3U5PA

Crystal structure of the complex of trim33 phd-bromo and h3(1-28)k9me3k14ack18ack23ac histone peptide
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
204
structure length
188
Chain Sequence
DPNEDWCAVCQNGGDLLCCEKCPKVFHLTCHVPTLLSFPSGDWICTFCRDIGKPEVEYDCDNLQHSKGLSPVDQRKCERLLLYLYCHELSIEFQEPVPASIPNYYKIIKKPMDLSTVKKKLQKKHSQHYQIPDDFVADVRLIFKNCERFNEMMKVVQVYASEVAQAGKAVALYFEDKLTEIYSDRTFA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords E3 ubiquitin-protein ligase TRIM33
publication title A poised chromatin platform for TGF-beta access to master regulators
pubmed doi rcsb
source organism Homo sapiens
total genus 56
structure length 188
sequence length 204
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2011-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 3u5pA02
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3u5pA01
4IR5A 2G45A 5TCMA 4A4BA 5D0CA 3DWYA 5LKXA 4QY4A 4QYDA 5F36A 5FB0A 5E9KA 5E74A 4N4HA 4BHWA 3O33A 5FFWA 4PPEA 5HENA 3M99A 4NYWA 4I7CA 4HXKA 5FFYA 4YYKA 2BAYA 3RPGB 3MULA 4QSTA 4XI1A 5EYAF 5JG6A 4Q0NA 4LR6A 4HXPA 4AUQB 5ENEA 3K2JA 5FE2A 5IGMA 4O7AA 3ZNIA 5JI8A 3MB4A 2IDAA 1WE9A 2CKLB 5FDZA 4OGIA 5ETDA 5FE6A 3GL6A 2YREA 4MSXA 1WIMA 4TYLA 2I7KA 2JRJA 1WEUA 1T1HA 5FEYA 4NQNA 1WEVA 2RI7A 5AMEA 5LVRA 3RCWA 2K1JA 4ZC9A 2KGIA 3SHBA 4LRGA 4O78A 5COIA 3HMHA 2MUMA 2M6MA 3NG2A 5H9MA 1VD4A 5L98A 4LK9A 2YHNA 4A0CD 1HYIA 4MR5A 5HELA 2DWWA 4HXRA 3N9OA 2YUCA 5TABA 4O75A 4WHWA 2GRCA 2K4DA 5A5PA 3NXBA 5H85A 2ECTA 2LGKA 4A49A 3P1FA 2HDPA 3C5KA 2CKLA 1X4IA 2LGVA 2PNXA 2YT5A 4UIXA 2F42A 3I2DA 5D3HA 1CHCA 3QZVA 1XWHA 1Z2QA 1X0JA 4NYVA 4XUAA 4BW1A 2OO1A 4P5OB 3I3JA 4MR6A 1BORA 5EPRA 2VPDA 5EISA 5E73A 4Z6IA 3DAIA 5J0DA 4LZRA 5KH3A 2YQLA 4UIZA 5C7NA 1VYXA 2MA6A 5F63A 3U5KA 5I7YA 4GB0A 2YDWA 5CPEA 5A5RA 3ZYUA 4YABA 4QSXA 2M1RA 4CFLA 4YYHA 3GG3A 2G4AA 4QEWA 2YW5A 3EB5A 5DYUA 4N4FA 5DFDA 2Y1MA 3ZPVE 2YQMA 4HBYA 5L8UA 4TU4A 4GNGA 5D1KB 2VPGA 1RMDA 5DW2A 4PY6A 4TZ2A 2G43A 4IOOA 3IU5A 4YY6A 2MD7B 5TB6A 5A5QA 4NUCA 5CQ8A 4LYSA 1WFKA 4QSPA 1ZBDB 4A9JA 2MNZA 5AIUA 5ACYA 3MUKA 3U5LA 2WP1A 4YYMA 5L96A 4HXOA 4NRBA 1ZS5A 3HCUA 4ZUXU 3LJWA 5EWVA 3UV5A 3L11A 3U5OA 4TZ8A 5D25A 3UW9A 4L58A 3JVMA 5I88A 2ECWA 4QZSA 2KIZA 2LSPB 5I29A 5TDWA 4XUBA 4UIUA 5G4RA 3G0LA 3L1ZB 5CUDA 2KWJA 5FBXA 4GPJA 5HRWA 4NR8A 5EWCA 2LRIC 5F60A 4NYXA 5CFWA 2YHOA 4QR4A 2LXHC 4R2YA 4ZDTA 4Q6FA 4PCIA 5A5SA 5E9VA 2KFTA 4QSUA 2KGGA 3DQVR 5HQ7A 2K17A 2L5UA 4TTEA 2MT5A 2RSDA 5CRZA 4A9MA 5KTUA 1MM2A 4NR4A 3AADA 3HMFA 2VPEA 4QEUA 4LYIA 2VPBA 4O74A 3EB6A 4QSSA 1WESA 4I7DA 5CS8A 5KH9A 5EWHA 4IORA 3T6RA 2I8NA 5BT3A 2Y43A 2E3KA 4O7FA 5C13A 4S3OB 4UYFB 2LXPC 2KR4A 4GNDA 1N87A 3SVHA 5AMFA 2I50A 1EQFA 2OUOA 4YY4A 4HBXA 2RNXA 2C2VS 4QR5A 4UP0A 5E9LA 3U5MA 4YYJA 3HCSA 4CUSA 1WENA 5G04B 4YATA 1WUMA 4YBSA 4AKNA 4CFKA 2JMDA 3G0JA 5EI4A 2XEUA 2YQDA 5D3SA 5EQ1A 2XB1A 5IGLA 5D1LB 5E0RA 3S91A 3N9LA 4LZ2A 1E6IA 5ENJA 4ALHA 2KWKA 4CL9A 3JVJA 3PHDA 4QF3A 4UYFA 4V3LC 4IR3A 4Y03A 5F62A 2CT2A 1MM3A 4YADA 4UYHA 2KWNA 4O7CA 4OGJA 4AVXA 2DVSA 3JVLA 3FKMX 1WEWA 5E3GA 4X2IA 5I80A 5DLZA 4O76A 5D3JA 3UV4A 4FK5A 3HTKC 4XY8A 1N72A 4C67A 5EPBA 5CQTA 4ALGA 5LJ2A 5FH6A 4N4GA 5B75A 5F1LA 3O34A 3AQAA 4HXNA 4O77A 5F3AA 3UV2A 1WUGA 3KNVA 4TT6A 5CUAA 5HQ6A 2YSMA 2HYED 4Z1SA 5B78A 5FE5A 5KU3A 4C9ZA 5I83A 2H60A 2D8SA 2M3HA 4C66A 5EV9A 5ENHA 4J0SA 5CQ4A 2E6SA 2RFJA 5HLSA 4R7EA 1FBVA 5EA1A 2EGPA 5DKCA 2L85A 4A4CA 4NR7A 1DVPA 5H1UA 2UZGA 5LJ0A 5HQ5A 2AN6A 5H1VA 2Y1NA 5D7XA 5DYCA 4NRAA 4FJCA 5DX4A 3O35A 3N9MA 3T7LA 3L1XA 5AITA 3DPLR 4CUQA 5DY7A 2LN0A 4HBWA 4QSVA 3HCTA 3N9QA 5II2A 3ZPV1 5AD2A 3SOUA 3M62A 5I7XA 5CQ7A 2QJ0A 4I7BA 2FSAA 5DFCA 4O71A 5LUUA 4LJNA 5AD3A 4QC1A 4ZW1A 4V3KC 2KE1A 4YAXA 4NRCA 2ECIA 3QZSA 2D82A 5ENIA 2L80A 4UP5A 4PS5A 4Z93A 1IYMA 2CSZA 4WZ3B 5LJ1A 5HFQA 5CUCA 5FE4A 5IGNA 1VFYA 5CUGA 5CTLA 2N9GA 4A9IA 5C87A 3KQIA 2H0DB 5L99A 5LKTA 5L8TA 1Z6UA 3P1CA 4WA6A 2JMJA 4YYIA 4X3GA 3IHPA 4LLBA 5D3NA 3P5OA 5FG6A 5LVQA 1WEEA 5HEMA 4O72A 2YSJA 4KCXA 5B79A 5H1TA 4MR3A 2YURA 5CUBA 2FUUA 2LDRA 4UYEA 4A9NA 1JOCA 4NS5A 5F5ZA 5DKHA 2RNYA 2DATA 2NAAA 2NXBA 5FE1A 3UVDA 2RO1A 5I86A 2CSYA 4BBQA 4FIPA 4TKPB 5DKAA 2VJEB 4W4UA 2OSSA 5FE9A 2ECVA 1FP0A 2ECGA 4QBMA 3ZYQA 1K2FA 3FL2A 5CQ6A 4A9EA 4YYNA 4DONA 5EVAA 5E9YA 1WGMA 1U6GB 4FO9A 2H0DA 4CUPA 4A9OA 2L84A 5G0FA 5HCLA 2VP7A 2L0BA 3SOWA 5A5NA 3M63A 2ECJA 5CP5A 4MEOA 4YK0A 5CQ3A 4E96A 4LDFA 5ETBA 5D3RA 2L5EA 4KV4A 2DKWA 5A5OA 3LQHA 5TRBA 4QR3A 4UYGA 2VJEA 4KV1A 4HXLA 4YYGA 1JM7B 3N9PA 5B77A 4TT4A 3C6WA 5D24A 2DX8A 5DW1A 3ONIA 3HMEA 4QB3A 2DVRA 5HJCA 5IG6A 5EM3A 5I89A 5D26A 4NXJA 4YYDA 4WZ2A 5A83A 2YU4A 5EWWA 4O64A 5C8GA 2K16A 5A85A 2ZETC 3MQMA 2M85A 1V87A 5J3XA 4O7EA 5FG5A 5G4SA 3TLPA 2EA6A 2L43A 3RPGC 2KWOA 3LQJA 4MEQA 1F68A 4QSRA 5FH8A 5HFRA 2EODA 1JM7A 5EICA 5ENBA 1WEPA 3ZVYA 4BW3A 5ENGA 3ZTGA 2JMIA 3S92A 4UITA 2QICA 2L75A 5D3TA 4UI9B 4QUTA 5KTXA 3MHHA 5CGPA 4TT2A 1WEMA 5E9MA 4XY9A 2LQ6A 4UIWA 3P1EA 4RVRA 4IOQA 5DBMA 5A7CA 4LKAA 5CQ5A 4NR9A 4QSQA 2R10A 3V43A 5EK9A 5DKDA 4O7BA 5HRVA 4Q0OA 4QYLA 4MENA 5EPSA 5FE7A 1JM4B 3SVGA 5JWMA 1G25A 3Q2FA 1E4UA 2R0SA 5CRMA 3MXFA 5I1QA 5C89A 3D7CA 5IGKA 5K29A 2WP2A 3O7AA 5F2PA 4GNFA 5BT5A 2DVQA 5D3LA 4B7YC 4A9KA 3MB3A 2VNFA 4MR4A 4YBMA 2YW8A 5TDRA 5A81A 4YH3A 2YEMA 2E7NA 1LDKC 2ECNA 2YYRA 5LCWB 1X4UA 5EP7A 2KREA 3PURA 4NR5A 3ZVZB 2RNWA 5DINA 4HBVA 4QUUA 5CZGA 3ASLA 4O70A 4AYCB 5D3PA 4PCEA 2F6NA 5KH7A 5B76A 4YBTA 3SOXA 2PUYA 5CQAA 2F6JA 2MJVB 2R0VA 4L7XA 4NN2A 4HXSA 5E7DA 5FE0A 3SVFA 2LGLA 2KTBB 3JVKA 3P1DA 5DYXA 4MVTA 1WEQA 2C2LA 5C4QA 4A9LA 2RS9B 4J1PA 5L97A 4A9FA 4A9HA 4Z6HA 5FH7A 4CLBA 2MD8C 4ZQLA 4IR6A 5EU1A 4J0RA 3QZTA 4NUDA 4QEVA 5I40A 5ENFA 5CUEA 5HM0A 2G6QA 5KO4A 1WILA 4WZ0A 4AYCA 5HRXA 3Q2EA 5E9IA 4GNEA 3O37A 4BW4A 5LKUA 2E6RA 5B8DA 2LV9A 4TU6A 2QIZA 3IU6A 4UYDA 5FG4A 4QNSA 4LC2A 4NUEA 2E7OA 4N4IA 4HXMA 5A82A 2KYUA 2MNYA 4WIVA 2VJFB 4YC9A 3LRQA 5ENCA 3LXJA 1LDJB 2LGGA 2YELA 2MIQA 4PKLA 5FERA 4TQNA 5LKZA 4NQMA 4OUFA 3PUQA 3VK6A 4LYWA 4B86C 3KV6A 4F52B 5TBNA 4TS8A 4WHUA 4J3IA 4IC2A 2FUIA 4CUUA 5EGUA 5KTWA 5KHMA 5DFBA 5BT4A 5IIDA 1X4JA 4LZSA 3U5JA 2OXQC 5C85A 4S3OC 4IR4A 5FE8A 3UVYA 1Z60A 3U5NA 5G05B 4QC3A 2VJFA 4UIVA 4QF2A 4BW2A 4NR6A 4XYAA 3GV4A 3KV5A 5DYAA 4QSWA 5D1MB 4LADB 2YYNA 4CURA 3UVXA 3RTRB 5F1HA 5II1A 5CY9A 5C11A 2MA5A 1F62A 2YEKA 5CU8A 4CUTA 3U5PA 3O70A 1HYJA 4BJXA 4CA1A 5I3LA 4CCGX 4F3IA 4AP4A 4PTBA 4UIYA 5FE3A 3N9NA 5DLXA 1JSPB 4FLPA 4Z1QA 1WEOA 4N3WA 5F25A 5E3DA 2D9EA 5EWDA 3LQIA 3O36A 5FB1A 4IC3A 4YH4A 5F61A 5FFVA 4MEPA 3MHSA 2R0YA 5IBNA 2DVVA 3UVWA 4R8PK 2KU3A
chains in the Genus database with same CATH superfamily
4IR5A 2G45A 5TCMA 4A4BA 5D0CA 3DWYA 5LKXA 4QY4A 4QYDA 5F36A 5FB0A 5E9KA 5E74A 4F1PA 1ZKRA 2DJAA 4N4HA 4BHWA 3O33A 5FFWA 4PPEA 5HENA 3M99A 4NYWA 2MKEA 4I7CA 4HXKA 5FFYA 4YYKA 2BAYA 4OGEA 3RPGB 3MULA 4QSTA 4XI1A 5EYAF 5JG6A 4Q0NA 2CRWA 4LR6A 4HXPA 4AUQB 5ENEA 3K2JA 5FE2A 5IGMA 4O7AA 3ZNIA 5JI8A 3MB4A 2IDAA 1WE9A 2CKLB 5FDZA 4OGIA 5ETDA 5FE6A 4OGCA 3GL6A 2YREA 4MSXA 1WIMA 4TYLA 5K3QA 2I7KA 2JRJA 1WEUA 1T1HA 5FEYA 3LVQE 4NQNA 1WEVA 2FD4A 2RI7A 5AMEA 5LVRA 3PLWA 2EGMA 3RCWA 2K1JA 4ZC9A 2KGIA 3SHBA 4LRGA 4O78A 5COIA 3HMHA 2MUMA 2M6MA 3NG2A 5H9MA 1VD4A 5L98A 4LK9A 2YHNA 4A0CD 1HYIA 4MR5A 5HELA 2DWWA 4HXRA 3N9OA 2YUCA 5TABA 4O75A 4WHWA 2GRCA 2K4DA 5A5PA 3NXBA 5H85A 2ECTA 2LGKA 4A49A 3P1FA 2HDPA 3C5KA 2CKLA 1X4IA 2LGVA 2PNXA 2YT5A 4UIXA 2F42A 3I2DA 5D3HA 1CHCA 4H9DA 3M7KA 3QZVA 1XWHA 1Z2QA 1X0JA 4NYVA 4XUAA 4BW1A 2OO1A 4P5OB 3I3JA 2XOYA 4MR6A 1BORA 5EPRA 2OWAA 2VPDA 5EISA 5E73A 4Z6IA 3DAIA 5J0DA 4LZRA 3FJUB 3LJUX 5KH3A 2YQLA 4UIZA 5C7NA 4Z0RA 1VYXA 2MA6A 5F63A 3U5KA 5I7YA 4GB0A 2YDWA 5CPEA 5A5RA 3ZYUA 2KKYA 4YABA 4QSXA 2M1RA 4CFLA 4YYHA 3GG3A 2G4AA 4QEWA 2YW5A 2DSMA 3EB5A 5DYUA 4N4FA 5DFDA 2Y1MA 3ZPVE 2YQMA 4HBYA 5L8UA 4TU4A 4GNGA 5D1KB 2VPGA 1RMDA 5DW2A 4PY6A 4TZ2A 2G43A 4IOOA 3IU5A 4YY6A 2MD7B 5TB6A 5A5QA 4NUCA 5CQ8A 4LYSA 1WFKA 4QSPA 1ZBDB 4A9JA 2MNZA 5AIUA 5ACYA 3MUKA 3U5LA 2WP1A 4YYMA 5L96A 4HXOA 4NRBA 1ZS5A 3HCUA 4ZUXU 3LJWA 5EWVA 3UV5A 3L11A 3U5OA 4TZ8A 3FM8C 5D25A 3UW9A 4L58A 3JVMA 5I88A 2ECWA 4QZSA 2KIZA 2LSPB 5I29A 5TDWA 4XUBA 4UIUA 5G4RA 3G0LA 3L1ZB 5CUDA 2KWJA 5FBXA 4GPJA 5HRWA 4NR8A 5EWCA 2LRIC 5F60A 4NYXA 5CFWA 2YHOA 4QR4A 2LXHC 4R2YA 4ZDTA 4Q6FA 2L7PA 4PCIA 5A5SA 5E9VA 2KFTA 4QSUA 2KGGA 4O62A 3DQVR 5HQ7A 2K17A 2L5UA 4TTEA 2MT5A 2RSDA 5CRZA 2XP0A 4A9MA 5KTUA 1MM2A 3FANA 4NR4A 3AADA 3HMFA 2VPEA 3FAOA 4QEUA 4LYIA 2VPBA 4O74A 3EB6A 4QSSA 1WESA 4I7DA 5CS8A 5KH9A 5EWHA 4IORA 3T6RA 2I8NA 5BT3A 2Y43A 2E3KA 4O7FA 5C13A 4S3OB 4UYFB 2LXPC 3VKGA 2KR4A 4GNDA 1N87A 3SVHA 5SVIB 5AMFA 2I50A 1EQFA 2OUOA 4YY4A 2CSVA 4HBXA 2RNXA 2C2VS 4QR5A 4UP0A 5E9LA 3U5MA 4YYJA 3HCSA 3O47A 4CUSA 1WENA 2JUNA 5G04B 4YATA 1WUMA 4YBSA 4AKNA 4CFKA 2JMDA 3G0JA 5EI4A 2XEUA 2YQDA 5D3SA 5EQ1A 2XB1A 5IGLA 5D1LB 5E0RA 3S91A 3N9LA 4LZ2A 1E6IA 5ENJA 4ALHA 2KWKA 4CL9A 3JVJA 3PHDA 4QF3A 4UYFA 4V3LC 4IR3A 4Y03A 5F62A 2CT2A 1MM3A 2M13A 4YADA 4UYHA 2KWNA 4O7CA 4OGJA 4AVXA 2DVSA 3JVLA 2XOZA 3FKMX 1WEWA 5E3GA 4X2IA 2KKXA 5I80A 5DLZA 4O76A 5D3JA 3UV4A 4FK5A 3HTKC 4XY8A 1N72A 4C67A 5EPBA 5CQTA 4ALGA 5LJ2A 5FH6A 4N4GA 3VKHA 5F1LA 5B75A 3O34A 3AQAA 4HXNA 4O77A 5F3AA 3UV2A 1WUGA 3KNVA 4TT6A 5CUAA 5HQ6A 2YSMA 2HYED 4Z1SA 5B78A 5FE5A 5KU3A 4C9ZA 3SUBA 5I83A 2H60A 2D8SA 2M3HA 4C66A 5EV9A 5ENHA 4J0SA 5CQ4A 2E6SA 2RFJA 5HLSA 4R7EA 1FBVA 2D8UA 5EA1A 2EGPA 5DKCA 2L85A 4A4CA 4NR7A 1DVPA 5H1UA 2UZGA 5LJ0A 5HQ5A 2AN6A 5H1VA 2Y1NA 5D7XA 5DYCA 4NRAA 4FJCA 5DX4A 3O35A 3N9MA 3T7LA 3L1XA 5AITA 3DPLR 4CUQA 5DY7A 2LN0A 4HBWA 4QSVA 4AI6A 3HCTA 3N9QA 5II2A 3ZPV1 5AD2A 3SOUA 3M62A 5I7XA 5CQ7A 2QJ0A 4I7BA 2FSAA 5DFCA 4O71A 5LUUA 2XOCA 4LJNA 5AD3A 4QC1A 4ZW1A 4V3KC 2KE1A 4YAXA 4NRCA 2ECIA 3QZSA 2D82A 5ENIA 2L80A 2P57A 4UP5A 4PS5A 4Z93A 1IYMA 3LDYA 2CSZA 3KDEC 3E2DA 4WZ3B 5LJ1A 5HFQA 5CUCA 3D1DA 5FE4A 5IGNA 1VFYA 5CUGA 5CTLA 2N9GA 4A9IA 5C87A 3KQIA 2H0DB 5L99A 5LKTA 5L8TA 1Z6UA 3P1CA 1PUOA 2JMJA 2EXUA 4WA6A 4YYIA 4X3GA 3IHPA 4LLBA 5D3NA 3P5OA 5FG6A 5LVQA 1WEEA 5HEMA 4O72A 2YSJA 4KCXA 5B79A 5H1TA 4MR3A 2YURA 5CUBA 2FUUA 2LDRA 4UYEA 4A9NA 1JOCA 4NS5A 5F5ZA 5DKHA 2RNYA 2DATA 2NAAA 2NXBA 5FE1A 3UVDA 2RO1A 5I86A 2CSYA 4BBQA 4FIPA 4TKPB 3H7HA 2VJEB 4W4UA 5DKAA 2JM3A 2OSSA 5FE9A 2ECVA 1FP0A 2ECGA 4QBMA 3ZYQA 1K2FA 3FL2A 5CQ6A 4A9EA 4YYNA 4DONA 5EVAA 5E9YA 1WGMA 1U6GB 3Q1DA 4FO9A 2H0DA 4CUPA 4A9OA 1MBMA 2L84A 5G0FA 5HCLA 2VP7A 2L0BA 3SOWA 5A5NA 3M63A 2ECJA 5CP5A 4MEOA 4YK0A 5CQ3A 4E96A 4LDFA 5ETBA 4AKGA 2FFWA 5D3RA 2L5EA 4KV4A 2IQJA 2DKWA 5A5OA 3LQHA 2YVRA 5TRBA 4QR3A 4UYGA 2VJEA 4KV1A 4HXLA 4YYGA 1JM7B 3N9PA 5B77A 4AKIA 3ERRA 4TT4A 3C6WA 5D24A 2DX8A 5DW1A 3ONIA 3HMEA 4QB3A 2DVRA 5HJCA 5IG6A 5EM3A 5I89A 5D26A 4NXJA 4YYDA 4WZ2A 5A83A 2YU4A 5EWWA 4O64A 5C8GA 2K16A 5A85A 2ZETC 3MQMA 2M85A 1V87A 5J3XA 4O7EA 5FG5A 5G4SA 3TLPA 2EA6A 2L43A 3RPGC 2KWOA 3LQJA 2LAUA 4MEQA 1F68A 4QSRA 5FH8A 5HFRA 2EODA 1JM7A 5SVIA 5EICA 5ENBA 1WEPA 3ZVYA 4BW3A 5ENGA 3ZTGA 2JMIA 3S92A 4UITA 2QICA 4QQ4A 2L75A 5D3TA 4UI9B 4QUTA 5KTXA 3MHHA 5CGPA 4TT2A 1WEMA 5E9MA 4XY9A 2LQ6A 4UIWA 3P1EA 5SVXA 4RVRA 4AKHA 4IOQA 5DBMA 5A7CA 4LKAA 5CQ5A 4NR9A 4QSQA 2R10A 3V43A 5EK9A 5DKDA 4O7BA 5HRVA 4Q0OA 4QYLA 4Z0OA 4MENA 5EPSA 5FE7A 3D1BA 1JM4B 3SVGA 5JWMA 1G25A 3Q2FA 1E4UA 2R0SA 5CRMA 3MXFA 5I1QA 5C89A 3D7CA 5IGKA 5K29A 2WP2A 3O7AA 5F2PA 4GNFA 5BT5A 2DVQA 3DWDA 5D3LA 4B7YC 3MDBC 4A9KA 3MB3A 2VNFA 4MR4A 4YBMA 2YW8A 5TDRA 5A81A 4YH3A 2YEMA 2E7NA 1LDKC 2ECNA 2YYRA 5LCWB 1X4UA 5EP7A 2KREA 3PURA 4NR5A 3ZVZB 2RNWA 5DINA 4HBVA 4QUUA 5CZGA 3ASLA 4O70A 4AYCB 5D3PA 4PCEA 2F6NA 5KH7A 5B76A 4YBTA 3SOXA 2PUYA 5CQAA 2F6JA 2MJVB 2R0VA 3DDTA 4L7XA 4NN2A 4HXSA 5E7DA 5FE0A 2RR4A 3SVFA 2LGLA 2KTBB 3JVKA 2EJNA 3P1DA 5DYXA 4MVTA 1WEQA 2C2LA 5C4QA 4A9LA 3LVRE 2RS9B 4J1PA 5L97A 4A9FA 4A9HA 4Z6HA 5SVYA 5FH7A 4CLBA 2MD8C 4ZQLA 4IR6A 5EU1A 4J0RA 3QZTA 4NUDA 4QEVA 3FEHA 5I40A 5ENFA 5CUEA 5HM0A 2G6QA 5KO4A 1DCQA 1WILA 4WZ0A 4AYCA 5HRXA 3Q2EA 5E9IA 4GNEA 3O37A 4BW4A 5LKUA 2E6RA 5B8DA 2LV9A 4TU6A 2QIZA 3IU6A 4UYDA 5FG4A 4QNSA 4LC2A 4NUEA 2E7OA 4N4IA 4HXMA 5A82A 2KYUA 2MNYA 4WIVA 2VJFB 4YC9A 3LRQA 5ENCA 3LXJA 1LDJB 2LGGA 2YELA 2MIQA 4PKLA 5FERA 4TQNA 5LKZA 4NQMA 4OUFA 3PUQA 3VK6A 4LYWA 4B86C 3KV6A 4F52B 5TBNA 4TS8A 4WHUA 4J3IA 3T9KA 4IC2A 2FUIA 4CUUA 5EGUA 5KTWA 2E61A 5KHMA 2CRRA 5DFBA 5BT4A 5IIDA 1X4JA 4LZSA 3U5JA 2OXQC 5C85A 4S3OC 4IR4A 5FE8A 3UVYA 1Z60A 3U5NA 5G05B 4QC3A 2VJFA 4UIVA 4QF2A 4BW2A 4NR6A 4XYAA 3GV4A 3KV5A 5DYAA 4QSWA 5D1MB 4LADB 2YYNA 4CURA 3UVXA 3JUEA 2B0OE 3RTRB 5F1HA 5II1A 5CY9A 5C11A 2MA5A 1F62A 2YEKA 5CU8A 4CUTA 3U5PA 3O70A 1HYJA 4BJXA 4CA1A 5I3LA 4CCGX 4F3IA 2CONA 4AP4A 4PTBA 4UIYA 5FE3A 3N9NA 5DLXA 1JSPB 4FLPA 4Z1QA 1WEOA 4N3WA 5F25A 5E3DA 2D9EA 5EWDA 3LQIA 3O36A 5FB1A 4IC3A 4YH4A 5F61A 5FFVA 4MEPA 3MHSA 2R0YA 5IBNA 2DVVA 3UVWA 4R8PK 2KU3A
chains in the Genus database with same CATH topology
4IR5A 2G45A 5TCMA 4A4BA 5D0CA 3DWYA 5LKXA 4QY4A 4QYDA 5F36A 5FB0A 5E9KA 5E74A 4N4HA 4BHWA 3O33A 5FFWA 4PPEA 5HENA 3M99A 4NYWA 4I7CA 4HXKA 5FFYA 4YYKA 2BAYA 3RPGB 3MULA 4QSTA 4XI1A 5EYAF 5JG6A 4Q0NA 4LR6A 4HXPA 4AUQB 5ENEA 3K2JA 5FE2A 5IGMA 4O7AA 3ZNIA 5JI8A 3MB4A 2IDAA 1WE9A 2CKLB 5FDZA 4OGIA 5ETDA 5FE6A 3GL6A 2YREA 4MSXA 1WIMA 4TYLA 2I7KA 2JRJA 1WEUA 1T1HA 5FEYA 4NQNA 1WEVA 2RI7A 5AMEA 5LVRA 3RCWA 2K1JA 4ZC9A 2KGIA 3SHBA 4LRGA 4O78A 5COIA 3HMHA 2MUMA 2M6MA 3NG2A 5H9MA 1VD4A 5L98A 4LK9A 2YHNA 4A0CD 1HYIA 4MR5A 5HELA 2DWWA 4HXRA 3N9OA 2YUCA 5TABA 4O75A 4WHWA 2GRCA 2K4DA 5A5PA 3NXBA 5H85A 2ECTA 2LGKA 4A49A 3P1FA 2HDPA 3C5KA 2CKLA 1X4IA 2LGVA 2PNXA 2YT5A 4UIXA 2F42A 3I2DA 5D3HA 1CHCA 3QZVA 1XWHA 1Z2QA 1X0JA 4NYVA 4XUAA 4BW1A 2OO1A 4P5OB 3I3JA 4MR6A 1BORA 5EPRA 2VPDA 5EISA 5E73A 4Z6IA 3DAIA 5J0DA 4LZRA 5KH3A 2YQLA 4UIZA 5C7NA 1VYXA 2MA6A 5F63A 3U5KA 5I7YA 4GB0A 2YDWA 5CPEA 5A5RA 3ZYUA 4YABA 4QSXA 2M1RA 4CFLA 4YYHA 3GG3A 2G4AA 4QEWA 2YW5A 3EB5A 5DYUA 4N4FA 5DFDA 2Y1MA 3ZPVE 2YQMA 4HBYA 5L8UA 4TU4A 4GNGA 5D1KB 2VPGA 1RMDA 5DW2A 4PY6A 4TZ2A 2G43A 4IOOA 3IU5A 4YY6A 2MD7B 5TB6A 5A5QA 4NUCA 5CQ8A 4LYSA 1WFKA 4QSPA 1ZBDB 4A9JA 2MNZA 5AIUA 5ACYA 3MUKA 3U5LA 2WP1A 4YYMA 5L96A 4HXOA 4NRBA 1ZS5A 3HCUA 4ZUXU 3LJWA 5EWVA 3UV5A 3L11A 3U5OA 4TZ8A 5D25A 3UW9A 4L58A 3JVMA 5I88A 2ECWA 4QZSA 2KIZA 2LSPB 5I29A 5TDWA 4XUBA 4UIUA 5G4RA 3G0LA 3L1ZB 5CUDA 2KWJA 5FBXA 4GPJA 5HRWA 4NR8A 5EWCA 2LRIC 5F60A 4NYXA 5CFWA 2YHOA 4QR4A 2LXHC 4R2YA 4ZDTA 4Q6FA 4PCIA 5A5SA 5E9VA 2KFTA 4QSUA 2KGGA 3DQVR 5HQ7A 2K17A 2L5UA 4TTEA 2MT5A 2RSDA 5CRZA 4A9MA 5KTUA 1MM2A 4NR4A 3AADA 3HMFA 2VPEA 4QEUA 4LYIA 2VPBA 4O74A 3EB6A 4QSSA 1WESA 4I7DA 5CS8A 5KH9A 5EWHA 4IORA 3T6RA 2I8NA 5BT3A 2Y43A 2E3KA 4O7FA 5C13A 4S3OB 4UYFB 2LXPC 2KR4A 4GNDA 1N87A 3SVHA 5AMFA 2I50A 1EQFA 2OUOA 4YY4A 4HBXA 2RNXA 2C2VS 4QR5A 4UP0A 5E9LA 3U5MA 4YYJA 3HCSA 4CUSA 1WENA 5G04B 4YATA 1WUMA 4YBSA 4AKNA 4CFKA 2JMDA 3G0JA 5EI4A 2XEUA 2YQDA 5D3SA 5EQ1A 2XB1A 5IGLA 5D1LB 5E0RA 3S91A 3N9LA 4LZ2A 1E6IA 5ENJA 4ALHA 2KWKA 4CL9A 3JVJA 3PHDA 4QF3A 4UYFA 4V3LC 4IR3A 4Y03A 5F62A 2CT2A 1MM3A 4YADA 4UYHA 2KWNA 4O7CA 4OGJA 4AVXA 2DVSA 3JVLA 3FKMX 1WEWA 5E3GA 4X2IA 5I80A 5DLZA 4O76A 5D3JA 3UV4A 4FK5A 3HTKC 4XY8A 1N72A 4C67A 5EPBA 5CQTA 4ALGA 5LJ2A 5FH6A 4N4GA 5B75A 5F1LA 3O34A 3AQAA 4HXNA 4O77A 5F3AA 3UV2A 1WUGA 3KNVA 4TT6A 5CUAA 5HQ6A 2YSMA 2HYED 4Z1SA 5B78A 5FE5A 5KU3A 4C9ZA 5I83A 2H60A 2D8SA 2M3HA 4C66A 5EV9A 5ENHA 4J0SA 5CQ4A 2E6SA 2RFJA 5HLSA 4R7EA 1FBVA 5EA1A 2EGPA 5DKCA 2L85A 4A4CA 4NR7A 1DVPA 5H1UA 2UZGA 5LJ0A 5HQ5A 2AN6A 5H1VA 2Y1NA 5D7XA 5DYCA 4NRAA 4FJCA 5DX4A 3O35A 3N9MA 3T7LA 3L1XA 5AITA 3DPLR 4CUQA 5DY7A 2LN0A 4HBWA 4QSVA 3HCTA 3N9QA 5II2A 3ZPV1 5AD2A 3SOUA 3M62A 5I7XA 5CQ7A 2QJ0A 4I7BA 2FSAA 5DFCA 4O71A 5LUUA 4LJNA 5AD3A 4QC1A 4ZW1A 4V3KC 2KE1A 4YAXA 4NRCA 2ECIA 3QZSA 2D82A 5ENIA 2L80A 4UP5A 4PS5A 4Z93A 1IYMA 2CSZA 4WZ3B 5LJ1A 5HFQA 5CUCA 5FE4A 5IGNA 1VFYA 5CUGA 5CTLA 2N9GA 4A9IA 5C87A 3KQIA 2H0DB 5L99A 5LKTA 5L8TA 1Z6UA 3P1CA 4WA6A 2JMJA 4YYIA 4X3GA 3IHPA 4LLBA 5D3NA 3P5OA 5FG6A 5LVQA 1WEEA 5HEMA 4O72A 2YSJA 4KCXA 5B79A 5H1TA 4MR3A 2YURA 5CUBA 2FUUA 2LDRA 4UYEA 4A9NA 1JOCA 4NS5A 5F5ZA 5DKHA 2RNYA 2DATA 2NAAA 2NXBA 5FE1A 3UVDA 2RO1A 5I86A 2CSYA 4BBQA 4FIPA 4TKPB 5DKAA 2VJEB 4W4UA 2OSSA 5FE9A 2ECVA 1FP0A 2ECGA 4QBMA 3ZYQA 1K2FA 3FL2A 5CQ6A 4A9EA 4YYNA 4DONA 5EVAA 5E9YA 1WGMA 1U6GB 4FO9A 2H0DA 4CUPA 4A9OA 2L84A 5G0FA 5HCLA 2VP7A 2L0BA 3SOWA 5A5NA 3M63A 2ECJA 5CP5A 4MEOA 4YK0A 5CQ3A 4E96A 4LDFA 5ETBA 5D3RA 2L5EA 4KV4A 2DKWA 5A5OA 3LQHA 5TRBA 4QR3A 4UYGA 2VJEA 4KV1A 4HXLA 4YYGA 1JM7B 3N9PA 5B77A 4TT4A 3C6WA 5D24A 2DX8A 5DW1A 3ONIA 3HMEA 4QB3A 2DVRA 5HJCA 5IG6A 5EM3A 5I89A 5D26A 4NXJA 4YYDA 4WZ2A 5A83A 2YU4A 5EWWA 4O64A 5C8GA 2K16A 5A85A 2ZETC 3MQMA 2M85A 1V87A 5J3XA 4O7EA 5FG5A 5G4SA 3TLPA 2EA6A 2L43A 3RPGC 2KWOA 3LQJA 4MEQA 1F68A 4QSRA 5FH8A 5HFRA 2EODA 1JM7A 5EICA 5ENBA 1WEPA 3ZVYA 4BW3A 5ENGA 3ZTGA 2JMIA 3S92A 4UITA 2QICA 2L75A 5D3TA 4UI9B 4QUTA 5KTXA 3MHHA 5CGPA 4TT2A 1WEMA 5E9MA 4XY9A 2LQ6A 4UIWA 3P1EA 4RVRA 4IOQA 5DBMA 5A7CA 4LKAA 5CQ5A 4NR9A 4QSQA 2R10A 3V43A 5EK9A 5DKDA 4O7BA 5HRVA 4Q0OA 4QYLA 4MENA 5EPSA 5FE7A 1JM4B 3SVGA 5JWMA 1G25A 3Q2FA 1E4UA 2R0SA 5CRMA 3MXFA 5I1QA 5C89A 3D7CA 5IGKA 5K29A 2WP2A 3O7AA 5F2PA 4GNFA 5BT5A 2DVQA 5D3LA 4B7YC 4A9KA 3MB3A 2VNFA 4MR4A 4YBMA 2YW8A 5TDRA 5A81A 4YH3A 2YEMA 2E7NA 1LDKC 2ECNA 2YYRA 5LCWB 1X4UA 5EP7A 2KREA 3PURA 4NR5A 3ZVZB 2RNWA 5DINA 4HBVA 4QUUA 5CZGA 3ASLA 4O70A 4AYCB 5D3PA 4PCEA 2F6NA 5KH7A 5B76A 4YBTA 3SOXA 2PUYA 5CQAA 2F6JA 2MJVB 2R0VA 4L7XA 4NN2A 4HXSA 5E7DA 5FE0A 3SVFA 2LGLA 2KTBB 3JVKA 3P1DA 5DYXA 4MVTA 1WEQA 2C2LA 5C4QA 4A9LA 2RS9B 4J1PA 5L97A 4A9FA 4A9HA 4Z6HA 5FH7A 4CLBA 2MD8C 4ZQLA 4IR6A 5EU1A 4J0RA 3QZTA 4NUDA 4QEVA 5I40A 5ENFA 5CUEA 5HM0A 2G6QA 5KO4A 1WILA 4WZ0A 4AYCA 5HRXA 3Q2EA 5E9IA 4GNEA 3O37A 4BW4A 5LKUA 2E6RA 5B8DA 2LV9A 4TU6A 2QIZA 3IU6A 4UYDA 5FG4A 4QNSA 4LC2A 4NUEA 2E7OA 4N4IA 4HXMA 5A82A 2KYUA 2MNYA 4WIVA 2VJFB 4YC9A 3LRQA 5ENCA 3LXJA 1LDJB 2LGGA 2YELA 2MIQA 4PKLA 5FERA 4TQNA 5LKZA 4NQMA 4OUFA 3PUQA 3VK6A 4LYWA 4B86C 3KV6A 4F52B 5TBNA 4TS8A 4WHUA 4J3IA 4IC2A 2FUIA 4CUUA 5EGUA 5KTWA 5KHMA 5DFBA 5BT4A 5IIDA 1X4JA 4LZSA 3U5JA 2OXQC 5C85A 4S3OC 4IR4A 5FE8A 3UVYA 1Z60A 3U5NA 5G05B 4QC3A 2VJFA 4UIVA 4QF2A 4BW2A 4NR6A 4XYAA 3GV4A 3KV5A 5DYAA 4QSWA 5D1MB 4LADB 2YYNA 4CURA 3UVXA 3RTRB 5F1HA 5II1A 5CY9A 5C11A 2MA5A 1F62A 2YEKA 5CU8A 4CUTA 3U5PA 3O70A 1HYJA 4BJXA 4CA1A 5I3LA 4CCGX 4F3IA 4AP4A 4PTBA 4UIYA 5FE3A 3N9NA 5DLXA 1JSPB 4FLPA 4Z1QA 1WEOA 4N3WA 5F25A 5E3DA 2D9EA 5EWDA 3LQIA 3O36A 5FB1A 4IC3A 4YH4A 5F61A 5FFVA 4MEPA 3MHSA 2R0YA 5IBNA 2DVVA 3UVWA 4R8PK 2KU3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IR5 A;  2G45 A;  5TCM A;  4A4B A;  5D0C A;  3DWY A;  5LKX A;  4QY4 A;  4QYD A;  5F36 A;  5FB0 A;  5E9K A;  5E74 A;  4N4H A;  4BHW A;  3O33 A;  5FFW A;  4PPE A;  5HEN A;  3M99 A;  4NYW A;  4I7C A;  4HXK A;  5FFY A;  4YYK A;  2BAY A;  3RPG B;  3MUL A;  4QST A;  4XI1 A;  5EYA F;  5JG6 A;  4Q0N A;  4LR6 A;  4HXP A;  4AUQ B;  5ENE A;  3K2J A;  5FE2 A;  5IGM A;  4O7A A;  3ZNI A;  5JI8 A;  3MB4 A;  2IDA A;  1WE9 A;  2CKL B;  5FDZ A;  4OGI A;  5ETD A;  5FE6 A;  3GL6 A;  2YRE A;  4MSX A;  1WIM A;  4TYL A;  2I7K A;  2JRJ A;  1WEU A;  1T1H A;  5FEY A;  4NQN A;  1WEV A;  2RI7 A;  5AME A;  5LVR A;  3RCW A;  2K1J A;  4ZC9 A;  2KGI A;  3SHB A;  4LRG A;  4O78 A;  5COI A;  3HMH A;  2MUM A;  2M6M A;  3NG2 A;  5H9M A;  1VD4 A;  5L98 A;  4LK9 A;  2YHN A;  4A0C D;  1HYI A;  4MR5 A;  5HEL A;  2DWW A;  4HXR A;  3N9O A;  2YUC A;  5TAB A;  4O75 A;  4WHW A;  2GRC A;  2K4D A;  5A5P A;  3NXB A;  5H85 A;  2ECT A;  2LGK A;  4A49 A;  3P1F A;  2HDP A;  3C5K A;  2CKL A;  1X4I A;  2LGV A;  2PNX A;  2YT5 A;  4UIX A;  2F42 A;  3I2D A;  5D3H A;  1CHC A;  3QZV A;  1XWH A;  1Z2Q A;  1X0J A;  4NYV A;  4XUA A;  4BW1 A;  2OO1 A;  4P5O B;  3I3J A;  4MR6 A;  1BOR A;  5EPR A;  2VPD A;  5EIS A;  5E73 A;  4Z6I A;  3DAI A;  5J0D A;  4LZR A;  5KH3 A;  2YQL A;  4UIZ A;  5C7N A;  1VYX A;  2MA6 A;  5F63 A;  3U5K A;  5I7Y A;  4GB0 A;  2YDW A;  5CPE A;  5A5R A;  3ZYU A;  4YAB A;  4QSX A;  2M1R A;  4CFL A;  4YYH A;  3GG3 A;  2G4A A;  4QEW A;  2YW5 A;  3EB5 A;  5DYU A;  4N4F A;  5DFD A;  2Y1M A;  3ZPV E;  2YQM A;  4HBY A;  5L8U A;  4TU4 A;  4GNG A;  5D1K B;  2VPG A;  1RMD A;  5DW2 A;  4PY6 A;  4TZ2 A;  2G43 A;  4IOO A;  3IU5 A;  4YY6 A;  2MD7 B;  5TB6 A;  5A5Q A;  4NUC A;  5CQ8 A;  4LYS A;  1WFK A;  4QSP A;  1ZBD B;  4A9J A;  2MNZ A;  5AIU A;  5ACY A;  3MUK A;  3U5L A;  2WP1 A;  4YYM A;  5L96 A;  4HXO A;  4NRB A;  1ZS5 A;  3HCU A;  4ZUX U;  3LJW A;  5EWV A;  3UV5 A;  3L11 A;  3U5O A;  4TZ8 A;  5D25 A;  3UW9 A;  4L58 A;  3JVM A;  5I88 A;  2ECW A;  4QZS A;  2KIZ A;  2LSP B;  5I29 A;  5TDW A;  4XUB A;  4UIU A;  5G4R A;  3G0L A;  3L1Z B;  5CUD A;  2KWJ A;  5FBX A;  4GPJ A;  5HRW A;  4NR8 A;  5EWC A;  2LRI C;  5F60 A;  4NYX A;  5CFW A;  2YHO A;  4QR4 A;  2LXH C;  4R2Y A;  4ZDT A;  4Q6F A;  4PCI A;  5A5S A;  5E9V A;  2KFT A;  4QSU A;  2KGG A;  3DQV R;  5HQ7 A;  2K17 A;  2L5U A;  4TTE A;  2MT5 A;  2RSD A;  5CRZ A;  4A9M A;  5KTU A;  1MM2 A;  4NR4 A;  3AAD A;  3HMF A;  2VPE A;  4QEU A;  4LYI A;  2VPB A;  4O74 A;  3EB6 A;  4QSS A;  1WES A;  4I7D A;  5CS8 A;  5KH9 A;  5EWH A;  4IOR A;  3T6R A;  2I8N A;  5BT3 A;  2Y43 A;  2E3K A;  4O7F A;  5C13 A;  4S3O B;  4UYF B;  2LXP C;  2KR4 A;  4GND A;  1N87 A;  3SVH A;  5AMF A;  2I50 A;  1EQF A;  2OUO A;  4YY4 A;  4HBX A;  2RNX A;  2C2V S;  4QR5 A;  4UP0 A;  5E9L A;  3U5M A;  4YYJ A;  3HCS A;  4CUS A;  1WEN A;  5G04 B;  4YAT A;  1WUM A;  4YBS A;  4AKN A;  4CFK A;  2JMD A;  3G0J A;  5EI4 A;  2XEU A;  2YQD A;  5D3S A;  5EQ1 A;  2XB1 A;  5IGL A;  5D1L B;  5E0R A;  3S91 A;  3N9L A;  4LZ2 A;  1E6I A;  5ENJ A;  4ALH A;  2KWK A;  4CL9 A;  3JVJ A;  3PHD A;  4QF3 A;  4UYF A;  4V3L C;  4IR3 A;  4Y03 A;  5F62 A;  2CT2 A;  1MM3 A;  4YAD A;  4UYH A;  2KWN A;  4O7C A;  4OGJ A;  4AVX A;  2DVS A;  3JVL A;  3FKM X;  1WEW A;  5E3G A;  4X2I A;  5I80 A;  5DLZ A;  4O76 A;  5D3J A;  3UV4 A;  4FK5 A;  3HTK C;  4XY8 A;  1N72 A;  4C67 A;  5EPB A;  5CQT A;  4ALG A;  5LJ2 A;  5FH6 A;  4N4G A;  5B75 A;  5F1L A;  3O34 A;  3AQA A;  4HXN A;  4O77 A;  5F3A A;  3UV2 A;  1WUG A;  3KNV A;  4TT6 A;  5CUA A;  5HQ6 A;  2YSM A;  2HYE D;  4Z1S A;  5B78 A;  5FE5 A;  5KU3 A;  4C9Z A;  5I83 A;  2H60 A;  2D8S A;  2M3H A;  4C66 A;  5EV9 A;  5ENH A;  4J0S A;  5CQ4 A;  2E6S A;  2RFJ A;  5HLS A;  4R7E A;  1FBV A;  5EA1 A;  2EGP A;  5DKC A;  2L85 A;  4A4C A;  4NR7 A;  1DVP A;  5H1U A;  2UZG A;  5LJ0 A;  5HQ5 A;  2AN6 A;  5H1V A;  2Y1N A;  5D7X A;  5DYC A;  4NRA A;  4FJC A;  5DX4 A;  3O35 A;  3N9M A;  3T7L A;  3L1X A;  5AIT A;  3DPL R;  4CUQ A;  5DY7 A;  2LN0 A;  4HBW A;  4QSV A;  3HCT A;  3N9Q A;  5II2 A;  3ZPV 1;  5AD2 A;  3SOU A;  3M62 A;  5I7X A;  5CQ7 A;  2QJ0 A;  4I7B A;  2FSA A;  5DFC A;  4O71 A;  5LUU A;  4LJN A;  5AD3 A;  4QC1 A;  4ZW1 A;  4V3K C;  2KE1 A;  4YAX A;  4NRC A;  2ECI A;  3QZS A;  2D82 A;  5ENI A;  2L80 A;  4UP5 A;  4PS5 A;  4Z93 A;  1IYM A;  2CSZ A;  4WZ3 B;  5LJ1 A;  5HFQ A;  5CUC A;  5FE4 A;  5IGN A;  1VFY A;  5CUG A;  5CTL A;  2N9G A;  4A9I A;  5C87 A;  3KQI A;  2H0D B;  5L99 A;  5LKT A;  5L8T A;  1Z6U A;  3P1C A;  4WA6 A;  2JMJ A;  4YYI A;  4X3G A;  3IHP A;  4LLB A;  5D3N A;  3P5O A;  5FG6 A;  5LVQ A;  1WEE A;  5HEM A;  4O72 A;  2YSJ A;  4KCX A;  5B79 A;  5H1T A;  4MR3 A;  2YUR A;  5CUB A;  2FUU A;  2LDR A;  4UYE A;  4A9N A;  1JOC A;  4NS5 A;  5F5Z A;  5DKH A;  2RNY A;  2DAT A;  2NAA A;  2NXB A;  5FE1 A;  3UVD A;  2RO1 A;  5I86 A;  2CSY A;  4BBQ A;  4FIP A;  4TKP B;  5DKA A;  2VJE B;  4W4U A;  2OSS A;  5FE9 A;  2ECV A;  1FP0 A;  2ECG A;  4QBM A;  3ZYQ A;  1K2F A;  3FL2 A;  5CQ6 A;  4A9E A;  4YYN A;  4DON A;  5EVA A;  5E9Y A;  1WGM A;  1U6G B;  4FO9 A;  2H0D A;  4CUP A;  4A9O A;  2L84 A;  5G0F A;  5HCL A;  2VP7 A;  2L0B A;  3SOW A;  5A5N A;  3M63 A;  2ECJ A;  5CP5 A;  4MEO A;  4YK0 A;  5CQ3 A;  4E96 A;  4LDF A;  5ETB A;  5D3R A;  2L5E A;  4KV4 A;  2DKW A;  5A5O A;  3LQH A;  5TRB A;  4QR3 A;  4UYG A;  2VJE A;  4KV1 A;  4HXL A;  4YYG A;  1JM7 B;  3N9P A;  5B77 A;  4TT4 A;  3C6W A;  5D24 A;  2DX8 A;  5DW1 A;  3ONI A;  3HME A;  4QB3 A;  2DVR A;  5HJC A;  5IG6 A;  5EM3 A;  5I89 A;  5D26 A;  4NXJ A;  4YYD A;  4WZ2 A;  5A83 A;  2YU4 A;  5EWW A;  4O64 A;  5C8G A;  2K16 A;  5A85 A;  2ZET C;  3MQM A;  2M85 A;  1V87 A;  5J3X A;  4O7E A;  5FG5 A;  5G4S A;  3TLP A;  2EA6 A;  2L43 A;  3RPG C;  2KWO A;  3LQJ A;  4MEQ A;  1F68 A;  4QSR A;  5FH8 A;  5HFR A;  2EOD A;  1JM7 A;  5EIC A;  5ENB A;  1WEP A;  3ZVY A;  4BW3 A;  5ENG A;  3ZTG A;  2JMI A;  3S92 A;  4UIT A;  2QIC A;  2L75 A;  5D3T A;  4UI9 B;  4QUT A;  5KTX A;  3MHH A;  5CGP A;  4TT2 A;  1WEM A;  5E9M A;  4XY9 A;  2LQ6 A;  4UIW A;  3P1E A;  4RVR A;  4IOQ A;  5DBM A;  5A7C A;  4LKA A;  5CQ5 A;  4NR9 A;  4QSQ A;  2R10 A;  3V43 A;  5EK9 A;  5DKD A;  4O7B A;  5HRV A;  4Q0O A;  4QYL A;  4MEN A;  5EPS A;  5FE7 A;  1JM4 B;  3SVG A;  5JWM A;  1G25 A;  3Q2F A;  1E4U A;  2R0S A;  5CRM A;  3MXF A;  5I1Q A;  5C89 A;  3D7C A;  5IGK A;  5K29 A;  2WP2 A;  3O7A A;  5F2P A;  4GNF A;  5BT5 A;  2DVQ A;  5D3L A;  4B7Y C;  4A9K A;  3MB3 A;  2VNF A;  4MR4 A;  4YBM A;  2YW8 A;  5TDR A;  5A81 A;  4YH3 A;  2YEM A;  2E7N A;  1LDK C;  2ECN A;  2YYR A;  5LCW B;  1X4U A;  5EP7 A;  2KRE A;  3PUR A;  4NR5 A;  3ZVZ B;  2RNW A;  5DIN A;  4HBV A;  4QUU A;  5CZG A;  3ASL A;  4O70 A;  4AYC B;  5D3P A;  4PCE A;  2F6N A;  5KH7 A;  5B76 A;  4YBT A;  3SOX A;  2PUY A;  5CQA A;  2F6J A;  2MJV B;  2R0V A;  4L7X A;  4NN2 A;  4HXS A;  5E7D A;  5FE0 A;  3SVF A;  2LGL A;  2KTB B;  3JVK A;  3P1D A;  5DYX A;  4MVT A;  1WEQ A;  2C2L A;  5C4Q A;  4A9L A;  2RS9 B;  4J1P A;  5L97 A;  4A9F A;  4A9H A;  4Z6H A;  5FH7 A;  4CLB A;  2MD8 C;  4ZQL A;  4IR6 A;  5EU1 A;  4J0R A;  3QZT A;  4NUD A;  4QEV A;  5I40 A;  5ENF A;  5CUE A;  5HM0 A;  2G6Q A;  5KO4 A;  1WIL A;  4WZ0 A;  4AYC A;  5HRX A;  3Q2E A;  5E9I A;  4GNE A;  3O37 A;  4BW4 A;  5LKU A;  2E6R A;  5B8D A;  2LV9 A;  4TU6 A;  2QIZ A;  3IU6 A;  4UYD A;  5FG4 A;  4QNS A;  4LC2 A;  4NUE A;  2E7O A;  4N4I A;  4HXM A;  5A82 A;  2KYU A;  2MNY A;  4WIV A;  2VJF B;  4YC9 A;  3LRQ A;  5ENC A;  3LXJ A;  1LDJ B;  2LGG A;  2YEL A;  2MIQ A;  4PKL A;  5FER A;  4TQN A;  5LKZ A;  4NQM A;  4OUF A;  3PUQ A;  3VK6 A;  4LYW A;  4B86 C;  3KV6 A;  4F52 B;  5TBN A;  4TS8 A;  4WHU A;  4J3I A;  4IC2 A;  2FUI A;  4CUU A;  5EGU A;  5KTW A;  5KHM A;  5DFB A;  5BT4 A;  5IID A;  1X4J A;  4LZS A;  3U5J A;  2OXQ C;  5C85 A;  4S3O C;  4IR4 A;  5FE8 A;  3UVY A;  1Z60 A;  3U5N A;  5G05 B;  4QC3 A;  2VJF A;  4UIV A;  4QF2 A;  4BW2 A;  4NR6 A;  4XYA A;  3GV4 A;  3KV5 A;  5DYA A;  4QSW A;  5D1M B;  4LAD B;  2YYN A;  4CUR A;  3UVX A;  3RTR B;  5F1H A;  5II1 A;  5CY9 A;  5C11 A;  2MA5 A;  1F62 A;  2YEK A;  5CU8 A;  4CUT A;  3U5P A;  3O70 A;  1HYJ A;  4BJX A;  4CA1 A;  5I3L A;  4CCG X;  4F3I A;  4AP4 A;  4PTB A;  4UIY A;  5FE3 A;  3N9N A;  5DLX A;  1JSP B;  4FLP A;  4Z1Q A;  1WEO A;  4N3W A;  5F25 A;  5E3D A;  2D9E A;  5EWD A;  3LQI A;  3O36 A;  5FB1 A;  4IC3 A;  4YH4 A;  5F61 A;  5FFV A;  4MEP A;  3MHS A;  2R0Y A;  5IBN A;  2DVV A;  3UVW A;  4R8P K;  2KU3 A; 
#chains in the Genus database with same CATH topology
 4IR5 A;  2G45 A;  5TCM A;  4A4B A;  5D0C A;  3DWY A;  5LKX A;  4QY4 A;  4QYD A;  5F36 A;  5FB0 A;  5E9K A;  5E74 A;  4F1P A;  1ZKR A;  2DJA A;  4N4H A;  4BHW A;  3O33 A;  5FFW A;  4PPE A;  5HEN A;  3M99 A;  4NYW A;  2MKE A;  4I7C A;  4HXK A;  5FFY A;  4YYK A;  2BAY A;  4OGE A;  3RPG B;  3MUL A;  4QST A;  4XI1 A;  5EYA F;  5JG6 A;  4Q0N A;  2CRW A;  4LR6 A;  4HXP A;  4AUQ B;  5ENE A;  3K2J A;  5FE2 A;  5IGM A;  4O7A A;  3ZNI A;  5JI8 A;  3MB4 A;  2IDA A;  1WE9 A;  2CKL B;  5FDZ A;  4OGI A;  5ETD A;  5FE6 A;  4OGC A;  3GL6 A;  2YRE A;  4MSX A;  1WIM A;  4TYL A;  5K3Q A;  2I7K A;  2JRJ A;  1WEU A;  1T1H A;  5FEY A;  3LVQ E;  4NQN A;  1WEV A;  2FD4 A;  2RI7 A;  5AME A;  5LVR A;  3PLW A;  2EGM A;  3RCW A;  2K1J A;  4ZC9 A;  2KGI A;  3SHB A;  4LRG A;  4O78 A;  5COI A;  3HMH A;  2MUM A;  2M6M A;  3NG2 A;  5H9M A;  1VD4 A;  5L98 A;  4LK9 A;  2YHN A;  4A0C D;  1HYI A;  4MR5 A;  5HEL A;  2DWW A;  4HXR A;  3N9O A;  2YUC A;  5TAB A;  4O75 A;  4WHW A;  2GRC A;  2K4D A;  5A5P A;  3NXB A;  5H85 A;  2ECT A;  2LGK A;  4A49 A;  3P1F A;  2HDP A;  3C5K A;  2CKL A;  1X4I A;  2LGV A;  2PNX A;  2YT5 A;  4UIX A;  2F42 A;  3I2D A;  5D3H A;  1CHC A;  4H9D A;  3M7K A;  3QZV A;  1XWH A;  1Z2Q A;  1X0J A;  4NYV A;  4XUA A;  4BW1 A;  2OO1 A;  4P5O B;  3I3J A;  2XOY A;  4MR6 A;  1BOR A;  5EPR A;  2OWA A;  2VPD A;  5EIS A;  5E73 A;  4Z6I A;  3DAI A;  5J0D A;  4LZR A;  3FJU B;  3LJU X;  5KH3 A;  2YQL A;  4UIZ A;  5C7N A;  4Z0R A;  1VYX A;  2MA6 A;  5F63 A;  3U5K A;  5I7Y A;  4GB0 A;  2YDW A;  5CPE A;  5A5R A;  3ZYU A;  2KKY A;  4YAB A;  4QSX A;  2M1R A;  4CFL A;  4YYH A;  3GG3 A;  2G4A A;  4QEW A;  2YW5 A;  2DSM A;  3EB5 A;  5DYU A;  4N4F A;  5DFD A;  2Y1M A;  3ZPV E;  2YQM A;  4HBY A;  5L8U A;  4TU4 A;  4GNG A;  5D1K B;  2VPG A;  1RMD A;  5DW2 A;  4PY6 A;  4TZ2 A;  2G43 A;  4IOO A;  3IU5 A;  4YY6 A;  2MD7 B;  5TB6 A;  5A5Q A;  4NUC A;  5CQ8 A;  4LYS A;  1WFK A;  4QSP A;  1ZBD B;  4A9J A;  2MNZ A;  5AIU A;  5ACY A;  3MUK A;  3U5L A;  2WP1 A;  4YYM A;  5L96 A;  4HXO A;  4NRB A;  1ZS5 A;  3HCU A;  4ZUX U;  3LJW A;  5EWV A;  3UV5 A;  3L11 A;  3U5O A;  4TZ8 A;  3FM8 C;  5D25 A;  3UW9 A;  4L58 A;  3JVM A;  5I88 A;  2ECW A;  4QZS A;  2KIZ A;  2LSP B;  5I29 A;  5TDW A;  4XUB A;  4UIU A;  5G4R A;  3G0L A;  3L1Z B;  5CUD A;  2KWJ A;  5FBX A;  4GPJ A;  5HRW A;  4NR8 A;  5EWC A;  2LRI C;  5F60 A;  4NYX A;  5CFW A;  2YHO A;  4QR4 A;  2LXH C;  4R2Y A;  4ZDT A;  4Q6F A;  2L7P A;  4PCI A;  5A5S A;  5E9V A;  2KFT A;  4QSU A;  2KGG A;  4O62 A;  3DQV R;  5HQ7 A;  2K17 A;  2L5U A;  4TTE A;  2MT5 A;  2RSD A;  5CRZ A;  2XP0 A;  4A9M A;  5KTU A;  1MM2 A;  3FAN A;  4NR4 A;  3AAD A;  3HMF A;  2VPE A;  3FAO A;  4QEU A;  4LYI A;  2VPB A;  4O74 A;  3EB6 A;  4QSS A;  1WES A;  4I7D A;  5CS8 A;  5KH9 A;  5EWH A;  4IOR A;  3T6R A;  2I8N A;  5BT3 A;  2Y43 A;  2E3K A;  4O7F A;  5C13 A;  4S3O B;  4UYF B;  2LXP C;  3VKG A;  2KR4 A;  4GND A;  1N87 A;  3SVH A;  5SVI B;  5AMF A;  2I50 A;  1EQF A;  2OUO A;  4YY4 A;  2CSV A;  4HBX A;  2RNX A;  2C2V S;  4QR5 A;  4UP0 A;  5E9L A;  3U5M A;  4YYJ A;  3HCS A;  3O47 A;  4CUS A;  1WEN A;  2JUN A;  5G04 B;  4YAT A;  1WUM A;  4YBS A;  4AKN A;  4CFK A;  2JMD A;  3G0J A;  5EI4 A;  2XEU A;  2YQD A;  5D3S A;  5EQ1 A;  2XB1 A;  5IGL A;  5D1L B;  5E0R A;  3S91 A;  3N9L A;  4LZ2 A;  1E6I A;  5ENJ A;  4ALH A;  2KWK A;  4CL9 A;  3JVJ A;  3PHD A;  4QF3 A;  4UYF A;  4V3L C;  4IR3 A;  4Y03 A;  5F62 A;  2CT2 A;  1MM3 A;  2M13 A;  4YAD A;  4UYH A;  2KWN A;  4O7C A;  4OGJ A;  4AVX A;  2DVS A;  3JVL A;  2XOZ A;  3FKM X;  1WEW A;  5E3G A;  4X2I A;  2KKX A;  5I80 A;  5DLZ A;  4O76 A;  5D3J A;  3UV4 A;  4FK5 A;  3HTK C;  4XY8 A;  1N72 A;  4C67 A;  5EPB A;  5CQT A;  4ALG A;  5LJ2 A;  5FH6 A;  4N4G A;  3VKH A;  5F1L A;  5B75 A;  3O34 A;  3AQA A;  4HXN A;  4O77 A;  5F3A A;  3UV2 A;  1WUG A;  3KNV A;  4TT6 A;  5CUA A;  5HQ6 A;  2YSM A;  2HYE D;  4Z1S A;  5B78 A;  5FE5 A;  5KU3 A;  4C9Z A;  3SUB A;  5I83 A;  2H60 A;  2D8S A;  2M3H A;  4C66 A;  5EV9 A;  5ENH A;  4J0S A;  5CQ4 A;  2E6S A;  2RFJ A;  5HLS A;  4R7E A;  1FBV A;  2D8U A;  5EA1 A;  2EGP A;  5DKC A;  2L85 A;  4A4C A;  4NR7 A;  1DVP A;  5H1U A;  2UZG A;  5LJ0 A;  5HQ5 A;  2AN6 A;  5H1V A;  2Y1N A;  5D7X A;  5DYC A;  4NRA A;  4FJC A;  5DX4 A;  3O35 A;  3N9M A;  3T7L A;  3L1X A;  5AIT A;  3DPL R;  4CUQ A;  5DY7 A;  2LN0 A;  4HBW A;  4QSV A;  4AI6 A;  3HCT A;  3N9Q A;  5II2 A;  3ZPV 1;  5AD2 A;  3SOU A;  3M62 A;  5I7X A;  5CQ7 A;  2QJ0 A;  4I7B A;  2FSA A;  5DFC A;  4O71 A;  5LUU A;  2XOC A;  4LJN A;  5AD3 A;  4QC1 A;  4ZW1 A;  4V3K C;  2KE1 A;  4YAX A;  4NRC A;  2ECI A;  3QZS A;  2D82 A;  5ENI A;  2L80 A;  2P57 A;  4UP5 A;  4PS5 A;  4Z93 A;  1IYM A;  3LDY A;  2CSZ A;  3KDE C;  3E2D A;  4WZ3 B;  5LJ1 A;  5HFQ A;  5CUC A;  3D1D A;  5FE4 A;  5IGN A;  1VFY A;  5CUG A;  5CTL A;  2N9G A;  4A9I A;  5C87 A;  3KQI A;  2H0D B;  5L99 A;  5LKT A;  5L8T A;  1Z6U A;  3P1C A;  1PUO A;  2JMJ A;  2EXU A;  4WA6 A;  4YYI A;  4X3G A;  3IHP A;  4LLB A;  5D3N A;  3P5O A;  5FG6 A;  5LVQ A;  1WEE A;  5HEM A;  4O72 A;  2YSJ A;  4KCX A;  5B79 A;  5H1T A;  4MR3 A;  2YUR A;  5CUB A;  2FUU A;  2LDR A;  4UYE A;  4A9N A;  1JOC A;  4NS5 A;  5F5Z A;  5DKH A;  2RNY A;  2DAT A;  2NAA A;  2NXB A;  5FE1 A;  3UVD A;  2RO1 A;  5I86 A;  2CSY A;  4BBQ A;  4FIP A;  4TKP B;  3H7H A;  2VJE B;  4W4U A;  5DKA A;  2JM3 A;  2OSS A;  5FE9 A;  2ECV A;  1FP0 A;  2ECG A;  4QBM A;  3ZYQ A;  1K2F A;  3FL2 A;  5CQ6 A;  4A9E A;  4YYN A;  4DON A;  5EVA A;  5E9Y A;  1WGM A;  1U6G B;  3Q1D A;  4FO9 A;  2H0D A;  4CUP A;  4A9O A;  1MBM A;  2L84 A;  5G0F A;  5HCL A;  2VP7 A;  2L0B A;  3SOW A;  5A5N A;  3M63 A;  2ECJ A;  5CP5 A;  4MEO A;  4YK0 A;  5CQ3 A;  4E96 A;  4LDF A;  5ETB A;  4AKG A;  2FFW A;  5D3R A;  2L5E A;  4KV4 A;  2IQJ A;  2DKW A;  5A5O A;  3LQH A;  2YVR A;  5TRB A;  4QR3 A;  4UYG A;  2VJE A;  4KV1 A;  4HXL A;  4YYG A;  1JM7 B;  3N9P A;  5B77 A;  4AKI A;  3ERR A;  4TT4 A;  3C6W A;  5D24 A;  2DX8 A;  5DW1 A;  3ONI A;  3HME A;  4QB3 A;  2DVR A;  5HJC A;  5IG6 A;  5EM3 A;  5I89 A;  5D26 A;  4NXJ A;  4YYD A;  4WZ2 A;  5A83 A;  2YU4 A;  5EWW A;  4O64 A;  5C8G A;  2K16 A;  5A85 A;  2ZET C;  3MQM A;  2M85 A;  1V87 A;  5J3X A;  4O7E A;  5FG5 A;  5G4S A;  3TLP A;  2EA6 A;  2L43 A;  3RPG C;  2KWO A;  3LQJ A;  2LAU A;  4MEQ A;  1F68 A;  4QSR A;  5FH8 A;  5HFR A;  2EOD A;  1JM7 A;  5SVI A;  5EIC A;  5ENB A;  1WEP A;  3ZVY A;  4BW3 A;  5ENG A;  3ZTG A;  2JMI A;  3S92 A;  4UIT A;  2QIC A;  4QQ4 A;  2L75 A;  5D3T A;  4UI9 B;  4QUT A;  5KTX A;  3MHH A;  5CGP A;  4TT2 A;  1WEM A;  5E9M A;  4XY9 A;  2LQ6 A;  4UIW A;  3P1E A;  5SVX A;  4RVR A;  4AKH A;  4IOQ A;  5DBM A;  5A7C A;  4LKA A;  5CQ5 A;  4NR9 A;  4QSQ A;  2R10 A;  3V43 A;  5EK9 A;  5DKD A;  4O7B A;  5HRV A;  4Q0O A;  4QYL A;  4Z0O A;  4MEN A;  5EPS A;  5FE7 A;  3D1B A;  1JM4 B;  3SVG A;  5JWM A;  1G25 A;  3Q2F A;  1E4U A;  2R0S A;  5CRM A;  3MXF A;  5I1Q A;  5C89 A;  3D7C A;  5IGK A;  5K29 A;  2WP2 A;  3O7A A;  5F2P A;  4GNF A;  5BT5 A;  2DVQ A;  3DWD A;  5D3L A;  4B7Y C;  3MDB C;  4A9K A;  3MB3 A;  2VNF A;  4MR4 A;  4YBM A;  2YW8 A;  5TDR A;  5A81 A;  4YH3 A;  2YEM A;  2E7N A;  1LDK C;  2ECN A;  2YYR A;  5LCW B;  1X4U A;  5EP7 A;  2KRE A;  3PUR A;  4NR5 A;  3ZVZ B;  2RNW A;  5DIN A;  4HBV A;  4QUU A;  5CZG A;  3ASL A;  4O70 A;  4AYC B;  5D3P A;  4PCE A;  2F6N A;  5KH7 A;  5B76 A;  4YBT A;  3SOX A;  2PUY A;  5CQA A;  2F6J A;  2MJV B;  2R0V A;  3DDT A;  4L7X A;  4NN2 A;  4HXS A;  5E7D A;  5FE0 A;  2RR4 A;  3SVF A;  2LGL A;  2KTB B;  3JVK A;  2EJN A;  3P1D A;  5DYX A;  4MVT A;  1WEQ A;  2C2L A;  5C4Q A;  4A9L A;  3LVR E;  2RS9 B;  4J1P A;  5L97 A;  4A9F A;  4A9H A;  4Z6H A;  5SVY A;  5FH7 A;  4CLB A;  2MD8 C;  4ZQL A;  4IR6 A;  5EU1 A;  4J0R A;  3QZT A;  4NUD A;  4QEV A;  3FEH A;  5I40 A;  5ENF A;  5CUE A;  5HM0 A;  2G6Q A;  5KO4 A;  1DCQ A;  1WIL A;  4WZ0 A;  4AYC A;  5HRX A;  3Q2E A;  5E9I A;  4GNE A;  3O37 A;  4BW4 A;  5LKU A;  2E6R A;  5B8D A;  2LV9 A;  4TU6 A;  2QIZ A;  3IU6 A;  4UYD A;  5FG4 A;  4QNS A;  4LC2 A;  4NUE A;  2E7O A;  4N4I A;  4HXM A;  5A82 A;  2KYU A;  2MNY A;  4WIV A;  2VJF B;  4YC9 A;  3LRQ A;  5ENC A;  3LXJ A;  1LDJ B;  2LGG A;  2YEL A;  2MIQ A;  4PKL A;  5FER A;  4TQN A;  5LKZ A;  4NQM A;  4OUF A;  3PUQ A;  3VK6 A;  4LYW A;  4B86 C;  3KV6 A;  4F52 B;  5TBN A;  4TS8 A;  4WHU A;  4J3I A;  3T9K A;  4IC2 A;  2FUI A;  4CUU A;  5EGU A;  5KTW A;  2E61 A;  5KHM A;  2CRR A;  5DFB A;  5BT4 A;  5IID A;  1X4J A;  4LZS A;  3U5J A;  2OXQ C;  5C85 A;  4S3O C;  4IR4 A;  5FE8 A;  3UVY A;  1Z60 A;  3U5N A;  5G05 B;  4QC3 A;  2VJF A;  4UIV A;  4QF2 A;  4BW2 A;  4NR6 A;  4XYA A;  3GV4 A;  3KV5 A;  5DYA A;  4QSW A;  5D1M B;  4LAD B;  2YYN A;  4CUR A;  3UVX A;  3JUE A;  2B0O E;  3RTR B;  5F1H A;  5II1 A;  5CY9 A;  5C11 A;  2MA5 A;  1F62 A;  2YEK A;  5CU8 A;  4CUT A;  3U5P A;  3O70 A;  1HYJ A;  4BJX A;  4CA1 A;  5I3L A;  4CCG X;  4F3I A;  2CON A;  4AP4 A;  4PTB A;  4UIY A;  5FE3 A;  3N9N A;  5DLX A;  1JSP B;  4FLP A;  4Z1Q A;  1WEO A;  4N3W A;  5F25 A;  5E3D A;  2D9E A;  5EWD A;  3LQI A;  3O36 A;  5FB1 A;  4IC3 A;  4YH4 A;  5F61 A;  5FFV A;  4MEP A;  3MHS A;  2R0Y A;  5IBN A;  2DVV A;  3UVW A;  4R8P K;  2KU3 A; 
#chains in the Genus database with same CATH homology
 4IR5 A;  2G45 A;  5TCM A;  4A4B A;  5D0C A;  3DWY A;  5LKX A;  4QY4 A;  4QYD A;  5F36 A;  5FB0 A;  5E9K A;  5E74 A;  4N4H A;  4BHW A;  3O33 A;  5FFW A;  4PPE A;  5HEN A;  3M99 A;  4NYW A;  4I7C A;  4HXK A;  5FFY A;  4YYK A;  2BAY A;  3RPG B;  3MUL A;  4QST A;  4XI1 A;  5EYA F;  5JG6 A;  4Q0N A;  4LR6 A;  4HXP A;  4AUQ B;  5ENE A;  3K2J A;  5FE2 A;  5IGM A;  4O7A A;  3ZNI A;  5JI8 A;  3MB4 A;  2IDA A;  1WE9 A;  2CKL B;  5FDZ A;  4OGI A;  5ETD A;  5FE6 A;  3GL6 A;  2YRE A;  4MSX A;  1WIM A;  4TYL A;  2I7K A;  2JRJ A;  1WEU A;  1T1H A;  5FEY A;  4NQN A;  1WEV A;  2RI7 A;  5AME A;  5LVR A;  3RCW A;  2K1J A;  4ZC9 A;  2KGI A;  3SHB A;  4LRG A;  4O78 A;  5COI A;  3HMH A;  2MUM A;  2M6M A;  3NG2 A;  5H9M A;  1VD4 A;  5L98 A;  4LK9 A;  2YHN A;  4A0C D;  1HYI A;  4MR5 A;  5HEL A;  2DWW A;  4HXR A;  3N9O A;  2YUC A;  5TAB A;  4O75 A;  4WHW A;  2GRC A;  2K4D A;  5A5P A;  3NXB A;  5H85 A;  2ECT A;  2LGK A;  4A49 A;  3P1F A;  2HDP A;  3C5K A;  2CKL A;  1X4I A;  2LGV A;  2PNX A;  2YT5 A;  4UIX A;  2F42 A;  3I2D A;  5D3H A;  1CHC A;  3QZV A;  1XWH A;  1Z2Q A;  1X0J A;  4NYV A;  4XUA A;  4BW1 A;  2OO1 A;  4P5O B;  3I3J A;  4MR6 A;  1BOR A;  5EPR A;  2VPD A;  5EIS A;  5E73 A;  4Z6I A;  3DAI A;  5J0D A;  4LZR A;  5KH3 A;  2YQL A;  4UIZ A;  5C7N A;  1VYX A;  2MA6 A;  5F63 A;  3U5K A;  5I7Y A;  4GB0 A;  2YDW A;  5CPE A;  5A5R A;  3ZYU A;  4YAB A;  4QSX A;  2M1R A;  4CFL A;  4YYH A;  3GG3 A;  2G4A A;  4QEW A;  2YW5 A;  3EB5 A;  5DYU A;  4N4F A;  5DFD A;  2Y1M A;  3ZPV E;  2YQM A;  4HBY A;  5L8U A;  4TU4 A;  4GNG A;  5D1K B;  2VPG A;  1RMD A;  5DW2 A;  4PY6 A;  4TZ2 A;  2G43 A;  4IOO A;  3IU5 A;  4YY6 A;  2MD7 B;  5TB6 A;  5A5Q A;  4NUC A;  5CQ8 A;  4LYS A;  1WFK A;  4QSP A;  1ZBD B;  4A9J A;  2MNZ A;  5AIU A;  5ACY A;  3MUK A;  3U5L A;  2WP1 A;  4YYM A;  5L96 A;  4HXO A;  4NRB A;  1ZS5 A;  3HCU A;  4ZUX U;  3LJW A;  5EWV A;  3UV5 A;  3L11 A;  3U5O A;  4TZ8 A;  5D25 A;  3UW9 A;  4L58 A;  3JVM A;  5I88 A;  2ECW A;  4QZS A;  2KIZ A;  2LSP B;  5I29 A;  5TDW A;  4XUB A;  4UIU A;  5G4R A;  3G0L A;  3L1Z B;  5CUD A;  2KWJ A;  5FBX A;  4GPJ A;  5HRW A;  4NR8 A;  5EWC A;  2LRI C;  5F60 A;  4NYX A;  5CFW A;  2YHO A;  4QR4 A;  2LXH C;  4R2Y A;  4ZDT A;  4Q6F A;  4PCI A;  5A5S A;  5E9V A;  2KFT A;  4QSU A;  2KGG A;  3DQV R;  5HQ7 A;  2K17 A;  2L5U A;  4TTE A;  2MT5 A;  2RSD A;  5CRZ A;  4A9M A;  5KTU A;  1MM2 A;  4NR4 A;  3AAD A;  3HMF A;  2VPE A;  4QEU A;  4LYI A;  2VPB A;  4O74 A;  3EB6 A;  4QSS A;  1WES A;  4I7D A;  5CS8 A;  5KH9 A;  5EWH A;  4IOR A;  3T6R A;  2I8N A;  5BT3 A;  2Y43 A;  2E3K A;  4O7F A;  5C13 A;  4S3O B;  4UYF B;  2LXP C;  2KR4 A;  4GND A;  1N87 A;  3SVH A;  5AMF A;  2I50 A;  1EQF A;  2OUO A;  4YY4 A;  4HBX A;  2RNX A;  2C2V S;  4QR5 A;  4UP0 A;  5E9L A;  3U5M A;  4YYJ A;  3HCS A;  4CUS A;  1WEN A;  5G04 B;  4YAT A;  1WUM A;  4YBS A;  4AKN A;  4CFK A;  2JMD A;  3G0J A;  5EI4 A;  2XEU A;  2YQD A;  5D3S A;  5EQ1 A;  2XB1 A;  5IGL A;  5D1L B;  5E0R A;  3S91 A;  3N9L A;  4LZ2 A;  1E6I A;  5ENJ A;  4ALH A;  2KWK A;  4CL9 A;  3JVJ A;  3PHD A;  4QF3 A;  4UYF A;  4V3L C;  4IR3 A;  4Y03 A;  5F62 A;  2CT2 A;  1MM3 A;  4YAD A;  4UYH A;  2KWN A;  4O7C A;  4OGJ A;  4AVX A;  2DVS A;  3JVL A;  3FKM X;  1WEW A;  5E3G A;  4X2I A;  5I80 A;  5DLZ A;  4O76 A;  5D3J A;  3UV4 A;  4FK5 A;  3HTK C;  4XY8 A;  1N72 A;  4C67 A;  5EPB A;  5CQT A;  4ALG A;  5LJ2 A;  5FH6 A;  4N4G A;  5B75 A;  5F1L A;  3O34 A;  3AQA A;  4HXN A;  4O77 A;  5F3A A;  3UV2 A;  1WUG A;  3KNV A;  4TT6 A;  5CUA A;  5HQ6 A;  2YSM A;  2HYE D;  4Z1S A;  5B78 A;  5FE5 A;  5KU3 A;  4C9Z A;  5I83 A;  2H60 A;  2D8S A;  2M3H A;  4C66 A;  5EV9 A;  5ENH A;  4J0S A;  5CQ4 A;  2E6S A;  2RFJ A;  5HLS A;  4R7E A;  1FBV A;  5EA1 A;  2EGP A;  5DKC A;  2L85 A;  4A4C A;  4NR7 A;  1DVP A;  5H1U A;  2UZG A;  5LJ0 A;  5HQ5 A;  2AN6 A;  5H1V A;  2Y1N A;  5D7X A;  5DYC A;  4NRA A;  4FJC A;  5DX4 A;  3O35 A;  3N9M A;  3T7L A;  3L1X A;  5AIT A;  3DPL R;  4CUQ A;  5DY7 A;  2LN0 A;  4HBW A;  4QSV A;  3HCT A;  3N9Q A;  5II2 A;  3ZPV 1;  5AD2 A;  3SOU A;  3M62 A;  5I7X A;  5CQ7 A;  2QJ0 A;  4I7B A;  2FSA A;  5DFC A;  4O71 A;  5LUU A;  4LJN A;  5AD3 A;  4QC1 A;  4ZW1 A;  4V3K C;  2KE1 A;  4YAX A;  4NRC A;  2ECI A;  3QZS A;  2D82 A;  5ENI A;  2L80 A;  4UP5 A;  4PS5 A;  4Z93 A;  1IYM A;  2CSZ A;  4WZ3 B;  5LJ1 A;  5HFQ A;  5CUC A;  5FE4 A;  5IGN A;  1VFY A;  5CUG A;  5CTL A;  2N9G A;  4A9I A;  5C87 A;  3KQI A;  2H0D B;  5L99 A;  5LKT A;  5L8T A;  1Z6U A;  3P1C A;  4WA6 A;  2JMJ A;  4YYI A;  4X3G A;  3IHP A;  4LLB A;  5D3N A;  3P5O A;  5FG6 A;  5LVQ A;  1WEE A;  5HEM A;  4O72 A;  2YSJ A;  4KCX A;  5B79 A;  5H1T A;  4MR3 A;  2YUR A;  5CUB A;  2FUU A;  2LDR A;  4UYE A;  4A9N A;  1JOC A;  4NS5 A;  5F5Z A;  5DKH A;  2RNY A;  2DAT A;  2NAA A;  2NXB A;  5FE1 A;  3UVD A;  2RO1 A;  5I86 A;  2CSY A;  4BBQ A;  4FIP A;  4TKP B;  5DKA A;  2VJE B;  4W4U A;  2OSS A;  5FE9 A;  2ECV A;  1FP0 A;  2ECG A;  4QBM A;  3ZYQ A;  1K2F A;  3FL2 A;  5CQ6 A;  4A9E A;  4YYN A;  4DON A;  5EVA A;  5E9Y A;  1WGM A;  1U6G B;  4FO9 A;  2H0D A;  4CUP A;  4A9O A;  2L84 A;  5G0F A;  5HCL A;  2VP7 A;  2L0B A;  3SOW A;  5A5N A;  3M63 A;  2ECJ A;  5CP5 A;  4MEO A;  4YK0 A;  5CQ3 A;  4E96 A;  4LDF A;  5ETB A;  5D3R A;  2L5E A;  4KV4 A;  2DKW A;  5A5O A;  3LQH A;  5TRB A;  4QR3 A;  4UYG A;  2VJE A;  4KV1 A;  4HXL A;  4YYG A;  1JM7 B;  3N9P A;  5B77 A;  4TT4 A;  3C6W A;  5D24 A;  2DX8 A;  5DW1 A;  3ONI A;  3HME A;  4QB3 A;  2DVR A;  5HJC A;  5IG6 A;  5EM3 A;  5I89 A;  5D26 A;  4NXJ A;  4YYD A;  4WZ2 A;  5A83 A;  2YU4 A;  5EWW A;  4O64 A;  5C8G A;  2K16 A;  5A85 A;  2ZET C;  3MQM A;  2M85 A;  1V87 A;  5J3X A;  4O7E A;  5FG5 A;  5G4S A;  3TLP A;  2EA6 A;  2L43 A;  3RPG C;  2KWO A;  3LQJ A;  4MEQ A;  1F68 A;  4QSR A;  5FH8 A;  5HFR A;  2EOD A;  1JM7 A;  5EIC A;  5ENB A;  1WEP A;  3ZVY A;  4BW3 A;  5ENG A;  3ZTG A;  2JMI A;  3S92 A;  4UIT A;  2QIC A;  2L75 A;  5D3T A;  4UI9 B;  4QUT A;  5KTX A;  3MHH A;  5CGP A;  4TT2 A;  1WEM A;  5E9M A;  4XY9 A;  2LQ6 A;  4UIW A;  3P1E A;  4RVR A;  4IOQ A;  5DBM A;  5A7C A;  4LKA A;  5CQ5 A;  4NR9 A;  4QSQ A;  2R10 A;  3V43 A;  5EK9 A;  5DKD A;  4O7B A;  5HRV A;  4Q0O A;  4QYL A;  4MEN A;  5EPS A;  5FE7 A;  1JM4 B;  3SVG A;  5JWM A;  1G25 A;  3Q2F A;  1E4U A;  2R0S A;  5CRM A;  3MXF A;  5I1Q A;  5C89 A;  3D7C A;  5IGK A;  5K29 A;  2WP2 A;  3O7A A;  5F2P A;  4GNF A;  5BT5 A;  2DVQ A;  5D3L A;  4B7Y C;  4A9K A;  3MB3 A;  2VNF A;  4MR4 A;  4YBM A;  2YW8 A;  5TDR A;  5A81 A;  4YH3 A;  2YEM A;  2E7N A;  1LDK C;  2ECN A;  2YYR A;  5LCW B;  1X4U A;  5EP7 A;  2KRE A;  3PUR A;  4NR5 A;  3ZVZ B;  2RNW A;  5DIN A;  4HBV A;  4QUU A;  5CZG A;  3ASL A;  4O70 A;  4AYC B;  5D3P A;  4PCE A;  2F6N A;  5KH7 A;  5B76 A;  4YBT A;  3SOX A;  2PUY A;  5CQA A;  2F6J A;  2MJV B;  2R0V A;  4L7X A;  4NN2 A;  4HXS A;  5E7D A;  5FE0 A;  3SVF A;  2LGL A;  2KTB B;  3JVK A;  3P1D A;  5DYX A;  4MVT A;  1WEQ A;  2C2L A;  5C4Q A;  4A9L A;  2RS9 B;  4J1P A;  5L97 A;  4A9F A;  4A9H A;  4Z6H A;  5FH7 A;  4CLB A;  2MD8 C;  4ZQL A;  4IR6 A;  5EU1 A;  4J0R A;  3QZT A;  4NUD A;  4QEV A;  5I40 A;  5ENF A;  5CUE A;  5HM0 A;  2G6Q A;  5KO4 A;  1WIL A;  4WZ0 A;  4AYC A;  5HRX A;  3Q2E A;  5E9I A;  4GNE A;  3O37 A;  4BW4 A;  5LKU A;  2E6R A;  5B8D A;  2LV9 A;  4TU6 A;  2QIZ A;  3IU6 A;  4UYD A;  5FG4 A;  4QNS A;  4LC2 A;  4NUE A;  2E7O A;  4N4I A;  4HXM A;  5A82 A;  2KYU A;  2MNY A;  4WIV A;  2VJF B;  4YC9 A;  3LRQ A;  5ENC A;  3LXJ A;  1LDJ B;  2LGG A;  2YEL A;  2MIQ A;  4PKL A;  5FER A;  4TQN A;  5LKZ A;  4NQM A;  4OUF A;  3PUQ A;  3VK6 A;  4LYW A;  4B86 C;  3KV6 A;  4F52 B;  5TBN A;  4TS8 A;  4WHU A;  4J3I A;  4IC2 A;  2FUI A;  4CUU A;  5EGU A;  5KTW A;  5KHM A;  5DFB A;  5BT4 A;  5IID A;  1X4J A;  4LZS A;  3U5J A;  2OXQ C;  5C85 A;  4S3O C;  4IR4 A;  5FE8 A;  3UVY A;  1Z60 A;  3U5N A;  5G05 B;  4QC3 A;  2VJF A;  4UIV A;  4QF2 A;  4BW2 A;  4NR6 A;  4XYA A;  3GV4 A;  3KV5 A;  5DYA A;  4QSW A;  5D1M B;  4LAD B;  2YYN A;  4CUR A;  3UVX A;  3RTR B;  5F1H A;  5II1 A;  5CY9 A;  5C11 A;  2MA5 A;  1F62 A;  2YEK A;  5CU8 A;  4CUT A;  3U5P A;  3O70 A;  1HYJ A;  4BJX A;  4CA1 A;  5I3L A;  4CCG X;  4F3I A;  4AP4 A;  4PTB A;  4UIY A;  5FE3 A;  3N9N A;  5DLX A;  1JSP B;  4FLP A;  4Z1Q A;  1WEO A;  4N3W A;  5F25 A;  5E3D A;  2D9E A;  5EWD A;  3LQI A;  3O36 A;  5FB1 A;  4IC3 A;  4YH4 A;  5F61 A;  5FFV A;  4MEP A;  3MHS A;  2R0Y A;  5IBN A;  2DVV A;  3UVW A;  4R8P K;  2KU3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...