4YABA

Crystal structure of trim24 phd-bromodomain complexed with 1-methyl-5-(2-methyl-1 3-thiazol-4-yl)-2 3-dihydro-1h-indol-2-one (1)
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
184
structure length
178
Chain Sequence
SPNEDWCAVCQNGGELLCCEKCPKVFHLSCHVPTLTNFPSGEWICTFCRDLSKPEVEYDCDAKKKTEGLVKLTPIDKRKCERLLLFLYCHEMSLAFQDPVPLTVPDYYKIIKNPMDLSTIKKRLQEDYSMYSKPEDFVADFRLIFQNCAEFNEPDSEVANAGIKLENYFEELLKNLYP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure-Guided Design of IACS-9571, a Selective High-Affinity Dual TRIM24-BRPF1 Bromodomain Inhibitor.
pubmed doi rcsb
molecule keywords Transcription intermediary factor 1-alpha
molecule tags Transcription/transcription inhibitor
source organism Homo sapiens
total genus 54
structure length 178
sequence length 184
chains with identical sequence B
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2015-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4yabA02
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4yabA01
1LDKC 4N4HA 2FUIA 5I86A 5HRXA 3UVXA 4PPEA 2YU4A 5H85A 4NR8A 4LDFA 4CUSA 4E96A 3ONIA 5LVQA 4O7FA 3UV5A 3LXJA 4B86C 5EWHA 5H1VA 4A4CA 2R0YA 3MUKA 5FERA 4FO9A 5ENBA 4GNFA 2Y43A 2RNWA 4QSUA 3T7LA 4QY4A 4YYDA 4UIZA 4WZ3B 4NRAA 4PTBA 2MD7B 5IBNA 2K16A 5FBXA 2YHNA 2YREA 5HEMA 3U5MA 5CUGA 4TYLA 5E74A 2MT5A 2YT5A 2KWOA 4A9IA 3LQHA 4A9JA 5C85A 3I3JA 5ACYA 2KWKA 5LCWB 5KH7A 4PY6A 2ECNA 5FG5A 4HXOA 5HFRA 4V3KC 1T1HA 5HLSA 5D3NA 5KTXA 2VPGA 3I2DA 5D3SA 5DFDA 5D3LA 4UYFB 4YK0A 5E9LA 3SHBA 5TDRA 5ETDA 4LZ2A 5II2A 3IU6A 3HMEA 4GPJA 4NR6A 2F6JA 2ECWA 3TLPA 2EA6A 3M62A 4R2YA 5TRBA 2I7KA 5LVRA 5CTLA 5CQ7A 4V3LC 5HELA 1X0JA 3RTRB 2PUYA 1X4UA 2DVQA 2ECJA 4WZ2A 4PCEA 2OXQC 4GNGA 5I80A 4OUFA 3O7AA 3JVLA 5EP7A 2LQ6A 3KV6A 4HXNA 5DKHA 5EWCA 4IOOA 3HCSA 3MHSA 4CUPA 3PUQA 3JVJA 2YUCA 3LQIA 2LGLA 3KNVA 4HXRA 2UZGA 4A4BA 2FUUA 4IR4A 2L43A 4BBQA 4A9KA 4FK5A 4LYWA 4AKNA 5EGUA 4O76A 5C89A 4W4UA 4CLBA 5E9KA 5HM0A 4UP0A 4C9ZA 5G04B 4HBYA 2E7OA 2QJ0A 2L84A 4QSTA 2ECTA 4UP5A 5A82A 5D26A 3V43A 5CS8A 5DBMA 5FH6A 4LADB 2YYRA 4QR3A 2M1RA 2CSYA 2D9EA 5EA1A 5I7XA 3U5JA 4J0SA 4UYEA 2M85A 1WEVA 4QUUA 5FB0A 1Z60A 2YQDA 2OO1A 5HENA 2M3HA 4QSWA 4QUTA 1JM4B 4LLBA 2MD8C 4QZSA 4NR7A 5A5QA 5C7NA 2C2VS 3UV4A 5IG6A 5TDWA 4MVTA 1F68A 1JSPB 2Y1MA 3IU5A 2C2LA 4LJNA 1E4UA 5DFBA 4QSPA 1X4JA 3N9NA 1U6GB 1E6IA 5HCLA 2H0DB 3L11A 3PURA 4N4GA 5F1LA 5KH3A 5CU8A 3ZPVE 3ZNIA 4NXJA 5KTUA 3SVFA 4QR5A 2WP2A 4PCIA 2VJEB 5HQ6A 4I7DA 5AITA 5LKTA 5TABA 5HFQA 2LXPC 5DLZA 5LKUA 5L99A 2YQMA 5HRWA 2N9GA 4QYLA 3KV5A 2DVVA 1ZBDB 2YEKA 4NUCA 4O7AA 5A83A 4YYNA 3HCTA 4O74A 1VFYA 4J3IA 4QC3A 4UIYA 4N4FA 4YC9A 1LDJB 5ENHA 3U5PA 5DINA 5EWVA 5ENCA 5EISA 4BJXA 2CKLA 5DYUA 5CQ6A 5DW2A 2FSAA 4Z1QA 5F60A 4QC1A 5FE9A 4QSSA 4XY9A 4Q6FA 1WFKA 2YW8A 4P5OB 5BT4A 3QZSA 3Q2EA 5ENFA 5A5RA 5JI8A 2EODA 4NR4A 2KU3A 5A5NA 4OGIA 5D3TA 3GG3A 4RVRA 2HYED 5TB6A 4O7BA 2KYUA 4TZ8A 4C67A 5DY7A 5HRVA 1WEQA 4GNEA 4Y03A 4AYCB 1N87A 4TU6A 5FE5A 4YBTA 2L5UA 2VJEA 4OGJA 4O7EA 5CQ3A 4XY8A 5HQ5A 2G4AA 5DKCA 5EVAA 5CPEA 5G4RA 2L0BA 4MR5A 2JRJA 5E0RA 4MR6A 4HXMA 5FFYA 5KTWA 2NXBA 5E3DA 5EWWA 5DYXA 3SOXA 5LJ2A 5CRZA 4LZRA 3SVGA 3LRQA 4F3IA 2MNZA 4O71A 5E7DA 4DONA 4LR6A 5D7XA 5FB1A 5A85A 4UYHA 5TCMA 4BW2A 5KH9A 3ZVZB 3ZPV1 3O34A 4I7CA 1MM3A 5F63A 5IGKA 2ECVA 2YHOA 1VD4A 4UYDA 3D7CA 2K17A 5D1MB 4QSXA 5A7CA 5B79A 5CGPA 5D24A 4FIPA 5FE7A 2YEMA 4QBMA 2YELA 4NQNA 4Z1SA 4IOQA 5CP5A 5H1TA 1WE9A 2XB1A 2QICA 3MQMA 4O70A 1WIMA 2F6NA 5CUEA 4UITA 3JVKA 5C87A 2G45A 2JMDA 4X3GA 3RPGC 2RO1A 1WENA 1WEOA 1BORA 4YATA 4IC3A 2KR4A 5I29A 2YSMA 4HXPA 1JM7A 2L85A 5D25A 4A9HA 4CUTA 1Z2QA 4NYWA 3N9OA 4A9MA 1CHCA 3HMFA 4QR4A 4LRGA 2VNFA 5FEYA 5ENEA 5IGMA 3DAIA 4C66A 4L7XA 3AQAA 5FG6A 4QB3A 1DVPA 4CURA 4PKLA 2E3KA 1K2FA 2LGVA 3P1EA 2VPBA 5JWMA 2ECIA 4IC2A 1F62A 5C4QA 4QEUA 3K2JA 4WIVA 5CY9A 2YQLA 3C5KA 2E7NA 3KQIA 5E73A 2RNYA 4YYHA 2KREA 4UYFA 5EPRA 5FH7A 4YH4A 3S91A 2HDPA 4QYDA 2L75A 2VP7A 5I1QA 3VK6A 5DW1A 5D3PA 5EK9A 2LSPB 4IORA 5AD2A 5CQ8A 4KV1A 3L1XA 2OSSA 4KV4A 5LKXA 4MEOA 5E9VA 3FKMX 5FE4A 4WHWA 1IYMA 2VJFB 5CUDA 5L8UA 2DVRA 3AADA 4IR6A 4AP4A 5TBNA 2G6QA 4L58A 5F62A 4LC2A 2G43A 5DYAA 5AD3A 1WESA 2R10A 3MB3A 5D3JA 2KGIA 5ETBA 4MEQA 5ENJA 5L98A 5LJ1A 2MNYA 5J0DA 4QNSA 5B76A 5HQ7A 4WZ0A 2RFJA 1N72A 3N9QA 4J0RA 3O33A 4MSXA 4QEWA 5DX4A 5I89A 3N9PA 5F36A 1FP0A 4CFKA 3PHDA 4TT4A 4X2IA 4QSRA 5CZGA 5HJCA 5ENGA 2JMJA 3HMHA 4R8PK 3DQVR 4AUQB 5D3RA 4CCGX 5CUBA 5L96A 4YH3A 3M63A 4YYGA 2ECGA 4WHUA 4YAXA 4UIWA 5AMEA 4ZW1A 2XEUA 5C8GA 4UIXA 5K29A 3EB6A 4O78A 3SVHA 5CQ5A 5L8TA 2MIQA 2YSJA 4A49A 5AIUA 5C11A 2RSDA 4GB0A 5I88A 4ZQLA 5I83A 5LJ0A 5EI4A 4LZSA 4YYIA 1JOCA 3U5NA 4Q0NA 4XUBA 4GNDA 3DWYA 5G05B 4S3OC 4TU4A 5FE1A 4Z6HA 2H0DA 4TQNA 4PS5A 5DLXA 1WEMA 5FE0A 4UYGA 2R0SA 5IIDA 4TT2A 3SOWA 4UIUA 4CL9A 3ASLA 4IR3A 4NN2A 3EB5A 2E6RA 3HCUA 2LXHC 1WUGA 3L1ZB 2CSZA 2LN0A 4O64A 4YBSA 4CUQA 4TS8A 5CQAA 2D82A 4MR4A 5F2PA 3ZYUA 5J3XA 1G25A 3RPGB 4IR5A 4A9OA 5LKZA 5EPSA 4O7CA 2YDWA 3P1FA 4XUAA 3NG2A 5H9MA 2LDRA 4ZUXU 2RI7A 4YY4A 3RCWA 2QIZA 2YYNA 5AMFA 4TT6A 5C13A 3U5OA 5FFWA 4HXLA 2L5EA 5D1KB 5A81A 4XYAA 5E9MA 3MULA 2YW5A 1FBVA 5I3LA 4CUUA 3UV2A 3LJWA 3G0LA 2EGPA 4QEVA 4HBVA 4BW1A 2L80A 4A0CD 1V87A 3P1CA 4MR3A 4NRCA 5F1HA 5FE6A 2DWWA 3LQJA 4KCXA 4YBMA 4ALGA 5KU3A 4TKPB 5BT3A 2JMIA 3MHHA 3G0JA 4NQMA 4QSVA 5CQ4A 2MUMA 3FL2A 2MJVB 2DVSA 5A5OA 3GL6A 4R7EA 3SOUA 4AYCA 4HXSA 2ZETC 5D3HA 1WGMA 2KFTA 4YYKA 3ZTGA 3P1DA 5FE2A 3UVDA 2NAAA 1X4IA 1EQFA 4YYJA 3U5KA 5KO4A 5CQTA 2KIZA 5B77A 2WP1A 4FLPA 4WA6A 5G0FA 5CRMA 4NUDA 5FDZA 5BT5A 4MEPA 3GV4A 4HBWA 4N3WA 3MXFA 3MB4A 3O35A 4Z93A 5DKDA 5F5ZA 3O37A 2KGGA 1HYJA 3T6RA 3ZVYA 5FE3A 2K1JA 3QZTA 2AN6A 4NR9A 2R0VA 4NYVA 5CUAA 4F52B 4UIVA 3UW9A 4LK9A 5IGLA 5II1A 4NYXA 4CFLA 5EPBA 3JVMA 4AVXA 2GRCA 4O77A 4TZ2A 5EU1A 5COIA 5EWDA 5B8DA 3M99A 5E9IA 4FJCA 4UI9B 1WEPA 4QSQA 5CUCA 1XWHA 2VPDA 3N9LA 3S92A 4A9LA 5I7YA 2YURA 2PNXA 4O75A 2RNXA 4A9FA 2F42A 5EQ1A 3HTKC 2MA5A 5EM3A 5E3GA 5B75A 5F3AA 5F61A 3C6WA 2CKLB 1WEWA 2VPEA 3U5LA 4HXKA 5JG6A 4N4IA 5DYCA 5EV9A 5L97A 4BW3A 1WUMA 1ZS5A 5A5PA 4S3OB 4ZDTA 1WEUA 5I40A 5G4SA 2LV9A 1VYXA 4B7YC 4NRBA 5FFVA 4Q0OA 4A9EA 4NR5A 2KTBB 2LRIC 2KE1A 3NXBA 2K4DA 5FE8A 1RMDA 5A5SA 2Y1NA 2DATA 4Z6IA 3O70A 3N9MA 4CA1A 1HYIA 5FG4A 4QF2A 2MA6A 2BAYA 2LGKA 1Z6UA 2DKWA 5FH8A 4TTEA 3UVWA 4NS5A 1MM2A 2KWJA 2IDAA 1JM7B 2E6SA 4LKAA 2I50A 4ZC9A 1WEEA 4YY6A 5EYAF 2DX8A 5H1UA 2H60A 4O72A 2VJFA 4I7BA 5DFCA 4MENA 5DKAA 5EICA 2M6MA 2I8NA 3O36A 5CFWA 4LYSA 4BW4A 4QF3A 5F25A 3QZVA 5ENIA 3IHPA 3P5OA 4YADA 3Q2FA 1WILA 5D0CA 2RS9B 4XI1A 5KHMA 5E9YA 3UVYA 4NUEA 4YABA 4A9NA 4YYMA 5LUUA 2D8SA 5IGNA 3ZYQA 5B78A 2OUOA 2CT2A 5D1LB 4ALHA 4J1PA 2LGGA 4LYIA 3DPLR 4BHWA 4HBXA 2KWNA
chains in the Genus database with same CATH superfamily
1LDKC 4N4HA 5SVYA 2FUIA 5I86A 5HRXA 3UVXA 4PPEA 2YU4A 5H85A 4NR8A 4LDFA 4CUSA 4E96A 3ONIA 5LVQA 4O7FA 3UV5A 3LXJA 4B86C 5EWHA 5H1VA 1MBMA 4A4CA 2R0YA 3MUKA 5FERA 4FO9A 5ENBA 4GNFA 2XP0A 2Y43A 2RNWA 4QSUA 3T7LA 5SVIB 3MDBC 4QY4A 4YYDA 4UIZA 4WZ3B 4NRAA 4PTBA 2MD7B 5IBNA 2K16A 5FBXA 2YHNA 2YREA 2RR4A 5HEMA 3U5MA 5CUGA 4TYLA 5E74A 2MT5A 2YT5A 2KWOA 4A9IA 3LQHA 4A9JA 5C85A 3I3JA 5ACYA 2KWKA 5LCWB 5KH7A 4PY6A 4AI6A 2ECNA 5FG5A 4HXOA 5HFRA 4V3KC 1T1HA 5HLSA 5D3NA 5KTXA 2VPGA 3I2DA 5D3SA 5DFDA 5D3LA 4UYFB 4YK0A 5E9LA 3SHBA 5TDRA 2CONA 5ETDA 4LZ2A 2FFWA 5II2A 3IU6A 3HMEA 4GPJA 4NR6A 2F6JA 2ECWA 3TLPA 2EA6A 3M62A 2JUNA 4R2YA 5TRBA 2I7KA 5LVRA 5CTLA 5CQ7A 4V3LC 5HELA 1X0JA 3RTRB 2PUYA 1X4UA 2DVQA 2ECJA 4WZ2A 4PCEA 2OXQC 4GNGA 5I80A 4OUFA 3O7AA 3JVLA 5EP7A 2LQ6A 3KV6A 4HXNA 5DKHA 5EWCA 4IOOA 3HCSA 3MHSA 4CUPA 3PUQA 3JVJA 2YUCA 3LQIA 5SVIA 2LGLA 3KNVA 4HXRA 2UZGA 4A4BA 2FUUA 4IR4A 2L43A 4BBQA 4A9KA 4FK5A 4LYWA 4AKNA 5EGUA 3FJUB 4O76A 5C89A 4W4UA 4CLBA 5E9KA 5HM0A 4UP0A 4C9ZA 5G04B 4HBYA 2E7OA 2M13A 2QJ0A 2L84A 4QSTA 2ECTA 4UP5A 5A82A 5D26A 3V43A 5CS8A 5DBMA 5FH6A 4LADB 2YYRA 4QR3A 2M1RA 2E61A 2CSYA 2D9EA 5EA1A 5I7XA 3U5JA 4J0SA 4UYEA 2M85A 1WEVA 4QUUA 5FB0A 1Z60A 2YQDA 2OO1A 5HENA 2M3HA 4QSWA 4QUTA 1JM4B 4LLBA 2MD8C 4QZSA 4NR7A 5A5QA 3E2DA 5C7NA 2C2VS 2XOYA 3UV4A 5IG6A 5TDWA 4MVTA 1F68A 1JSPB 2Y1MA 3IU5A 2C2LA 4LJNA 1E4UA 5DFBA 4QSPA 1X4JA 3N9NA 1U6GB 1E6IA 5HCLA 2H0DB 3L11A 3PURA 4N4GA 5F1LA 5KH3A 5CU8A 3ZPVE 3ZNIA 4NXJA 5KTUA 3SVFA 4QR5A 2WP2A 4PCIA 2VJEB 5HQ6A 4I7DA 5AITA 5LKTA 5TABA 5HFQA 2LXPC 5DLZA 5LKUA 5L99A 2YQMA 5HRWA 2N9GA 3FEHA 4QYLA 3KV5A 2DVVA 1ZBDB 2YEKA 4NUCA 4O7AA 5A83A 4YYNA 3HCTA 4O74A 1VFYA 4J3IA 4QC3A 4UIYA 4N4FA 4YC9A 1LDJB 5ENHA 3U5PA 5DINA 5EWVA 5ENCA 5EISA 4BJXA 3O47A 2CKLA 5DYUA 5CQ6A 5DW2A 2FSAA 4Z1QA 5F60A 4QC1A 5FE9A 4QSSA 4XY9A 4Q6FA 1WFKA 2YW8A 4P5OB 5BT4A 3QZSA 2D8UA 3Q2EA 5ENFA 5A5RA 5JI8A 2EODA 4NR4A 2KU3A 5A5NA 4OGIA 5D3TA 3GG3A 4RVRA 2HYED 3D1BA 5TB6A 4O7BA 2KYUA 4TZ8A 4C67A 5DY7A 5HRVA 1WEQA 4GNEA 4Y03A 4AYCB 1N87A 3H7HA 4TU6A 5FE5A 4YBTA 2L5UA 2VJEA 4OGJA 4O7EA 5CQ3A 4XY8A 5HQ5A 4AKHA 2G4AA 5DKCA 5EVAA 5CPEA 5G4RA 2L0BA 4MR5A 2JRJA 5E0RA 4MR6A 4HXMA 5FFYA 5KTWA 5K3QA 2NXBA 5E3DA 3VKHA 5EWWA 5DYXA 3SOXA 5LJ2A 5CRZA 4LZRA 3SVGA 3LRQA 4F3IA 2MNZA 4O71A 5E7DA 4DONA 4LR6A 5D7XA 5FB1A 5A85A 4UYHA 5TCMA 2DJAA 4BW2A 5KH9A 3ZVZB 3ZPV1 3O34A 4I7CA 1MM3A 5F63A 5IGKA 2ECVA 2YHOA 1VD4A 4UYDA 3D7CA 2K17A 2L7PA 4QSXA 5D1MB 5A7CA 5B79A 5CGPA 5D24A 4FIPA 5FE7A 2YEMA 3LVQE 4QBMA 2YELA 4NQNA 4Z1SA 4IOQA 5CP5A 5H1TA 1WE9A 2XB1A 2QICA 3MQMA 4O70A 1WIMA 2F6NA 5CUEA 4UITA 3JVKA 5C87A 2G45A 2JMDA 3PLWA 4X3GA 3RPGC 2RO1A 1WENA 1WEOA 1BORA 4YATA 4IC3A 2EGMA 2KR4A 5I29A 2YSMA 4HXPA 1JM7A 2L85A 5D25A 4A9HA 4CUTA 1Z2QA 4NYWA 2MKEA 3N9OA 4A9MA 1CHCA 3HMFA 4QR4A 4LRGA 2VNFA 4QQ4A 5FEYA 5ENEA 5IGMA 1PUOA 3DAIA 4C66A 4L7XA 4F1PA 2B0OE 3AQAA 5FG6A 4H9DA 3SUBA 4QB3A 1DVPA 4CURA 4PKLA 2E3KA 3JUEA 1K2FA 2LGVA 3P1EA 2VPBA 5JWMA 2ECIA 4IC2A 2YVRA 1F62A 5C4QA 2XOZA 4QEUA 3K2JA 4WIVA 5CY9A 2YQLA 3C5KA 2E7NA 3KQIA 5E73A 2RNYA 1DCQA 4YYHA 2KREA 4UYFA 3FAOA 5EPRA 5FH7A 4YH4A 3S91A 2HDPA 4QYDA 2L75A 2VP7A 5I1QA 3VK6A 5DW1A 5D3PA 5EK9A 2LSPB 4IORA 5AD2A 5CQ8A 4KV1A 3L1XA 2OSSA 4KV4A 5LKXA 4MEOA 5E9VA 3FKMX 5FE4A 4WHWA 1IYMA 2VJFB 5CUDA 5L8UA 2DVRA 3AADA 4IR6A 4AP4A 5TBNA 2G6QA 4L58A 5F62A 2EXUA 4LC2A 2G43A 5DYAA 5AD3A 1WESA 2R10A 2KKYA 4O62A 3MB3A 5D3JA 2KGIA 5ETBA 4MEQA 5ENJA 5L98A 5LJ1A 2DSMA 5J0DA 4QNSA 2MNYA 5B76A 5HQ7A 4WZ0A 2RFJA 1N72A 3N9QA 4J0RA 3O33A 3M7KA 4MSXA 4QEWA 5DX4A 3VKGA 2OWAA 5I89A 3N9PA 5F36A 1FP0A 4CFKA 3PHDA 4TT4A 4X2IA 4QSRA 5CZGA 5HJCA 5ENGA 2JMJA 3DWDA 3HMHA 4R8PK 3DQVR 4AUQB 5D3RA 3Q1DA 5CUBA 5L96A 4YH3A 3M63A 4CCGX 4YYGA 2ECGA 4WHUA 4YAXA 4OGCA 4UIWA 5AMEA 4ZW1A 2XEUA 5C8GA 4UIXA 5K29A 3EB6A 4O78A 3SVHA 5CQ5A 5L8TA 2MIQA 2YSJA 4A49A 5AIUA 5C11A 2RSDA 4GB0A 5I88A 4ZQLA 5I83A 5LJ0A 5EI4A 4LZSA 4YYIA 1JOCA 3U5NA 4Q0NA 4XUBA 4GNDA 3DWYA 2CRWA 5G05B 4S3OC 4TU4A 5FE1A 4Z6HA 2H0DA 4TQNA 4PS5A 5DLXA 1WEMA 5FE0A 4UYGA 2R0SA 5IIDA 4TT2A 3SOWA 4UIUA 4CL9A 2XOCA 4IR3A 3ASLA 2EJNA 3EB5A 2E6RA 3HCUA 2LXHC 4NN2A 1WUGA 4OGEA 3L1ZB 2CSZA 2LN0A 4O64A 4YBSA 4CUQA 4TS8A 5CQAA 2D82A 4MR4A 5F2PA 3ZYUA 5J3XA 1G25A 3RPGB 4IR5A 4A9OA 5LKZA 5EPSA 4O7CA 2YDWA 3P1FA 4XUAA 3NG2A 5H9MA 2LDRA 4ZUXU 2RI7A 4YY4A 3RCWA 2QIZA 2YYNA 5AMFA 4TT6A 5C13A 3U5OA 5FFWA 4HXLA 2L5EA 5D1KB 3D1DA 5A81A 3T9KA 4XYAA 5E9MA 3MULA 2YW5A 1FBVA 5I3LA 4CUUA 2FD4A 3UV2A 3LJWA 3G0LA 2EGPA 4QEVA 4HBVA 4BW1A 2L80A 2CSVA 4A0CD 1V87A 3P1CA 4MR3A 4NRCA 3LDYA 5F1HA 2IQJA 5FE6A 2DWWA 3LQJA 4KCXA 4YBMA 4ALGA 5KU3A 4TKPB 5BT3A 2JMIA 3MHHA 3G0JA 4NQMA 4QSVA 5CQ4A 2MUMA 3FL2A 2MJVB 2DVSA 5A5OA 3GL6A 4R7EA 3SOUA 4AYCA 4HXSA 2ZETC 1ZKRA 2JM3A 5D3HA 1WGMA 2KFTA 4YYKA 3ZTGA 3P1DA 5FE2A 3UVDA 2NAAA 1X4IA 1EQFA 4YYJA 3U5KA 5KO4A 5CQTA 2KIZA 5B77A 2WP1A 4FLPA 4WA6A 5G0FA 5CRMA 4NUDA 5FDZA 5BT5A 4MEPA 3GV4A 4HBWA 4N3WA 3MXFA 3MB4A 3O35A 4Z93A 5DKDA 3ERRA 3O37A 5F5ZA 2KGGA 1HYJA 3T6RA 3ZVYA 5FE3A 2K1JA 3QZTA 2AN6A 4NR9A 2R0VA 2LAUA 4NYVA 5CUAA 4F52B 4UIVA 3UW9A 4LK9A 5IGLA 5II1A 4NYXA 4CFLA 5EPBA 3JVMA 4AVXA 2GRCA 4O77A 4TZ2A 5EU1A 5COIA 5EWDA 5B8DA 3M99A 5E9IA 4FJCA 4UI9B 2P57A 1WEPA 4QSQA 5CUCA 1XWHA 2VPDA 3N9LA 3S92A 4A9LA 5I7YA 2CRRA 2YURA 2PNXA 4O75A 2RNXA 4A9FA 2F42A 5EQ1A 3HTKC 2MA5A 5EM3A 5E3GA 5B75A 5F3AA 5F61A 3C6WA 2CKLB 1WEWA 2VPEA 3U5LA 4HXKA 5JG6A 4N4IA 5DYCA 5EV9A 5L97A 4BW3A 3FM8C 1WUMA 1ZS5A 5A5PA 4S3OB 4AKGA 4Z0RA 4ZDTA 1WEUA 5I40A 5G4SA 2LV9A 1VYXA 4B7YC 2KKXA 4NRBA 5FFVA 4Q0OA 4A9EA 4NR5A 2KTBB 2LRIC 2KE1A 3NXBA 2K4DA 5SVXA 5FE8A 1RMDA 5A5SA 2Y1NA 2DATA 4Z6IA 3O70A 3N9MA 4CA1A 1HYIA 5FG4A 3LVRE 4QF2A 3KDEC 2MA6A 2BAYA 2LGKA 1Z6UA 2DKWA 5FH8A 4TTEA 3DDTA 3UVWA 4NS5A 1MM2A 2KWJA 2IDAA 1JM7B 2E6SA 4LKAA 2I50A 4ZC9A 1WEEA 4YY6A 5EYAF 2DX8A 5H1UA 2H60A 4O72A 2VJFA 3LJUX 4I7BA 5DFCA 4MENA 5DKAA 5EICA 2M6MA 2I8NA 3O36A 3FANA 5CFWA 4LYSA 4BW4A 4QF3A 5F25A 3QZVA 5ENIA 4AKIA 3IHPA 4Z0OA 3P5OA 4YADA 3Q2FA 1WILA 5D0CA 2RS9B 4XI1A 5KHMA 5E9YA 3UVYA 4NUEA 4YABA 4A9NA 4YYMA 5LUUA 2D8SA 5IGNA 3ZYQA 5B78A 2OUOA 2CT2A 5D1LB 4ALHA 4J1PA 2LGGA 4LYIA 3DPLR 4BHWA 4HBXA 2KWNA
chains in the Genus database with same CATH topology
1LDKC 4N4HA 2FUIA 5I86A 5HRXA 3UVXA 4PPEA 2YU4A 5H85A 4NR8A 4LDFA 4CUSA 4E96A 3ONIA 5LVQA 4O7FA 3UV5A 3LXJA 4B86C 5EWHA 5H1VA 4A4CA 2R0YA 3MUKA 5FERA 4FO9A 5ENBA 4GNFA 2Y43A 2RNWA 4QSUA 3T7LA 4QY4A 4YYDA 4UIZA 4WZ3B 4NRAA 4PTBA 2MD7B 5IBNA 2K16A 5FBXA 2YHNA 2YREA 5HEMA 3U5MA 5CUGA 4TYLA 5E74A 2MT5A 2YT5A 2KWOA 4A9IA 3LQHA 4A9JA 5C85A 3I3JA 5ACYA 2KWKA 5LCWB 5KH7A 4PY6A 2ECNA 5FG5A 4HXOA 5HFRA 4V3KC 1T1HA 5HLSA 5D3NA 5KTXA 2VPGA 3I2DA 5D3SA 5DFDA 5D3LA 4UYFB 4YK0A 5E9LA 3SHBA 5TDRA 5ETDA 4LZ2A 5II2A 3IU6A 3HMEA 4GPJA 4NR6A 2F6JA 2ECWA 3TLPA 2EA6A 3M62A 4R2YA 5TRBA 2I7KA 5LVRA 5CTLA 5CQ7A 4V3LC 5HELA 1X0JA 3RTRB 2PUYA 1X4UA 2DVQA 2ECJA 4WZ2A 4PCEA 2OXQC 4GNGA 5I80A 4OUFA 3O7AA 3JVLA 5EP7A 2LQ6A 3KV6A 4HXNA 5DKHA 5EWCA 4IOOA 3HCSA 3MHSA 4CUPA 3PUQA 3JVJA 2YUCA 3LQIA 2LGLA 3KNVA 4HXRA 2UZGA 4A4BA 2FUUA 4IR4A 2L43A 4BBQA 4A9KA 4FK5A 4LYWA 4AKNA 5EGUA 4O76A 5C89A 4W4UA 4CLBA 5E9KA 5HM0A 4UP0A 4C9ZA 5G04B 4HBYA 2E7OA 2QJ0A 2L84A 4QSTA 2ECTA 4UP5A 5A82A 5D26A 3V43A 5CS8A 5DBMA 5FH6A 4LADB 2YYRA 4QR3A 2M1RA 2CSYA 2D9EA 5EA1A 5I7XA 3U5JA 4J0SA 4UYEA 2M85A 1WEVA 4QUUA 5FB0A 1Z60A 2YQDA 2OO1A 5HENA 2M3HA 4QSWA 4QUTA 1JM4B 4LLBA 2MD8C 4QZSA 4NR7A 5A5QA 5C7NA 2C2VS 3UV4A 5IG6A 5TDWA 4MVTA 1F68A 1JSPB 2Y1MA 3IU5A 2C2LA 4LJNA 1E4UA 5DFBA 4QSPA 1X4JA 3N9NA 1U6GB 1E6IA 5HCLA 2H0DB 3L11A 3PURA 4N4GA 5F1LA 5KH3A 5CU8A 3ZPVE 3ZNIA 4NXJA 5KTUA 3SVFA 4QR5A 2WP2A 4PCIA 2VJEB 5HQ6A 4I7DA 5AITA 5LKTA 5TABA 5HFQA 2LXPC 5DLZA 5LKUA 5L99A 2YQMA 5HRWA 2N9GA 4QYLA 3KV5A 2DVVA 1ZBDB 2YEKA 4NUCA 4O7AA 5A83A 4YYNA 3HCTA 4O74A 1VFYA 4J3IA 4QC3A 4UIYA 4N4FA 4YC9A 1LDJB 5ENHA 3U5PA 5DINA 5EWVA 5ENCA 5EISA 4BJXA 2CKLA 5DYUA 5CQ6A 5DW2A 2FSAA 4Z1QA 5F60A 4QC1A 5FE9A 4QSSA 4XY9A 4Q6FA 1WFKA 2YW8A 4P5OB 5BT4A 3QZSA 3Q2EA 5ENFA 5A5RA 5JI8A 2EODA 4NR4A 2KU3A 5A5NA 4OGIA 5D3TA 3GG3A 4RVRA 2HYED 5TB6A 4O7BA 2KYUA 4TZ8A 4C67A 5DY7A 5HRVA 1WEQA 4GNEA 4Y03A 4AYCB 1N87A 4TU6A 5FE5A 4YBTA 2L5UA 2VJEA 4OGJA 4O7EA 5CQ3A 4XY8A 5HQ5A 2G4AA 5DKCA 5EVAA 5CPEA 5G4RA 2L0BA 4MR5A 2JRJA 5E0RA 4MR6A 4HXMA 5FFYA 5KTWA 2NXBA 5E3DA 5EWWA 5DYXA 3SOXA 5LJ2A 5CRZA 4LZRA 3SVGA 3LRQA 4F3IA 2MNZA 4O71A 5E7DA 4DONA 4LR6A 5D7XA 5FB1A 5A85A 4UYHA 5TCMA 4BW2A 5KH9A 3ZVZB 3ZPV1 3O34A 4I7CA 1MM3A 5F63A 5IGKA 2ECVA 2YHOA 1VD4A 4UYDA 3D7CA 2K17A 5D1MB 4QSXA 5A7CA 5B79A 5CGPA 5D24A 4FIPA 5FE7A 2YEMA 4QBMA 2YELA 4NQNA 4Z1SA 4IOQA 5CP5A 5H1TA 1WE9A 2XB1A 2QICA 3MQMA 4O70A 1WIMA 2F6NA 5CUEA 4UITA 3JVKA 5C87A 2G45A 2JMDA 4X3GA 3RPGC 2RO1A 1WENA 1WEOA 1BORA 4YATA 4IC3A 2KR4A 5I29A 2YSMA 4HXPA 1JM7A 2L85A 5D25A 4A9HA 4CUTA 1Z2QA 4NYWA 3N9OA 4A9MA 1CHCA 3HMFA 4QR4A 4LRGA 2VNFA 5FEYA 5ENEA 5IGMA 3DAIA 4C66A 4L7XA 3AQAA 5FG6A 4QB3A 1DVPA 4CURA 4PKLA 2E3KA 1K2FA 2LGVA 3P1EA 2VPBA 5JWMA 2ECIA 4IC2A 1F62A 5C4QA 4QEUA 3K2JA 4WIVA 5CY9A 2YQLA 3C5KA 2E7NA 3KQIA 5E73A 2RNYA 4YYHA 2KREA 4UYFA 5EPRA 5FH7A 4YH4A 3S91A 2HDPA 4QYDA 2L75A 2VP7A 5I1QA 3VK6A 5DW1A 5D3PA 5EK9A 2LSPB 4IORA 5AD2A 5CQ8A 4KV1A 3L1XA 2OSSA 4KV4A 5LKXA 4MEOA 5E9VA 3FKMX 5FE4A 4WHWA 1IYMA 2VJFB 5CUDA 5L8UA 2DVRA 3AADA 4IR6A 4AP4A 5TBNA 2G6QA 4L58A 5F62A 4LC2A 2G43A 5DYAA 5AD3A 1WESA 2R10A 3MB3A 5D3JA 2KGIA 5ETBA 4MEQA 5ENJA 5L98A 5LJ1A 2MNYA 5J0DA 4QNSA 5B76A 5HQ7A 4WZ0A 2RFJA 1N72A 3N9QA 4J0RA 3O33A 4MSXA 4QEWA 5DX4A 5I89A 3N9PA 5F36A 1FP0A 4CFKA 3PHDA 4TT4A 4X2IA 4QSRA 5CZGA 5HJCA 5ENGA 2JMJA 3HMHA 4R8PK 3DQVR 4AUQB 5D3RA 4CCGX 5CUBA 5L96A 4YH3A 3M63A 4YYGA 2ECGA 4WHUA 4YAXA 4UIWA 5AMEA 4ZW1A 2XEUA 5C8GA 4UIXA 5K29A 3EB6A 4O78A 3SVHA 5CQ5A 5L8TA 2MIQA 2YSJA 4A49A 5AIUA 5C11A 2RSDA 4GB0A 5I88A 4ZQLA 5I83A 5LJ0A 5EI4A 4LZSA 4YYIA 1JOCA 3U5NA 4Q0NA 4XUBA 4GNDA 3DWYA 5G05B 4S3OC 4TU4A 5FE1A 4Z6HA 2H0DA 4TQNA 4PS5A 5DLXA 1WEMA 5FE0A 4UYGA 2R0SA 5IIDA 4TT2A 3SOWA 4UIUA 4CL9A 3ASLA 4IR3A 4NN2A 3EB5A 2E6RA 3HCUA 2LXHC 1WUGA 3L1ZB 2CSZA 2LN0A 4O64A 4YBSA 4CUQA 4TS8A 5CQAA 2D82A 4MR4A 5F2PA 3ZYUA 5J3XA 1G25A 3RPGB 4IR5A 4A9OA 5LKZA 5EPSA 4O7CA 2YDWA 3P1FA 4XUAA 3NG2A 5H9MA 2LDRA 4ZUXU 2RI7A 4YY4A 3RCWA 2QIZA 2YYNA 5AMFA 4TT6A 5C13A 3U5OA 5FFWA 4HXLA 2L5EA 5D1KB 5A81A 4XYAA 5E9MA 3MULA 2YW5A 1FBVA 5I3LA 4CUUA 3UV2A 3LJWA 3G0LA 2EGPA 4QEVA 4HBVA 4BW1A 2L80A 4A0CD 1V87A 3P1CA 4MR3A 4NRCA 5F1HA 5FE6A 2DWWA 3LQJA 4KCXA 4YBMA 4ALGA 5KU3A 4TKPB 5BT3A 2JMIA 3MHHA 3G0JA 4NQMA 4QSVA 5CQ4A 2MUMA 3FL2A 2MJVB 2DVSA 5A5OA 3GL6A 4R7EA 3SOUA 4AYCA 4HXSA 2ZETC 5D3HA 1WGMA 2KFTA 4YYKA 3ZTGA 3P1DA 5FE2A 3UVDA 2NAAA 1X4IA 1EQFA 4YYJA 3U5KA 5KO4A 5CQTA 2KIZA 5B77A 2WP1A 4FLPA 4WA6A 5G0FA 5CRMA 4NUDA 5FDZA 5BT5A 4MEPA 3GV4A 4HBWA 4N3WA 3MXFA 3MB4A 3O35A 4Z93A 5DKDA 5F5ZA 3O37A 2KGGA 1HYJA 3T6RA 3ZVYA 5FE3A 2K1JA 3QZTA 2AN6A 4NR9A 2R0VA 4NYVA 5CUAA 4F52B 4UIVA 3UW9A 4LK9A 5IGLA 5II1A 4NYXA 4CFLA 5EPBA 3JVMA 4AVXA 2GRCA 4O77A 4TZ2A 5EU1A 5COIA 5EWDA 5B8DA 3M99A 5E9IA 4FJCA 4UI9B 1WEPA 4QSQA 5CUCA 1XWHA 2VPDA 3N9LA 3S92A 4A9LA 5I7YA 2YURA 2PNXA 4O75A 2RNXA 4A9FA 2F42A 5EQ1A 3HTKC 2MA5A 5EM3A 5E3GA 5B75A 5F3AA 5F61A 3C6WA 2CKLB 1WEWA 2VPEA 3U5LA 4HXKA 5JG6A 4N4IA 5DYCA 5EV9A 5L97A 4BW3A 1WUMA 1ZS5A 5A5PA 4S3OB 4ZDTA 1WEUA 5I40A 5G4SA 2LV9A 1VYXA 4B7YC 4NRBA 5FFVA 4Q0OA 4A9EA 4NR5A 2KTBB 2LRIC 2KE1A 3NXBA 2K4DA 5FE8A 1RMDA 5A5SA 2Y1NA 2DATA 4Z6IA 3O70A 3N9MA 4CA1A 1HYIA 5FG4A 4QF2A 2MA6A 2BAYA 2LGKA 1Z6UA 2DKWA 5FH8A 4TTEA 3UVWA 4NS5A 1MM2A 2KWJA 2IDAA 1JM7B 2E6SA 4LKAA 2I50A 4ZC9A 1WEEA 4YY6A 5EYAF 2DX8A 5H1UA 2H60A 4O72A 2VJFA 4I7BA 5DFCA 4MENA 5DKAA 5EICA 2M6MA 2I8NA 3O36A 5CFWA 4LYSA 4BW4A 4QF3A 5F25A 3QZVA 5ENIA 3IHPA 3P5OA 4YADA 3Q2FA 1WILA 5D0CA 2RS9B 4XI1A 5KHMA 5E9YA 3UVYA 4NUEA 4YABA 4A9NA 4YYMA 5LUUA 2D8SA 5IGNA 3ZYQA 5B78A 2OUOA 2CT2A 5D1LB 4ALHA 4J1PA 2LGGA 4LYIA 3DPLR 4BHWA 4HBXA 2KWNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LDK C;  4N4H A;  2FUI A;  5I86 A;  5HRX A;  3UVX A;  4PPE A;  2YU4 A;  5H85 A;  4NR8 A;  4LDF A;  4CUS A;  4E96 A;  3ONI A;  5LVQ A;  4O7F A;  3UV5 A;  3LXJ A;  4B86 C;  5EWH A;  5H1V A;  4A4C A;  2R0Y A;  3MUK A;  5FER A;  4FO9 A;  5ENB A;  4GNF A;  2Y43 A;  2RNW A;  4QSU A;  3T7L A;  4QY4 A;  4YYD A;  4UIZ A;  4WZ3 B;  4NRA A;  4PTB A;  2MD7 B;  5IBN A;  2K16 A;  5FBX A;  2YHN A;  2YRE A;  5HEM A;  3U5M A;  5CUG A;  4TYL A;  5E74 A;  2MT5 A;  2YT5 A;  2KWO A;  4A9I A;  3LQH A;  4A9J A;  5C85 A;  3I3J A;  5ACY A;  2KWK A;  5LCW B;  5KH7 A;  4PY6 A;  2ECN A;  5FG5 A;  4HXO A;  5HFR A;  4V3K C;  1T1H A;  5HLS A;  5D3N A;  5KTX A;  2VPG A;  3I2D A;  5D3S A;  5DFD A;  5D3L A;  4UYF B;  4YK0 A;  5E9L A;  3SHB A;  5TDR A;  5ETD A;  4LZ2 A;  5II2 A;  3IU6 A;  3HME A;  4GPJ A;  4NR6 A;  2F6J A;  2ECW A;  3TLP A;  2EA6 A;  3M62 A;  4R2Y A;  5TRB A;  2I7K A;  5LVR A;  5CTL A;  5CQ7 A;  4V3L C;  5HEL A;  1X0J A;  3RTR B;  2PUY A;  1X4U A;  2DVQ A;  2ECJ A;  4WZ2 A;  4PCE A;  2OXQ C;  4GNG A;  5I80 A;  4OUF A;  3O7A A;  3JVL A;  5EP7 A;  2LQ6 A;  3KV6 A;  4HXN A;  5DKH A;  5EWC A;  4IOO A;  3HCS A;  3MHS A;  4CUP A;  3PUQ A;  3JVJ A;  2YUC A;  3LQI A;  2LGL A;  3KNV A;  4HXR A;  2UZG A;  4A4B A;  2FUU A;  4IR4 A;  2L43 A;  4BBQ A;  4A9K A;  4FK5 A;  4LYW A;  4AKN A;  5EGU A;  4O76 A;  5C89 A;  4W4U A;  4CLB A;  5E9K A;  5HM0 A;  4UP0 A;  4C9Z A;  5G04 B;  4HBY A;  2E7O A;  2QJ0 A;  2L84 A;  4QST A;  2ECT A;  4UP5 A;  5A82 A;  5D26 A;  3V43 A;  5CS8 A;  5DBM A;  5FH6 A;  4LAD B;  2YYR A;  4QR3 A;  2M1R A;  2CSY A;  2D9E A;  5EA1 A;  5I7X A;  3U5J A;  4J0S A;  4UYE A;  2M85 A;  1WEV A;  4QUU A;  5FB0 A;  1Z60 A;  2YQD A;  2OO1 A;  5HEN A;  2M3H A;  4QSW A;  4QUT A;  1JM4 B;  4LLB A;  2MD8 C;  4QZS A;  4NR7 A;  5A5Q A;  5C7N A;  2C2V S;  3UV4 A;  5IG6 A;  5TDW A;  4MVT A;  1F68 A;  1JSP B;  2Y1M A;  3IU5 A;  2C2L A;  4LJN A;  1E4U A;  5DFB A;  4QSP A;  1X4J A;  3N9N A;  1U6G B;  1E6I A;  5HCL A;  2H0D B;  3L11 A;  3PUR A;  4N4G A;  5F1L A;  5KH3 A;  5CU8 A;  3ZPV E;  3ZNI A;  4NXJ A;  5KTU A;  3SVF A;  4QR5 A;  2WP2 A;  4PCI A;  2VJE B;  5HQ6 A;  4I7D A;  5AIT A;  5LKT A;  5TAB A;  5HFQ A;  2LXP C;  5DLZ A;  5LKU A;  5L99 A;  2YQM A;  5HRW A;  2N9G A;  4QYL A;  3KV5 A;  2DVV A;  1ZBD B;  2YEK A;  4NUC A;  4O7A A;  5A83 A;  4YYN A;  3HCT A;  4O74 A;  1VFY A;  4J3I A;  4QC3 A;  4UIY A;  4N4F A;  4YC9 A;  1LDJ B;  5ENH A;  3U5P A;  5DIN A;  5EWV A;  5ENC A;  5EIS A;  4BJX A;  2CKL A;  5DYU A;  5CQ6 A;  5DW2 A;  2FSA A;  4Z1Q A;  5F60 A;  4QC1 A;  5FE9 A;  4QSS A;  4XY9 A;  4Q6F A;  1WFK A;  2YW8 A;  4P5O B;  5BT4 A;  3QZS A;  3Q2E A;  5ENF A;  5A5R A;  5JI8 A;  2EOD A;  4NR4 A;  2KU3 A;  5A5N A;  4OGI A;  5D3T A;  3GG3 A;  4RVR A;  2HYE D;  5TB6 A;  4O7B A;  2KYU A;  4TZ8 A;  4C67 A;  5DY7 A;  5HRV A;  1WEQ A;  4GNE A;  4Y03 A;  4AYC B;  1N87 A;  4TU6 A;  5FE5 A;  4YBT A;  2L5U A;  2VJE A;  4OGJ A;  4O7E A;  5CQ3 A;  4XY8 A;  5HQ5 A;  2G4A A;  5DKC A;  5EVA A;  5CPE A;  5G4R A;  2L0B A;  4MR5 A;  2JRJ A;  5E0R A;  4MR6 A;  4HXM A;  5FFY A;  5KTW A;  2NXB A;  5E3D A;  5EWW A;  5DYX A;  3SOX A;  5LJ2 A;  5CRZ A;  4LZR A;  3SVG A;  3LRQ A;  4F3I A;  2MNZ A;  4O71 A;  5E7D A;  4DON A;  4LR6 A;  5D7X A;  5FB1 A;  5A85 A;  4UYH A;  5TCM A;  4BW2 A;  5KH9 A;  3ZVZ B;  3ZPV 1;  3O34 A;  4I7C A;  1MM3 A;  5F63 A;  5IGK A;  2ECV A;  2YHO A;  1VD4 A;  4UYD A;  3D7C A;  2K17 A;  5D1M B;  4QSX A;  5A7C A;  5B79 A;  5CGP A;  5D24 A;  4FIP A;  5FE7 A;  2YEM A;  4QBM A;  2YEL A;  4NQN A;  4Z1S A;  4IOQ A;  5CP5 A;  5H1T A;  1WE9 A;  2XB1 A;  2QIC A;  3MQM A;  4O70 A;  1WIM A;  2F6N A;  5CUE A;  4UIT A;  3JVK A;  5C87 A;  2G45 A;  2JMD A;  4X3G A;  3RPG C;  2RO1 A;  1WEN A;  1WEO A;  1BOR A;  4YAT A;  4IC3 A;  2KR4 A;  5I29 A;  2YSM A;  4HXP A;  1JM7 A;  2L85 A;  5D25 A;  4A9H A;  4CUT A;  1Z2Q A;  4NYW A;  3N9O A;  4A9M A;  1CHC A;  3HMF A;  4QR4 A;  4LRG A;  2VNF A;  5FEY A;  5ENE A;  5IGM A;  3DAI A;  4C66 A;  4L7X A;  3AQA A;  5FG6 A;  4QB3 A;  1DVP A;  4CUR A;  4PKL A;  2E3K A;  1K2F A;  2LGV A;  3P1E A;  2VPB A;  5JWM A;  2ECI A;  4IC2 A;  1F62 A;  5C4Q A;  4QEU A;  3K2J A;  4WIV A;  5CY9 A;  2YQL A;  3C5K A;  2E7N A;  3KQI A;  5E73 A;  2RNY A;  4YYH A;  2KRE A;  4UYF A;  5EPR A;  5FH7 A;  4YH4 A;  3S91 A;  2HDP A;  4QYD A;  2L75 A;  2VP7 A;  5I1Q A;  3VK6 A;  5DW1 A;  5D3P A;  5EK9 A;  2LSP B;  4IOR A;  5AD2 A;  5CQ8 A;  4KV1 A;  3L1X A;  2OSS A;  4KV4 A;  5LKX A;  4MEO A;  5E9V A;  3FKM X;  5FE4 A;  4WHW A;  1IYM A;  2VJF B;  5CUD A;  5L8U A;  2DVR A;  3AAD A;  4IR6 A;  4AP4 A;  5TBN A;  2G6Q A;  4L58 A;  5F62 A;  4LC2 A;  2G43 A;  5DYA A;  5AD3 A;  1WES A;  2R10 A;  3MB3 A;  5D3J A;  2KGI A;  5ETB A;  4MEQ A;  5ENJ A;  5L98 A;  5LJ1 A;  2MNY A;  5J0D A;  4QNS A;  5B76 A;  5HQ7 A;  4WZ0 A;  2RFJ A;  1N72 A;  3N9Q A;  4J0R A;  3O33 A;  4MSX A;  4QEW A;  5DX4 A;  5I89 A;  3N9P A;  5F36 A;  1FP0 A;  4CFK A;  3PHD A;  4TT4 A;  4X2I A;  4QSR A;  5CZG A;  5HJC A;  5ENG A;  2JMJ A;  3HMH A;  4R8P K;  3DQV R;  4AUQ B;  5D3R A;  4CCG X;  5CUB A;  5L96 A;  4YH3 A;  3M63 A;  4YYG A;  2ECG A;  4WHU A;  4YAX A;  4UIW A;  5AME A;  4ZW1 A;  2XEU A;  5C8G A;  4UIX A;  5K29 A;  3EB6 A;  4O78 A;  3SVH A;  5CQ5 A;  5L8T A;  2MIQ A;  2YSJ A;  4A49 A;  5AIU A;  5C11 A;  2RSD A;  4GB0 A;  5I88 A;  4ZQL A;  5I83 A;  5LJ0 A;  5EI4 A;  4LZS A;  4YYI A;  1JOC A;  3U5N A;  4Q0N A;  4XUB A;  4GND A;  3DWY A;  5G05 B;  4S3O C;  4TU4 A;  5FE1 A;  4Z6H A;  2H0D A;  4TQN A;  4PS5 A;  5DLX A;  1WEM A;  5FE0 A;  4UYG A;  2R0S A;  5IID A;  4TT2 A;  3SOW A;  4UIU A;  4CL9 A;  3ASL A;  4IR3 A;  4NN2 A;  3EB5 A;  2E6R A;  3HCU A;  2LXH C;  1WUG A;  3L1Z B;  2CSZ A;  2LN0 A;  4O64 A;  4YBS A;  4CUQ A;  4TS8 A;  5CQA A;  2D82 A;  4MR4 A;  5F2P A;  3ZYU A;  5J3X A;  1G25 A;  3RPG B;  4IR5 A;  4A9O A;  5LKZ A;  5EPS A;  4O7C A;  2YDW A;  3P1F A;  4XUA A;  3NG2 A;  5H9M A;  2LDR A;  4ZUX U;  2RI7 A;  4YY4 A;  3RCW A;  2QIZ A;  2YYN A;  5AMF A;  4TT6 A;  5C13 A;  3U5O A;  5FFW A;  4HXL A;  2L5E A;  5D1K B;  5A81 A;  4XYA A;  5E9M A;  3MUL A;  2YW5 A;  1FBV A;  5I3L A;  4CUU A;  3UV2 A;  3LJW A;  3G0L A;  2EGP A;  4QEV A;  4HBV A;  4BW1 A;  2L80 A;  4A0C D;  1V87 A;  3P1C A;  4MR3 A;  4NRC A;  5F1H A;  5FE6 A;  2DWW A;  3LQJ A;  4KCX A;  4YBM A;  4ALG A;  5KU3 A;  4TKP B;  5BT3 A;  2JMI A;  3MHH A;  3G0J A;  4NQM A;  4QSV A;  5CQ4 A;  2MUM A;  3FL2 A;  2MJV B;  2DVS A;  5A5O A;  3GL6 A;  4R7E A;  3SOU A;  4AYC A;  4HXS A;  2ZET C;  5D3H A;  1WGM A;  2KFT A;  4YYK A;  3ZTG A;  3P1D A;  5FE2 A;  3UVD A;  2NAA A;  1X4I A;  1EQF A;  4YYJ A;  3U5K A;  5KO4 A;  5CQT A;  2KIZ A;  5B77 A;  2WP1 A;  4FLP A;  4WA6 A;  5G0F A;  5CRM A;  4NUD A;  5FDZ A;  5BT5 A;  4MEP A;  3GV4 A;  4HBW A;  4N3W A;  3MXF A;  3MB4 A;  3O35 A;  4Z93 A;  5DKD A;  5F5Z A;  3O37 A;  2KGG A;  1HYJ A;  3T6R A;  3ZVY A;  5FE3 A;  2K1J A;  3QZT A;  2AN6 A;  4NR9 A;  2R0V A;  4NYV A;  5CUA A;  4F52 B;  4UIV A;  3UW9 A;  4LK9 A;  5IGL A;  5II1 A;  4NYX A;  4CFL A;  5EPB A;  3JVM A;  4AVX A;  2GRC A;  4O77 A;  4TZ2 A;  5EU1 A;  5COI A;  5EWD A;  5B8D A;  3M99 A;  5E9I A;  4FJC A;  4UI9 B;  1WEP A;  4QSQ A;  5CUC A;  1XWH A;  2VPD A;  3N9L A;  3S92 A;  4A9L A;  5I7Y A;  2YUR A;  2PNX A;  4O75 A;  2RNX A;  4A9F A;  2F42 A;  5EQ1 A;  3HTK C;  2MA5 A;  5EM3 A;  5E3G A;  5B75 A;  5F3A A;  5F61 A;  3C6W A;  2CKL B;  1WEW A;  2VPE A;  3U5L A;  4HXK A;  5JG6 A;  4N4I A;  5DYC A;  5EV9 A;  5L97 A;  4BW3 A;  1WUM A;  1ZS5 A;  5A5P A;  4S3O B;  4ZDT A;  1WEU A;  5I40 A;  5G4S A;  2LV9 A;  1VYX A;  4B7Y C;  4NRB A;  5FFV A;  4Q0O A;  4A9E A;  4NR5 A;  2KTB B;  2LRI C;  2KE1 A;  3NXB A;  2K4D A;  5FE8 A;  1RMD A;  5A5S A;  2Y1N A;  2DAT A;  4Z6I A;  3O70 A;  3N9M A;  4CA1 A;  1HYI A;  5FG4 A;  4QF2 A;  2MA6 A;  2BAY A;  2LGK A;  1Z6U A;  2DKW A;  5FH8 A;  4TTE A;  3UVW A;  4NS5 A;  1MM2 A;  2KWJ A;  2IDA A;  1JM7 B;  2E6S A;  4LKA A;  2I50 A;  4ZC9 A;  1WEE A;  4YY6 A;  5EYA F;  2DX8 A;  5H1U A;  2H60 A;  4O72 A;  2VJF A;  4I7B A;  5DFC A;  4MEN A;  5DKA A;  5EIC A;  2M6M A;  2I8N A;  3O36 A;  5CFW A;  4LYS A;  4BW4 A;  4QF3 A;  5F25 A;  3QZV A;  5ENI A;  3IHP A;  3P5O A;  4YAD A;  3Q2F A;  1WIL A;  5D0C A;  2RS9 B;  4XI1 A;  5KHM A;  5E9Y A;  3UVY A;  4NUE A;  4YAB A;  4A9N A;  4YYM A;  5LUU A;  2D8S A;  5IGN A;  3ZYQ A;  5B78 A;  2OUO A;  2CT2 A;  5D1L B;  4ALH A;  4J1P A;  2LGG A;  4LYI A;  3DPL R;  4BHW A;  4HBX A;  2KWN A; 
#chains in the Genus database with same CATH topology
 1LDK C;  4N4H A;  5SVY A;  2FUI A;  5I86 A;  5HRX A;  3UVX A;  4PPE A;  2YU4 A;  5H85 A;  4NR8 A;  4LDF A;  4CUS A;  4E96 A;  3ONI A;  5LVQ A;  4O7F A;  3UV5 A;  3LXJ A;  4B86 C;  5EWH A;  5H1V A;  1MBM A;  4A4C A;  2R0Y A;  3MUK A;  5FER A;  4FO9 A;  5ENB A;  4GNF A;  2XP0 A;  2Y43 A;  2RNW A;  4QSU A;  3T7L A;  5SVI B;  3MDB C;  4QY4 A;  4YYD A;  4UIZ A;  4WZ3 B;  4NRA A;  4PTB A;  2MD7 B;  5IBN A;  2K16 A;  5FBX A;  2YHN A;  2YRE A;  2RR4 A;  5HEM A;  3U5M A;  5CUG A;  4TYL A;  5E74 A;  2MT5 A;  2YT5 A;  2KWO A;  4A9I A;  3LQH A;  4A9J A;  5C85 A;  3I3J A;  5ACY A;  2KWK A;  5LCW B;  5KH7 A;  4PY6 A;  4AI6 A;  2ECN A;  5FG5 A;  4HXO A;  5HFR A;  4V3K C;  1T1H A;  5HLS A;  5D3N A;  5KTX A;  2VPG A;  3I2D A;  5D3S A;  5DFD A;  5D3L A;  4UYF B;  4YK0 A;  5E9L A;  3SHB A;  5TDR A;  2CON A;  5ETD A;  4LZ2 A;  2FFW A;  5II2 A;  3IU6 A;  3HME A;  4GPJ A;  4NR6 A;  2F6J A;  2ECW A;  3TLP A;  2EA6 A;  3M62 A;  2JUN A;  4R2Y A;  5TRB A;  2I7K A;  5LVR A;  5CTL A;  5CQ7 A;  4V3L C;  5HEL A;  1X0J A;  3RTR B;  2PUY A;  1X4U A;  2DVQ A;  2ECJ A;  4WZ2 A;  4PCE A;  2OXQ C;  4GNG A;  5I80 A;  4OUF A;  3O7A A;  3JVL A;  5EP7 A;  2LQ6 A;  3KV6 A;  4HXN A;  5DKH A;  5EWC A;  4IOO A;  3HCS A;  3MHS A;  4CUP A;  3PUQ A;  3JVJ A;  2YUC A;  3LQI A;  5SVI A;  2LGL A;  3KNV A;  4HXR A;  2UZG A;  4A4B A;  2FUU A;  4IR4 A;  2L43 A;  4BBQ A;  4A9K A;  4FK5 A;  4LYW A;  4AKN A;  5EGU A;  3FJU B;  4O76 A;  5C89 A;  4W4U A;  4CLB A;  5E9K A;  5HM0 A;  4UP0 A;  4C9Z A;  5G04 B;  4HBY A;  2E7O A;  2M13 A;  2QJ0 A;  2L84 A;  4QST A;  2ECT A;  4UP5 A;  5A82 A;  5D26 A;  3V43 A;  5CS8 A;  5DBM A;  5FH6 A;  4LAD B;  2YYR A;  4QR3 A;  2M1R A;  2E61 A;  2CSY A;  2D9E A;  5EA1 A;  5I7X A;  3U5J A;  4J0S A;  4UYE A;  2M85 A;  1WEV A;  4QUU A;  5FB0 A;  1Z60 A;  2YQD A;  2OO1 A;  5HEN A;  2M3H A;  4QSW A;  4QUT A;  1JM4 B;  4LLB A;  2MD8 C;  4QZS A;  4NR7 A;  5A5Q A;  3E2D A;  5C7N A;  2C2V S;  2XOY A;  3UV4 A;  5IG6 A;  5TDW A;  4MVT A;  1F68 A;  1JSP B;  2Y1M A;  3IU5 A;  2C2L A;  4LJN A;  1E4U A;  5DFB A;  4QSP A;  1X4J A;  3N9N A;  1U6G B;  1E6I A;  5HCL A;  2H0D B;  3L11 A;  3PUR A;  4N4G A;  5F1L A;  5KH3 A;  5CU8 A;  3ZPV E;  3ZNI A;  4NXJ A;  5KTU A;  3SVF A;  4QR5 A;  2WP2 A;  4PCI A;  2VJE B;  5HQ6 A;  4I7D A;  5AIT A;  5LKT A;  5TAB A;  5HFQ A;  2LXP C;  5DLZ A;  5LKU A;  5L99 A;  2YQM A;  5HRW A;  2N9G A;  3FEH A;  4QYL A;  3KV5 A;  2DVV A;  1ZBD B;  2YEK A;  4NUC A;  4O7A A;  5A83 A;  4YYN A;  3HCT A;  4O74 A;  1VFY A;  4J3I A;  4QC3 A;  4UIY A;  4N4F A;  4YC9 A;  1LDJ B;  5ENH A;  3U5P A;  5DIN A;  5EWV A;  5ENC A;  5EIS A;  4BJX A;  3O47 A;  2CKL A;  5DYU A;  5CQ6 A;  5DW2 A;  2FSA A;  4Z1Q A;  5F60 A;  4QC1 A;  5FE9 A;  4QSS A;  4XY9 A;  4Q6F A;  1WFK A;  2YW8 A;  4P5O B;  5BT4 A;  3QZS A;  2D8U A;  3Q2E A;  5ENF A;  5A5R A;  5JI8 A;  2EOD A;  4NR4 A;  2KU3 A;  5A5N A;  4OGI A;  5D3T A;  3GG3 A;  4RVR A;  2HYE D;  3D1B A;  5TB6 A;  4O7B A;  2KYU A;  4TZ8 A;  4C67 A;  5DY7 A;  5HRV A;  1WEQ A;  4GNE A;  4Y03 A;  4AYC B;  1N87 A;  3H7H A;  4TU6 A;  5FE5 A;  4YBT A;  2L5U A;  2VJE A;  4OGJ A;  4O7E A;  5CQ3 A;  4XY8 A;  5HQ5 A;  4AKH A;  2G4A A;  5DKC A;  5EVA A;  5CPE A;  5G4R A;  2L0B A;  4MR5 A;  2JRJ A;  5E0R A;  4MR6 A;  4HXM A;  5FFY A;  5KTW A;  5K3Q A;  2NXB A;  5E3D A;  3VKH A;  5EWW A;  5DYX A;  3SOX A;  5LJ2 A;  5CRZ A;  4LZR A;  3SVG A;  3LRQ A;  4F3I A;  2MNZ A;  4O71 A;  5E7D A;  4DON A;  4LR6 A;  5D7X A;  5FB1 A;  5A85 A;  4UYH A;  5TCM A;  2DJA A;  4BW2 A;  5KH9 A;  3ZVZ B;  3ZPV 1;  3O34 A;  4I7C A;  1MM3 A;  5F63 A;  5IGK A;  2ECV A;  2YHO A;  1VD4 A;  4UYD A;  3D7C A;  2K17 A;  2L7P A;  4QSX A;  5D1M B;  5A7C A;  5B79 A;  5CGP A;  5D24 A;  4FIP A;  5FE7 A;  2YEM A;  3LVQ E;  4QBM A;  2YEL A;  4NQN A;  4Z1S A;  4IOQ A;  5CP5 A;  5H1T A;  1WE9 A;  2XB1 A;  2QIC A;  3MQM A;  4O70 A;  1WIM A;  2F6N A;  5CUE A;  4UIT A;  3JVK A;  5C87 A;  2G45 A;  2JMD A;  3PLW A;  4X3G A;  3RPG C;  2RO1 A;  1WEN A;  1WEO A;  1BOR A;  4YAT A;  4IC3 A;  2EGM A;  2KR4 A;  5I29 A;  2YSM A;  4HXP A;  1JM7 A;  2L85 A;  5D25 A;  4A9H A;  4CUT A;  1Z2Q A;  4NYW A;  2MKE A;  3N9O A;  4A9M A;  1CHC A;  3HMF A;  4QR4 A;  4LRG A;  2VNF A;  4QQ4 A;  5FEY A;  5ENE A;  5IGM A;  1PUO A;  3DAI A;  4C66 A;  4L7X A;  4F1P A;  2B0O E;  3AQA A;  5FG6 A;  4H9D A;  3SUB A;  4QB3 A;  1DVP A;  4CUR A;  4PKL A;  2E3K A;  3JUE A;  1K2F A;  2LGV A;  3P1E A;  2VPB A;  5JWM A;  2ECI A;  4IC2 A;  2YVR A;  1F62 A;  5C4Q A;  2XOZ A;  4QEU A;  3K2J A;  4WIV A;  5CY9 A;  2YQL A;  3C5K A;  2E7N A;  3KQI A;  5E73 A;  2RNY A;  1DCQ A;  4YYH A;  2KRE A;  4UYF A;  3FAO A;  5EPR A;  5FH7 A;  4YH4 A;  3S91 A;  2HDP A;  4QYD A;  2L75 A;  2VP7 A;  5I1Q A;  3VK6 A;  5DW1 A;  5D3P A;  5EK9 A;  2LSP B;  4IOR A;  5AD2 A;  5CQ8 A;  4KV1 A;  3L1X A;  2OSS A;  4KV4 A;  5LKX A;  4MEO A;  5E9V A;  3FKM X;  5FE4 A;  4WHW A;  1IYM A;  2VJF B;  5CUD A;  5L8U A;  2DVR A;  3AAD A;  4IR6 A;  4AP4 A;  5TBN A;  2G6Q A;  4L58 A;  5F62 A;  2EXU A;  4LC2 A;  2G43 A;  5DYA A;  5AD3 A;  1WES A;  2R10 A;  2KKY A;  4O62 A;  3MB3 A;  5D3J A;  2KGI A;  5ETB A;  4MEQ A;  5ENJ A;  5L98 A;  5LJ1 A;  2DSM A;  5J0D A;  4QNS A;  2MNY A;  5B76 A;  5HQ7 A;  4WZ0 A;  2RFJ A;  1N72 A;  3N9Q A;  4J0R A;  3O33 A;  3M7K A;  4MSX A;  4QEW A;  5DX4 A;  3VKG A;  2OWA A;  5I89 A;  3N9P A;  5F36 A;  1FP0 A;  4CFK A;  3PHD A;  4TT4 A;  4X2I A;  4QSR A;  5CZG A;  5HJC A;  5ENG A;  2JMJ A;  3DWD A;  3HMH A;  4R8P K;  3DQV R;  4AUQ B;  5D3R A;  3Q1D A;  5CUB A;  5L96 A;  4YH3 A;  3M63 A;  4CCG X;  4YYG A;  2ECG A;  4WHU A;  4YAX A;  4OGC A;  4UIW A;  5AME A;  4ZW1 A;  2XEU A;  5C8G A;  4UIX A;  5K29 A;  3EB6 A;  4O78 A;  3SVH A;  5CQ5 A;  5L8T A;  2MIQ A;  2YSJ A;  4A49 A;  5AIU A;  5C11 A;  2RSD A;  4GB0 A;  5I88 A;  4ZQL A;  5I83 A;  5LJ0 A;  5EI4 A;  4LZS A;  4YYI A;  1JOC A;  3U5N A;  4Q0N A;  4XUB A;  4GND A;  3DWY A;  2CRW A;  5G05 B;  4S3O C;  4TU4 A;  5FE1 A;  4Z6H A;  2H0D A;  4TQN A;  4PS5 A;  5DLX A;  1WEM A;  5FE0 A;  4UYG A;  2R0S A;  5IID A;  4TT2 A;  3SOW A;  4UIU A;  4CL9 A;  2XOC A;  4IR3 A;  3ASL A;  2EJN A;  3EB5 A;  2E6R A;  3HCU A;  2LXH C;  4NN2 A;  1WUG A;  4OGE A;  3L1Z B;  2CSZ A;  2LN0 A;  4O64 A;  4YBS A;  4CUQ A;  4TS8 A;  5CQA A;  2D82 A;  4MR4 A;  5F2P A;  3ZYU A;  5J3X A;  1G25 A;  3RPG B;  4IR5 A;  4A9O A;  5LKZ A;  5EPS A;  4O7C A;  2YDW A;  3P1F A;  4XUA A;  3NG2 A;  5H9M A;  2LDR A;  4ZUX U;  2RI7 A;  4YY4 A;  3RCW A;  2QIZ A;  2YYN A;  5AMF A;  4TT6 A;  5C13 A;  3U5O A;  5FFW A;  4HXL A;  2L5E A;  5D1K B;  3D1D A;  5A81 A;  3T9K A;  4XYA A;  5E9M A;  3MUL A;  2YW5 A;  1FBV A;  5I3L A;  4CUU A;  2FD4 A;  3UV2 A;  3LJW A;  3G0L A;  2EGP A;  4QEV A;  4HBV A;  4BW1 A;  2L80 A;  2CSV A;  4A0C D;  1V87 A;  3P1C A;  4MR3 A;  4NRC A;  3LDY A;  5F1H A;  2IQJ A;  5FE6 A;  2DWW A;  3LQJ A;  4KCX A;  4YBM A;  4ALG A;  5KU3 A;  4TKP B;  5BT3 A;  2JMI A;  3MHH A;  3G0J A;  4NQM A;  4QSV A;  5CQ4 A;  2MUM A;  3FL2 A;  2MJV B;  2DVS A;  5A5O A;  3GL6 A;  4R7E A;  3SOU A;  4AYC A;  4HXS A;  2ZET C;  1ZKR A;  2JM3 A;  5D3H A;  1WGM A;  2KFT A;  4YYK A;  3ZTG A;  3P1D A;  5FE2 A;  3UVD A;  2NAA A;  1X4I A;  1EQF A;  4YYJ A;  3U5K A;  5KO4 A;  5CQT A;  2KIZ A;  5B77 A;  2WP1 A;  4FLP A;  4WA6 A;  5G0F A;  5CRM A;  4NUD A;  5FDZ A;  5BT5 A;  4MEP A;  3GV4 A;  4HBW A;  4N3W A;  3MXF A;  3MB4 A;  3O35 A;  4Z93 A;  5DKD A;  3ERR A;  3O37 A;  5F5Z A;  2KGG A;  1HYJ A;  3T6R A;  3ZVY A;  5FE3 A;  2K1J A;  3QZT A;  2AN6 A;  4NR9 A;  2R0V A;  2LAU A;  4NYV A;  5CUA A;  4F52 B;  4UIV A;  3UW9 A;  4LK9 A;  5IGL A;  5II1 A;  4NYX A;  4CFL A;  5EPB A;  3JVM A;  4AVX A;  2GRC A;  4O77 A;  4TZ2 A;  5EU1 A;  5COI A;  5EWD A;  5B8D A;  3M99 A;  5E9I A;  4FJC A;  4UI9 B;  2P57 A;  1WEP A;  4QSQ A;  5CUC A;  1XWH A;  2VPD A;  3N9L A;  3S92 A;  4A9L A;  5I7Y A;  2CRR A;  2YUR A;  2PNX A;  4O75 A;  2RNX A;  4A9F A;  2F42 A;  5EQ1 A;  3HTK C;  2MA5 A;  5EM3 A;  5E3G A;  5B75 A;  5F3A A;  5F61 A;  3C6W A;  2CKL B;  1WEW A;  2VPE A;  3U5L A;  4HXK A;  5JG6 A;  4N4I A;  5DYC A;  5EV9 A;  5L97 A;  4BW3 A;  3FM8 C;  1WUM A;  1ZS5 A;  5A5P A;  4S3O B;  4AKG A;  4Z0R A;  4ZDT A;  1WEU A;  5I40 A;  5G4S A;  2LV9 A;  1VYX A;  4B7Y C;  2KKX A;  4NRB A;  5FFV A;  4Q0O A;  4A9E A;  4NR5 A;  2KTB B;  2LRI C;  2KE1 A;  3NXB A;  2K4D A;  5SVX A;  5FE8 A;  1RMD A;  5A5S A;  2Y1N A;  2DAT A;  4Z6I A;  3O70 A;  3N9M A;  4CA1 A;  1HYI A;  5FG4 A;  3LVR E;  4QF2 A;  3KDE C;  2MA6 A;  2BAY A;  2LGK A;  1Z6U A;  2DKW A;  5FH8 A;  4TTE A;  3DDT A;  3UVW A;  4NS5 A;  1MM2 A;  2KWJ A;  2IDA A;  1JM7 B;  2E6S A;  4LKA A;  2I50 A;  4ZC9 A;  1WEE A;  4YY6 A;  5EYA F;  2DX8 A;  5H1U A;  2H60 A;  4O72 A;  2VJF A;  3LJU X;  4I7B A;  5DFC A;  4MEN A;  5DKA A;  5EIC A;  2M6M A;  2I8N A;  3O36 A;  3FAN A;  5CFW A;  4LYS A;  4BW4 A;  4QF3 A;  5F25 A;  3QZV A;  5ENI A;  4AKI A;  3IHP A;  4Z0O A;  3P5O A;  4YAD A;  3Q2F A;  1WIL A;  5D0C A;  2RS9 B;  4XI1 A;  5KHM A;  5E9Y A;  3UVY A;  4NUE A;  4YAB A;  4A9N A;  4YYM A;  5LUU A;  2D8S A;  5IGN A;  3ZYQ A;  5B78 A;  2OUO A;  2CT2 A;  5D1L B;  4ALH A;  4J1P A;  2LGG A;  4LYI A;  3DPL R;  4BHW A;  4HBX A;  2KWN A; 
#chains in the Genus database with same CATH homology
 1LDK C;  4N4H A;  2FUI A;  5I86 A;  5HRX A;  3UVX A;  4PPE A;  2YU4 A;  5H85 A;  4NR8 A;  4LDF A;  4CUS A;  4E96 A;  3ONI A;  5LVQ A;  4O7F A;  3UV5 A;  3LXJ A;  4B86 C;  5EWH A;  5H1V A;  4A4C A;  2R0Y A;  3MUK A;  5FER A;  4FO9 A;  5ENB A;  4GNF A;  2Y43 A;  2RNW A;  4QSU A;  3T7L A;  4QY4 A;  4YYD A;  4UIZ A;  4WZ3 B;  4NRA A;  4PTB A;  2MD7 B;  5IBN A;  2K16 A;  5FBX A;  2YHN A;  2YRE A;  5HEM A;  3U5M A;  5CUG A;  4TYL A;  5E74 A;  2MT5 A;  2YT5 A;  2KWO A;  4A9I A;  3LQH A;  4A9J A;  5C85 A;  3I3J A;  5ACY A;  2KWK A;  5LCW B;  5KH7 A;  4PY6 A;  2ECN A;  5FG5 A;  4HXO A;  5HFR A;  4V3K C;  1T1H A;  5HLS A;  5D3N A;  5KTX A;  2VPG A;  3I2D A;  5D3S A;  5DFD A;  5D3L A;  4UYF B;  4YK0 A;  5E9L A;  3SHB A;  5TDR A;  5ETD A;  4LZ2 A;  5II2 A;  3IU6 A;  3HME A;  4GPJ A;  4NR6 A;  2F6J A;  2ECW A;  3TLP A;  2EA6 A;  3M62 A;  4R2Y A;  5TRB A;  2I7K A;  5LVR A;  5CTL A;  5CQ7 A;  4V3L C;  5HEL A;  1X0J A;  3RTR B;  2PUY A;  1X4U A;  2DVQ A;  2ECJ A;  4WZ2 A;  4PCE A;  2OXQ C;  4GNG A;  5I80 A;  4OUF A;  3O7A A;  3JVL A;  5EP7 A;  2LQ6 A;  3KV6 A;  4HXN A;  5DKH A;  5EWC A;  4IOO A;  3HCS A;  3MHS A;  4CUP A;  3PUQ A;  3JVJ A;  2YUC A;  3LQI A;  2LGL A;  3KNV A;  4HXR A;  2UZG A;  4A4B A;  2FUU A;  4IR4 A;  2L43 A;  4BBQ A;  4A9K A;  4FK5 A;  4LYW A;  4AKN A;  5EGU A;  4O76 A;  5C89 A;  4W4U A;  4CLB A;  5E9K A;  5HM0 A;  4UP0 A;  4C9Z A;  5G04 B;  4HBY A;  2E7O A;  2QJ0 A;  2L84 A;  4QST A;  2ECT A;  4UP5 A;  5A82 A;  5D26 A;  3V43 A;  5CS8 A;  5DBM A;  5FH6 A;  4LAD B;  2YYR A;  4QR3 A;  2M1R A;  2CSY A;  2D9E A;  5EA1 A;  5I7X A;  3U5J A;  4J0S A;  4UYE A;  2M85 A;  1WEV A;  4QUU A;  5FB0 A;  1Z60 A;  2YQD A;  2OO1 A;  5HEN A;  2M3H A;  4QSW A;  4QUT A;  1JM4 B;  4LLB A;  2MD8 C;  4QZS A;  4NR7 A;  5A5Q A;  5C7N A;  2C2V S;  3UV4 A;  5IG6 A;  5TDW A;  4MVT A;  1F68 A;  1JSP B;  2Y1M A;  3IU5 A;  2C2L A;  4LJN A;  1E4U A;  5DFB A;  4QSP A;  1X4J A;  3N9N A;  1U6G B;  1E6I A;  5HCL A;  2H0D B;  3L11 A;  3PUR A;  4N4G A;  5F1L A;  5KH3 A;  5CU8 A;  3ZPV E;  3ZNI A;  4NXJ A;  5KTU A;  3SVF A;  4QR5 A;  2WP2 A;  4PCI A;  2VJE B;  5HQ6 A;  4I7D A;  5AIT A;  5LKT A;  5TAB A;  5HFQ A;  2LXP C;  5DLZ A;  5LKU A;  5L99 A;  2YQM A;  5HRW A;  2N9G A;  4QYL A;  3KV5 A;  2DVV A;  1ZBD B;  2YEK A;  4NUC A;  4O7A A;  5A83 A;  4YYN A;  3HCT A;  4O74 A;  1VFY A;  4J3I A;  4QC3 A;  4UIY A;  4N4F A;  4YC9 A;  1LDJ B;  5ENH A;  3U5P A;  5DIN A;  5EWV A;  5ENC A;  5EIS A;  4BJX A;  2CKL A;  5DYU A;  5CQ6 A;  5DW2 A;  2FSA A;  4Z1Q A;  5F60 A;  4QC1 A;  5FE9 A;  4QSS A;  4XY9 A;  4Q6F A;  1WFK A;  2YW8 A;  4P5O B;  5BT4 A;  3QZS A;  3Q2E A;  5ENF A;  5A5R A;  5JI8 A;  2EOD A;  4NR4 A;  2KU3 A;  5A5N A;  4OGI A;  5D3T A;  3GG3 A;  4RVR A;  2HYE D;  5TB6 A;  4O7B A;  2KYU A;  4TZ8 A;  4C67 A;  5DY7 A;  5HRV A;  1WEQ A;  4GNE A;  4Y03 A;  4AYC B;  1N87 A;  4TU6 A;  5FE5 A;  4YBT A;  2L5U A;  2VJE A;  4OGJ A;  4O7E A;  5CQ3 A;  4XY8 A;  5HQ5 A;  2G4A A;  5DKC A;  5EVA A;  5CPE A;  5G4R A;  2L0B A;  4MR5 A;  2JRJ A;  5E0R A;  4MR6 A;  4HXM A;  5FFY A;  5KTW A;  2NXB A;  5E3D A;  5EWW A;  5DYX A;  3SOX A;  5LJ2 A;  5CRZ A;  4LZR A;  3SVG A;  3LRQ A;  4F3I A;  2MNZ A;  4O71 A;  5E7D A;  4DON A;  4LR6 A;  5D7X A;  5FB1 A;  5A85 A;  4UYH A;  5TCM A;  4BW2 A;  5KH9 A;  3ZVZ B;  3ZPV 1;  3O34 A;  4I7C A;  1MM3 A;  5F63 A;  5IGK A;  2ECV A;  2YHO A;  1VD4 A;  4UYD A;  3D7C A;  2K17 A;  5D1M B;  4QSX A;  5A7C A;  5B79 A;  5CGP A;  5D24 A;  4FIP A;  5FE7 A;  2YEM A;  4QBM A;  2YEL A;  4NQN A;  4Z1S A;  4IOQ A;  5CP5 A;  5H1T A;  1WE9 A;  2XB1 A;  2QIC A;  3MQM A;  4O70 A;  1WIM A;  2F6N A;  5CUE A;  4UIT A;  3JVK A;  5C87 A;  2G45 A;  2JMD A;  4X3G A;  3RPG C;  2RO1 A;  1WEN A;  1WEO A;  1BOR A;  4YAT A;  4IC3 A;  2KR4 A;  5I29 A;  2YSM A;  4HXP A;  1JM7 A;  2L85 A;  5D25 A;  4A9H A;  4CUT A;  1Z2Q A;  4NYW A;  3N9O A;  4A9M A;  1CHC A;  3HMF A;  4QR4 A;  4LRG A;  2VNF A;  5FEY A;  5ENE A;  5IGM A;  3DAI A;  4C66 A;  4L7X A;  3AQA A;  5FG6 A;  4QB3 A;  1DVP A;  4CUR A;  4PKL A;  2E3K A;  1K2F A;  2LGV A;  3P1E A;  2VPB A;  5JWM A;  2ECI A;  4IC2 A;  1F62 A;  5C4Q A;  4QEU A;  3K2J A;  4WIV A;  5CY9 A;  2YQL A;  3C5K A;  2E7N A;  3KQI A;  5E73 A;  2RNY A;  4YYH A;  2KRE A;  4UYF A;  5EPR A;  5FH7 A;  4YH4 A;  3S91 A;  2HDP A;  4QYD A;  2L75 A;  2VP7 A;  5I1Q A;  3VK6 A;  5DW1 A;  5D3P A;  5EK9 A;  2LSP B;  4IOR A;  5AD2 A;  5CQ8 A;  4KV1 A;  3L1X A;  2OSS A;  4KV4 A;  5LKX A;  4MEO A;  5E9V A;  3FKM X;  5FE4 A;  4WHW A;  1IYM A;  2VJF B;  5CUD A;  5L8U A;  2DVR A;  3AAD A;  4IR6 A;  4AP4 A;  5TBN A;  2G6Q A;  4L58 A;  5F62 A;  4LC2 A;  2G43 A;  5DYA A;  5AD3 A;  1WES A;  2R10 A;  3MB3 A;  5D3J A;  2KGI A;  5ETB A;  4MEQ A;  5ENJ A;  5L98 A;  5LJ1 A;  2MNY A;  5J0D A;  4QNS A;  5B76 A;  5HQ7 A;  4WZ0 A;  2RFJ A;  1N72 A;  3N9Q A;  4J0R A;  3O33 A;  4MSX A;  4QEW A;  5DX4 A;  5I89 A;  3N9P A;  5F36 A;  1FP0 A;  4CFK A;  3PHD A;  4TT4 A;  4X2I A;  4QSR A;  5CZG A;  5HJC A;  5ENG A;  2JMJ A;  3HMH A;  4R8P K;  3DQV R;  4AUQ B;  5D3R A;  4CCG X;  5CUB A;  5L96 A;  4YH3 A;  3M63 A;  4YYG A;  2ECG A;  4WHU A;  4YAX A;  4UIW A;  5AME A;  4ZW1 A;  2XEU A;  5C8G A;  4UIX A;  5K29 A;  3EB6 A;  4O78 A;  3SVH A;  5CQ5 A;  5L8T A;  2MIQ A;  2YSJ A;  4A49 A;  5AIU A;  5C11 A;  2RSD A;  4GB0 A;  5I88 A;  4ZQL A;  5I83 A;  5LJ0 A;  5EI4 A;  4LZS A;  4YYI A;  1JOC A;  3U5N A;  4Q0N A;  4XUB A;  4GND A;  3DWY A;  5G05 B;  4S3O C;  4TU4 A;  5FE1 A;  4Z6H A;  2H0D A;  4TQN A;  4PS5 A;  5DLX A;  1WEM A;  5FE0 A;  4UYG A;  2R0S A;  5IID A;  4TT2 A;  3SOW A;  4UIU A;  4CL9 A;  3ASL A;  4IR3 A;  4NN2 A;  3EB5 A;  2E6R A;  3HCU A;  2LXH C;  1WUG A;  3L1Z B;  2CSZ A;  2LN0 A;  4O64 A;  4YBS A;  4CUQ A;  4TS8 A;  5CQA A;  2D82 A;  4MR4 A;  5F2P A;  3ZYU A;  5J3X A;  1G25 A;  3RPG B;  4IR5 A;  4A9O A;  5LKZ A;  5EPS A;  4O7C A;  2YDW A;  3P1F A;  4XUA A;  3NG2 A;  5H9M A;  2LDR A;  4ZUX U;  2RI7 A;  4YY4 A;  3RCW A;  2QIZ A;  2YYN A;  5AMF A;  4TT6 A;  5C13 A;  3U5O A;  5FFW A;  4HXL A;  2L5E A;  5D1K B;  5A81 A;  4XYA A;  5E9M A;  3MUL A;  2YW5 A;  1FBV A;  5I3L A;  4CUU A;  3UV2 A;  3LJW A;  3G0L A;  2EGP A;  4QEV A;  4HBV A;  4BW1 A;  2L80 A;  4A0C D;  1V87 A;  3P1C A;  4MR3 A;  4NRC A;  5F1H A;  5FE6 A;  2DWW A;  3LQJ A;  4KCX A;  4YBM A;  4ALG A;  5KU3 A;  4TKP B;  5BT3 A;  2JMI A;  3MHH A;  3G0J A;  4NQM A;  4QSV A;  5CQ4 A;  2MUM A;  3FL2 A;  2MJV B;  2DVS A;  5A5O A;  3GL6 A;  4R7E A;  3SOU A;  4AYC A;  4HXS A;  2ZET C;  5D3H A;  1WGM A;  2KFT A;  4YYK A;  3ZTG A;  3P1D A;  5FE2 A;  3UVD A;  2NAA A;  1X4I A;  1EQF A;  4YYJ A;  3U5K A;  5KO4 A;  5CQT A;  2KIZ A;  5B77 A;  2WP1 A;  4FLP A;  4WA6 A;  5G0F A;  5CRM A;  4NUD A;  5FDZ A;  5BT5 A;  4MEP A;  3GV4 A;  4HBW A;  4N3W A;  3MXF A;  3MB4 A;  3O35 A;  4Z93 A;  5DKD A;  5F5Z A;  3O37 A;  2KGG A;  1HYJ A;  3T6R A;  3ZVY A;  5FE3 A;  2K1J A;  3QZT A;  2AN6 A;  4NR9 A;  2R0V A;  4NYV A;  5CUA A;  4F52 B;  4UIV A;  3UW9 A;  4LK9 A;  5IGL A;  5II1 A;  4NYX A;  4CFL A;  5EPB A;  3JVM A;  4AVX A;  2GRC A;  4O77 A;  4TZ2 A;  5EU1 A;  5COI A;  5EWD A;  5B8D A;  3M99 A;  5E9I A;  4FJC A;  4UI9 B;  1WEP A;  4QSQ A;  5CUC A;  1XWH A;  2VPD A;  3N9L A;  3S92 A;  4A9L A;  5I7Y A;  2YUR A;  2PNX A;  4O75 A;  2RNX A;  4A9F A;  2F42 A;  5EQ1 A;  3HTK C;  2MA5 A;  5EM3 A;  5E3G A;  5B75 A;  5F3A A;  5F61 A;  3C6W A;  2CKL B;  1WEW A;  2VPE A;  3U5L A;  4HXK A;  5JG6 A;  4N4I A;  5DYC A;  5EV9 A;  5L97 A;  4BW3 A;  1WUM A;  1ZS5 A;  5A5P A;  4S3O B;  4ZDT A;  1WEU A;  5I40 A;  5G4S A;  2LV9 A;  1VYX A;  4B7Y C;  4NRB A;  5FFV A;  4Q0O A;  4A9E A;  4NR5 A;  2KTB B;  2LRI C;  2KE1 A;  3NXB A;  2K4D A;  5FE8 A;  1RMD A;  5A5S A;  2Y1N A;  2DAT A;  4Z6I A;  3O70 A;  3N9M A;  4CA1 A;  1HYI A;  5FG4 A;  4QF2 A;  2MA6 A;  2BAY A;  2LGK A;  1Z6U A;  2DKW A;  5FH8 A;  4TTE A;  3UVW A;  4NS5 A;  1MM2 A;  2KWJ A;  2IDA A;  1JM7 B;  2E6S A;  4LKA A;  2I50 A;  4ZC9 A;  1WEE A;  4YY6 A;  5EYA F;  2DX8 A;  5H1U A;  2H60 A;  4O72 A;  2VJF A;  4I7B A;  5DFC A;  4MEN A;  5DKA A;  5EIC A;  2M6M A;  2I8N A;  3O36 A;  5CFW A;  4LYS A;  4BW4 A;  4QF3 A;  5F25 A;  3QZV A;  5ENI A;  3IHP A;  3P5O A;  4YAD A;  3Q2F A;  1WIL A;  5D0C A;  2RS9 B;  4XI1 A;  5KHM A;  5E9Y A;  3UVY A;  4NUE A;  4YAB A;  4A9N A;  4YYM A;  5LUU A;  2D8S A;  5IGN A;  3ZYQ A;  5B78 A;  2OUO A;  2CT2 A;  5D1L B;  4ALH A;  4J1P A;  2LGG A;  4LYI A;  3DPL R;  4BHW A;  4HBX A;  2KWN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...