5K89A

Crystal structure of human calcium-bound s100a1
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
90
structure length
85
Chain Sequence
MGSELETAMETLINVFHAHSGKEGDKYKLSKKELKELLQTELSGFLDDAVDKVMKELDENGDGEVDFQEYVVLVAALTVACNNFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray crystal structure of human calcium-bound S100A1.
pubmed doi rcsb
molecule keywords Protein S100-A1
molecule tags Metal binding protein
source organism Homo sapiens
total genus 31
structure length 85
sequence length 90
chains with identical sequence C, H
ec nomenclature
pdb deposition date 2016-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 5k89A00
2FOTA 3NSIA 1F4QA 4PE4A 1L7ZA 4PHMA 1XO5A 1A03A 5HKYA 2MA2A 2TN4A 5HLOA 1JSAA 2KFHA 1QLSA 1KFUL 5F6TA 4PE7A 1KFXL 4M2QA 1M45A 1SRAA 2LCPA 2OS8B 1GJYA 4N1GA 2CBLA 4PHNA 1J1DA 2K2FA 1CLLA 4N1FA 1QVIY 1JUOA 3DVJA 1QXPA 1LKJA 3I5HB 1CM1A 1TOPA 3CS1A 5PALA 2K7BA 1VRKA 2KGBC 2A4JA 1F55A 4GAOA 2LUCA 4PCWA 1JF0A 1OMVA 1PVBA 4OVNF 4XJKA 2EGDA 3TS5B 3KPXA 1KK7Z 2WNDA 1SL7A 3DF0B 1M31A 2LNKA 5HKZA 2JPTA 2GGZA 5CSJA 3BUWB 1KCYA 2F33A 4MSPA 3DVMA 1DJGA 3D0YA 3EK8A 1TNXA 2ZRTA 1CFCA 2KBIA 2M7NA 2KBMA 1C07A 2F2PA 3BUOB 1UWOA 2JC2A 3IF7A 1QJTA 3AAKA 5TNCA 2FCDA 3NSOA 3GOFA 3KHEA 4MEWA 3WHTB 2Y1MA 4MRYA 4OCIA 1HT9A 4P5OE 1BODA 3CZTX 3I5HC 1UHNA 1CDMA 1QX5B 1IJ5A 1IRJA 2OTGB 4ZCUA 2M1UA 1YRTB 5AANA 1S26D 5ER4X 3LLEA 1M39A 2LC5A 4QJ4B 5KU1A 4DIRA 2O5GA 1KK8B 1N65A 3D10A 3TS5C 1UP5A 1SYMA 2KAXA 1PALA 3IQOA 4AOMA 1NCZA 1TCFA 3PALA 1FW4A 1OE9B 2BBMA 1EXRA 1PRWA 3RLZA 2CNPA 2I18A 2R2IA 2JQ6A 2BL0B 1K8UA 1YTZC 4ETOA 2KFGA 2K8MB 3CLNA 2MBXA 1CFDA 2KAVA 1GQMA 5AFPA 1FI6A 2F2OA 3PFVA 4GFTA 4I5NB 3EKHA 4PALA 3FWCA 2KDHA 1AJ5A 3I5FB 4YGBB 2LVVA 2COLB 2KYFA 3TZ1A 1QX7A 2I94A 1B47A 1DJZA 1QVIZ 1UHKA 2KI6C 3BOWA 3AKBA 3BXKA 4ORBB 2WCFA 1AP4A 1QATA 1SKTA 3DD4A 3SJSA 4DS7A 1C7VA 1KK8C 1OZSA 4YGEB 1K95A 1PSBA 1KFUS 1K90D 3LK0A 1BU3A 5AERA 1Y6WA 2KOTA 3VROA 1B4CA 2JRFA 4GGNA 1DMOA 2BCBA 1R6PA 2PRUA 1SY9A 1C7WA 4ORAB 4MZJA 2KYCA 1F8HA 3VRRA 1M46A 1NX0A 2BL0C 2M1KB 4U8DA 4MVFA 4YGCB 5IBWA 1UHJA 1K9KA 2Q4UA 1TRFA 2NCOA 2OPOA 3CGAA 3SG6A 1S6CA 2LMUA 1RTP1 3H4SE 3RM1A 1WRZA 4MZKA 3I5FC 4DCKA 1IWQA 4YRUA 2HETA 3AAJA 2H2KA 4AQIA 2JT0A 4NDDA 2JTTA 2PMYA 2KQYA 1UUSA 1TIZA 5I2QA 4WRIA 4NDBA 1W7JB 2JOJA 3SG4A 3TUYC 4CFRA 3I5GB 4WQ2A 1K9UA 4OR9B 2BKHB 3DVEA 3C1VA 3VRNA 1HQVA 1CDLA 2M8UA 3OB2B 3OX6A 1KQMC 3DF0A 4IL1A 1JC2A 5K89A 1D1OA 1SCVA 4I5JA 1CNPA 1F4OA 2KI6D 1DJXA 4I5KA 1XFWO 2NZ0A 5BPJA 2EC6B 1NWDA 3OP0A 1SW8A 1LXFC 4PE1A 1IQ5A 5CPVA 1NIWA 2M29A 5AXIA 3EVUA 3K21A 1QV0A 3VRPA 4QJ5B 1J7PA 1YR5A 4YBHB 3KEVA 1A4PA 5FYXA 1KSMA 1IJ6A 2BBNA 1CMGA 1CLMA 3BYAA 2B1UA 2I2RE 1DGVA 1K9PA 1DF0B 2H61A 5JOLA 1LA0A 2LMTA 1XFYO 1WLZA 2BE6A 3DVKA 2ZNDA 4M2OA 3NSLA 1E8AA 2FJUB 3CR4X 3KF9A 2OS8C 3SIAA 4FQOA 2BKIB 2FCEA 2V53A 2M97A 3A8RA 2SASA 1SR6B 2JT3A 1EG3A 2KAYA 2WORA 1TNQA 4FTGA 1PSRA 1B8LA 1DJYA 4OKHA 2KQ6A 4ICBA 5I8NA 5G08A 3SG5A 1V1FA 2KHNA 2K7OA 2JXCA 2LP3A 2BE4A 2WCBA 4DUQA 1RFJA 1G8IA 2LLSA 5KSZA 2Y5IA 3I5IB 3E3RA 3JTDB 1OOJA 1QIWA 1MXEA 3TDUA 1QIVA 1SBJA 1NPQA 1TN4A 1A75B 1NX1A 3BQ3A 3F45A 2KNEA 1WLMA 1FI5A 1S6JA 1JFKA 3CR2A 3O4YA 3LK1A 4YGDB 1B8RA 2I7AA 2LV7A 1YRUB 2L5XB 3NXAA 1S5GY 1NUBA 1DT7B 1EG4A 1ZUZA 1ZOTB 5DKNA 1CB1A 1PK0D 2NCPA 2JNXA 4OV2A 2L51A 3VRQA 4YI9A 1A29A 3FIAA 1EL4A 1K94A 2LHLA 4HREE 2PASA 3EVVA 1BJFA 4C0JA 1WRKA 2P6BB 1K93D 1MR8A 1QS7A 1S36A 5J3XA 1IG5A 2H61C 3EVRA 4M2PA 2OTGC 1QLKA 1OSAA 1SL8A 3JTDC 4MLWA 3AKAA 4E68A 2LVIA 2AMIA 2L0PA 2ISDA 1DJHA 1TNPA 1LVCD 2JWWA 4P2YB 4GBAA 2K0JA 1J1EA 2LVJA 3MSEB 2NLNA 3IQQA 1YURA 2KFFA 5CSIA 1SMGA 1KFXS 3A4UB 1KQVA 2JTZA 1XYDA 2MHHA 4CLNA 1NCXA 4R1EA 3WNXB 1J55A 3PN7B 1S6IA 1YX7A 1ZACA 1WY9A 1DJWA 1V1GA 2LHIA 2QPTA 1B1GA 1XFUO 2ZRSA 1CDNA 1CFFA 1EJ3A 1SK6D 2Q91A 1OMDA 2LUXA 2L50A 4QJ3B 1BG1A 2HQWA 5HYDA 4GPLB 1NP8A 1AJ4A 2PALA 1KK7Y 4NQGA 1N0YA 1YUSA 2LM5A 3EK4A 3GK2A 3ZWHA 2HPSA 1QX2A 1DVIA 3KO0A 1OQPA 3O78A 4HSZA 3QRXA 2L4HA 2HF5A 2K61A 2ZKMX 1B7TY 1NX3A 1SCMB 4Q04A 1LINA 2LLUA 2KSPA 2KI4B 5JJGA 1NX2A 3CWGA 1FBVA 2MRDA 1J7RA 1PULA 1MXLC 1RWYA 1BLQA 3GK1A 2K7DA 2WC8A 2MJWB 1UHHA 2CTNA 1M63B 4XYNA 3BUNB 1IQ3A 2JZIA 2VRGA 3HCMA 3PATA 1MUXA 1AK8A 1S5GZ 1H4BA 1F54A 1XA5A 1DF0A 4PHJA 4ZCVA 4JPZB 4BY5A 2BCAA 1CFPA 2LAPA 1YUUA 1IKUA 1MWNA 5CSNA 3TDZA 1U5IB 1CM4A 4TNCA 3CR5X 4A4CA 2M7LA 4WQ3A 2LANA 1BMOA 1OZOA 1Q80A 2ZFDA 1CTRA 2MLEC 5KTYA 1IH0A 1TCOB 2CCMA 1L2OB 2DOQA 2LMVA 1WDCB 4HRGA 4PE0A 1CLBA 1BR4B 3HX4A 2K7CA 1SCMC 4AQJA 1TNWA 3LL8B 2LP2A 2KI4C 3I5GC 5B8IB 3PLFB 2G2BA 2L4IA 4PHKA 1Y1UA 2MAZA 1BF5A 1FF1A 1K96A 1KSOA 1XK4C 1SPYA 1B8CA 1DJIA 2D8NA 4CIDA 1QV1A 2IS9A 4C0KA 4GGFA 1A75A 1NCYA 4F0ZB 2PVBA 2PSRA 2CXJA 5I2OA 3BUXB 3PSRA 4NDCA 1BT6A 2M9GA 1DTLA 1XFZO 2EC6C 2SCPA 4C0LA 2LLTA 3WXAA 3FWBA 1NSHA 1ZFSA 2GV5A 4USLA 5CSFA 1YVHA 2F3YA 4BY4A 1JFJA 3OB1B 1WRLA 4ORCB 1UURA 1L2OC 1WDCC 1BR1B 3EKJA 1TTXA 3OX5A 1G33A 4CFQA 2LE9B 2K2AA 5AEQA 1RJVA 1QASA 1RK9A 2KGRA 3BUMB 4JQ0D 1B7TZ 4A4BA 5I2LA 1FPWA 1F71A 1DGUA 1SL9A 4GUKA 2EHBA 1J7QA 3M0WA 1K2HA 2G9BA 1XVJA 3CTNA 2AAOA 4I5LB 3SIBA 1BOCA 1AVSA 2WCEA 4XJKB 1JF2A 1SR6C 1J7OA 1YVLA 3D0YB 2CT9A 1GGZA 2MLFC 1CMFA 1PVAA 4PDZA 2NXQA 1NYAA 2E30A 3FS7A 5DKRA 2HQ8A 4MN0A 2RGIA 4MZLA 4GNKB 1B9AA 1W7IB 3I5IC 1ALWA 1GGWA 1RROA 4MRXA 1R2UA 4D1EA 4MBEA 4GGFC 1G4YR 4CPVA 4L9MA 4YI8A 2L2EA 3TDIA 2JXLA 1XFXO 1F70A 2ZNEA 3WHUB 5GQQC 1UHIA 3JVTB 1LA3A 1MF8B 1Y1AA 4UPGA 1N2DA 1JWDA 3EK7A 1KWOB 2F3ZA 2AUCA 1XFVO 2JULA 2BCXA 2L98A 3NSKA 1XK4A 1YUTA 2Y1NA 3ICBA 4JWQA 1AUIB 3SG2A 1IGVA 3TUYB 1Y1XA 2M3WA 2JT8A 4DRWA 1AHRA 3LCPC 1A2XA 1ALVA 2Y4QA 3GK4X 1U5IA 2O60A 1S3PA 2JU0A 2QACA 2BECA 4YGAA 2E6WA 1Y0VH 5HLVA 1ZMZA 5HKWA 2ZN8A 1KQMB 1JBAA 3BOWB 3SG3A 1MQ1A 3ZNIA 2LVKA 2JNFA 3JVTC 1S1EA 1EH2A 1H8BA 5DKQA 1SNLA 3PN7C 2M49B 3VGOA 1QTXA 5D7FA 2WOSA 2ZN9A 5D69A 3SG7A 1KWOC 1X02A 1CDPA 3OHMB 1CKKA 1MHOA 2F8PA 4HRHA 2GGMA 3O2PA 4N5XA 1ODBA 1YX8A 1OMRA 5ER5A 1RECA 3O6BA 3PM8A 2M0RA
chains in the Genus database with same CATH superfamily
2FOTA 3NSIA 1F4QA 4PE4A 1L7ZA 4PHMA 1XO5A 1A03A 5HKYA 2MA2A 2TN4A 5HLOA 1JSAA 2KFHA 1QLSA 1KFUL 5F6TA 4PE7A 1KFXL 4M2QA 1M45A 2QEVA 1SRAA 2LCPA 2OS8B 1GJYA 4N1GA 2CBLA 4PHNA 1J1DA 2K2FA 1CLLA 2KPHA 4N1FA 1QVIY 3VB1A 1JUOA 3DVJA 1QXPA 1LKJA 3I5HB 1CM1A 1TOPA 3CS1A 5PALA 2K7BA 1VRKA 2KGBC 2A4JA 4INWA 1F55A 4GAOA 2LUCA 4PCWA 1JF0A 1OMVA 3S0FA 1PVBA 3D77A 4OVNF 4XJKA 2EGDA 3TS5B 3KPXA 1KK7Z 2WNDA 1SL7A 3DF0B 1M31A 2LNKA 5HKZA 2JPTA 3L4LA 2GGZA 5CSJA 2WCLA 3BUWB 3CZ0A 1KCYA 2F33A 4MSPA 3DVMA 1DJGA 3D0YA 3EK8A 1TNXA 2ZRTA 1CFCA 2KBIA 2M7NA 3FE9A 2KBMA 2PYQA 1C07A 2F2PA 3BUOB 1OOGA 1UWOA 2JC2A 3IF7A 1QJTA 3AAKA 5TNCA 2FCDA 3NSOA 3GOFA 3KHEA 4MEWA 3WHTB 2Y1MA 4MRYA 4OCIA 1HT9A 1XFRA 4P5OE 1BODA 1Z2CB 3D75A 3CZTX 3I5HC 1UHNA 1CDMA 1QX5B 1IJ5A 1IRJA 2OTGB 4ZCUA 2M1UA 1YRTB 2QEOA 5AANA 1S26D 5ER4X 3LLEA 2QEHA 1DELA 1M39A 2LC5A 4QJ4B 5KU1A 4DIRA 2O5GA 1KK8B 1N65A 3D10A 3TS5C 1UP5A 1SYMA 2KAXA 1PALA 3IQOA 4AOMA 1NCZA 1TCFA 3NGVA 3RZSA 1C3ZA 3PALA 1FW4A 5D3OA 1OE9B 1OOFA 2BBMA 1EXRA 4OZDA 1PRWA 3RLZA 2CNPA 2I18A 2R2IA 2JQ6A 2BL0B 2H8VA 1K8UA 1GM0A 3B7AA 1YTZC 4ETOA 2KFGA 5FI6A 2K8MB 3CLNA 2MBXA 3O4XA 1CFDA 2KAVA 1GQMA 1OW4A 5AFPA 2F2OA 3PFVA 4GFTA 4I5NB 1FI6A 3EKHA 4PALA 3FWCA 2KDHA 1AJ5A 3I5FB 3OBVA 4YGBB 2LVVA 2COLB 2KYFA 3TZ1A 1QX7A 2I94A 1B47A 1DJZA 1QVIZ 1UHKA 2KI6C 3BOWA 1TWOA 5I94A 3AKBA 3BXKA 4ORBB 2WCFA 1AP4A 1QATA 1SKTA 3DD4A 3SJSA 4DS7A 2P71A 3NHIA 1C7VA 3UO9A 1KK8C 1OZSA 4YGEB 1OOHA 1K95A 1PSBA 1KFUS 1K90D 3LK0A 1BU3A 5AERA 1Y6WA 2KOTA 3VROA 1B4CA 2JRFA 4GGNA 1DMOA 1ORGA 1R6PA 2BCBA 2PRUA 1SY9A 1C7WA 4ORAB 4MZJA 2KYCA 1F8HA 3VRRA 1M46A 1NX0A 3PJIA 2KLEA 2BL0C 2M1KB 4U8DA 4MVFA 4YGCB 5IBWA 1UHJA 1K9KA 2Q4UA 1TRFA 2NCOA 2OPOA 3CGAA 3S0BA 3SG6A 1S6CA 2LMUA 2WC6A 1RTP1 3SS3A 3H4SE 3RM1A 1WRZA 4MZKA 3I5FC 4DCKA 1IWQA 4YRUA 2HETA 3L4AA 3AAJA 2H2KA 4AQIA 2JT0A 3D78A 4NDDA 2JTTA 2BAPA 2PMYA 2KQYA 1UUSA 1TIZA 1W9ZA 5I2QA 4WRIA 4NDBA 3UNWA 1W7JB 2JOJA 3SG4A 3TUYC 4CFRA 3I5GB 4WQ2A 1K9UA 4OR9B 2BKHB 3DVEA 1CFFA 3CYZA 3C1VA 3VRNA 5FI2A 1HQVA 1CDLA 2M8UA 3OB2B 3OX6A 1KQMC 3DF0A 4IL1A 1JC2A 5K89A 1D1OA 1SCVA 4I5JA 1CNPA 1F4OA 2KI6D 1DJXA 4I5KA 1XFWO 2NZ0A 5BPJA 2EC6B 1NWDA 3OP0A 1SW8A 1LXFC 4PE1A 4KYNA 1IQ5A 5CPVA 1NIWA 2M29A 2WC5A 5AXIA 3QMEA 3EVUA 3K21A 1QV0A 3VRPA 3S0GA 4QJ5B 1J7PA 1YR5A 4YBHB 3KEVA 3SS5A 1A4PA 5FYXA 1KSMA 1IJ6A 2BBNA 1CMGA 1CLMA 3BYAA 2B1UA 2I2RE 1DGVA 3CZ2A 1K9PA 1DF0B 2H61A 5JOLA 1LA0A 2LMTA 1XFYO 1WLZA 2BE6A 3DVKA 2ZNDA 4M2OA 3NSLA 1E8AA 2FJUB 3R1VA 3CR4X 3KF9A 2OS8C 3SIAA 3B87A 2BKIB 4FQOA 2FCEA 2V53A 2M97A 3A8RA 2SASA 1SR6B 2JT3A 1EG3A 2KAYA 2WORA 3N7HA 1TNQA 4FTGA 1PSRA 1B8LA 1DJYA 4OKHA 2KQ6A 4ICBA 5I8NA 5G08A 3V2LA 3SG5A 3DYEA 1V1FA 2KHNA 2K7OA 2JXCA 2LP3A 2BE4A 2WCBA 4DUQA 1RFJA 1G8IA 2LLSA 4F7FA 2Y5IA 3I5IB 3E3RA 3JTDB 3NHTA 5KSZA 1OOJA 1QIWA 1MXEA 3TDUA 1QIVA 1SBJA 3D76A 3R1PA 1NPQA 1TN4A 1A75B 1NX1A 3BQ3A 3F45A 2KNEA 1WLMA 1FI5A 1S6JA 1JFKA 3CR2A 3O4YA 3LK1A 4YGDB 1B8RA 2I7AA 2LV7A 1YRUB 2L5XB 3NXAA 1S5GY 1NUBA 3EG5B 1DT7B 1EG4A 1ZUZA 1ZOTB 5DKNA 1CB1A 1PK0D 2NCPA 2JNXA 4OV2A 2L51A 3VRQA 4YI9A 1A29A 3FIAA 1EL4A 1K94A 2WCHA 2LHLA 4HREE 2PASA 3EVVA 1BJFA 4C0JA 2P70A 1DEKA 1WRKA 2P6BB 2YGUA 1K93D 1MR8A 1QS7A 1S36A 5J3XA 1IG5A 2H61C 3EVRA 4M2PA 2OTGC 1QLKA 1OSAA 1SL8A 3JTDC 4MLWA 3AKAA 4E68A 2LVIA 2AMIA 2L0PA 2ISDA 1DJHA 1TNPA 1LVCD 2JWWA 4P2YB 4GBAA 2K0JA 1J1EA 2LVJA 3MSEB 2NLNA 3IQQA 1YURA 2KFFA 5CSIA 2QEBA 3CZ1A 1SMGA 1KFXS 3A4UB 1KQVA 2JTZA 1XYDA 2MHHA 4CLNA 1SSEB 1NCXA 4R1EA 3FE6A 3WNXB 1J55A 2WCKA 3PN7B 1S6IA 1YX7A 1ZACA 1WY9A 1DJWA 1V1GA 2LHIA 1TUZA 2QPTA 1XFUO 2ZRSA 3CDNA 1B1GA 1EJ3A 1CDNA 1SK6D 2Q91A 1OMDA 2LUXA 2L50A 4QJ3B 1BG1A 2HQWA 5HYDA 4GPLB 1NP8A 3DY9A 3S0EA 1AJ4A 2PALA 1KK7Y 4NQGA 1N0YA 1YUSA 2LM5A 3EK4A 3GK2A 3ZWHA 2HPSA 1QX2A 1DVIA 3KO0A 1OQPA 3O78A 4HSZA 3QRXA 2L4HA 2HF5A 2K61A 2ZKMX 1B7TY 1NX3A 1SCMB 2KLDA 1LINA 2LLUA 4Q04A 2KSPA 2KI4B 5JJGA 3R72A 1NX2A 3CWGA 1FBVA 2MRDA 1J7RA 4INXA 1PULA 1MXLC 1RWYA 1BLQA 3GK1A 2K7DA 2WC8A 2MJWB 1UHHA 2CTNA 3D73A 1M63B 2ERBA 4XYNA 3BUNB 1IQ3A 1DQEA 2JZIA 2VRGA 3HCMA 3PATA 1MUXA 1AK8A 1S5GZ 1H4BA 3PM2A 1F54A 1XA5A 1DF0A 4PHJA 4ZCVA 4JPZB 4BY5A 2BCAA 1CFPA 2LAPA 1YUUA 1IKUA 1MWNA 5CSNA 3TDZA 1U5IB 1CM4A 4TNCA 3CR5X 4A4CA 1LS8A 4WQ3A 2M7LA 2LANA 1QWVA 1BMOA 1OZOA 1Q80A 2ZFDA 1CTRA 2MLEC 5KTYA 1IH0A 2L5YA 1TCOB 2CCMA 1L2OB 2DOQA 2LMVA 1WDCB 4HRGA 4PE0A 1CLBA 2BNXA 1BR4B 3HX4A 2K7CA 1SCMC 4AQJA 1TNWA 3LL8B 2LP2A 2KI4C 3I5GC 5B8IB 3PLFB 2G2BA 2L4IA 4PHKA 1Y1UA 2MAZA 1BF5A 1FF1A 1K96A 1KSOA 1XK4C 1SPYA 1B8CA 1DJIA 2D8NA 4CIDA 1QV1A 2IS9A 4C0KA 3OGNA 1A75A 1NCYA 4GGFA 4F0ZB 2PVBA 2PSRA 2CXJA 5I2OA 3BUXB 3PSRA 4JD9A 4NDCA 1BT6A 2M9GA 1DTLA 1XFZO 2EC6C 2GTEA 2SCPA 4C0LA 2LLTA 3WXAA 2QDIA 3FWBA 1NSHA 1ZFSA 2GV5A 3FE8A 4USLA 5CSFA 5DICA 1YVHA 2F3YA 4BY4A 1JFJA 3OB1B 1WRLA 4ORCB 3IVTA 1UURA 1L2OC 2WCJA 1WDCC 1BR1B 3EKJA 1TTXA 3OX5A 3L47A 1G33A 4CFQA 2LE9B 2K2AA 5AEQA 1RJVA 1QASA 1RK9A 2KGRA 3BUMB 4JQ0D 1B7TZ 4A4BA 5I2LA 1FPWA 2JPOA 1F71A 1DGUA 1SL9A 2FJYA 2EHBA 4GUKA 1J7QA 3BFHA 3M0WA 1K2HA 2G9BA 1XVJA 3CTNA 5EL2A 2AAOA 4I5LB 3SIBA 1BOCA 1AVSA 2WCEA 4XJKB 4PT1A 1JF2A 5FI7A 1SR6C 3B88A 1YVLA 4IJ7A 3D0YB 1J7OA 2CT9A 1GGZA 2MLFC 4JKTA 1CMFA 1PVAA 4PDZA 4FQTA 2NXQA 1NYAA 2E30A 3FS7A 5DKRA 2HQ8A 3S0DA 4MN0A 2RGIA 4MZLA 4GNKB 1B9AA 1W7IB 3I5IC 1ALWA 3D74A 1GGWA 1RROA 4MRXA 1TUJA 1R2UA 3BFAA 4D1EA 4MBEA 4GGFC 1G4YR 4CPVA 4L9MA 4YI8A 2L2EA 3TDIA 2JXLA 1XFXO 1Z4HA 2L2CA 1F70A 2ZNEA 5HL1A 3K1EA 3WHUB 5GQQC 1UHIA 3JVTB 1LA3A 1MF8B 3DXLA 3B86A 1Y1AA 4UPGA 1OOIX 1C3YA 1N2DA 1JWDA 3EK7A 3BJHA 2K60A 1KWOB 2F3ZA 2AUCA 1XFVO 2JULA 2BCXA 2L98A 3NSKA 1XK4A 1YUTA 2Y1NA 1T14A 3ICBA 4JWQA 1AUIB 3SG2A 1IGVA 3TUYB 1Y1XA 1IIOA 2M3WA 2JT8A 1P28A 2PQLA 2WCMA 4DRWA 1AHRA 3LCPC 1A2XA 1ALVA 1DC1A 2Y4QA 3GK4X 1U5IA 2O60A 3SS4A 1S3PA 2JU0A 2QACA 2BECA 4YGAA 2E6WA 1Y0VH 5HLVA 1ZMZA 5HKWA 2ZN8A 1KQMB 1JBAA 3BOWB 3SG3A 1MQ1A 3ZNIA 3DZTA 2LVKA 2JNFA 3JVTC 1S1EA 3BFBA 1EH2A 1H8BA 3Q8IA 5DKQA 1SNLA 3PN7C 2M49B 3VGOA 1QTXA 5D7FA 2WOSA 2ZN9A 5D69A 3SG7A 1KWOC 3S0AA 1X02A 1CDPA 3OHMB 3R1OA 1CKKA 1MHOA 3CABA 2F8PA 4HRHA 2GGMA 3O2PA 4N5XA 1ODBA 1YX8A 1OMRA 5ER5A 1RECA 3B6XA 3O6BA 3PM8A 2M0RA
chains in the Genus database with same CATH topology
2FOTA 3NSIA 1F4QA 4PE4A 1L7ZA 4PHMA 1XO5A 1A03A 5HKYA 2MA2A 2TN4A 5HLOA 1JSAA 2KFHA 1QLSA 1KFUL 5F6TA 4PE7A 1KFXL 4M2QA 1M45A 1SRAA 2LCPA 2OS8B 1GJYA 4N1GA 2CBLA 4PHNA 1J1DA 2K2FA 1CLLA 4N1FA 1QVIY 1JUOA 3DVJA 1QXPA 1LKJA 3I5HB 1CM1A 1TOPA 3CS1A 5PALA 2K7BA 1VRKA 2KGBC 2A4JA 1F55A 4GAOA 2LUCA 4PCWA 1JF0A 1OMVA 1PVBA 4OVNF 4XJKA 2EGDA 3TS5B 3KPXA 1KK7Z 2WNDA 1SL7A 3DF0B 1M31A 2LNKA 5HKZA 2JPTA 2GGZA 5CSJA 3BUWB 1KCYA 2F33A 4MSPA 3DVMA 1DJGA 3D0YA 3EK8A 1TNXA 2ZRTA 1CFCA 2KBIA 2M7NA 2KBMA 1C07A 2F2PA 3BUOB 1UWOA 2JC2A 3IF7A 1QJTA 3AAKA 5TNCA 2FCDA 3NSOA 3GOFA 3KHEA 4MEWA 3WHTB 2Y1MA 4MRYA 4OCIA 1HT9A 4P5OE 1BODA 3CZTX 3I5HC 1UHNA 1CDMA 1QX5B 1IJ5A 1IRJA 2OTGB 4ZCUA 2M1UA 1YRTB 5AANA 1S26D 5ER4X 3LLEA 1M39A 2LC5A 4QJ4B 5KU1A 4DIRA 2O5GA 1KK8B 1N65A 3D10A 3TS5C 1UP5A 1SYMA 2KAXA 1PALA 3IQOA 4AOMA 1NCZA 1TCFA 3PALA 1FW4A 1OE9B 2BBMA 1EXRA 1PRWA 3RLZA 2CNPA 2I18A 2R2IA 2JQ6A 2BL0B 1K8UA 1YTZC 4ETOA 2KFGA 2K8MB 3CLNA 2MBXA 1CFDA 2KAVA 1GQMA 5AFPA 1FI6A 2F2OA 3PFVA 4GFTA 4I5NB 3EKHA 4PALA 3FWCA 2KDHA 1AJ5A 3I5FB 4YGBB 2LVVA 2COLB 2KYFA 3TZ1A 1QX7A 2I94A 1B47A 1DJZA 1QVIZ 1UHKA 2KI6C 3BOWA 3AKBA 3BXKA 4ORBB 2WCFA 1AP4A 1QATA 1SKTA 3DD4A 3SJSA 4DS7A 1C7VA 1KK8C 1OZSA 4YGEB 1K95A 1PSBA 1KFUS 1K90D 3LK0A 1BU3A 5AERA 1Y6WA 2KOTA 3VROA 1B4CA 2JRFA 4GGNA 1DMOA 2BCBA 1R6PA 2PRUA 1SY9A 1C7WA 4ORAB 4MZJA 2KYCA 1F8HA 3VRRA 1M46A 1NX0A 2BL0C 2M1KB 4U8DA 4MVFA 4YGCB 5IBWA 1UHJA 1K9KA 2Q4UA 1TRFA 2NCOA 2OPOA 3CGAA 3SG6A 1S6CA 2LMUA 1RTP1 3H4SE 3RM1A 1WRZA 4MZKA 3I5FC 4DCKA 1IWQA 4YRUA 2HETA 3AAJA 2H2KA 4AQIA 2JT0A 4NDDA 2JTTA 2PMYA 2KQYA 1UUSA 1TIZA 5I2QA 4WRIA 4NDBA 1W7JB 2JOJA 3SG4A 3TUYC 4CFRA 3I5GB 4WQ2A 1K9UA 4OR9B 2BKHB 3DVEA 3C1VA 3VRNA 1HQVA 1CDLA 2M8UA 3OB2B 3OX6A 1KQMC 3DF0A 4IL1A 1JC2A 5K89A 1D1OA 1SCVA 4I5JA 1CNPA 1F4OA 2KI6D 1DJXA 4I5KA 1XFWO 2NZ0A 5BPJA 2EC6B 1NWDA 3OP0A 1SW8A 1LXFC 4PE1A 1IQ5A 5CPVA 1NIWA 2M29A 5AXIA 3EVUA 3K21A 1QV0A 3VRPA 4QJ5B 1J7PA 1YR5A 4YBHB 3KEVA 1A4PA 5FYXA 1KSMA 1IJ6A 2BBNA 1CMGA 1CLMA 3BYAA 2B1UA 2I2RE 1DGVA 1K9PA 1DF0B 2H61A 5JOLA 1LA0A 2LMTA 1XFYO 1WLZA 2BE6A 3DVKA 2ZNDA 4M2OA 3NSLA 1E8AA 2FJUB 3CR4X 3KF9A 2OS8C 3SIAA 4FQOA 2BKIB 2FCEA 2V53A 2M97A 3A8RA 2SASA 1SR6B 2JT3A 1EG3A 2KAYA 2WORA 1TNQA 4FTGA 1PSRA 1B8LA 1DJYA 4OKHA 2KQ6A 4ICBA 5I8NA 5G08A 3SG5A 1V1FA 2KHNA 2K7OA 2JXCA 2LP3A 2BE4A 2WCBA 4DUQA 1RFJA 1G8IA 2LLSA 5KSZA 2Y5IA 3I5IB 3E3RA 3JTDB 1OOJA 1QIWA 1MXEA 3TDUA 1QIVA 1SBJA 1NPQA 1TN4A 1A75B 1NX1A 3BQ3A 3F45A 2KNEA 1WLMA 1FI5A 1S6JA 1JFKA 3CR2A 3O4YA 3LK1A 4YGDB 1B8RA 2I7AA 2LV7A 1YRUB 2L5XB 3NXAA 1S5GY 1NUBA 1DT7B 1EG4A 1ZUZA 1ZOTB 5DKNA 1CB1A 1PK0D 2NCPA 2JNXA 4OV2A 2L51A 3VRQA 4YI9A 1A29A 3FIAA 1EL4A 1K94A 2LHLA 4HREE 2PASA 3EVVA 1BJFA 4C0JA 1WRKA 2P6BB 1K93D 1MR8A 1QS7A 1S36A 5J3XA 1IG5A 2H61C 3EVRA 4M2PA 2OTGC 1QLKA 1OSAA 1SL8A 3JTDC 4MLWA 3AKAA 4E68A 2LVIA 2AMIA 2L0PA 2ISDA 1DJHA 1TNPA 1LVCD 2JWWA 4P2YB 4GBAA 2K0JA 1J1EA 2LVJA 3MSEB 2NLNA 3IQQA 1YURA 2KFFA 5CSIA 1SMGA 1KFXS 3A4UB 1KQVA 2JTZA 1XYDA 2MHHA 4CLNA 1NCXA 4R1EA 3WNXB 1J55A 3PN7B 1S6IA 1YX7A 1ZACA 1WY9A 1DJWA 1V1GA 2LHIA 2QPTA 1B1GA 1XFUO 2ZRSA 1CDNA 1CFFA 1EJ3A 1SK6D 2Q91A 1OMDA 2LUXA 2L50A 4QJ3B 1BG1A 2HQWA 5HYDA 4GPLB 1NP8A 1AJ4A 2PALA 1KK7Y 4NQGA 1N0YA 1YUSA 2LM5A 3EK4A 3GK2A 3ZWHA 2HPSA 1QX2A 1DVIA 3KO0A 1OQPA 3O78A 4HSZA 3QRXA 2L4HA 2HF5A 2K61A 2ZKMX 1B7TY 1NX3A 1SCMB 4Q04A 1LINA 2LLUA 2KSPA 2KI4B 5JJGA 1NX2A 3CWGA 1FBVA 2MRDA 1J7RA 1PULA 1MXLC 1RWYA 1BLQA 3GK1A 2K7DA 2WC8A 2MJWB 1UHHA 2CTNA 1M63B 4XYNA 3BUNB 1IQ3A 2JZIA 2VRGA 3HCMA 3PATA 1MUXA 1AK8A 1S5GZ 1H4BA 1F54A 1XA5A 1DF0A 4PHJA 4ZCVA 4JPZB 4BY5A 2BCAA 1CFPA 2LAPA 1YUUA 1IKUA 1MWNA 5CSNA 3TDZA 1U5IB 1CM4A 4TNCA 3CR5X 4A4CA 2M7LA 4WQ3A 2LANA 1BMOA 1OZOA 1Q80A 2ZFDA 1CTRA 2MLEC 5KTYA 1IH0A 1TCOB 2CCMA 1L2OB 2DOQA 2LMVA 1WDCB 4HRGA 4PE0A 1CLBA 1BR4B 3HX4A 2K7CA 1SCMC 4AQJA 1TNWA 3LL8B 2LP2A 2KI4C 3I5GC 5B8IB 3PLFB 2G2BA 2L4IA 4PHKA 1Y1UA 2MAZA 1BF5A 1FF1A 1K96A 1KSOA 1XK4C 1SPYA 1B8CA 1DJIA 2D8NA 4CIDA 1QV1A 2IS9A 4C0KA 4GGFA 1A75A 1NCYA 4F0ZB 2PVBA 2PSRA 2CXJA 5I2OA 3BUXB 3PSRA 4NDCA 1BT6A 2M9GA 1DTLA 1XFZO 2EC6C 2SCPA 4C0LA 2LLTA 3WXAA 3FWBA 1NSHA 1ZFSA 2GV5A 4USLA 5CSFA 1YVHA 2F3YA 4BY4A 1JFJA 3OB1B 1WRLA 4ORCB 1UURA 1L2OC 1WDCC 1BR1B 3EKJA 1TTXA 3OX5A 1G33A 4CFQA 2LE9B 2K2AA 5AEQA 1RJVA 1QASA 1RK9A 2KGRA 3BUMB 4JQ0D 1B7TZ 4A4BA 5I2LA 1FPWA 1F71A 1DGUA 1SL9A 4GUKA 2EHBA 1J7QA 3M0WA 1K2HA 2G9BA 1XVJA 3CTNA 2AAOA 4I5LB 3SIBA 1BOCA 1AVSA 2WCEA 4XJKB 1JF2A 1SR6C 1J7OA 1YVLA 3D0YB 2CT9A 1GGZA 2MLFC 1CMFA 1PVAA 4PDZA 2NXQA 1NYAA 2E30A 3FS7A 5DKRA 2HQ8A 4MN0A 2RGIA 4MZLA 4GNKB 1B9AA 1W7IB 3I5IC 1ALWA 1GGWA 1RROA 4MRXA 1R2UA 4D1EA 4MBEA 4GGFC 1G4YR 4CPVA 4L9MA 4YI8A 2L2EA 3TDIA 2JXLA 1XFXO 1F70A 2ZNEA 3WHUB 5GQQC 1UHIA 3JVTB 1LA3A 1MF8B 1Y1AA 4UPGA 1N2DA 1JWDA 3EK7A 1KWOB 2F3ZA 2AUCA 1XFVO 2JULA 2BCXA 2L98A 3NSKA 1XK4A 1YUTA 2Y1NA 3ICBA 4JWQA 1AUIB 3SG2A 1IGVA 3TUYB 1Y1XA 2M3WA 2JT8A 4DRWA 1AHRA 3LCPC 1A2XA 1ALVA 2Y4QA 3GK4X 1U5IA 2O60A 1S3PA 2JU0A 2QACA 2BECA 4YGAA 2E6WA 1Y0VH 5HLVA 1ZMZA 5HKWA 2ZN8A 1KQMB 1JBAA 3BOWB 3SG3A 1MQ1A 3ZNIA 2LVKA 2JNFA 3JVTC 1S1EA 1EH2A 1H8BA 5DKQA 1SNLA 3PN7C 2M49B 3VGOA 1QTXA 5D7FA 2WOSA 2ZN9A 5D69A 3SG7A 1KWOC 1X02A 1CDPA 3OHMB 1CKKA 1MHOA 2F8PA 4HRHA 2GGMA 3O2PA 4N5XA 1ODBA 1YX8A 1OMRA 5ER5A 1RECA 3O6BA 3PM8A 2M0RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FOT A;  3NSI A;  1F4Q A;  4PE4 A;  1L7Z A;  4PHM A;  1XO5 A;  1A03 A;  5HKY A;  2MA2 A;  2TN4 A;  5HLO A;  1JSA A;  2KFH A;  1QLS A;  1KFU L;  5F6T A;  4PE7 A;  1KFX L;  4M2Q A;  1M45 A;  1SRA A;  2LCP A;  2OS8 B;  1GJY A;  4N1G A;  2CBL A;  4PHN A;  1J1D A;  2K2F A;  1CLL A;  4N1F A;  1QVI Y;  1JUO A;  3DVJ A;  1QXP A;  1LKJ A;  3I5H B;  1CM1 A;  1TOP A;  3CS1 A;  5PAL A;  2K7B A;  1VRK A;  2KGB C;  2A4J A;  1F55 A;  4GAO A;  2LUC A;  4PCW A;  1JF0 A;  1OMV A;  1PVB A;  4OVN F;  4XJK A;  2EGD A;  3TS5 B;  3KPX A;  1KK7 Z;  2WND A;  1SL7 A;  3DF0 B;  1M31 A;  2LNK A;  5HKZ A;  2JPT A;  2GGZ A;  5CSJ A;  3BUW B;  1KCY A;  2F33 A;  4MSP A;  3DVM A;  1DJG A;  3D0Y A;  3EK8 A;  1TNX A;  2ZRT A;  1CFC A;  2KBI A;  2M7N A;  2KBM A;  1C07 A;  2F2P A;  3BUO B;  1UWO A;  2JC2 A;  3IF7 A;  1QJT A;  3AAK A;  5TNC A;  2FCD A;  3NSO A;  3GOF A;  3KHE A;  4MEW A;  3WHT B;  2Y1M A;  4MRY A;  4OCI A;  1HT9 A;  4P5O E;  1BOD A;  3CZT X;  3I5H C;  1UHN A;  1CDM A;  1QX5 B;  1IJ5 A;  1IRJ A;  2OTG B;  4ZCU A;  2M1U A;  1YRT B;  5AAN A;  1S26 D;  5ER4 X;  3LLE A;  1M39 A;  2LC5 A;  4QJ4 B;  5KU1 A;  4DIR A;  2O5G A;  1KK8 B;  1N65 A;  3D10 A;  3TS5 C;  1UP5 A;  1SYM A;  2KAX A;  1PAL A;  3IQO A;  4AOM A;  1NCZ A;  1TCF A;  3PAL A;  1FW4 A;  1OE9 B;  2BBM A;  1EXR A;  1PRW A;  3RLZ A;  2CNP A;  2I18 A;  2R2I A;  2JQ6 A;  2BL0 B;  1K8U A;  1YTZ C;  4ETO A;  2KFG A;  2K8M B;  3CLN A;  2MBX A;  1CFD A;  2KAV A;  1GQM A;  5AFP A;  1FI6 A;  2F2O A;  3PFV A;  4GFT A;  4I5N B;  3EKH A;  4PAL A;  3FWC A;  2KDH A;  1AJ5 A;  3I5F B;  4YGB B;  2LVV A;  2COL B;  2KYF A;  3TZ1 A;  1QX7 A;  2I94 A;  1B47 A;  1DJZ A;  1QVI Z;  1UHK A;  2KI6 C;  3BOW A;  3AKB A;  3BXK A;  4ORB B;  2WCF A;  1AP4 A;  1QAT A;  1SKT A;  3DD4 A;  3SJS A;  4DS7 A;  1C7V A;  1KK8 C;  1OZS A;  4YGE B;  1K95 A;  1PSB A;  1KFU S;  1K90 D;  3LK0 A;  1BU3 A;  5AER A;  1Y6W A;  2KOT A;  3VRO A;  1B4C A;  2JRF A;  4GGN A;  1DMO A;  2BCB A;  1R6P A;  2PRU A;  1SY9 A;  1C7W A;  4ORA B;  4MZJ A;  2KYC A;  1F8H A;  3VRR A;  1M46 A;  1NX0 A;  2BL0 C;  2M1K B;  4U8D A;  4MVF A;  4YGC B;  5IBW A;  1UHJ A;  1K9K A;  2Q4U A;  1TRF A;  2NCO A;  2OPO A;  3CGA A;  3SG6 A;  1S6C A;  2LMU A;  1RTP 1;  3H4S E;  3RM1 A;  1WRZ A;  4MZK A;  3I5F C;  4DCK A;  1IWQ A;  4YRU A;  2HET A;  3AAJ A;  2H2K A;  4AQI A;  2JT0 A;  4NDD A;  2JTT A;  2PMY A;  2KQY A;  1UUS A;  1TIZ A;  5I2Q A;  4WRI A;  4NDB A;  1W7J B;  2JOJ A;  3SG4 A;  3TUY C;  4CFR A;  3I5G B;  4WQ2 A;  1K9U A;  4OR9 B;  2BKH B;  3DVE A;  3C1V A;  3VRN A;  1HQV A;  1CDL A;  2M8U A;  3OB2 B;  3OX6 A;  1KQM C;  3DF0 A;  4IL1 A;  1JC2 A;  5K89 A;  1D1O A;  1SCV A;  4I5J A;  1CNP A;  1F4O A;  2KI6 D;  1DJX A;  4I5K A;  1XFW O;  2NZ0 A;  5BPJ A;  2EC6 B;  1NWD A;  3OP0 A;  1SW8 A;  1LXF C;  4PE1 A;  1IQ5 A;  5CPV A;  1NIW A;  2M29 A;  5AXI A;  3EVU A;  3K21 A;  1QV0 A;  3VRP A;  4QJ5 B;  1J7P A;  1YR5 A;  4YBH B;  3KEV A;  1A4P A;  5FYX A;  1KSM A;  1IJ6 A;  2BBN A;  1CMG A;  1CLM A;  3BYA A;  2B1U A;  2I2R E;  1DGV A;  1K9P A;  1DF0 B;  2H61 A;  5JOL A;  1LA0 A;  2LMT A;  1XFY O;  1WLZ A;  2BE6 A;  3DVK A;  2ZND A;  4M2O A;  3NSL A;  1E8A A;  2FJU B;  3CR4 X;  3KF9 A;  2OS8 C;  3SIA A;  4FQO A;  2BKI B;  2FCE A;  2V53 A;  2M97 A;  3A8R A;  2SAS A;  1SR6 B;  2JT3 A;  1EG3 A;  2KAY A;  2WOR A;  1TNQ A;  4FTG A;  1PSR A;  1B8L A;  1DJY A;  4OKH A;  2KQ6 A;  4ICB A;  5I8N A;  5G08 A;  3SG5 A;  1V1F A;  2KHN A;  2K7O A;  2JXC A;  2LP3 A;  2BE4 A;  2WCB A;  4DUQ A;  1RFJ A;  1G8I A;  2LLS A;  5KSZ A;  2Y5I A;  3I5I B;  3E3R A;  3JTD B;  1OOJ A;  1QIW A;  1MXE A;  3TDU A;  1QIV A;  1SBJ A;  1NPQ A;  1TN4 A;  1A75 B;  1NX1 A;  3BQ3 A;  3F45 A;  2KNE A;  1WLM A;  1FI5 A;  1S6J A;  1JFK A;  3CR2 A;  3O4Y A;  3LK1 A;  4YGD B;  1B8R A;  2I7A A;  2LV7 A;  1YRU B;  2L5X B;  3NXA A;  1S5G Y;  1NUB A;  1DT7 B;  1EG4 A;  1ZUZ A;  1ZOT B;  5DKN A;  1CB1 A;  1PK0 D;  2NCP A;  2JNX A;  4OV2 A;  2L51 A;  3VRQ A;  4YI9 A;  1A29 A;  3FIA A;  1EL4 A;  1K94 A;  2LHL A;  4HRE E;  2PAS A;  3EVV A;  1BJF A;  4C0J A;  1WRK A;  2P6B B;  1K93 D;  1MR8 A;  1QS7 A;  1S36 A;  5J3X A;  1IG5 A;  2H61 C;  3EVR A;  4M2P A;  2OTG C;  1QLK A;  1OSA A;  1SL8 A;  3JTD C;  4MLW A;  3AKA A;  4E68 A;  2LVI A;  2AMI A;  2L0P A;  2ISD A;  1DJH A;  1TNP A;  1LVC D;  2JWW A;  4P2Y B;  4GBA A;  2K0J A;  1J1E A;  2LVJ A;  3MSE B;  2NLN A;  3IQQ A;  1YUR A;  2KFF A;  5CSI A;  1SMG A;  1KFX S;  3A4U B;  1KQV A;  2JTZ A;  1XYD A;  2MHH A;  4CLN A;  1NCX A;  4R1E A;  3WNX B;  1J55 A;  3PN7 B;  1S6I A;  1YX7 A;  1ZAC A;  1WY9 A;  1DJW A;  1V1G A;  2LHI A;  2QPT A;  1B1G A;  1XFU O;  2ZRS A;  1CDN A;  1CFF A;  1EJ3 A;  1SK6 D;  2Q91 A;  1OMD A;  2LUX A;  2L50 A;  4QJ3 B;  1BG1 A;  2HQW A;  5HYD A;  4GPL B;  1NP8 A;  1AJ4 A;  2PAL A;  1KK7 Y;  4NQG A;  1N0Y A;  1YUS A;  2LM5 A;  3EK4 A;  3GK2 A;  3ZWH A;  2HPS A;  1QX2 A;  1DVI A;  3KO0 A;  1OQP A;  3O78 A;  4HSZ A;  3QRX A;  2L4H A;  2HF5 A;  2K61 A;  2ZKM X;  1B7T Y;  1NX3 A;  1SCM B;  4Q04 A;  1LIN A;  2LLU A;  2KSP A;  2KI4 B;  5JJG A;  1NX2 A;  3CWG A;  1FBV A;  2MRD A;  1J7R A;  1PUL A;  1MXL C;  1RWY A;  1BLQ A;  3GK1 A;  2K7D A;  2WC8 A;  2MJW B;  1UHH A;  2CTN A;  1M63 B;  4XYN A;  3BUN B;  1IQ3 A;  2JZI A;  2VRG A;  3HCM A;  3PAT A;  1MUX A;  1AK8 A;  1S5G Z;  1H4B A;  1F54 A;  1XA5 A;  1DF0 A;  4PHJ A;  4ZCV A;  4JPZ B;  4BY5 A;  2BCA A;  1CFP A;  2LAP A;  1YUU A;  1IKU A;  1MWN A;  5CSN A;  3TDZ A;  1U5I B;  1CM4 A;  4TNC A;  3CR5 X;  4A4C A;  2M7L A;  4WQ3 A;  2LAN A;  1BMO A;  1OZO A;  1Q80 A;  2ZFD A;  1CTR A;  2MLE C;  5KTY A;  1IH0 A;  1TCO B;  2CCM A;  1L2O B;  2DOQ A;  2LMV A;  1WDC B;  4HRG A;  4PE0 A;  1CLB A;  1BR4 B;  3HX4 A;  2K7C A;  1SCM C;  4AQJ A;  1TNW A;  3LL8 B;  2LP2 A;  2KI4 C;  3I5G C;  5B8I B;  3PLF B;  2G2B A;  2L4I A;  4PHK A;  1Y1U A;  2MAZ A;  1BF5 A;  1FF1 A;  1K96 A;  1KSO A;  1XK4 C;  1SPY A;  1B8C A;  1DJI A;  2D8N A;  4CID A;  1QV1 A;  2IS9 A;  4C0K A;  4GGF A;  1A75 A;  1NCY A;  4F0Z B;  2PVB A;  2PSR A;  2CXJ A;  5I2O A;  3BUX B;  3PSR A;  4NDC A;  1BT6 A;  2M9G A;  1DTL A;  1XFZ O;  2EC6 C;  2SCP A;  4C0L A;  2LLT A;  3WXA A;  3FWB A;  1NSH A;  1ZFS A;  2GV5 A;  4USL A;  5CSF A;  1YVH A;  2F3Y A;  4BY4 A;  1JFJ A;  3OB1 B;  1WRL A;  4ORC B;  1UUR A;  1L2O C;  1WDC C;  1BR1 B;  3EKJ A;  1TTX A;  3OX5 A;  1G33 A;  4CFQ A;  2LE9 B;  2K2A A;  5AEQ A;  1RJV A;  1QAS A;  1RK9 A;  2KGR A;  3BUM B;  4JQ0 D;  1B7T Z;  4A4B A;  5I2L A;  1FPW A;  1F71 A;  1DGU A;  1SL9 A;  4GUK A;  2EHB A;  1J7Q A;  3M0W A;  1K2H A;  2G9B A;  1XVJ A;  3CTN A;  2AAO A;  4I5L B;  3SIB A;  1BOC A;  1AVS A;  2WCE A;  4XJK B;  1JF2 A;  1SR6 C;  1J7O A;  1YVL A;  3D0Y B;  2CT9 A;  1GGZ A;  2MLF C;  1CMF A;  1PVA A;  4PDZ A;  2NXQ A;  1NYA A;  2E30 A;  3FS7 A;  5DKR A;  2HQ8 A;  4MN0 A;  2RGI A;  4MZL A;  4GNK B;  1B9A A;  1W7I B;  3I5I C;  1ALW A;  1GGW A;  1RRO A;  4MRX A;  1R2U A;  4D1E A;  4MBE A;  4GGF C;  1G4Y R;  4CPV A;  4L9M A;  4YI8 A;  2L2E A;  3TDI A;  2JXL A;  1XFX O;  1F70 A;  2ZNE A;  3WHU B;  5GQQ C;  1UHI A;  3JVT B;  1LA3 A;  1MF8 B;  1Y1A A;  4UPG A;  1N2D A;  1JWD A;  3EK7 A;  1KWO B;  2F3Z A;  2AUC A;  1XFV O;  2JUL A;  2BCX A;  2L98 A;  3NSK A;  1XK4 A;  1YUT A;  2Y1N A;  3ICB A;  4JWQ A;  1AUI B;  3SG2 A;  1IGV A;  3TUY B;  1Y1X A;  2M3W A;  2JT8 A;  4DRW A;  1AHR A;  3LCP C;  1A2X A;  1ALV A;  2Y4Q A;  3GK4 X;  1U5I A;  2O60 A;  1S3P A;  2JU0 A;  2QAC A;  2BEC A;  4YGA A;  2E6W A;  1Y0V H;  5HLV A;  1ZMZ A;  5HKW A;  2ZN8 A;  1KQM B;  1JBA A;  3BOW B;  3SG3 A;  1MQ1 A;  3ZNI A;  2LVK A;  2JNF A;  3JVT C;  1S1E A;  1EH2 A;  1H8B A;  5DKQ A;  1SNL A;  3PN7 C;  2M49 B;  3VGO A;  1QTX A;  5D7F A;  2WOS A;  2ZN9 A;  5D69 A;  3SG7 A;  1KWO C;  1X02 A;  1CDP A;  3OHM B;  1CKK A;  1MHO A;  2F8P A;  4HRH A;  2GGM A;  3O2P A;  4N5X A;  1ODB A;  1YX8 A;  1OMR A;  5ER5 A;  1REC A;  3O6B A;  3PM8 A;  2M0R A; 
#chains in the Genus database with same CATH topology
 2FOT A;  3NSI A;  1F4Q A;  4PE4 A;  1L7Z A;  4PHM A;  1XO5 A;  1A03 A;  5HKY A;  2MA2 A;  2TN4 A;  5HLO A;  1JSA A;  2KFH A;  1QLS A;  1KFU L;  5F6T A;  4PE7 A;  1KFX L;  4M2Q A;  1M45 A;  2QEV A;  1SRA A;  2LCP A;  2OS8 B;  1GJY A;  4N1G A;  2CBL A;  4PHN A;  1J1D A;  2K2F A;  1CLL A;  2KPH A;  4N1F A;  1QVI Y;  3VB1 A;  1JUO A;  3DVJ A;  1QXP A;  1LKJ A;  3I5H B;  1CM1 A;  1TOP A;  3CS1 A;  5PAL A;  2K7B A;  1VRK A;  2KGB C;  2A4J A;  4INW A;  1F55 A;  4GAO A;  2LUC A;  4PCW A;  1JF0 A;  1OMV A;  3S0F A;  1PVB A;  3D77 A;  4OVN F;  4XJK A;  2EGD A;  3TS5 B;  3KPX A;  1KK7 Z;  2WND A;  1SL7 A;  3DF0 B;  1M31 A;  2LNK A;  5HKZ A;  2JPT A;  3L4L A;  2GGZ A;  5CSJ A;  2WCL A;  3BUW B;  3CZ0 A;  1KCY A;  2F33 A;  4MSP A;  3DVM A;  1DJG A;  3D0Y A;  3EK8 A;  1TNX A;  2ZRT A;  1CFC A;  2KBI A;  2M7N A;  3FE9 A;  2KBM A;  2PYQ A;  1C07 A;  2F2P A;  3BUO B;  1OOG A;  1UWO A;  2JC2 A;  3IF7 A;  1QJT A;  3AAK A;  5TNC A;  2FCD A;  3NSO A;  3GOF A;  3KHE A;  4MEW A;  3WHT B;  2Y1M A;  4MRY A;  4OCI A;  1HT9 A;  1XFR A;  4P5O E;  1BOD A;  1Z2C B;  3D75 A;  3CZT X;  3I5H C;  1UHN A;  1CDM A;  1QX5 B;  1IJ5 A;  1IRJ A;  2OTG B;  4ZCU A;  2M1U A;  1YRT B;  2QEO A;  5AAN A;  1S26 D;  5ER4 X;  3LLE A;  2QEH A;  1DEL A;  1M39 A;  2LC5 A;  4QJ4 B;  5KU1 A;  4DIR A;  2O5G A;  1KK8 B;  1N65 A;  3D10 A;  3TS5 C;  1UP5 A;  1SYM A;  2KAX A;  1PAL A;  3IQO A;  4AOM A;  1NCZ A;  1TCF A;  3NGV A;  3RZS A;  1C3Z A;  3PAL A;  1FW4 A;  5D3O A;  1OE9 B;  1OOF A;  2BBM A;  1EXR A;  4OZD A;  1PRW A;  3RLZ A;  2CNP A;  2I18 A;  2R2I A;  2JQ6 A;  2BL0 B;  2H8V A;  1K8U A;  1GM0 A;  3B7A A;  1YTZ C;  4ETO A;  2KFG A;  5FI6 A;  2K8M B;  3CLN A;  2MBX A;  3O4X A;  1CFD A;  2KAV A;  1GQM A;  1OW4 A;  5AFP A;  2F2O A;  3PFV A;  4GFT A;  4I5N B;  1FI6 A;  3EKH A;  4PAL A;  3FWC A;  2KDH A;  1AJ5 A;  3I5F B;  3OBV A;  4YGB B;  2LVV A;  2COL B;  2KYF A;  3TZ1 A;  1QX7 A;  2I94 A;  1B47 A;  1DJZ A;  1QVI Z;  1UHK A;  2KI6 C;  3BOW A;  1TWO A;  5I94 A;  3AKB A;  3BXK A;  4ORB B;  2WCF A;  1AP4 A;  1QAT A;  1SKT A;  3DD4 A;  3SJS A;  4DS7 A;  2P71 A;  3NHI A;  1C7V A;  3UO9 A;  1KK8 C;  1OZS A;  4YGE B;  1OOH A;  1K95 A;  1PSB A;  1KFU S;  1K90 D;  3LK0 A;  1BU3 A;  5AER A;  1Y6W A;  2KOT A;  3VRO A;  1B4C A;  2JRF A;  4GGN A;  1DMO A;  1ORG A;  1R6P A;  2BCB A;  2PRU A;  1SY9 A;  1C7W A;  4ORA B;  4MZJ A;  2KYC A;  1F8H A;  3VRR A;  1M46 A;  1NX0 A;  3PJI A;  2KLE A;  2BL0 C;  2M1K B;  4U8D A;  4MVF A;  4YGC B;  5IBW A;  1UHJ A;  1K9K A;  2Q4U A;  1TRF A;  2NCO A;  2OPO A;  3CGA A;  3S0B A;  3SG6 A;  1S6C A;  2LMU A;  2WC6 A;  1RTP 1;  3SS3 A;  3H4S E;  3RM1 A;  1WRZ A;  4MZK A;  3I5F C;  4DCK A;  1IWQ A;  4YRU A;  2HET A;  3L4A A;  3AAJ A;  2H2K A;  4AQI A;  2JT0 A;  3D78 A;  4NDD A;  2JTT A;  2BAP A;  2PMY A;  2KQY A;  1UUS A;  1TIZ A;  1W9Z A;  5I2Q A;  4WRI A;  4NDB A;  3UNW A;  1W7J B;  2JOJ A;  3SG4 A;  3TUY C;  4CFR A;  3I5G B;  4WQ2 A;  1K9U A;  4OR9 B;  2BKH B;  3DVE A;  1CFF A;  3CYZ A;  3C1V A;  3VRN A;  5FI2 A;  1HQV A;  1CDL A;  2M8U A;  3OB2 B;  3OX6 A;  1KQM C;  3DF0 A;  4IL1 A;  1JC2 A;  5K89 A;  1D1O A;  1SCV A;  4I5J A;  1CNP A;  1F4O A;  2KI6 D;  1DJX A;  4I5K A;  1XFW O;  2NZ0 A;  5BPJ A;  2EC6 B;  1NWD A;  3OP0 A;  1SW8 A;  1LXF C;  4PE1 A;  4KYN A;  1IQ5 A;  5CPV A;  1NIW A;  2M29 A;  2WC5 A;  5AXI A;  3QME A;  3EVU A;  3K21 A;  1QV0 A;  3VRP A;  3S0G A;  4QJ5 B;  1J7P A;  1YR5 A;  4YBH B;  3KEV A;  3SS5 A;  1A4P A;  5FYX A;  1KSM A;  1IJ6 A;  2BBN A;  1CMG A;  1CLM A;  3BYA A;  2B1U A;  2I2R E;  1DGV A;  3CZ2 A;  1K9P A;  1DF0 B;  2H61 A;  5JOL A;  1LA0 A;  2LMT A;  1XFY O;  1WLZ A;  2BE6 A;  3DVK A;  2ZND A;  4M2O A;  3NSL A;  1E8A A;  2FJU B;  3R1V A;  3CR4 X;  3KF9 A;  2OS8 C;  3SIA A;  3B87 A;  2BKI B;  4FQO A;  2FCE A;  2V53 A;  2M97 A;  3A8R A;  2SAS A;  1SR6 B;  2JT3 A;  1EG3 A;  2KAY A;  2WOR A;  3N7H A;  1TNQ A;  4FTG A;  1PSR A;  1B8L A;  1DJY A;  4OKH A;  2KQ6 A;  4ICB A;  5I8N A;  5G08 A;  3V2L A;  3SG5 A;  3DYE A;  1V1F A;  2KHN A;  2K7O A;  2JXC A;  2LP3 A;  2BE4 A;  2WCB A;  4DUQ A;  1RFJ A;  1G8I A;  2LLS A;  4F7F A;  2Y5I A;  3I5I B;  3E3R A;  3JTD B;  3NHT A;  5KSZ A;  1OOJ A;  1QIW A;  1MXE A;  3TDU A;  1QIV A;  1SBJ A;  3D76 A;  3R1P A;  1NPQ A;  1TN4 A;  1A75 B;  1NX1 A;  3BQ3 A;  3F45 A;  2KNE A;  1WLM A;  1FI5 A;  1S6J A;  1JFK A;  3CR2 A;  3O4Y A;  3LK1 A;  4YGD B;  1B8R A;  2I7A A;  2LV7 A;  1YRU B;  2L5X B;  3NXA A;  1S5G Y;  1NUB A;  3EG5 B;  1DT7 B;  1EG4 A;  1ZUZ A;  1ZOT B;  5DKN A;  1CB1 A;  1PK0 D;  2NCP A;  2JNX A;  4OV2 A;  2L51 A;  3VRQ A;  4YI9 A;  1A29 A;  3FIA A;  1EL4 A;  1K94 A;  2WCH A;  2LHL A;  4HRE E;  2PAS A;  3EVV A;  1BJF A;  4C0J A;  2P70 A;  1DEK A;  1WRK A;  2P6B B;  2YGU A;  1K93 D;  1MR8 A;  1QS7 A;  1S36 A;  5J3X A;  1IG5 A;  2H61 C;  3EVR A;  4M2P A;  2OTG C;  1QLK A;  1OSA A;  1SL8 A;  3JTD C;  4MLW A;  3AKA A;  4E68 A;  2LVI A;  2AMI A;  2L0P A;  2ISD A;  1DJH A;  1TNP A;  1LVC D;  2JWW A;  4P2Y B;  4GBA A;  2K0J A;  1J1E A;  2LVJ A;  3MSE B;  2NLN A;  3IQQ A;  1YUR A;  2KFF A;  5CSI A;  2QEB A;  3CZ1 A;  1SMG A;  1KFX S;  3A4U B;  1KQV A;  2JTZ A;  1XYD A;  2MHH A;  4CLN A;  1SSE B;  1NCX A;  4R1E A;  3FE6 A;  3WNX B;  1J55 A;  2WCK A;  3PN7 B;  1S6I A;  1YX7 A;  1ZAC A;  1WY9 A;  1DJW A;  1V1G A;  2LHI A;  1TUZ A;  2QPT A;  1XFU O;  2ZRS A;  3CDN A;  1B1G A;  1EJ3 A;  1CDN A;  1SK6 D;  2Q91 A;  1OMD A;  2LUX A;  2L50 A;  4QJ3 B;  1BG1 A;  2HQW A;  5HYD A;  4GPL B;  1NP8 A;  3DY9 A;  3S0E A;  1AJ4 A;  2PAL A;  1KK7 Y;  4NQG A;  1N0Y A;  1YUS A;  2LM5 A;  3EK4 A;  3GK2 A;  3ZWH A;  2HPS A;  1QX2 A;  1DVI A;  3KO0 A;  1OQP A;  3O78 A;  4HSZ A;  3QRX A;  2L4H A;  2HF5 A;  2K61 A;  2ZKM X;  1B7T Y;  1NX3 A;  1SCM B;  2KLD A;  1LIN A;  2LLU A;  4Q04 A;  2KSP A;  2KI4 B;  5JJG A;  3R72 A;  1NX2 A;  3CWG A;  1FBV A;  2MRD A;  1J7R A;  4INX A;  1PUL A;  1MXL C;  1RWY A;  1BLQ A;  3GK1 A;  2K7D A;  2WC8 A;  2MJW B;  1UHH A;  2CTN A;  3D73 A;  1M63 B;  2ERB A;  4XYN A;  3BUN B;  1IQ3 A;  1DQE A;  2JZI A;  2VRG A;  3HCM A;  3PAT A;  1MUX A;  1AK8 A;  1S5G Z;  1H4B A;  3PM2 A;  1F54 A;  1XA5 A;  1DF0 A;  4PHJ A;  4ZCV A;  4JPZ B;  4BY5 A;  2BCA A;  1CFP A;  2LAP A;  1YUU A;  1IKU A;  1MWN A;  5CSN A;  3TDZ A;  1U5I B;  1CM4 A;  4TNC A;  3CR5 X;  4A4C A;  1LS8 A;  4WQ3 A;  2M7L A;  2LAN A;  1QWV A;  1BMO A;  1OZO A;  1Q80 A;  2ZFD A;  1CTR A;  2MLE C;  5KTY A;  1IH0 A;  2L5Y A;  1TCO B;  2CCM A;  1L2O B;  2DOQ A;  2LMV A;  1WDC B;  4HRG A;  4PE0 A;  1CLB A;  2BNX A;  1BR4 B;  3HX4 A;  2K7C A;  1SCM C;  4AQJ A;  1TNW A;  3LL8 B;  2LP2 A;  2KI4 C;  3I5G C;  5B8I B;  3PLF B;  2G2B A;  2L4I A;  4PHK A;  1Y1U A;  2MAZ A;  1BF5 A;  1FF1 A;  1K96 A;  1KSO A;  1XK4 C;  1SPY A;  1B8C A;  1DJI A;  2D8N A;  4CID A;  1QV1 A;  2IS9 A;  4C0K A;  3OGN A;  1A75 A;  1NCY A;  4GGF A;  4F0Z B;  2PVB A;  2PSR A;  2CXJ A;  5I2O A;  3BUX B;  3PSR A;  4JD9 A;  4NDC A;  1BT6 A;  2M9G A;  1DTL A;  1XFZ O;  2EC6 C;  2GTE A;  2SCP A;  4C0L A;  2LLT A;  3WXA A;  2QDI A;  3FWB A;  1NSH A;  1ZFS A;  2GV5 A;  3FE8 A;  4USL A;  5CSF A;  5DIC A;  1YVH A;  2F3Y A;  4BY4 A;  1JFJ A;  3OB1 B;  1WRL A;  4ORC B;  3IVT A;  1UUR A;  1L2O C;  2WCJ A;  1WDC C;  1BR1 B;  3EKJ A;  1TTX A;  3OX5 A;  3L47 A;  1G33 A;  4CFQ A;  2LE9 B;  2K2A A;  5AEQ A;  1RJV A;  1QAS A;  1RK9 A;  2KGR A;  3BUM B;  4JQ0 D;  1B7T Z;  4A4B A;  5I2L A;  1FPW A;  2JPO A;  1F71 A;  1DGU A;  1SL9 A;  2FJY A;  2EHB A;  4GUK A;  1J7Q A;  3BFH A;  3M0W A;  1K2H A;  2G9B A;  1XVJ A;  3CTN A;  5EL2 A;  2AAO A;  4I5L B;  3SIB A;  1BOC A;  1AVS A;  2WCE A;  4XJK B;  4PT1 A;  1JF2 A;  5FI7 A;  1SR6 C;  3B88 A;  1YVL A;  4IJ7 A;  3D0Y B;  1J7O A;  2CT9 A;  1GGZ A;  2MLF C;  4JKT A;  1CMF A;  1PVA A;  4PDZ A;  4FQT A;  2NXQ A;  1NYA A;  2E30 A;  3FS7 A;  5DKR A;  2HQ8 A;  3S0D A;  4MN0 A;  2RGI A;  4MZL A;  4GNK B;  1B9A A;  1W7I B;  3I5I C;  1ALW A;  3D74 A;  1GGW A;  1RRO A;  4MRX A;  1TUJ A;  1R2U A;  3BFA A;  4D1E A;  4MBE A;  4GGF C;  1G4Y R;  4CPV A;  4L9M A;  4YI8 A;  2L2E A;  3TDI A;  2JXL A;  1XFX O;  1Z4H A;  2L2C A;  1F70 A;  2ZNE A;  5HL1 A;  3K1E A;  3WHU B;  5GQQ C;  1UHI A;  3JVT B;  1LA3 A;  1MF8 B;  3DXL A;  3B86 A;  1Y1A A;  4UPG A;  1OOI X;  1C3Y A;  1N2D A;  1JWD A;  3EK7 A;  3BJH A;  2K60 A;  1KWO B;  2F3Z A;  2AUC A;  1XFV O;  2JUL A;  2BCX A;  2L98 A;  3NSK A;  1XK4 A;  1YUT A;  2Y1N A;  1T14 A;  3ICB A;  4JWQ A;  1AUI B;  3SG2 A;  1IGV A;  3TUY B;  1Y1X A;  1IIO A;  2M3W A;  2JT8 A;  1P28 A;  2PQL A;  2WCM A;  4DRW A;  1AHR A;  3LCP C;  1A2X A;  1ALV A;  1DC1 A;  2Y4Q A;  3GK4 X;  1U5I A;  2O60 A;  3SS4 A;  1S3P A;  2JU0 A;  2QAC A;  2BEC A;  4YGA A;  2E6W A;  1Y0V H;  5HLV A;  1ZMZ A;  5HKW A;  2ZN8 A;  1KQM B;  1JBA A;  3BOW B;  3SG3 A;  1MQ1 A;  3ZNI A;  3DZT A;  2LVK A;  2JNF A;  3JVT C;  1S1E A;  3BFB A;  1EH2 A;  1H8B A;  3Q8I A;  5DKQ A;  1SNL A;  3PN7 C;  2M49 B;  3VGO A;  1QTX A;  5D7F A;  2WOS A;  2ZN9 A;  5D69 A;  3SG7 A;  1KWO C;  3S0A A;  1X02 A;  1CDP A;  3OHM B;  3R1O A;  1CKK A;  1MHO A;  3CAB A;  2F8P A;  4HRH A;  2GGM A;  3O2P A;  4N5X A;  1ODB A;  1YX8 A;  1OMR A;  5ER5 A;  1REC A;  3B6X A;  3O6B A;  3PM8 A;  2M0R A; 
#chains in the Genus database with same CATH homology
 2FOT A;  3NSI A;  1F4Q A;  4PE4 A;  1L7Z A;  4PHM A;  1XO5 A;  1A03 A;  5HKY A;  2MA2 A;  2TN4 A;  5HLO A;  1JSA A;  2KFH A;  1QLS A;  1KFU L;  5F6T A;  4PE7 A;  1KFX L;  4M2Q A;  1M45 A;  1SRA A;  2LCP A;  2OS8 B;  1GJY A;  4N1G A;  2CBL A;  4PHN A;  1J1D A;  2K2F A;  1CLL A;  4N1F A;  1QVI Y;  1JUO A;  3DVJ A;  1QXP A;  1LKJ A;  3I5H B;  1CM1 A;  1TOP A;  3CS1 A;  5PAL A;  2K7B A;  1VRK A;  2KGB C;  2A4J A;  1F55 A;  4GAO A;  2LUC A;  4PCW A;  1JF0 A;  1OMV A;  1PVB A;  4OVN F;  4XJK A;  2EGD A;  3TS5 B;  3KPX A;  1KK7 Z;  2WND A;  1SL7 A;  3DF0 B;  1M31 A;  2LNK A;  5HKZ A;  2JPT A;  2GGZ A;  5CSJ A;  3BUW B;  1KCY A;  2F33 A;  4MSP A;  3DVM A;  1DJG A;  3D0Y A;  3EK8 A;  1TNX A;  2ZRT A;  1CFC A;  2KBI A;  2M7N A;  2KBM A;  1C07 A;  2F2P A;  3BUO B;  1UWO A;  2JC2 A;  3IF7 A;  1QJT A;  3AAK A;  5TNC A;  2FCD A;  3NSO A;  3GOF A;  3KHE A;  4MEW A;  3WHT B;  2Y1M A;  4MRY A;  4OCI A;  1HT9 A;  4P5O E;  1BOD A;  3CZT X;  3I5H C;  1UHN A;  1CDM A;  1QX5 B;  1IJ5 A;  1IRJ A;  2OTG B;  4ZCU A;  2M1U A;  1YRT B;  5AAN A;  1S26 D;  5ER4 X;  3LLE A;  1M39 A;  2LC5 A;  4QJ4 B;  5KU1 A;  4DIR A;  2O5G A;  1KK8 B;  1N65 A;  3D10 A;  3TS5 C;  1UP5 A;  1SYM A;  2KAX A;  1PAL A;  3IQO A;  4AOM A;  1NCZ A;  1TCF A;  3PAL A;  1FW4 A;  1OE9 B;  2BBM A;  1EXR A;  1PRW A;  3RLZ A;  2CNP A;  2I18 A;  2R2I A;  2JQ6 A;  2BL0 B;  1K8U A;  1YTZ C;  4ETO A;  2KFG A;  2K8M B;  3CLN A;  2MBX A;  1CFD A;  2KAV A;  1GQM A;  5AFP A;  1FI6 A;  2F2O A;  3PFV A;  4GFT A;  4I5N B;  3EKH A;  4PAL A;  3FWC A;  2KDH A;  1AJ5 A;  3I5F B;  4YGB B;  2LVV A;  2COL B;  2KYF A;  3TZ1 A;  1QX7 A;  2I94 A;  1B47 A;  1DJZ A;  1QVI Z;  1UHK A;  2KI6 C;  3BOW A;  3AKB A;  3BXK A;  4ORB B;  2WCF A;  1AP4 A;  1QAT A;  1SKT A;  3DD4 A;  3SJS A;  4DS7 A;  1C7V A;  1KK8 C;  1OZS A;  4YGE B;  1K95 A;  1PSB A;  1KFU S;  1K90 D;  3LK0 A;  1BU3 A;  5AER A;  1Y6W A;  2KOT A;  3VRO A;  1B4C A;  2JRF A;  4GGN A;  1DMO A;  2BCB A;  1R6P A;  2PRU A;  1SY9 A;  1C7W A;  4ORA B;  4MZJ A;  2KYC A;  1F8H A;  3VRR A;  1M46 A;  1NX0 A;  2BL0 C;  2M1K B;  4U8D A;  4MVF A;  4YGC B;  5IBW A;  1UHJ A;  1K9K A;  2Q4U A;  1TRF A;  2NCO A;  2OPO A;  3CGA A;  3SG6 A;  1S6C A;  2LMU A;  1RTP 1;  3H4S E;  3RM1 A;  1WRZ A;  4MZK A;  3I5F C;  4DCK A;  1IWQ A;  4YRU A;  2HET A;  3AAJ A;  2H2K A;  4AQI A;  2JT0 A;  4NDD A;  2JTT A;  2PMY A;  2KQY A;  1UUS A;  1TIZ A;  5I2Q A;  4WRI A;  4NDB A;  1W7J B;  2JOJ A;  3SG4 A;  3TUY C;  4CFR A;  3I5G B;  4WQ2 A;  1K9U A;  4OR9 B;  2BKH B;  3DVE A;  3C1V A;  3VRN A;  1HQV A;  1CDL A;  2M8U A;  3OB2 B;  3OX6 A;  1KQM C;  3DF0 A;  4IL1 A;  1JC2 A;  5K89 A;  1D1O A;  1SCV A;  4I5J A;  1CNP A;  1F4O A;  2KI6 D;  1DJX A;  4I5K A;  1XFW O;  2NZ0 A;  5BPJ A;  2EC6 B;  1NWD A;  3OP0 A;  1SW8 A;  1LXF C;  4PE1 A;  1IQ5 A;  5CPV A;  1NIW A;  2M29 A;  5AXI A;  3EVU A;  3K21 A;  1QV0 A;  3VRP A;  4QJ5 B;  1J7P A;  1YR5 A;  4YBH B;  3KEV A;  1A4P A;  5FYX A;  1KSM A;  1IJ6 A;  2BBN A;  1CMG A;  1CLM A;  3BYA A;  2B1U A;  2I2R E;  1DGV A;  1K9P A;  1DF0 B;  2H61 A;  5JOL A;  1LA0 A;  2LMT A;  1XFY O;  1WLZ A;  2BE6 A;  3DVK A;  2ZND A;  4M2O A;  3NSL A;  1E8A A;  2FJU B;  3CR4 X;  3KF9 A;  2OS8 C;  3SIA A;  4FQO A;  2BKI B;  2FCE A;  2V53 A;  2M97 A;  3A8R A;  2SAS A;  1SR6 B;  2JT3 A;  1EG3 A;  2KAY A;  2WOR A;  1TNQ A;  4FTG A;  1PSR A;  1B8L A;  1DJY A;  4OKH A;  2KQ6 A;  4ICB A;  5I8N A;  5G08 A;  3SG5 A;  1V1F A;  2KHN A;  2K7O A;  2JXC A;  2LP3 A;  2BE4 A;  2WCB A;  4DUQ A;  1RFJ A;  1G8I A;  2LLS A;  5KSZ A;  2Y5I A;  3I5I B;  3E3R A;  3JTD B;  1OOJ A;  1QIW A;  1MXE A;  3TDU A;  1QIV A;  1SBJ A;  1NPQ A;  1TN4 A;  1A75 B;  1NX1 A;  3BQ3 A;  3F45 A;  2KNE A;  1WLM A;  1FI5 A;  1S6J A;  1JFK A;  3CR2 A;  3O4Y A;  3LK1 A;  4YGD B;  1B8R A;  2I7A A;  2LV7 A;  1YRU B;  2L5X B;  3NXA A;  1S5G Y;  1NUB A;  1DT7 B;  1EG4 A;  1ZUZ A;  1ZOT B;  5DKN A;  1CB1 A;  1PK0 D;  2NCP A;  2JNX A;  4OV2 A;  2L51 A;  3VRQ A;  4YI9 A;  1A29 A;  3FIA A;  1EL4 A;  1K94 A;  2LHL A;  4HRE E;  2PAS A;  3EVV A;  1BJF A;  4C0J A;  1WRK A;  2P6B B;  1K93 D;  1MR8 A;  1QS7 A;  1S36 A;  5J3X A;  1IG5 A;  2H61 C;  3EVR A;  4M2P A;  2OTG C;  1QLK A;  1OSA A;  1SL8 A;  3JTD C;  4MLW A;  3AKA A;  4E68 A;  2LVI A;  2AMI A;  2L0P A;  2ISD A;  1DJH A;  1TNP A;  1LVC D;  2JWW A;  4P2Y B;  4GBA A;  2K0J A;  1J1E A;  2LVJ A;  3MSE B;  2NLN A;  3IQQ A;  1YUR A;  2KFF A;  5CSI A;  1SMG A;  1KFX S;  3A4U B;  1KQV A;  2JTZ A;  1XYD A;  2MHH A;  4CLN A;  1NCX A;  4R1E A;  3WNX B;  1J55 A;  3PN7 B;  1S6I A;  1YX7 A;  1ZAC A;  1WY9 A;  1DJW A;  1V1G A;  2LHI A;  2QPT A;  1B1G A;  1XFU O;  2ZRS A;  1CDN A;  1CFF A;  1EJ3 A;  1SK6 D;  2Q91 A;  1OMD A;  2LUX A;  2L50 A;  4QJ3 B;  1BG1 A;  2HQW A;  5HYD A;  4GPL B;  1NP8 A;  1AJ4 A;  2PAL A;  1KK7 Y;  4NQG A;  1N0Y A;  1YUS A;  2LM5 A;  3EK4 A;  3GK2 A;  3ZWH A;  2HPS A;  1QX2 A;  1DVI A;  3KO0 A;  1OQP A;  3O78 A;  4HSZ A;  3QRX A;  2L4H A;  2HF5 A;  2K61 A;  2ZKM X;  1B7T Y;  1NX3 A;  1SCM B;  4Q04 A;  1LIN A;  2LLU A;  2KSP A;  2KI4 B;  5JJG A;  1NX2 A;  3CWG A;  1FBV A;  2MRD A;  1J7R A;  1PUL A;  1MXL C;  1RWY A;  1BLQ A;  3GK1 A;  2K7D A;  2WC8 A;  2MJW B;  1UHH A;  2CTN A;  1M63 B;  4XYN A;  3BUN B;  1IQ3 A;  2JZI A;  2VRG A;  3HCM A;  3PAT A;  1MUX A;  1AK8 A;  1S5G Z;  1H4B A;  1F54 A;  1XA5 A;  1DF0 A;  4PHJ A;  4ZCV A;  4JPZ B;  4BY5 A;  2BCA A;  1CFP A;  2LAP A;  1YUU A;  1IKU A;  1MWN A;  5CSN A;  3TDZ A;  1U5I B;  1CM4 A;  4TNC A;  3CR5 X;  4A4C A;  2M7L A;  4WQ3 A;  2LAN A;  1BMO A;  1OZO A;  1Q80 A;  2ZFD A;  1CTR A;  2MLE C;  5KTY A;  1IH0 A;  1TCO B;  2CCM A;  1L2O B;  2DOQ A;  2LMV A;  1WDC B;  4HRG A;  4PE0 A;  1CLB A;  1BR4 B;  3HX4 A;  2K7C A;  1SCM C;  4AQJ A;  1TNW A;  3LL8 B;  2LP2 A;  2KI4 C;  3I5G C;  5B8I B;  3PLF B;  2G2B A;  2L4I A;  4PHK A;  1Y1U A;  2MAZ A;  1BF5 A;  1FF1 A;  1K96 A;  1KSO A;  1XK4 C;  1SPY A;  1B8C A;  1DJI A;  2D8N A;  4CID A;  1QV1 A;  2IS9 A;  4C0K A;  4GGF A;  1A75 A;  1NCY A;  4F0Z B;  2PVB A;  2PSR A;  2CXJ A;  5I2O A;  3BUX B;  3PSR A;  4NDC A;  1BT6 A;  2M9G A;  1DTL A;  1XFZ O;  2EC6 C;  2SCP A;  4C0L A;  2LLT A;  3WXA A;  3FWB A;  1NSH A;  1ZFS A;  2GV5 A;  4USL A;  5CSF A;  1YVH A;  2F3Y A;  4BY4 A;  1JFJ A;  3OB1 B;  1WRL A;  4ORC B;  1UUR A;  1L2O C;  1WDC C;  1BR1 B;  3EKJ A;  1TTX A;  3OX5 A;  1G33 A;  4CFQ A;  2LE9 B;  2K2A A;  5AEQ A;  1RJV A;  1QAS A;  1RK9 A;  2KGR A;  3BUM B;  4JQ0 D;  1B7T Z;  4A4B A;  5I2L A;  1FPW A;  1F71 A;  1DGU A;  1SL9 A;  4GUK A;  2EHB A;  1J7Q A;  3M0W A;  1K2H A;  2G9B A;  1XVJ A;  3CTN A;  2AAO A;  4I5L B;  3SIB A;  1BOC A;  1AVS A;  2WCE A;  4XJK B;  1JF2 A;  1SR6 C;  1J7O A;  1YVL A;  3D0Y B;  2CT9 A;  1GGZ A;  2MLF C;  1CMF A;  1PVA A;  4PDZ A;  2NXQ A;  1NYA A;  2E30 A;  3FS7 A;  5DKR A;  2HQ8 A;  4MN0 A;  2RGI A;  4MZL A;  4GNK B;  1B9A A;  1W7I B;  3I5I C;  1ALW A;  1GGW A;  1RRO A;  4MRX A;  1R2U A;  4D1E A;  4MBE A;  4GGF C;  1G4Y R;  4CPV A;  4L9M A;  4YI8 A;  2L2E A;  3TDI A;  2JXL A;  1XFX O;  1F70 A;  2ZNE A;  3WHU B;  5GQQ C;  1UHI A;  3JVT B;  1LA3 A;  1MF8 B;  1Y1A A;  4UPG A;  1N2D A;  1JWD A;  3EK7 A;  1KWO B;  2F3Z A;  2AUC A;  1XFV O;  2JUL A;  2BCX A;  2L98 A;  3NSK A;  1XK4 A;  1YUT A;  2Y1N A;  3ICB A;  4JWQ A;  1AUI B;  3SG2 A;  1IGV A;  3TUY B;  1Y1X A;  2M3W A;  2JT8 A;  4DRW A;  1AHR A;  3LCP C;  1A2X A;  1ALV A;  2Y4Q A;  3GK4 X;  1U5I A;  2O60 A;  1S3P A;  2JU0 A;  2QAC A;  2BEC A;  4YGA A;  2E6W A;  1Y0V H;  5HLV A;  1ZMZ A;  5HKW A;  2ZN8 A;  1KQM B;  1JBA A;  3BOW B;  3SG3 A;  1MQ1 A;  3ZNI A;  2LVK A;  2JNF A;  3JVT C;  1S1E A;  1EH2 A;  1H8B A;  5DKQ A;  1SNL A;  3PN7 C;  2M49 B;  3VGO A;  1QTX A;  5D7F A;  2WOS A;  2ZN9 A;  5D69 A;  3SG7 A;  1KWO C;  1X02 A;  1CDP A;  3OHM B;  1CKK A;  1MHO A;  2F8P A;  4HRH A;  2GGM A;  3O2P A;  4N5X A;  1ODB A;  1YX8 A;  1OMR A;  5ER5 A;  1REC A;  3O6B A;  3PM8 A;  2M0R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...