4F8HA

X-ray structure of the anesthetic ketamine bound to the glic pentameric ligand-gated ion channel
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
311
structure length
311
Chain Sequence
b'VSPPPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVETNLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proton-gated ion channel
publication title Structure of the Pentameric Ligand-Gated Ion Channel GLIC Bound with Anesthetic Ketamine.
pubmed doi rcsb
source organism Gloeobacter violaceus
molecule tags Transport protein
total genus 89
structure length 311
sequence length 311
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2012-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 4f8hA02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 4f8hA01
2Y58A 3GUAA 4LMKA 4QH4A 2KSRA 3ZDHA 3U8LA 3JADA 4NZBA 4A97A 2XNUA 4A98A 5CFBA 5FJVA 4QH5A 2BYNA 1OEDB 5HCJA 5CO5A 3C84A 5AFHA 3RQUA 2XNVA 1UW6A 2PH9A 3PMZA 3UU4A 4QACA 4IL9A 3U8JA 4ZJTA 1OEDE 3RIAA 4ZJSA 4HFHA 4UM3P 4UM1A 4ZZCA 3PEOA 2YN6A 3UU3A 3TLTA 2BYQA 4HFEA 2YMDA 4TNWA 4TWDA 5HEOA 2W8GA 4FRRA 3EI0A 2BR7A 3P50A 2WNLA 2MAWA 2X00D 3RI5A 3UQ7A 2XYSA 2BG9A 2BYSA 4UXUA 5IUXA 2BYRA 5AFKA 3P4WA 2XQAA 1UX2A 3TLVA 5J5GA 2M6BA 2XQ6A 3WTNA 4AFTA 5AFMB 2XYTA 3WTIA 3WTJA 2XQ4A 3WTLA 3WTHA 2QC1B 3IGQA 5LG3A 3WTOA 4TWHA 5HEJA 5J0ZA 4PIRA 3SQ6A 2X00A 2YOEA 5AFLA 5BRXA 3UU5A 4ZRUA 2BG9C 2XQ7A 4LMJA 2WZYA 3U8NA 2BYPA 3JAEA 3UQ4A 5AFJA 4ALXA 5HEGA 2BJ0A 4DBMA 3TLUA 2LM2A 2M6IA 3UU8A 4COFA 2C9TA 3U8MA 5J5HA 3ZKRA 2ZJVA 3JAFA 4ILAA 3TLWA 4XK9A 4TWFA 5BW2A 5J5IA 5L4EA 2BG9E 3UU6A 2XQ3A 4QH1A 3WTMA 2WN9A 2Y56A 4IL4A 2XZ5A 4QAAA 4D01A 5BP0A 2XQ8A 3RHWA 4QABA 4NPPA 4EZ1A 5KE4A 4IREA 4TNVA 2XQ9A 4BQTA 3SQ9A 4HFDA 5HEUA 5HEHA 3WTKA 4AFHA 4XHEA 4UY2A 4F8HA 3TLSA 4WV9A 3SIOA 3T4MA 5AINA 5TVCA 2YKSA 4ZZBA 1I9BA 4B5DA 2BR8A 3EHZA 2LKGA 5KZUA 2Y7YA 5AFMA 5J5FA 2BG9B 2LKHA 4UM3S 4AFGA 4ZR6A 5SYOA 1OEDA 3RIFA 2XZ6A 2XNTA 3C79A 2ZJUA 4BFQA 2Y54A 5AFNA 2W8FA 2PGZA 2WNCA 3WIPA 5JMEA 3SH1A 5HCMA 3LSVA 3EAMA 3ZDGA 3UUBA 1UV6A 4HFCA 5L47A 2WNJA 2XQ5A 2VL0A 4ILCA 4Z90A 2Y57A 4HFIA 2UZ6A 5L4HA 4ZK1A 3RQWA 4ILBA 2LLYA 1OEDC 4HFBA 4UM3A 4Z91A 2YMEA 5LXBA 4X5TA 4HQPA 4ZK4A 3U8KA 4LMLA
chains in the Genus database with same CATH superfamily
1HG2A 3RIUA 3ZMTB 3ONLC 5FJVA 2UXXB 2XASB 4K0KT 4EOZB 3PMZA 4JUYA 3AA6B 3P4QA 3PU8A 5AQFB 2ODUA 2WM9A 1ZHCA 4C91A 5F5WA 2YMDA 3EVYA 2LSGA 3FZKB 3RI5A 4YJ2E 3PUZF 4TV9E 3AECA 3WTHA 1FIOA 2XQ7A 5KXJA 5JDMA 4UVBB 4MALA 5AQSB 2FBWA 3UUXB 4ISTA 2C9TA 3VRBA 1CUNA 4IDPA 2XAHB 4YSZA 5LGUB 4QAAA 5H6QB 3VRAA 1D0YA 4QABA 1JNZA 5KE4A 5M4YA 5LJMA 3PUVF 5AQKB 5HEUA 5JR9A 1M7KA 2BR8A 2WB5A 4H9RC 2ZM2A 5HXSA 5AFMA 5AQQB 2UUBT 4WBNE 2LSJA 5DABA 2K9AA 2I59A 4GKKT 2XAGB 3FB2A 1J5ET 3UUBA 4QXHB 4IGUA 2L3LA 1WYCA 3AE1A 4QH4A 4A98A 5J1GA 5HCJA 5AFHA 2DWGA 3LBXB 3ANWB 4AISA 3QK6A 3NRYA 4BAYB 2V6YB 5FXWA 5HEOA 4QXCB 2OA5A 4HWCA 2ZM0A 3P4RA 2W00A 3ZSTA 1MIVA 1YD8G 2XYTA 4PAGA 5LG3A 3JC6D 5EK2A 3K3OA 2X00A 2YOEA 2D2SA 2BG9C 3HL6A 3AEEA 4P1NA 5HWXA 3ZCIA 4YTMA 2N1GA 4IHJE 4XK9A 4UXNB 3N2KE 2LHNA 4AKLA 1KNRA 3CMLA 2IUBA 5JDLA 2A72A 4PFPA 3N9LA 4CN1A 3B13A 3AE5A 4AKIA 3EHZA 3AEFA 4GKJT 1OEDA 3RIFA 4BFQA 2C0SA 2JQKA 4JI6T 4H63V 3SWHA 4K0UA 4AKHA 2XQ5A 3AA7B 2Z6EA 3RF1A 4UM3A 2V5DA 4CN4A 2D0UA 5LXBA 1N32T 2ACZA 5J2TE 4GK0E 3F31A 4PK4A 4YSXA 3AE6A 4IDNA 3U8JA 5FL1A 4UM3P 2MBGA 4B3RT 2LJLA 1LKXA 4B3TT 4HFEA 1WLXA 4E7SA 5JR9B 1D0XA 4H9OC 4GYSA 1HNWT 5AFMB 3SFEA 2JQHA 4Q25A 3FZHB 3SQ6A 5ABGA 4JI8T 3N2OA 2WZYA 5KX5E 2KINB 2VK9A 3C98B 3UU8A 1UK5A 4E7ZA 2LM9A 3ETUA 3JAFA 2CHOA 4ISSA 1E7PA 4JV5T 3UU6A 3ZMSB 2NW8A 1IAPA 4O4IE 2XAFB 4ILUA 3JC6C 4EZ1A 5JRCA 4TX5A 2XQ9A 3L39A 3WTKA 5L3FB 2YU1A 3ABVA 2FJDA 5AQHB 3H37A 2C5KT 4ZXLA 1UX4A 4ZR6A 5AQIB 2LOPA 5JDFA 2EHOD 2E2AA 3C50A 1WCRA 3WIPA 3AA0B 3AAEB 3FBZA 2X9WA 3OYZA 1MIYA 3HKCE 5HYAA 2JQQA 1CHUA 3FZLB 3N2GE 3W15B 4LMKA 3ZDHA 3P4PA 2FUPA 4X1YE 1OWAA 1NEKA 1YQ4A 4PJNA 4ZHQE 2PFVA 2ES0A 3OTOT 1HTJF 1HX8A 1HX1B 4TNWA 2W8GA 2CRBA 2X9HA 2H7OA 2LSIA 2B1EA 2BYSA 1UX2A 4EEDA 2H7VC 2Y8DA 3WTLA 3CVRA 4H9QC 4ZI7E 3I0QA 4YY3T 3C4XA 2VVSA 3G06A 3NWIA 2R6GF 2IC9A 2HN1A 1JNRA 1KF6A 2UUAT 3GA8A 2YDRA 3M65A 1IBMT 3O4XE 4BA9A 4LF5T 1HG5A 4DR3T 3AVSA 2XQ3A 2XAJB 2NTXA 1D0ZA 4U7YA 4X64T 3LK3B 4ZOLE 3QUJA 5ADXL 3SFDA 1E2AA 3QC9A 5HEHA 4UY2A 3QOFA 1SE7A 4HWHA 4WNKA 2IC6A 4H9NC 5J5FA 1MNDA 3FBLA 4LF4T 2Y54A 3PU3A 3CWZB 1T98A 2WCAA 3H3MA 4DIDB 1XNQT 4HFIA 4HKAA 2FJAA 2ZMAA 5JVDE 4CN6A 4ZK4A 3N9NA 1Z0PA 2KSRA 2IAKA 3ZYMA 2EHOC 3A7MA 4PJMA 3U3IA 3RIAA 5F8PA 4HFHA 2E9XD 3MJXA 2DL1A 4UV9B 5CB4E 4DVDA 3KV9A 2KWIB 4O8SA 5JRCB 3BQIA 5HWYA 3AE7A 5J2UE 1HF8A 5LNKA 4KBMB 3WTJA 1UCUA 1T72A 2XY8B 1LVKA 2NR4A 5HAXA 5AQMB 2BVMA 3V5UA 2YEVC 5FVKA 2YDQA 4ERRA 3E08A 2X66A 3EDVA 3PUSA 5J5IA 3CQXC 1KFYA 1NAFA 2CWYA 5L3GB 5L2LA 2LHRA 4YLHA 4KI0F 2A2FX 2XQ8A 4XAXB 4TNVA 4UVAB 4X66T 2Y48B 4HN9A 3IBPA 3CPZA 3L8RA 3BQKA 5SYOA 4ADZA 5IHYA 3ANWA 2V7KA 4AXPA 4QHOA 2IIUA 4ILCA 2UZ6A 4X20E 2KLQA 4X5TA 3U8KA 2BS3A 4IE0A 3PUWF 2XNUA 5CFBA 5CO5A 5HXEA 1UW6A 2W62A 2JQ9A 1YKEB 4ZZCA 1XWMA 2BR7A 3PUYF 4PFOA 4YHJA 5AFKA 4IE4A 4IDQA 2M6BA 3LK2B 2HPLA 3ZT6A 4DNDA 1YW0A 4PNIA 2WQYA 4GK5E 5J0ZA 4PIRA 3U8NA 3O9XA 3Q5WA 1VOMA 1ZV4X 1VCTA 2E9XC 5EK4A 1IZNB 3KV6A 4IE7A 4V1Av 2LM2A 3TLUA 1D1AA 3KV4A 2XZEA 2ZJVA 4ZI3D 3PE0A 4DV2T 3AA1B 3K3QC 1ZP0A 4ZS3A 1US7B 4AQGA 2JIWA 4IREA 5CJ5A 3ETVA 5FXXA 2X9YA 2NP9A 1KNPA 2BDEA 4TZ4C 2DWKA 2KXPB 4KUMB 2CBIA 1MMDA 3PURA 3ZCJA 2N9DA 4UV8B 3ZC0A 2Q9QA 1IJ5A 2WDVA 3KBTA 4YXDA 2WP9A 3Q5DA 2UXBT 4OYJA 4L9IA 3RYIE 3KV5A 1XMQT 4AQFA 2JRKA 4QH5A 2L8KA 3AEGA 4B6XA 1UUSA 4QKNA 5LB7B 1OEDE 4KHZF 3ZJ1A 2V1DB 4X62T 2JMKA 2MTQA 5BMVE 2WWUA 5EZYE 4DV4T 3R6NA 3O1HA 4DV3T 3N9PA 2VKDA 5HXCA 4CQIA 3VKHA 5GONE 3JAEA 2BKNA 5JDNA 2DNXA 2P9BA 3SS1A 4COFA 2J4GA 5KMGP 1YXRA 4UIGA 4F6RC 2Y56A 3UTKA 2F4VT 4DBRA 2J1DG 2LRKA 2I0MA 3H3AA 2FJBA 4JEUB 2UXNB 4CXXA 4IE5A 2IDOB 1QLBA 2Y7YA 2MOZA 4N78D 4ZI3C 2W8FA 2PGZA 2CCQA 4MBQA 1GQEA 3SH1A 5HCMA 1ZEEA 3RYFE 4I50E 3RQWA 1Z8UA 1XZYA 4ILBA 4HFBA 2H88A 1HCIA 3ZN1B 5CA0E 3LFMA 4YTPA 5L3EB 1XMOT 1HNZT 4NZBA 4A97A 2BYNA 3C84A 1ZKEA 2DI4A 3EABA 3AEAA 4O2BE 2WMNA 4A56A 4TWDA 2HN2A 3OBVE 5FP3A 2EHOB 4WYVA 2BZBA 3D0TA 3UT5E 5IUXA 1IBLT 1MIWA 2CHNA 5DQVA 3OYXA 3GMIA 3QNUA 3J9X1 3WTOA 2NW7A 5HEJA 3NZQA 2Q9QB 3UU5A 5C2TA 2HHHT 4ANJA 2UU9T 4JI1T 3EUHA 4ALXA 5AFUL 3TLWA 4AIUA 2X0YA 2JPFA 5AQVB 1OXZA 2LSKA 4D01A 3FZMB 1Y64B 2VL8A 5CGMA 4F8HA 4DV6T 2CE7A 3MA9A 3UFGA 3RX6A 1FEWA 4DR7T 2XZ6A 4EGWA 3A5XA 5JTGA 2WU2A 1J1JA 3E0ZA 2VL0A 2YK0A 2LLYA 3I9YA 1S35A 4YFSA 2UXDT 3GUAA 3R84B 2HH7A 4GIWA 2V26A 2YU2A 2KNDA 2LE8A 2CPTA 1R8IA 5IWAT 5AQOB 4QWNB 3E22E 4UELA 2W0GA 3UUNA 1O3XA 4FRRA 5HXHA 3KINB 3AE9A 2BG9A 4KX6A 3CQGB 5LP6E 3TLVA 2B76A 2XQ6A 3QB5A 3CX7B 4EEBA 2W67A 4CI1B 1DU2A 1MMNA 4UVCB 3AXJA 2V5CA 3RC8A 4ZRUA 5FY7A 3Q2MA 2WMOA 3UQ4A 3OJAA 3VU7H 1LVFA 4IT4A 4C90A 5AFJA 2CXLA 4AKRB 2M6IA 1W09A 3VR9A 1VCSA 2CM0A 5FMNA 4KP3C 1HFAA 4CI3B 3KVAA 5LBMA 4EZ4A 3S4UA 1IBKT 3UULA 5DQWA 4XHEA 1NWMX 2G0UA 5AQJB 2LKGA 2DLRA 4UM3S 5FY0A 4O2AE 3RH3A 4I43B 5ABFA 2WZIA 3N9MA 3LSVA 4OX9T 2X51A 4LFAT 2QGSA 4JI2T 4NXNT 2AE9A 4A5XA 4Z91A 3PUAA 2VKHA 3P4SA 4DV5T 2SPCA 4L5GA 3NZPA 4FJOA 3U8LA 4JBWF 3RYCE 3Q9DA 2XUEA 3KFWX 2CA5A 2K24A 4ZJSA 2VURA 3RIUC 1MMAA 3PEOA 4CZZB 3PDYA 4M1PA 4H9PC 2YDSA 2V7LA 2OV9A 2X00D 2X68A 2W63A 3P4WA 4XBFB 3WTIA 4IDZA 2QC1B 5AQPB 2NWBA 4PJLA 4JI5T 4NXMT 5FYMA 2BYPA 3WAJA 4DUZT 4QX7B 4DR2T 5AQUB 4DR5T 4UR9A 2CXFA 4MLKA 5H6RB 2WN9A 2WY2A 2ZM6T 3FHNA 2X0HA 3NVOA 3U78A 4WV9A 3GN5B 5AINA 4GYRA 1I9BA 3PUXF 2BG9B 2LKHA 4AKGA 1I94T 4LF7T 5AFNA 5AQNB 5JDHA 2J62A 2RP4A 5JR9C 2KT9A 2OLTA 5FXZA 3EAMA 3EDUA 2CEAA 3AXJB 4Z90A 2Y57A 1H7CA 1BR2A 4BJMA 5AQGB 2XHEB 4AI6A 5F3JA 4TV8E 2PH9A 4DV7T 2WDQA 1V9DA 5HXRA 3P7IA 5LA6E 4JI3T 4DBQA 2V8SV 1WFDA 2WU5A 3P50A 5LBQB 3UFEA 3HA4A 2BYRA 3PTRB 2MYSA 2WBLA 3O1IA 3ZPOA 2IW5B 4YT0A 5ABFB 2Y6XA 3DTOA 4LMJA 2BS2A 4HEAA 3AAIA 2V7MA 5LCYA 4CXYA 4G63A 4ZS2A 5BR8T 3NKZA 5J5HA 4ZEYA 1LRZA 2A3DA 4ILAA 2JJ9A 3ZC1A 2K3WA 4LFBT 4QH1A 4JI7T 1U5PA 3CIRA 3CQCB 3AE4A 4GOUA 2X9XA 3WAKA 4UF0A 5L3CB 5TAOA 3SIOA 3T4MA 1UX5A 3GWHA 3AEBA 5KZUA 1FMVA 3LK42 5JREA 3IA3A 3M3ZB 3RLFF 2W4XA 2WNCA 3ESLA 4HWFA 2KWHA 2CXDA 1UV6A 3ZEFB 1OEDC 3UUMA 5JDGA 2EHOA 4WBOA 2YMEA 1NENA 1E1HB 4EB6E 4HGAA 5LGTB 4PW8A 4DUYT 4G2AA 3V5SA 4U31A 3P8CD 3AB3B 4ZJTA 4IL9A 3T1HT 2YN6A 3TLTA 2QVAA 4ASKA 4MFRA 4X1KE 1KEYA 3PUQA 2XQAA 4NIQA 5J5GA 2XM2A 2XQ4A 2NTYA 2L9QA 3CX8B 4IDOA 5L3BB 4KMCA 4TWHA 1ZOYA 4JI0T 5BRXA 1MMGA 4U3CA 3VHLA 1U4QA 4H9SE 4JEHB 4HWIB 4I55E 2VQFT 3I9WA 3ZLIA 3I1AA 3CX6B 3C4WA 4JI4T 2VKJA 3HKEE 2DHRA 3AE8A 2PG8A 4OHFA 1KK7A 3RHWA 2I6HA 5LGNB 4P09A 1W0BA 2VB6A 3ZT7A 4B5DA 2RA1A 1BR4A 3RC3A 4AFGA 2XJ7A 2QRXA 3ZDGA 4Z8XA 4NUVA 4AQYT 4ZK1A 3Q5XA 1J5WA 1FJGT 1QUUA 2CBJA 1G73A 3L3PA 4L0RA 2WS3A 5EK3A 2CLYC 2RPAA 2VKOA 3JADA 4TN7B 2NW9A 2XNVA 4OK0A 4O4HE 3FZFB 1D1CA 4UM1A 4PJJA 2XSAA 3UU3A 5JDQA 1XDOA 4DV1T 4UF0B 2V7IA 3AE2A 2WNLA 2C5JA 2W66A 1SA0E 2LEHA 1X9BA 4H63H 2WAUA 2E9XA 3DJBA 2V6XA 3FXDB 1BR1A 5CA1E 5AFLA 3ZMVB 4U72A 1WYBA 4EZHA 3OKQA 5C8YE 3QB5K 4EAHA 1D1BA 3A8YC 3IHRA 3U8MA 1T7SA 5FXVA 2VQET 3RGLA 3AVRA 2BG9E 4EV6A 3CK6A 2XPKA 4KHPT 3MZKB 4QXBB 2PJQA 4HFDA 1WR0A 3J7Yq 2BKPA 3TLSA 4U74A 3ONJA 2D5UA 3AEDA 1XDPA 2VWAA 4ZZBA 3ZMUB 4UEMA 2J47A 2X0LB 1AJ3A 2C5IT 2D9DA 4DMVA 2QA7A 3C79A 2BBHA 3ZMZB 1M62A 5DJQC 4IE6A 4HFCA 3VR8A 3HKDE 3VKGA 1G8XA 3NBXX 5L4HA 4WZXA 4YHHT 1T8BA 1WR6A 3K3NA 2X67A 1IJ6A 3F57A 1EZ3A 3RQUA 4DMWA 1N33T 3UU4A 4QACA 3MXZA 2K48A 3N5LA 3BQLA 1HNXT 4LF8T 2MAWA 3PJAJ 2QYWA 2ZM8A 3X1DA 3ZSSA 4UXUA 4EIWA 3IGQA 3PV0F 2ZLYA 3WI3A 4P0AA 2K5BB 4HWDA 1QSDA 3ZYLA 3GN5A 2H89A 5HEGA 2BJ0A 4DBMA 3K8PC 4EXTA 3KBUA 1N36T 4U33A 5BW2A 5L4EA 2DCFA 2VASA 4ZI2D 1S94A 2KMFA 2M67A 1UGOA 2H3RA 3AAAB 2Q9QD 2E8IA 4B3MT 2ZJUA 3ZN0B 2E9XB 4X65T 2E5VA 5LG4A 1X79A 4QX8B 2WZHA 3BK9A 1UURA 3L09A 2XTLA 2BS4A 3RRCA 2LOSA 3T8OA 4JLEA 2D0TA 4DO0A 3IEEA 4CXWA 2Y58A 5FY1A 2JMHA 5BP0A 4YJ3E 1OEDB 4EYYR 3AE3A 5A1LA 3CKDA 2BBJA 2BVLA 1WRDA 2PTFA 2CMRA 3N9QA 1FMWA 4B3ST 1W9RA 3UQ7A 2LRLA 2VVNA 1N34T 4I0UA 4PK6A 5AQLB 2ACXA 2LT3A 1Y01A 2WDRA 3HI2A 4P0BA 4XZCA 2WSSV 5FKYA 4HTEA 3B57A 4U2ZA 3B5MA 3F2EA 5LOVE 3I0OA 4LFCT 4O4LE 1HS7A 3SRZA 4HE8A 4IIJE 3Q5EA 3N9OA 2E5LT 4EYUA 1B7TA 3TKLB 3WTMA 2XZ5A 3IF8B 2UUCT 4CI2B 2AXDS 5ABEA 3C64A 2XAQB 4DR4T 4J2CA 4U2YA 3SOLA 3LJCA 4BQTA 3SQ9A 2HPJA 4AFHA 1YQ3A 3RYHE 5E0OA 2YINA 1MNEA 2W2UA 3O1JA 2CWOA 2XNTA 3DP7A 3C51A 2GK9A 4OYKA 2IMLA 5ABHA 1XNRT 3MK7C 4WW0A 1L0VA 5L47A 3ZJ2A 4ZI2C 4LF6T 3ZYKA 5ETWA 3T1YT 3LG7A 3K1SA 4DV0T 4LMLA 4PK5A 2Q9QC 5LHHB 5AQRB 4TUYE 2BKOA 4YSYA 5LMUT 5LHIB 3KVBA 5LJNA 5C3JA 5LYJE 5KDMC 3MACA 2CLYB 3FXEB 4I4TE 4AQFC 2BYQA 1SUMB 3PUGA 4LF9T 3EI0A 3JCFA 2XSBA 1BR0A 2XYSA 5FNVE 3LDQB 3HKBE 4O4JE 3WTNA 4AFTA 3RKOA 3ZT5A 4JYAT 2NOXA 4HFVA 4NUUA 2A9UA 4FI5A 1YKHB 2XQYA 3C4ZA 3KDSE 2LSYA 3ONXA 2FJEA 2UXCT 3OVUA 3ZKRA 1VRBA 4TWFA 4DR1T 4X1IE 3LBXA 2N2NA 2IHR1 4BJNA 5JQGE 2XM1A 5AQTB 4IL4A 5FVLA 2MPKA 4DR6T 4NPPA 2V6YA 3RPUA 1HR0T 4OFZA 5TVCA 5LHGB 2YKSA 2ODVA 5JH7E 2W61A 4U7IA 2WWVA 5L3DB 3PJAA 2V7JA 3HR0A 5JMEA 5LXTE 4MHCA 2WNJA 3MKDA 5LMNT 2PBIA 4YTNA 3RRWA 3NRXA 1SHZC 3RKGA 2KZ7B 5IYZE 1I6ZA 4HQPA 1W0AA 1KNZA 3OPCA 5FL0A
chains in the Genus database with same CATH topology
2Y58A 3GUAA 4LMKA 4QH4A 2KSRA 3ZDHA 3U8LA 3JADA 4NZBA 4A97A 2XNUA 4A98A 5CFBA 5FJVA 4QH5A 2BYNA 1OEDB 5HCJA 5CO5A 3C84A 5AFHA 3RQUA 2XNVA 1UW6A 2PH9A 3PMZA 3UU4A 4QACA 4IL9A 3U8JA 4ZJTA 1OEDE 3RIAA 4ZJSA 4HFHA 4UM3P 4UM1A 4ZZCA 3PEOA 2YN6A 3UU3A 3TLTA 2BYQA 4HFEA 2YMDA 4TNWA 4TWDA 5HEOA 2W8GA 4FRRA 3EI0A 2BR7A 3P50A 2WNLA 2MAWA 2X00D 3RI5A 3UQ7A 2XYSA 2BG9A 2BYSA 4UXUA 5IUXA 2BYRA 5AFKA 3P4WA 2XQAA 1UX2A 3TLVA 5J5GA 2M6BA 2XQ6A 3WTNA 4AFTA 5AFMB 2XYTA 3WTIA 3WTJA 2XQ4A 3WTLA 3WTHA 2QC1B 3IGQA 5LG3A 3WTOA 4TWHA 5HEJA 5J0ZA 4PIRA 3SQ6A 2X00A 2YOEA 5AFLA 5BRXA 3UU5A 4ZRUA 2BG9C 2XQ7A 4LMJA 2WZYA 3U8NA 2BYPA 3JAEA 3UQ4A 5AFJA 4ALXA 5HEGA 2BJ0A 4DBMA 3TLUA 2LM2A 2M6IA 3UU8A 4COFA 2C9TA 3U8MA 5J5HA 3ZKRA 2ZJVA 3JAFA 4ILAA 3TLWA 4XK9A 4TWFA 5BW2A 5J5IA 5L4EA 2BG9E 3UU6A 2XQ3A 4QH1A 3WTMA 2WN9A 2Y56A 4IL4A 2XZ5A 4QAAA 4D01A 5BP0A 2XQ8A 3RHWA 4QABA 4NPPA 4EZ1A 5KE4A 4IREA 4TNVA 2XQ9A 4BQTA 3SQ9A 4HFDA 5HEUA 5HEHA 3WTKA 4AFHA 4XHEA 4UY2A 4F8HA 3TLSA 4WV9A 3SIOA 3T4MA 5AINA 5TVCA 2YKSA 4ZZBA 1I9BA 4B5DA 2BR8A 3EHZA 2LKGA 5KZUA 2Y7YA 5AFMA 5J5FA 2BG9B 2LKHA 4UM3S 4AFGA 4ZR6A 5SYOA 1OEDA 3RIFA 2XZ6A 2XNTA 3C79A 2ZJUA 4BFQA 2Y54A 5AFNA 2W8FA 2PGZA 2WNCA 3WIPA 5JMEA 3SH1A 5HCMA 3LSVA 3EAMA 3ZDGA 3UUBA 1UV6A 4HFCA 5L47A 2WNJA 2XQ5A 2VL0A 4ILCA 4Z90A 2Y57A 4HFIA 2UZ6A 5L4HA 4ZK1A 3RQWA 4ILBA 2LLYA 1OEDC 4HFBA 4UM3A 4Z91A 2YMEA 5LXBA 4X5TA 4HQPA 4ZK4A 3U8KA 4LMLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y58 A;  3GUA A;  4LMK A;  4QH4 A;  2KSR A;  3ZDH A;  3U8L A;  3JAD A;  4NZB A;  4A97 A;  2XNU A;  4A98 A;  5CFB A;  5FJV A;  4QH5 A;  2BYN A;  1OED B;  5HCJ A;  5CO5 A;  3C84 A;  5AFH A;  3RQU A;  2XNV A;  1UW6 A;  2PH9 A;  3PMZ A;  3UU4 A;  4QAC A;  4IL9 A;  3U8J A;  4ZJT A;  1OED E;  3RIA A;  4ZJS A;  4HFH A;  4UM3 P;  4UM1 A;  4ZZC A;  3PEO A;  2YN6 A;  3UU3 A;  3TLT A;  2BYQ A;  4HFE A;  2YMD A;  4TNW A;  4TWD A;  5HEO A;  2W8G A;  4FRR A;  3EI0 A;  2BR7 A;  3P50 A;  2WNL A;  2MAW A;  2X00 D;  3RI5 A;  3UQ7 A;  2XYS A;  2BG9 A;  2BYS A;  4UXU A;  5IUX A;  2BYR A;  5AFK A;  3P4W A;  2XQA A;  1UX2 A;  3TLV A;  5J5G A;  2M6B A;  2XQ6 A;  3WTN A;  4AFT A;  5AFM B;  2XYT A;  3WTI A;  3WTJ A;  2XQ4 A;  3WTL A;  3WTH A;  2QC1 B;  3IGQ A;  5LG3 A;  3WTO A;  4TWH A;  5HEJ A;  5J0Z A;  4PIR A;  3SQ6 A;  2X00 A;  2YOE A;  5AFL A;  5BRX A;  3UU5 A;  4ZRU A;  2BG9 C;  2XQ7 A;  4LMJ A;  2WZY A;  3U8N A;  2BYP A;  3JAE A;  3UQ4 A;  5AFJ A;  4ALX A;  5HEG A;  2BJ0 A;  4DBM A;  3TLU A;  2LM2 A;  2M6I A;  3UU8 A;  4COF A;  2C9T A;  3U8M A;  5J5H A;  3ZKR A;  2ZJV A;  3JAF A;  4ILA A;  3TLW A;  4XK9 A;  4TWF A;  5BW2 A;  5J5I A;  5L4E A;  2BG9 E;  3UU6 A;  2XQ3 A;  4QH1 A;  3WTM A;  2WN9 A;  2Y56 A;  4IL4 A;  2XZ5 A;  4QAA A;  4D01 A;  5BP0 A;  2XQ8 A;  3RHW A;  4QAB A;  4NPP A;  4EZ1 A;  5KE4 A;  4IRE A;  4TNV A;  2XQ9 A;  4BQT A;  3SQ9 A;  4HFD A;  5HEU A;  5HEH A;  3WTK A;  4AFH A;  4XHE A;  4UY2 A;  4F8H A;  3TLS A;  4WV9 A;  3SIO A;  3T4M A;  5AIN A;  5TVC A;  2YKS A;  4ZZB A;  1I9B A;  4B5D A;  2BR8 A;  3EHZ A;  2LKG A;  5KZU A;  2Y7Y A;  5AFM A;  5J5F A;  2BG9 B;  2LKH A;  4UM3 S;  4AFG A;  4ZR6 A;  5SYO A;  1OED A;  3RIF A;  2XZ6 A;  2XNT A;  3C79 A;  2ZJU A;  4BFQ A;  2Y54 A;  5AFN A;  2W8F A;  2PGZ A;  2WNC A;  3WIP A;  5JME A;  3SH1 A;  5HCM A;  3LSV A;  3EAM A;  3ZDG A;  3UUB A;  1UV6 A;  4HFC A;  5L47 A;  2WNJ A;  2XQ5 A;  2VL0 A;  4ILC A;  4Z90 A;  2Y57 A;  4HFI A;  2UZ6 A;  5L4H A;  4ZK1 A;  3RQW A;  4ILB A;  2LLY A;  1OED C;  4HFB A;  4UM3 A;  4Z91 A;  2YME A;  5LXB A;  4X5T A;  4HQP A;  4ZK4 A;  3U8K A;  4LML A; 
#chains in the Genus database with same CATH topology
 1HG2 A;  3RIU A;  3ZMT B;  3ONL C;  5FJV A;  2UXX B;  2XAS B;  4K0K T;  4EOZ B;  3PMZ A;  4JUY A;  3AA6 B;  3P4Q A;  3PU8 A;  5AQF B;  2ODU A;  2WM9 A;  1ZHC A;  4C91 A;  5F5W A;  2YMD A;  3EVY A;  2LSG A;  3FZK B;  3RI5 A;  4YJ2 E;  3PUZ F;  4TV9 E;  3AEC A;  3WTH A;  1FIO A;  2XQ7 A;  5KXJ A;  5JDM A;  4UVB B;  4MAL A;  5AQS B;  2FBW A;  3UUX B;  4IST A;  2C9T A;  3VRB A;  1CUN A;  4IDP A;  2XAH B;  4YSZ A;  5LGU B;  4QAA A;  5H6Q B;  3VRA A;  1D0Y A;  4QAB A;  1JNZ A;  5KE4 A;  5M4Y A;  5LJM A;  3PUV F;  5AQK B;  5HEU A;  5JR9 A;  1M7K A;  2BR8 A;  2WB5 A;  4H9R C;  2ZM2 A;  5HXS A;  5AFM A;  5AQQ B;  2UUB T;  4WBN E;  2LSJ A;  5DAB A;  2K9A A;  2I59 A;  4GKK T;  2XAG B;  3FB2 A;  1J5E T;  3UUB A;  4QXH B;  4IGU A;  2L3L A;  1WYC A;  3AE1 A;  4QH4 A;  4A98 A;  5J1G A;  5HCJ A;  5AFH A;  2DWG A;  3LBX B;  3ANW B;  4AIS A;  3QK6 A;  3NRY A;  4BAY B;  2V6Y B;  5FXW A;  5HEO A;  4QXC B;  2OA5 A;  4HWC A;  2ZM0 A;  3P4R A;  2W00 A;  3ZST A;  1MIV A;  1YD8 G;  2XYT A;  4PAG A;  5LG3 A;  3JC6 D;  5EK2 A;  3K3O A;  2X00 A;  2YOE A;  2D2S A;  2BG9 C;  3HL6 A;  3AEE A;  4P1N A;  5HWX A;  3ZCI A;  4YTM A;  2N1G A;  4IHJ E;  4XK9 A;  4UXN B;  3N2K E;  2LHN A;  4AKL A;  1KNR A;  3CML A;  2IUB A;  5JDL A;  2A72 A;  4PFP A;  3N9L A;  4CN1 A;  3B13 A;  3AE5 A;  4AKI A;  3EHZ A;  3AEF A;  4GKJ T;  1OED A;  3RIF A;  4BFQ A;  2C0S A;  2JQK A;  4JI6 T;  4H63 V;  3SWH A;  4K0U A;  4AKH A;  2XQ5 A;  3AA7 B;  2Z6E A;  3RF1 A;  4UM3 A;  2V5D A;  4CN4 A;  2D0U A;  5LXB A;  1N32 T;  2ACZ A;  5J2T E;  4GK0 E;  3F31 A;  4PK4 A;  4YSX A;  3AE6 A;  4IDN A;  3U8J A;  5FL1 A;  4UM3 P;  2MBG A;  4B3R T;  2LJL A;  1LKX A;  4B3T T;  4HFE A;  1WLX A;  4E7S A;  5JR9 B;  1D0X A;  4H9O C;  4GYS A;  1HNW T;  5AFM B;  3SFE A;  2JQH A;  4Q25 A;  3FZH B;  3SQ6 A;  5ABG A;  4JI8 T;  3N2O A;  2WZY A;  5KX5 E;  2KIN B;  2VK9 A;  3C98 B;  3UU8 A;  1UK5 A;  4E7Z A;  2LM9 A;  3ETU A;  3JAF A;  2CHO A;  4ISS A;  1E7P A;  4JV5 T;  3UU6 A;  3ZMS B;  2NW8 A;  1IAP A;  4O4I E;  2XAF B;  4ILU A;  3JC6 C;  4EZ1 A;  5JRC A;  4TX5 A;  2XQ9 A;  3L39 A;  3WTK A;  5L3F B;  2YU1 A;  3ABV A;  2FJD A;  5AQH B;  3H37 A;  2C5K T;  4ZXL A;  1UX4 A;  4ZR6 A;  5AQI B;  2LOP A;  5JDF A;  2EHO D;  2E2A A;  3C50 A;  1WCR A;  3WIP A;  3AA0 B;  3AAE B;  3FBZ A;  2X9W A;  3OYZ A;  1MIY A;  3HKC E;  5HYA A;  2JQQ A;  1CHU A;  3FZL B;  3N2G E;  3W15 B;  4LMK A;  3ZDH A;  3P4P A;  2FUP A;  4X1Y E;  1OWA A;  1NEK A;  1YQ4 A;  4PJN A;  4ZHQ E;  2PFV A;  2ES0 A;  3OTO T;  1HTJ F;  1HX8 A;  1HX1 B;  4TNW A;  2W8G A;  2CRB A;  2X9H A;  2H7O A;  2LSI A;  2B1E A;  2BYS A;  1UX2 A;  4EED A;  2H7V C;  2Y8D A;  3WTL A;  3CVR A;  4H9Q C;  4ZI7 E;  3I0Q A;  4YY3 T;  3C4X A;  2VVS A;  3G06 A;  3NWI A;  2R6G F;  2IC9 A;  2HN1 A;  1JNR A;  1KF6 A;  2UUA T;  3GA8 A;  2YDR A;  3M65 A;  1IBM T;  3O4X E;  4BA9 A;  4LF5 T;  1HG5 A;  4DR3 T;  3AVS A;  2XQ3 A;  2XAJ B;  2NTX A;  1D0Z A;  4U7Y A;  4X64 T;  3LK3 B;  4ZOL E;  3QUJ A;  5ADX L;  3SFD A;  1E2A A;  3QC9 A;  5HEH A;  4UY2 A;  3QOF A;  1SE7 A;  4HWH A;  4WNK A;  2IC6 A;  4H9N C;  5J5F A;  1MND A;  3FBL A;  4LF4 T;  2Y54 A;  3PU3 A;  3CWZ B;  1T98 A;  2WCA A;  3H3M A;  4DID B;  1XNQ T;  4HFI A;  4HKA A;  2FJA A;  2ZMA A;  5JVD E;  4CN6 A;  4ZK4 A;  3N9N A;  1Z0P A;  2KSR A;  2IAK A;  3ZYM A;  2EHO C;  3A7M A;  4PJM A;  3U3I A;  3RIA A;  5F8P A;  4HFH A;  2E9X D;  3MJX A;  2DL1 A;  4UV9 B;  5CB4 E;  4DVD A;  3KV9 A;  2KWI B;  4O8S A;  5JRC B;  3BQI A;  5HWY A;  3AE7 A;  5J2U E;  1HF8 A;  5LNK A;  4KBM B;  3WTJ A;  1UCU A;  1T72 A;  2XY8 B;  1LVK A;  2NR4 A;  5HAX A;  5AQM B;  2BVM A;  3V5U A;  2YEV C;  5FVK A;  2YDQ A;  4ERR A;  3E08 A;  2X66 A;  3EDV A;  3PUS A;  5J5I A;  3CQX C;  1KFY A;  1NAF A;  2CWY A;  5L3G B;  5L2L A;  2LHR A;  4YLH A;  4KI0 F;  2A2F X;  2XQ8 A;  4XAX B;  4TNV A;  4UVA B;  4X66 T;  2Y48 B;  4HN9 A;  3IBP A;  3CPZ A;  3L8R A;  3BQK A;  5SYO A;  4ADZ A;  5IHY A;  3ANW A;  2V7K A;  4AXP A;  4QHO A;  2IIU A;  4ILC A;  2UZ6 A;  4X20 E;  2KLQ A;  4X5T A;  3U8K A;  2BS3 A;  4IE0 A;  3PUW F;  2XNU A;  5CFB A;  5CO5 A;  5HXE A;  1UW6 A;  2W62 A;  2JQ9 A;  1YKE B;  4ZZC A;  1XWM A;  2BR7 A;  3PUY F;  4PFO A;  4YHJ A;  5AFK A;  4IE4 A;  4IDQ A;  2M6B A;  3LK2 B;  2HPL A;  3ZT6 A;  4DND A;  1YW0 A;  4PNI A;  2WQY A;  4GK5 E;  5J0Z A;  4PIR A;  3U8N A;  3O9X A;  3Q5W A;  1VOM A;  1ZV4 X;  1VCT A;  2E9X C;  5EK4 A;  1IZN B;  3KV6 A;  4IE7 A;  4V1A v;  2LM2 A;  3TLU A;  1D1A A;  3KV4 A;  2XZE A;  2ZJV A;  4ZI3 D;  3PE0 A;  4DV2 T;  3AA1 B;  3K3Q C;  1ZP0 A;  4ZS3 A;  1US7 B;  4AQG A;  2JIW A;  4IRE A;  5CJ5 A;  3ETV A;  5FXX A;  2X9Y A;  2NP9 A;  1KNP A;  2BDE A;  4TZ4 C;  2DWK A;  2KXP B;  4KUM B;  2CBI A;  1MMD A;  3PUR A;  3ZCJ A;  2N9D A;  4UV8 B;  3ZC0 A;  2Q9Q A;  1IJ5 A;  2WDV A;  3KBT A;  4YXD A;  2WP9 A;  3Q5D A;  2UXB T;  4OYJ A;  4L9I A;  3RYI E;  3KV5 A;  1XMQ T;  4AQF A;  2JRK A;  4QH5 A;  2L8K A;  3AEG A;  4B6X A;  1UUS A;  4QKN A;  5LB7 B;  1OED E;  4KHZ F;  3ZJ1 A;  2V1D B;  4X62 T;  2JMK A;  2MTQ A;  5BMV E;  2WWU A;  5EZY E;  4DV4 T;  3R6N A;  3O1H A;  4DV3 T;  3N9P A;  2VKD A;  5HXC A;  4CQI A;  3VKH A;  5GON E;  3JAE A;  2BKN A;  5JDN A;  2DNX A;  2P9B A;  3SS1 A;  4COF A;  2J4G A;  5KMG P;  1YXR A;  4UIG A;  4F6R C;  2Y56 A;  3UTK A;  2F4V T;  4DBR A;  2J1D G;  2LRK A;  2I0M A;  3H3A A;  2FJB A;  4JEU B;  2UXN B;  4CXX A;  4IE5 A;  2IDO B;  1QLB A;  2Y7Y A;  2MOZ A;  4N78 D;  4ZI3 C;  2W8F A;  2PGZ A;  2CCQ A;  4MBQ A;  1GQE A;  3SH1 A;  5HCM A;  1ZEE A;  3RYF E;  4I50 E;  3RQW A;  1Z8U A;  1XZY A;  4ILB A;  4HFB A;  2H88 A;  1HCI A;  3ZN1 B;  5CA0 E;  3LFM A;  4YTP A;  5L3E B;  1XMO T;  1HNZ T;  4NZB A;  4A97 A;  2BYN A;  3C84 A;  1ZKE A;  2DI4 A;  3EAB A;  3AEA A;  4O2B E;  2WMN A;  4A56 A;  4TWD A;  2HN2 A;  3OBV E;  5FP3 A;  2EHO B;  4WYV A;  2BZB A;  3D0T A;  3UT5 E;  5IUX A;  1IBL T;  1MIW A;  2CHN A;  5DQV A;  3OYX A;  3GMI A;  3QNU A;  3J9X 1;  3WTO A;  2NW7 A;  5HEJ A;  3NZQ A;  2Q9Q B;  3UU5 A;  5C2T A;  2HHH T;  4ANJ A;  2UU9 T;  4JI1 T;  3EUH A;  4ALX A;  5AFU L;  3TLW A;  4AIU A;  2X0Y A;  2JPF A;  5AQV B;  1OXZ A;  2LSK A;  4D01 A;  3FZM B;  1Y64 B;  2VL8 A;  5CGM A;  4F8H A;  4DV6 T;  2CE7 A;  3MA9 A;  3UFG A;  3RX6 A;  1FEW A;  4DR7 T;  2XZ6 A;  4EGW A;  3A5X A;  5JTG A;  2WU2 A;  1J1J A;  3E0Z A;  2VL0 A;  2YK0 A;  2LLY A;  3I9Y A;  1S35 A;  4YFS A;  2UXD T;  3GUA A;  3R84 B;  2HH7 A;  4GIW A;  2V26 A;  2YU2 A;  2KND A;  2LE8 A;  2CPT A;  1R8I A;  5IWA T;  5AQO B;  4QWN B;  3E22 E;  4UEL A;  2W0G A;  3UUN A;  1O3X A;  4FRR A;  5HXH A;  3KIN B;  3AE9 A;  2BG9 A;  4KX6 A;  3CQG B;  5LP6 E;  3TLV A;  2B76 A;  2XQ6 A;  3QB5 A;  3CX7 B;  4EEB A;  2W67 A;  4CI1 B;  1DU2 A;  1MMN A;  4UVC B;  3AXJ A;  2V5C A;  3RC8 A;  4ZRU A;  5FY7 A;  3Q2M A;  2WMO A;  3UQ4 A;  3OJA A;  3VU7 H;  1LVF A;  4IT4 A;  4C90 A;  5AFJ A;  2CXL A;  4AKR B;  2M6I A;  1W09 A;  3VR9 A;  1VCS A;  2CM0 A;  5FMN A;  4KP3 C;  1HFA A;  4CI3 B;  3KVA A;  5LBM A;  4EZ4 A;  3S4U A;  1IBK T;  3UUL A;  5DQW A;  4XHE A;  1NWM X;  2G0U A;  5AQJ B;  2LKG A;  2DLR A;  4UM3 S;  5FY0 A;  4O2A E;  3RH3 A;  4I43 B;  5ABF A;  2WZI A;  3N9M A;  3LSV A;  4OX9 T;  2X51 A;  4LFA T;  2QGS A;  4JI2 T;  4NXN T;  2AE9 A;  4A5X A;  4Z91 A;  3PUA A;  2VKH A;  3P4S A;  4DV5 T;  2SPC A;  4L5G A;  3NZP A;  4FJO A;  3U8L A;  4JBW F;  3RYC E;  3Q9D A;  2XUE A;  3KFW X;  2CA5 A;  2K24 A;  4ZJS A;  2VUR A;  3RIU C;  1MMA A;  3PEO A;  4CZZ B;  3PDY A;  4M1P A;  4H9P C;  2YDS A;  2V7L A;  2OV9 A;  2X00 D;  2X68 A;  2W63 A;  3P4W A;  4XBF B;  3WTI A;  4IDZ A;  2QC1 B;  5AQP B;  2NWB A;  4PJL A;  4JI5 T;  4NXM T;  5FYM A;  2BYP A;  3WAJ A;  4DUZ T;  4QX7 B;  4DR2 T;  5AQU B;  4DR5 T;  4UR9 A;  2CXF A;  4MLK A;  5H6R B;  2WN9 A;  2WY2 A;  2ZM6 T;  3FHN A;  2X0H A;  3NVO A;  3U78 A;  4WV9 A;  3GN5 B;  5AIN A;  4GYR A;  1I9B A;  3PUX F;  2BG9 B;  2LKH A;  4AKG A;  1I94 T;  4LF7 T;  5AFN A;  5AQN B;  5JDH A;  2J62 A;  2RP4 A;  5JR9 C;  2KT9 A;  2OLT A;  5FXZ A;  3EAM A;  3EDU A;  2CEA A;  3AXJ B;  4Z90 A;  2Y57 A;  1H7C A;  1BR2 A;  4BJM A;  5AQG B;  2XHE B;  4AI6 A;  5F3J A;  4TV8 E;  2PH9 A;  4DV7 T;  2WDQ A;  1V9D A;  5HXR A;  3P7I A;  5LA6 E;  4JI3 T;  4DBQ A;  2V8S V;  1WFD A;  2WU5 A;  3P50 A;  5LBQ B;  3UFE A;  3HA4 A;  2BYR A;  3PTR B;  2MYS A;  2WBL A;  3O1I A;  3ZPO A;  2IW5 B;  4YT0 A;  5ABF B;  2Y6X A;  3DTO A;  4LMJ A;  2BS2 A;  4HEA A;  3AAI A;  2V7M A;  5LCY A;  4CXY A;  4G63 A;  4ZS2 A;  5BR8 T;  3NKZ A;  5J5H A;  4ZEY A;  1LRZ A;  2A3D A;  4ILA A;  2JJ9 A;  3ZC1 A;  2K3W A;  4LFB T;  4QH1 A;  4JI7 T;  1U5P A;  3CIR A;  3CQC B;  3AE4 A;  4GOU A;  2X9X A;  3WAK A;  4UF0 A;  5L3C B;  5TAO A;  3SIO A;  3T4M A;  1UX5 A;  3GWH A;  3AEB A;  5KZU A;  1FMV A;  3LK4 2;  5JRE A;  3IA3 A;  3M3Z B;  3RLF F;  2W4X A;  2WNC A;  3ESL A;  4HWF A;  2KWH A;  2CXD A;  1UV6 A;  3ZEF B;  1OED C;  3UUM A;  5JDG A;  2EHO A;  4WBO A;  2YME A;  1NEN A;  1E1H B;  4EB6 E;  4HGA A;  5LGT B;  4PW8 A;  4DUY T;  4G2A A;  3V5S A;  4U31 A;  3P8C D;  3AB3 B;  4ZJT A;  4IL9 A;  3T1H T;  2YN6 A;  3TLT A;  2QVA A;  4ASK A;  4MFR A;  4X1K E;  1KEY A;  3PUQ A;  2XQA A;  4NIQ A;  5J5G A;  2XM2 A;  2XQ4 A;  2NTY A;  2L9Q A;  3CX8 B;  4IDO A;  5L3B B;  4KMC A;  4TWH A;  1ZOY A;  4JI0 T;  5BRX A;  1MMG A;  4U3C A;  3VHL A;  1U4Q A;  4H9S E;  4JEH B;  4HWI B;  4I55 E;  2VQF T;  3I9W A;  3ZLI A;  3I1A A;  3CX6 B;  3C4W A;  4JI4 T;  2VKJ A;  3HKE E;  2DHR A;  3AE8 A;  2PG8 A;  4OHF A;  1KK7 A;  3RHW A;  2I6H A;  5LGN B;  4P09 A;  1W0B A;  2VB6 A;  3ZT7 A;  4B5D A;  2RA1 A;  1BR4 A;  3RC3 A;  4AFG A;  2XJ7 A;  2QRX A;  3ZDG A;  4Z8X A;  4NUV A;  4AQY T;  4ZK1 A;  3Q5X A;  1J5W A;  1FJG T;  1QUU A;  2CBJ A;  1G73 A;  3L3P A;  4L0R A;  2WS3 A;  5EK3 A;  2CLY C;  2RPA A;  2VKO A;  3JAD A;  4TN7 B;  2NW9 A;  2XNV A;  4OK0 A;  4O4H E;  3FZF B;  1D1C A;  4UM1 A;  4PJJ A;  2XSA A;  3UU3 A;  5JDQ A;  1XDO A;  4DV1 T;  4UF0 B;  2V7I A;  3AE2 A;  2WNL A;  2C5J A;  2W66 A;  1SA0 E;  2LEH A;  1X9B A;  4H63 H;  2WAU A;  2E9X A;  3DJB A;  2V6X A;  3FXD B;  1BR1 A;  5CA1 E;  5AFL A;  3ZMV B;  4U72 A;  1WYB A;  4EZH A;  3OKQ A;  5C8Y E;  3QB5 K;  4EAH A;  1D1B A;  3A8Y C;  3IHR A;  3U8M A;  1T7S A;  5FXV A;  2VQE T;  3RGL A;  3AVR A;  2BG9 E;  4EV6 A;  3CK6 A;  2XPK A;  4KHP T;  3MZK B;  4QXB B;  2PJQ A;  4HFD A;  1WR0 A;  3J7Y q;  2BKP A;  3TLS A;  4U74 A;  3ONJ A;  2D5U A;  3AED A;  1XDP A;  2VWA A;  4ZZB A;  3ZMU B;  4UEM A;  2J47 A;  2X0L B;  1AJ3 A;  2C5I T;  2D9D A;  4DMV A;  2QA7 A;  3C79 A;  2BBH A;  3ZMZ B;  1M62 A;  5DJQ C;  4IE6 A;  4HFC A;  3VR8 A;  3HKD E;  3VKG A;  1G8X A;  3NBX X;  5L4H A;  4WZX A;  4YHH T;  1T8B A;  1WR6 A;  3K3N A;  2X67 A;  1IJ6 A;  3F57 A;  1EZ3 A;  3RQU A;  4DMW A;  1N33 T;  3UU4 A;  4QAC A;  3MXZ A;  2K48 A;  3N5L A;  3BQL A;  1HNX T;  4LF8 T;  2MAW A;  3PJA J;  2QYW A;  2ZM8 A;  3X1D A;  3ZSS A;  4UXU A;  4EIW A;  3IGQ A;  3PV0 F;  2ZLY A;  3WI3 A;  4P0A A;  2K5B B;  4HWD A;  1QSD A;  3ZYL A;  3GN5 A;  2H89 A;  5HEG A;  2BJ0 A;  4DBM A;  3K8P C;  4EXT A;  3KBU A;  1N36 T;  4U33 A;  5BW2 A;  5L4E A;  2DCF A;  2VAS A;  4ZI2 D;  1S94 A;  2KMF A;  2M67 A;  1UGO A;  2H3R A;  3AAA B;  2Q9Q D;  2E8I A;  4B3M T;  2ZJU A;  3ZN0 B;  2E9X B;  4X65 T;  2E5V A;  5LG4 A;  1X79 A;  4QX8 B;  2WZH A;  3BK9 A;  1UUR A;  3L09 A;  2XTL A;  2BS4 A;  3RRC A;  2LOS A;  3T8O A;  4JLE A;  2D0T A;  4DO0 A;  3IEE A;  4CXW A;  2Y58 A;  5FY1 A;  2JMH A;  5BP0 A;  4YJ3 E;  1OED B;  4EYY R;  3AE3 A;  5A1L A;  3CKD A;  2BBJ A;  2BVL A;  1WRD A;  2PTF A;  2CMR A;  3N9Q A;  1FMW A;  4B3S T;  1W9R A;  3UQ7 A;  2LRL A;  2VVN A;  1N34 T;  4I0U A;  4PK6 A;  5AQL B;  2ACX A;  2LT3 A;  1Y01 A;  2WDR A;  3HI2 A;  4P0B A;  4XZC A;  2WSS V;  5FKY A;  4HTE A;  3B57 A;  4U2Z A;  3B5M A;  3F2E A;  5LOV E;  3I0O A;  4LFC T;  4O4L E;  1HS7 A;  3SRZ A;  4HE8 A;  4IIJ E;  3Q5E A;  3N9O A;  2E5L T;  4EYU A;  1B7T A;  3TKL B;  3WTM A;  2XZ5 A;  3IF8 B;  2UUC T;  4CI2 B;  2AXD S;  5ABE A;  3C64 A;  2XAQ B;  4DR4 T;  4J2C A;  4U2Y A;  3SOL A;  3LJC A;  4BQT A;  3SQ9 A;  2HPJ A;  4AFH A;  1YQ3 A;  3RYH E;  5E0O A;  2YIN A;  1MNE A;  2W2U A;  3O1J A;  2CWO A;  2XNT A;  3DP7 A;  3C51 A;  2GK9 A;  4OYK A;  2IML A;  5ABH A;  1XNR T;  3MK7 C;  4WW0 A;  1L0V A;  5L47 A;  3ZJ2 A;  4ZI2 C;  4LF6 T;  3ZYK A;  5ETW A;  3T1Y T;  3LG7 A;  3K1S A;  4DV0 T;  4LML A;  4PK5 A;  2Q9Q C;  5LHH B;  5AQR B;  4TUY E;  2BKO A;  4YSY A;  5LMU T;  5LHI B;  3KVB A;  5LJN A;  5C3J A;  5LYJ E;  5KDM C;  3MAC A;  2CLY B;  3FXE B;  4I4T E;  4AQF C;  2BYQ A;  1SUM B;  3PUG A;  4LF9 T;  3EI0 A;  3JCF A;  2XSB A;  1BR0 A;  2XYS A;  5FNV E;  3LDQ B;  3HKB E;  4O4J E;  3WTN A;  4AFT A;  3RKO A;  3ZT5 A;  4JYA T;  2NOX A;  4HFV A;  4NUU A;  2A9U A;  4FI5 A;  1YKH B;  2XQY A;  3C4Z A;  3KDS E;  2LSY A;  3ONX A;  2FJE A;  2UXC T;  3OVU A;  3ZKR A;  1VRB A;  4TWF A;  4DR1 T;  4X1I E;  3LBX A;  2N2N A;  2IHR 1;  4BJN A;  5JQG E;  2XM1 A;  5AQT B;  4IL4 A;  5FVL A;  2MPK A;  4DR6 T;  4NPP A;  2V6Y A;  3RPU A;  1HR0 T;  4OFZ A;  5TVC A;  5LHG B;  2YKS A;  2ODV A;  5JH7 E;  2W61 A;  4U7I A;  2WWV A;  5L3D B;  3PJA A;  2V7J A;  3HR0 A;  5JME A;  5LXT E;  4MHC A;  2WNJ A;  3MKD A;  5LMN T;  2PBI A;  4YTN A;  3RRW A;  3NRX A;  1SHZ C;  3RKG A;  2KZ7 B;  5IYZ E;  1I6Z A;  4HQP A;  1W0A A;  1KNZ A;  3OPC A;  5FL0 A; 
#chains in the Genus database with same CATH homology
 2Y58 A;  3GUA A;  4LMK A;  4QH4 A;  2KSR A;  3ZDH A;  3U8L A;  3JAD A;  4NZB A;  4A97 A;  2XNU A;  4A98 A;  5CFB A;  5FJV A;  4QH5 A;  2BYN A;  1OED B;  5HCJ A;  5CO5 A;  3C84 A;  5AFH A;  3RQU A;  2XNV A;  1UW6 A;  2PH9 A;  3PMZ A;  3UU4 A;  4QAC A;  4IL9 A;  3U8J A;  4ZJT A;  1OED E;  3RIA A;  4ZJS A;  4HFH A;  4UM3 P;  4UM1 A;  4ZZC A;  3PEO A;  2YN6 A;  3UU3 A;  3TLT A;  2BYQ A;  4HFE A;  2YMD A;  4TNW A;  4TWD A;  5HEO A;  2W8G A;  4FRR A;  3EI0 A;  2BR7 A;  3P50 A;  2WNL A;  2MAW A;  2X00 D;  3RI5 A;  3UQ7 A;  2XYS A;  2BG9 A;  2BYS A;  4UXU A;  5IUX A;  2BYR A;  5AFK A;  3P4W A;  2XQA A;  1UX2 A;  3TLV A;  5J5G A;  2M6B A;  2XQ6 A;  3WTN A;  4AFT A;  5AFM B;  2XYT A;  3WTI A;  3WTJ A;  2XQ4 A;  3WTL A;  3WTH A;  2QC1 B;  3IGQ A;  5LG3 A;  3WTO A;  4TWH A;  5HEJ A;  5J0Z A;  4PIR A;  3SQ6 A;  2X00 A;  2YOE A;  5AFL A;  5BRX A;  3UU5 A;  4ZRU A;  2BG9 C;  2XQ7 A;  4LMJ A;  2WZY A;  3U8N A;  2BYP A;  3JAE A;  3UQ4 A;  5AFJ A;  4ALX A;  5HEG A;  2BJ0 A;  4DBM A;  3TLU A;  2LM2 A;  2M6I A;  3UU8 A;  4COF A;  2C9T A;  3U8M A;  5J5H A;  3ZKR A;  2ZJV A;  3JAF A;  4ILA A;  3TLW A;  4XK9 A;  4TWF A;  5BW2 A;  5J5I A;  5L4E A;  2BG9 E;  3UU6 A;  2XQ3 A;  4QH1 A;  3WTM A;  2WN9 A;  2Y56 A;  4IL4 A;  2XZ5 A;  4QAA A;  4D01 A;  5BP0 A;  2XQ8 A;  3RHW A;  4QAB A;  4NPP A;  4EZ1 A;  5KE4 A;  4IRE A;  4TNV A;  2XQ9 A;  4BQT A;  3SQ9 A;  4HFD A;  5HEU A;  5HEH A;  3WTK A;  4AFH A;  4XHE A;  4UY2 A;  4F8H A;  3TLS A;  4WV9 A;  3SIO A;  3T4M A;  5AIN A;  5TVC A;  2YKS A;  4ZZB A;  1I9B A;  4B5D A;  2BR8 A;  3EHZ A;  2LKG A;  5KZU A;  2Y7Y A;  5AFM A;  5J5F A;  2BG9 B;  2LKH A;  4UM3 S;  4AFG A;  4ZR6 A;  5SYO A;  1OED A;  3RIF A;  2XZ6 A;  2XNT A;  3C79 A;  2ZJU A;  4BFQ A;  2Y54 A;  5AFN A;  2W8F A;  2PGZ A;  2WNC A;  3WIP A;  5JME A;  3SH1 A;  5HCM A;  3LSV A;  3EAM A;  3ZDG A;  3UUB A;  1UV6 A;  4HFC A;  5L47 A;  2WNJ A;  2XQ5 A;  2VL0 A;  4ILC A;  4Z90 A;  2Y57 A;  4HFI A;  2UZ6 A;  5L4H A;  4ZK1 A;  3RQW A;  4ILB A;  2LLY A;  1OED C;  4HFB A;  4UM3 A;  4Z91 A;  2YME A;  5LXB A;  4X5T A;  4HQP A;  4ZK4 A;  3U8K A;  4LML A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...