3U5NA

Crystal structure of the complex of trim33 phd-bromo and h3(1-20)k9me3k14ac histone peptide
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
205
structure length
185
Chain Sequence
DDPNEDWCAVCQNGGDLLCCEKCPKVFHLTCHVPTLLSFPSGDWICTFCRDIGKPEVEYDCDAQGLSPVDQRKCERLLLYLYCHELSIEFQEPVPASIPNYYKIIKKPMDLSTVKKKLQKKHSQHYQIPDDFVADVRLIFKNCERFNEMMKVVQKADSEVAQAGKAVALYFEDKLTEIYSDRTFA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords E3 ubiquitin-protein ligase TRIM33
publication title A Poised Chromatin Platform for TGF-beta access to master regulators
pubmed doi rcsb
source organism Homo sapiens
total genus 58
structure length 185
sequence length 205
chains with identical sequence B
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2011-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 3u5nA02
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3u5nA01
5H9MA 2G45A 4CUQA 4NR7A 2E3KA 4Q0NA 5CFWA 5G0FA 1JM4B 2G6QA 5DYXA 3U5JA 3JVJA 5DLXA 5D0CA 4MEPA 4N4HA 2VPGA 4HXNA 4O77A 4HXPA 2LGLA 5EI4A 5C11A 3EB6A 2R10A 5CUBA 2K17A 5D26A 5G4SA 5LJ1A 4UIWA 4PCIA 5ACYA 3LQJA 5A5PA 2LV9A 5FB0A 2N9GA 4CL9A 5FE8A 4TZ2A 3N9PA 4S3OC 2NXBA 5DKCA 3P1EA 4BHWA 3SVHA 2F6NA 3AQAA 4QUTA 3HMHA 4A9FA 3S92A 5I40A 3U5NA 2RO1A 2M1RA 4CUSA 4Z1QA 4LYWA 1U6GB 4O64A 2K1JA 5TABA 2I8NA 1WEQA 2VP7A 4LADB 5J3XA 3MB3A 4FIPA 3HCSA 2I7KA 3G0JA 2MD7B 5EM3A 3DQVR 1WEVA 2RSDA 2FUIA 3IU6A 3U5LA 3UV2A 2QJ0A 5TB6A 4L7XA 1X4JA 4TU6A 5DKHA 2VJEB 4NRBA 3P5OA 5HRVA 2JRJA 5ENJA 4PTBA 5COIA 2YQLA 4FJCA 5D3HA 5CTLA 5FE2A 4MSXA 5E9KA 5CRMA 5FB1A 2Y43A 5C8GA 5D3PA 4LK9A 5A5OA 5TBNA 4I7BA 2QICA 2E6SA 5EK9A 1FBVA 2K4DA 1DVPA 3O7AA 5HELA 2VPEA 5L96A 4NQNA 2MNYA 4X3GA 4CA1A 5I29A 5BT4A 4TTEA 4LJNA 1E4UA 4YBTA 2L5UA 4QC3A 4XY9A 5L97A 4UIYA 5TDWA 5KH7A 1WEPA 5KO4A 5A82A 5HEMA 4Q6FA 2RNWA 5KHMA 4NRAA 2YHNA 3JVMA 4TKPB 4QUUA 5FG6A 4YH3A 4ALHA 2JMDA 4QSWA 2L80A 1JOCA 5JWMA 5C85A 4QZSA 2E7NA 4TT4A 4LZSA 5E0RA 4KCXA 4A4BA 4O7BA 4AVXA 5I86A 4GNGA 5CUGA 4IC3A 3JVKA 4X2IA 4NUEA 3N9QA 5H85A 5CQ8A 5A5RA 3QZSA 5C13A 3P1DA 2YQDA 1WEMA 2D8SA 4O7AA 5G04B 5F2PA 4ZW1A 1JSPB 1Z60A 5E9LA 4GNEA 5F5ZA 5LJ0A 4O7FA 5EP7A 2FSAA 3U5PA 5AD3A 4C67A 5F63A 4N3WA 4F3IA 1WEEA 5FBXA 1VYXA 3T6RA 3KV5A 5FE1A 5HCLA 1WE9A 5DX4A 4IOOA 5CS8A 4UYDA 2M3HA 3SVFA 4HXMA 5LKUA 1LDKC 5BT5A 2MJVB 4XUBA 3O33A 4QBMA 4QSQA 4QY4A 4NYXA 4WZ2A 2D9EA 5II2A 4KV1A 4N4GA 4HXRA 5DYCA 2YREA 5DINA 4YYMA 4IR3A 2KWJA 5EU1A 2YUCA 5LKZA 4MEQA 4YYHA 2KE1A 3G0LA 2KR4A 5DFCA 5CUEA 4MR5A 4YBMA 4B7YC 4PCEA 2VPBA 4QF3A 1MM3A 5CPEA 5G4RA 5D1LB 4ZDTA 2L85A 3I3JA 5HJCA 5EWWA 5HM0A 3M63A 4LRGA 2ECGA 3HMEA 4UI9B 2LSPB 3ZVZB 2LGKA 3LXJA 2YW8A 4Z6IA 4YYJA 2KTBB 5ETBA 5EPSA 2LXHC 5HENA 4TYLA 4LR6A 5FH8A 3FL2A 4GB0A 5D3TA 3MB4A 2KGGA 3M99A 5FERA 5F62A 4J3IA 3C6WA 5EQ1A 4QC1A 5HLSA 4NQMA 4TT6A 4A9OA 3P1FA 5HQ6A 2KWNA 2DVSA 4N4IA 3NXBA 4O74A 5HQ5A 4NRCA 2RI7A 2LRIC 4GPJA 1WEOA 2MIQA 2YW5A 5F36A 2CSZA 5FE9A 3UV5A 4YYIA 5C4QA 3GG3A 5ETDA 5CQ4A 5C7NA 5A81A 4RVRA 5AITA 5F1HA 2E7OA 5B76A 5F61A 2YQMA 3QZVA 4QSTA 4QYDA 5D7XA 2G43A 1XWHA 4MENA 5ENIA 3P1CA 4HXLA 5TCMA 3UVXA 4I7DA 2L5EA 2H0DA 2YDWA 2IDAA 2VNFA 4W4UA 5H1TA 1FP0A 4QR5A 1T1HA 2YYRA 5CQ5A 5D24A 5IGLA 2CSYA 5LKTA 5E9VA 5EA1A 2MUMA 3N9NA 3SOUA 3D7CA 5A5NA 2EGPA 3Q2FA 4O75A 5CP5A 5FH7A 5L8TA 2KYUA 4V3LC 5B79A 5FFYA 4A9MA 5I7XA 5I80A 5HFQA 4NS5A 5IIDA 3N9MA 2R0SA 4YH4A 1JM7A 4MR4A 3KNVA 4BW1A 2JMIA 2DWWA 4IOQA 1Z6UA 5LVQA 3AADA 2YT5A 3MHSA 1WUGA 1RMDA 5E3GA 1WILA 4UYFA 2YHOA 5J0DA 3UW9A 3GL6A 5JG6A 4FLPA 4LZ2A 4A9NA 2LGVA 2RNXA 5D3JA 3ASLA 3MHHA 3HTKC 4WZ0A 2H0DB 4BBQA 2PUYA 5EYAF 4B86C 2R0VA 5HFRA 5EWDA 2L75A 4R2YA 5KTXA 3SOXA 2E6RA 2DKWA 5IGMA 2OSSA 2NAAA 5IGKA 1WENA 3T7LA 4IR6A 4QSPA 2YELA 5A83A 5FG4A 2MNZA 2Y1MA 4LLBA 5D3RA 4MEOA 4O76A 3ZPV1 4WZ3B 4HBXA 1WESA 5EPRA 5F1LA 2OUOA 1HYJA 4IR4A 4PPEA 4XYAA 5FFVA 3FKMX 1BORA 4P5OB 5EPBA 2CKLA 4YYKA 4A0CD 2RNYA 4QR4A 2YYNA 4TQNA 4O7EA 3UVWA 5A5SA 1WIMA 4WIVA 3I2DA 3N9LA 4LC2A 3MXFA 4QSUA 5FDZA 5ENBA 5E7DA 4WA6A 4CUTA 5E3DA 2L0BA 1MM2A 4HBVA 4UIXA 3LQHA 1VD4A 2EA6A 1VFYA 5BT3A 2FUUA 3PHDA 5ENEA 4A9KA 4GNDA 5LVRA 3DPLR 5HQ7A 5B77A 5IBNA 4V3KC 5CUAA 5ENHA 1N72A 3ZYQA 3L11A 5DW1A 4L58A 1EQFA 2OO1A 4Y03A 4J1PA 2KIZA 5D25A 4BW4A 1WEWA 4E96A 4O72A 2ECIA 5K29A 2LXPC 5II1A 3PUQA 2CKLB 5FE5A 5KU3A 4UYHA 3O34A 4O78A 4UIUA 5DFBA 3VK6A 2L43A 3ONIA 5DYAA 3GV4A 5E73A 5F3AA 3KV6A 4QB3A 4R7EA 5H1VA 4YYDA 4IC2A 2M6MA 4F52B 3UVDA 5CGPA 5E9MA 2EODA 2F42A 5DKAA 5CQ7A 1F68A 4TS8A 4CCGX 4LDFA 5LCWB 5AIUA 3ZPVE 2XEUA 5CQAA 2M85A 5D3SA 4TZ8A 3KQIA 4FK5A 4CUPA 5D1MB 3PURA 4HXKA 4QSSA 4MR3A 3HCUA 4QSVA 4QNSA 5CQ6A 5I3LA 4HXSA 2QIZA 3L1XA 5FE7A 4LKAA 5KH9A 3SHBA 4YY4A 1WFKA 4YADA 3EB5A 4ALGA 4CURA 2HDPA 2PNXA 5FH6A 2LQ6A 2VJFA 2H60A 3V43A 4O70A 5E74A 4BW3A 4QSXA 3HCTA 5LUUA 4Z1SA 1X4UA 2YURA 1E6IA 2LDRA 5DBMA 1G25A 4N4FA 3O36A 4YY6A 4DONA 4AUQB 2VJEA 4KV4A 1F62A 5EVAA 3RCWA 1N87A 5G05B 5CY9A 4AYCA 2BAYA 1CHCA 2YEKA 5FE3A 5I7YA 2GRCA 5LKXA 5IG6A 4NXJA 4NUDA 4WHWA 5ENGA 2ECVA 2ECJA 4UP5A 4UIVA 3DAIA 4QEUA 2L84A 4CFLA 3TLPA 3LQIA 2G4AA 4HBWA 4WHUA 4QF2A 3QZTA 2F6JA 4YYGA 4BJXA 5DLZA 4YK0A 2WP1A 5CUDA 4QEVA 2OXQC 5I83A 3M62A 5EWCA 2VJFB 5CUCA 2UZGA 1IYMA 1ZBDB 4YYNA 2MA5A 5I89A 5FEYA 3ZTGA 4YC9A 4QYLA 5B8DA 2KWKA 4A9JA 3IU5A 2DATA 2KWOA 4I7CA 3U5MA 5F60A 4R8PK 4CFKA 2Y1NA 4S3OB 3MULA 4XY8A 3JVLA 3Q2EA 5KTUA 1X0JA 3UV4A 3ZYUA 2DX8A 4AYCB 4ZC9A 4HBYA 3K2JA 4O71A 5A85A 5D3LA 5FE0A 4YAXA 4J0RA 4UP0A 2I50A 4GNFA 5I88A 3ZVYA 3LRQA 4OUFA 5C89A 5HRXA 1WEUA 4J0SA 5D3NA 4YATA 4A9IA 4ZQLA 4CUUA 3U5OA 5EISA 5E9IA 3SVGA 4UITA 4BW2A 5L98A 2ZETC 5CRZA 2JMJA 5FE4A 3U5KA 4C66A 2CT2A 5ENCA 3O37A 2WP2A 2DVVA 2RS9B 5DFDA 2YSMA 1JM7B 5EWVA 4ZUXU 5DKDA 5EWHA 5EICA 3O70A 4NR9A 2DVRA 4UYFB 1WUMA 1X4IA 4A9LA 5DY7A 2R0YA 5H1UA 5EGUA 5AMEA 1V87A 4Q0OA 2KFTA 1ZS5A 5A5QA 2YSJA 4NR4A 4NR5A 5EV9A 4A9EA 2K16A 5LJ2A 5B75A 2MD8C 4PKLA 5HRWA 2ECTA 1LDJB 3RTRB 4QSRA 4A9HA 5C87A 4OGJA 2YEMA 5AD2A 5KTWA 5CQTA 3HMFA 1WGMA 4AKNA 2AN6A 2KREA 2DVQA 2ECNA 2KGIA 2VPDA 2LGGA 4C9ZA 3LJWA 5ENFA 3SOWA 4Z93A 4O7CA 2ECWA 4NR8A 5FG5A 5TRBA 5AMFA 4UYGA 5FFWA 4YABA 5CU8A 5F25A 4UIZA 4XUAA 4NR6A 5DW2A 5I1QA 4PY6A 4A4CA 4CLBA 4Z6HA 4TT2A 3MUKA 4IORA 4PS5A 3DWYA 5IGNA 2MT5A 3RPGC 4A49A 2RFJA 5L8UA 4TU4A 4NYVA 3C5KA 5JI8A 4AP4A 3ZNIA 4YBSA 4QR3A 5B78A 4OGIA 4LYIA 4MR6A 4NYWA 4XI1A 4NN2A 5TDRA 5E9YA 4FO9A 5DYUA 2D82A 5D1KB 5CZGA 2LN0A 4HXOA 4LYSA 3N9OA 3UVYA 1Z2QA 2HYED 5A7CA 2YU4A 3RPGB 1K2FA 4LZRA 4QEWA 3IHPA 4NUCA 5CQ3A 5KH3A 5FE6A 2XB1A 4IR5A 3S91A 1HYIA 3NG2A 5L99A 2C2LA 3MQMA 2KU3A 4MVTA 2C2VS 3L1ZB 4UYEA 2MA6A 3O35A
chains in the Genus database with same CATH superfamily
5H9MA 2G45A 4CUQA 4NR7A 2E3KA 4Q0NA 5CFWA 5G0FA 1JM4B 2G6QA 5DYXA 3U5JA 3JVJA 5DLXA 5D0CA 4MEPA 4N4HA 2VPGA 4HXNA 4O77A 4HXPA 2LGLA 5EI4A 5C11A 3EB6A 2R10A 5CUBA 2K17A 5D26A 5G4SA 5LJ1A 4UIWA 4PCIA 5ACYA 3LQJA 5A5PA 2LV9A 5FB0A 5SVYA 2N9GA 3KDEC 4CL9A 5FE8A 4TZ2A 3N9PA 4S3OC 2NXBA 5DKCA 3P1EA 4BHWA 3SVHA 1DCQA 3D1BA 2F6NA 3AQAA 4QUTA 3HMHA 4A9FA 3S92A 5I40A 3U5NA 2RO1A 2M1RA 4CUSA 4Z1QA 4LYWA 1U6GB 4O64A 2K1JA 5TABA 2I8NA 1WEQA 2VP7A 4LADB 5J3XA 3MB3A 2OWAA 3HCSA 4FIPA 2I7KA 3G0JA 2MD7B 5EM3A 3DQVR 2E61A 1WEVA 2RSDA 2FUIA 3IU6A 3U5LA 3UV2A 2QJ0A 5TB6A 4L7XA 1X4JA 4TU6A 5DKHA 2VJEB 4NRBA 3P5OA 5HRVA 2JRJA 5ENJA 4PTBA 5COIA 2LAUA 2YQLA 5D3HA 4FJCA 5CTLA 5FE2A 4MSXA 5E9KA 5CRMA 5FB1A 2Y43A 5C8GA 5D3PA 4LK9A 5A5OA 2CRWA 5TBNA 4I7BA 2QICA 2E6SA 5EK9A 1FBVA 2K4DA 1DVPA 3O7AA 5HELA 2VPEA 5L96A 4NQNA 3FJUB 2MNYA 4X3GA 4CA1A 3VKGA 5I29A 5BT4A 4TTEA 4LJNA 2KKXA 3FANA 1E4UA 4YBTA 2L5UA 4QC3A 4XY9A 5L97A 4UIYA 5TDWA 5KH7A 1WEPA 5KO4A 5A82A 5HEMA 4Q6FA 2RNWA 5KHMA 4NRAA 2YHNA 3JVMA 4TKPB 4AKIA 4QUUA 5FG6A 4YH3A 4ALHA 2JMDA 4QSWA 2L80A 1JOCA 5JWMA 5C85A 4QZSA 1PUOA 2E7NA 4TT4A 4LZSA 5E0RA 4KCXA 4A4BA 3T9KA 4O7BA 4AVXA 5I86A 4GNGA 5CUGA 4IC3A 3JVKA 4X2IA 4NUEA 3N9QA 5H85A 3Q1DA 5CQ8A 5A5RA 3QZSA 5C13A 3P1DA 2YQDA 1WEMA 2D8SA 4O7AA 5G04B 5F2PA 4ZW1A 1JSPB 1Z60A 5E9LA 2DJAA 4GNEA 5F5ZA 5LJ0A 4O7FA 5EP7A 2FSAA 3U5PA 5AD3A 4C67A 5F63A 4N3WA 4F3IA 1WEEA 5FBXA 1VYXA 3T6RA 3KV5A 5FE1A 5HCLA 1WE9A 5DX4A 4IOOA 5CS8A 4UYDA 2M3HA 3SVFA 4HXMA 5LKUA 1LDKC 5BT5A 2IQJA 2MJVB 4XUBA 3D1DA 3O33A 4QBMA 4QSQA 4QY4A 4NYXA 4WZ2A 2D9EA 5II2A 4KV1A 4N4GA 4HXRA 5DYCA 2YREA 5DINA 4YYMA 2JM3A 4IR3A 2KWJA 5EU1A 3FM8C 2YUCA 5LKZA 4MEQA 4YYHA 2KE1A 3G0LA 2KR4A 5DFCA 5CUEA 4MR5A 4YBMA 4B7YC 4PCEA 2VPBA 4QF3A 1MM3A 5CPEA 5G4RA 5D1LB 4ZDTA 2L85A 3I3JA 5HJCA 5EWWA 3O47A 5HM0A 3H7HA 3M63A 4LRGA 2ECGA 3HMEA 4UI9B 2LSPB 3ZVZB 2LGKA 3LXJA 2YW8A 4Z6IA 5K3QA 4YYJA 2KTBB 5ETBA 5EPSA 2LXHC 5HENA 4TYLA 4LR6A 5FH8A 1MBMA 3FL2A 4GB0A 5D3TA 3MB4A 2KGGA 3M99A 5FERA 5F62A 4J3IA 3C6WA 5EQ1A 4QC1A 5HLSA 4NQMA 4TT6A 4A9OA 3P1FA 5HQ6A 2KWNA 2DVSA 4N4IA 3NXBA 4O74A 5HQ5A 4NRCA 2RI7A 2LRIC 4GPJA 1WEOA 2MIQA 2YW5A 2XOZA 5F36A 2CSZA 5FE9A 3UV5A 4YYIA 5C4QA 3GG3A 5ETDA 5CQ4A 5C7NA 5A81A 4RVRA 2FD4A 5AITA 5F1HA 2E7OA 5B76A 3ERRA 5F61A 2YQMA 3QZVA 4QSTA 4QYDA 5D7XA 2G43A 1XWHA 2CONA 4MENA 5ENIA 3P1CA 4HXLA 5TCMA 3UVXA 4I7DA 2L5EA 2H0DA 2YDWA 2IDAA 2P57A 3LJUX 2VNFA 4W4UA 5H1TA 1FP0A 4QR5A 1T1HA 2YYRA 5CQ5A 5D24A 5IGLA 4F1PA 2CSYA 5LKTA 5E9VA 5EA1A 2MUMA 3N9NA 2MKEA 3SOUA 3D7CA 5A5NA 2EGPA 3Q2FA 4O75A 5CP5A 5FH7A 5L8TA 2KYUA 2L7PA 4V3LC 5B79A 5FFYA 4A9MA 5I7XA 5I80A 5HFQA 3JUEA 4NS5A 5IIDA 3N9MA 2R0SA 4YH4A 1JM7A 4MR4A 3KNVA 4BW1A 2JMIA 2DWWA 4IOQA 3FAOA 1Z6UA 5LVQA 3AADA 2YT5A 3MHSA 1WUGA 1RMDA 5E3GA 1WILA 4UYFA 2YHOA 5J0DA 3UW9A 3GL6A 5JG6A 4FLPA 4LZ2A 4A9NA 2LGVA 2RNXA 5D3JA 3ASLA 3PLWA 3MHHA 3HTKC 4WZ0A 2H0DB 4BBQA 2PUYA 5EYAF 4B86C 2R0VA 5HFRA 5EWDA 2YVRA 2XOCA 2L75A 4R2YA 5KTXA 3SOXA 2XOYA 2E6RA 2DKWA 5IGMA 2RR4A 2OSSA 2NAAA 5IGKA 1WENA 3T7LA 4IR6A 4QSPA 2YELA 5A83A 5FG4A 2MNZA 2Y1MA 4LLBA 5D3RA 4MEOA 4O76A 3ZPV1 4WZ3B 4HBXA 1WESA 5EPRA 5F1LA 2OUOA 1HYJA 4IR4A 4PPEA 4XYAA 5FFVA 3FKMX 1BORA 4P5OB 3SUBA 5EPBA 2CKLA 4YYKA 4AKHA 4A0CD 2RNYA 4QR4A 2YYNA 4TQNA 4O7EA 3UVWA 5A5SA 1WIMA 2EXUA 4WIVA 3I2DA 3N9LA 4LC2A 5SVIA 3MXFA 4QSUA 5FDZA 5ENBA 5E7DA 4WA6A 4CUTA 5E3DA 2L0BA 1MM2A 4HBVA 3LVQE 4UIXA 3LQHA 1VD4A 2EA6A 1VFYA 5BT3A 2FUUA 3PHDA 5ENEA 4A9KA 4GNDA 5LVRA 2M13A 3DPLR 5HQ7A 5B77A 5IBNA 4V3KC 5CUAA 5ENHA 3M7KA 1N72A 3ZYQA 3L11A 5DW1A 4L58A 1EQFA 2OO1A 4Y03A 4O62A 4J1PA 2KIZA 2KKYA 5D25A 4BW4A 1WEWA 4E96A 4O72A 2ECIA 5K29A 2LXPC 5II1A 3PUQA 2CKLB 5FE5A 5KU3A 1ZKRA 4UYHA 3O34A 4O78A 4UIUA 5DFBA 3VK6A 2L43A 3ONIA 5DYAA 3GV4A 5E73A 5F3AA 3KV6A 4QB3A 4R7EA 5H1VA 4YYDA 4IC2A 2M6MA 2B0OE 4F52B 3UVDA 5CGPA 5E9MA 2EODA 2F42A 5DKAA 5CQ7A 1F68A 4TS8A 4CCGX 4LDFA 5LCWB 5AIUA 3ZPVE 2XEUA 5CQAA 2M85A 5D3SA 4TZ8A 3KQIA 4FK5A 4CUPA 4QQ4A 5D1MB 3PURA 4HXKA 4QSSA 4MR3A 3HCUA 4QSVA 4QNSA 5CQ6A 5I3LA 4HXSA 2QIZA 2CSVA 5FE7A 3L1XA 4LKAA 5KH9A 4YY4A 1WFKA 4YADA 3SHBA 3EB5A 2VPDA 4ALGA 4CURA 2HDPA 2PNXA 5FH6A 2LQ6A 2VJFA 2H60A 3V43A 4O70A 5E74A 4BW3A 4QSXA 3HCTA 5LUUA 2EGMA 4Z1SA 1X4UA 2YURA 1E6IA 2LDRA 5DBMA 1G25A 4N4FA 3O36A 4YY6A 4DONA 4AUQB 2VJEA 4KV4A 1F62A 5EVAA 3RCWA 1N87A 5G05B 5CY9A 4H9DA 4AYCA 2BAYA 1CHCA 2YEKA 5FE3A 5I7YA 2GRCA 5LKXA 5IG6A 3DWDA 4NXJA 4NUDA 4WHWA 5ENGA 4OGEA 2ECVA 2ECJA 4UP5A 4UIVA 3DAIA 4QEUA 2L84A 4CFLA 3TLPA 3LQIA 2G4AA 4HBWA 4WHUA 4QF2A 3QZTA 2F6JA 4YYGA 4BJXA 5DLZA 4YK0A 2WP1A 5CUDA 4QEVA 2EJNA 2JUNA 2OXQC 5I83A 3M62A 5EWCA 2VJFB 5CUCA 2UZGA 1IYMA 1ZBDB 4YYNA 2MA5A 5I89A 5FEYA 3ZTGA 4YC9A 4QYLA 4Z0RA 5B8DA 2KWKA 4A9JA 5SVXA 3IU5A 2DATA 2KWOA 4I7CA 3U5MA 5F60A 4R8PK 4CFKA 2Y1NA 4S3OB 3MULA 4XY8A 3JVLA 3Q2EA 5KTUA 1X0JA 3UV4A 3ZYUA 2DX8A 4AYCB 4ZC9A 4HBYA 3K2JA 4O71A 5A85A 5D3LA 5FE0A 4YAXA 4J0RA 4UP0A 2I50A 4GNFA 5I88A 3ZVYA 3LRQA 4OUFA 5C89A 5HRXA 1WEUA 4J0SA 5D3NA 4YATA 4A9IA 4ZQLA 4CUUA 3U5OA 5EISA 3DDTA 5E9IA 3SVGA 4UITA 4BW2A 5L98A 2ZETC 5CRZA 2JMJA 5FE4A 3U5KA 4C66A 2CT2A 5ENCA 3O37A 2WP2A 2DVVA 2RS9B 5DFDA 2YSMA 3LVRE 5EWVA 4ZUXU 1JM7B 5DKDA 5EWHA 4AI6A 5EICA 3O70A 4NR9A 2DVRA 4UYFB 1WUMA 1X4IA 4A9LA 5DY7A 2R0YA 5H1UA 5EGUA 5AMEA 1V87A 4Q0OA 2KFTA 1ZS5A 5A5QA 2YSJA 2XP0A 4NR4A 4NR5A 5EV9A 4A9EA 2K16A 5LJ2A 5B75A 2MD8C 4PKLA 5HRWA 2ECTA 1LDJB 3RTRB 4QSRA 4A9HA 5C87A 4OGJA 2YEMA 5AD2A 5KTWA 5CQTA 4AKGA 3HMFA 1WGMA 4AKNA 2AN6A 2KREA 2DVQA 2D8UA 2ECNA 2KGIA 2LGGA 4C9ZA 3LJWA 5ENFA 3SOWA 4Z93A 4O7CA 2ECWA 4NR8A 5FG5A 5TRBA 3FEHA 5AMFA 4UYGA 5FFWA 3LDYA 4YABA 5CU8A 3E2DA 5F25A 4UIZA 4XUAA 4NR6A 5DW2A 5I1QA 4PY6A 4A4CA 4CLBA 4Z6HA 4TT2A 3MUKA 4IORA 4PS5A 3DWYA 5IGNA 2MT5A 4Z0OA 3RPGC 4A49A 2RFJA 5SVIB 5L8UA 4TU4A 4NYVA 3C5KA 5JI8A 4AP4A 2CRRA 3ZNIA 4YBSA 4QR3A 5B78A 4OGIA 4LYIA 4MR6A 4NYWA 4XI1A 4NN2A 5TDRA 5E9YA 4FO9A 4OGCA 3MDBC 5DYUA 2D82A 5D1KB 5CZGA 2LN0A 4HXOA 4LYSA 3N9OA 3UVYA 1Z2QA 2HYED 5A7CA 2YU4A 2FFWA 3RPGB 1K2FA 4LZRA 4QEWA 3IHPA 4NUCA 5CQ3A 5KH3A 5FE6A 3VKHA 2XB1A 4IR5A 3S91A 1HYIA 3NG2A 5L99A 2C2LA 3MQMA 2KU3A 4MVTA 2C2VS 3L1ZB 2DSMA 4UYEA 2MA6A 3O35A
chains in the Genus database with same CATH topology
5H9MA 2G45A 4CUQA 4NR7A 2E3KA 4Q0NA 5CFWA 5G0FA 1JM4B 2G6QA 5DYXA 3U5JA 3JVJA 5DLXA 5D0CA 4MEPA 4N4HA 2VPGA 4HXNA 4O77A 4HXPA 2LGLA 5EI4A 5C11A 3EB6A 2R10A 5CUBA 2K17A 5D26A 5G4SA 5LJ1A 4UIWA 4PCIA 5ACYA 3LQJA 5A5PA 2LV9A 5FB0A 2N9GA 4CL9A 5FE8A 4TZ2A 3N9PA 4S3OC 2NXBA 5DKCA 3P1EA 4BHWA 3SVHA 2F6NA 3AQAA 4QUTA 3HMHA 4A9FA 3S92A 5I40A 3U5NA 2RO1A 2M1RA 4CUSA 4Z1QA 4LYWA 1U6GB 4O64A 2K1JA 5TABA 2I8NA 1WEQA 2VP7A 4LADB 5J3XA 3MB3A 4FIPA 3HCSA 2I7KA 3G0JA 2MD7B 5EM3A 3DQVR 1WEVA 2RSDA 2FUIA 3IU6A 3U5LA 3UV2A 2QJ0A 5TB6A 4L7XA 1X4JA 4TU6A 5DKHA 2VJEB 4NRBA 3P5OA 5HRVA 2JRJA 5ENJA 4PTBA 5COIA 2YQLA 4FJCA 5D3HA 5CTLA 5FE2A 4MSXA 5E9KA 5CRMA 5FB1A 2Y43A 5C8GA 5D3PA 4LK9A 5A5OA 5TBNA 4I7BA 2QICA 2E6SA 5EK9A 1FBVA 2K4DA 1DVPA 3O7AA 5HELA 2VPEA 5L96A 4NQNA 2MNYA 4X3GA 4CA1A 5I29A 5BT4A 4TTEA 4LJNA 1E4UA 4YBTA 2L5UA 4QC3A 4XY9A 5L97A 4UIYA 5TDWA 5KH7A 1WEPA 5KO4A 5A82A 5HEMA 4Q6FA 2RNWA 5KHMA 4NRAA 2YHNA 3JVMA 4TKPB 4QUUA 5FG6A 4YH3A 4ALHA 2JMDA 4QSWA 2L80A 1JOCA 5JWMA 5C85A 4QZSA 2E7NA 4TT4A 4LZSA 5E0RA 4KCXA 4A4BA 4O7BA 4AVXA 5I86A 4GNGA 5CUGA 4IC3A 3JVKA 4X2IA 4NUEA 3N9QA 5H85A 5CQ8A 5A5RA 3QZSA 5C13A 3P1DA 2YQDA 1WEMA 2D8SA 4O7AA 5G04B 5F2PA 4ZW1A 1JSPB 1Z60A 5E9LA 4GNEA 5F5ZA 5LJ0A 4O7FA 5EP7A 2FSAA 3U5PA 5AD3A 4C67A 5F63A 4N3WA 4F3IA 1WEEA 5FBXA 1VYXA 3T6RA 3KV5A 5FE1A 5HCLA 1WE9A 5DX4A 4IOOA 5CS8A 4UYDA 2M3HA 3SVFA 4HXMA 5LKUA 1LDKC 5BT5A 2MJVB 4XUBA 3O33A 4QBMA 4QSQA 4QY4A 4NYXA 4WZ2A 2D9EA 5II2A 4KV1A 4N4GA 4HXRA 5DYCA 2YREA 5DINA 4YYMA 4IR3A 2KWJA 5EU1A 2YUCA 5LKZA 4MEQA 4YYHA 2KE1A 3G0LA 2KR4A 5DFCA 5CUEA 4MR5A 4YBMA 4B7YC 4PCEA 2VPBA 4QF3A 1MM3A 5CPEA 5G4RA 5D1LB 4ZDTA 2L85A 3I3JA 5HJCA 5EWWA 5HM0A 3M63A 4LRGA 2ECGA 3HMEA 4UI9B 2LSPB 3ZVZB 2LGKA 3LXJA 2YW8A 4Z6IA 4YYJA 2KTBB 5ETBA 5EPSA 2LXHC 5HENA 4TYLA 4LR6A 5FH8A 3FL2A 4GB0A 5D3TA 3MB4A 2KGGA 3M99A 5FERA 5F62A 4J3IA 3C6WA 5EQ1A 4QC1A 5HLSA 4NQMA 4TT6A 4A9OA 3P1FA 5HQ6A 2KWNA 2DVSA 4N4IA 3NXBA 4O74A 5HQ5A 4NRCA 2RI7A 2LRIC 4GPJA 1WEOA 2MIQA 2YW5A 5F36A 2CSZA 5FE9A 3UV5A 4YYIA 5C4QA 3GG3A 5ETDA 5CQ4A 5C7NA 5A81A 4RVRA 5AITA 5F1HA 2E7OA 5B76A 5F61A 2YQMA 3QZVA 4QSTA 4QYDA 5D7XA 2G43A 1XWHA 4MENA 5ENIA 3P1CA 4HXLA 5TCMA 3UVXA 4I7DA 2L5EA 2H0DA 2YDWA 2IDAA 2VNFA 4W4UA 5H1TA 1FP0A 4QR5A 1T1HA 2YYRA 5CQ5A 5D24A 5IGLA 2CSYA 5LKTA 5E9VA 5EA1A 2MUMA 3N9NA 3SOUA 3D7CA 5A5NA 2EGPA 3Q2FA 4O75A 5CP5A 5FH7A 5L8TA 2KYUA 4V3LC 5B79A 5FFYA 4A9MA 5I7XA 5I80A 5HFQA 4NS5A 5IIDA 3N9MA 2R0SA 4YH4A 1JM7A 4MR4A 3KNVA 4BW1A 2JMIA 2DWWA 4IOQA 1Z6UA 5LVQA 3AADA 2YT5A 3MHSA 1WUGA 1RMDA 5E3GA 1WILA 4UYFA 2YHOA 5J0DA 3UW9A 3GL6A 5JG6A 4FLPA 4LZ2A 4A9NA 2LGVA 2RNXA 5D3JA 3ASLA 3MHHA 3HTKC 4WZ0A 2H0DB 4BBQA 2PUYA 5EYAF 4B86C 2R0VA 5HFRA 5EWDA 2L75A 4R2YA 5KTXA 3SOXA 2E6RA 2DKWA 5IGMA 2OSSA 2NAAA 5IGKA 1WENA 3T7LA 4IR6A 4QSPA 2YELA 5A83A 5FG4A 2MNZA 2Y1MA 4LLBA 5D3RA 4MEOA 4O76A 3ZPV1 4WZ3B 4HBXA 1WESA 5EPRA 5F1LA 2OUOA 1HYJA 4IR4A 4PPEA 4XYAA 5FFVA 3FKMX 1BORA 4P5OB 5EPBA 2CKLA 4YYKA 4A0CD 2RNYA 4QR4A 2YYNA 4TQNA 4O7EA 3UVWA 5A5SA 1WIMA 4WIVA 3I2DA 3N9LA 4LC2A 3MXFA 4QSUA 5FDZA 5ENBA 5E7DA 4WA6A 4CUTA 5E3DA 2L0BA 1MM2A 4HBVA 4UIXA 3LQHA 1VD4A 2EA6A 1VFYA 5BT3A 2FUUA 3PHDA 5ENEA 4A9KA 4GNDA 5LVRA 3DPLR 5HQ7A 5B77A 5IBNA 4V3KC 5CUAA 5ENHA 1N72A 3ZYQA 3L11A 5DW1A 4L58A 1EQFA 2OO1A 4Y03A 4J1PA 2KIZA 5D25A 4BW4A 1WEWA 4E96A 4O72A 2ECIA 5K29A 2LXPC 5II1A 3PUQA 2CKLB 5FE5A 5KU3A 4UYHA 3O34A 4O78A 4UIUA 5DFBA 3VK6A 2L43A 3ONIA 5DYAA 3GV4A 5E73A 5F3AA 3KV6A 4QB3A 4R7EA 5H1VA 4YYDA 4IC2A 2M6MA 4F52B 3UVDA 5CGPA 5E9MA 2EODA 2F42A 5DKAA 5CQ7A 1F68A 4TS8A 4CCGX 4LDFA 5LCWB 5AIUA 3ZPVE 2XEUA 5CQAA 2M85A 5D3SA 4TZ8A 3KQIA 4FK5A 4CUPA 5D1MB 3PURA 4HXKA 4QSSA 4MR3A 3HCUA 4QSVA 4QNSA 5CQ6A 5I3LA 4HXSA 2QIZA 3L1XA 5FE7A 4LKAA 5KH9A 3SHBA 4YY4A 1WFKA 4YADA 3EB5A 4ALGA 4CURA 2HDPA 2PNXA 5FH6A 2LQ6A 2VJFA 2H60A 3V43A 4O70A 5E74A 4BW3A 4QSXA 3HCTA 5LUUA 4Z1SA 1X4UA 2YURA 1E6IA 2LDRA 5DBMA 1G25A 4N4FA 3O36A 4YY6A 4DONA 4AUQB 2VJEA 4KV4A 1F62A 5EVAA 3RCWA 1N87A 5G05B 5CY9A 4AYCA 2BAYA 1CHCA 2YEKA 5FE3A 5I7YA 2GRCA 5LKXA 5IG6A 4NXJA 4NUDA 4WHWA 5ENGA 2ECVA 2ECJA 4UP5A 4UIVA 3DAIA 4QEUA 2L84A 4CFLA 3TLPA 3LQIA 2G4AA 4HBWA 4WHUA 4QF2A 3QZTA 2F6JA 4YYGA 4BJXA 5DLZA 4YK0A 2WP1A 5CUDA 4QEVA 2OXQC 5I83A 3M62A 5EWCA 2VJFB 5CUCA 2UZGA 1IYMA 1ZBDB 4YYNA 2MA5A 5I89A 5FEYA 3ZTGA 4YC9A 4QYLA 5B8DA 2KWKA 4A9JA 3IU5A 2DATA 2KWOA 4I7CA 3U5MA 5F60A 4R8PK 4CFKA 2Y1NA 4S3OB 3MULA 4XY8A 3JVLA 3Q2EA 5KTUA 1X0JA 3UV4A 3ZYUA 2DX8A 4AYCB 4ZC9A 4HBYA 3K2JA 4O71A 5A85A 5D3LA 5FE0A 4YAXA 4J0RA 4UP0A 2I50A 4GNFA 5I88A 3ZVYA 3LRQA 4OUFA 5C89A 5HRXA 1WEUA 4J0SA 5D3NA 4YATA 4A9IA 4ZQLA 4CUUA 3U5OA 5EISA 5E9IA 3SVGA 4UITA 4BW2A 5L98A 2ZETC 5CRZA 2JMJA 5FE4A 3U5KA 4C66A 2CT2A 5ENCA 3O37A 2WP2A 2DVVA 2RS9B 5DFDA 2YSMA 1JM7B 5EWVA 4ZUXU 5DKDA 5EWHA 5EICA 3O70A 4NR9A 2DVRA 4UYFB 1WUMA 1X4IA 4A9LA 5DY7A 2R0YA 5H1UA 5EGUA 5AMEA 1V87A 4Q0OA 2KFTA 1ZS5A 5A5QA 2YSJA 4NR4A 4NR5A 5EV9A 4A9EA 2K16A 5LJ2A 5B75A 2MD8C 4PKLA 5HRWA 2ECTA 1LDJB 3RTRB 4QSRA 4A9HA 5C87A 4OGJA 2YEMA 5AD2A 5KTWA 5CQTA 3HMFA 1WGMA 4AKNA 2AN6A 2KREA 2DVQA 2ECNA 2KGIA 2VPDA 2LGGA 4C9ZA 3LJWA 5ENFA 3SOWA 4Z93A 4O7CA 2ECWA 4NR8A 5FG5A 5TRBA 5AMFA 4UYGA 5FFWA 4YABA 5CU8A 5F25A 4UIZA 4XUAA 4NR6A 5DW2A 5I1QA 4PY6A 4A4CA 4CLBA 4Z6HA 4TT2A 3MUKA 4IORA 4PS5A 3DWYA 5IGNA 2MT5A 3RPGC 4A49A 2RFJA 5L8UA 4TU4A 4NYVA 3C5KA 5JI8A 4AP4A 3ZNIA 4YBSA 4QR3A 5B78A 4OGIA 4LYIA 4MR6A 4NYWA 4XI1A 4NN2A 5TDRA 5E9YA 4FO9A 5DYUA 2D82A 5D1KB 5CZGA 2LN0A 4HXOA 4LYSA 3N9OA 3UVYA 1Z2QA 2HYED 5A7CA 2YU4A 3RPGB 1K2FA 4LZRA 4QEWA 3IHPA 4NUCA 5CQ3A 5KH3A 5FE6A 2XB1A 4IR5A 3S91A 1HYIA 3NG2A 5L99A 2C2LA 3MQMA 2KU3A 4MVTA 2C2VS 3L1ZB 4UYEA 2MA6A 3O35A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5H9M A;  2G45 A;  4CUQ A;  4NR7 A;  2E3K A;  4Q0N A;  5CFW A;  5G0F A;  1JM4 B;  2G6Q A;  5DYX A;  3U5J A;  3JVJ A;  5DLX A;  5D0C A;  4MEP A;  4N4H A;  2VPG A;  4HXN A;  4O77 A;  4HXP A;  2LGL A;  5EI4 A;  5C11 A;  3EB6 A;  2R10 A;  5CUB A;  2K17 A;  5D26 A;  5G4S A;  5LJ1 A;  4UIW A;  4PCI A;  5ACY A;  3LQJ A;  5A5P A;  2LV9 A;  5FB0 A;  2N9G A;  4CL9 A;  5FE8 A;  4TZ2 A;  3N9P A;  4S3O C;  2NXB A;  5DKC A;  3P1E A;  4BHW A;  3SVH A;  2F6N A;  3AQA A;  4QUT A;  3HMH A;  4A9F A;  3S92 A;  5I40 A;  3U5N A;  2RO1 A;  2M1R A;  4CUS A;  4Z1Q A;  4LYW A;  1U6G B;  4O64 A;  2K1J A;  5TAB A;  2I8N A;  1WEQ A;  2VP7 A;  4LAD B;  5J3X A;  3MB3 A;  4FIP A;  3HCS A;  2I7K A;  3G0J A;  2MD7 B;  5EM3 A;  3DQV R;  1WEV A;  2RSD A;  2FUI A;  3IU6 A;  3U5L A;  3UV2 A;  2QJ0 A;  5TB6 A;  4L7X A;  1X4J A;  4TU6 A;  5DKH A;  2VJE B;  4NRB A;  3P5O A;  5HRV A;  2JRJ A;  5ENJ A;  4PTB A;  5COI A;  2YQL A;  4FJC A;  5D3H A;  5CTL A;  5FE2 A;  4MSX A;  5E9K A;  5CRM A;  5FB1 A;  2Y43 A;  5C8G A;  5D3P A;  4LK9 A;  5A5O A;  5TBN A;  4I7B A;  2QIC A;  2E6S A;  5EK9 A;  1FBV A;  2K4D A;  1DVP A;  3O7A A;  5HEL A;  2VPE A;  5L96 A;  4NQN A;  2MNY A;  4X3G A;  4CA1 A;  5I29 A;  5BT4 A;  4TTE A;  4LJN A;  1E4U A;  4YBT A;  2L5U A;  4QC3 A;  4XY9 A;  5L97 A;  4UIY A;  5TDW A;  5KH7 A;  1WEP A;  5KO4 A;  5A82 A;  5HEM A;  4Q6F A;  2RNW A;  5KHM A;  4NRA A;  2YHN A;  3JVM A;  4TKP B;  4QUU A;  5FG6 A;  4YH3 A;  4ALH A;  2JMD A;  4QSW A;  2L80 A;  1JOC A;  5JWM A;  5C85 A;  4QZS A;  2E7N A;  4TT4 A;  4LZS A;  5E0R A;  4KCX A;  4A4B A;  4O7B A;  4AVX A;  5I86 A;  4GNG A;  5CUG A;  4IC3 A;  3JVK A;  4X2I A;  4NUE A;  3N9Q A;  5H85 A;  5CQ8 A;  5A5R A;  3QZS A;  5C13 A;  3P1D A;  2YQD A;  1WEM A;  2D8S A;  4O7A A;  5G04 B;  5F2P A;  4ZW1 A;  1JSP B;  1Z60 A;  5E9L A;  4GNE A;  5F5Z A;  5LJ0 A;  4O7F A;  5EP7 A;  2FSA A;  3U5P A;  5AD3 A;  4C67 A;  5F63 A;  4N3W A;  4F3I A;  1WEE A;  5FBX A;  1VYX A;  3T6R A;  3KV5 A;  5FE1 A;  5HCL A;  1WE9 A;  5DX4 A;  4IOO A;  5CS8 A;  4UYD A;  2M3H A;  3SVF A;  4HXM A;  5LKU A;  1LDK C;  5BT5 A;  2MJV B;  4XUB A;  3O33 A;  4QBM A;  4QSQ A;  4QY4 A;  4NYX A;  4WZ2 A;  2D9E A;  5II2 A;  4KV1 A;  4N4G A;  4HXR A;  5DYC A;  2YRE A;  5DIN A;  4YYM A;  4IR3 A;  2KWJ A;  5EU1 A;  2YUC A;  5LKZ A;  4MEQ A;  4YYH A;  2KE1 A;  3G0L A;  2KR4 A;  5DFC A;  5CUE A;  4MR5 A;  4YBM A;  4B7Y C;  4PCE A;  2VPB A;  4QF3 A;  1MM3 A;  5CPE A;  5G4R A;  5D1L B;  4ZDT A;  2L85 A;  3I3J A;  5HJC A;  5EWW A;  5HM0 A;  3M63 A;  4LRG A;  2ECG A;  3HME A;  4UI9 B;  2LSP B;  3ZVZ B;  2LGK A;  3LXJ A;  2YW8 A;  4Z6I A;  4YYJ A;  2KTB B;  5ETB A;  5EPS A;  2LXH C;  5HEN A;  4TYL A;  4LR6 A;  5FH8 A;  3FL2 A;  4GB0 A;  5D3T A;  3MB4 A;  2KGG A;  3M99 A;  5FER A;  5F62 A;  4J3I A;  3C6W A;  5EQ1 A;  4QC1 A;  5HLS A;  4NQM A;  4TT6 A;  4A9O A;  3P1F A;  5HQ6 A;  2KWN A;  2DVS A;  4N4I A;  3NXB A;  4O74 A;  5HQ5 A;  4NRC A;  2RI7 A;  2LRI C;  4GPJ A;  1WEO A;  2MIQ A;  2YW5 A;  5F36 A;  2CSZ A;  5FE9 A;  3UV5 A;  4YYI A;  5C4Q A;  3GG3 A;  5ETD A;  5CQ4 A;  5C7N A;  5A81 A;  4RVR A;  5AIT A;  5F1H A;  2E7O A;  5B76 A;  5F61 A;  2YQM A;  3QZV A;  4QST A;  4QYD A;  5D7X A;  2G43 A;  1XWH A;  4MEN A;  5ENI A;  3P1C A;  4HXL A;  5TCM A;  3UVX A;  4I7D A;  2L5E A;  2H0D A;  2YDW A;  2IDA A;  2VNF A;  4W4U A;  5H1T A;  1FP0 A;  4QR5 A;  1T1H A;  2YYR A;  5CQ5 A;  5D24 A;  5IGL A;  2CSY A;  5LKT A;  5E9V A;  5EA1 A;  2MUM A;  3N9N A;  3SOU A;  3D7C A;  5A5N A;  2EGP A;  3Q2F A;  4O75 A;  5CP5 A;  5FH7 A;  5L8T A;  2KYU A;  4V3L C;  5B79 A;  5FFY A;  4A9M A;  5I7X A;  5I80 A;  5HFQ A;  4NS5 A;  5IID A;  3N9M A;  2R0S A;  4YH4 A;  1JM7 A;  4MR4 A;  3KNV A;  4BW1 A;  2JMI A;  2DWW A;  4IOQ A;  1Z6U A;  5LVQ A;  3AAD A;  2YT5 A;  3MHS A;  1WUG A;  1RMD A;  5E3G A;  1WIL A;  4UYF A;  2YHO A;  5J0D A;  3UW9 A;  3GL6 A;  5JG6 A;  4FLP A;  4LZ2 A;  4A9N A;  2LGV A;  2RNX A;  5D3J A;  3ASL A;  3MHH A;  3HTK C;  4WZ0 A;  2H0D B;  4BBQ A;  2PUY A;  5EYA F;  4B86 C;  2R0V A;  5HFR A;  5EWD A;  2L75 A;  4R2Y A;  5KTX A;  3SOX A;  2E6R A;  2DKW A;  5IGM A;  2OSS A;  2NAA A;  5IGK A;  1WEN A;  3T7L A;  4IR6 A;  4QSP A;  2YEL A;  5A83 A;  5FG4 A;  2MNZ A;  2Y1M A;  4LLB A;  5D3R A;  4MEO A;  4O76 A;  3ZPV 1;  4WZ3 B;  4HBX A;  1WES A;  5EPR A;  5F1L A;  2OUO A;  1HYJ A;  4IR4 A;  4PPE A;  4XYA A;  5FFV A;  3FKM X;  1BOR A;  4P5O B;  5EPB A;  2CKL A;  4YYK A;  4A0C D;  2RNY A;  4QR4 A;  2YYN A;  4TQN A;  4O7E A;  3UVW A;  5A5S A;  1WIM A;  4WIV A;  3I2D A;  3N9L A;  4LC2 A;  3MXF A;  4QSU A;  5FDZ A;  5ENB A;  5E7D A;  4WA6 A;  4CUT A;  5E3D A;  2L0B A;  1MM2 A;  4HBV A;  4UIX A;  3LQH A;  1VD4 A;  2EA6 A;  1VFY A;  5BT3 A;  2FUU A;  3PHD A;  5ENE A;  4A9K A;  4GND A;  5LVR A;  3DPL R;  5HQ7 A;  5B77 A;  5IBN A;  4V3K C;  5CUA A;  5ENH A;  1N72 A;  3ZYQ A;  3L11 A;  5DW1 A;  4L58 A;  1EQF A;  2OO1 A;  4Y03 A;  4J1P A;  2KIZ A;  5D25 A;  4BW4 A;  1WEW A;  4E96 A;  4O72 A;  2ECI A;  5K29 A;  2LXP C;  5II1 A;  3PUQ A;  2CKL B;  5FE5 A;  5KU3 A;  4UYH A;  3O34 A;  4O78 A;  4UIU A;  5DFB A;  3VK6 A;  2L43 A;  3ONI A;  5DYA A;  3GV4 A;  5E73 A;  5F3A A;  3KV6 A;  4QB3 A;  4R7E A;  5H1V A;  4YYD A;  4IC2 A;  2M6M A;  4F52 B;  3UVD A;  5CGP A;  5E9M A;  2EOD A;  2F42 A;  5DKA A;  5CQ7 A;  1F68 A;  4TS8 A;  4CCG X;  4LDF A;  5LCW B;  5AIU A;  3ZPV E;  2XEU A;  5CQA A;  2M85 A;  5D3S A;  4TZ8 A;  3KQI A;  4FK5 A;  4CUP A;  5D1M B;  3PUR A;  4HXK A;  4QSS A;  4MR3 A;  3HCU A;  4QSV A;  4QNS A;  5CQ6 A;  5I3L A;  4HXS A;  2QIZ A;  3L1X A;  5FE7 A;  4LKA A;  5KH9 A;  3SHB A;  4YY4 A;  1WFK A;  4YAD A;  3EB5 A;  4ALG A;  4CUR A;  2HDP A;  2PNX A;  5FH6 A;  2LQ6 A;  2VJF A;  2H60 A;  3V43 A;  4O70 A;  5E74 A;  4BW3 A;  4QSX A;  3HCT A;  5LUU A;  4Z1S A;  1X4U A;  2YUR A;  1E6I A;  2LDR A;  5DBM A;  1G25 A;  4N4F A;  3O36 A;  4YY6 A;  4DON A;  4AUQ B;  2VJE A;  4KV4 A;  1F62 A;  5EVA A;  3RCW A;  1N87 A;  5G05 B;  5CY9 A;  4AYC A;  2BAY A;  1CHC A;  2YEK A;  5FE3 A;  5I7Y A;  2GRC A;  5LKX A;  5IG6 A;  4NXJ A;  4NUD A;  4WHW A;  5ENG A;  2ECV A;  2ECJ A;  4UP5 A;  4UIV A;  3DAI A;  4QEU A;  2L84 A;  4CFL A;  3TLP A;  3LQI A;  2G4A A;  4HBW A;  4WHU A;  4QF2 A;  3QZT A;  2F6J A;  4YYG A;  4BJX A;  5DLZ A;  4YK0 A;  2WP1 A;  5CUD A;  4QEV A;  2OXQ C;  5I83 A;  3M62 A;  5EWC A;  2VJF B;  5CUC A;  2UZG A;  1IYM A;  1ZBD B;  4YYN A;  2MA5 A;  5I89 A;  5FEY A;  3ZTG A;  4YC9 A;  4QYL A;  5B8D A;  2KWK A;  4A9J A;  3IU5 A;  2DAT A;  2KWO A;  4I7C A;  3U5M A;  5F60 A;  4R8P K;  4CFK A;  2Y1N A;  4S3O B;  3MUL A;  4XY8 A;  3JVL A;  3Q2E A;  5KTU A;  1X0J A;  3UV4 A;  3ZYU A;  2DX8 A;  4AYC B;  4ZC9 A;  4HBY A;  3K2J A;  4O71 A;  5A85 A;  5D3L A;  5FE0 A;  4YAX A;  4J0R A;  4UP0 A;  2I50 A;  4GNF A;  5I88 A;  3ZVY A;  3LRQ A;  4OUF A;  5C89 A;  5HRX A;  1WEU A;  4J0S A;  5D3N A;  4YAT A;  4A9I A;  4ZQL A;  4CUU A;  3U5O A;  5EIS A;  5E9I A;  3SVG A;  4UIT A;  4BW2 A;  5L98 A;  2ZET C;  5CRZ A;  2JMJ A;  5FE4 A;  3U5K A;  4C66 A;  2CT2 A;  5ENC A;  3O37 A;  2WP2 A;  2DVV A;  2RS9 B;  5DFD A;  2YSM A;  1JM7 B;  5EWV A;  4ZUX U;  5DKD A;  5EWH A;  5EIC A;  3O70 A;  4NR9 A;  2DVR A;  4UYF B;  1WUM A;  1X4I A;  4A9L A;  5DY7 A;  2R0Y A;  5H1U A;  5EGU A;  5AME A;  1V87 A;  4Q0O A;  2KFT A;  1ZS5 A;  5A5Q A;  2YSJ A;  4NR4 A;  4NR5 A;  5EV9 A;  4A9E A;  2K16 A;  5LJ2 A;  5B75 A;  2MD8 C;  4PKL A;  5HRW A;  2ECT A;  1LDJ B;  3RTR B;  4QSR A;  4A9H A;  5C87 A;  4OGJ A;  2YEM A;  5AD2 A;  5KTW A;  5CQT A;  3HMF A;  1WGM A;  4AKN A;  2AN6 A;  2KRE A;  2DVQ A;  2ECN A;  2KGI A;  2VPD A;  2LGG A;  4C9Z A;  3LJW A;  5ENF A;  3SOW A;  4Z93 A;  4O7C A;  2ECW A;  4NR8 A;  5FG5 A;  5TRB A;  5AMF A;  4UYG A;  5FFW A;  4YAB A;  5CU8 A;  5F25 A;  4UIZ A;  4XUA A;  4NR6 A;  5DW2 A;  5I1Q A;  4PY6 A;  4A4C A;  4CLB A;  4Z6H A;  4TT2 A;  3MUK A;  4IOR A;  4PS5 A;  3DWY A;  5IGN A;  2MT5 A;  3RPG C;  4A49 A;  2RFJ A;  5L8U A;  4TU4 A;  4NYV A;  3C5K A;  5JI8 A;  4AP4 A;  3ZNI A;  4YBS A;  4QR3 A;  5B78 A;  4OGI A;  4LYI A;  4MR6 A;  4NYW A;  4XI1 A;  4NN2 A;  5TDR A;  5E9Y A;  4FO9 A;  5DYU A;  2D82 A;  5D1K B;  5CZG A;  2LN0 A;  4HXO A;  4LYS A;  3N9O A;  3UVY A;  1Z2Q A;  2HYE D;  5A7C A;  2YU4 A;  3RPG B;  1K2F A;  4LZR A;  4QEW A;  3IHP A;  4NUC A;  5CQ3 A;  5KH3 A;  5FE6 A;  2XB1 A;  4IR5 A;  3S91 A;  1HYI A;  3NG2 A;  5L99 A;  2C2L A;  3MQM A;  2KU3 A;  4MVT A;  2C2V S;  3L1Z B;  4UYE A;  2MA6 A;  3O35 A; 
#chains in the Genus database with same CATH topology
 5H9M A;  2G45 A;  4CUQ A;  4NR7 A;  2E3K A;  4Q0N A;  5CFW A;  5G0F A;  1JM4 B;  2G6Q A;  5DYX A;  3U5J A;  3JVJ A;  5DLX A;  5D0C A;  4MEP A;  4N4H A;  2VPG A;  4HXN A;  4O77 A;  4HXP A;  2LGL A;  5EI4 A;  5C11 A;  3EB6 A;  2R10 A;  5CUB A;  2K17 A;  5D26 A;  5G4S A;  5LJ1 A;  4UIW A;  4PCI A;  5ACY A;  3LQJ A;  5A5P A;  2LV9 A;  5FB0 A;  5SVY A;  2N9G A;  3KDE C;  4CL9 A;  5FE8 A;  4TZ2 A;  3N9P A;  4S3O C;  2NXB A;  5DKC A;  3P1E A;  4BHW A;  3SVH A;  1DCQ A;  3D1B A;  2F6N A;  3AQA A;  4QUT A;  3HMH A;  4A9F A;  3S92 A;  5I40 A;  3U5N A;  2RO1 A;  2M1R A;  4CUS A;  4Z1Q A;  4LYW A;  1U6G B;  4O64 A;  2K1J A;  5TAB A;  2I8N A;  1WEQ A;  2VP7 A;  4LAD B;  5J3X A;  3MB3 A;  2OWA A;  3HCS A;  4FIP A;  2I7K A;  3G0J A;  2MD7 B;  5EM3 A;  3DQV R;  2E61 A;  1WEV A;  2RSD A;  2FUI A;  3IU6 A;  3U5L A;  3UV2 A;  2QJ0 A;  5TB6 A;  4L7X A;  1X4J A;  4TU6 A;  5DKH A;  2VJE B;  4NRB A;  3P5O A;  5HRV A;  2JRJ A;  5ENJ A;  4PTB A;  5COI A;  2LAU A;  2YQL A;  5D3H A;  4FJC A;  5CTL A;  5FE2 A;  4MSX A;  5E9K A;  5CRM A;  5FB1 A;  2Y43 A;  5C8G A;  5D3P A;  4LK9 A;  5A5O A;  2CRW A;  5TBN A;  4I7B A;  2QIC A;  2E6S A;  5EK9 A;  1FBV A;  2K4D A;  1DVP A;  3O7A A;  5HEL A;  2VPE A;  5L96 A;  4NQN A;  3FJU B;  2MNY A;  4X3G A;  4CA1 A;  3VKG A;  5I29 A;  5BT4 A;  4TTE A;  4LJN A;  2KKX A;  3FAN A;  1E4U A;  4YBT A;  2L5U A;  4QC3 A;  4XY9 A;  5L97 A;  4UIY A;  5TDW A;  5KH7 A;  1WEP A;  5KO4 A;  5A82 A;  5HEM A;  4Q6F A;  2RNW A;  5KHM A;  4NRA A;  2YHN A;  3JVM A;  4TKP B;  4AKI A;  4QUU A;  5FG6 A;  4YH3 A;  4ALH A;  2JMD A;  4QSW A;  2L80 A;  1JOC A;  5JWM A;  5C85 A;  4QZS A;  1PUO A;  2E7N A;  4TT4 A;  4LZS A;  5E0R A;  4KCX A;  4A4B A;  3T9K A;  4O7B A;  4AVX A;  5I86 A;  4GNG A;  5CUG A;  4IC3 A;  3JVK A;  4X2I A;  4NUE A;  3N9Q A;  5H85 A;  3Q1D A;  5CQ8 A;  5A5R A;  3QZS A;  5C13 A;  3P1D A;  2YQD A;  1WEM A;  2D8S A;  4O7A A;  5G04 B;  5F2P A;  4ZW1 A;  1JSP B;  1Z60 A;  5E9L A;  2DJA A;  4GNE A;  5F5Z A;  5LJ0 A;  4O7F A;  5EP7 A;  2FSA A;  3U5P A;  5AD3 A;  4C67 A;  5F63 A;  4N3W A;  4F3I A;  1WEE A;  5FBX A;  1VYX A;  3T6R A;  3KV5 A;  5FE1 A;  5HCL A;  1WE9 A;  5DX4 A;  4IOO A;  5CS8 A;  4UYD A;  2M3H A;  3SVF A;  4HXM A;  5LKU A;  1LDK C;  5BT5 A;  2IQJ A;  2MJV B;  4XUB A;  3D1D A;  3O33 A;  4QBM A;  4QSQ A;  4QY4 A;  4NYX A;  4WZ2 A;  2D9E A;  5II2 A;  4KV1 A;  4N4G A;  4HXR A;  5DYC A;  2YRE A;  5DIN A;  4YYM A;  2JM3 A;  4IR3 A;  2KWJ A;  5EU1 A;  3FM8 C;  2YUC A;  5LKZ A;  4MEQ A;  4YYH A;  2KE1 A;  3G0L A;  2KR4 A;  5DFC A;  5CUE A;  4MR5 A;  4YBM A;  4B7Y C;  4PCE A;  2VPB A;  4QF3 A;  1MM3 A;  5CPE A;  5G4R A;  5D1L B;  4ZDT A;  2L85 A;  3I3J A;  5HJC A;  5EWW A;  3O47 A;  5HM0 A;  3H7H A;  3M63 A;  4LRG A;  2ECG A;  3HME A;  4UI9 B;  2LSP B;  3ZVZ B;  2LGK A;  3LXJ A;  2YW8 A;  4Z6I A;  5K3Q A;  4YYJ A;  2KTB B;  5ETB A;  5EPS A;  2LXH C;  5HEN A;  4TYL A;  4LR6 A;  5FH8 A;  1MBM A;  3FL2 A;  4GB0 A;  5D3T A;  3MB4 A;  2KGG A;  3M99 A;  5FER A;  5F62 A;  4J3I A;  3C6W A;  5EQ1 A;  4QC1 A;  5HLS A;  4NQM A;  4TT6 A;  4A9O A;  3P1F A;  5HQ6 A;  2KWN A;  2DVS A;  4N4I A;  3NXB A;  4O74 A;  5HQ5 A;  4NRC A;  2RI7 A;  2LRI C;  4GPJ A;  1WEO A;  2MIQ A;  2YW5 A;  2XOZ A;  5F36 A;  2CSZ A;  5FE9 A;  3UV5 A;  4YYI A;  5C4Q A;  3GG3 A;  5ETD A;  5CQ4 A;  5C7N A;  5A81 A;  4RVR A;  2FD4 A;  5AIT A;  5F1H A;  2E7O A;  5B76 A;  3ERR A;  5F61 A;  2YQM A;  3QZV A;  4QST A;  4QYD A;  5D7X A;  2G43 A;  1XWH A;  2CON A;  4MEN A;  5ENI A;  3P1C A;  4HXL A;  5TCM A;  3UVX A;  4I7D A;  2L5E A;  2H0D A;  2YDW A;  2IDA A;  2P57 A;  3LJU X;  2VNF A;  4W4U A;  5H1T A;  1FP0 A;  4QR5 A;  1T1H A;  2YYR A;  5CQ5 A;  5D24 A;  5IGL A;  4F1P A;  2CSY A;  5LKT A;  5E9V A;  5EA1 A;  2MUM A;  3N9N A;  2MKE A;  3SOU A;  3D7C A;  5A5N A;  2EGP A;  3Q2F A;  4O75 A;  5CP5 A;  5FH7 A;  5L8T A;  2KYU A;  2L7P A;  4V3L C;  5B79 A;  5FFY A;  4A9M A;  5I7X A;  5I80 A;  5HFQ A;  3JUE A;  4NS5 A;  5IID A;  3N9M A;  2R0S A;  4YH4 A;  1JM7 A;  4MR4 A;  3KNV A;  4BW1 A;  2JMI A;  2DWW A;  4IOQ A;  3FAO A;  1Z6U A;  5LVQ A;  3AAD A;  2YT5 A;  3MHS A;  1WUG A;  1RMD A;  5E3G A;  1WIL A;  4UYF A;  2YHO A;  5J0D A;  3UW9 A;  3GL6 A;  5JG6 A;  4FLP A;  4LZ2 A;  4A9N A;  2LGV A;  2RNX A;  5D3J A;  3ASL A;  3PLW A;  3MHH A;  3HTK C;  4WZ0 A;  2H0D B;  4BBQ A;  2PUY A;  5EYA F;  4B86 C;  2R0V A;  5HFR A;  5EWD A;  2YVR A;  2XOC A;  2L75 A;  4R2Y A;  5KTX A;  3SOX A;  2XOY A;  2E6R A;  2DKW A;  5IGM A;  2RR4 A;  2OSS A;  2NAA A;  5IGK A;  1WEN A;  3T7L A;  4IR6 A;  4QSP A;  2YEL A;  5A83 A;  5FG4 A;  2MNZ A;  2Y1M A;  4LLB A;  5D3R A;  4MEO A;  4O76 A;  3ZPV 1;  4WZ3 B;  4HBX A;  1WES A;  5EPR A;  5F1L A;  2OUO A;  1HYJ A;  4IR4 A;  4PPE A;  4XYA A;  5FFV A;  3FKM X;  1BOR A;  4P5O B;  3SUB A;  5EPB A;  2CKL A;  4YYK A;  4AKH A;  4A0C D;  2RNY A;  4QR4 A;  2YYN A;  4TQN A;  4O7E A;  3UVW A;  5A5S A;  1WIM A;  2EXU A;  4WIV A;  3I2D A;  3N9L A;  4LC2 A;  5SVI A;  3MXF A;  4QSU A;  5FDZ A;  5ENB A;  5E7D A;  4WA6 A;  4CUT A;  5E3D A;  2L0B A;  1MM2 A;  4HBV A;  3LVQ E;  4UIX A;  3LQH A;  1VD4 A;  2EA6 A;  1VFY A;  5BT3 A;  2FUU A;  3PHD A;  5ENE A;  4A9K A;  4GND A;  5LVR A;  2M13 A;  3DPL R;  5HQ7 A;  5B77 A;  5IBN A;  4V3K C;  5CUA A;  5ENH A;  3M7K A;  1N72 A;  3ZYQ A;  3L11 A;  5DW1 A;  4L58 A;  1EQF A;  2OO1 A;  4Y03 A;  4O62 A;  4J1P A;  2KIZ A;  2KKY A;  5D25 A;  4BW4 A;  1WEW A;  4E96 A;  4O72 A;  2ECI A;  5K29 A;  2LXP C;  5II1 A;  3PUQ A;  2CKL B;  5FE5 A;  5KU3 A;  1ZKR A;  4UYH A;  3O34 A;  4O78 A;  4UIU A;  5DFB A;  3VK6 A;  2L43 A;  3ONI A;  5DYA A;  3GV4 A;  5E73 A;  5F3A A;  3KV6 A;  4QB3 A;  4R7E A;  5H1V A;  4YYD A;  4IC2 A;  2M6M A;  2B0O E;  4F52 B;  3UVD A;  5CGP A;  5E9M A;  2EOD A;  2F42 A;  5DKA A;  5CQ7 A;  1F68 A;  4TS8 A;  4CCG X;  4LDF A;  5LCW B;  5AIU A;  3ZPV E;  2XEU A;  5CQA A;  2M85 A;  5D3S A;  4TZ8 A;  3KQI A;  4FK5 A;  4CUP A;  4QQ4 A;  5D1M B;  3PUR A;  4HXK A;  4QSS A;  4MR3 A;  3HCU A;  4QSV A;  4QNS A;  5CQ6 A;  5I3L A;  4HXS A;  2QIZ A;  2CSV A;  5FE7 A;  3L1X A;  4LKA A;  5KH9 A;  4YY4 A;  1WFK A;  4YAD A;  3SHB A;  3EB5 A;  2VPD A;  4ALG A;  4CUR A;  2HDP A;  2PNX A;  5FH6 A;  2LQ6 A;  2VJF A;  2H60 A;  3V43 A;  4O70 A;  5E74 A;  4BW3 A;  4QSX A;  3HCT A;  5LUU A;  2EGM A;  4Z1S A;  1X4U A;  2YUR A;  1E6I A;  2LDR A;  5DBM A;  1G25 A;  4N4F A;  3O36 A;  4YY6 A;  4DON A;  4AUQ B;  2VJE A;  4KV4 A;  1F62 A;  5EVA A;  3RCW A;  1N87 A;  5G05 B;  5CY9 A;  4H9D A;  4AYC A;  2BAY A;  1CHC A;  2YEK A;  5FE3 A;  5I7Y A;  2GRC A;  5LKX A;  5IG6 A;  3DWD A;  4NXJ A;  4NUD A;  4WHW A;  5ENG A;  4OGE A;  2ECV A;  2ECJ A;  4UP5 A;  4UIV A;  3DAI A;  4QEU A;  2L84 A;  4CFL A;  3TLP A;  3LQI A;  2G4A A;  4HBW A;  4WHU A;  4QF2 A;  3QZT A;  2F6J A;  4YYG A;  4BJX A;  5DLZ A;  4YK0 A;  2WP1 A;  5CUD A;  4QEV A;  2EJN A;  2JUN A;  2OXQ C;  5I83 A;  3M62 A;  5EWC A;  2VJF B;  5CUC A;  2UZG A;  1IYM A;  1ZBD B;  4YYN A;  2MA5 A;  5I89 A;  5FEY A;  3ZTG A;  4YC9 A;  4QYL A;  4Z0R A;  5B8D A;  2KWK A;  4A9J A;  5SVX A;  3IU5 A;  2DAT A;  2KWO A;  4I7C A;  3U5M A;  5F60 A;  4R8P K;  4CFK A;  2Y1N A;  4S3O B;  3MUL A;  4XY8 A;  3JVL A;  3Q2E A;  5KTU A;  1X0J A;  3UV4 A;  3ZYU A;  2DX8 A;  4AYC B;  4ZC9 A;  4HBY A;  3K2J A;  4O71 A;  5A85 A;  5D3L A;  5FE0 A;  4YAX A;  4J0R A;  4UP0 A;  2I50 A;  4GNF A;  5I88 A;  3ZVY A;  3LRQ A;  4OUF A;  5C89 A;  5HRX A;  1WEU A;  4J0S A;  5D3N A;  4YAT A;  4A9I A;  4ZQL A;  4CUU A;  3U5O A;  5EIS A;  3DDT A;  5E9I A;  3SVG A;  4UIT A;  4BW2 A;  5L98 A;  2ZET C;  5CRZ A;  2JMJ A;  5FE4 A;  3U5K A;  4C66 A;  2CT2 A;  5ENC A;  3O37 A;  2WP2 A;  2DVV A;  2RS9 B;  5DFD A;  2YSM A;  3LVR E;  5EWV A;  4ZUX U;  1JM7 B;  5DKD A;  5EWH A;  4AI6 A;  5EIC A;  3O70 A;  4NR9 A;  2DVR A;  4UYF B;  1WUM A;  1X4I A;  4A9L A;  5DY7 A;  2R0Y A;  5H1U A;  5EGU A;  5AME A;  1V87 A;  4Q0O A;  2KFT A;  1ZS5 A;  5A5Q A;  2YSJ A;  2XP0 A;  4NR4 A;  4NR5 A;  5EV9 A;  4A9E A;  2K16 A;  5LJ2 A;  5B75 A;  2MD8 C;  4PKL A;  5HRW A;  2ECT A;  1LDJ B;  3RTR B;  4QSR A;  4A9H A;  5C87 A;  4OGJ A;  2YEM A;  5AD2 A;  5KTW A;  5CQT A;  4AKG A;  3HMF A;  1WGM A;  4AKN A;  2AN6 A;  2KRE A;  2DVQ A;  2D8U A;  2ECN A;  2KGI A;  2LGG A;  4C9Z A;  3LJW A;  5ENF A;  3SOW A;  4Z93 A;  4O7C A;  2ECW A;  4NR8 A;  5FG5 A;  5TRB A;  3FEH A;  5AMF A;  4UYG A;  5FFW A;  3LDY A;  4YAB A;  5CU8 A;  3E2D A;  5F25 A;  4UIZ A;  4XUA A;  4NR6 A;  5DW2 A;  5I1Q A;  4PY6 A;  4A4C A;  4CLB A;  4Z6H A;  4TT2 A;  3MUK A;  4IOR A;  4PS5 A;  3DWY A;  5IGN A;  2MT5 A;  4Z0O A;  3RPG C;  4A49 A;  2RFJ A;  5SVI B;  5L8U A;  4TU4 A;  4NYV A;  3C5K A;  5JI8 A;  4AP4 A;  2CRR A;  3ZNI A;  4YBS A;  4QR3 A;  5B78 A;  4OGI A;  4LYI A;  4MR6 A;  4NYW A;  4XI1 A;  4NN2 A;  5TDR A;  5E9Y A;  4FO9 A;  4OGC A;  3MDB C;  5DYU A;  2D82 A;  5D1K B;  5CZG A;  2LN0 A;  4HXO A;  4LYS A;  3N9O A;  3UVY A;  1Z2Q A;  2HYE D;  5A7C A;  2YU4 A;  2FFW A;  3RPG B;  1K2F A;  4LZR A;  4QEW A;  3IHP A;  4NUC A;  5CQ3 A;  5KH3 A;  5FE6 A;  3VKH A;  2XB1 A;  4IR5 A;  3S91 A;  1HYI A;  3NG2 A;  5L99 A;  2C2L A;  3MQM A;  2KU3 A;  4MVT A;  2C2V S;  3L1Z B;  2DSM A;  4UYE A;  2MA6 A;  3O35 A; 
#chains in the Genus database with same CATH homology
 5H9M A;  2G45 A;  4CUQ A;  4NR7 A;  2E3K A;  4Q0N A;  5CFW A;  5G0F A;  1JM4 B;  2G6Q A;  5DYX A;  3U5J A;  3JVJ A;  5DLX A;  5D0C A;  4MEP A;  4N4H A;  2VPG A;  4HXN A;  4O77 A;  4HXP A;  2LGL A;  5EI4 A;  5C11 A;  3EB6 A;  2R10 A;  5CUB A;  2K17 A;  5D26 A;  5G4S A;  5LJ1 A;  4UIW A;  4PCI A;  5ACY A;  3LQJ A;  5A5P A;  2LV9 A;  5FB0 A;  2N9G A;  4CL9 A;  5FE8 A;  4TZ2 A;  3N9P A;  4S3O C;  2NXB A;  5DKC A;  3P1E A;  4BHW A;  3SVH A;  2F6N A;  3AQA A;  4QUT A;  3HMH A;  4A9F A;  3S92 A;  5I40 A;  3U5N A;  2RO1 A;  2M1R A;  4CUS A;  4Z1Q A;  4LYW A;  1U6G B;  4O64 A;  2K1J A;  5TAB A;  2I8N A;  1WEQ A;  2VP7 A;  4LAD B;  5J3X A;  3MB3 A;  4FIP A;  3HCS A;  2I7K A;  3G0J A;  2MD7 B;  5EM3 A;  3DQV R;  1WEV A;  2RSD A;  2FUI A;  3IU6 A;  3U5L A;  3UV2 A;  2QJ0 A;  5TB6 A;  4L7X A;  1X4J A;  4TU6 A;  5DKH A;  2VJE B;  4NRB A;  3P5O A;  5HRV A;  2JRJ A;  5ENJ A;  4PTB A;  5COI A;  2YQL A;  4FJC A;  5D3H A;  5CTL A;  5FE2 A;  4MSX A;  5E9K A;  5CRM A;  5FB1 A;  2Y43 A;  5C8G A;  5D3P A;  4LK9 A;  5A5O A;  5TBN A;  4I7B A;  2QIC A;  2E6S A;  5EK9 A;  1FBV A;  2K4D A;  1DVP A;  3O7A A;  5HEL A;  2VPE A;  5L96 A;  4NQN A;  2MNY A;  4X3G A;  4CA1 A;  5I29 A;  5BT4 A;  4TTE A;  4LJN A;  1E4U A;  4YBT A;  2L5U A;  4QC3 A;  4XY9 A;  5L97 A;  4UIY A;  5TDW A;  5KH7 A;  1WEP A;  5KO4 A;  5A82 A;  5HEM A;  4Q6F A;  2RNW A;  5KHM A;  4NRA A;  2YHN A;  3JVM A;  4TKP B;  4QUU A;  5FG6 A;  4YH3 A;  4ALH A;  2JMD A;  4QSW A;  2L80 A;  1JOC A;  5JWM A;  5C85 A;  4QZS A;  2E7N A;  4TT4 A;  4LZS A;  5E0R A;  4KCX A;  4A4B A;  4O7B A;  4AVX A;  5I86 A;  4GNG A;  5CUG A;  4IC3 A;  3JVK A;  4X2I A;  4NUE A;  3N9Q A;  5H85 A;  5CQ8 A;  5A5R A;  3QZS A;  5C13 A;  3P1D A;  2YQD A;  1WEM A;  2D8S A;  4O7A A;  5G04 B;  5F2P A;  4ZW1 A;  1JSP B;  1Z60 A;  5E9L A;  4GNE A;  5F5Z A;  5LJ0 A;  4O7F A;  5EP7 A;  2FSA A;  3U5P A;  5AD3 A;  4C67 A;  5F63 A;  4N3W A;  4F3I A;  1WEE A;  5FBX A;  1VYX A;  3T6R A;  3KV5 A;  5FE1 A;  5HCL A;  1WE9 A;  5DX4 A;  4IOO A;  5CS8 A;  4UYD A;  2M3H A;  3SVF A;  4HXM A;  5LKU A;  1LDK C;  5BT5 A;  2MJV B;  4XUB A;  3O33 A;  4QBM A;  4QSQ A;  4QY4 A;  4NYX A;  4WZ2 A;  2D9E A;  5II2 A;  4KV1 A;  4N4G A;  4HXR A;  5DYC A;  2YRE A;  5DIN A;  4YYM A;  4IR3 A;  2KWJ A;  5EU1 A;  2YUC A;  5LKZ A;  4MEQ A;  4YYH A;  2KE1 A;  3G0L A;  2KR4 A;  5DFC A;  5CUE A;  4MR5 A;  4YBM A;  4B7Y C;  4PCE A;  2VPB A;  4QF3 A;  1MM3 A;  5CPE A;  5G4R A;  5D1L B;  4ZDT A;  2L85 A;  3I3J A;  5HJC A;  5EWW A;  5HM0 A;  3M63 A;  4LRG A;  2ECG A;  3HME A;  4UI9 B;  2LSP B;  3ZVZ B;  2LGK A;  3LXJ A;  2YW8 A;  4Z6I A;  4YYJ A;  2KTB B;  5ETB A;  5EPS A;  2LXH C;  5HEN A;  4TYL A;  4LR6 A;  5FH8 A;  3FL2 A;  4GB0 A;  5D3T A;  3MB4 A;  2KGG A;  3M99 A;  5FER A;  5F62 A;  4J3I A;  3C6W A;  5EQ1 A;  4QC1 A;  5HLS A;  4NQM A;  4TT6 A;  4A9O A;  3P1F A;  5HQ6 A;  2KWN A;  2DVS A;  4N4I A;  3NXB A;  4O74 A;  5HQ5 A;  4NRC A;  2RI7 A;  2LRI C;  4GPJ A;  1WEO A;  2MIQ A;  2YW5 A;  5F36 A;  2CSZ A;  5FE9 A;  3UV5 A;  4YYI A;  5C4Q A;  3GG3 A;  5ETD A;  5CQ4 A;  5C7N A;  5A81 A;  4RVR A;  5AIT A;  5F1H A;  2E7O A;  5B76 A;  5F61 A;  2YQM A;  3QZV A;  4QST A;  4QYD A;  5D7X A;  2G43 A;  1XWH A;  4MEN A;  5ENI A;  3P1C A;  4HXL A;  5TCM A;  3UVX A;  4I7D A;  2L5E A;  2H0D A;  2YDW A;  2IDA A;  2VNF A;  4W4U A;  5H1T A;  1FP0 A;  4QR5 A;  1T1H A;  2YYR A;  5CQ5 A;  5D24 A;  5IGL A;  2CSY A;  5LKT A;  5E9V A;  5EA1 A;  2MUM A;  3N9N A;  3SOU A;  3D7C A;  5A5N A;  2EGP A;  3Q2F A;  4O75 A;  5CP5 A;  5FH7 A;  5L8T A;  2KYU A;  4V3L C;  5B79 A;  5FFY A;  4A9M A;  5I7X A;  5I80 A;  5HFQ A;  4NS5 A;  5IID A;  3N9M A;  2R0S A;  4YH4 A;  1JM7 A;  4MR4 A;  3KNV A;  4BW1 A;  2JMI A;  2DWW A;  4IOQ A;  1Z6U A;  5LVQ A;  3AAD A;  2YT5 A;  3MHS A;  1WUG A;  1RMD A;  5E3G A;  1WIL A;  4UYF A;  2YHO A;  5J0D A;  3UW9 A;  3GL6 A;  5JG6 A;  4FLP A;  4LZ2 A;  4A9N A;  2LGV A;  2RNX A;  5D3J A;  3ASL A;  3MHH A;  3HTK C;  4WZ0 A;  2H0D B;  4BBQ A;  2PUY A;  5EYA F;  4B86 C;  2R0V A;  5HFR A;  5EWD A;  2L75 A;  4R2Y A;  5KTX A;  3SOX A;  2E6R A;  2DKW A;  5IGM A;  2OSS A;  2NAA A;  5IGK A;  1WEN A;  3T7L A;  4IR6 A;  4QSP A;  2YEL A;  5A83 A;  5FG4 A;  2MNZ A;  2Y1M A;  4LLB A;  5D3R A;  4MEO A;  4O76 A;  3ZPV 1;  4WZ3 B;  4HBX A;  1WES A;  5EPR A;  5F1L A;  2OUO A;  1HYJ A;  4IR4 A;  4PPE A;  4XYA A;  5FFV A;  3FKM X;  1BOR A;  4P5O B;  5EPB A;  2CKL A;  4YYK A;  4A0C D;  2RNY A;  4QR4 A;  2YYN A;  4TQN A;  4O7E A;  3UVW A;  5A5S A;  1WIM A;  4WIV A;  3I2D A;  3N9L A;  4LC2 A;  3MXF A;  4QSU A;  5FDZ A;  5ENB A;  5E7D A;  4WA6 A;  4CUT A;  5E3D A;  2L0B A;  1MM2 A;  4HBV A;  4UIX A;  3LQH A;  1VD4 A;  2EA6 A;  1VFY A;  5BT3 A;  2FUU A;  3PHD A;  5ENE A;  4A9K A;  4GND A;  5LVR A;  3DPL R;  5HQ7 A;  5B77 A;  5IBN A;  4V3K C;  5CUA A;  5ENH A;  1N72 A;  3ZYQ A;  3L11 A;  5DW1 A;  4L58 A;  1EQF A;  2OO1 A;  4Y03 A;  4J1P A;  2KIZ A;  5D25 A;  4BW4 A;  1WEW A;  4E96 A;  4O72 A;  2ECI A;  5K29 A;  2LXP C;  5II1 A;  3PUQ A;  2CKL B;  5FE5 A;  5KU3 A;  4UYH A;  3O34 A;  4O78 A;  4UIU A;  5DFB A;  3VK6 A;  2L43 A;  3ONI A;  5DYA A;  3GV4 A;  5E73 A;  5F3A A;  3KV6 A;  4QB3 A;  4R7E A;  5H1V A;  4YYD A;  4IC2 A;  2M6M A;  4F52 B;  3UVD A;  5CGP A;  5E9M A;  2EOD A;  2F42 A;  5DKA A;  5CQ7 A;  1F68 A;  4TS8 A;  4CCG X;  4LDF A;  5LCW B;  5AIU A;  3ZPV E;  2XEU A;  5CQA A;  2M85 A;  5D3S A;  4TZ8 A;  3KQI A;  4FK5 A;  4CUP A;  5D1M B;  3PUR A;  4HXK A;  4QSS A;  4MR3 A;  3HCU A;  4QSV A;  4QNS A;  5CQ6 A;  5I3L A;  4HXS A;  2QIZ A;  3L1X A;  5FE7 A;  4LKA A;  5KH9 A;  3SHB A;  4YY4 A;  1WFK A;  4YAD A;  3EB5 A;  4ALG A;  4CUR A;  2HDP A;  2PNX A;  5FH6 A;  2LQ6 A;  2VJF A;  2H60 A;  3V43 A;  4O70 A;  5E74 A;  4BW3 A;  4QSX A;  3HCT A;  5LUU A;  4Z1S A;  1X4U A;  2YUR A;  1E6I A;  2LDR A;  5DBM A;  1G25 A;  4N4F A;  3O36 A;  4YY6 A;  4DON A;  4AUQ B;  2VJE A;  4KV4 A;  1F62 A;  5EVA A;  3RCW A;  1N87 A;  5G05 B;  5CY9 A;  4AYC A;  2BAY A;  1CHC A;  2YEK A;  5FE3 A;  5I7Y A;  2GRC A;  5LKX A;  5IG6 A;  4NXJ A;  4NUD A;  4WHW A;  5ENG A;  2ECV A;  2ECJ A;  4UP5 A;  4UIV A;  3DAI A;  4QEU A;  2L84 A;  4CFL A;  3TLP A;  3LQI A;  2G4A A;  4HBW A;  4WHU A;  4QF2 A;  3QZT A;  2F6J A;  4YYG A;  4BJX A;  5DLZ A;  4YK0 A;  2WP1 A;  5CUD A;  4QEV A;  2OXQ C;  5I83 A;  3M62 A;  5EWC A;  2VJF B;  5CUC A;  2UZG A;  1IYM A;  1ZBD B;  4YYN A;  2MA5 A;  5I89 A;  5FEY A;  3ZTG A;  4YC9 A;  4QYL A;  5B8D A;  2KWK A;  4A9J A;  3IU5 A;  2DAT A;  2KWO A;  4I7C A;  3U5M A;  5F60 A;  4R8P K;  4CFK A;  2Y1N A;  4S3O B;  3MUL A;  4XY8 A;  3JVL A;  3Q2E A;  5KTU A;  1X0J A;  3UV4 A;  3ZYU A;  2DX8 A;  4AYC B;  4ZC9 A;  4HBY A;  3K2J A;  4O71 A;  5A85 A;  5D3L A;  5FE0 A;  4YAX A;  4J0R A;  4UP0 A;  2I50 A;  4GNF A;  5I88 A;  3ZVY A;  3LRQ A;  4OUF A;  5C89 A;  5HRX A;  1WEU A;  4J0S A;  5D3N A;  4YAT A;  4A9I A;  4ZQL A;  4CUU A;  3U5O A;  5EIS A;  5E9I A;  3SVG A;  4UIT A;  4BW2 A;  5L98 A;  2ZET C;  5CRZ A;  2JMJ A;  5FE4 A;  3U5K A;  4C66 A;  2CT2 A;  5ENC A;  3O37 A;  2WP2 A;  2DVV A;  2RS9 B;  5DFD A;  2YSM A;  1JM7 B;  5EWV A;  4ZUX U;  5DKD A;  5EWH A;  5EIC A;  3O70 A;  4NR9 A;  2DVR A;  4UYF B;  1WUM A;  1X4I A;  4A9L A;  5DY7 A;  2R0Y A;  5H1U A;  5EGU A;  5AME A;  1V87 A;  4Q0O A;  2KFT A;  1ZS5 A;  5A5Q A;  2YSJ A;  4NR4 A;  4NR5 A;  5EV9 A;  4A9E A;  2K16 A;  5LJ2 A;  5B75 A;  2MD8 C;  4PKL A;  5HRW A;  2ECT A;  1LDJ B;  3RTR B;  4QSR A;  4A9H A;  5C87 A;  4OGJ A;  2YEM A;  5AD2 A;  5KTW A;  5CQT A;  3HMF A;  1WGM A;  4AKN A;  2AN6 A;  2KRE A;  2DVQ A;  2ECN A;  2KGI A;  2VPD A;  2LGG A;  4C9Z A;  3LJW A;  5ENF A;  3SOW A;  4Z93 A;  4O7C A;  2ECW A;  4NR8 A;  5FG5 A;  5TRB A;  5AMF A;  4UYG A;  5FFW A;  4YAB A;  5CU8 A;  5F25 A;  4UIZ A;  4XUA A;  4NR6 A;  5DW2 A;  5I1Q A;  4PY6 A;  4A4C A;  4CLB A;  4Z6H A;  4TT2 A;  3MUK A;  4IOR A;  4PS5 A;  3DWY A;  5IGN A;  2MT5 A;  3RPG C;  4A49 A;  2RFJ A;  5L8U A;  4TU4 A;  4NYV A;  3C5K A;  5JI8 A;  4AP4 A;  3ZNI A;  4YBS A;  4QR3 A;  5B78 A;  4OGI A;  4LYI A;  4MR6 A;  4NYW A;  4XI1 A;  4NN2 A;  5TDR A;  5E9Y A;  4FO9 A;  5DYU A;  2D82 A;  5D1K B;  5CZG A;  2LN0 A;  4HXO A;  4LYS A;  3N9O A;  3UVY A;  1Z2Q A;  2HYE D;  5A7C A;  2YU4 A;  3RPG B;  1K2F A;  4LZR A;  4QEW A;  3IHP A;  4NUC A;  5CQ3 A;  5KH3 A;  5FE6 A;  2XB1 A;  4IR5 A;  3S91 A;  1HYI A;  3NG2 A;  5L99 A;  2C2L A;  3MQM A;  2KU3 A;  4MVT A;  2C2V S;  3L1Z B;  4UYE A;  2MA6 A;  3O35 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...