2JTTA 3TDIA 1CDPA 4MN0A 4OVNF 1UHIA 4ORCB 4PCWA 1PALA 2K8MB 1PVBA 2FCDA 3KO0A 4PDZA 3BYAA 2H2KA 1TNXA 3VRPA 2KFHA 5AERA 3KHEA 2LANA 3BUXB 4XJKB 3DD4A 2I2RE 2K2FA 2BE4A 1H4BA 4F0ZB 1SRAA 1XFWO 1A75A 1B7TY 3NSOA 3OX6A 2LNKA 1RTP1 2LVIA 3FIAA 1A03A 1SR6C 1M31A 1MUXA 3BUNB 4JWQA 2Y1NA 2JXCA 4MRYA 1QX5B 1FPWA 2F3ZA 4YGCB 2F33A 1SBJA 1GQMA 3E3RA 1CB1A 2LAPA 3DF0A 3A4UB 1Y1UA 1NSHA 3TUYC 1QVIZ 2F3YA 1B8LA 3BUOB 2MLFC 4WQ3A 1QATA 2CCMA 1BMOA 1WLMA 2JOJA 4CIDA 4NDDA 1SCVA 1WRZA 2FCEA 2M0RA 3I5HC 1QX2A 4I5JA 2Q4UA 2JWWA 2AUCA 4MRXA 3EKJA 3PSRA 2Y1MA 1XO5A 3TZ1A 2KGRA 4I5KA 3BQ3A 4M2OA 3FS7A 3SJSA 1IGVA 5ER4X 4ORBB 2LVJA 1DF0A 2LLTA 1QVIY 1K96A 1S6IA 3CR2A 3WXAA 1F4OA 3D10A 1CKKA 1UHHA 4I5NB 5J3XA 3O4YA 4N5XA 2GGZA 5CPVA 3JTDC 1B9AA 1C7WA 1QIVA 2LUXA 1JWDA 3IQOA 2I94A 4P2YB 1L7ZA 1PULA 3FWBA 1U5IA 1YR5A 1A2XA 2JRFA 2KOTA 1NP8A 5CSJA 2KQ6A 2M1KB 1OZSA 1SMGA 1G4YR 1MF8B 2K7OA 5AANA 1CDNA 1UHNA 1FF1A 2AMIA 1A75B 3SG5A 1S26D 2AAOA 1MR8A 2NXQA 2L5XB 3TS5B 2F8PA 1B8CA 1BG1A 1SW8A 4OR9B 2CNPA 2JXLA 3TDZA 2FOTA 1IWQA 1SR6B 1OMRA 3PALA 4HRHA 2LHLA 2CXJA 2JULA 2LVVA 1IJ6A 2NCPA 3EK4A 3GK1A 2MJWB 3DF0B 4D1EA 4N1FA 4GPLB 4DCKA 3CWGA 4MZLA 1CDLA 4GFTA 1KK8B 1N2DA 3OHMB 1BLQA 1V1FA 3O2PA 1DJZA 4OV2A 1CM1A 1KFUL 3EKHA 2BBMA 1HQVA 1YUTA 2PASA 5JJGA 3LK0A 2F2PA 2O5GA 1EG3A 4HRGA 1YVHA 4Q04A 1ALVA 1BU3A 1A4PA 3FWCA 1XFUO 5FYXA 1Y0VH 1QJTA 1CLMA 2MA2A 3I5FB 2JU0A 1PRWA 4M2QA 4MZKA 1DF0B 1L2OB 1B4CA 1WDCB 3PLFB 1IQ3A 1OSAA 2WNDA 2VRGA 1M46A 1CMGA 3VROA 1F70A 4ZCUA 5I2OA 1CDMA 1V1GA 1U5IB 3K21A 2M3WA 1W7IB 5G08A 1PSRA 4MVFA 1EXRA 1CFPA 1CM4A 4PALA 4GUKA 1GGWA 5BPJA 1S36A 2K0JA 2P6BB 4NQGA 1Y6WA 5TNCA 1LVCD 1YVLA 2E30A 2KYCA 3A8RA 1XA5A 1NX0A 3I5IB 2JT8A 1CFDA 1WY9A 4FTGA 5D69A 1QV1A 3TS5C 4GNKB 1DJXA 1FW4A 3CR5X 1QLSA 5KSZA 2B1UA 1LXFC 4YI8A 3NSKA 4MSPA 4TNCA 1EG4A 4XYNA 1KQVA 1LINA 5I8NA 1MWNA 1J55A 1NYAA 1DTLA 2PRUA 4L9MA 2L50A 3SG4A 4CLNA 5PALA 4CPVA 1JBAA 1QLKA 1CMFA 2QPTA 1D1OA 1KK8C 1MQ1A 2I7AA 3BUWB 4AQJA 4MEWA 1OQPA 1DJYA 1Q80A 1UP5A 2KFGA 1AVSA 4MBEA 4YGDB 1M63B 3PN7B 3SG6A 4C0LA 5HYDA 1BF5A 2LP3A 2GV5A 3BOWB 1DVIA 2IS9A 3KPXA 4ORAB 3ZWHA 3HX4A 2KBMA 3SIBA 3OP0A 5I2QA 2G2BA 1NCYA 4GBAA 2WCEA 3C1VA 3GK4X 4U8DA 3CLNA 1ZFSA 3I5FC 1KQMB 1G8IA 2KQYA 1R2UA 1YTZC 2JQ6A 1S6CA 3LL8B 1C07A 3NSIA 1AUIB 1A29A 1L2OC 4NDBA 1WDCC 3F45A 2ZRSA 1S1EA 2D8NA 5B8IB 4GGNA 5DKRA 2WORA 4PE4A 1F55A 2EGDA 1MHOA 2JZIA 1DGUA 4HSZA 5JOLA 1KFUS 2K61A 1XYDA 1TNPA 2TN4A 1SNLA 2KGBC 2WCBA 3D0YA 1AJ5A 4P5OE 3HCMA 1HT9A 3IQQA 2HETA 1PSBA 1XFVO 1TCOB 2WC8A 1VRKA 2M49B 3AAKA 1AK8A 5CSNA 1QX7A 2HPSA 2LVKA 1MXLC 2KI4B 2BBNA 3DVEA 2BCBA 3WNXB 2CT9A 4AOMA 3GOFA 2F2OA 1TCFA 1IKUA 1SL9A 3I5IC 3SG7A 3LLEA 3KEVA 1XFZO 2MLEC 4CFRA 2L51A 1WRKA 2EC6B 4WQ2A 3LCPC 1J7QA 2ISDA 2NZ0A 5HKYA 1J1DA 2JTZA 2FJUB 3DVMA 2KSPA 1ZOTB 3AKBA 3ICBA 2JPTA 3M0WA 1NX2A 1OE9B 2L0PA 2LE9B 1QTXA 2BECA 3O78A 1C7VA 1ZUZA 1K90D 1J1EA 4UPGA 1UHKA 4PE7A 3SG2A 4YGAA 3EK7A 2K7DA 1F8HA 3CR4X 1KSMA 3JVTB 2WCFA 3PN7C 2MRDA 1XFXO 3PFVA 4BY5A 1JC2A 4C0JA 5AFPA 2BCAA 2KI6D 1H8BA 1FI5A 3CTNA 4OKHA 3BOWA 2OTGB 3OB2B 1BODA 1YUUA 1KQMC 3DVJA 2BKHB 4YBHB 2LV7A 1QXPA 1J7RA 2PSRA 3D0YB 1J7PA 5HLOA 1TOPA 1N65A 3I5GB 1KSOA 1IH0A 2M29A 1ODBA 2KBIA 2LUCA 1RROA 2JNXA 4MLWA 1K95A 2H61A 2KNEA 3TDUA 1WLZA 3RLZA 1KK7Z 4PHMA 4PHNA 1SK6D 5KTYA 1DT7B 3PM8A 1LA0A 1MXEA 1EL4A 2KI4C 1IRJA 3KF9A 1BT6A 1LKJA 4ETOA 2LCPA 1JSAA 2A4JA 2M7NA 4C0KA 4GGFA 2CBLA 2K7BA 4OCIA 4QJ4B 2BE6A 2GGMA 5AEQA 5K89A 2CTNA 2BL0B 3LK1A 3WHUB 1K2HA 3MSEB 1KFXL 4YI9A 5F6TA 1RWYA 1RFJA 2EC6C 2ZN9A 5AXIA 3RM1A 2KI6C 4N1GA 1GJYA 1TNQA 3O6BA 1KK7Y 3CS1A 4QJ5B 1B8RA 1EJ3A 2O60A 5I2LA 4A4CA 1AJ4A 2LMTA 2M97A 1UHJA 4PHJA 1YUSA 1PK0D 2L98A 1NUBA 2L4IA 3AAJA 1XVJA 2LP2A 2LLSA 5CSIA 1LA3A 1SCMB 1DJGA 3EK8A 3VRNA 4DIRA 2L4HA 1G33A 3BUMB 4GAOA 1UUSA 1SYMA 3JVTC 1DGVA 1QIWA 1B1GA 1AHRA 2LMVA 1XFYO 2NLNA 1J7OA 2ZNEA 2SASA 2LLUA 1BOCA 1KWOB 1DJHA 2K2AA 1S6JA 4WRIA 1SPYA 1SL8A 2OTGC 3NXAA 1TN4A 3CGAA 3H4SE 3SG3A 1DJWA 2ZN8A 2LMUA 2PMYA 1DMOA 1OZOA 3I5GC 4IL1A 4AQIA 3EVUA 1IJ5A 1K9UA 1TIZA 4QJ3B 2JT3A 1JFKA 2MBXA 1E8AA 1JF2A 2R2IA 5D7FA 1RECA 2I18A 1BJFA 1K93D 1UURA 1BR1B 4ZCVA 1K8UA 3GK2A 1SKTA 1CLLA 1OOJA 2HQ8A 1CTRA 1YRTB 4YGBB 2M9GA 4MZJA 1DJIA 3EVVA 2BKIB 5HLVA 3NSLA 1ZACA 4JQ0D 4PE1A 2BL0C 2KAXA 1UWOA 1F4QA 2G9BA 2KAYA 2QACA 2L2EA 3AKAA 2M1UA 4PHKA 2OPOA 1R6PA 4FQOA 1JFJA 1K9PA 2BCXA 2OS8C 4PE0A 1YRUB 4BY4A 2M8UA 2LHIA 1Y1XA 2ZNDA 3EVRA 1F71A 3PATA 4USLA 2KYFA 1QASA 5IBWA 2E6WA 1K9KA 2KFFA 2Y4QA 5GQQC 4DS7A 3BXKA 2V53A 1TTXA 5HKZA 2ZFDA 1SCMC 3ZNIA 1NWDA 3DVKA 1FBVA 4HREE 2JNFA 2ZRTA 2KHNA 2LM5A 2WOSA 1KCYA 4DRWA 2Q91A 1W7JB 1CNPA 1RJVA 1KFXS 4CFQA 3QRXA 5DKQA 3CZTX 4YRUA 2NCOA 2EHBA 3IF7A 5DKNA 4XJKA 5ER5A 3VRQA 1QV0A 4NDCA 4M2PA 1NCXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KWO C;  1JUO A;  1CFC A;  2PVB A;  1Y1A A;  1YUR A;  5HKW A;  1GGZ A;  2Y5I A;  2COL B;  3VGO A;  1S5G Z;  1B47 A;  1NCZ A;  3OB1 B;  3SIA A;  4YGE B;  1NX3 A;  1QS7 A;  1M39 A;  2SCP A;  5CSF A;  1ALW A;  2KDH A;  1N0Y A;  1TRF A;  2H61 C;  1TNW A;  1SL7 A;  1NPQ A;  3OX5 A;  3TUY B;  1BR4 B;  1NIW A;  2LC5 A;  1RK9 A;  1YX7 A;  2ZKM X;  1AP4 A;  1S3P A;  4ICB A;  1M45 A;  1XK4 C;  2HQW A;  2KAV A;  4GGF C;  1NX1 A;  2M7L A;  2HF5 A;  2DOQ A;  1YX8 A;  3I5H B;  4A4B A;  3WHT B;  1F54 A;  1PVA A;  1S5G Y;  1X02 A;  2JT0 A;  1XK4 A;  2K7C A;  2RGI A;  1SY9 A;  1JF0 A;  1CLB A;  2JC2 A;  5KU1 A;  1OMV A;  4R1E A;  3VRR A;  4DUQ A;  1CFF A;  4I5L B;  2MAZ A;  4E68 A;  2PAL A;  1WRL A;  4JPZ B;  1EH2 A;  1FI6 A;  1ZMZ A;  1B7T Z;  1IG5 A;  1OMD A;  2MHH A;  1IQ5 A;  2OS8 B;  3JTD B;  1K94 A;  2JTT A;  3TDI A;  1CDP A;  4MN0 A;  4OVN F;  1UHI A;  4ORC B;  4PCW A;  1PAL A;  2K8M B;  1PVB A;  2FCD A;  3KO0 A;  4PDZ A;  3BYA A;  2H2K A;  1TNX A;  3VRP A;  2KFH A;  5AER A;  3KHE A;  2LAN A;  3BUX B;  4XJK B;  3DD4 A;  2I2R E;  2K2F A;  2BE4 A;  1H4B A;  4F0Z B;  1SRA A;  1XFW O;  1A75 A;  1B7T Y;  3NSO A;  3OX6 A;  2LNK A;  1RTP 1;  2LVI A;  3FIA A;  1A03 A;  1SR6 C;  1M31 A;  1MUX A;  3BUN B;  4JWQ A;  2Y1N A;  2JXC A;  4MRY A;  1QX5 B;  1FPW A;  2F3Z A;  4YGC B;  2F33 A;  1SBJ A;  1GQM A;  3E3R A;  1CB1 A;  2LAP A;  3DF0 A;  3A4U B;  1Y1U A;  1NSH A;  3TUY C;  1QVI Z;  2F3Y A;  1B8L A;  3BUO B;  2MLF C;  4WQ3 A;  1QAT A;  2CCM A;  1BMO A;  1WLM A;  2JOJ A;  4CID A;  4NDD A;  1SCV A;  1WRZ A;  2FCE A;  2M0R A;  3I5H C;  1QX2 A;  4I5J A;  2Q4U A;  2JWW A;  2AUC A;  4MRX A;  3EKJ A;  3PSR A;  2Y1M A;  1XO5 A;  3TZ1 A;  2KGR A;  4I5K A;  3BQ3 A;  4M2O A;  3FS7 A;  3SJS A;  1IGV A;  5ER4 X;  4ORB B;  2LVJ A;  1DF0 A;  2LLT A;  1QVI Y;  1K96 A;  1S6I A;  3CR2 A;  3WXA A;  1F4O A;  3D10 A;  1CKK A;  1UHH A;  4I5N B;  5J3X A;  3O4Y A;  4N5X A;  2GGZ A;  5CPV A;  3JTD C;  1B9A A;  1C7W A;  1QIV A;  2LUX A;  1JWD A;  3IQO A;  2I94 A;  4P2Y B;  1L7Z A;  1PUL A;  3FWB A;  1U5I A;  1YR5 A;  1A2X A;  2JRF A;  2KOT A;  1NP8 A;  5CSJ A;  2KQ6 A;  2M1K B;  1OZS A;  1SMG A;  1G4Y R;  1MF8 B;  2K7O A;  5AAN A;  1CDN A;  1UHN A;  1FF1 A;  2AMI A;  1A75 B;  3SG5 A;  1S26 D;  2AAO A;  1MR8 A;  2NXQ A;  2L5X B;  3TS5 B;  2F8P A;  1B8C A;  1BG1 A;  1SW8 A;  4OR9 B;  2CNP A;  2JXL A;  3TDZ A;  2FOT A;  1IWQ A;  1SR6 B;  1OMR A;  3PAL A;  4HRH A;  2LHL A;  2CXJ A;  2JUL A;  2LVV A;  1IJ6 A;  2NCP A;  3EK4 A;  3GK1 A;  2MJW B;  3DF0 B;  4D1E A;  4N1F A;  4GPL B;  4DCK A;  3CWG A;  4MZL A;  1CDL A;  4GFT A;  1KK8 B;  1N2D A;  3OHM B;  1BLQ A;  1V1F A;  3O2P A;  1DJZ A;  4OV2 A;  1CM1 A;  1KFU L;  3EKH A;  2BBM A;  1HQV A;  1YUT A;  2PAS A;  5JJG A;  3LK0 A;  2F2P A;  2O5G A;  1EG3 A;  4HRG A;  1YVH A;  4Q04 A;  1ALV A;  1BU3 A;  1A4P A;  3FWC A;  1XFU O;  5FYX A;  1Y0V H;  1QJT A;  1CLM A;  2MA2 A;  3I5F B;  2JU0 A;  1PRW A;  4M2Q A;  4MZK A;  1DF0 B;  1L2O B;  1B4C A;  1WDC B;  3PLF B;  1IQ3 A;  1OSA A;  2WND A;  2VRG A;  1M46 A;  1CMG A;  3VRO A;  1F70 A;  4ZCU A;  5I2O A;  1CDM A;  1V1G A;  1U5I B;  3K21 A;  2M3W A;  1W7I B;  5G08 A;  1PSR A;  4MVF A;  1EXR A;  1CFP A;  1CM4 A;  4PAL A;  4GUK A;  1GGW A;  5BPJ A;  1S36 A;  2K0J A;  2P6B B;  4NQG A;  1Y6W A;  5TNC A;  1LVC D;  1YVL A;  2E30 A;  2KYC A;  3A8R A;  1XA5 A;  1NX0 A;  3I5I B;  2JT8 A;  1CFD A;  1WY9 A;  4FTG A;  5D69 A;  1QV1 A;  3TS5 C;  4GNK B;  1DJX A;  1FW4 A;  3CR5 X;  1QLS A;  5KSZ A;  2B1U A;  1LXF C;  4YI8 A;  3NSK A;  4MSP A;  4TNC A;  1EG4 A;  4XYN A;  1KQV A;  1LIN A;  5I8N A;  1MWN A;  1J55 A;  1NYA A;  1DTL A;  2PRU A;  4L9M A;  2L50 A;  3SG4 A;  4CLN A;  5PAL A;  4CPV A;  1JBA A;  1QLK A;  1CMF A;  2QPT A;  1D1O A;  1KK8 C;  1MQ1 A;  2I7A A;  3BUW B;  4AQJ A;  4MEW A;  1OQP A;  1DJY A;  1Q80 A;  1UP5 A;  2KFG A;  1AVS A;  4MBE A;  4YGD B;  1M63 B;  3PN7 B;  3SG6 A;  4C0L A;  5HYD A;  1BF5 A;  2LP3 A;  2GV5 A;  3BOW B;  1DVI A;  2IS9 A;  3KPX A;  4ORA B;  3ZWH A;  3HX4 A;  2KBM A;  3SIB A;  3OP0 A;  5I2Q A;  2G2B A;  1NCY A;  4GBA A;  2WCE A;  3C1V A;  3GK4 X;  4U8D A;  3CLN A;  1ZFS A;  3I5F C;  1KQM B;  1G8I A;  2KQY A;  1R2U A;  1YTZ C;  2JQ6 A;  1S6C A;  3LL8 B;  1C07 A;  3NSI A;  1AUI B;  1A29 A;  1L2O C;  4NDB A;  1WDC C;  3F45 A;  2ZRS A;  1S1E A;  2D8N A;  5B8I B;  4GGN A;  5DKR A;  2WOR A;  4PE4 A;  1F55 A;  2EGD A;  1MHO A;  2JZI A;  1DGU A;  4HSZ A;  5JOL A;  1KFU S;  2K61 A;  1XYD A;  1TNP A;  2TN4 A;  1SNL A;  2KGB C;  2WCB A;  3D0Y A;  1AJ5 A;  4P5O E;  3HCM A;  1HT9 A;  3IQQ A;  2HET A;  1PSB A;  1XFV O;  1TCO B;  2WC8 A;  1VRK A;  2M49 B;  3AAK A;  1AK8 A;  5CSN A;  1QX7 A;  2HPS A;  2LVK A;  1MXL C;  2KI4 B;  2BBN A;  3DVE A;  2BCB A;  3WNX B;  2CT9 A;  4AOM A;  3GOF A;  2F2O A;  1TCF A;  1IKU A;  1SL9 A;  3I5I C;  3SG7 A;  3LLE A;  3KEV A;  1XFZ O;  2MLE C;  4CFR A;  2L51 A;  1WRK A;  2EC6 B;  4WQ2 A;  3LCP C;  1J7Q A;  2ISD A;  2NZ0 A;  5HKY A;  1J1D A;  2JTZ A;  2FJU B;  3DVM A;  2KSP A;  1ZOT B;  3AKB A;  3ICB A;  2JPT A;  3M0W A;  1NX2 A;  1OE9 B;  2L0P A;  2LE9 B;  1QTX A;  2BEC A;  3O78 A;  1C7V A;  1ZUZ A;  1K90 D;  1J1E A;  4UPG A;  1UHK A;  4PE7 A;  3SG2 A;  4YGA A;  3EK7 A;  2K7D A;  1F8H A;  3CR4 X;  1KSM A;  3JVT B;  2WCF A;  3PN7 C;  2MRD A;  1XFX O;  3PFV A;  4BY5 A;  1JC2 A;  4C0J A;  5AFP A;  2BCA A;  2KI6 D;  1H8B A;  1FI5 A;  3CTN A;  4OKH A;  3BOW A;  2OTG B;  3OB2 B;  1BOD A;  1YUU A;  1KQM C;  3DVJ A;  2BKH B;  4YBH B;  2LV7 A;  1QXP A;  1J7R A;  2PSR A;  3D0Y B;  1J7P A;  5HLO A;  1TOP A;  1N65 A;  3I5G B;  1KSO A;  1IH0 A;  2M29 A;  1ODB A;  2KBI A;  2LUC A;  1RRO A;  2JNX A;  4MLW A;  1K95 A;  2H61 A;  2KNE A;  3TDU A;  1WLZ A;  3RLZ A;  1KK7 Z;  4PHM A;  4PHN A;  1SK6 D;  5KTY A;  1DT7 B;  3PM8 A;  1LA0 A;  1MXE A;  1EL4 A;  2KI4 C;  1IRJ A;  3KF9 A;  1BT6 A;  1LKJ A;  4ETO A;  2LCP A;  1JSA A;  2A4J A;  2M7N A;  4C0K A;  4GGF A;  2CBL A;  2K7B A;  4OCI A;  4QJ4 B;  2BE6 A;  2GGM A;  5AEQ A;  5K89 A;  2CTN A;  2BL0 B;  3LK1 A;  3WHU B;  1K2H A;  3MSE B;  1KFX L;  4YI9 A;  5F6T A;  1RWY A;  1RFJ A;  2EC6 C;  2ZN9 A;  5AXI A;  3RM1 A;  2KI6 C;  4N1G A;  1GJY A;  1TNQ A;  3O6B A;  1KK7 Y;  3CS1 A;  4QJ5 B;  1B8R A;  1EJ3 A;  2O60 A;  5I2L A;  4A4C A;  1AJ4 A;  2LMT A;  2M97 A;  1UHJ A;  4PHJ A;  1YUS A;  1PK0 D;  2L98 A;  1NUB A;  2L4I A;  3AAJ A;  1XVJ A;  2LP2 A;  2LLS A;  5CSI A;  1LA3 A;  1SCM B;  1DJG A;  3EK8 A;  3VRN A;  4DIR A;  2L4H A;  1G33 A;  3BUM B;  4GAO A;  1UUS A;  1SYM A;  3JVT C;  1DGV A;  1QIW A;  1B1G A;  1AHR A;  2LMV A;  1XFY O;  2NLN A;  1J7O A;  2ZNE A;  2SAS A;  2LLU A;  1BOC A;  1KWO B;  1DJH A;  2K2A A;  1S6J A;  4WRI A;  1SPY A;  1SL8 A;  2OTG C;  3NXA A;  1TN4 A;  3CGA A;  3H4S E;  3SG3 A;  1DJW A;  2ZN8 A;  2LMU A;  2PMY A;  1DMO A;  1OZO A;  3I5G C;  4IL1 A;  4AQI A;  3EVU A;  1IJ5 A;  1K9U A;  1TIZ A;  4QJ3 B;  2JT3 A;  1JFK A;  2MBX A;  1E8A A;  1JF2 A;  2R2I A;  5D7F A;  1REC A;  2I18 A;  1BJF A;  1K93 D;  1UUR A;  1BR1 B;  4ZCV A;  1K8U A;  3GK2 A;  1SKT A;  1CLL A;  1OOJ A;  2HQ8 A;  1CTR A;  1YRT B;  4YGB B;  2M9G A;  4MZJ A;  1DJI A;  3EVV A;  2BKI B;  5HLV A;  3NSL A;  1ZAC A;  4JQ0 D;  4PE1 A;  2BL0 C;  2KAX A;  1UWO A;  1F4Q A;  2G9B A;  2KAY A;  2QAC A;  2L2E A;  3AKA A;  2M1U A;  4PHK A;  2OPO A;  1R6P A;  4FQO A;  1JFJ A;  1K9P A;  2BCX A;  2OS8 C;  4PE0 A;  1YRU B;  4BY4 A;  2M8U A;  2LHI A;  1Y1X A;  2ZND A;  3EVR A;  1F71 A;  3PAT A;  4USL A;  2KYF A;  1QAS A;  5IBW A;  2E6W A;  1K9K A;  2KFF A;  2Y4Q A;  5GQQ C;  4DS7 A;  3BXK A;  2V53 A;  1TTX A;  5HKZ A;  2ZFD A;  1SCM C;  3ZNI A;  1NWD A;  3DVK A;  1FBV A;  4HRE E;  2JNF A;  2ZRT A;  2KHN A;  2LM5 A;  2WOS A;  1KCY A;  4DRW A;  2Q91 A;  1W7J B;  1CNP A;  1RJV A;  1KFX S;  4CFQ A;  3QRX A;  5DKQ A;  3CZT X;  4YRU A;  2NCO A;  2EHB A;  3IF7 A;  5DKN A;  4XJK A;  5ER5 A;  3VRQ A;  1QV0 A;  4NDC A;  4M2P A;  1NCX A; 
#chains in the Genus database with same CATH topology
 1KWO C;  1JUO A;  1CFC A;  2PVB A;  3CAB A;  1Y1A A;  1YUR A;  5HKW A;  1GGZ A;  2Y5I A;  2COL B;  3VGO A;  1S5G Z;  3V2L A;  1B47 A;  1NCZ A;  3OB1 B;  3SIA A;  4YGE B;  1NX3 A;  1QS7 A;  1M39 A;  2SCP A;  5CSF A;  3PM2 A;  1ALW A;  2KDH A;  1N0Y A;  1TRF A;  2PQL A;  2H61 C;  1TNW A;  1SL7 A;  1NPQ A;  3OX5 A;  3TUY B;  1BR4 B;  1NIW A;  2LC5 A;  1CKK A;  1RK9 A;  1YX7 A;  2ZKM X;  1AP4 A;  1S3P A;  4ICB A;  1M45 A;  1XK4 C;  2HQW A;  2KAV A;  4GGF C;  1NX1 A;  2M7L A;  2HF5 A;  2DOQ A;  1YX8 A;  3I5H B;  4A4B A;  3WHT B;  1F54 A;  1PVA A;  1S5G Y;  1X02 A;  2JT0 A;  1XK4 A;  2K7C A;  2RGI A;  1SY9 A;  1JF0 A;  4OZD A;  3SS4 A;  1CLB A;  2JC2 A;  5KU1 A;  1OMV A;  3NGV A;  4R1E A;  3VRR A;  4DUQ A;  1CFF A;  4I5L B;  5DIC A;  2MAZ A;  4E68 A;  2PAL A;  1WRL A;  4JPZ B;  4F7F A;  1EH2 A;  1FI6 A;  1ZMZ A;  1B7T Z;  1IG5 A;  1OMD A;  2MHH A;  1IQ5 A;  2OS8 B;  3JTD B;  1K94 A;  2JTT A;  3TDI A;  1CDP A;  4MN0 A;  4OVN F;  1UHI A;  4ORC B;  4PCW A;  1PAL A;  2K8M B;  1PVB A;  2FCD A;  2GTE A;  3KO0 A;  4PDZ A;  3S0B A;  3BYA A;  2H2K A;  1TNX A;  3VRP A;  2KFH A;  5AER A;  3KHE A;  3SG6 A;  2LAN A;  3BUX B;  4XJK B;  3D76 A;  3DD4 A;  2I2R E;  2K2F A;  2BE4 A;  3B87 A;  1H4B A;  4F0Z B;  1SRA A;  1XFW O;  1A75 A;  1B7T Y;  3NSO A;  3OX6 A;  2LNK A;  1RTP 1;  2LVI A;  3FIA A;  1A03 A;  1SR6 C;  1M31 A;  1MUX A;  3R72 A;  3BUN B;  4JWQ A;  2Y1N A;  3S0F A;  2JXC A;  3D75 A;  1QX5 B;  4MRY A;  1FPW A;  4FQT A;  2F3Z A;  2K60 A;  4YGC B;  2F33 A;  1SBJ A;  1GQM A;  3E3R A;  1CB1 A;  2LAP A;  3BFH A;  3DF0 A;  3A4U B;  1Y1U A;  1NSH A;  3TUY C;  1QVI Z;  2F3Y A;  1B8L A;  3BUO B;  2MLF C;  4WQ3 A;  1QAT A;  2CCM A;  1DEL A;  1BMO A;  1WLM A;  2JOJ A;  4CID A;  4NDD A;  1SCV A;  1WRZ A;  2FCE A;  1OOG A;  2M0R A;  1QX2 A;  3I5H C;  2Q4U A;  2JWW A;  4I5J A;  2AUC A;  4MRX A;  1LS8 A;  3EKJ A;  3PSR A;  2Y1M A;  1XO5 A;  3TZ1 A;  2KGR A;  4I5K A;  3BQ3 A;  4M2O A;  3FS7 A;  3SJS A;  1IGV A;  5ER4 X;  4ORB B;  2LVJ A;  1DF0 A;  2LLT A;  3IVT A;  1QVI Y;  1K96 A;  1S6I A;  3CR2 A;  3SS5 A;  1F4O A;  3D10 A;  3WXA A;  1UHH A;  2QEH A;  4I5N B;  5J3X A;  3O4Y A;  4N5X A;  2GGZ A;  5CPV A;  3JTD C;  1B9A A;  1C7W A;  1QIV A;  2LUX A;  1JWD A;  3IQO A;  2I94 A;  4P2Y B;  1L7Z A;  1PUL A;  3FWB A;  1U5I A;  1YR5 A;  1A2X A;  2JRF A;  2KOT A;  1NP8 A;  5CSJ A;  2KQ6 A;  2M1K B;  3CYZ A;  1OZS A;  3S0G A;  1SMG A;  1G4Y R;  2WCH A;  1MF8 B;  2K7O A;  5AAN A;  1CDN A;  1UHN A;  1FF1 A;  2AMI A;  1A75 B;  3SG5 A;  1S26 D;  2AAO A;  1MR8 A;  2NXQ A;  1DEK A;  2L5X B;  2L5Y A;  3TS5 B;  2F8P A;  1B8C A;  1BG1 A;  1SW8 A;  4OR9 B;  2CNP A;  5FI6 A;  2JXL A;  2WC6 A;  3TDZ A;  2FOT A;  1IWQ A;  1SR6 B;  3SS3 A;  1OMR A;  3PAL A;  4HRH A;  2LHL A;  3OBV A;  2CXJ A;  2JUL A;  2LVV A;  1IJ6 A;  1DC1 A;  2NCP A;  3EK4 A;  3GK1 A;  2MJW B;  2H8V A;  3DF0 B;  4D1E A;  4N1F A;  4GPL B;  4DCK A;  2WCJ A;  3CWG A;  4MZL A;  1CDL A;  4GFT A;  1KK8 B;  1N2D A;  1SSE B;  3OHM B;  1BLQ A;  1T14 A;  1V1F A;  3O2P A;  1DJZ A;  4OV2 A;  1OOF A;  1CM1 A;  1KFU L;  3EKH A;  2BBM A;  5FI7 A;  1HQV A;  1YUT A;  2PAS A;  5HL1 A;  3LK0 A;  5JJG A;  2F2P A;  2O5G A;  1EG3 A;  3BJH A;  4HRG A;  1YVH A;  4Q04 A;  1ALV A;  1BU3 A;  1A4P A;  3QME A;  3FWC A;  1XFU O;  5FYX A;  4JKT A;  1Y0V H;  1QJT A;  1CLM A;  2MA2 A;  3I5F B;  2JU0 A;  1PRW A;  4M2Q A;  4MZK A;  1DF0 B;  2QEV A;  1L2O B;  1B4C A;  1WDC B;  3PLF B;  1IQ3 A;  1OSA A;  2WND A;  2VRG A;  1M46 A;  1CMG A;  3VRO A;  1F70 A;  4ZCU A;  1XFR A;  5I2O A;  1CDM A;  1V1G A;  1U5I B;  2WCM A;  3FE6 A;  3B88 A;  3K21 A;  2M3W A;  4IJ7 A;  1W7I B;  2WC5 A;  5G08 A;  1PSR A;  4MVF A;  1EXR A;  1CFP A;  1CM4 A;  4PAL A;  4GUK A;  1GGW A;  5BPJ A;  1S36 A;  2K0J A;  2P6B B;  4NQG A;  1Y6W A;  5TNC A;  1LVC D;  1YVL A;  2E30 A;  2KYC A;  3A8R A;  1XA5 A;  1NX0 A;  3I5I B;  2JT8 A;  3PJI A;  1CFD A;  1WY9 A;  4FTG A;  5D69 A;  1QV1 A;  3TS5 C;  3B6X A;  4GNK B;  1DJX A;  1FW4 A;  3CR5 X;  1QLS A;  5KSZ A;  2B1U A;  1LXF C;  5D3O A;  4YI8 A;  3NSK A;  4MSP A;  4TNC A;  1EG4 A;  4XYN A;  1KQV A;  1LIN A;  3D73 A;  1MWN A;  5I8N A;  1J55 A;  1NYA A;  4PT1 A;  1DTL A;  2PRU A;  3BFB A;  4L9M A;  2L50 A;  3SG4 A;  3S0D A;  4CLN A;  5PAL A;  4CPV A;  1JBA A;  1QLK A;  1CMF A;  2QPT A;  1D1O A;  1KK8 C;  1MQ1 A;  2I7A A;  3BUW B;  4JD9 A;  4AQJ A;  4MEW A;  1OQP A;  1DJY A;  1Q80 A;  1UP5 A;  2KFG A;  1AVS A;  4MBE A;  4YGD B;  1M63 B;  2FJY A;  2PYQ A;  2WCK A;  3PN7 B;  5EL2 A;  2LP3 A;  2GV5 A;  3BOW B;  1DVI A;  2IS9 A;  3KPX A;  4ORA B;  3UO9 A;  3ZWH A;  3HX4 A;  2KBM A;  3SIB A;  3OP0 A;  1GM0 A;  5I2Q A;  2G2B A;  1NCY A;  4GBA A;  2WCE A;  3C1V A;  3GK4 X;  4U8D A;  3CLN A;  1ZFS A;  3I5F C;  1KQM B;  1G8I A;  2KQY A;  1R2U A;  1YTZ C;  2JQ6 A;  1S6C A;  3LL8 B;  1IIO A;  1C07 A;  3NSI A;  1AUI B;  1A29 A;  1L2O C;  4NDB A;  1WDC C;  3F45 A;  2ZRS A;  1S1E A;  2D8N A;  3R1P A;  4GGN A;  5DKR A;  5B8I B;  2WOR A;  3DY9 A;  4PE4 A;  2EGD A;  1MHO A;  2JZI A;  1F55 A;  1DGU A;  4HSZ A;  5JOL A;  1OW4 A;  1KFU S;  2K61 A;  1XYD A;  1TNP A;  2TN4 A;  1SNL A;  2KGB C;  2WCB A;  3D0Y A;  1AJ5 A;  4P5O E;  3HCM A;  1HT9 A;  3IQQ A;  2HET A;  3DZT A;  1PSB A;  1XFV O;  1TCO B;  2WC8 A;  1VRK A;  2M49 B;  3AAK A;  2BNX A;  1AK8 A;  5CSN A;  1QX7 A;  2HPS A;  2LVK A;  1MXL C;  2KI4 B;  3N7H A;  2BBN A;  3DVE A;  2BCB A;  3WNX B;  2CT9 A;  4AOM A;  3GOF A;  2F2O A;  1TCF A;  1IKU A;  3L47 A;  1SL9 A;  3CDN A;  3I5I C;  2QDI A;  3SG7 A;  3VB1 A;  3LLE A;  3KEV A;  1XFZ O;  2MLE C;  1OOI X;  4CFR A;  2L51 A;  1WRK A;  2EC6 B;  4WQ2 A;  3LCP C;  1J7Q A;  2ISD A;  1ORG A;  2NZ0 A;  5HKY A;  1J1D A;  2JTZ A;  3CZ2 A;  2FJU B;  3DVM A;  2KSP A;  1ZOT B;  3AKB A;  3ICB A;  2JPT A;  3M0W A;  1TWO A;  1NX2 A;  2YGU A;  1OE9 B;  2L0P A;  2LE9 B;  2QEO A;  3B7A A;  3D78 A;  3K1E A;  3FE9 A;  1QTX A;  2BEC A;  3O78 A;  1C7V A;  1ZUZ A;  1K90 D;  3BFA A;  1J1E A;  4UPG A;  5I94 A;  1UHK A;  3R1V A;  4PE7 A;  3SG2 A;  4YGA A;  3EK7 A;  2K7D A;  3NHT A;  3CR4 X;  1KSM A;  1F8H A;  3JVT B;  2WCF A;  1QWV A;  3PN7 C;  1BF5 A;  2MRD A;  1XFX O;  3PFV A;  4BY5 A;  1JC2 A;  4C0J A;  5AFP A;  2BCA A;  2KI6 D;  2QEB A;  4INW A;  2KLE A;  1FI5 A;  3CTN A;  1H8B A;  4OKH A;  3BOW A;  2OTG B;  3OB2 B;  1P28 A;  1BOD A;  1YUU A;  1KQM C;  3DVJ A;  3L4A A;  2BKH B;  3EG5 B;  2KLD A;  4YBH B;  2LV7 A;  1QXP A;  1J7R A;  3S0A A;  2PSR A;  3D0Y B;  1J7P A;  5HLO A;  1TOP A;  1N65 A;  3CZ0 A;  1KSO A;  3I5G B;  1IH0 A;  2M29 A;  1ODB A;  2KBI A;  2LUC A;  1RRO A;  2JNX A;  4MLW A;  1K95 A;  2H61 A;  2KNE A;  3TDU A;  1WLZ A;  3RLZ A;  4KYN A;  1KK7 Z;  3D74 A;  4PHM A;  4PHN A;  1SK6 D;  4INX A;  5KTY A;  1DT7 B;  3PM8 A;  1LA0 A;  1MXE A;  1EL4 A;  2KI4 C;  1IRJ A;  3KF9 A;  3DXL A;  1BT6 A;  1LKJ A;  4ETO A;  2LCP A;  1JSA A;  2A4J A;  2M7N A;  4C0K A;  4GGF A;  2CBL A;  2K7B A;  4OCI A;  4QJ4 B;  2BE6 A;  2ERB A;  2GGM A;  5AEQ A;  5K89 A;  2CTN A;  1OOH A;  2BL0 B;  3LK1 A;  3WHU B;  1K2H A;  3MSE B;  1KFX L;  4YI9 A;  5F6T A;  1RWY A;  3CZ1 A;  1RFJ A;  2EC6 C;  2ZN9 A;  5AXI A;  3RZS A;  3RM1 A;  2KI6 C;  2KPH A;  4N1G A;  1GJY A;  1TNQ A;  3O6B A;  1KK7 Y;  3CS1 A;  4QJ5 B;  1B8R A;  1EJ3 A;  2O60 A;  2JPO A;  5I2L A;  4A4C A;  1AJ4 A;  2LMT A;  2M97 A;  1UHJ A;  4PHJ A;  1YUS A;  1PK0 D;  1TUZ A;  2L98 A;  1NUB A;  2L4I A;  2P70 A;  3AAJ A;  1XVJ A;  2LP2 A;  2LLS A;  5CSI A;  1LA3 A;  1SCM B;  1DJG A;  3EK8 A;  1TUJ A;  3VRN A;  4DIR A;  2L4H A;  1G33 A;  3BUM B;  3B86 A;  1UUS A;  1SYM A;  3O4X A;  4GAO A;  3JVT C;  1DGV A;  1QIW A;  1B1G A;  1AHR A;  2LMV A;  1XFY O;  2NLN A;  1J7O A;  2ZNE A;  3NHI A;  2SAS A;  2LLU A;  1BOC A;  2BAP A;  1KWO B;  3DYE A;  1DJH A;  2K2A A;  1S6J A;  4WRI A;  1SPY A;  1SL8 A;  2OTG C;  3NXA A;  1TN4 A;  3CGA A;  3H4S E;  5FI2 A;  1DJW A;  3SG3 A;  2ZN8 A;  2LMU A;  2PMY A;  1DMO A;  3R1O A;  1OZO A;  3I5G C;  4IL1 A;  4AQI A;  3EVU A;  1IJ5 A;  1K9U A;  1TIZ A;  4QJ3 B;  2JT3 A;  1JFK A;  2L2C A;  2MBX A;  1E8A A;  3L4L A;  3UNW A;  1JF2 A;  2R2I A;  5D7F A;  1REC A;  2I18 A;  1BJF A;  3S0E A;  1K93 D;  1UUR A;  1BR1 B;  4ZCV A;  1K8U A;  3GK2 A;  1SKT A;  1CLL A;  1OOJ A;  2HQ8 A;  1CTR A;  1YRT B;  4YGB B;  3OGN A;  5HYD A;  2M9G A;  2WCL A;  4C0L A;  1C3Y A;  4MZJ A;  1DJI A;  1DQE A;  3EVV A;  2BKI B;  5HLV A;  3NSL A;  1ZAC A;  4JQ0 D;  4PE1 A;  2BL0 C;  2KAX A;  1UWO A;  1F4Q A;  2G9B A;  2KAY A;  2QAC A;  2L2E A;  3Q8I A;  2P71 A;  3AKA A;  2M1U A;  4PHK A;  2OPO A;  1R6P A;  4FQO A;  1JFJ A;  1K9P A;  2BCX A;  2OS8 C;  4PE0 A;  1YRU B;  4BY4 A;  1Z4H A;  2LHI A;  1Y1X A;  2M8U A;  2ZND A;  3EVR A;  1F71 A;  3PAT A;  4USL A;  2KYF A;  1QAS A;  5IBW A;  2E6W A;  1K9K A;  2KFF A;  2Y4Q A;  5GQQ C;  4DS7 A;  3BXK A;  2V53 A;  1TTX A;  5HKZ A;  2ZFD A;  1SCM C;  3ZNI A;  1NWD A;  3DVK A;  1C3Z A;  1FBV A;  4HRE E;  2JNF A;  2ZRT A;  2KHN A;  2LM5 A;  2WOS A;  1KCY A;  4DRW A;  2Q91 A;  1W7J B;  1CNP A;  1RJV A;  1KFX S;  4CFQ A;  3QRX A;  5DKQ A;  3CZT X;  1Z2C B;  4YRU A;  2NCO A;  2EHB A;  3FE8 A;  3IF7 A;  5DKN A;  4XJK A;  3D77 A;  5ER5 A;  3VRQ A;  1QV0 A;  4NDC A;  4M2P A;  1NCX A;  1W9Z A; 
#chains in the Genus database with same CATH homology
 1KWO C;  1JUO A;  1CFC A;  2PVB A;  1Y1A A;  1YUR A;  5HKW A;  1GGZ A;  2Y5I A;  2COL B;  3VGO A;  1S5G Z;  1B47 A;  1NCZ A;  3OB1 B;  3SIA A;  4YGE B;  1NX3 A;  1QS7 A;  1M39 A;  2SCP A;  5CSF A;  1ALW A;  2KDH A;  1N0Y A;  1TRF A;  2H61 C;  1TNW A;  1SL7 A;  1NPQ A;  3OX5 A;  3TUY B;  1BR4 B;  1NIW A;  2LC5 A;  1RK9 A;  1YX7 A;  2ZKM X;  1AP4 A;  1S3P A;  4ICB A;  1M45 A;  1XK4 C;  2HQW A;  2KAV A;  4GGF C;  1NX1 A;  2M7L A;  2HF5 A;  2DOQ A;  1YX8 A;  3I5H B;  4A4B A;  3WHT B;  1F54 A;  1PVA A;  1S5G Y;  1X02 A;  2JT0 A;  1XK4 A;  2K7C A;  2RGI A;  1SY9 A;  1JF0 A;  1CLB A;  2JC2 A;  5KU1 A;  1OMV A;  4R1E A;  3VRR A;  4DUQ A;  1CFF A;  4I5L B;  2MAZ A;  4E68 A;  2PAL A;  1WRL A;  4JPZ B;  1EH2 A;  1FI6 A;  1ZMZ A;  1B7T Z;  1IG5 A;  1OMD A;  2MHH A;  1IQ5 A;  2OS8 B;  3JTD B;  1K94 A;  2JTT A;  3TDI A;  1CDP A;  4MN0 A;  4OVN F;  1UHI A;  4ORC B;  4PCW A;  1PAL A;  2K8M B;  1PVB A;  2FCD A;  3KO0 A;  4PDZ A;  3BYA A;  2H2K A;  1TNX A;  3VRP A;  2KFH A;  5AER A;  3KHE A;  2LAN A;  3BUX B;  4XJK B;  3DD4 A;  2I2R E;  2K2F A;  2BE4 A;  1H4B A;  4F0Z B;  1SRA A;  1XFW O;  1A75 A;  1B7T Y;  3NSO A;  3OX6 A;  2LNK A;  1RTP 1;  2LVI A;  3FIA A;  1A03 A;  1SR6 C;  1M31 A;  1MUX A;  3BUN B;  4JWQ A;  2Y1N A;  2JXC A;  4MRY A;  1QX5 B;  1FPW A;  2F3Z A;  4YGC B;  2F33 A;  1SBJ A;  1GQM A;  3E3R A;  1CB1 A;  2LAP A;  3DF0 A;  3A4U B;  1Y1U A;  1NSH A;  3TUY C;  1QVI Z;  2F3Y A;  1B8L A;  3BUO B;  2MLF C;  4WQ3 A;  1QAT A;  2CCM A;  1BMO A;  1WLM A;  2JOJ A;  4CID A;  4NDD A;  1SCV A;  1WRZ A;  2FCE A;  2M0R A;  3I5H C;  1QX2 A;  4I5J A;  2Q4U A;  2JWW A;  2AUC A;  4MRX A;  3EKJ A;  3PSR A;  2Y1M A;  1XO5 A;  3TZ1 A;  2KGR A;  4I5K A;  3BQ3 A;  4M2O A;  3FS7 A;  3SJS A;  1IGV A;  5ER4 X;  4ORB B;  2LVJ A;  1DF0 A;  2LLT A;  1QVI Y;  1K96 A;  1S6I A;  3CR2 A;  3WXA A;  1F4O A;  3D10 A;  1CKK A;  1UHH A;  4I5N B;  5J3X A;  3O4Y A;  4N5X A;  2GGZ A;  5CPV A;  3JTD C;  1B9A A;  1C7W A;  1QIV A;  2LUX A;  1JWD A;  3IQO A;  2I94 A;  4P2Y B;  1L7Z A;  1PUL A;  3FWB A;  1U5I A;  1YR5 A;  1A2X A;  2JRF A;  2KOT A;  1NP8 A;  5CSJ A;  2KQ6 A;  2M1K B;  1OZS A;  1SMG A;  1G4Y R;  1MF8 B;  2K7O A;  5AAN A;  1CDN A;  1UHN A;  1FF1 A;  2AMI A;  1A75 B;  3SG5 A;  1S26 D;  2AAO A;  1MR8 A;  2NXQ A;  2L5X B;  3TS5 B;  2F8P A;  1B8C A;  1BG1 A;  1SW8 A;  4OR9 B;  2CNP A;  2JXL A;  3TDZ A;  2FOT A;  1IWQ A;  1SR6 B;  1OMR A;  3PAL A;  4HRH A;  2LHL A;  2CXJ A;  2JUL A;  2LVV A;  1IJ6 A;  2NCP A;  3EK4 A;  3GK1 A;  2MJW B;  3DF0 B;  4D1E A;  4N1F A;  4GPL B;  4DCK A;  3CWG A;  4MZL A;  1CDL A;  4GFT A;  1KK8 B;  1N2D A;  3OHM B;  1BLQ A;  1V1F A;  3O2P A;  1DJZ A;  4OV2 A;  1CM1 A;  1KFU L;  3EKH A;  2BBM A;  1HQV A;  1YUT A;  2PAS A;  5JJG A;  3LK0 A;  2F2P A;  2O5G A;  1EG3 A;  4HRG A;  1YVH A;  4Q04 A;  1ALV A;  1BU3 A;  1A4P A;  3FWC A;  1XFU O;  5FYX A;  1Y0V H;  1QJT A;  1CLM A;  2MA2 A;  3I5F B;  2JU0 A;  1PRW A;  4M2Q A;  4MZK A;  1DF0 B;  1L2O B;  1B4C A;  1WDC B;  3PLF B;  1IQ3 A;  1OSA A;  2WND A;  2VRG A;  1M46 A;  1CMG A;  3VRO A;  1F70 A;  4ZCU A;  5I2O A;  1CDM A;  1V1G A;  1U5I B;  3K21 A;  2M3W A;  1W7I B;  5G08 A;  1PSR A;  4MVF A;  1EXR A;  1CFP A;  1CM4 A;  4PAL A;  4GUK A;  1GGW A;  5BPJ A;  1S36 A;  2K0J A;  2P6B B;  4NQG A;  1Y6W A;  5TNC A;  1LVC D;  1YVL A;  2E30 A;  2KYC A;  3A8R A;  1XA5 A;  1NX0 A;  3I5I B;  2JT8 A;  1CFD A;  1WY9 A;  4FTG A;  5D69 A;  1QV1 A;  3TS5 C;  4GNK B;  1DJX A;  1FW4 A;  3CR5 X;  1QLS A;  5KSZ A;  2B1U A;  1LXF C;  4YI8 A;  3NSK A;  4MSP A;  4TNC A;  1EG4 A;  4XYN A;  1KQV A;  1LIN A;  5I8N A;  1MWN A;  1J55 A;  1NYA A;  1DTL A;  2PRU A;  4L9M A;  2L50 A;  3SG4 A;  4CLN A;  5PAL A;  4CPV A;  1JBA A;  1QLK A;  1CMF A;  2QPT A;  1D1O A;  1KK8 C;  1MQ1 A;  2I7A A;  3BUW B;  4AQJ A;  4MEW A;  1OQP A;  1DJY A;  1Q80 A;  1UP5 A;  2KFG A;  1AVS A;  4MBE A;  4YGD B;  1M63 B;  3PN7 B;  3SG6 A;  4C0L A;  5HYD A;  1BF5 A;  2LP3 A;  2GV5 A;  3BOW B;  1DVI A;  2IS9 A;  3KPX A;  4ORA B;  3ZWH A;  3HX4 A;  2KBM A;  3SIB A;  3OP0 A;  5I2Q A;  2G2B A;  1NCY A;  4GBA A;  2WCE A;  3C1V A;  3GK4 X;  4U8D A;  3CLN A;  1ZFS A;  3I5F C;  1KQM B;  1G8I A;  2KQY A;  1R2U A;  1YTZ C;  2JQ6 A;  1S6C A;  3LL8 B;  1C07 A;  3NSI A;  1AUI B;  1A29 A;  1L2O C;  4NDB A;  1WDC C;  3F45 A;  2ZRS A;  1S1E A;  2D8N A;  5B8I B;  4GGN A;  5DKR A;  2WOR A;  4PE4 A;  1F55 A;  2EGD A;  1MHO A;  2JZI A;  1DGU A;  4HSZ A;  5JOL A;  1KFU S;  2K61 A;  1XYD A;  1TNP A;  2TN4 A;  1SNL A;  2KGB C;  2WCB A;  3D0Y A;  1AJ5 A;  4P5O E;  3HCM A;  1HT9 A;  3IQQ A;  2HET A;  1PSB A;  1XFV O;  1TCO B;  2WC8 A;  1VRK A;  2M49 B;  3AAK A;  1AK8 A;  5CSN A;  1QX7 A;  2HPS A;  2LVK A;  1MXL C;  2KI4 B;  2BBN A;  3DVE A;  2BCB A;  3WNX B;  2CT9 A;  4AOM A;  3GOF A;  2F2O A;  1TCF A;  1IKU A;  1SL9 A;  3I5I C;  3SG7 A;  3LLE A;  3KEV A;  1XFZ O;  2MLE C;  4CFR A;  2L51 A;  1WRK A;  2EC6 B;  4WQ2 A;  3LCP C;  1J7Q A;  2ISD A;  2NZ0 A;  5HKY A;  1J1D A;  2JTZ A;  2FJU B;  3DVM A;  2KSP A;  1ZOT B;  3AKB A;  3ICB A;  2JPT A;  3M0W A;  1NX2 A;  1OE9 B;  2L0P A;  2LE9 B;  1QTX A;  2BEC A;  3O78 A;  1C7V A;  1ZUZ A;  1K90 D;  1J1E A;  4UPG A;  1UHK A;  4PE7 A;  3SG2 A;  4YGA A;  3EK7 A;  2K7D A;  1F8H A;  3CR4 X;  1KSM A;  3JVT B;  2WCF A;  3PN7 C;  2MRD A;  1XFX O;  3PFV A;  4BY5 A;  1JC2 A;  4C0J A;  5AFP A;  2BCA A;  2KI6 D;  1H8B A;  1FI5 A;  3CTN A;  4OKH A;  3BOW A;  2OTG B;  3OB2 B;  1BOD A;  1YUU A;  1KQM C;  3DVJ A;  2BKH B;  4YBH B;  2LV7 A;  1QXP A;  1J7R A;  2PSR A;  3D0Y B;  1J7P A;  5HLO A;  1TOP A;  1N65 A;  3I5G B;  1KSO A;  1IH0 A;  2M29 A;  1ODB A;  2KBI A;  2LUC A;  1RRO A;  2JNX A;  4MLW A;  1K95 A;  2H61 A;  2KNE A;  3TDU A;  1WLZ A;  3RLZ A;  1KK7 Z;  4PHM A;  4PHN A;  1SK6 D;  5KTY A;  1DT7 B;  3PM8 A;  1LA0 A;  1MXE A;  1EL4 A;  2KI4 C;  1IRJ A;  3KF9 A;  1BT6 A;  1LKJ A;  4ETO A;  2LCP A;  1JSA A;  2A4J A;  2M7N A;  4C0K A;  4GGF A;  2CBL A;  2K7B A;  4OCI A;  4QJ4 B;  2BE6 A;  2GGM A;  5AEQ A;  5K89 A;  2CTN A;  2BL0 B;  3LK1 A;  3WHU B;  1K2H A;  3MSE B;  1KFX L;  4YI9 A;  5F6T A;  1RWY A;  1RFJ A;  2EC6 C;  2ZN9 A;  5AXI A;  3RM1 A;  2KI6 C;  4N1G A;  1GJY A;  1TNQ A;  3O6B A;  1KK7 Y;  3CS1 A;  4QJ5 B;  1B8R A;  1EJ3 A;  2O60 A;  5I2L A;  4A4C A;  1AJ4 A;  2LMT A;  2M97 A;  1UHJ A;  4PHJ A;  1YUS A;  1PK0 D;  2L98 A;  1NUB A;  2L4I A;  3AAJ A;  1XVJ A;  2LP2 A;  2LLS A;  5CSI A;  1LA3 A;  1SCM B;  1DJG A;  3EK8 A;  3VRN A;  4DIR A;  2L4H A;  1G33 A;  3BUM B;  4GAO A;  1UUS A;  1SYM A;  3JVT C;  1DGV A;  1QIW A;  1B1G A;  1AHR A;  2LMV A;  1XFY O;  2NLN A;  1J7O A;  2ZNE A;  2SAS A;  2LLU A;  1BOC A;  1KWO B;  1DJH A;  2K2A A;  1S6J A;  4WRI A;  1SPY A;  1SL8 A;  2OTG C;  3NXA A;  1TN4 A;  3CGA A;  3H4S E;  3SG3 A;  1DJW A;  2ZN8 A;  2LMU A;  2PMY A;  1DMO A;  1OZO A;  3I5G C;  4IL1 A;  4AQI A;  3EVU A;  1IJ5 A;  1K9U A;  1TIZ A;  4QJ3 B;  2JT3 A;  1JFK A;  2MBX A;  1E8A A;  1JF2 A;  2R2I A;  5D7F A;  1REC A;  2I18 A;  1BJF A;  1K93 D;  1UUR A;  1BR1 B;  4ZCV A;  1K8U A;  3GK2 A;  1SKT A;  1CLL A;  1OOJ A;  2HQ8 A;  1CTR A;  1YRT B;  4YGB B;  2M9G A;  4MZJ A;  1DJI A;  3EVV A;  2BKI B;  5HLV A;  3NSL A;  1ZAC A;  4JQ0 D;  4PE1 A;  2BL0 C;  2KAX A;  1UWO A;  1F4Q A;  2G9B A;  2KAY A;  2QAC A;  2L2E A;  3AKA A;  2M1U A;  4PHK A;  2OPO A;  1R6P A;  4FQO A;  1JFJ A;  1K9P A;  2BCX A;  2OS8 C;  4PE0 A;  1YRU B;  4BY4 A;  2M8U A;  2LHI A;  1Y1X A;  2ZND A;  3EVR A;  1F71 A;  3PAT A;  4USL A;  2KYF A;  1QAS A;  5IBW A;  2E6W A;  1K9K A;  2KFF A;  2Y4Q A;  5GQQ C;  4DS7 A;  3BXK A;  2V53 A;  1TTX A;  5HKZ A;  2ZFD A;  1SCM C;  3ZNI A;  1NWD A;  3DVK A;  1FBV A;  4HRE E;  2JNF A;  2ZRT A;  2KHN A;  2LM5 A;  2WOS A;  1KCY A;  4DRW A;  2Q91 A;  1W7J B;  1CNP A;  1RJV A;  1KFX S;  4CFQ A;  3QRX A;  5DKQ A;  3CZT X;  4YRU A;  2NCO A;  2EHB A;  3IF7 A;  5DKN A;  4XJK A;  5ER5 A;  3VRQ A;  1QV0 A;  4NDC A;  4M2P A;  1NCX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...