5H1TA

Complex structure of trim24 phd-bromodomain and inhibitor 1
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
182
structure length
172
Chain Sequence
NEDWCAVCQNGGELLCCEKCPKVFHLSCHVPTLTNFPSGEWICTFCRDLSKPEVEYDKKTEGLVKLTPIDKRKCERLLLFLYCHEMSLAFQDPVPLTVPDYYKIIKNPMDLSTIKKRLQEDYSMYSKPEDFVADFRLIFQNCAEFNEPDSEVANAGIKLENYFEELLKNLYP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The polar warhead of a TRIM24 bromodomain inhibitor rearranges a water-mediated interaction network
pubmed doi rcsb
molecule keywords Transcription intermediary factor 1-alpha
molecule tags Transcription/transcription inhibitor
source organism Homo sapiens
total genus 50
structure length 172
sequence length 182
chains with identical sequence B, C, D
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2016-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5h1tA02
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 5h1tA01
5HM0A 5A5SA 2VJFA 4MR5A 4HBWA 4GNFA 5CUDA 5F5ZA 5II1A 5L8TA 4MEOA 5DKDA 5I89A 3P5OA 3UVDA 4ZC9A 2LGGA 5KH3A 5I88A 5I7XA 5CUGA 5G4SA 2ECIA 2LXPC 3U5NA 4A9NA 3JVKA 2ECNA 5DBMA 3HTKC 5B79A 4WHWA 5H1VA 5EYAF 2M3HA 3QZSA 5A5RA 3FL2A 4HXMA 3SOUA 4UYEA 5CUEA 3JVLA 4F3IA 2LGLA 5FE1A 5AMEA 5E9KA 3KV5A 4QBMA 4QSRA 2E6RA 3P1FA 1WEVA 4CFLA 5F60A 4V3LC 4A4BA 5B75A 3MQMA 5G04B 4L7XA 2NXBA 4YADA 2E7NA 4O71A 4NRCA 2MUMA 5CQAA 5JI8A 5FE6A 3HCTA 2KWKA 5CP5A 2LGVA 4A9KA 4OGJA 4UI9B 1X0JA 1V87A 4P5OB 5L8UA 5TB6A 5E9IA 5FDZA 4PKLA 4UIXA 4A9FA 5AMFA 4UIUA 5CUAA 4R8PK 5B76A 3M63A 4OUFA 3UV2A 2KYUA 3IU6A 4A9HA 4AP4A 4CUQA 3MUKA 2MD7B 2ZETC 4I7DA 4IR5A 4BBQA 5FE4A 2D8SA 4GB0A 5C13A 4YBTA 2DVSA 5DYCA 5EK9A 5IGNA 4TYLA 4NR6A 4C67A 4AVXA 2EGPA 4NR5A 4QSWA 2KFTA 2VPBA 2Y1NA 1JM7B 5K29A 5F62A 2R0YA 3SOXA 2L84A 2YSMA 1LDKC 4NUDA 4NS5A 3G0LA 4QEVA 4NYWA 4NRBA 5DKAA 4YC9A 4FIPA 3T7LA 5EGUA 4QF3A 5F3AA 5LCWB 5DYUA 5L96A 1JM4B 5D1MB 4A9OA 4O75A 5E3DA 5A7CA 4YAXA 2AN6A 4Y03A 5D3SA 2YW8A 1X4IA 2CT2A 5ETBA 4MVTA 2KR4A 3HMEA 4X3GA 3SVGA 3N9OA 5KTWA 4I7CA 4R2YA 4WIVA 4O72A 2BAYA 5F2PA 4N4IA 4HBVA 2IDAA 5E9MA 3UVXA 4YYKA 3MULA 2H0DB 2L5UA 4YABA 5D3RA 4NR9A 4MENA 5LKTA 1JM7A 4LADB 5AITA 4LZSA 4A4CA 5IG6A 2DWWA 2XEUA 4NXJA 3RPGC 3O36A 4LYWA 4NYXA 2RFJA 5E74A 5HQ5A 3L11A 2M85A 4O64A 4NRAA 2KGIA 4X2IA 5C11A 2DVQA 2OO1A 4MEQA 4Z6HA 3N9QA 1CHCA 5FE0A 2MA5A 3GL6A 1N72A 5HQ7A 2CKLA 3V43A 5EPBA 4AYCB 5CS8A 4QB3A 4QEWA 5DW2A 1WEQA 5FEYA 3PHDA 2YEKA 2QICA 4UIYA 5ETDA 3N9MA 2VJFB 5F63A 5I80A 5FFVA 2G6QA 4FJCA 5EV9A 1N87A 2YYRA 5KTXA 3EB5A 5LKXA 4GNGA 2MNYA 4IR3A 2MIQA 5D3PA 3EB6A 5D26A 5IGKA 2VJEB 4TU4A 5LUUA 4B7YC 2JMDA 3P1DA 4J0SA 1WIMA 2C2VS 4HXSA 2LQ6A 5EWDA 5J0DA 5TDRA 5KTUA 1WENA 4MR3A 4QYLA 3NXBA 4MR6A 5C7NA 4AYCA 2H60A 5LVQA 5DFDA 1F68A 5CUBA 1WUGA 4XUAA 4C9ZA 5FB0A 2EODA 4N4GA 1WEPA 4QC3A 3ZYQA 5JG6A 2VJEA 2YYNA 2DATA 3KNVA 1WEMA 2I7KA 4BHWA 5LJ1A 2MNZA 4CUTA 2MT5A 4UP5A 1E6IA 2MJVB 5E3GA 5FH7A 3UV4A 2CSYA 4TZ8A 5KH7A 5CGPA 4NR8A 4Q0OA 2YSJA 5CTLA 2YHOA 2VP7A 4O77A 2YUCA 2L85A 1FP0A 5D1LB 4O7FA 4TT4A 4YYNA 5I86A 5D24A 2VPGA 2KIZA 3U5OA 1WFKA 4A0CD 2D82A 4QSVA 4BW1A 3LRQA 2K1JA 4L58A 4PPEA 4J0RA 4GPJA 2LSPB 3HCSA 5F1LA 2M1RA 5I1QA 4XY8A 5IBNA 4FO9A 4CURA 5A82A 1K2FA 4QR3A 5I7YA 1X4JA 3DAIA 4HXRA 5E73A 5FG6A 4NN2A 2ECTA 4WZ2A 4NR4A 4IORA 5EQ1A 5KH9A 3LQHA 5L98A 2KE1A 4QC1A 3QZTA 4YH4A 4YYMA 4BW3A 5D3LA 4QF2A 2G4AA 2N9GA 3IU5A 4NYVA 4TTEA 5EA1A 5ENFA 1Z2QA 2UZGA 5CU8A 3M99A 5EM3A 4QNSA 3RPGB 4UYFB 2ECWA 1FBVA 2ECGA 4N4HA 4MR4A 5G05B 5D3JA 3RTRB 3LQJA 3PURA 4XI1A 5HRXA 5D3TA 5TBNA 4ZUXU 1WESA 1X4UA 4ZDTA 1U6GB 4F52B 5L97A 3GG3A 1WUMA 5A5OA 5TABA 5FERA 5EWCA 5D0CA 3SVFA 2PUYA 2K16A 5EP7A 3UVYA 2CKLB 1LDJB 1G25A 5HENA 3MB3A 5F61A 5A81A 4NUEA 3FKMX 4QR4A 5EWVA 5DINA 4QZSA 4UYGA 5CRMA 4HBXA 5HRVA 5C89A 5EISA 5H1UA 1RMDA 4E96A 4UYDA 4YBSA 4IC2A 2KTBB 5EPRA 4UYFA 2EA6A 3QZVA 2ECJA 2L0BA 5DLZA 2M6MA 3ZVZB 4BW4A 3O37A 2YELA 5D3NA 5TDWA 5EVAA 4IOOA 2LDRA 4O78A 2Y1MA 4LJNA 2R0VA 4O7EA 2G43A 4Z93A 5CQ5A 4WHUA 4UIVA 4RVRA 2DVRA 4LZ2A 1BORA 5FFYA 5CUCA 2YQDA 1WEEA 4DONA 5E7DA 3SOWA 3MHSA 2OUOA 5L99A 2C2LA 2HYED 3DQVR 3I3JA 4HXNA 5CQ7A 2D9EA 5AIUA 3UW9A 4J3IA 5DLXA 4A9LA 4AUQB 1E4UA 3MXFA 5FE3A 5FE8A 4QSTA 4AKNA 4YY4A 2YU4A 4TU6A 1WILA 4ZQLA 4HXPA 4QUTA 2G45A 4Z1QA 5LJ2A 1MM3A 3HMFA 4QEUA 4YYJA 4S3OC 4WA6A 4LZRA 2E6SA 4BJXA 4QSPA 5AD3A 5KU3A 4NQMA 5ENBA 5B78A 4PTBA 4CA1A 5FG5A 4HXOA 5CY9A 5ENHA 5FH6A 5A5NA 5I40A 2L43A 2LGKA 4V3KC 2F42A 4LR6A 2I50A 2FUUA 2KWNA 5BT5A 3I2DA 2JMIA 4Q6FA 4IC3A 2OXQC 5C87A 4O7AA 5FBXA 2E7OA 2YT5A 5DFCA 2NAAA 3JVJA 5HELA 5FE9A 4R7EA 1IYMA 4TZ2A 5I29A 3ONIA 2KU3A 2YREA 3C5KA 2RS9B 1JSPB 5HCLA 4UYHA 1VD4A 4TT6A 4CL9A 5CQ3A 4IR6A 4PS5A 2YW5A 2YQLA 3O7AA 3SVHA 4TS8A 5J3XA 2GRCA 4NR7A 4FK5A 3ZPV1 5TCMA 4LYSA 5C85A 5HFRA 2VNFA 5EICA 3AADA 5EWWA 5II2A 5HRWA 4CCGX 3MB4A 4UIWA 4HXKA 3S92A 5H1TA 2MA6A 4ALHA 4WZ3B 4UITA 2KREA 4NUCA 4UIZA 4BW2A 5FFWA 4IOQA 2Y43A 4O76A 3C6WA 3LXJA 4QR5A 2VPDA 3GV4A 2DKWA 2ECVA 3N9NA 3O70A 1VYXA 5G4RA 2KWOA 5EU1A 4YYGA 4LLBA 2VPEA 5AD2A 2LN0A 1MM2A 4W4UA 1WEOA 4YATA 5I3LA 5E9VA 4A9EA 2LV9A 4C66A 4Z1SA 2R0SA 5C8GA 2CSZA 4ZW1A 5B77A 2PNXA 4HXLA 4O7CA 3ASLA 4Z6IA 3SHBA 4FLPA 2QIZA 2DVVA 3O34A 3S91A 2LRIC 5EI4A 3N9PA 4A9JA 5FE5A 5ENGA 4A49A 5FG4A 3G0JA 3UV5A 4IR4A 4LYIA 4YYDA 3ZPVE 5DYAA 5DX4A 5ENIA 5CZGA 4YK0A 5CRZA 3RCWA 4A9IA 3HCUA 3AQAA 4MSXA 3DWYA 3Q2EA 5F1HA 4XYAA 3LJWA 4HBYA 4CUSA 2YQMA 5EPSA 5LKUA 2YEMA 3D7CA 2HDPA 4N3WA 4GNDA 1WEUA 5I83A 5E0RA 4A9MA 2RO1A 2WP2A 5HEMA 3PUQA 4GNEA 3T6RA 4YY6A 2K4DA 4S3OB 5DFBA 4CUPA 5HLSA 5B8DA 5G0FA 2K17A 2E3KA 2WP1A 2KWJA 4CFKA 5H85A 4YYHA 3NG2A 4TQNA 2YDWA 5CPEA 5CFWA 5JWMA 3MHHA 5BT4A 5DY7A 5FB1A 2FUIA 3LQIA 5C4QA 4LRGA 4YH3A 5KO4A 4YBMA 5CQ6A 5ENCA 5IGLA 4J1PA 5D1KB 4KCXA 5E9LA 4KV4A 2JRJA 4YYIA 3Q2FA 5CQ4A 2YHNA 5A83A 4ALGA 3L1ZB 4LKAA 1F62A 5H9MA 3O35A 4KV1A 5HFQA 2RNWA 4B86C 5LJ0A 4LC2A 4PCEA 4WZ0A 3O33A 4XUBA 1JOCA 3KV6A 2F6JA 5HQ6A 4QSUA 1Z60A 5KHMA 3DPLR 5A85A 4N4FA 4TT2A 4CLBA 2R10A 4Q0NA 4PY6A 2RSDA 3ZNIA 2KGGA 1DVPA 1T1HA 4LK9A 5LVRA 5CQTA 5F36A 3P1EA 2L80A 3JVMA 5COIA 3M62A 5D3HA 3U5PA 2XB1A 5LKZA 3U5LA 2RI7A 5A5PA 2RNXA 4QSSA 2I8NA 4QUUA 5D7XA 5DW1A 4MEPA 4O7BA 5DKCA 5ENEA 1WE9A 4I7BA 5ACYA 3VK6A 4O70A 4OGIA 4QSQA 2YURA 4XY9A 2FSAA 2RNYA 3U5KA 1WGMA 4UP0A 4TKPB 5IGMA 1XWHA 3UVWA 1Z6UA 2H0DA 3KQIA 4QSXA 3K2JA 5DYXA 3ZYUA 3P1CA 5FE7A 2DX8A 5FH8A 2JMJA 3L1XA 1VFYA 4PCIA 1HYJA 2LXHC 1ZS5A 5CQ8A 2F6NA 2L75A 5IIDA 3IHPA 3N9LA 1EQFA 5D25A 2L5EA 5A5QA 4O74A 2MD8C 3ZTGA 5BT3A 5DKHA 4QYDA 5FE2A 3TLPA 3HMHA 5F25A 4NQNA 1HYIA 5TRBA 2OSSA 5EWHA 3ZVYA 5ENJA 3U5JA 4QY4A 1ZBDB 3U5MA 4LDFA 5HJCA 1WEWA 5E9YA 2QJ0A 4CUUA
chains in the Genus database with same CATH superfamily
5HM0A 5A5SA 2VJFA 4MR5A 4HBWA 3VKGA 5CUDA 5F5ZA 5II1A 5L8TA 4GNFA 4MEOA 5DKDA 5I89A 3P5OA 3UVDA 4ZC9A 2LGGA 5KH3A 5I88A 5I7XA 5CUGA 5G4SA 2ECIA 2LXPC 3U5NA 4A9NA 3JVKA 2ECNA 5DBMA 3HTKC 5B79A 4WHWA 5H1VA 5EYAF 2M3HA 3QZSA 5A5RA 3FL2A 4HXMA 3MDBC 3SOUA 4UYEA 5CUEA 3JVLA 4F3IA 2LGLA 5SVYA 5FE1A 5AMEA 2FD4A 5E9KA 3KV5A 4QBMA 4QSRA 2E6RA 3P1FA 1WEVA 4CFLA 5F60A 4V3LC 4A4BA 5B75A 3MQMA 5G04B 4L7XA 2NXBA 4YADA 2E7NA 4O71A 4NRCA 2MUMA 5CQAA 5JI8A 2XP0A 5FE6A 3T9KA 3HCTA 2KWKA 5CP5A 2RR4A 2LGVA 4A9KA 4OGJA 4UI9B 1X0JA 1V87A 4P5OB 5L8UA 5TB6A 5E9IA 5FDZA 4PKLA 4UIXA 4A9FA 5AMFA 4UIUA 5CUAA 5SVIA 5B76A 4R8PK 3M63A 4OUFA 3UV2A 2KYUA 3IU6A 4A9HA 4AP4A 4CUQA 3MUKA 2MD7B 2ZETC 4I7DA 4IR5A 4BBQA 5FE4A 2D8SA 4GB0A 5C13A 4YBTA 2DVSA 5DYCA 5EK9A 5IGNA 4TYLA 4NR6A 4C67A 4AVXA 2EGPA 4NR5A 4QSWA 2KFTA 2VPBA 2Y1NA 1JM7B 2FFWA 3FEHA 5K29A 5F62A 2R0YA 3SOXA 2L84A 2YSMA 4UP5A 1LDKC 4NUDA 4NS5A 3G0LA 4QEVA 4NYWA 4NRBA 5DKAA 4YC9A 4FIPA 3T7LA 5EGUA 4QF3A 5F3AA 5LCWB 3LJUX 4Z0RA 5DYUA 5L96A 1JM4B 2EXUA 5D1MB 4A9OA 4O75A 5E3DA 5A7CA 4YAXA 2AN6A 4Y03A 5D3SA 2YW8A 1X4IA 2CT2A 5ETBA 2B0OE 4MVTA 2KR4A 3HMEA 4X3GA 3SVGA 3N9OA 5KTWA 4I7CA 4R2YA 4WIVA 4O72A 2BAYA 5F2PA 4N4IA 4HBVA 2IDAA 5E9MA 3UVXA 4YYKA 3MULA 2H0DB 2L5UA 4YABA 5D3RA 4NR9A 4MENA 5LKTA 1JM7A 4LADB 5AITA 4LZSA 4A4CA 5IG6A 2DWWA 2XEUA 4NXJA 3RPGC 3O36A 4LYWA 4NYXA 2RFJA 5E74A 5HQ5A 4H9DA 3L11A 2M85A 4O64A 4NRAA 2KGIA 4X2IA 5C11A 2DVQA 2OO1A 4MEQA 4Z6HA 3N9QA 1CHCA 5FE0A 2MA5A 3GL6A 3H7HA 1N72A 5HQ7A 2CKLA 3V43A 5EPBA 4AYCB 2KKXA 5CS8A 4QB3A 4QEWA 5DW2A 1WEQA 5FEYA 3PHDA 2YEKA 2IQJA 4UIYA 2QICA 5ETDA 3N9MA 2VJFB 5F63A 5I80A 5FFVA 3LVRE 2G6QA 4FJCA 5EV9A 1N87A 2YYRA 5KTXA 3EB5A 5LKXA 4GNGA 2MNYA 4IR3A 2MIQA 5D3PA 3EB6A 5D26A 5IGKA 2VJEB 4TU4A 5LUUA 4B7YC 2JMDA 3P1DA 4J0SA 1WIMA 2C2VS 4HXSA 2LQ6A 2M13A 2CRRA 5EWDA 5J0DA 5TDRA 5KTUA 1WENA 4MR3A 4QYLA 2DSMA 3NXBA 4MR6A 5C7NA 4AYCA 2H60A 5LVQA 5DFDA 1F68A 5CUBA 1WUGA 4XUAA 3O47A 5SVIB 4C9ZA 5FB0A 2EODA 4N4GA 1WEPA 4F1PA 4QC3A 3ZYQA 5JG6A 2VJEA 2YYNA 2DATA 3KDEC 3KNVA 1WEMA 2I7KA 4BHWA 5LJ1A 2MNZA 4CUTA 2MT5A 3FM8C 1E6IA 2MJVB 5E3GA 5FH7A 3UV4A 2CSYA 4TZ8A 2XOZA 5KH7A 5CGPA 4NR8A 4Q0OA 2YSJA 5CTLA 2YHOA 2VP7A 4O77A 2YUCA 2L85A 1FP0A 5D1LB 4O7FA 4TT4A 4YYNA 5I86A 5D24A 2VPGA 2KIZA 3U5OA 1WFKA 4A0CD 2D82A 4QSVA 4BW1A 3LRQA 2K1JA 4L58A 4PPEA 4J0RA 4GPJA 2LSPB 3HCSA 5F1LA 2M1RA 5I1QA 4XY8A 5IBNA 4AKIA 4CURA 5A82A 1K2FA 4FO9A 4QR3A 5K3QA 5I7YA 1X4JA 3DAIA 4HXRA 5E73A 5FG6A 4NN2A 2ECTA 4WZ2A 4NR4A 4IORA 5EQ1A 5KH9A 3LQHA 5L98A 1ZKRA 2KE1A 4QC1A 3QZTA 4YH4A 4YYMA 4BW3A 5D3LA 4QF2A 2G4AA 2N9GA 3IU5A 4NYVA 4TTEA 5EA1A 5ENFA 1Z2QA 2UZGA 5CU8A 3M99A 5EM3A 4QNSA 3RPGB 4UYFB 2ECWA 1FBVA 2ECGA 4N4HA 4MR4A 5G05B 5D3JA 3RTRB 3LQJA 3PURA 2EGMA 4XI1A 5HRXA 5D3TA 5TBNA 2L7PA 4ZUXU 1WESA 1X4UA 4ZDTA 1U6GB 4F52B 5L97A 3E2DA 3GG3A 1WUMA 5A5OA 5TABA 3M7KA 5FERA 5EWCA 5D0CA 3SVFA 2PUYA 2K16A 5EP7A 3UVYA 2CKLB 1LDJB 3Q1DA 1G25A 5HENA 3MB3A 5F61A 5A81A 4NUEA 3FKMX 4QR4A 5EWVA 5DINA 4QZSA 4UYGA 2KKYA 5CRMA 4HBXA 5HRVA 5C89A 5EISA 5H1UA 1RMDA 4E96A 4UYDA 4YBSA 4IC2A 2KTBB 5EPRA 4UYFA 2EA6A 3QZVA 2ECJA 2L0BA 5DLZA 2M6MA 3ZVZB 4BW4A 3O37A 2YELA 5D3NA 5TDWA 5EVAA 4IOOA 2LDRA 2DJAA 3LDYA 4O78A 2Y1MA 4LJNA 2R0VA 4O7EA 2G43A 4Z93A 5CQ5A 4WHUA 3FAOA 4UIVA 4RVRA 2DVRA 4LZ2A 1BORA 5FFYA 5CUCA 2YQDA 1WEEA 4DONA 5E7DA 3SOWA 3MHSA 2OUOA 5L99A 2C2LA 3LVQE 4OGCA 2HYED 3VKHA 3DQVR 3I3JA 4HXNA 5CQ7A 2D9EA 1DCQA 5AIUA 3UW9A 4J3IA 5DLXA 4A9LA 4OGEA 4AUQB 1E4UA 3MXFA 5FE3A 5FE8A 4QSTA 4AKNA 4YY4A 2YU4A 4TU6A 1WILA 4ZQLA 4HXPA 4QUTA 2G45A 4Z1QA 5LJ2A 2XOYA 1MM3A 3HMFA 4QEUA 4YYJA 4S3OC 4WA6A 4LZRA 2E6SA 4BJXA 4QSPA 5AD3A 5KU3A 4NQMA 5ENBA 5B78A 3D1DA 4PTBA 4CA1A 5FG5A 4HXOA 5CY9A 5ENHA 5FH6A 5A5NA 5I40A 2L43A 2LGKA 4V3KC 3SUBA 2F42A 4LR6A 2I50A 2FUUA 2KWNA 5BT5A 3FANA 3I2DA 2JMIA 4Q6FA 4IC3A 2OXQC 5C87A 3DWDA 4O7AA 5FBXA 5SVXA 2E7OA 2YT5A 5DFCA 2NAAA 3JVJA 5HELA 5FE9A 3DDTA 3ERRA 4R7EA 3D1BA 4TZ2A 1IYMA 5I29A 3ONIA 2KU3A 2YREA 3C5KA 2RS9B 1JSPB 5HCLA 4UYHA 1VD4A 4TT6A 4O62A 4CL9A 5CQ3A 4IR6A 4PS5A 2YW5A 2JUNA 2YQLA 3O7AA 3SVHA 4TS8A 5J3XA 2GRCA 4NR7A 4FK5A 4AKGA 2P57A 3ZPV1 5TCMA 4LYSA 5C85A 5HFRA 2VNFA 5EICA 3AADA 5EWWA 5II2A 5HRWA 4CCGX 3MB4A 4UIWA 4HXKA 2MKEA 3JUEA 3S92A 5H1TA 2MA6A 4ALHA 4WZ3B 4UITA 2KREA 4NUCA 4UIZA 4BW2A 5FFWA 2CONA 4IOQA 2Y43A 4O76A 3C6WA 3LXJA 4QR5A 2YVRA 2VPDA 3GV4A 2DKWA 2ECVA 3N9NA 3O70A 1VYXA 5G4RA 2KWOA 5EU1A 4YYGA 4LLBA 2VPEA 5AD2A 2LN0A 1MM2A 4W4UA 1WEOA 4YATA 2CSVA 5I3LA 5E9VA 4A9EA 2LV9A 4C66A 4Z1SA 2R0SA 5C8GA 2CSZA 4ZW1A 5B77A 2PNXA 4HXLA 4O7CA 3ASLA 4Z6IA 3SHBA 4FLPA 2QIZA 2DVVA 3O34A 3S91A 2LRIC 5EI4A 4AKHA 3N9PA 4A9JA 5FE5A 5ENGA 4A49A 5FG4A 3G0JA 3UV5A 4IR4A 4LYIA 4YYDA 3ZPVE 5DYAA 5DX4A 5ENIA 5CZGA 4YK0A 5CRZA 3RCWA 4A9IA 3HCUA 3AQAA 4MSXA 4AI6A 3DWYA 3Q2EA 5F1HA 4XYAA 2XOCA 3LJWA 4HBYA 4CUSA 2YQMA 5EPSA 5LKUA 2YEMA 3D7CA 2HDPA 4N3WA 2D8UA 4GNDA 1WEUA 5I83A 5E0RA 4A9MA 2RO1A 2WP2A 5HEMA 3PUQA 4GNEA 3T6RA 4YY6A 2K4DA 4S3OB 5DFBA 4CUPA 5HLSA 2OWAA 5G0FA 2K17A 5B8DA 2E3KA 2WP1A 2KWJA 4CFKA 5H85A 4YYHA 3NG2A 4TQNA 2YDWA 5CPEA 5CFWA 5JWMA 3MHHA 5BT4A 5DY7A 5FB1A 2FUIA 3LQIA 5C4QA 4LRGA 4YH3A 5KO4A 4YBMA 5CQ6A 5ENCA 5IGLA 4J1PA 5D1KB 4KCXA 5E9LA 2LAUA 1MBMA 4KV4A 2JRJA 4YYIA 3Q2FA 5CQ4A 2YHNA 2EJNA 2CRWA 5A83A 4ALGA 2E61A 4QQ4A 3L1ZB 4LKAA 1F62A 5H9MA 3O35A 4KV1A 5HFQA 2RNWA 4B86C 5LJ0A 4LC2A 4PCEA 4WZ0A 3O33A 4XUBA 1JOCA 3KV6A 2F6JA 5HQ6A 4QSUA 1Z60A 5KHMA 3DPLR 5A85A 4N4FA 4TT2A 4CLBA 2R10A 4Q0NA 4PY6A 2RSDA 3ZNIA 2KGGA 1DVPA 1T1HA 4LK9A 5LVRA 5CQTA 5F36A 3P1EA 2L80A 3JVMA 5COIA 3M62A 5D3HA 3U5PA 2XB1A 5LKZA 3U5LA 2RI7A 5A5PA 2RNXA 4QSSA 2I8NA 4QUUA 5D7XA 5DW1A 4MEPA 4O7BA 5DKCA 5ENEA 1WE9A 4I7BA 5ACYA 3VK6A 4O70A 4OGIA 4QSQA 2YURA 4XY9A 2FSAA 2RNYA 3U5KA 1WGMA 4UP0A 4TKPB 5IGMA 1XWHA 3UVWA 3FJUB 1Z6UA 2H0DA 3KQIA 4QSXA 3K2JA 5DYXA 3ZYUA 3P1CA 5FE7A 2JM3A 2DX8A 5FH8A 2JMJA 3L1XA 1VFYA 4PCIA 1HYJA 2LXHC 1ZS5A 5CQ8A 2F6NA 2L75A 5IIDA 3IHPA 4Z0OA 3PLWA 3N9LA 1EQFA 5D25A 2L5EA 5A5QA 4O74A 2MD8C 3ZTGA 5BT3A 5DKHA 4QYDA 5FE2A 3TLPA 3HMHA 5F25A 4NQNA 1HYIA 5TRBA 2OSSA 1PUOA 5EWHA 3ZVYA 5ENJA 3U5JA 4QY4A 1ZBDB 3U5MA 4LDFA 5HJCA 1WEWA 5E9YA 2QJ0A 4CUUA
chains in the Genus database with same CATH topology
5HM0A 5A5SA 2VJFA 4MR5A 4HBWA 4GNFA 5CUDA 5F5ZA 5II1A 5L8TA 4MEOA 5DKDA 5I89A 3P5OA 3UVDA 4ZC9A 2LGGA 5KH3A 5I88A 5I7XA 5CUGA 5G4SA 2ECIA 2LXPC 3U5NA 4A9NA 3JVKA 2ECNA 5DBMA 3HTKC 5B79A 4WHWA 5H1VA 5EYAF 2M3HA 3QZSA 5A5RA 3FL2A 4HXMA 3SOUA 4UYEA 5CUEA 3JVLA 4F3IA 2LGLA 5FE1A 5AMEA 5E9KA 3KV5A 4QBMA 4QSRA 2E6RA 3P1FA 1WEVA 4CFLA 5F60A 4V3LC 4A4BA 5B75A 3MQMA 5G04B 4L7XA 2NXBA 4YADA 2E7NA 4O71A 4NRCA 2MUMA 5CQAA 5JI8A 5FE6A 3HCTA 2KWKA 5CP5A 2LGVA 4A9KA 4OGJA 4UI9B 1X0JA 1V87A 4P5OB 5L8UA 5TB6A 5E9IA 5FDZA 4PKLA 4UIXA 4A9FA 5AMFA 4UIUA 5CUAA 4R8PK 5B76A 3M63A 4OUFA 3UV2A 2KYUA 3IU6A 4A9HA 4AP4A 4CUQA 3MUKA 2MD7B 2ZETC 4I7DA 4IR5A 4BBQA 5FE4A 2D8SA 4GB0A 5C13A 4YBTA 2DVSA 5DYCA 5EK9A 5IGNA 4TYLA 4NR6A 4C67A 4AVXA 2EGPA 4NR5A 4QSWA 2KFTA 2VPBA 2Y1NA 1JM7B 5K29A 5F62A 2R0YA 3SOXA 2L84A 2YSMA 1LDKC 4NUDA 4NS5A 3G0LA 4QEVA 4NYWA 4NRBA 5DKAA 4YC9A 4FIPA 3T7LA 5EGUA 4QF3A 5F3AA 5LCWB 5DYUA 5L96A 1JM4B 5D1MB 4A9OA 4O75A 5E3DA 5A7CA 4YAXA 2AN6A 4Y03A 5D3SA 2YW8A 1X4IA 2CT2A 5ETBA 4MVTA 2KR4A 3HMEA 4X3GA 3SVGA 3N9OA 5KTWA 4I7CA 4R2YA 4WIVA 4O72A 2BAYA 5F2PA 4N4IA 4HBVA 2IDAA 5E9MA 3UVXA 4YYKA 3MULA 2H0DB 2L5UA 4YABA 5D3RA 4NR9A 4MENA 5LKTA 1JM7A 4LADB 5AITA 4LZSA 4A4CA 5IG6A 2DWWA 2XEUA 4NXJA 3RPGC 3O36A 4LYWA 4NYXA 2RFJA 5E74A 5HQ5A 3L11A 2M85A 4O64A 4NRAA 2KGIA 4X2IA 5C11A 2DVQA 2OO1A 4MEQA 4Z6HA 3N9QA 1CHCA 5FE0A 2MA5A 3GL6A 1N72A 5HQ7A 2CKLA 3V43A 5EPBA 4AYCB 5CS8A 4QB3A 4QEWA 5DW2A 1WEQA 5FEYA 3PHDA 2YEKA 2QICA 4UIYA 5ETDA 3N9MA 2VJFB 5F63A 5I80A 5FFVA 2G6QA 4FJCA 5EV9A 1N87A 2YYRA 5KTXA 3EB5A 5LKXA 4GNGA 2MNYA 4IR3A 2MIQA 5D3PA 3EB6A 5D26A 5IGKA 2VJEB 4TU4A 5LUUA 4B7YC 2JMDA 3P1DA 4J0SA 1WIMA 2C2VS 4HXSA 2LQ6A 5EWDA 5J0DA 5TDRA 5KTUA 1WENA 4MR3A 4QYLA 3NXBA 4MR6A 5C7NA 4AYCA 2H60A 5LVQA 5DFDA 1F68A 5CUBA 1WUGA 4XUAA 4C9ZA 5FB0A 2EODA 4N4GA 1WEPA 4QC3A 3ZYQA 5JG6A 2VJEA 2YYNA 2DATA 3KNVA 1WEMA 2I7KA 4BHWA 5LJ1A 2MNZA 4CUTA 2MT5A 4UP5A 1E6IA 2MJVB 5E3GA 5FH7A 3UV4A 2CSYA 4TZ8A 5KH7A 5CGPA 4NR8A 4Q0OA 2YSJA 5CTLA 2YHOA 2VP7A 4O77A 2YUCA 2L85A 1FP0A 5D1LB 4O7FA 4TT4A 4YYNA 5I86A 5D24A 2VPGA 2KIZA 3U5OA 1WFKA 4A0CD 2D82A 4QSVA 4BW1A 3LRQA 2K1JA 4L58A 4PPEA 4J0RA 4GPJA 2LSPB 3HCSA 5F1LA 2M1RA 5I1QA 4XY8A 5IBNA 4FO9A 4CURA 5A82A 1K2FA 4QR3A 5I7YA 1X4JA 3DAIA 4HXRA 5E73A 5FG6A 4NN2A 2ECTA 4WZ2A 4NR4A 4IORA 5EQ1A 5KH9A 3LQHA 5L98A 2KE1A 4QC1A 3QZTA 4YH4A 4YYMA 4BW3A 5D3LA 4QF2A 2G4AA 2N9GA 3IU5A 4NYVA 4TTEA 5EA1A 5ENFA 1Z2QA 2UZGA 5CU8A 3M99A 5EM3A 4QNSA 3RPGB 4UYFB 2ECWA 1FBVA 2ECGA 4N4HA 4MR4A 5G05B 5D3JA 3RTRB 3LQJA 3PURA 4XI1A 5HRXA 5D3TA 5TBNA 4ZUXU 1WESA 1X4UA 4ZDTA 1U6GB 4F52B 5L97A 3GG3A 1WUMA 5A5OA 5TABA 5FERA 5EWCA 5D0CA 3SVFA 2PUYA 2K16A 5EP7A 3UVYA 2CKLB 1LDJB 1G25A 5HENA 3MB3A 5F61A 5A81A 4NUEA 3FKMX 4QR4A 5EWVA 5DINA 4QZSA 4UYGA 5CRMA 4HBXA 5HRVA 5C89A 5EISA 5H1UA 1RMDA 4E96A 4UYDA 4YBSA 4IC2A 2KTBB 5EPRA 4UYFA 2EA6A 3QZVA 2ECJA 2L0BA 5DLZA 2M6MA 3ZVZB 4BW4A 3O37A 2YELA 5D3NA 5TDWA 5EVAA 4IOOA 2LDRA 4O78A 2Y1MA 4LJNA 2R0VA 4O7EA 2G43A 4Z93A 5CQ5A 4WHUA 4UIVA 4RVRA 2DVRA 4LZ2A 1BORA 5FFYA 5CUCA 2YQDA 1WEEA 4DONA 5E7DA 3SOWA 3MHSA 2OUOA 5L99A 2C2LA 2HYED 3DQVR 3I3JA 4HXNA 5CQ7A 2D9EA 5AIUA 3UW9A 4J3IA 5DLXA 4A9LA 4AUQB 1E4UA 3MXFA 5FE3A 5FE8A 4QSTA 4AKNA 4YY4A 2YU4A 4TU6A 1WILA 4ZQLA 4HXPA 4QUTA 2G45A 4Z1QA 5LJ2A 1MM3A 3HMFA 4QEUA 4YYJA 4S3OC 4WA6A 4LZRA 2E6SA 4BJXA 4QSPA 5AD3A 5KU3A 4NQMA 5ENBA 5B78A 4PTBA 4CA1A 5FG5A 4HXOA 5CY9A 5ENHA 5FH6A 5A5NA 5I40A 2L43A 2LGKA 4V3KC 2F42A 4LR6A 2I50A 2FUUA 2KWNA 5BT5A 3I2DA 2JMIA 4Q6FA 4IC3A 2OXQC 5C87A 4O7AA 5FBXA 2E7OA 2YT5A 5DFCA 2NAAA 3JVJA 5HELA 5FE9A 4R7EA 1IYMA 4TZ2A 5I29A 3ONIA 2KU3A 2YREA 3C5KA 2RS9B 1JSPB 5HCLA 4UYHA 1VD4A 4TT6A 4CL9A 5CQ3A 4IR6A 4PS5A 2YW5A 2YQLA 3O7AA 3SVHA 4TS8A 5J3XA 2GRCA 4NR7A 4FK5A 3ZPV1 5TCMA 4LYSA 5C85A 5HFRA 2VNFA 5EICA 3AADA 5EWWA 5II2A 5HRWA 4CCGX 3MB4A 4UIWA 4HXKA 3S92A 5H1TA 2MA6A 4ALHA 4WZ3B 4UITA 2KREA 4NUCA 4UIZA 4BW2A 5FFWA 4IOQA 2Y43A 4O76A 3C6WA 3LXJA 4QR5A 2VPDA 3GV4A 2DKWA 2ECVA 3N9NA 3O70A 1VYXA 5G4RA 2KWOA 5EU1A 4YYGA 4LLBA 2VPEA 5AD2A 2LN0A 1MM2A 4W4UA 1WEOA 4YATA 5I3LA 5E9VA 4A9EA 2LV9A 4C66A 4Z1SA 2R0SA 5C8GA 2CSZA 4ZW1A 5B77A 2PNXA 4HXLA 4O7CA 3ASLA 4Z6IA 3SHBA 4FLPA 2QIZA 2DVVA 3O34A 3S91A 2LRIC 5EI4A 3N9PA 4A9JA 5FE5A 5ENGA 4A49A 5FG4A 3G0JA 3UV5A 4IR4A 4LYIA 4YYDA 3ZPVE 5DYAA 5DX4A 5ENIA 5CZGA 4YK0A 5CRZA 3RCWA 4A9IA 3HCUA 3AQAA 4MSXA 3DWYA 3Q2EA 5F1HA 4XYAA 3LJWA 4HBYA 4CUSA 2YQMA 5EPSA 5LKUA 2YEMA 3D7CA 2HDPA 4N3WA 4GNDA 1WEUA 5I83A 5E0RA 4A9MA 2RO1A 2WP2A 5HEMA 3PUQA 4GNEA 3T6RA 4YY6A 2K4DA 4S3OB 5DFBA 4CUPA 5HLSA 5B8DA 5G0FA 2K17A 2E3KA 2WP1A 2KWJA 4CFKA 5H85A 4YYHA 3NG2A 4TQNA 2YDWA 5CPEA 5CFWA 5JWMA 3MHHA 5BT4A 5DY7A 5FB1A 2FUIA 3LQIA 5C4QA 4LRGA 4YH3A 5KO4A 4YBMA 5CQ6A 5ENCA 5IGLA 4J1PA 5D1KB 4KCXA 5E9LA 4KV4A 2JRJA 4YYIA 3Q2FA 5CQ4A 2YHNA 5A83A 4ALGA 3L1ZB 4LKAA 1F62A 5H9MA 3O35A 4KV1A 5HFQA 2RNWA 4B86C 5LJ0A 4LC2A 4PCEA 4WZ0A 3O33A 4XUBA 1JOCA 3KV6A 2F6JA 5HQ6A 4QSUA 1Z60A 5KHMA 3DPLR 5A85A 4N4FA 4TT2A 4CLBA 2R10A 4Q0NA 4PY6A 2RSDA 3ZNIA 2KGGA 1DVPA 1T1HA 4LK9A 5LVRA 5CQTA 5F36A 3P1EA 2L80A 3JVMA 5COIA 3M62A 5D3HA 3U5PA 2XB1A 5LKZA 3U5LA 2RI7A 5A5PA 2RNXA 4QSSA 2I8NA 4QUUA 5D7XA 5DW1A 4MEPA 4O7BA 5DKCA 5ENEA 1WE9A 4I7BA 5ACYA 3VK6A 4O70A 4OGIA 4QSQA 2YURA 4XY9A 2FSAA 2RNYA 3U5KA 1WGMA 4UP0A 4TKPB 5IGMA 1XWHA 3UVWA 1Z6UA 2H0DA 3KQIA 4QSXA 3K2JA 5DYXA 3ZYUA 3P1CA 5FE7A 2DX8A 5FH8A 2JMJA 3L1XA 1VFYA 4PCIA 1HYJA 2LXHC 1ZS5A 5CQ8A 2F6NA 2L75A 5IIDA 3IHPA 3N9LA 1EQFA 5D25A 2L5EA 5A5QA 4O74A 2MD8C 3ZTGA 5BT3A 5DKHA 4QYDA 5FE2A 3TLPA 3HMHA 5F25A 4NQNA 1HYIA 5TRBA 2OSSA 5EWHA 3ZVYA 5ENJA 3U5JA 4QY4A 1ZBDB 3U5MA 4LDFA 5HJCA 1WEWA 5E9YA 2QJ0A 4CUUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HM0 A;  5A5S A;  2VJF A;  4MR5 A;  4HBW A;  4GNF A;  5CUD A;  5F5Z A;  5II1 A;  5L8T A;  4MEO A;  5DKD A;  5I89 A;  3P5O A;  3UVD A;  4ZC9 A;  2LGG A;  5KH3 A;  5I88 A;  5I7X A;  5CUG A;  5G4S A;  2ECI A;  2LXP C;  3U5N A;  4A9N A;  3JVK A;  2ECN A;  5DBM A;  3HTK C;  5B79 A;  4WHW A;  5H1V A;  5EYA F;  2M3H A;  3QZS A;  5A5R A;  3FL2 A;  4HXM A;  3SOU A;  4UYE A;  5CUE A;  3JVL A;  4F3I A;  2LGL A;  5FE1 A;  5AME A;  5E9K A;  3KV5 A;  4QBM A;  4QSR A;  2E6R A;  3P1F A;  1WEV A;  4CFL A;  5F60 A;  4V3L C;  4A4B A;  5B75 A;  3MQM A;  5G04 B;  4L7X A;  2NXB A;  4YAD A;  2E7N A;  4O71 A;  4NRC A;  2MUM A;  5CQA A;  5JI8 A;  5FE6 A;  3HCT A;  2KWK A;  5CP5 A;  2LGV A;  4A9K A;  4OGJ A;  4UI9 B;  1X0J A;  1V87 A;  4P5O B;  5L8U A;  5TB6 A;  5E9I A;  5FDZ A;  4PKL A;  4UIX A;  4A9F A;  5AMF A;  4UIU A;  5CUA A;  4R8P K;  5B76 A;  3M63 A;  4OUF A;  3UV2 A;  2KYU A;  3IU6 A;  4A9H A;  4AP4 A;  4CUQ A;  3MUK A;  2MD7 B;  2ZET C;  4I7D A;  4IR5 A;  4BBQ A;  5FE4 A;  2D8S A;  4GB0 A;  5C13 A;  4YBT A;  2DVS A;  5DYC A;  5EK9 A;  5IGN A;  4TYL A;  4NR6 A;  4C67 A;  4AVX A;  2EGP A;  4NR5 A;  4QSW A;  2KFT A;  2VPB A;  2Y1N A;  1JM7 B;  5K29 A;  5F62 A;  2R0Y A;  3SOX A;  2L84 A;  2YSM A;  1LDK C;  4NUD A;  4NS5 A;  3G0L A;  4QEV A;  4NYW A;  4NRB A;  5DKA A;  4YC9 A;  4FIP A;  3T7L A;  5EGU A;  4QF3 A;  5F3A A;  5LCW B;  5DYU A;  5L96 A;  1JM4 B;  5D1M B;  4A9O A;  4O75 A;  5E3D A;  5A7C A;  4YAX A;  2AN6 A;  4Y03 A;  5D3S A;  2YW8 A;  1X4I A;  2CT2 A;  5ETB A;  4MVT A;  2KR4 A;  3HME A;  4X3G A;  3SVG A;  3N9O A;  5KTW A;  4I7C A;  4R2Y A;  4WIV A;  4O72 A;  2BAY A;  5F2P A;  4N4I A;  4HBV A;  2IDA A;  5E9M A;  3UVX A;  4YYK A;  3MUL A;  2H0D B;  2L5U A;  4YAB A;  5D3R A;  4NR9 A;  4MEN A;  5LKT A;  1JM7 A;  4LAD B;  5AIT A;  4LZS A;  4A4C A;  5IG6 A;  2DWW A;  2XEU A;  4NXJ A;  3RPG C;  3O36 A;  4LYW A;  4NYX A;  2RFJ A;  5E74 A;  5HQ5 A;  3L11 A;  2M85 A;  4O64 A;  4NRA A;  2KGI A;  4X2I A;  5C11 A;  2DVQ A;  2OO1 A;  4MEQ A;  4Z6H A;  3N9Q A;  1CHC A;  5FE0 A;  2MA5 A;  3GL6 A;  1N72 A;  5HQ7 A;  2CKL A;  3V43 A;  5EPB A;  4AYC B;  5CS8 A;  4QB3 A;  4QEW A;  5DW2 A;  1WEQ A;  5FEY A;  3PHD A;  2YEK A;  2QIC A;  4UIY A;  5ETD A;  3N9M A;  2VJF B;  5F63 A;  5I80 A;  5FFV A;  2G6Q A;  4FJC A;  5EV9 A;  1N87 A;  2YYR A;  5KTX A;  3EB5 A;  5LKX A;  4GNG A;  2MNY A;  4IR3 A;  2MIQ A;  5D3P A;  3EB6 A;  5D26 A;  5IGK A;  2VJE B;  4TU4 A;  5LUU A;  4B7Y C;  2JMD A;  3P1D A;  4J0S A;  1WIM A;  2C2V S;  4HXS A;  2LQ6 A;  5EWD A;  5J0D A;  5TDR A;  5KTU A;  1WEN A;  4MR3 A;  4QYL A;  3NXB A;  4MR6 A;  5C7N A;  4AYC A;  2H60 A;  5LVQ A;  5DFD A;  1F68 A;  5CUB A;  1WUG A;  4XUA A;  4C9Z A;  5FB0 A;  2EOD A;  4N4G A;  1WEP A;  4QC3 A;  3ZYQ A;  5JG6 A;  2VJE A;  2YYN A;  2DAT A;  3KNV A;  1WEM A;  2I7K A;  4BHW A;  5LJ1 A;  2MNZ A;  4CUT A;  2MT5 A;  4UP5 A;  1E6I A;  2MJV B;  5E3G A;  5FH7 A;  3UV4 A;  2CSY A;  4TZ8 A;  5KH7 A;  5CGP A;  4NR8 A;  4Q0O A;  2YSJ A;  5CTL A;  2YHO A;  2VP7 A;  4O77 A;  2YUC A;  2L85 A;  1FP0 A;  5D1L B;  4O7F A;  4TT4 A;  4YYN A;  5I86 A;  5D24 A;  2VPG A;  2KIZ A;  3U5O A;  1WFK A;  4A0C D;  2D82 A;  4QSV A;  4BW1 A;  3LRQ A;  2K1J A;  4L58 A;  4PPE A;  4J0R A;  4GPJ A;  2LSP B;  3HCS A;  5F1L A;  2M1R A;  5I1Q A;  4XY8 A;  5IBN A;  4FO9 A;  4CUR A;  5A82 A;  1K2F A;  4QR3 A;  5I7Y A;  1X4J A;  3DAI A;  4HXR A;  5E73 A;  5FG6 A;  4NN2 A;  2ECT A;  4WZ2 A;  4NR4 A;  4IOR A;  5EQ1 A;  5KH9 A;  3LQH A;  5L98 A;  2KE1 A;  4QC1 A;  3QZT A;  4YH4 A;  4YYM A;  4BW3 A;  5D3L A;  4QF2 A;  2G4A A;  2N9G A;  3IU5 A;  4NYV A;  4TTE A;  5EA1 A;  5ENF A;  1Z2Q A;  2UZG A;  5CU8 A;  3M99 A;  5EM3 A;  4QNS A;  3RPG B;  4UYF B;  2ECW A;  1FBV A;  2ECG A;  4N4H A;  4MR4 A;  5G05 B;  5D3J A;  3RTR B;  3LQJ A;  3PUR A;  4XI1 A;  5HRX A;  5D3T A;  5TBN A;  4ZUX U;  1WES A;  1X4U A;  4ZDT A;  1U6G B;  4F52 B;  5L97 A;  3GG3 A;  1WUM A;  5A5O A;  5TAB A;  5FER A;  5EWC A;  5D0C A;  3SVF A;  2PUY A;  2K16 A;  5EP7 A;  3UVY A;  2CKL B;  1LDJ B;  1G25 A;  5HEN A;  3MB3 A;  5F61 A;  5A81 A;  4NUE A;  3FKM X;  4QR4 A;  5EWV A;  5DIN A;  4QZS A;  4UYG A;  5CRM A;  4HBX A;  5HRV A;  5C89 A;  5EIS A;  5H1U A;  1RMD A;  4E96 A;  4UYD A;  4YBS A;  4IC2 A;  2KTB B;  5EPR A;  4UYF A;  2EA6 A;  3QZV A;  2ECJ A;  2L0B A;  5DLZ A;  2M6M A;  3ZVZ B;  4BW4 A;  3O37 A;  2YEL A;  5D3N A;  5TDW A;  5EVA A;  4IOO A;  2LDR A;  4O78 A;  2Y1M A;  4LJN A;  2R0V A;  4O7E A;  2G43 A;  4Z93 A;  5CQ5 A;  4WHU A;  4UIV A;  4RVR A;  2DVR A;  4LZ2 A;  1BOR A;  5FFY A;  5CUC A;  2YQD A;  1WEE A;  4DON A;  5E7D A;  3SOW A;  3MHS A;  2OUO A;  5L99 A;  2C2L A;  2HYE D;  3DQV R;  3I3J A;  4HXN A;  5CQ7 A;  2D9E A;  5AIU A;  3UW9 A;  4J3I A;  5DLX A;  4A9L A;  4AUQ B;  1E4U A;  3MXF A;  5FE3 A;  5FE8 A;  4QST A;  4AKN A;  4YY4 A;  2YU4 A;  4TU6 A;  1WIL A;  4ZQL A;  4HXP A;  4QUT A;  2G45 A;  4Z1Q A;  5LJ2 A;  1MM3 A;  3HMF A;  4QEU A;  4YYJ A;  4S3O C;  4WA6 A;  4LZR A;  2E6S A;  4BJX A;  4QSP A;  5AD3 A;  5KU3 A;  4NQM A;  5ENB A;  5B78 A;  4PTB A;  4CA1 A;  5FG5 A;  4HXO A;  5CY9 A;  5ENH A;  5FH6 A;  5A5N A;  5I40 A;  2L43 A;  2LGK A;  4V3K C;  2F42 A;  4LR6 A;  2I50 A;  2FUU A;  2KWN A;  5BT5 A;  3I2D A;  2JMI A;  4Q6F A;  4IC3 A;  2OXQ C;  5C87 A;  4O7A A;  5FBX A;  2E7O A;  2YT5 A;  5DFC A;  2NAA A;  3JVJ A;  5HEL A;  5FE9 A;  4R7E A;  1IYM A;  4TZ2 A;  5I29 A;  3ONI A;  2KU3 A;  2YRE A;  3C5K A;  2RS9 B;  1JSP B;  5HCL A;  4UYH A;  1VD4 A;  4TT6 A;  4CL9 A;  5CQ3 A;  4IR6 A;  4PS5 A;  2YW5 A;  2YQL A;  3O7A A;  3SVH A;  4TS8 A;  5J3X A;  2GRC A;  4NR7 A;  4FK5 A;  3ZPV 1;  5TCM A;  4LYS A;  5C85 A;  5HFR A;  2VNF A;  5EIC A;  3AAD A;  5EWW A;  5II2 A;  5HRW A;  4CCG X;  3MB4 A;  4UIW A;  4HXK A;  3S92 A;  5H1T A;  2MA6 A;  4ALH A;  4WZ3 B;  4UIT A;  2KRE A;  4NUC A;  4UIZ A;  4BW2 A;  5FFW A;  4IOQ A;  2Y43 A;  4O76 A;  3C6W A;  3LXJ A;  4QR5 A;  2VPD A;  3GV4 A;  2DKW A;  2ECV A;  3N9N A;  3O70 A;  1VYX A;  5G4R A;  2KWO A;  5EU1 A;  4YYG A;  4LLB A;  2VPE A;  5AD2 A;  2LN0 A;  1MM2 A;  4W4U A;  1WEO A;  4YAT A;  5I3L A;  5E9V A;  4A9E A;  2LV9 A;  4C66 A;  4Z1S A;  2R0S A;  5C8G A;  2CSZ A;  4ZW1 A;  5B77 A;  2PNX A;  4HXL A;  4O7C A;  3ASL A;  4Z6I A;  3SHB A;  4FLP A;  2QIZ A;  2DVV A;  3O34 A;  3S91 A;  2LRI C;  5EI4 A;  3N9P A;  4A9J A;  5FE5 A;  5ENG A;  4A49 A;  5FG4 A;  3G0J A;  3UV5 A;  4IR4 A;  4LYI A;  4YYD A;  3ZPV E;  5DYA A;  5DX4 A;  5ENI A;  5CZG A;  4YK0 A;  5CRZ A;  3RCW A;  4A9I A;  3HCU A;  3AQA A;  4MSX A;  3DWY A;  3Q2E A;  5F1H A;  4XYA A;  3LJW A;  4HBY A;  4CUS A;  2YQM A;  5EPS A;  5LKU A;  2YEM A;  3D7C A;  2HDP A;  4N3W A;  4GND A;  1WEU A;  5I83 A;  5E0R A;  4A9M A;  2RO1 A;  2WP2 A;  5HEM A;  3PUQ A;  4GNE A;  3T6R A;  4YY6 A;  2K4D A;  4S3O B;  5DFB A;  4CUP A;  5HLS A;  5B8D A;  5G0F A;  2K17 A;  2E3K A;  2WP1 A;  2KWJ A;  4CFK A;  5H85 A;  4YYH A;  3NG2 A;  4TQN A;  2YDW A;  5CPE A;  5CFW A;  5JWM A;  3MHH A;  5BT4 A;  5DY7 A;  5FB1 A;  2FUI A;  3LQI A;  5C4Q A;  4LRG A;  4YH3 A;  5KO4 A;  4YBM A;  5CQ6 A;  5ENC A;  5IGL A;  4J1P A;  5D1K B;  4KCX A;  5E9L A;  4KV4 A;  2JRJ A;  4YYI A;  3Q2F A;  5CQ4 A;  2YHN A;  5A83 A;  4ALG A;  3L1Z B;  4LKA A;  1F62 A;  5H9M A;  3O35 A;  4KV1 A;  5HFQ A;  2RNW A;  4B86 C;  5LJ0 A;  4LC2 A;  4PCE A;  4WZ0 A;  3O33 A;  4XUB A;  1JOC A;  3KV6 A;  2F6J A;  5HQ6 A;  4QSU A;  1Z60 A;  5KHM A;  3DPL R;  5A85 A;  4N4F A;  4TT2 A;  4CLB A;  2R10 A;  4Q0N A;  4PY6 A;  2RSD A;  3ZNI A;  2KGG A;  1DVP A;  1T1H A;  4LK9 A;  5LVR A;  5CQT A;  5F36 A;  3P1E A;  2L80 A;  3JVM A;  5COI A;  3M62 A;  5D3H A;  3U5P A;  2XB1 A;  5LKZ A;  3U5L A;  2RI7 A;  5A5P A;  2RNX A;  4QSS A;  2I8N A;  4QUU A;  5D7X A;  5DW1 A;  4MEP A;  4O7B A;  5DKC A;  5ENE A;  1WE9 A;  4I7B A;  5ACY A;  3VK6 A;  4O70 A;  4OGI A;  4QSQ A;  2YUR A;  4XY9 A;  2FSA A;  2RNY A;  3U5K A;  1WGM A;  4UP0 A;  4TKP B;  5IGM A;  1XWH A;  3UVW A;  1Z6U A;  2H0D A;  3KQI A;  4QSX A;  3K2J A;  5DYX A;  3ZYU A;  3P1C A;  5FE7 A;  2DX8 A;  5FH8 A;  2JMJ A;  3L1X A;  1VFY A;  4PCI A;  1HYJ A;  2LXH C;  1ZS5 A;  5CQ8 A;  2F6N A;  2L75 A;  5IID A;  3IHP A;  3N9L A;  1EQF A;  5D25 A;  2L5E A;  5A5Q A;  4O74 A;  2MD8 C;  3ZTG A;  5BT3 A;  5DKH A;  4QYD A;  5FE2 A;  3TLP A;  3HMH A;  5F25 A;  4NQN A;  1HYI A;  5TRB A;  2OSS A;  5EWH A;  3ZVY A;  5ENJ A;  3U5J A;  4QY4 A;  1ZBD B;  3U5M A;  4LDF A;  5HJC A;  1WEW A;  5E9Y A;  2QJ0 A;  4CUU A; 
#chains in the Genus database with same CATH topology
 5HM0 A;  5A5S A;  2VJF A;  4MR5 A;  4HBW A;  3VKG A;  5CUD A;  5F5Z A;  5II1 A;  5L8T A;  4GNF A;  4MEO A;  5DKD A;  5I89 A;  3P5O A;  3UVD A;  4ZC9 A;  2LGG A;  5KH3 A;  5I88 A;  5I7X A;  5CUG A;  5G4S A;  2ECI A;  2LXP C;  3U5N A;  4A9N A;  3JVK A;  2ECN A;  5DBM A;  3HTK C;  5B79 A;  4WHW A;  5H1V A;  5EYA F;  2M3H A;  3QZS A;  5A5R A;  3FL2 A;  4HXM A;  3MDB C;  3SOU A;  4UYE A;  5CUE A;  3JVL A;  4F3I A;  2LGL A;  5SVY A;  5FE1 A;  5AME A;  2FD4 A;  5E9K A;  3KV5 A;  4QBM A;  4QSR A;  2E6R A;  3P1F A;  1WEV A;  4CFL A;  5F60 A;  4V3L C;  4A4B A;  5B75 A;  3MQM A;  5G04 B;  4L7X A;  2NXB A;  4YAD A;  2E7N A;  4O71 A;  4NRC A;  2MUM A;  5CQA A;  5JI8 A;  2XP0 A;  5FE6 A;  3T9K A;  3HCT A;  2KWK A;  5CP5 A;  2RR4 A;  2LGV A;  4A9K A;  4OGJ A;  4UI9 B;  1X0J A;  1V87 A;  4P5O B;  5L8U A;  5TB6 A;  5E9I A;  5FDZ A;  4PKL A;  4UIX A;  4A9F A;  5AMF A;  4UIU A;  5CUA A;  5SVI A;  5B76 A;  4R8P K;  3M63 A;  4OUF A;  3UV2 A;  2KYU A;  3IU6 A;  4A9H A;  4AP4 A;  4CUQ A;  3MUK A;  2MD7 B;  2ZET C;  4I7D A;  4IR5 A;  4BBQ A;  5FE4 A;  2D8S A;  4GB0 A;  5C13 A;  4YBT A;  2DVS A;  5DYC A;  5EK9 A;  5IGN A;  4TYL A;  4NR6 A;  4C67 A;  4AVX A;  2EGP A;  4NR5 A;  4QSW A;  2KFT A;  2VPB A;  2Y1N A;  1JM7 B;  2FFW A;  3FEH A;  5K29 A;  5F62 A;  2R0Y A;  3SOX A;  2L84 A;  2YSM A;  4UP5 A;  1LDK C;  4NUD A;  4NS5 A;  3G0L A;  4QEV A;  4NYW A;  4NRB A;  5DKA A;  4YC9 A;  4FIP A;  3T7L A;  5EGU A;  4QF3 A;  5F3A A;  5LCW B;  3LJU X;  4Z0R A;  5DYU A;  5L96 A;  1JM4 B;  2EXU A;  5D1M B;  4A9O A;  4O75 A;  5E3D A;  5A7C A;  4YAX A;  2AN6 A;  4Y03 A;  5D3S A;  2YW8 A;  1X4I A;  2CT2 A;  5ETB A;  2B0O E;  4MVT A;  2KR4 A;  3HME A;  4X3G A;  3SVG A;  3N9O A;  5KTW A;  4I7C A;  4R2Y A;  4WIV A;  4O72 A;  2BAY A;  5F2P A;  4N4I A;  4HBV A;  2IDA A;  5E9M A;  3UVX A;  4YYK A;  3MUL A;  2H0D B;  2L5U A;  4YAB A;  5D3R A;  4NR9 A;  4MEN A;  5LKT A;  1JM7 A;  4LAD B;  5AIT A;  4LZS A;  4A4C A;  5IG6 A;  2DWW A;  2XEU A;  4NXJ A;  3RPG C;  3O36 A;  4LYW A;  4NYX A;  2RFJ A;  5E74 A;  5HQ5 A;  4H9D A;  3L11 A;  2M85 A;  4O64 A;  4NRA A;  2KGI A;  4X2I A;  5C11 A;  2DVQ A;  2OO1 A;  4MEQ A;  4Z6H A;  3N9Q A;  1CHC A;  5FE0 A;  2MA5 A;  3GL6 A;  3H7H A;  1N72 A;  5HQ7 A;  2CKL A;  3V43 A;  5EPB A;  4AYC B;  2KKX A;  5CS8 A;  4QB3 A;  4QEW A;  5DW2 A;  1WEQ A;  5FEY A;  3PHD A;  2YEK A;  2IQJ A;  4UIY A;  2QIC A;  5ETD A;  3N9M A;  2VJF B;  5F63 A;  5I80 A;  5FFV A;  3LVR E;  2G6Q A;  4FJC A;  5EV9 A;  1N87 A;  2YYR A;  5KTX A;  3EB5 A;  5LKX A;  4GNG A;  2MNY A;  4IR3 A;  2MIQ A;  5D3P A;  3EB6 A;  5D26 A;  5IGK A;  2VJE B;  4TU4 A;  5LUU A;  4B7Y C;  2JMD A;  3P1D A;  4J0S A;  1WIM A;  2C2V S;  4HXS A;  2LQ6 A;  2M13 A;  2CRR A;  5EWD A;  5J0D A;  5TDR A;  5KTU A;  1WEN A;  4MR3 A;  4QYL A;  2DSM A;  3NXB A;  4MR6 A;  5C7N A;  4AYC A;  2H60 A;  5LVQ A;  5DFD A;  1F68 A;  5CUB A;  1WUG A;  4XUA A;  3O47 A;  5SVI B;  4C9Z A;  5FB0 A;  2EOD A;  4N4G A;  1WEP A;  4F1P A;  4QC3 A;  3ZYQ A;  5JG6 A;  2VJE A;  2YYN A;  2DAT A;  3KDE C;  3KNV A;  1WEM A;  2I7K A;  4BHW A;  5LJ1 A;  2MNZ A;  4CUT A;  2MT5 A;  3FM8 C;  1E6I A;  2MJV B;  5E3G A;  5FH7 A;  3UV4 A;  2CSY A;  4TZ8 A;  2XOZ A;  5KH7 A;  5CGP A;  4NR8 A;  4Q0O A;  2YSJ A;  5CTL A;  2YHO A;  2VP7 A;  4O77 A;  2YUC A;  2L85 A;  1FP0 A;  5D1L B;  4O7F A;  4TT4 A;  4YYN A;  5I86 A;  5D24 A;  2VPG A;  2KIZ A;  3U5O A;  1WFK A;  4A0C D;  2D82 A;  4QSV A;  4BW1 A;  3LRQ A;  2K1J A;  4L58 A;  4PPE A;  4J0R A;  4GPJ A;  2LSP B;  3HCS A;  5F1L A;  2M1R A;  5I1Q A;  4XY8 A;  5IBN A;  4AKI A;  4CUR A;  5A82 A;  1K2F A;  4FO9 A;  4QR3 A;  5K3Q A;  5I7Y A;  1X4J A;  3DAI A;  4HXR A;  5E73 A;  5FG6 A;  4NN2 A;  2ECT A;  4WZ2 A;  4NR4 A;  4IOR A;  5EQ1 A;  5KH9 A;  3LQH A;  5L98 A;  1ZKR A;  2KE1 A;  4QC1 A;  3QZT A;  4YH4 A;  4YYM A;  4BW3 A;  5D3L A;  4QF2 A;  2G4A A;  2N9G A;  3IU5 A;  4NYV A;  4TTE A;  5EA1 A;  5ENF A;  1Z2Q A;  2UZG A;  5CU8 A;  3M99 A;  5EM3 A;  4QNS A;  3RPG B;  4UYF B;  2ECW A;  1FBV A;  2ECG A;  4N4H A;  4MR4 A;  5G05 B;  5D3J A;  3RTR B;  3LQJ A;  3PUR A;  2EGM A;  4XI1 A;  5HRX A;  5D3T A;  5TBN A;  2L7P A;  4ZUX U;  1WES A;  1X4U A;  4ZDT A;  1U6G B;  4F52 B;  5L97 A;  3E2D A;  3GG3 A;  1WUM A;  5A5O A;  5TAB A;  3M7K A;  5FER A;  5EWC A;  5D0C A;  3SVF A;  2PUY A;  2K16 A;  5EP7 A;  3UVY A;  2CKL B;  1LDJ B;  3Q1D A;  1G25 A;  5HEN A;  3MB3 A;  5F61 A;  5A81 A;  4NUE A;  3FKM X;  4QR4 A;  5EWV A;  5DIN A;  4QZS A;  4UYG A;  2KKY A;  5CRM A;  4HBX A;  5HRV A;  5C89 A;  5EIS A;  5H1U A;  1RMD A;  4E96 A;  4UYD A;  4YBS A;  4IC2 A;  2KTB B;  5EPR A;  4UYF A;  2EA6 A;  3QZV A;  2ECJ A;  2L0B A;  5DLZ A;  2M6M A;  3ZVZ B;  4BW4 A;  3O37 A;  2YEL A;  5D3N A;  5TDW A;  5EVA A;  4IOO A;  2LDR A;  2DJA A;  3LDY A;  4O78 A;  2Y1M A;  4LJN A;  2R0V A;  4O7E A;  2G43 A;  4Z93 A;  5CQ5 A;  4WHU A;  3FAO A;  4UIV A;  4RVR A;  2DVR A;  4LZ2 A;  1BOR A;  5FFY A;  5CUC A;  2YQD A;  1WEE A;  4DON A;  5E7D A;  3SOW A;  3MHS A;  2OUO A;  5L99 A;  2C2L A;  3LVQ E;  4OGC A;  2HYE D;  3VKH A;  3DQV R;  3I3J A;  4HXN A;  5CQ7 A;  2D9E A;  1DCQ A;  5AIU A;  3UW9 A;  4J3I A;  5DLX A;  4A9L A;  4OGE A;  4AUQ B;  1E4U A;  3MXF A;  5FE3 A;  5FE8 A;  4QST A;  4AKN A;  4YY4 A;  2YU4 A;  4TU6 A;  1WIL A;  4ZQL A;  4HXP A;  4QUT A;  2G45 A;  4Z1Q A;  5LJ2 A;  2XOY A;  1MM3 A;  3HMF A;  4QEU A;  4YYJ A;  4S3O C;  4WA6 A;  4LZR A;  2E6S A;  4BJX A;  4QSP A;  5AD3 A;  5KU3 A;  4NQM A;  5ENB A;  5B78 A;  3D1D A;  4PTB A;  4CA1 A;  5FG5 A;  4HXO A;  5CY9 A;  5ENH A;  5FH6 A;  5A5N A;  5I40 A;  2L43 A;  2LGK A;  4V3K C;  3SUB A;  2F42 A;  4LR6 A;  2I50 A;  2FUU A;  2KWN A;  5BT5 A;  3FAN A;  3I2D A;  2JMI A;  4Q6F A;  4IC3 A;  2OXQ C;  5C87 A;  3DWD A;  4O7A A;  5FBX A;  5SVX A;  2E7O A;  2YT5 A;  5DFC A;  2NAA A;  3JVJ A;  5HEL A;  5FE9 A;  3DDT A;  3ERR A;  4R7E A;  3D1B A;  4TZ2 A;  1IYM A;  5I29 A;  3ONI A;  2KU3 A;  2YRE A;  3C5K A;  2RS9 B;  1JSP B;  5HCL A;  4UYH A;  1VD4 A;  4TT6 A;  4O62 A;  4CL9 A;  5CQ3 A;  4IR6 A;  4PS5 A;  2YW5 A;  2JUN A;  2YQL A;  3O7A A;  3SVH A;  4TS8 A;  5J3X A;  2GRC A;  4NR7 A;  4FK5 A;  4AKG A;  2P57 A;  3ZPV 1;  5TCM A;  4LYS A;  5C85 A;  5HFR A;  2VNF A;  5EIC A;  3AAD A;  5EWW A;  5II2 A;  5HRW A;  4CCG X;  3MB4 A;  4UIW A;  4HXK A;  2MKE A;  3JUE A;  3S92 A;  5H1T A;  2MA6 A;  4ALH A;  4WZ3 B;  4UIT A;  2KRE A;  4NUC A;  4UIZ A;  4BW2 A;  5FFW A;  2CON A;  4IOQ A;  2Y43 A;  4O76 A;  3C6W A;  3LXJ A;  4QR5 A;  2YVR A;  2VPD A;  3GV4 A;  2DKW A;  2ECV A;  3N9N A;  3O70 A;  1VYX A;  5G4R A;  2KWO A;  5EU1 A;  4YYG A;  4LLB A;  2VPE A;  5AD2 A;  2LN0 A;  1MM2 A;  4W4U A;  1WEO A;  4YAT A;  2CSV A;  5I3L A;  5E9V A;  4A9E A;  2LV9 A;  4C66 A;  4Z1S A;  2R0S A;  5C8G A;  2CSZ A;  4ZW1 A;  5B77 A;  2PNX A;  4HXL A;  4O7C A;  3ASL A;  4Z6I A;  3SHB A;  4FLP A;  2QIZ A;  2DVV A;  3O34 A;  3S91 A;  2LRI C;  5EI4 A;  4AKH A;  3N9P A;  4A9J A;  5FE5 A;  5ENG A;  4A49 A;  5FG4 A;  3G0J A;  3UV5 A;  4IR4 A;  4LYI A;  4YYD A;  3ZPV E;  5DYA A;  5DX4 A;  5ENI A;  5CZG A;  4YK0 A;  5CRZ A;  3RCW A;  4A9I A;  3HCU A;  3AQA A;  4MSX A;  4AI6 A;  3DWY A;  3Q2E A;  5F1H A;  4XYA A;  2XOC A;  3LJW A;  4HBY A;  4CUS A;  2YQM A;  5EPS A;  5LKU A;  2YEM A;  3D7C A;  2HDP A;  4N3W A;  2D8U A;  4GND A;  1WEU A;  5I83 A;  5E0R A;  4A9M A;  2RO1 A;  2WP2 A;  5HEM A;  3PUQ A;  4GNE A;  3T6R A;  4YY6 A;  2K4D A;  4S3O B;  5DFB A;  4CUP A;  5HLS A;  2OWA A;  5G0F A;  2K17 A;  5B8D A;  2E3K A;  2WP1 A;  2KWJ A;  4CFK A;  5H85 A;  4YYH A;  3NG2 A;  4TQN A;  2YDW A;  5CPE A;  5CFW A;  5JWM A;  3MHH A;  5BT4 A;  5DY7 A;  5FB1 A;  2FUI A;  3LQI A;  5C4Q A;  4LRG A;  4YH3 A;  5KO4 A;  4YBM A;  5CQ6 A;  5ENC A;  5IGL A;  4J1P A;  5D1K B;  4KCX A;  5E9L A;  2LAU A;  1MBM A;  4KV4 A;  2JRJ A;  4YYI A;  3Q2F A;  5CQ4 A;  2YHN A;  2EJN A;  2CRW A;  5A83 A;  4ALG A;  2E61 A;  4QQ4 A;  3L1Z B;  4LKA A;  1F62 A;  5H9M A;  3O35 A;  4KV1 A;  5HFQ A;  2RNW A;  4B86 C;  5LJ0 A;  4LC2 A;  4PCE A;  4WZ0 A;  3O33 A;  4XUB A;  1JOC A;  3KV6 A;  2F6J A;  5HQ6 A;  4QSU A;  1Z60 A;  5KHM A;  3DPL R;  5A85 A;  4N4F A;  4TT2 A;  4CLB A;  2R10 A;  4Q0N A;  4PY6 A;  2RSD A;  3ZNI A;  2KGG A;  1DVP A;  1T1H A;  4LK9 A;  5LVR A;  5CQT A;  5F36 A;  3P1E A;  2L80 A;  3JVM A;  5COI A;  3M62 A;  5D3H A;  3U5P A;  2XB1 A;  5LKZ A;  3U5L A;  2RI7 A;  5A5P A;  2RNX A;  4QSS A;  2I8N A;  4QUU A;  5D7X A;  5DW1 A;  4MEP A;  4O7B A;  5DKC A;  5ENE A;  1WE9 A;  4I7B A;  5ACY A;  3VK6 A;  4O70 A;  4OGI A;  4QSQ A;  2YUR A;  4XY9 A;  2FSA A;  2RNY A;  3U5K A;  1WGM A;  4UP0 A;  4TKP B;  5IGM A;  1XWH A;  3UVW A;  3FJU B;  1Z6U A;  2H0D A;  3KQI A;  4QSX A;  3K2J A;  5DYX A;  3ZYU A;  3P1C A;  5FE7 A;  2JM3 A;  2DX8 A;  5FH8 A;  2JMJ A;  3L1X A;  1VFY A;  4PCI A;  1HYJ A;  2LXH C;  1ZS5 A;  5CQ8 A;  2F6N A;  2L75 A;  5IID A;  3IHP A;  4Z0O A;  3PLW A;  3N9L A;  1EQF A;  5D25 A;  2L5E A;  5A5Q A;  4O74 A;  2MD8 C;  3ZTG A;  5BT3 A;  5DKH A;  4QYD A;  5FE2 A;  3TLP A;  3HMH A;  5F25 A;  4NQN A;  1HYI A;  5TRB A;  2OSS A;  1PUO A;  5EWH A;  3ZVY A;  5ENJ A;  3U5J A;  4QY4 A;  1ZBD B;  3U5M A;  4LDF A;  5HJC A;  1WEW A;  5E9Y A;  2QJ0 A;  4CUU A; 
#chains in the Genus database with same CATH homology
 5HM0 A;  5A5S A;  2VJF A;  4MR5 A;  4HBW A;  4GNF A;  5CUD A;  5F5Z A;  5II1 A;  5L8T A;  4MEO A;  5DKD A;  5I89 A;  3P5O A;  3UVD A;  4ZC9 A;  2LGG A;  5KH3 A;  5I88 A;  5I7X A;  5CUG A;  5G4S A;  2ECI A;  2LXP C;  3U5N A;  4A9N A;  3JVK A;  2ECN A;  5DBM A;  3HTK C;  5B79 A;  4WHW A;  5H1V A;  5EYA F;  2M3H A;  3QZS A;  5A5R A;  3FL2 A;  4HXM A;  3SOU A;  4UYE A;  5CUE A;  3JVL A;  4F3I A;  2LGL A;  5FE1 A;  5AME A;  5E9K A;  3KV5 A;  4QBM A;  4QSR A;  2E6R A;  3P1F A;  1WEV A;  4CFL A;  5F60 A;  4V3L C;  4A4B A;  5B75 A;  3MQM A;  5G04 B;  4L7X A;  2NXB A;  4YAD A;  2E7N A;  4O71 A;  4NRC A;  2MUM A;  5CQA A;  5JI8 A;  5FE6 A;  3HCT A;  2KWK A;  5CP5 A;  2LGV A;  4A9K A;  4OGJ A;  4UI9 B;  1X0J A;  1V87 A;  4P5O B;  5L8U A;  5TB6 A;  5E9I A;  5FDZ A;  4PKL A;  4UIX A;  4A9F A;  5AMF A;  4UIU A;  5CUA A;  4R8P K;  5B76 A;  3M63 A;  4OUF A;  3UV2 A;  2KYU A;  3IU6 A;  4A9H A;  4AP4 A;  4CUQ A;  3MUK A;  2MD7 B;  2ZET C;  4I7D A;  4IR5 A;  4BBQ A;  5FE4 A;  2D8S A;  4GB0 A;  5C13 A;  4YBT A;  2DVS A;  5DYC A;  5EK9 A;  5IGN A;  4TYL A;  4NR6 A;  4C67 A;  4AVX A;  2EGP A;  4NR5 A;  4QSW A;  2KFT A;  2VPB A;  2Y1N A;  1JM7 B;  5K29 A;  5F62 A;  2R0Y A;  3SOX A;  2L84 A;  2YSM A;  1LDK C;  4NUD A;  4NS5 A;  3G0L A;  4QEV A;  4NYW A;  4NRB A;  5DKA A;  4YC9 A;  4FIP A;  3T7L A;  5EGU A;  4QF3 A;  5F3A A;  5LCW B;  5DYU A;  5L96 A;  1JM4 B;  5D1M B;  4A9O A;  4O75 A;  5E3D A;  5A7C A;  4YAX A;  2AN6 A;  4Y03 A;  5D3S A;  2YW8 A;  1X4I A;  2CT2 A;  5ETB A;  4MVT A;  2KR4 A;  3HME A;  4X3G A;  3SVG A;  3N9O A;  5KTW A;  4I7C A;  4R2Y A;  4WIV A;  4O72 A;  2BAY A;  5F2P A;  4N4I A;  4HBV A;  2IDA A;  5E9M A;  3UVX A;  4YYK A;  3MUL A;  2H0D B;  2L5U A;  4YAB A;  5D3R A;  4NR9 A;  4MEN A;  5LKT A;  1JM7 A;  4LAD B;  5AIT A;  4LZS A;  4A4C A;  5IG6 A;  2DWW A;  2XEU A;  4NXJ A;  3RPG C;  3O36 A;  4LYW A;  4NYX A;  2RFJ A;  5E74 A;  5HQ5 A;  3L11 A;  2M85 A;  4O64 A;  4NRA A;  2KGI A;  4X2I A;  5C11 A;  2DVQ A;  2OO1 A;  4MEQ A;  4Z6H A;  3N9Q A;  1CHC A;  5FE0 A;  2MA5 A;  3GL6 A;  1N72 A;  5HQ7 A;  2CKL A;  3V43 A;  5EPB A;  4AYC B;  5CS8 A;  4QB3 A;  4QEW A;  5DW2 A;  1WEQ A;  5FEY A;  3PHD A;  2YEK A;  2QIC A;  4UIY A;  5ETD A;  3N9M A;  2VJF B;  5F63 A;  5I80 A;  5FFV A;  2G6Q A;  4FJC A;  5EV9 A;  1N87 A;  2YYR A;  5KTX A;  3EB5 A;  5LKX A;  4GNG A;  2MNY A;  4IR3 A;  2MIQ A;  5D3P A;  3EB6 A;  5D26 A;  5IGK A;  2VJE B;  4TU4 A;  5LUU A;  4B7Y C;  2JMD A;  3P1D A;  4J0S A;  1WIM A;  2C2V S;  4HXS A;  2LQ6 A;  5EWD A;  5J0D A;  5TDR A;  5KTU A;  1WEN A;  4MR3 A;  4QYL A;  3NXB A;  4MR6 A;  5C7N A;  4AYC A;  2H60 A;  5LVQ A;  5DFD A;  1F68 A;  5CUB A;  1WUG A;  4XUA A;  4C9Z A;  5FB0 A;  2EOD A;  4N4G A;  1WEP A;  4QC3 A;  3ZYQ A;  5JG6 A;  2VJE A;  2YYN A;  2DAT A;  3KNV A;  1WEM A;  2I7K A;  4BHW A;  5LJ1 A;  2MNZ A;  4CUT A;  2MT5 A;  4UP5 A;  1E6I A;  2MJV B;  5E3G A;  5FH7 A;  3UV4 A;  2CSY A;  4TZ8 A;  5KH7 A;  5CGP A;  4NR8 A;  4Q0O A;  2YSJ A;  5CTL A;  2YHO A;  2VP7 A;  4O77 A;  2YUC A;  2L85 A;  1FP0 A;  5D1L B;  4O7F A;  4TT4 A;  4YYN A;  5I86 A;  5D24 A;  2VPG A;  2KIZ A;  3U5O A;  1WFK A;  4A0C D;  2D82 A;  4QSV A;  4BW1 A;  3LRQ A;  2K1J A;  4L58 A;  4PPE A;  4J0R A;  4GPJ A;  2LSP B;  3HCS A;  5F1L A;  2M1R A;  5I1Q A;  4XY8 A;  5IBN A;  4FO9 A;  4CUR A;  5A82 A;  1K2F A;  4QR3 A;  5I7Y A;  1X4J A;  3DAI A;  4HXR A;  5E73 A;  5FG6 A;  4NN2 A;  2ECT A;  4WZ2 A;  4NR4 A;  4IOR A;  5EQ1 A;  5KH9 A;  3LQH A;  5L98 A;  2KE1 A;  4QC1 A;  3QZT A;  4YH4 A;  4YYM A;  4BW3 A;  5D3L A;  4QF2 A;  2G4A A;  2N9G A;  3IU5 A;  4NYV A;  4TTE A;  5EA1 A;  5ENF A;  1Z2Q A;  2UZG A;  5CU8 A;  3M99 A;  5EM3 A;  4QNS A;  3RPG B;  4UYF B;  2ECW A;  1FBV A;  2ECG A;  4N4H A;  4MR4 A;  5G05 B;  5D3J A;  3RTR B;  3LQJ A;  3PUR A;  4XI1 A;  5HRX A;  5D3T A;  5TBN A;  4ZUX U;  1WES A;  1X4U A;  4ZDT A;  1U6G B;  4F52 B;  5L97 A;  3GG3 A;  1WUM A;  5A5O A;  5TAB A;  5FER A;  5EWC A;  5D0C A;  3SVF A;  2PUY A;  2K16 A;  5EP7 A;  3UVY A;  2CKL B;  1LDJ B;  1G25 A;  5HEN A;  3MB3 A;  5F61 A;  5A81 A;  4NUE A;  3FKM X;  4QR4 A;  5EWV A;  5DIN A;  4QZS A;  4UYG A;  5CRM A;  4HBX A;  5HRV A;  5C89 A;  5EIS A;  5H1U A;  1RMD A;  4E96 A;  4UYD A;  4YBS A;  4IC2 A;  2KTB B;  5EPR A;  4UYF A;  2EA6 A;  3QZV A;  2ECJ A;  2L0B A;  5DLZ A;  2M6M A;  3ZVZ B;  4BW4 A;  3O37 A;  2YEL A;  5D3N A;  5TDW A;  5EVA A;  4IOO A;  2LDR A;  4O78 A;  2Y1M A;  4LJN A;  2R0V A;  4O7E A;  2G43 A;  4Z93 A;  5CQ5 A;  4WHU A;  4UIV A;  4RVR A;  2DVR A;  4LZ2 A;  1BOR A;  5FFY A;  5CUC A;  2YQD A;  1WEE A;  4DON A;  5E7D A;  3SOW A;  3MHS A;  2OUO A;  5L99 A;  2C2L A;  2HYE D;  3DQV R;  3I3J A;  4HXN A;  5CQ7 A;  2D9E A;  5AIU A;  3UW9 A;  4J3I A;  5DLX A;  4A9L A;  4AUQ B;  1E4U A;  3MXF A;  5FE3 A;  5FE8 A;  4QST A;  4AKN A;  4YY4 A;  2YU4 A;  4TU6 A;  1WIL A;  4ZQL A;  4HXP A;  4QUT A;  2G45 A;  4Z1Q A;  5LJ2 A;  1MM3 A;  3HMF A;  4QEU A;  4YYJ A;  4S3O C;  4WA6 A;  4LZR A;  2E6S A;  4BJX A;  4QSP A;  5AD3 A;  5KU3 A;  4NQM A;  5ENB A;  5B78 A;  4PTB A;  4CA1 A;  5FG5 A;  4HXO A;  5CY9 A;  5ENH A;  5FH6 A;  5A5N A;  5I40 A;  2L43 A;  2LGK A;  4V3K C;  2F42 A;  4LR6 A;  2I50 A;  2FUU A;  2KWN A;  5BT5 A;  3I2D A;  2JMI A;  4Q6F A;  4IC3 A;  2OXQ C;  5C87 A;  4O7A A;  5FBX A;  2E7O A;  2YT5 A;  5DFC A;  2NAA A;  3JVJ A;  5HEL A;  5FE9 A;  4R7E A;  1IYM A;  4TZ2 A;  5I29 A;  3ONI A;  2KU3 A;  2YRE A;  3C5K A;  2RS9 B;  1JSP B;  5HCL A;  4UYH A;  1VD4 A;  4TT6 A;  4CL9 A;  5CQ3 A;  4IR6 A;  4PS5 A;  2YW5 A;  2YQL A;  3O7A A;  3SVH A;  4TS8 A;  5J3X A;  2GRC A;  4NR7 A;  4FK5 A;  3ZPV 1;  5TCM A;  4LYS A;  5C85 A;  5HFR A;  2VNF A;  5EIC A;  3AAD A;  5EWW A;  5II2 A;  5HRW A;  4CCG X;  3MB4 A;  4UIW A;  4HXK A;  3S92 A;  5H1T A;  2MA6 A;  4ALH A;  4WZ3 B;  4UIT A;  2KRE A;  4NUC A;  4UIZ A;  4BW2 A;  5FFW A;  4IOQ A;  2Y43 A;  4O76 A;  3C6W A;  3LXJ A;  4QR5 A;  2VPD A;  3GV4 A;  2DKW A;  2ECV A;  3N9N A;  3O70 A;  1VYX A;  5G4R A;  2KWO A;  5EU1 A;  4YYG A;  4LLB A;  2VPE A;  5AD2 A;  2LN0 A;  1MM2 A;  4W4U A;  1WEO A;  4YAT A;  5I3L A;  5E9V A;  4A9E A;  2LV9 A;  4C66 A;  4Z1S A;  2R0S A;  5C8G A;  2CSZ A;  4ZW1 A;  5B77 A;  2PNX A;  4HXL A;  4O7C A;  3ASL A;  4Z6I A;  3SHB A;  4FLP A;  2QIZ A;  2DVV A;  3O34 A;  3S91 A;  2LRI C;  5EI4 A;  3N9P A;  4A9J A;  5FE5 A;  5ENG A;  4A49 A;  5FG4 A;  3G0J A;  3UV5 A;  4IR4 A;  4LYI A;  4YYD A;  3ZPV E;  5DYA A;  5DX4 A;  5ENI A;  5CZG A;  4YK0 A;  5CRZ A;  3RCW A;  4A9I A;  3HCU A;  3AQA A;  4MSX A;  3DWY A;  3Q2E A;  5F1H A;  4XYA A;  3LJW A;  4HBY A;  4CUS A;  2YQM A;  5EPS A;  5LKU A;  2YEM A;  3D7C A;  2HDP A;  4N3W A;  4GND A;  1WEU A;  5I83 A;  5E0R A;  4A9M A;  2RO1 A;  2WP2 A;  5HEM A;  3PUQ A;  4GNE A;  3T6R A;  4YY6 A;  2K4D A;  4S3O B;  5DFB A;  4CUP A;  5HLS A;  5B8D A;  5G0F A;  2K17 A;  2E3K A;  2WP1 A;  2KWJ A;  4CFK A;  5H85 A;  4YYH A;  3NG2 A;  4TQN A;  2YDW A;  5CPE A;  5CFW A;  5JWM A;  3MHH A;  5BT4 A;  5DY7 A;  5FB1 A;  2FUI A;  3LQI A;  5C4Q A;  4LRG A;  4YH3 A;  5KO4 A;  4YBM A;  5CQ6 A;  5ENC A;  5IGL A;  4J1P A;  5D1K B;  4KCX A;  5E9L A;  4KV4 A;  2JRJ A;  4YYI A;  3Q2F A;  5CQ4 A;  2YHN A;  5A83 A;  4ALG A;  3L1Z B;  4LKA A;  1F62 A;  5H9M A;  3O35 A;  4KV1 A;  5HFQ A;  2RNW A;  4B86 C;  5LJ0 A;  4LC2 A;  4PCE A;  4WZ0 A;  3O33 A;  4XUB A;  1JOC A;  3KV6 A;  2F6J A;  5HQ6 A;  4QSU A;  1Z60 A;  5KHM A;  3DPL R;  5A85 A;  4N4F A;  4TT2 A;  4CLB A;  2R10 A;  4Q0N A;  4PY6 A;  2RSD A;  3ZNI A;  2KGG A;  1DVP A;  1T1H A;  4LK9 A;  5LVR A;  5CQT A;  5F36 A;  3P1E A;  2L80 A;  3JVM A;  5COI A;  3M62 A;  5D3H A;  3U5P A;  2XB1 A;  5LKZ A;  3U5L A;  2RI7 A;  5A5P A;  2RNX A;  4QSS A;  2I8N A;  4QUU A;  5D7X A;  5DW1 A;  4MEP A;  4O7B A;  5DKC A;  5ENE A;  1WE9 A;  4I7B A;  5ACY A;  3VK6 A;  4O70 A;  4OGI A;  4QSQ A;  2YUR A;  4XY9 A;  2FSA A;  2RNY A;  3U5K A;  1WGM A;  4UP0 A;  4TKP B;  5IGM A;  1XWH A;  3UVW A;  1Z6U A;  2H0D A;  3KQI A;  4QSX A;  3K2J A;  5DYX A;  3ZYU A;  3P1C A;  5FE7 A;  2DX8 A;  5FH8 A;  2JMJ A;  3L1X A;  1VFY A;  4PCI A;  1HYJ A;  2LXH C;  1ZS5 A;  5CQ8 A;  2F6N A;  2L75 A;  5IID A;  3IHP A;  3N9L A;  1EQF A;  5D25 A;  2L5E A;  5A5Q A;  4O74 A;  2MD8 C;  3ZTG A;  5BT3 A;  5DKH A;  4QYD A;  5FE2 A;  3TLP A;  3HMH A;  5F25 A;  4NQN A;  1HYI A;  5TRB A;  2OSS A;  5EWH A;  3ZVY A;  5ENJ A;  3U5J A;  4QY4 A;  1ZBD B;  3U5M A;  4LDF A;  5HJC A;  1WEW A;  5E9Y A;  2QJ0 A;  4CUU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...