5I8NA

Solution structure of human calcium-binding s100a9 (c3s) protein
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
114
structure length
114
Chain Sequence
MTSKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIMLMARLTWASHEKMHEGDEGPGHHHKPGLGEGTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Blocking the interaction between S100A9 and RAGE V domain using CHAPS molecule: A novel route to drug development against cell proliferation
pubmed doi rcsb
molecule keywords Protein S100-A9
molecule tags Metal binding protein
source organism Homo sapiens
total genus 33
structure length 114
sequence length 114
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 5i8nA00
1DJWA 1NWDA 4YGAA 1WLZA 1AVSA 1QASA 1QTXA 2M9GA 2KBMA 1CMGA 1CNPA 2EC6B 2I94A 1DGVA 2K0JA 3NSOA 1TNWA 4GGFC 4I5NB 3VRNA 1YX7A 2I2RE 3TUYC 3I5GC 3GOFA 1SNLA 1K9PA 3PLFB 5AANA 1K2HA 3SG6A 1TNXA 1W7IB 1Y6WA 2NZ0A 1RECA 5KSZA 2FJUB 2K2AA 2LNKA 3WNXB 4QJ3B 2WCBA 1J1EA 3DVJA 1JBAA 2CCMA 1UHKA 1R6PA 1QLKA 1S1EA 3KF9A 1B47A 1K95A 2KAVA 2R2IA 3DF0B 2VRGA 2KAXA 2M7LA 1CFFA 1N65A 1PVBA 3CWGA 2L50A 1IGVA 4MRYA 5DKNA 4AQJA 1PVAA 1JC2A 2MA2A 2RGIA 4BY5A 2LC5A 5J3XA 1NIWA 3SIBA 4YGEB 1KK8B 1S36A 1XO5A 1MXEA 2KYCA 1OOJA 4OKHA 1BODA 2KI6C 1CKKA 1B7TY 4MEWA 3AAJA 3PN7B 1B7TZ 1V1FA 1RJVA 1EXRA 1Y1AA 1SBJA 3EK4A 3HX4A 2LUCA 3ZNIA 2BCXA 3C1VA 1PSBA 3DVMA 1XK4A 3TUYB 3I5GB 1R2UA 1FF1A 2LLTA 1IJ5A 3OB1B 4PHMA 1L2OC 1GGWA 1QV1A 3VRQA 1CLMA 5K89A 1SCMB 1NSHA 1S26D 5I8NA 4GFTA 3DF0A 1NP8A 2KDHA 1KCYA 3TDUA 4DCKA 1H4BA 3IQOA 1A4PA 2ZNDA 4M2OA 1PSRA 1XA5A 3CTNA 1LVCD 3I5FB 1OQPA 1XVJA 3BUOB 1HQVA 1SR6C 3DVEA 4PE1A 1QLSA 1YUUA 1YVHA 1DGUA 1QX5B 1AUIB 2JRFA 3BXKA 2JZIA 2M29A 2KFHA 1TCFA 2H61C 2ZNEA 4MVFA 1LA0A 3NSKA 1AJ4A 1TOPA 3TS5C 1TN4A 1KSMA 1SPYA 1KWOB 2P6BB 3OP0A 3SG7A 2DOQA 2KI6D 2AMIA 2E30A 4JQ0D 4U8DA 1CDMA 1UHIA 4YBHB 2JNFA 2TN4A 4HSZA 1DTLA 3RM1A 1UUSA 1YRUB 2JQ6A 2B1UA 4CFQA 1WY9A 2KI4B 4ZCVA 1ALVA 1L2OB 3NSIA 3FWCA 4AQIA 1GQMA 2JT0A 2SASA 4GAOA 2WORA 4MLWA 4ORAB 2OS8C 1UWOA 5JOLA 1B8LA 3BUWB 1N0YA 1N2DA 3AAKA 1DJXA 2LP3A 4BY4A 2GGZA 2F33A 4YGDB 3SG4A 1KQMC 2QPTA 1SR6B 1JFKA 2WC8A 1MUXA 4UPGA 5AFPA 3LLEA 1BT6A 4DRWA 4QJ5B 3WHUB 2PALA 3TDIA 1CDPA 1NX2A 1WDCC 4TNCA 2OPOA 3BUNB 1AJ5A 1B8CA 3M0WA 4FTGA 1K90D 4PE7A 1ALWA 2M8UA 1DJZA 2Y5IA 1RTP1 2KYFA 4PE4A 2BECA 1K93D 4USLA 2MLFC 3E3RA 5B8IB 2LMTA 1EJ3A 1QIWA 1NYAA 1WRZA 2BL0B 4NDBA 1XFXO 3SJSA 3PFVA 2L0PA 1CB1A 3AKAA 2CXJA 4PCWA 3KHEA 1L7ZA 4R1EA 2L51A 4DIRA 4YRUA 3AKBA 5AXIA 2KSPA 2LE9B 3BUXB 4CIDA 3SG2A 4DUQA 2JXCA 2L5XB 1IH0A 3IQQA 1CFCA 2O60A 1MF8B 1SRAA 1C07A 1F55A 2MBXA 1YR5A 4E68A 1M46A 2WNDA 1S6JA 3I5IB 3GK4X 4PDZA 2L98A 2F2PA 1DJHA 2H61A 2GGMA 4P5OE 2E6WA 1YURA 5HKYA 1IRJA 3JVTB 1KFUS 2Q91A 1JF0A 3A8RA 2Y1NA 1FW4A 2LV7A 4P2YB 2IS9A 2COLB 3FWBA 3EKHA 1DJYA 1DT7B 1FI5A 4JWQA 2LVVA 1SY9A 3OX6A 2K61A 1KK7Y 1TNPA 1B8RA 2JC2A 3OX5A 1KK7Z 4AOMA 3LL8B 1QV0A 4I5KA 2M1UA 2ZN8A 2ZRSA 1Y1XA 3DVKA 4C0KA 4PHJA 5TNCA 4ICBA 1K94A 3LK0A 1SK6D 1IKUA 2Y1MA 2ZKMX 4CPVA 1A03A 3BYAA 3LK1A 4XYNA 4HRHA 3BOWB 4N1FA 4WQ3A 1JUOA 1NX3A 1MQ1A 2I7AA 5CSIA 1IWQA 5HLVA 5JJGA 3DD4A 2KHNA 4MZJA 2CNPA 1V1GA 2LMUA 2MJWB 2KOTA 4MBEA 1RWYA 1LINA 3NXAA 4ETOA 5KU1A 2HETA 1GJYA 2NCPA 3I5HC 4N5XA 1B4CA 1BMOA 2LP2A 4A4BA 1FPWA 1M31A 3O78A 5GQQC 5AERA 2BCAA 1AK8A 1YVLA 3PSRA 1KQVA 2LMVA 2L4IA 1W7JB 4MSPA 1PK0D 2HPSA 3JTDC 2LHLA 2CBLA 1QX7A 4GGFA 3A4UB 5HLOA 3BOWA 1CMFA 3PALA 1UHNA 1H8BA 1DJGA 5PALA 2FCEA 4WQ2A 2ISDA 1RFJA 4MN0A 1QXPA 2MLEC 3CLNA 5HKWA 1NX1A 2G2BA 3TDZA 1SW8A 5DKQA 3EK8A 3OB2B 4XJKB 5I2LA 1BG1A 1HT9A 4YI9A 1ZMZA 4PALA 2FCDA 4C0LA 1TIZA 1XFWO 1M39A 3GK1A 4OVNF 2AAOA 2OTGC 1NCZA 1D1OA 2A4JA 3KO0A 1KFXS 1J7PA 1FBVA 3BQ3A 4PHKA 3TZ1A 2AUCA 3KEVA 2D8NA 1A29A 3IF7A 1DVIA 1DF0B 1ZUZA 3TS5B 1BR4B 1J7OA 1K9UA 1ZOTB 1F71A 3O6BA 1JSAA 1KFXL 5DKRA 3EKJA 4L9MA 2M0RA 4ORBB 1RK9A 3WHTB 5AEQA 2NCOA 1OMDA 1BU3A 2Y4QA 2KQ6A 4MZKA 4NDDA 1MHOA 1UURA 2LVJA 1XFYO 4YGBB 4GNKB 3CR5X 1G8IA 5CSJA 1BF5A 1Q80A 1CM4A 5F6TA 4XJKA 1YUTA 1IJ6A 3O2PA 1F4QA 3WXAA 1IG5A 3FIAA 3PM8A 5HKZA 1YX8A 2F3YA 2GV5A 3D0YA 2OS8B 1RROA 2LLSA 1A75B 3VRRA 1OE9B 1UP5A 1C7VA 2PVBA 1Y0VH 1E8AA 3SG3A 2JTZA 2PRUA 2QACA 1NCYA 4NQGA 2BE4A 1UHJA 1KK8C 1TRFA 2K7DA 3ICBA 4OV2A 1KQMB 1CDNA 1XYDA 2OTGB 1NX0A 2KAYA 1J55A 4GPLB 1ZFSA 3PN7C 3VGOA 3CS1A 1OSAA 1A2XA 3RLZA 1DF0A 1WDCB 4M2PA 1C7WA 2H2KA 2F8PA 4F0ZB 2M7NA 2HF5A 4N1GA 1B1GA 1MXLC 4I5LB 4NDCA 1TCOB 1F4OA 5HYDA 1EG4A 1F54A 2LANA 1G4YR 1M63B 4GGNA 1VRKA 5I2QA 5IBWA 3D10A 1TNQA 1OZSA 5ER5A 1SCMC 1EL4A 3CR2A 1PALA 4Q04A 1B9AA 1KFUL 1MR8A 1EG3A 2K8MB 2I18A 5ER4X 4M2QA 1SCVA 1BLQA 4CLNA 5D7FA 3CZTX 1CLLA 1JFJA 1DJIA 1A75A 1NPQA 1SL7A 3I5FC 4D1EA 1CFDA 5D69A 5CSNA 3NSLA 2Q4UA 4CFRA 2JU0A 3K21A 1U5IB 1YUSA 2BE6A 2JXLA 4OR9B 2M49B 2MAZA 3EVUA 4DS7A 1S5GY 1QX2A 1IQ5A 2F3ZA 1S5GZ 5I2OA 4WRIA 2KGRA 1AHRA 4A4CA 1KWOC 3SG5A 3SIAA 1JF2A 3HCMA 4YGCB 4C0JA 3CR4X 1ODBA 1CDLA 1CM1A 2G9BA 1FI6A 2ZRTA 3OHMB 1XFUO 2BKHB 2CTNA 2KBIA 2KI4C 5KTYA 2PMYA 1OMRA 2PASA 1SKTA 2MRDA 2ZFDA 1WLMA 1GGZA 2BBMA 3MSEB 1LA3A 1YTZC 2CT9A 2WCFA 3H4SE 2ZN9A 1KSOA 2KFGA 1WRLA 3KPXA 1QATA 2F2OA 2MHHA 1PULA 3EK7A 1LXFC 5G08A 5CPVA 1OZOA 1NUBA 3BUMB 1YRTB 1QJTA 2KNEA 1U5IA 3CGAA 3EVVA 3O4YA 1J7QA 1BJFA 1EH2A 2SCPA 4QJ4B 1IQ3A 2K7OA 2JNXA 2JPTA 1CFPA 1S3PA 4HRGA 1F8HA 1X02A 2LCPA 2WOSA 4MZLA 3F45A 2JOJA 1XFVO 3D0YB 3FS7A 1F70A 4GUKA 1CTRA 1K96A 2L4HA 1SMGA 3EVRA 1WRKA 3PATA 3QRXA 2JT8A 4OCIA 2M1KB 1J1DA 2LVIA 4JPZB 3GK2A 2L2EA 3I5HB 1ZACA 1J7RA 2BKIB 2BL0C 4HREE 2KFFA 1XFZO 2LHIA 4MRXA 2JWWA 1AP4A 4ORCB 2EC6C 4I5JA 2LUXA 1S6IA 1OMVA 2LM5A 1SYMA 1BOCA 4IL1A 1K9KA 2JULA 5CSFA 5BPJA 1NCXA 1Y1UA 4FQOA 1QIVA 2JT3A 4PHNA 1JWDA 3LCPC 5FYXA 2M97A 3JTDB 2K7CA 1CLBA 1XK4C 2WCEA 1DMOA 2K7BA 2LVKA 1SL9A 2BBNA 3VRPA 2KQYA 1QVIY 2V53A 2JTTA 3I5IC 2FOTA 2O5GA 1SL8A 1QVIZ 2NLNA 2HQ8A 2EGDA 2PSRA 4PE0A 4GBAA 1TTXA 1K8UA 2LLUA 2NXQA 4YI8A 3JVTC 1G33A 1BR1B 2KGBC 4ZCUA 2EHBA 2LAPA 1UHHA 3VROA 2BCBA 1M45A 1LKJA 1PRWA 1QS7A 2K2FA 1MWNA 2HQWA 1S6CA 2M3WA 3ZWHA
chains in the Genus database with same CATH superfamily
1DJWA 1NWDA 1IIOA 4YGAA 3OBVA 1WLZA 1AVSA 1QASA 1QTXA 1TWOA 2M9GA 2KBMA 1CMGA 1CNPA 2EC6B 2WCMA 2I94A 1DGVA 1XFRA 1TUZA 2K0JA 3NSOA 1TNWA 4GGFC 4I5NB 3VRNA 1YX7A 2I2RE 3BJHA 3I5GC 3S0DA 3GOFA 1SNLA 1K9PA 3L4LA 3PLFB 3TUYC 5AANA 1K2HA 3SG6A 1TNXA 1W7IB 1Y6WA 2NZ0A 1RECA 5D3OA 2FJUB 2K2AA 2LNKA 5FI2A 3K1EA 4QJ3B 3WNXB 2WCBA 4IJ7A 1J1EA 3DVJA 1DQEA 1JBAA 2CCMA 1UHKA 3D76A 1R6PA 1QLKA 1S1EA 2WCHA 3KF9A 1B47A 1K95A 2KAVA 2L2CA 2R2IA 3DF0B 2VRGA 2KAXA 2M7LA 1CFFA 3S0EA 1N65A 3BFHA 1PVBA 3CWGA 2L50A 1IGVA 4MRYA 5DKNA 4AQJA 1PVAA 1JC2A 2MA2A 2RGIA 5HL1A 4BY5A 2LC5A 5J3XA 1NIWA 3SIBA 4YGEB 1KK8B 1S36A 1XO5A 1MXEA 2KYCA 1OOJA 3B6XA 4OKHA 2KI6C 1BODA 1CKKA 1B7TY 4MEWA 3AAJA 3PN7B 1B7TZ 1V1FA 1RJVA 1EXRA 1Y1AA 1SBJA 3EK4A 3HX4A 2LUCA 3ZNIA 2BCXA 3C1VA 1PSBA 3DVMA 1XK4A 3TUYB 3I5GB 1R2UA 1FF1A 2LLTA 2YGUA 1IJ5A 3OB1B 4PHMA 1L2OC 1GGWA 1QV1A 3VRQA 1CLMA 5K89A 1SCMB 3R1VA 1NSHA 1S26D 5I8NA 2L5YA 4GFTA 3DF0A 1NP8A 2KDHA 4JD9A 3VB1A 1KCYA 3TDUA 4DCKA 1H4BA 3IQOA 1A4PA 2ZNDA 4M2OA 3BFBA 1PSRA 1XA5A 3CTNA 1LVCD 3I5FB 1OQPA 1XVJA 3BUOB 1HQVA 1SR6C 3DVEA 4PE1A 1QLSA 1YUUA 3D77A 1YVHA 1DGUA 1QX5B 1AUIB 5FI6A 2JRFA 3BXKA 1OOHA 2JZIA 2M29A 2KFHA 1SSEB 1TCFA 2H61C 2ZNEA 4MVFA 1LA0A 3NSKA 1AJ4A 1TOPA 3TS5C 1TN4A 1KSMA 1SPYA 1KWOB 2P6BB 3OP0A 3SG7A 1TUJA 2DOQA 2KI6D 2AMIA 2E30A 4JQ0D 4U8DA 1CDMA 1UHIA 4YBHB 2JNFA 2TN4A 4KYNA 4HSZA 1DTLA 3RM1A 1UUSA 1YRUB 2JQ6A 2B1UA 2WC6A 4CFQA 1WY9A 2KI4B 4ZCVA 1ALVA 1L2OB 3NSIA 3FWCA 4AQIA 1GQMA 2JT0A 2SASA 4GAOA 2WORA 4MLWA 4ORAB 4OZDA 2OS8C 3SS5A 1UWOA 5JOLA 1B8LA 3BUWB 3DZTA 3IVTA 1N0YA 1N2DA 3AAKA 1QWVA 1DJXA 3CZ0A 1Z2CB 2LP3A 4BY4A 2GGZA 2F33A 1Z4HA 4YGDB 3SG4A 1KQMC 2QPTA 1SR6B 1JFKA 3D75A 2WC8A 1MUXA 4UPGA 5AFPA 3LLEA 2KPHA 1BT6A 4DRWA 4QJ5B 3WHUB 2PALA 3TDIA 1CDPA 1NX2A 1WDCC 4TNCA 2KLEA 3CDNA 2OPOA 3BUNB 4INXA 1AJ5A 1B8CA 3M0WA 4FTGA 1K90D 4PE7A 1ALWA 2M8UA 1DJZA 2Y5IA 2ERBA 1RTP1 2KYFA 1OW4A 4PE4A 2BECA 1K93D 4USLA 2MLFC 3E3RA 5B8IB 2LMTA 1EJ3A 1QIWA 3O4XA 1NYAA 1WRZA 2FJYA 2BL0B 2PYQA 4NDBA 1XFXO 3SJSA 3PFVA 2L0PA 1CB1A 3AKAA 2WCLA 3B86A 2CXJA 4PCWA 3KHEA 1L7ZA 4R1EA 2L51A 4DIRA 4YRUA 3AKBA 5AXIA 2KSPA 2WCKA 2LE9B 3BUXB 4CIDA 3SG2A 4DUQA 2JXCA 2GTEA 2L5XB 1IH0A 3IQQA 1CFCA 2O60A 1MF8B 1SRAA 4F7FA 1C07A 1F55A 2MBXA 1YR5A 3CZ2A 3UO9A 3R72A 4E68A 1M46A 2WNDA 1S6JA 3I5IB 3GK4X 4PDZA 3RZSA 2L98A 2F2PA 1DJHA 2H61A 2GGMA 4P5OE 2E6WA 1YURA 5HKYA 1IRJA 3JVTB 1KFUS 2Q91A 1JF0A 3A8RA 2Y1NA 1FW4A 2LV7A 4P2YB 2IS9A 2COLB 3FWBA 3EKHA 1DJYA 1DT7B 3CABA 1FI5A 4JWQA 2LVVA 1SY9A 3OX6A 2K61A 1KK7Y 1TNPA 1B8RA 2JC2A 3OX5A 1KK7Z 4AOMA 3LL8B 1QV0A 4I5KA 2M1UA 2ZN8A 2ZRSA 1Y1XA 3DVKA 4C0KA 2JPOA 4PHJA 5FI7A 4ICBA 5TNCA 1K94A 3LK0A 3V2LA 1SK6D 1IKUA 2Y1MA 2ZKMX 4CPVA 1A03A 3BYAA 3LK1A 4XYNA 4HRHA 1P28A 3BOWB 4N1FA 4WQ3A 1JUOA 1NX3A 4INWA 1MQ1A 2I7AA 5CSIA 1IWQA 3B87A 5HLVA 5JJGA 3DD4A 2KHNA 4MZJA 3NHIA 2CNPA 2QEOA 1V1GA 2LMUA 2MJWB 3D78A 2KOTA 4MBEA 2KLDA 1RWYA 1LINA 3NXAA 4ETOA 5KU1A 2HETA 3EG5B 3B7AA 1GJYA 3S0BA 2NCPA 3I5HC 4N5XA 1B4CA 1BMOA 2LP2A 4A4BA 1FPWA 1M31A 3O78A 5GQQC 5AERA 2BCAA 1AK8A 1YVLA 3PSRA 1KQVA 2LMVA 2L4IA 1W7JB 4MSPA 1PK0D 2HPSA 3JTDC 3DY9A 2LHLA 2CBLA 1QX7A 4GGFA 4JKTA 3A4UB 5HLOA 3BOWA 1CMFA 3SS3A 3PALA 1UHNA 3SS4A 1H8BA 1DJGA 5PALA 2FCEA 4WQ2A 2ISDA 5KSZA 1RFJA 4MN0A 1QXPA 2MLEC 3CLNA 5HKWA 1NX1A 2G2BA 3TDZA 3S0FA 1SW8A 5DKQA 3EK8A 3OB2B 4XJKB 5I2LA 1DC1A 1BG1A 2P71A 1HT9A 4YI9A 1ZMZA 4PALA 2FCDA 4C0LA 1TIZA 1XFWO 1M39A 3GK1A 4OVNF 2AAOA 2OTGC 1DELA 1NCZA 3CZ1A 1D1OA 2A4JA 3KO0A 1KFXS 1J7PA 1FBVA 3BQ3A 5DICA 4PHKA 3TZ1A 2AUCA 3KEVA 2D8NA 1A29A 3IF7A 1DVIA 1DF0B 1ZUZA 3TS5B 1BR4B 1J7OA 1K9UA 1ZOTB 1LS8A 3O6BA 1F71A 1JSAA 1KFXL 5DKRA 3EKJA 4L9MA 2M0RA 4ORBB 1RK9A 3WHTB 5AEQA 2NCOA 1OMDA 1BU3A 2Y4QA 2KQ6A 4MZKA 4NDDA 1MHOA 1UURA 2LVJA 1XFYO 4YGBB 4GNKB 3CR5X 1G8IA 2H8VA 3FE9A 5CSJA 1BF5A 5EL2A 1Q80A 1CM4A 5F6TA 4XJKA 1YUTA 1IJ6A 3O2PA 1F4QA 3WXAA 1IG5A 3FIAA 3PM8A 1C3YA 5HKZA 1YX8A 2F3YA 2GV5A 3D0YA 2OS8B 1RROA 2LLSA 2P70A 1A75B 2PQLA 3VRRA 1OE9B 1UP5A 1C7VA 2PVBA 1Y0VH 1E8AA 3SG3A 2JTZA 2PRUA 2QACA 1NCYA 4NQGA 2BE4A 1UHJA 1KK8C 1TRFA 2K7DA 3ICBA 4OV2A 1KQMB 1CDNA 1XYDA 2OTGB 1NX0A 2KAYA 1J55A 4GPLB 1ZFSA 3L4AA 3PN7C 3VGOA 2WC5A 3B88A 3CS1A 1OSAA 1A2XA 3RLZA 1DF0A 1WDCB 4M2PA 3Q8IA 1DEKA 1C7WA 2H2KA 2F8PA 4F0ZB 2M7NA 2HF5A 3DYEA 4N1GA 1B1GA 1MXLC 4I5LB 4NDCA 1TCOB 1F4OA 5HYDA 1EG4A 1F54A 2LANA 1G4YR 1M63B 4GGNA 1VRKA 5I2QA 5IBWA 1C3ZA 3D10A 1TNQA 1OZSA 4PT1A 5ER5A 1SCMC 1EL4A 3CR2A 1PALA 4Q04A 1B9AA 1KFUL 1MR8A 3OGNA 3NHTA 1EG3A 2K8MB 2I18A 5ER4X 4M2QA 1SCVA 1BLQA 4CLNA 5D7FA 3CZTX 1CLLA 1JFJA 1DJIA 1A75A 1NPQA 1SL7A 3I5FC 4D1EA 3CYZA 4FQTA 1CFDA 5D69A 5CSNA 3NSLA 2Q4UA 4CFRA 2JU0A 3K21A 1U5IB 1W9ZA 1YUSA 2BE6A 2JXLA 2M49B 2MAZA 3EVUA 4OR9B 4DS7A 1S5GY 2BAPA 1QX2A 1IQ5A 2F3ZA 1S5GZ 5I2OA 4WRIA 2KGRA 1AHRA 3FE8A 1OOIX 4A4CA 1KWOC 3SG5A 3SIAA 1JF2A 3HCMA 4YGCB 4C0JA 3CR4X 1ODBA 1CDLA 1CM1A 2G9BA 1FI6A 2ZRTA 3OHMB 1XFUO 2BKHB 2CTNA 2KBIA 2KI4C 5KTYA 2PMYA 1OMRA 2PASA 1SKTA 2MRDA 2ZFDA 1WLMA 1GGZA 2BBMA 3MSEB 1ORGA 1LA3A 1YTZC 2CT9A 2WCFA 3H4SE 3PJIA 2ZN9A 3R1OA 1OOFA 2QEHA 1KSOA 2KFGA 3N7HA 1WRLA 3KPXA 1QATA 2F2OA 5I94A 2MHHA 1PULA 2BNXA 3EK7A 3D74A 1LXFC 5G08A 5CPVA 1OZOA 1NUBA 3BUMB 3PM2A 1YRTB 1QJTA 2KNEA 1U5IA 3CGAA 3EVVA 3O4YA 3S0AA 1J7QA 1BJFA 1EH2A 1GM0A 2SCPA 3UNWA 4QJ4B 1IQ3A 2K7OA 2JNXA 2JPTA 1CFPA 1S3PA 4HRGA 1F8HA 2QDIA 1X02A 2LCPA 2WOSA 4MZLA 3F45A 2JOJA 1XFVO 3D0YB 3FS7A 1F70A 4GUKA 1CTRA 1K96A 2L4HA 1SMGA 3EVRA 1WRKA 3PATA 3QRXA 2JT8A 4OCIA 2M1KB 3S0GA 1J1DA 2LVIA 4JPZB 2QEVA 3GK2A 2L2EA 3I5HB 1ZACA 1J7RA 2BKIB 2BL0C 4HREE 2KFFA 1XFZO 2LHIA 4MRXA 2JWWA 1AP4A 4ORCB 3D73A 2QEBA 2EC6C 4I5JA 2LUXA 1S6IA 1OMVA 2LM5A 1SYMA 1BOCA 4IL1A 1K9KA 2JULA 5CSFA 3NGVA 1NCXA 1Y1UA 4FQOA 1QIVA 2JT3A 4PHNA 5BPJA 3LCPC 5FYXA 2M97A 3JTDB 2K7CA 1JWDA 1CLBA 1XK4C 2WCEA 1T14A 3L47A 1DMOA 2K7BA 2LVKA 1SL9A 2BBNA 3VRPA 2KQYA 1QVIY 2V53A 2JTTA 3I5IC 2FOTA 2O5GA 1SL8A 1QVIZ 2NLNA 1OOGA 2HQ8A 2EGDA 2PSRA 4PE0A 2K60A 4GBAA 1TTXA 1K8UA 2LLUA 2NXQA 4YI8A 3JVTC 1G33A 1BR1B 2KGBC 3BFAA 3QMEA 4ZCUA 2EHBA 2LAPA 1UHHA 3VROA 2BCBA 1M45A 1LKJA 1PRWA 1QS7A 2K2FA 1MWNA 2HQWA 3DXLA 3R1PA 1S6CA 2M3WA 3FE6A 2WCJA 3ZWHA
chains in the Genus database with same CATH topology
1DJWA 1NWDA 4YGAA 1WLZA 1AVSA 1QASA 1QTXA 2M9GA 2KBMA 1CMGA 1CNPA 2EC6B 2I94A 1DGVA 2K0JA 3NSOA 1TNWA 4GGFC 4I5NB 3VRNA 1YX7A 2I2RE 3TUYC 3I5GC 3GOFA 1SNLA 1K9PA 3PLFB 5AANA 1K2HA 3SG6A 1TNXA 1W7IB 1Y6WA 2NZ0A 1RECA 5KSZA 2FJUB 2K2AA 2LNKA 3WNXB 4QJ3B 2WCBA 1J1EA 3DVJA 1JBAA 2CCMA 1UHKA 1R6PA 1QLKA 1S1EA 3KF9A 1B47A 1K95A 2KAVA 2R2IA 3DF0B 2VRGA 2KAXA 2M7LA 1CFFA 1N65A 1PVBA 3CWGA 2L50A 1IGVA 4MRYA 5DKNA 4AQJA 1PVAA 1JC2A 2MA2A 2RGIA 4BY5A 2LC5A 5J3XA 1NIWA 3SIBA 4YGEB 1KK8B 1S36A 1XO5A 1MXEA 2KYCA 1OOJA 4OKHA 1BODA 2KI6C 1CKKA 1B7TY 4MEWA 3AAJA 3PN7B 1B7TZ 1V1FA 1RJVA 1EXRA 1Y1AA 1SBJA 3EK4A 3HX4A 2LUCA 3ZNIA 2BCXA 3C1VA 1PSBA 3DVMA 1XK4A 3TUYB 3I5GB 1R2UA 1FF1A 2LLTA 1IJ5A 3OB1B 4PHMA 1L2OC 1GGWA 1QV1A 3VRQA 1CLMA 5K89A 1SCMB 1NSHA 1S26D 5I8NA 4GFTA 3DF0A 1NP8A 2KDHA 1KCYA 3TDUA 4DCKA 1H4BA 3IQOA 1A4PA 2ZNDA 4M2OA 1PSRA 1XA5A 3CTNA 1LVCD 3I5FB 1OQPA 1XVJA 3BUOB 1HQVA 1SR6C 3DVEA 4PE1A 1QLSA 1YUUA 1YVHA 1DGUA 1QX5B 1AUIB 2JRFA 3BXKA 2JZIA 2M29A 2KFHA 1TCFA 2H61C 2ZNEA 4MVFA 1LA0A 3NSKA 1AJ4A 1TOPA 3TS5C 1TN4A 1KSMA 1SPYA 1KWOB 2P6BB 3OP0A 3SG7A 2DOQA 2KI6D 2AMIA 2E30A 4JQ0D 4U8DA 1CDMA 1UHIA 4YBHB 2JNFA 2TN4A 4HSZA 1DTLA 3RM1A 1UUSA 1YRUB 2JQ6A 2B1UA 4CFQA 1WY9A 2KI4B 4ZCVA 1ALVA 1L2OB 3NSIA 3FWCA 4AQIA 1GQMA 2JT0A 2SASA 4GAOA 2WORA 4MLWA 4ORAB 2OS8C 1UWOA 5JOLA 1B8LA 3BUWB 1N0YA 1N2DA 3AAKA 1DJXA 2LP3A 4BY4A 2GGZA 2F33A 4YGDB 3SG4A 1KQMC 2QPTA 1SR6B 1JFKA 2WC8A 1MUXA 4UPGA 5AFPA 3LLEA 1BT6A 4DRWA 4QJ5B 3WHUB 2PALA 3TDIA 1CDPA 1NX2A 1WDCC 4TNCA 2OPOA 3BUNB 1AJ5A 1B8CA 3M0WA 4FTGA 1K90D 4PE7A 1ALWA 2M8UA 1DJZA 2Y5IA 1RTP1 2KYFA 4PE4A 2BECA 1K93D 4USLA 2MLFC 3E3RA 5B8IB 2LMTA 1EJ3A 1QIWA 1NYAA 1WRZA 2BL0B 4NDBA 1XFXO 3SJSA 3PFVA 2L0PA 1CB1A 3AKAA 2CXJA 4PCWA 3KHEA 1L7ZA 4R1EA 2L51A 4DIRA 4YRUA 3AKBA 5AXIA 2KSPA 2LE9B 3BUXB 4CIDA 3SG2A 4DUQA 2JXCA 2L5XB 1IH0A 3IQQA 1CFCA 2O60A 1MF8B 1SRAA 1C07A 1F55A 2MBXA 1YR5A 4E68A 1M46A 2WNDA 1S6JA 3I5IB 3GK4X 4PDZA 2L98A 2F2PA 1DJHA 2H61A 2GGMA 4P5OE 2E6WA 1YURA 5HKYA 1IRJA 3JVTB 1KFUS 2Q91A 1JF0A 3A8RA 2Y1NA 1FW4A 2LV7A 4P2YB 2IS9A 2COLB 3FWBA 3EKHA 1DJYA 1DT7B 1FI5A 4JWQA 2LVVA 1SY9A 3OX6A 2K61A 1KK7Y 1TNPA 1B8RA 2JC2A 3OX5A 1KK7Z 4AOMA 3LL8B 1QV0A 4I5KA 2M1UA 2ZN8A 2ZRSA 1Y1XA 3DVKA 4C0KA 4PHJA 5TNCA 4ICBA 1K94A 3LK0A 1SK6D 1IKUA 2Y1MA 2ZKMX 4CPVA 1A03A 3BYAA 3LK1A 4XYNA 4HRHA 3BOWB 4N1FA 4WQ3A 1JUOA 1NX3A 1MQ1A 2I7AA 5CSIA 1IWQA 5HLVA 5JJGA 3DD4A 2KHNA 4MZJA 2CNPA 1V1GA 2LMUA 2MJWB 2KOTA 4MBEA 1RWYA 1LINA 3NXAA 4ETOA 5KU1A 2HETA 1GJYA 2NCPA 3I5HC 4N5XA 1B4CA 1BMOA 2LP2A 4A4BA 1FPWA 1M31A 3O78A 5GQQC 5AERA 2BCAA 1AK8A 1YVLA 3PSRA 1KQVA 2LMVA 2L4IA 1W7JB 4MSPA 1PK0D 2HPSA 3JTDC 2LHLA 2CBLA 1QX7A 4GGFA 3A4UB 5HLOA 3BOWA 1CMFA 3PALA 1UHNA 1H8BA 1DJGA 5PALA 2FCEA 4WQ2A 2ISDA 1RFJA 4MN0A 1QXPA 2MLEC 3CLNA 5HKWA 1NX1A 2G2BA 3TDZA 1SW8A 5DKQA 3EK8A 3OB2B 4XJKB 5I2LA 1BG1A 1HT9A 4YI9A 1ZMZA 4PALA 2FCDA 4C0LA 1TIZA 1XFWO 1M39A 3GK1A 4OVNF 2AAOA 2OTGC 1NCZA 1D1OA 2A4JA 3KO0A 1KFXS 1J7PA 1FBVA 3BQ3A 4PHKA 3TZ1A 2AUCA 3KEVA 2D8NA 1A29A 3IF7A 1DVIA 1DF0B 1ZUZA 3TS5B 1BR4B 1J7OA 1K9UA 1ZOTB 1F71A 3O6BA 1JSAA 1KFXL 5DKRA 3EKJA 4L9MA 2M0RA 4ORBB 1RK9A 3WHTB 5AEQA 2NCOA 1OMDA 1BU3A 2Y4QA 2KQ6A 4MZKA 4NDDA 1MHOA 1UURA 2LVJA 1XFYO 4YGBB 4GNKB 3CR5X 1G8IA 5CSJA 1BF5A 1Q80A 1CM4A 5F6TA 4XJKA 1YUTA 1IJ6A 3O2PA 1F4QA 3WXAA 1IG5A 3FIAA 3PM8A 5HKZA 1YX8A 2F3YA 2GV5A 3D0YA 2OS8B 1RROA 2LLSA 1A75B 3VRRA 1OE9B 1UP5A 1C7VA 2PVBA 1Y0VH 1E8AA 3SG3A 2JTZA 2PRUA 2QACA 1NCYA 4NQGA 2BE4A 1UHJA 1KK8C 1TRFA 2K7DA 3ICBA 4OV2A 1KQMB 1CDNA 1XYDA 2OTGB 1NX0A 2KAYA 1J55A 4GPLB 1ZFSA 3PN7C 3VGOA 3CS1A 1OSAA 1A2XA 3RLZA 1DF0A 1WDCB 4M2PA 1C7WA 2H2KA 2F8PA 4F0ZB 2M7NA 2HF5A 4N1GA 1B1GA 1MXLC 4I5LB 4NDCA 1TCOB 1F4OA 5HYDA 1EG4A 1F54A 2LANA 1G4YR 1M63B 4GGNA 1VRKA 5I2QA 5IBWA 3D10A 1TNQA 1OZSA 5ER5A 1SCMC 1EL4A 3CR2A 1PALA 4Q04A 1B9AA 1KFUL 1MR8A 1EG3A 2K8MB 2I18A 5ER4X 4M2QA 1SCVA 1BLQA 4CLNA 5D7FA 3CZTX 1CLLA 1JFJA 1DJIA 1A75A 1NPQA 1SL7A 3I5FC 4D1EA 1CFDA 5D69A 5CSNA 3NSLA 2Q4UA 4CFRA 2JU0A 3K21A 1U5IB 1YUSA 2BE6A 2JXLA 4OR9B 2M49B 2MAZA 3EVUA 4DS7A 1S5GY 1QX2A 1IQ5A 2F3ZA 1S5GZ 5I2OA 4WRIA 2KGRA 1AHRA 4A4CA 1KWOC 3SG5A 3SIAA 1JF2A 3HCMA 4YGCB 4C0JA 3CR4X 1ODBA 1CDLA 1CM1A 2G9BA 1FI6A 2ZRTA 3OHMB 1XFUO 2BKHB 2CTNA 2KBIA 2KI4C 5KTYA 2PMYA 1OMRA 2PASA 1SKTA 2MRDA 2ZFDA 1WLMA 1GGZA 2BBMA 3MSEB 1LA3A 1YTZC 2CT9A 2WCFA 3H4SE 2ZN9A 1KSOA 2KFGA 1WRLA 3KPXA 1QATA 2F2OA 2MHHA 1PULA 3EK7A 1LXFC 5G08A 5CPVA 1OZOA 1NUBA 3BUMB 1YRTB 1QJTA 2KNEA 1U5IA 3CGAA 3EVVA 3O4YA 1J7QA 1BJFA 1EH2A 2SCPA 4QJ4B 1IQ3A 2K7OA 2JNXA 2JPTA 1CFPA 1S3PA 4HRGA 1F8HA 1X02A 2LCPA 2WOSA 4MZLA 3F45A 2JOJA 1XFVO 3D0YB 3FS7A 1F70A 4GUKA 1CTRA 1K96A 2L4HA 1SMGA 3EVRA 1WRKA 3PATA 3QRXA 2JT8A 4OCIA 2M1KB 1J1DA 2LVIA 4JPZB 3GK2A 2L2EA 3I5HB 1ZACA 1J7RA 2BKIB 2BL0C 4HREE 2KFFA 1XFZO 2LHIA 4MRXA 2JWWA 1AP4A 4ORCB 2EC6C 4I5JA 2LUXA 1S6IA 1OMVA 2LM5A 1SYMA 1BOCA 4IL1A 1K9KA 2JULA 5CSFA 5BPJA 1NCXA 1Y1UA 4FQOA 1QIVA 2JT3A 4PHNA 1JWDA 3LCPC 5FYXA 2M97A 3JTDB 2K7CA 1CLBA 1XK4C 2WCEA 1DMOA 2K7BA 2LVKA 1SL9A 2BBNA 3VRPA 2KQYA 1QVIY 2V53A 2JTTA 3I5IC 2FOTA 2O5GA 1SL8A 1QVIZ 2NLNA 2HQ8A 2EGDA 2PSRA 4PE0A 4GBAA 1TTXA 1K8UA 2LLUA 2NXQA 4YI8A 3JVTC 1G33A 1BR1B 2KGBC 4ZCUA 2EHBA 2LAPA 1UHHA 3VROA 2BCBA 1M45A 1LKJA 1PRWA 1QS7A 2K2FA 1MWNA 2HQWA 1S6CA 2M3WA 3ZWHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DJW A;  1NWD A;  4YGA A;  1WLZ A;  1AVS A;  1QAS A;  1QTX A;  2M9G A;  2KBM A;  1CMG A;  1CNP A;  2EC6 B;  2I94 A;  1DGV A;  2K0J A;  3NSO A;  1TNW A;  4GGF C;  4I5N B;  3VRN A;  1YX7 A;  2I2R E;  3TUY C;  3I5G C;  3GOF A;  1SNL A;  1K9P A;  3PLF B;  5AAN A;  1K2H A;  3SG6 A;  1TNX A;  1W7I B;  1Y6W A;  2NZ0 A;  1REC A;  5KSZ A;  2FJU B;  2K2A A;  2LNK A;  3WNX B;  4QJ3 B;  2WCB A;  1J1E A;  3DVJ A;  1JBA A;  2CCM A;  1UHK A;  1R6P A;  1QLK A;  1S1E A;  3KF9 A;  1B47 A;  1K95 A;  2KAV A;  2R2I A;  3DF0 B;  2VRG A;  2KAX A;  2M7L A;  1CFF A;  1N65 A;  1PVB A;  3CWG A;  2L50 A;  1IGV A;  4MRY A;  5DKN A;  4AQJ A;  1PVA A;  1JC2 A;  2MA2 A;  2RGI A;  4BY5 A;  2LC5 A;  5J3X A;  1NIW A;  3SIB A;  4YGE B;  1KK8 B;  1S36 A;  1XO5 A;  1MXE A;  2KYC A;  1OOJ A;  4OKH A;  1BOD A;  2KI6 C;  1CKK A;  1B7T Y;  4MEW A;  3AAJ A;  3PN7 B;  1B7T Z;  1V1F A;  1RJV A;  1EXR A;  1Y1A A;  1SBJ A;  3EK4 A;  3HX4 A;  2LUC A;  3ZNI A;  2BCX A;  3C1V A;  1PSB A;  3DVM A;  1XK4 A;  3TUY B;  3I5G B;  1R2U A;  1FF1 A;  2LLT A;  1IJ5 A;  3OB1 B;  4PHM A;  1L2O C;  1GGW A;  1QV1 A;  3VRQ A;  1CLM A;  5K89 A;  1SCM B;  1NSH A;  1S26 D;  5I8N A;  4GFT A;  3DF0 A;  1NP8 A;  2KDH A;  1KCY A;  3TDU A;  4DCK A;  1H4B A;  3IQO A;  1A4P A;  2ZND A;  4M2O A;  1PSR A;  1XA5 A;  3CTN A;  1LVC D;  3I5F B;  1OQP A;  1XVJ A;  3BUO B;  1HQV A;  1SR6 C;  3DVE A;  4PE1 A;  1QLS A;  1YUU A;  1YVH A;  1DGU A;  1QX5 B;  1AUI B;  2JRF A;  3BXK A;  2JZI A;  2M29 A;  2KFH A;  1TCF A;  2H61 C;  2ZNE A;  4MVF A;  1LA0 A;  3NSK A;  1AJ4 A;  1TOP A;  3TS5 C;  1TN4 A;  1KSM A;  1SPY A;  1KWO B;  2P6B B;  3OP0 A;  3SG7 A;  2DOQ A;  2KI6 D;  2AMI A;  2E30 A;  4JQ0 D;  4U8D A;  1CDM A;  1UHI A;  4YBH B;  2JNF A;  2TN4 A;  4HSZ A;  1DTL A;  3RM1 A;  1UUS A;  1YRU B;  2JQ6 A;  2B1U A;  4CFQ A;  1WY9 A;  2KI4 B;  4ZCV A;  1ALV A;  1L2O B;  3NSI A;  3FWC A;  4AQI A;  1GQM A;  2JT0 A;  2SAS A;  4GAO A;  2WOR A;  4MLW A;  4ORA B;  2OS8 C;  1UWO A;  5JOL A;  1B8L A;  3BUW B;  1N0Y A;  1N2D A;  3AAK A;  1DJX A;  2LP3 A;  4BY4 A;  2GGZ A;  2F33 A;  4YGD B;  3SG4 A;  1KQM C;  2QPT A;  1SR6 B;  1JFK A;  2WC8 A;  1MUX A;  4UPG A;  5AFP A;  3LLE A;  1BT6 A;  4DRW A;  4QJ5 B;  3WHU B;  2PAL A;  3TDI A;  1CDP A;  1NX2 A;  1WDC C;  4TNC A;  2OPO A;  3BUN B;  1AJ5 A;  1B8C A;  3M0W A;  4FTG A;  1K90 D;  4PE7 A;  1ALW A;  2M8U A;  1DJZ A;  2Y5I A;  1RTP 1;  2KYF A;  4PE4 A;  2BEC A;  1K93 D;  4USL A;  2MLF C;  3E3R A;  5B8I B;  2LMT A;  1EJ3 A;  1QIW A;  1NYA A;  1WRZ A;  2BL0 B;  4NDB A;  1XFX O;  3SJS A;  3PFV A;  2L0P A;  1CB1 A;  3AKA A;  2CXJ A;  4PCW A;  3KHE A;  1L7Z A;  4R1E A;  2L51 A;  4DIR A;  4YRU A;  3AKB A;  5AXI A;  2KSP A;  2LE9 B;  3BUX B;  4CID A;  3SG2 A;  4DUQ A;  2JXC A;  2L5X B;  1IH0 A;  3IQQ A;  1CFC A;  2O60 A;  1MF8 B;  1SRA A;  1C07 A;  1F55 A;  2MBX A;  1YR5 A;  4E68 A;  1M46 A;  2WND A;  1S6J A;  3I5I B;  3GK4 X;  4PDZ A;  2L98 A;  2F2P A;  1DJH A;  2H61 A;  2GGM A;  4P5O E;  2E6W A;  1YUR A;  5HKY A;  1IRJ A;  3JVT B;  1KFU S;  2Q91 A;  1JF0 A;  3A8R A;  2Y1N A;  1FW4 A;  2LV7 A;  4P2Y B;  2IS9 A;  2COL B;  3FWB A;  3EKH A;  1DJY A;  1DT7 B;  1FI5 A;  4JWQ A;  2LVV A;  1SY9 A;  3OX6 A;  2K61 A;  1KK7 Y;  1TNP A;  1B8R A;  2JC2 A;  3OX5 A;  1KK7 Z;  4AOM A;  3LL8 B;  1QV0 A;  4I5K A;  2M1U A;  2ZN8 A;  2ZRS A;  1Y1X A;  3DVK A;  4C0K A;  4PHJ A;  5TNC A;  4ICB A;  1K94 A;  3LK0 A;  1SK6 D;  1IKU A;  2Y1M A;  2ZKM X;  4CPV A;  1A03 A;  3BYA A;  3LK1 A;  4XYN A;  4HRH A;  3BOW B;  4N1F A;  4WQ3 A;  1JUO A;  1NX3 A;  1MQ1 A;  2I7A A;  5CSI A;  1IWQ A;  5HLV A;  5JJG A;  3DD4 A;  2KHN A;  4MZJ A;  2CNP A;  1V1G A;  2LMU A;  2MJW B;  2KOT A;  4MBE A;  1RWY A;  1LIN A;  3NXA A;  4ETO A;  5KU1 A;  2HET A;  1GJY A;  2NCP A;  3I5H C;  4N5X A;  1B4C A;  1BMO A;  2LP2 A;  4A4B A;  1FPW A;  1M31 A;  3O78 A;  5GQQ C;  5AER A;  2BCA A;  1AK8 A;  1YVL A;  3PSR A;  1KQV A;  2LMV A;  2L4I A;  1W7J B;  4MSP A;  1PK0 D;  2HPS A;  3JTD C;  2LHL A;  2CBL A;  1QX7 A;  4GGF A;  3A4U B;  5HLO A;  3BOW A;  1CMF A;  3PAL A;  1UHN A;  1H8B A;  1DJG A;  5PAL A;  2FCE A;  4WQ2 A;  2ISD A;  1RFJ A;  4MN0 A;  1QXP A;  2MLE C;  3CLN A;  5HKW A;  1NX1 A;  2G2B A;  3TDZ A;  1SW8 A;  5DKQ A;  3EK8 A;  3OB2 B;  4XJK B;  5I2L A;  1BG1 A;  1HT9 A;  4YI9 A;  1ZMZ A;  4PAL A;  2FCD A;  4C0L A;  1TIZ A;  1XFW O;  1M39 A;  3GK1 A;  4OVN F;  2AAO A;  2OTG C;  1NCZ A;  1D1O A;  2A4J A;  3KO0 A;  1KFX S;  1J7P A;  1FBV A;  3BQ3 A;  4PHK A;  3TZ1 A;  2AUC A;  3KEV A;  2D8N A;  1A29 A;  3IF7 A;  1DVI A;  1DF0 B;  1ZUZ A;  3TS5 B;  1BR4 B;  1J7O A;  1K9U A;  1ZOT B;  1F71 A;  3O6B A;  1JSA A;  1KFX L;  5DKR A;  3EKJ A;  4L9M A;  2M0R A;  4ORB B;  1RK9 A;  3WHT B;  5AEQ A;  2NCO A;  1OMD A;  1BU3 A;  2Y4Q A;  2KQ6 A;  4MZK A;  4NDD A;  1MHO A;  1UUR A;  2LVJ A;  1XFY O;  4YGB B;  4GNK B;  3CR5 X;  1G8I A;  5CSJ A;  1BF5 A;  1Q80 A;  1CM4 A;  5F6T A;  4XJK A;  1YUT A;  1IJ6 A;  3O2P A;  1F4Q A;  3WXA A;  1IG5 A;  3FIA A;  3PM8 A;  5HKZ A;  1YX8 A;  2F3Y A;  2GV5 A;  3D0Y A;  2OS8 B;  1RRO A;  2LLS A;  1A75 B;  3VRR A;  1OE9 B;  1UP5 A;  1C7V A;  2PVB A;  1Y0V H;  1E8A A;  3SG3 A;  2JTZ A;  2PRU A;  2QAC A;  1NCY A;  4NQG A;  2BE4 A;  1UHJ A;  1KK8 C;  1TRF A;  2K7D A;  3ICB A;  4OV2 A;  1KQM B;  1CDN A;  1XYD A;  2OTG B;  1NX0 A;  2KAY A;  1J55 A;  4GPL B;  1ZFS A;  3PN7 C;  3VGO A;  3CS1 A;  1OSA A;  1A2X A;  3RLZ A;  1DF0 A;  1WDC B;  4M2P A;  1C7W A;  2H2K A;  2F8P A;  4F0Z B;  2M7N A;  2HF5 A;  4N1G A;  1B1G A;  1MXL C;  4I5L B;  4NDC A;  1TCO B;  1F4O A;  5HYD A;  1EG4 A;  1F54 A;  2LAN A;  1G4Y R;  1M63 B;  4GGN A;  1VRK A;  5I2Q A;  5IBW A;  3D10 A;  1TNQ A;  1OZS A;  5ER5 A;  1SCM C;  1EL4 A;  3CR2 A;  1PAL A;  4Q04 A;  1B9A A;  1KFU L;  1MR8 A;  1EG3 A;  2K8M B;  2I18 A;  5ER4 X;  4M2Q A;  1SCV A;  1BLQ A;  4CLN A;  5D7F A;  3CZT X;  1CLL A;  1JFJ A;  1DJI A;  1A75 A;  1NPQ A;  1SL7 A;  3I5F C;  4D1E A;  1CFD A;  5D69 A;  5CSN A;  3NSL A;  2Q4U A;  4CFR A;  2JU0 A;  3K21 A;  1U5I B;  1YUS A;  2BE6 A;  2JXL A;  4OR9 B;  2M49 B;  2MAZ A;  3EVU A;  4DS7 A;  1S5G Y;  1QX2 A;  1IQ5 A;  2F3Z A;  1S5G Z;  5I2O A;  4WRI A;  2KGR A;  1AHR A;  4A4C A;  1KWO C;  3SG5 A;  3SIA A;  1JF2 A;  3HCM A;  4YGC B;  4C0J A;  3CR4 X;  1ODB A;  1CDL A;  1CM1 A;  2G9B A;  1FI6 A;  2ZRT A;  3OHM B;  1XFU O;  2BKH B;  2CTN A;  2KBI A;  2KI4 C;  5KTY A;  2PMY A;  1OMR A;  2PAS A;  1SKT A;  2MRD A;  2ZFD A;  1WLM A;  1GGZ A;  2BBM A;  3MSE B;  1LA3 A;  1YTZ C;  2CT9 A;  2WCF A;  3H4S E;  2ZN9 A;  1KSO A;  2KFG A;  1WRL A;  3KPX A;  1QAT A;  2F2O A;  2MHH A;  1PUL A;  3EK7 A;  1LXF C;  5G08 A;  5CPV A;  1OZO A;  1NUB A;  3BUM B;  1YRT B;  1QJT A;  2KNE A;  1U5I A;  3CGA A;  3EVV A;  3O4Y A;  1J7Q A;  1BJF A;  1EH2 A;  2SCP A;  4QJ4 B;  1IQ3 A;  2K7O A;  2JNX A;  2JPT A;  1CFP A;  1S3P A;  4HRG A;  1F8H A;  1X02 A;  2LCP A;  2WOS A;  4MZL A;  3F45 A;  2JOJ A;  1XFV O;  3D0Y B;  3FS7 A;  1F70 A;  4GUK A;  1CTR A;  1K96 A;  2L4H A;  1SMG A;  3EVR A;  1WRK A;  3PAT A;  3QRX A;  2JT8 A;  4OCI A;  2M1K B;  1J1D A;  2LVI A;  4JPZ B;  3GK2 A;  2L2E A;  3I5H B;  1ZAC A;  1J7R A;  2BKI B;  2BL0 C;  4HRE E;  2KFF A;  1XFZ O;  2LHI A;  4MRX A;  2JWW A;  1AP4 A;  4ORC B;  2EC6 C;  4I5J A;  2LUX A;  1S6I A;  1OMV A;  2LM5 A;  1SYM A;  1BOC A;  4IL1 A;  1K9K A;  2JUL A;  5CSF A;  5BPJ A;  1NCX A;  1Y1U A;  4FQO A;  1QIV A;  2JT3 A;  4PHN A;  1JWD A;  3LCP C;  5FYX A;  2M97 A;  3JTD B;  2K7C A;  1CLB A;  1XK4 C;  2WCE A;  1DMO A;  2K7B A;  2LVK A;  1SL9 A;  2BBN A;  3VRP A;  2KQY A;  1QVI Y;  2V53 A;  2JTT A;  3I5I C;  2FOT A;  2O5G A;  1SL8 A;  1QVI Z;  2NLN A;  2HQ8 A;  2EGD A;  2PSR A;  4PE0 A;  4GBA A;  1TTX A;  1K8U A;  2LLU A;  2NXQ A;  4YI8 A;  3JVT C;  1G33 A;  1BR1 B;  2KGB C;  4ZCU A;  2EHB A;  2LAP A;  1UHH A;  3VRO A;  2BCB A;  1M45 A;  1LKJ A;  1PRW A;  1QS7 A;  2K2F A;  1MWN A;  2HQW A;  1S6C A;  2M3W A;  3ZWH A; 
#chains in the Genus database with same CATH topology
 1DJW A;  1NWD A;  1IIO A;  4YGA A;  3OBV A;  1WLZ A;  1AVS A;  1QAS A;  1QTX A;  1TWO A;  2M9G A;  2KBM A;  1CMG A;  1CNP A;  2EC6 B;  2WCM A;  2I94 A;  1DGV A;  1XFR A;  1TUZ A;  2K0J A;  3NSO A;  1TNW A;  4GGF C;  4I5N B;  3VRN A;  1YX7 A;  2I2R E;  3BJH A;  3I5G C;  3S0D A;  3GOF A;  1SNL A;  1K9P A;  3L4L A;  3PLF B;  3TUY C;  5AAN A;  1K2H A;  3SG6 A;  1TNX A;  1W7I B;  1Y6W A;  2NZ0 A;  1REC A;  5D3O A;  2FJU B;  2K2A A;  2LNK A;  5FI2 A;  3K1E A;  4QJ3 B;  3WNX B;  2WCB A;  4IJ7 A;  1J1E A;  3DVJ A;  1DQE A;  1JBA A;  2CCM A;  1UHK A;  3D76 A;  1R6P A;  1QLK A;  1S1E A;  2WCH A;  3KF9 A;  1B47 A;  1K95 A;  2KAV A;  2L2C A;  2R2I A;  3DF0 B;  2VRG A;  2KAX A;  2M7L A;  1CFF A;  3S0E A;  1N65 A;  3BFH A;  1PVB A;  3CWG A;  2L50 A;  1IGV A;  4MRY A;  5DKN A;  4AQJ A;  1PVA A;  1JC2 A;  2MA2 A;  2RGI A;  5HL1 A;  4BY5 A;  2LC5 A;  5J3X A;  1NIW A;  3SIB A;  4YGE B;  1KK8 B;  1S36 A;  1XO5 A;  1MXE A;  2KYC A;  1OOJ A;  3B6X A;  4OKH A;  2KI6 C;  1BOD A;  1CKK A;  1B7T Y;  4MEW A;  3AAJ A;  3PN7 B;  1B7T Z;  1V1F A;  1RJV A;  1EXR A;  1Y1A A;  1SBJ A;  3EK4 A;  3HX4 A;  2LUC A;  3ZNI A;  2BCX A;  3C1V A;  1PSB A;  3DVM A;  1XK4 A;  3TUY B;  3I5G B;  1R2U A;  1FF1 A;  2LLT A;  2YGU A;  1IJ5 A;  3OB1 B;  4PHM A;  1L2O C;  1GGW A;  1QV1 A;  3VRQ A;  1CLM A;  5K89 A;  1SCM B;  3R1V A;  1NSH A;  1S26 D;  5I8N A;  2L5Y A;  4GFT A;  3DF0 A;  1NP8 A;  2KDH A;  4JD9 A;  3VB1 A;  1KCY A;  3TDU A;  4DCK A;  1H4B A;  3IQO A;  1A4P A;  2ZND A;  4M2O A;  3BFB A;  1PSR A;  1XA5 A;  3CTN A;  1LVC D;  3I5F B;  1OQP A;  1XVJ A;  3BUO B;  1HQV A;  1SR6 C;  3DVE A;  4PE1 A;  1QLS A;  1YUU A;  3D77 A;  1YVH A;  1DGU A;  1QX5 B;  1AUI B;  5FI6 A;  2JRF A;  3BXK A;  1OOH A;  2JZI A;  2M29 A;  2KFH A;  1SSE B;  1TCF A;  2H61 C;  2ZNE A;  4MVF A;  1LA0 A;  3NSK A;  1AJ4 A;  1TOP A;  3TS5 C;  1TN4 A;  1KSM A;  1SPY A;  1KWO B;  2P6B B;  3OP0 A;  3SG7 A;  1TUJ A;  2DOQ A;  2KI6 D;  2AMI A;  2E30 A;  4JQ0 D;  4U8D A;  1CDM A;  1UHI A;  4YBH B;  2JNF A;  2TN4 A;  4KYN A;  4HSZ A;  1DTL A;  3RM1 A;  1UUS A;  1YRU B;  2JQ6 A;  2B1U A;  2WC6 A;  4CFQ A;  1WY9 A;  2KI4 B;  4ZCV A;  1ALV A;  1L2O B;  3NSI A;  3FWC A;  4AQI A;  1GQM A;  2JT0 A;  2SAS A;  4GAO A;  2WOR A;  4MLW A;  4ORA B;  4OZD A;  2OS8 C;  3SS5 A;  1UWO A;  5JOL A;  1B8L A;  3BUW B;  3DZT A;  3IVT A;  1N0Y A;  1N2D A;  3AAK A;  1QWV A;  1DJX A;  3CZ0 A;  1Z2C B;  2LP3 A;  4BY4 A;  2GGZ A;  2F33 A;  1Z4H A;  4YGD B;  3SG4 A;  1KQM C;  2QPT A;  1SR6 B;  1JFK A;  3D75 A;  2WC8 A;  1MUX A;  4UPG A;  5AFP A;  3LLE A;  2KPH A;  1BT6 A;  4DRW A;  4QJ5 B;  3WHU B;  2PAL A;  3TDI A;  1CDP A;  1NX2 A;  1WDC C;  4TNC A;  2KLE A;  3CDN A;  2OPO A;  3BUN B;  4INX A;  1AJ5 A;  1B8C A;  3M0W A;  4FTG A;  1K90 D;  4PE7 A;  1ALW A;  2M8U A;  1DJZ A;  2Y5I A;  2ERB A;  1RTP 1;  2KYF A;  1OW4 A;  4PE4 A;  2BEC A;  1K93 D;  4USL A;  2MLF C;  3E3R A;  5B8I B;  2LMT A;  1EJ3 A;  1QIW A;  3O4X A;  1NYA A;  1WRZ A;  2FJY A;  2BL0 B;  2PYQ A;  4NDB A;  1XFX O;  3SJS A;  3PFV A;  2L0P A;  1CB1 A;  3AKA A;  2WCL A;  3B86 A;  2CXJ A;  4PCW A;  3KHE A;  1L7Z A;  4R1E A;  2L51 A;  4DIR A;  4YRU A;  3AKB A;  5AXI A;  2KSP A;  2WCK A;  2LE9 B;  3BUX B;  4CID A;  3SG2 A;  4DUQ A;  2JXC A;  2GTE A;  2L5X B;  1IH0 A;  3IQQ A;  1CFC A;  2O60 A;  1MF8 B;  1SRA A;  4F7F A;  1C07 A;  1F55 A;  2MBX A;  1YR5 A;  3CZ2 A;  3UO9 A;  3R72 A;  4E68 A;  1M46 A;  2WND A;  1S6J A;  3I5I B;  3GK4 X;  4PDZ A;  3RZS A;  2L98 A;  2F2P A;  1DJH A;  2H61 A;  2GGM A;  4P5O E;  2E6W A;  1YUR A;  5HKY A;  1IRJ A;  3JVT B;  1KFU S;  2Q91 A;  1JF0 A;  3A8R A;  2Y1N A;  1FW4 A;  2LV7 A;  4P2Y B;  2IS9 A;  2COL B;  3FWB A;  3EKH A;  1DJY A;  1DT7 B;  3CAB A;  1FI5 A;  4JWQ A;  2LVV A;  1SY9 A;  3OX6 A;  2K61 A;  1KK7 Y;  1TNP A;  1B8R A;  2JC2 A;  3OX5 A;  1KK7 Z;  4AOM A;  3LL8 B;  1QV0 A;  4I5K A;  2M1U A;  2ZN8 A;  2ZRS A;  1Y1X A;  3DVK A;  4C0K A;  2JPO A;  4PHJ A;  5FI7 A;  4ICB A;  5TNC A;  1K94 A;  3LK0 A;  3V2L A;  1SK6 D;  1IKU A;  2Y1M A;  2ZKM X;  4CPV A;  1A03 A;  3BYA A;  3LK1 A;  4XYN A;  4HRH A;  1P28 A;  3BOW B;  4N1F A;  4WQ3 A;  1JUO A;  1NX3 A;  4INW A;  1MQ1 A;  2I7A A;  5CSI A;  1IWQ A;  3B87 A;  5HLV A;  5JJG A;  3DD4 A;  2KHN A;  4MZJ A;  3NHI A;  2CNP A;  2QEO A;  1V1G A;  2LMU A;  2MJW B;  3D78 A;  2KOT A;  4MBE A;  2KLD A;  1RWY A;  1LIN A;  3NXA A;  4ETO A;  5KU1 A;  2HET A;  3EG5 B;  3B7A A;  1GJY A;  3S0B A;  2NCP A;  3I5H C;  4N5X A;  1B4C A;  1BMO A;  2LP2 A;  4A4B A;  1FPW A;  1M31 A;  3O78 A;  5GQQ C;  5AER A;  2BCA A;  1AK8 A;  1YVL A;  3PSR A;  1KQV A;  2LMV A;  2L4I A;  1W7J B;  4MSP A;  1PK0 D;  2HPS A;  3JTD C;  3DY9 A;  2LHL A;  2CBL A;  1QX7 A;  4GGF A;  4JKT A;  3A4U B;  5HLO A;  3BOW A;  1CMF A;  3SS3 A;  3PAL A;  1UHN A;  3SS4 A;  1H8B A;  1DJG A;  5PAL A;  2FCE A;  4WQ2 A;  2ISD A;  5KSZ A;  1RFJ A;  4MN0 A;  1QXP A;  2MLE C;  3CLN A;  5HKW A;  1NX1 A;  2G2B A;  3TDZ A;  3S0F A;  1SW8 A;  5DKQ A;  3EK8 A;  3OB2 B;  4XJK B;  5I2L A;  1DC1 A;  1BG1 A;  2P71 A;  1HT9 A;  4YI9 A;  1ZMZ A;  4PAL A;  2FCD A;  4C0L A;  1TIZ A;  1XFW O;  1M39 A;  3GK1 A;  4OVN F;  2AAO A;  2OTG C;  1DEL A;  1NCZ A;  3CZ1 A;  1D1O A;  2A4J A;  3KO0 A;  1KFX S;  1J7P A;  1FBV A;  3BQ3 A;  5DIC A;  4PHK A;  3TZ1 A;  2AUC A;  3KEV A;  2D8N A;  1A29 A;  3IF7 A;  1DVI A;  1DF0 B;  1ZUZ A;  3TS5 B;  1BR4 B;  1J7O A;  1K9U A;  1ZOT B;  1LS8 A;  3O6B A;  1F71 A;  1JSA A;  1KFX L;  5DKR A;  3EKJ A;  4L9M A;  2M0R A;  4ORB B;  1RK9 A;  3WHT B;  5AEQ A;  2NCO A;  1OMD A;  1BU3 A;  2Y4Q A;  2KQ6 A;  4MZK A;  4NDD A;  1MHO A;  1UUR A;  2LVJ A;  1XFY O;  4YGB B;  4GNK B;  3CR5 X;  1G8I A;  2H8V A;  3FE9 A;  5CSJ A;  1BF5 A;  5EL2 A;  1Q80 A;  1CM4 A;  5F6T A;  4XJK A;  1YUT A;  1IJ6 A;  3O2P A;  1F4Q A;  3WXA A;  1IG5 A;  3FIA A;  3PM8 A;  1C3Y A;  5HKZ A;  1YX8 A;  2F3Y A;  2GV5 A;  3D0Y A;  2OS8 B;  1RRO A;  2LLS A;  2P70 A;  1A75 B;  2PQL A;  3VRR A;  1OE9 B;  1UP5 A;  1C7V A;  2PVB A;  1Y0V H;  1E8A A;  3SG3 A;  2JTZ A;  2PRU A;  2QAC A;  1NCY A;  4NQG A;  2BE4 A;  1UHJ A;  1KK8 C;  1TRF A;  2K7D A;  3ICB A;  4OV2 A;  1KQM B;  1CDN A;  1XYD A;  2OTG B;  1NX0 A;  2KAY A;  1J55 A;  4GPL B;  1ZFS A;  3L4A A;  3PN7 C;  3VGO A;  2WC5 A;  3B88 A;  3CS1 A;  1OSA A;  1A2X A;  3RLZ A;  1DF0 A;  1WDC B;  4M2P A;  3Q8I A;  1DEK A;  1C7W A;  2H2K A;  2F8P A;  4F0Z B;  2M7N A;  2HF5 A;  3DYE A;  4N1G A;  1B1G A;  1MXL C;  4I5L B;  4NDC A;  1TCO B;  1F4O A;  5HYD A;  1EG4 A;  1F54 A;  2LAN A;  1G4Y R;  1M63 B;  4GGN A;  1VRK A;  5I2Q A;  5IBW A;  1C3Z A;  3D10 A;  1TNQ A;  1OZS A;  4PT1 A;  5ER5 A;  1SCM C;  1EL4 A;  3CR2 A;  1PAL A;  4Q04 A;  1B9A A;  1KFU L;  1MR8 A;  3OGN A;  3NHT A;  1EG3 A;  2K8M B;  2I18 A;  5ER4 X;  4M2Q A;  1SCV A;  1BLQ A;  4CLN A;  5D7F A;  3CZT X;  1CLL A;  1JFJ A;  1DJI A;  1A75 A;  1NPQ A;  1SL7 A;  3I5F C;  4D1E A;  3CYZ A;  4FQT A;  1CFD A;  5D69 A;  5CSN A;  3NSL A;  2Q4U A;  4CFR A;  2JU0 A;  3K21 A;  1U5I B;  1W9Z A;  1YUS A;  2BE6 A;  2JXL A;  2M49 B;  2MAZ A;  3EVU A;  4OR9 B;  4DS7 A;  1S5G Y;  2BAP A;  1QX2 A;  1IQ5 A;  2F3Z A;  1S5G Z;  5I2O A;  4WRI A;  2KGR A;  1AHR A;  3FE8 A;  1OOI X;  4A4C A;  1KWO C;  3SG5 A;  3SIA A;  1JF2 A;  3HCM A;  4YGC B;  4C0J A;  3CR4 X;  1ODB A;  1CDL A;  1CM1 A;  2G9B A;  1FI6 A;  2ZRT A;  3OHM B;  1XFU O;  2BKH B;  2CTN A;  2KBI A;  2KI4 C;  5KTY A;  2PMY A;  1OMR A;  2PAS A;  1SKT A;  2MRD A;  2ZFD A;  1WLM A;  1GGZ A;  2BBM A;  3MSE B;  1ORG A;  1LA3 A;  1YTZ C;  2CT9 A;  2WCF A;  3H4S E;  3PJI A;  2ZN9 A;  3R1O A;  1OOF A;  2QEH A;  1KSO A;  2KFG A;  3N7H A;  1WRL A;  3KPX A;  1QAT A;  2F2O A;  5I94 A;  2MHH A;  1PUL A;  2BNX A;  3EK7 A;  3D74 A;  1LXF C;  5G08 A;  5CPV A;  1OZO A;  1NUB A;  3BUM B;  3PM2 A;  1YRT B;  1QJT A;  2KNE A;  1U5I A;  3CGA A;  3EVV A;  3O4Y A;  3S0A A;  1J7Q A;  1BJF A;  1EH2 A;  1GM0 A;  2SCP A;  3UNW A;  4QJ4 B;  1IQ3 A;  2K7O A;  2JNX A;  2JPT A;  1CFP A;  1S3P A;  4HRG A;  1F8H A;  2QDI A;  1X02 A;  2LCP A;  2WOS A;  4MZL A;  3F45 A;  2JOJ A;  1XFV O;  3D0Y B;  3FS7 A;  1F70 A;  4GUK A;  1CTR A;  1K96 A;  2L4H A;  1SMG A;  3EVR A;  1WRK A;  3PAT A;  3QRX A;  2JT8 A;  4OCI A;  2M1K B;  3S0G A;  1J1D A;  2LVI A;  4JPZ B;  2QEV A;  3GK2 A;  2L2E A;  3I5H B;  1ZAC A;  1J7R A;  2BKI B;  2BL0 C;  4HRE E;  2KFF A;  1XFZ O;  2LHI A;  4MRX A;  2JWW A;  1AP4 A;  4ORC B;  3D73 A;  2QEB A;  2EC6 C;  4I5J A;  2LUX A;  1S6I A;  1OMV A;  2LM5 A;  1SYM A;  1BOC A;  4IL1 A;  1K9K A;  2JUL A;  5CSF A;  3NGV A;  1NCX A;  1Y1U A;  4FQO A;  1QIV A;  2JT3 A;  4PHN A;  5BPJ A;  3LCP C;  5FYX A;  2M97 A;  3JTD B;  2K7C A;  1JWD A;  1CLB A;  1XK4 C;  2WCE A;  1T14 A;  3L47 A;  1DMO A;  2K7B A;  2LVK A;  1SL9 A;  2BBN A;  3VRP A;  2KQY A;  1QVI Y;  2V53 A;  2JTT A;  3I5I C;  2FOT A;  2O5G A;  1SL8 A;  1QVI Z;  2NLN A;  1OOG A;  2HQ8 A;  2EGD A;  2PSR A;  4PE0 A;  2K60 A;  4GBA A;  1TTX A;  1K8U A;  2LLU A;  2NXQ A;  4YI8 A;  3JVT C;  1G33 A;  1BR1 B;  2KGB C;  3BFA A;  3QME A;  4ZCU A;  2EHB A;  2LAP A;  1UHH A;  3VRO A;  2BCB A;  1M45 A;  1LKJ A;  1PRW A;  1QS7 A;  2K2F A;  1MWN A;  2HQW A;  3DXL A;  3R1P A;  1S6C A;  2M3W A;  3FE6 A;  2WCJ A;  3ZWH A; 
#chains in the Genus database with same CATH homology
 1DJW A;  1NWD A;  4YGA A;  1WLZ A;  1AVS A;  1QAS A;  1QTX A;  2M9G A;  2KBM A;  1CMG A;  1CNP A;  2EC6 B;  2I94 A;  1DGV A;  2K0J A;  3NSO A;  1TNW A;  4GGF C;  4I5N B;  3VRN A;  1YX7 A;  2I2R E;  3TUY C;  3I5G C;  3GOF A;  1SNL A;  1K9P A;  3PLF B;  5AAN A;  1K2H A;  3SG6 A;  1TNX A;  1W7I B;  1Y6W A;  2NZ0 A;  1REC A;  5KSZ A;  2FJU B;  2K2A A;  2LNK A;  3WNX B;  4QJ3 B;  2WCB A;  1J1E A;  3DVJ A;  1JBA A;  2CCM A;  1UHK A;  1R6P A;  1QLK A;  1S1E A;  3KF9 A;  1B47 A;  1K95 A;  2KAV A;  2R2I A;  3DF0 B;  2VRG A;  2KAX A;  2M7L A;  1CFF A;  1N65 A;  1PVB A;  3CWG A;  2L50 A;  1IGV A;  4MRY A;  5DKN A;  4AQJ A;  1PVA A;  1JC2 A;  2MA2 A;  2RGI A;  4BY5 A;  2LC5 A;  5J3X A;  1NIW A;  3SIB A;  4YGE B;  1KK8 B;  1S36 A;  1XO5 A;  1MXE A;  2KYC A;  1OOJ A;  4OKH A;  1BOD A;  2KI6 C;  1CKK A;  1B7T Y;  4MEW A;  3AAJ A;  3PN7 B;  1B7T Z;  1V1F A;  1RJV A;  1EXR A;  1Y1A A;  1SBJ A;  3EK4 A;  3HX4 A;  2LUC A;  3ZNI A;  2BCX A;  3C1V A;  1PSB A;  3DVM A;  1XK4 A;  3TUY B;  3I5G B;  1R2U A;  1FF1 A;  2LLT A;  1IJ5 A;  3OB1 B;  4PHM A;  1L2O C;  1GGW A;  1QV1 A;  3VRQ A;  1CLM A;  5K89 A;  1SCM B;  1NSH A;  1S26 D;  5I8N A;  4GFT A;  3DF0 A;  1NP8 A;  2KDH A;  1KCY A;  3TDU A;  4DCK A;  1H4B A;  3IQO A;  1A4P A;  2ZND A;  4M2O A;  1PSR A;  1XA5 A;  3CTN A;  1LVC D;  3I5F B;  1OQP A;  1XVJ A;  3BUO B;  1HQV A;  1SR6 C;  3DVE A;  4PE1 A;  1QLS A;  1YUU A;  1YVH A;  1DGU A;  1QX5 B;  1AUI B;  2JRF A;  3BXK A;  2JZI A;  2M29 A;  2KFH A;  1TCF A;  2H61 C;  2ZNE A;  4MVF A;  1LA0 A;  3NSK A;  1AJ4 A;  1TOP A;  3TS5 C;  1TN4 A;  1KSM A;  1SPY A;  1KWO B;  2P6B B;  3OP0 A;  3SG7 A;  2DOQ A;  2KI6 D;  2AMI A;  2E30 A;  4JQ0 D;  4U8D A;  1CDM A;  1UHI A;  4YBH B;  2JNF A;  2TN4 A;  4HSZ A;  1DTL A;  3RM1 A;  1UUS A;  1YRU B;  2JQ6 A;  2B1U A;  4CFQ A;  1WY9 A;  2KI4 B;  4ZCV A;  1ALV A;  1L2O B;  3NSI A;  3FWC A;  4AQI A;  1GQM A;  2JT0 A;  2SAS A;  4GAO A;  2WOR A;  4MLW A;  4ORA B;  2OS8 C;  1UWO A;  5JOL A;  1B8L A;  3BUW B;  1N0Y A;  1N2D A;  3AAK A;  1DJX A;  2LP3 A;  4BY4 A;  2GGZ A;  2F33 A;  4YGD B;  3SG4 A;  1KQM C;  2QPT A;  1SR6 B;  1JFK A;  2WC8 A;  1MUX A;  4UPG A;  5AFP A;  3LLE A;  1BT6 A;  4DRW A;  4QJ5 B;  3WHU B;  2PAL A;  3TDI A;  1CDP A;  1NX2 A;  1WDC C;  4TNC A;  2OPO A;  3BUN B;  1AJ5 A;  1B8C A;  3M0W A;  4FTG A;  1K90 D;  4PE7 A;  1ALW A;  2M8U A;  1DJZ A;  2Y5I A;  1RTP 1;  2KYF A;  4PE4 A;  2BEC A;  1K93 D;  4USL A;  2MLF C;  3E3R A;  5B8I B;  2LMT A;  1EJ3 A;  1QIW A;  1NYA A;  1WRZ A;  2BL0 B;  4NDB A;  1XFX O;  3SJS A;  3PFV A;  2L0P A;  1CB1 A;  3AKA A;  2CXJ A;  4PCW A;  3KHE A;  1L7Z A;  4R1E A;  2L51 A;  4DIR A;  4YRU A;  3AKB A;  5AXI A;  2KSP A;  2LE9 B;  3BUX B;  4CID A;  3SG2 A;  4DUQ A;  2JXC A;  2L5X B;  1IH0 A;  3IQQ A;  1CFC A;  2O60 A;  1MF8 B;  1SRA A;  1C07 A;  1F55 A;  2MBX A;  1YR5 A;  4E68 A;  1M46 A;  2WND A;  1S6J A;  3I5I B;  3GK4 X;  4PDZ A;  2L98 A;  2F2P A;  1DJH A;  2H61 A;  2GGM A;  4P5O E;  2E6W A;  1YUR A;  5HKY A;  1IRJ A;  3JVT B;  1KFU S;  2Q91 A;  1JF0 A;  3A8R A;  2Y1N A;  1FW4 A;  2LV7 A;  4P2Y B;  2IS9 A;  2COL B;  3FWB A;  3EKH A;  1DJY A;  1DT7 B;  1FI5 A;  4JWQ A;  2LVV A;  1SY9 A;  3OX6 A;  2K61 A;  1KK7 Y;  1TNP A;  1B8R A;  2JC2 A;  3OX5 A;  1KK7 Z;  4AOM A;  3LL8 B;  1QV0 A;  4I5K A;  2M1U A;  2ZN8 A;  2ZRS A;  1Y1X A;  3DVK A;  4C0K A;  4PHJ A;  5TNC A;  4ICB A;  1K94 A;  3LK0 A;  1SK6 D;  1IKU A;  2Y1M A;  2ZKM X;  4CPV A;  1A03 A;  3BYA A;  3LK1 A;  4XYN A;  4HRH A;  3BOW B;  4N1F A;  4WQ3 A;  1JUO A;  1NX3 A;  1MQ1 A;  2I7A A;  5CSI A;  1IWQ A;  5HLV A;  5JJG A;  3DD4 A;  2KHN A;  4MZJ A;  2CNP A;  1V1G A;  2LMU A;  2MJW B;  2KOT A;  4MBE A;  1RWY A;  1LIN A;  3NXA A;  4ETO A;  5KU1 A;  2HET A;  1GJY A;  2NCP A;  3I5H C;  4N5X A;  1B4C A;  1BMO A;  2LP2 A;  4A4B A;  1FPW A;  1M31 A;  3O78 A;  5GQQ C;  5AER A;  2BCA A;  1AK8 A;  1YVL A;  3PSR A;  1KQV A;  2LMV A;  2L4I A;  1W7J B;  4MSP A;  1PK0 D;  2HPS A;  3JTD C;  2LHL A;  2CBL A;  1QX7 A;  4GGF A;  3A4U B;  5HLO A;  3BOW A;  1CMF A;  3PAL A;  1UHN A;  1H8B A;  1DJG A;  5PAL A;  2FCE A;  4WQ2 A;  2ISD A;  1RFJ A;  4MN0 A;  1QXP A;  2MLE C;  3CLN A;  5HKW A;  1NX1 A;  2G2B A;  3TDZ A;  1SW8 A;  5DKQ A;  3EK8 A;  3OB2 B;  4XJK B;  5I2L A;  1BG1 A;  1HT9 A;  4YI9 A;  1ZMZ A;  4PAL A;  2FCD A;  4C0L A;  1TIZ A;  1XFW O;  1M39 A;  3GK1 A;  4OVN F;  2AAO A;  2OTG C;  1NCZ A;  1D1O A;  2A4J A;  3KO0 A;  1KFX S;  1J7P A;  1FBV A;  3BQ3 A;  4PHK A;  3TZ1 A;  2AUC A;  3KEV A;  2D8N A;  1A29 A;  3IF7 A;  1DVI A;  1DF0 B;  1ZUZ A;  3TS5 B;  1BR4 B;  1J7O A;  1K9U A;  1ZOT B;  1F71 A;  3O6B A;  1JSA A;  1KFX L;  5DKR A;  3EKJ A;  4L9M A;  2M0R A;  4ORB B;  1RK9 A;  3WHT B;  5AEQ A;  2NCO A;  1OMD A;  1BU3 A;  2Y4Q A;  2KQ6 A;  4MZK A;  4NDD A;  1MHO A;  1UUR A;  2LVJ A;  1XFY O;  4YGB B;  4GNK B;  3CR5 X;  1G8I A;  5CSJ A;  1BF5 A;  1Q80 A;  1CM4 A;  5F6T A;  4XJK A;  1YUT A;  1IJ6 A;  3O2P A;  1F4Q A;  3WXA A;  1IG5 A;  3FIA A;  3PM8 A;  5HKZ A;  1YX8 A;  2F3Y A;  2GV5 A;  3D0Y A;  2OS8 B;  1RRO A;  2LLS A;  1A75 B;  3VRR A;  1OE9 B;  1UP5 A;  1C7V A;  2PVB A;  1Y0V H;  1E8A A;  3SG3 A;  2JTZ A;  2PRU A;  2QAC A;  1NCY A;  4NQG A;  2BE4 A;  1UHJ A;  1KK8 C;  1TRF A;  2K7D A;  3ICB A;  4OV2 A;  1KQM B;  1CDN A;  1XYD A;  2OTG B;  1NX0 A;  2KAY A;  1J55 A;  4GPL B;  1ZFS A;  3PN7 C;  3VGO A;  3CS1 A;  1OSA A;  1A2X A;  3RLZ A;  1DF0 A;  1WDC B;  4M2P A;  1C7W A;  2H2K A;  2F8P A;  4F0Z B;  2M7N A;  2HF5 A;  4N1G A;  1B1G A;  1MXL C;  4I5L B;  4NDC A;  1TCO B;  1F4O A;  5HYD A;  1EG4 A;  1F54 A;  2LAN A;  1G4Y R;  1M63 B;  4GGN A;  1VRK A;  5I2Q A;  5IBW A;  3D10 A;  1TNQ A;  1OZS A;  5ER5 A;  1SCM C;  1EL4 A;  3CR2 A;  1PAL A;  4Q04 A;  1B9A A;  1KFU L;  1MR8 A;  1EG3 A;  2K8M B;  2I18 A;  5ER4 X;  4M2Q A;  1SCV A;  1BLQ A;  4CLN A;  5D7F A;  3CZT X;  1CLL A;  1JFJ A;  1DJI A;  1A75 A;  1NPQ A;  1SL7 A;  3I5F C;  4D1E A;  1CFD A;  5D69 A;  5CSN A;  3NSL A;  2Q4U A;  4CFR A;  2JU0 A;  3K21 A;  1U5I B;  1YUS A;  2BE6 A;  2JXL A;  4OR9 B;  2M49 B;  2MAZ A;  3EVU A;  4DS7 A;  1S5G Y;  1QX2 A;  1IQ5 A;  2F3Z A;  1S5G Z;  5I2O A;  4WRI A;  2KGR A;  1AHR A;  4A4C A;  1KWO C;  3SG5 A;  3SIA A;  1JF2 A;  3HCM A;  4YGC B;  4C0J A;  3CR4 X;  1ODB A;  1CDL A;  1CM1 A;  2G9B A;  1FI6 A;  2ZRT A;  3OHM B;  1XFU O;  2BKH B;  2CTN A;  2KBI A;  2KI4 C;  5KTY A;  2PMY A;  1OMR A;  2PAS A;  1SKT A;  2MRD A;  2ZFD A;  1WLM A;  1GGZ A;  2BBM A;  3MSE B;  1LA3 A;  1YTZ C;  2CT9 A;  2WCF A;  3H4S E;  2ZN9 A;  1KSO A;  2KFG A;  1WRL A;  3KPX A;  1QAT A;  2F2O A;  2MHH A;  1PUL A;  3EK7 A;  1LXF C;  5G08 A;  5CPV A;  1OZO A;  1NUB A;  3BUM B;  1YRT B;  1QJT A;  2KNE A;  1U5I A;  3CGA A;  3EVV A;  3O4Y A;  1J7Q A;  1BJF A;  1EH2 A;  2SCP A;  4QJ4 B;  1IQ3 A;  2K7O A;  2JNX A;  2JPT A;  1CFP A;  1S3P A;  4HRG A;  1F8H A;  1X02 A;  2LCP A;  2WOS A;  4MZL A;  3F45 A;  2JOJ A;  1XFV O;  3D0Y B;  3FS7 A;  1F70 A;  4GUK A;  1CTR A;  1K96 A;  2L4H A;  1SMG A;  3EVR A;  1WRK A;  3PAT A;  3QRX A;  2JT8 A;  4OCI A;  2M1K B;  1J1D A;  2LVI A;  4JPZ B;  3GK2 A;  2L2E A;  3I5H B;  1ZAC A;  1J7R A;  2BKI B;  2BL0 C;  4HRE E;  2KFF A;  1XFZ O;  2LHI A;  4MRX A;  2JWW A;  1AP4 A;  4ORC B;  2EC6 C;  4I5J A;  2LUX A;  1S6I A;  1OMV A;  2LM5 A;  1SYM A;  1BOC A;  4IL1 A;  1K9K A;  2JUL A;  5CSF A;  5BPJ A;  1NCX A;  1Y1U A;  4FQO A;  1QIV A;  2JT3 A;  4PHN A;  1JWD A;  3LCP C;  5FYX A;  2M97 A;  3JTD B;  2K7C A;  1CLB A;  1XK4 C;  2WCE A;  1DMO A;  2K7B A;  2LVK A;  1SL9 A;  2BBN A;  3VRP A;  2KQY A;  1QVI Y;  2V53 A;  2JTT A;  3I5I C;  2FOT A;  2O5G A;  1SL8 A;  1QVI Z;  2NLN A;  2HQ8 A;  2EGD A;  2PSR A;  4PE0 A;  4GBA A;  1TTX A;  1K8U A;  2LLU A;  2NXQ A;  4YI8 A;  3JVT C;  1G33 A;  1BR1 B;  2KGB C;  4ZCU A;  2EHB A;  2LAP A;  1UHH A;  3VRO A;  2BCB A;  1M45 A;  1LKJ A;  1PRW A;  1QS7 A;  2K2F A;  1MWN A;  2HQW A;  1S6C A;  2M3W A;  3ZWH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...