1A0KA

Profilin i from arabidopsis thaliana
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
130
structure length
130
Chain Sequence
SWQSYVDDHLMCDVEGNHLTAAAILGQDGSVWAQSAKFPQLKPQEIDGIKKDFEEPGFLAPTGLFLGGEKYMVIQGEQGAVIRGKKGPGGVTIKKTNQALVFGFYDEPMTGGQCNLVVERLGDYLIESEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cytoskeleton
molecule keywords PROFILIN
publication title The crystal structure of a major allergen from plants.
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 34
structure length 130
sequence length 130
ec nomenclature
pdb deposition date 1997-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00235 Profilin Profilin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.30 Alpha Beta 2-Layer Sandwich Beta-Lactamase Dynein light chain 2a, cytoplasmic 1a0kA00
2ACGA 2JKFA 1HLUP 1G5UA 3KYEA 3UB5P 1ACFA 1FIKA 1AWIA 3CHWP 2PAVP 1VETA 1Y4OA 3L7HA 3T12B 2HZ5A 1VEUA 4FTXA 3U4LP 3NULA 1PRQA 1SKOA 1PNEA 5FDSA 1K0KA 3T1QB 2PBDP 2E8JA 4X1LA 4ESPA 3LEQA 2JKGA 1A0KA 3CPTB 3D9YA 3NECA 5EM1A 5EVEA 2VK3A 2BTFP 3MSHA 2ZL1B 1SZVA 4D60A 4QWOA 4FUWA 4X25A 2V8FA 2PRFA 1Z09A 3MS6A 1VETB 1F2KA 1CJFA 1VEUB 4X1MA 2B95A 3L9KA 5FEFA 3DAVA 1CQAA 1D1JA 1YPRA 3T1XA 5EV0A 1J3WA 1SKOB 2V8CA 5FEGA 1CF0A 5EM0A 3CPTA 3T1RA 1PFLA 3T1SA 2ZL1A 3LGOA 1FILA
chains in the Genus database with same CATH superfamily
1TVFA 1M6KA 5MC7A 3G32A 3IWOA 4PM5A 3KSFA 5D3OA 1YM1A 1XGIA 1CEGA 1PI5A 5EOOA 4GS9A 3L7HA 3C7VA 4DE2A 2W1RA 3Q82A 3ZG9B 3VMAA 1MWUA 1PYYA 4L0LA 1HZOA 3O86A 3TJZC 1OTDA 1CI8A 3LIDA 4I5SA 2DRWA 5FDSA 1TEMA 3W4PA 2J8YA 2XH9A 3UB9A 3ZGAB 2ZQDA 3TOIA 3A0VA 3BLMA 5CEBA 5FI7A 3EEHA 3CJMA 3RFBA 1EW0A 3G30A 4EEPA 4Q0IA 3BFEA 1CK3A 4KZBA 5L07A 4P6ZM 2HGVA 3CMZA 3WS2A 4WUJA 5E2EA 3M2JA 5A90A 2ZM0A 5DTTA 5AVFA 3MF0A 2XDMA 1J9MA 5TFQA 3PR6A 1E3UA 1YKDA 5DKKA 4WELA 1FR1A 5FAPA 1OJGA 1P97A 2OWJA 1JWPA 5FQQA 1TS0A 3ZVWA 1ZG4A 4UHUA 5EVIA 1LLBA 3M6HA 3UO9A 3CPTA 1PIOA 1WYCA 3PBSA 4EQ1A 4GKUA 2XROA 2EWVA 2XRNA 1K56A 4GJ4A 5FATA 2JKGA 2GJ3A 3TSGA 3BFGA 4GOGA 1DRMA 1NYYA 3A3IA 4BLMA 3MJQA 2VV6A 3UB5P 3CWFA 3MXRA 3GTCA 2X01A 4EWFA 1BLPA 2EX8A 2QPNA 4R70A 1W5DA 2YKFA 4BBTA 3R7WA 3VOYA 2HDQA 2J7VA 3GVBA 3UMDA 3ULFA 4OPRA 3MQ0A 3MR0A 1LHYA 1E25A 3PBNA 4BMWA 4HOIA 1L0FA 2GX5A 5HDSA 3E98A 3MZEA 3O88A 2D02A 4UA6A 4N9LA 4NG2A 2O9CA 3P01A 5C5KA 5EM1A 5FA7A 1SDNA 2Y2GA 4NETA 1PWDA 3QP8A 2PHYA 3T50A 2JE5A 2PU2A 3A3DA 4IUKA 1TDLA 1O7EA 5L10A 3CUEC 5HL1A 5KIZA 1S4SA 4I39A 5HW3A 1LI0A 2O9AA 2WKHA 3W4OA 3FPVA 1MWRA 2O0YA 2A24A 3LI8A 2IWBA 3FWLA 1OMEA 2P74A 3OBFA 2W3DA 5F83A 4N1XA 2HJEA 2M1CA 1YLWA 2XD1A 3O87A 4GNUA 2O9BA 3HLGA 4EUZA 4P6BA 5FQKA 2ZC5B 2W0NA 2VGLM 4WEJA 3N7WA 3Q7ZA 5AQ7A 1JWVA 4QU3A 2A49A 1DJAA 2ZLYA 4YWZA 4HNBA 4B93A 1KGFA 4F3LB 4S2NA 3KX0X 1I5QA 3NI9A 3RXXA 3JYIA 3BM6A 4WYYA 4U0XA 1BULA 2HJ9C 2H0TA 4BBVA 5CXWA 1GSVA 3PBQA 4Y0TA 2ZC4B 2FZ0A 4O01A 1FCNA 2WAEA 3LEQA 3LFVA 3ITAA 3SZTA 2K31A 1EI5A 4D60A 1SCWA 2DNSA 3ZYTA 2IWDA 5G18A 4UQIM 4H8RA 1KVLA 3DTKA 4KENB 1M40A 3MQQA 3DTEA 3HUMA 3EOIA 1K4FA 2EX2A 5F5YA 1STZA 2ZM2A 1U60A 4HBUA 4S2IA 1D1JA 3ZFZA 3SS5A 1LL8A 3QNBA 3C30A 5EOEA 3FV7A 3HUNA 1H5XA 5EM0A 1BTLA 4KG6A 5HARA 3QHYA 3A3FA 3NY4A 3P98A 3E4PA 1XXMA 1LI9A 2Y2QA 4GN2A 1OTAA 1K38A 5K5BA 2QJ5A 2OOLA 2W3HA 5HFOA 3A3JA 1DY6A 3QP5A 2ZJ9A 2I72A 1CEFA 1YLZA 3ZNTA 5EVIC 2Y2MA 4MCWA 4GD6A 2I9VA 4X68A 4R23A 5AQ9A 3IHAA 3RTYA 1DP9A 4HQAA 1W8QA 4KQOA 1IOUA 1N9OA 3BWLA 4GZBA 5FAQA 1FSWA 3OOVA 2EXAA 3KO6A 4CLCB 5F6AA 2IWCA 1GSXA 2EXBA 2Z2MB 1SDEA 2JKRM 2JCHA 3C2WA 3UE0A 3BY8A 3G2YA 1Q2PA 2OAP1 4MMNA 1TF1A 2VGKA 1K54A 1W63M 4HJ3A 5GL9A 3BRMA 1T1BA 3MXSA 1YMSA 2NUPC 2WGWB 3G35A 4JKTA 1S0WA 5TR7A 4XUXA 2KLIA 2H0YA 3NJAA 2VLGA 2V8CA 2JKTI 3JVUA 1MWTA 3VFHA 3EQUA 2V0UA 1G6AA 2Q9MA 1KDWA 4UAAA 1E4DA 5KSCA 4C6YA 4HEFA 4DE0A 2EX9A 1XA1A 1PZPA 4Q0HA 3KYQA 4GCZA 4R3BA 5CECA 2QHKA 1S66L 1ESIA 4LENA 3IBRA 4NXFA 1T1CA 2PD8A 1IYOA 4OH0A 2LB5A 4E3NA 3Q7VA 5AQAA 1HD8A 4ARZB 1NYMA 1NXYA 1VEUA 4GHIB 3IXGA 3C4OA 3PBRA 3UB8A 3C8CA 4B4XA 5HZHA 4HH2A 4E3LA 1FCOA 4PM9A 3UN7A 5GHYA 3LEZA 5DF8A 5A92A 3N8LA 3HLEA 4UA7A 3K3DA 3VP0A 2YKHA 2W1TB 3S7QA 2VV8A 4ME4A 4WEKA 4K0XA 4I3JA 1PI4A 2ZC6B 3OLOA 5CGXA 3FC7A 5KZHA 3T4OA 2Y2NA 3SH7A 4UEYA 2J3TC 3D4FA 2XR0A 5EVLA 5DFYA 3MS6A 4LV1A 3Q07A 1XP4A 2XQZA 3LR4A 4LCMA 5AVEA 3NOTC 3LICA 3H7WA 4ZBEA 1DP6A 4EU0A 1OPXA 4DE3A 5CRFA 1J3WA 2Y2LA 2Y8HA 2XGNA 3OPRA 5HL6A 3W8KA 5J8XA 4CLCD 4MLLA 3ISGA 2Y2OA 1PFLA 1G28A 3CZDA 3VV4A 2VX8A 3LGOA 1FILA 1C3BA 2UV0E 3PHYA 2JKFA 3E0YA 1NLYA 2A3UA 3KYEA 4E3JA 3R4KA 4OQGA 4FSFA 4WZ4A 3CHWP 4RX2A 5A8BA 1I2SA 1FSYA 4G3VA 1Z6FA 5IHVA 4E3MA 4II7A 1PZOA 3HJKA 4CLCE 4I3AA 3VP3A 5E2HA 1KE3A 3V5MA 3OPPA 4OQIA 1H8MA 5TBMA 5HPIA 4PPRA 1ONHA 4OPYA 5CGWA 3MBZA 3N4IA 2EFUA 5HWVA 3NECA 5IT5A 1ZTUA 1RP5A 3T4TA 1SZVA 3FYZA 1H8ZA 1WE4A 3T4KA 3FKVA 4R4SA 3OC2A 2P9VA 3UPOA 3F1OA 4XT2B 2WZXA 3V67A 3QP1A 2WKEA 1TDGA 4QJGA 1YT4A 4FD8A 2XFTA 3IXDA 4JXVA 1D7EA 4P0MA 3IXHA 3MXQA 4GB7A 3LY3A 5HDDA 3PAGA 4G3KA 3IS2B 1SKOB 5FDHA 4KZ3A 1L0EA 4WMCD 3OPLA 3T1RA 3HL9A 2ZL1A 3NDEA 1K54C 5DJUA 5DKLA 5HPFA 3GMWA 3IXBA 2A2LA 4MN7A 2HDUA 4OOYA 4DDSA 4UA9A 4QD4A 3S22A 3ITBA 1FOFA 5HAPA 3B42A 3QP4A 2ZOHA 1Y4OA 4JLFA 4OQ0A 2WZZA 1MPLA 1JWZA 3H82B 4RX3A 3LY4A 4N1HA 2JN7A 4EBLA 2G7UA 5EUAA 2C5WB 4S2JA 2QJ7A 4KZ9A 4HI4A 5AQBA 5GLBA 1OTEA 3WS0A 1XGJA 4HESA 4KUOA 1IYPA 4X1LA 4QY5A 4YNRA 2WK0A 3FZCA 4ESPA 4Z9QA 4PKYA 2BASA 3IF6A 5A91A 5F1FA 2Q0OA 3LO7A 5FASA 4ZJ2A 4AFIA 4EXOA 4IVIA 3FKWA 3VSLA 3F1NB 4ZTKA 1S1ZA 2HP9A 3V3SA 2INWA 3PAEA 2VA0A 2XFSA 3BJNA 3GDIA 3HBRA 4N9KA 1BLCA 4KZAA 4S2KA 1MY8A 1VETB 2B18A 2M7UA 3UE1A 4KG2A 1H0MA 4Q8IA 1F2KA 1CJFA 3N8SA 5EFWA 4K91A 5TJJA 2ZOIA 3BFDA 1JNUA 4LRXC 1MZUA 3UDFA 2WGIA 4ZJ3A 2BG1A 4FCFA 1KOUA 1NY0A 1ODVA 3IQAA 4LV2A 5HDCA 2ACGA 1LT0A 2H28A 4H6JB 1OJ5A 2GNXA 1G5UA 3MKEA 5F1GA 3ZG8B 3HLDA 2OLUA 1FQGA 4KZ4A 1Y54A 1AWIA 3TE8A 4B4ZA 3LIFA 3UY6A 5M19A 3IX4A 3T4LA 2Z6CA 4EESA 2KOIA 4ZJ1A 2Y4AA 2Y59A 5HAQA 3HREA 2HP5A 2Z2LB 4ETZA 1RGYA 1NJ4A 5EPHA 4LRYC 3B47A 1NZUA 1F5MA 4EV4A 4Z1WA 4YOFA 3EQVA 5M18A 4QHCA 3AGFA 3MFDA 3D9YA 4NEED 1L2SA 3T4QA 2XA7S 4JBFA 4U0TA 4X53A 3S1YA 3AGDA 4EEUA 4X25A 3B33A 4DF6A 4X56A 3BQAA 3ZVTA 2FH5A 1ES2A 2EX6A 1MC0A 3HCYA 2PR6A 4ZRRA 3NC8A 1L3LA 2E8IA 4GLQA 4WLAA 3M6BA 1YLYA 3BEBA 4R3AA 4DE1A 1K4EA 5L8MA 2JC7A 2O99A 5FSRA 2OV5A 2K2NA 1EROA 4BD1A 2K7SA 2J3WA 1S6RA 3K3CA 2HP6A 1OT9A 1ZG6A 2BLSA 3IWQA 2ZM8A 1G6OA 4S2PA 3SOIA 3MKFA 1UGUA 4BENA 5EECA 2PAVP 1N9BA 1X0OA 4GW9A 1K25A 4DKIA 3O5YA 4DJ3A 4X6TA 3GRJA 3MZFA 2JKRI 3ZDJA 2Y79A 4PM7A 3TRCA 4I3IA 2PD7A 3VP1A 2HDSA 3C7UA 4NXGA 2RL3A 3WS5A 4E3IA 3KSHA 1XJ2A 3G6OA 1MXOA 3UNWA 1ES3A 1QMFA 3OCNA 4EQIA 2WKIA 2XLNA 2LB9A 2WUQA 2V0WA 4PM6A 2VEAA 3LR0A 1LL5A 2H10A 1PWGA 1ZHHB 2ZQAA 3FG8A 5L2FA 3LI9A 2L0WA 2X71A 4FUWA 1UWNX 3UMEA 3C5AA 1KDSA 1QMEA 3KYZA 3S7OA 1TS8A 4EERA 4RVAA 1DJBA 1FCMA 4WM9A 3DWKA 2KDKA 4GS9B 4R38A 1KGEA 3E2LA 5I5LA 3G31A 3L9KA 1EWZA 3BFCA 3IX8A 3S7PA 3UB7A 1BT5A 2J9OA 2PDRA 5CHJA 1P9WA 4JXWA 3SS4A 4WL9A 3ZCZA 4K0WA 3IF6C 1YLJA 2PBYA 4LLOB 2GDNA 1GHPA 3PBOA 5G4YA 3A3EA 4LV3A 3DBAA 3JPUA 2WAFA 1YQSA 4GDBA 3ZHHA 3G2ZA 3GQZA 4HP4A 4LRZE 3V3RA 3UPNA 3KSGA 4C3QA 3D72A 5DF7A 2PYPA 4PAUA 4ZAMA 4M4XA 1NWZA 4IJGA 2L4RA 1K0KA 3EEAA 4KZ8A 5FQIA 5GLCA 2HV1A 3WRZA 5EVIB 5FI2A 5HD3A 4D2OA 1V9YA 3BQ8A 1AXBA 3CPTB 2AVXA 4F94A 5AJGA 2BTFP 2DCFA 2QMIA 3MSHA 3H9WA 4I38A 1GHMA 4OPQA 1TS7A 3VOLA 4F3LA 1XPBA 4QWOA 2V1BA 5KSHA 1XKZA 2D01A 3BECA 3RXWA 1GA0A 3GR2A 1P9RA 4L9GA 4O0PA 4IUHA 3R7WB 3MFXA 1FR6A 1S4RA 3DAVA 4HP9A 4L9FA 4P85A 4S2NC 1OTIA 1W8YA 5EV0A 3V50A 1YAXA 2JKTM 2W3EA 5HX9A 1ERQA 3MQOA 3NCKA 5FEGA 4KQRA 2GZAA 4JGOA 2QYBA 4KZ5A 3RH8B 2Y2KA 5BOHA 3PBTA 1K6SA 2C6WB 3VP4A 1KE0A 1KVMA 4BBUA 3VE3A 1K55A 2VGLS 2XA7M 2Q9NA 5FL3A 1PW8A 2P7JA 4QB8A 3C38A 2HZ5A 2ZMFA 1F9IA 1GCEA 1ES5A 4O8GA 3EGXC 3CITA 4KUKA 3GV9A 3WWXA 3MMHA 3GSGA 1BLSA 3ZQ5A 2MJ6A 3SW1A 2A24B 4DMZA 1WA9A 1BLHA 2FFFB 4MBFA 2EA9A 2HPBA 2V9AA 3Q81A 4Y17A 2VK3A 5HWTA 4JF4A 4X55A 2UWXA 3S4XA 2B02A 2W27A 5DVAA 2PU4A 1ZC2A 3E2KA 3VOZA 3IBJA 1T18A 3NIAA 2CC1A 3IX3A 1YMXA 1E3UD 3ZG5A 3BW6A 3EWKA 1ONGA 1VQQA 4UQIS 1IYQA 1DJCA 2FFYA 5J3WA 3UE3A 3C4PA 1DP8A 1XX2A 3DTIA 3T1XA 3G4PA 4LFUA 4CLCA 4C75A 4IHQA 5EVID 4DDYA 1CF0A 1IKIA 3UDXA 5EE8A 3ZG7B 1K57A 3WRTA 3RJUA 5HSQA 2R9XA 3PXPA 4S2LA 1K56D 3E4QA 4IEDA 3PYPA 1HLUP 2ZQ8A 2Z6DA 4OONA 4EW7A 2PYRA 4JGPA 1ACFA 3ZNYA 4B9OA 2WKQA 4ID4A 3LYXA 1T1AA 2WGWA 5KMWA 3LR5A 4Y5FA 2Y2IA 4LGWA 3NULA 2WYXA 5IS1A 1VHMA 2WKRA 2G2WA 1LSWA 2OSUA 3UDIA 3LIAA 4BQMA 1H8YA 4DRTA 1NLZA 1OT6A 2PR5A 4DJ2A 3HLCA 1V9ZA 1A0KA 3ICYA 5GLDA 3O3VA 2J80A 4OPZA 4BL3A 4XUZA 2X02A 2V2FF 4Y0OA 4WBGA 1XJ3A 3QP2A 2VZWA 4E04A 3BYDA 4ARZA 1MKMA 4GHIA 2XSSA 1W79A 2V1AA 1IKGA 1W63Q 3OZHA 4OOMA 3QP6A 3IH8A 5DJTA 5J4EA 3FPWA 3UPPA 2B95A 4HY8A 4IBRA 4HHDA 4MN6A 4NK3A 2G2UA 4XXRA 4YFMA 1L0GA 4ZDXA 2W1TA 1ALQA 4WMCA 5FI6A 4DXBA 1NZOA 4OVDA 3T1SA 2WADA 4O7DA 1IFQA 3ZG0A 3OCLA 1ES4A 5J7EA 1K6RA 3HVFA 4BJPA 1T19A 1ERMA 1GSWA 4NKPA 3F1PB 2M7VA 4B88A 5CHMA 3DWZA 4ETXA 4R3JA 4FTXA 4PHTA 4S2MA 1CI9A 5IU1A 2J3TD 4KG5A 2HDRA 2Y2HA 4OOLA 4Y13A 4MBHA 4MBKA 4E3KA 1YLTA 2E8JA 2WGVA 2ZMAA 1K55C 4OP5A 3MZDA 3T4SA 4KQDA 1YSPA 1G68A 4IBXA 3IF5A 3A0SA 3N6IA 2Y91A 1XFQA 4MN5A 2QWSA 2V8FA 1N4OA 4Y7PA 2QKPA 2VV7A 1IELA 3Q7VB 5CGSA 1D06A 5GLAA 1VEUB 3AGEA 5FEFA 2IA2A 2VKSA 4U3TA 2PT7A 4OLDA 1N9LA 1ESUA 3LCEA 4WZ5A 1HVBA 4PKYG 1XFNA 4MEZA 2ZBBA 1BUEA 4QPRA 1S1YA 3CAXA 4CJNA 3P7NA 1L0DA 5M1AA 4KZ7A 2VGJA 3HUOA 4WF0A 5TGFA 5CX7A 3SH8A 1HTZA 4LV0A 5F68A 4BWIA 2JHEA 1UWPX 4EBPA 4EETB 1FIKA 2NUTC 4XT2A 4Y15A 5FQ9A 3V39A 5DF9A 5A93A 4OP8A 1F98A 3B3XA 1GHIA 4DXCA 1S67L 4CLCC 3CLOA 3CI6A 4FOFA 3IS2A 1SKOA 1K57C 4HBTA 4NXEA 1PNEA 2XF3A 3HJIA 3H7WB 4P87A 5E2GA 4R6LA 1PWCA 3IT9A 1LL9A 2DMWA 2PBDP 3IWIA 5F69A 3WS4A 4RA7A 4JGQA 4HJ6A 5E43A 4OQHA 3E4OA 4OLGA 5CERA 5DFXA 4NXBA 4A5RA 1JVJA 1JTGA 1SKFA 4S2OA 4CPKA 1WYBA 4EBNA 2CMNA 1RCJA 3VE4A 3H82A 1MKIA 4MNRA 3OPHA 3BLSA 1Q2QA 3G34A 1SHVA 1TS6A 4KQQA 2P08A 1YSQA 3WS1A 4X1MA 3HLBA 4JPMA 4JXGA 5HAIA 4WN5A 4K08A 4BD0A 1I2WA 3KSIA 3W4QA 4JXSA 3EGDC 4P6ZS 4R0QA 4Q0JA 1BYWA 1VB6A 3DW0A 2ZMVA 4JF6A 5TBMB 3IHBA 5I94A 5FAOA 3PTEA 4FH2A 2W3GA 3F1NA 1W7FA 2W3FA 2VJWA 1PW1A 4LCLA 5HWWA 4GDNA 4MDZA 5CTMA 1VETA 2V20A 3S7NA 3LIBA 3IH9A 2P9VB 3F1OB 5CEDA 2ZD8A 3F1PA 3NOPC 4PMAA 1RGZA 1O07A 2KX6A 5FQMA 4HH3A 3BFFA 1NRJA 2WKPA 4M3KA 3Q1FA 3D3OA 3TG9A 2XEPA 2ZQCA 2OAQ1 2Y55A 1VM1A 2HF6A 4H6JA 3HLWA 1LSVA 3NHQA 5EVEA 3N8RA 1KE4A 4LPZA 2ZL1B 5DTKA 2EWWA 3LIEA 3LUQA 1NRFA 2OLVA 2L1MA 4R1GA 2Y2JA 4PM8A 1OTBA 4GD8A 4R4RA 1ZKJA 4HJ4A 5G4ZA 1XA7A 4CQHA 3HLFA 4OKPA 5HD5A 1Y28A 2ZQ7A 5CHUA 1JTDA 1CQAA 1YPRA 5FQJA 3T4JA 5L09A 2B5RA 1XJ4A 4X69A 5CTNA 4IVKA 1XJ6A 3NDGA 2OWHA 3I7JA 3P09A 3GECA 4L9EA 4E3OA 3VSKA 3BY9A 3IF6B 4Y3IA 1N9NA 2Y2PA 3NBLA 2QZ6A 3JVVA 3UE6A 1MBLA 4BL2A 5JYPA 2J9PA 1BSGA 3T12B 2EFXA 3U2AA 3CUEA 4WZ5C 4RYEA 3U4LP 5F82A 2ZQ9A 4Y2FA 1PRQA 4JGRA 2XK1A 4Y0UA 5E2FA 2ZC7A 1KGGA 4JF5A 5LBRA 4KZ6A 3T1QB 4HIAA 3CG5A 2R78A 1MWSA 5GHXA 4EUVA 1LSXA 1GA9A 3A0RA 1YLPA 5GHZA 2P04A 1IEMA 3SH9A 1IYSA 1BZAA 4RQ9A 3VFFA 2PRFA 3LR3A 2RCXA 1TD5A 5U47A 2XD5A 5JYOA 1Z09A 4E6XA 2JBFA 1H3QA 4N92A 2V1ZA 3QNCA 3UB6A 3W2ZA 4DN0A 3SS3A 4FH4A 2R9WA 3NOUC 3VP2A 4E6WA 4YINA 3M2KA 1P0ZA 3K2NA 2ZC3B 3TW8A 4G3WA 2H5SA 4QY6A 5DTSA 3DTMA
chains in the Genus database with same CATH topology
2ACGA 2JKFA 1HLUP 1G5UA 3KYEA 3UB5P 1ACFA 1FIKA 1AWIA 3CHWP 2PAVP 1VETA 1Y4OA 3L7HA 3T12B 2HZ5A 1VEUA 4FTXA 3U4LP 3NULA 1PRQA 1SKOA 1PNEA 5FDSA 1K0KA 3T1QB 2PBDP 2E8JA 4X1LA 4ESPA 3LEQA 2JKGA 1A0KA 3CPTB 3D9YA 3NECA 5EM1A 5EVEA 2VK3A 2BTFP 3MSHA 2ZL1B 1SZVA 4D60A 4QWOA 4FUWA 4X25A 2V8FA 2PRFA 1Z09A 3MS6A 1VETB 1F2KA 1CJFA 1VEUB 4X1MA 2B95A 3L9KA 5FEFA 3DAVA 1CQAA 1D1JA 1YPRA 3T1XA 5EV0A 1J3WA 1SKOB 2V8CA 5FEGA 1CF0A 5EM0A 3CPTA 3T1RA 1PFLA 3T1SA 2ZL1A 3LGOA 1FILA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ACG A;  2JKF A;  1HLU P;  1G5U A;  3KYE A;  3UB5 P;  1ACF A;  1FIK A;  1AWI A;  3CHW P;  2PAV P;  1VET A;  1Y4O A;  3L7H A;  3T12 B;  2HZ5 A;  1VEU A;  4FTX A;  3U4L P;  3NUL A;  1PRQ A;  1SKO A;  1PNE A;  5FDS A;  1K0K A;  3T1Q B;  2PBD P;  2E8J A;  4X1L A;  4ESP A;  3LEQ A;  2JKG A;  1A0K A;  3CPT B;  3D9Y A;  3NEC A;  5EM1 A;  5EVE A;  2VK3 A;  2BTF P;  3MSH A;  2ZL1 B;  1SZV A;  4D60 A;  4QWO A;  4FUW A;  4X25 A;  2V8F A;  2PRF A;  1Z09 A;  3MS6 A;  1VET B;  1F2K A;  1CJF A;  1VEU B;  4X1M A;  2B95 A;  3L9K A;  5FEF A;  3DAV A;  1CQA A;  1D1J A;  1YPR A;  3T1X A;  5EV0 A;  1J3W A;  1SKO B;  2V8C A;  5FEG A;  1CF0 A;  5EM0 A;  3CPT A;  3T1R A;  1PFL A;  3T1S A;  2ZL1 A;  3LGO A;  1FIL A; 
#chains in the Genus database with same CATH topology
 1TVF A;  1M6K A;  5MC7 A;  3G32 A;  3IWO A;  4PM5 A;  3KSF A;  5D3O A;  1YM1 A;  1XGI A;  1CEG A;  1PI5 A;  5EOO A;  4GS9 A;  3L7H A;  3C7V A;  4DE2 A;  2W1R A;  3Q82 A;  3ZG9 B;  3VMA A;  1MWU A;  1PYY A;  4L0L A;  1HZO A;  3O86 A;  3TJZ C;  1OTD A;  1CI8 A;  3LID A;  4I5S A;  2DRW A;  5FDS A;  1TEM A;  3W4P A;  2J8Y A;  2XH9 A;  3UB9 A;  3ZGA B;  2ZQD A;  3TOI A;  3A0V A;  3BLM A;  5CEB A;  5FI7 A;  3EEH A;  3CJM A;  3RFB A;  1EW0 A;  3G30 A;  4EEP A;  4Q0I A;  3BFE A;  1CK3 A;  4KZB A;  5L07 A;  4P6Z M;  2HGV A;  3CMZ A;  3WS2 A;  4WUJ A;  5E2E A;  3M2J A;  5A90 A;  2ZM0 A;  5DTT A;  5AVF A;  3MF0 A;  2XDM A;  1J9M A;  5TFQ A;  3PR6 A;  1E3U A;  1YKD A;  5DKK A;  4WEL A;  1FR1 A;  5FAP A;  1OJG A;  1P97 A;  2OWJ A;  1JWP A;  5FQQ A;  1TS0 A;  3ZVW A;  1ZG4 A;  4UHU A;  5EVI A;  1LLB A;  3M6H A;  3UO9 A;  3CPT A;  1PIO A;  1WYC A;  3PBS A;  4EQ1 A;  4GKU A;  2XRO A;  2EWV A;  2XRN A;  1K56 A;  4GJ4 A;  5FAT A;  2JKG A;  2GJ3 A;  3TSG A;  3BFG A;  4GOG A;  1DRM A;  1NYY A;  3A3I A;  4BLM A;  3MJQ A;  2VV6 A;  3UB5 P;  3CWF A;  3MXR A;  3GTC A;  2X01 A;  4EWF A;  1BLP A;  2EX8 A;  2QPN A;  4R70 A;  1W5D A;  2YKF A;  4BBT A;  3R7W A;  3VOY A;  2HDQ A;  2J7V A;  3GVB A;  3UMD A;  3ULF A;  4OPR A;  3MQ0 A;  3MR0 A;  1LHY A;  1E25 A;  3PBN A;  4BMW A;  4HOI A;  1L0F A;  2GX5 A;  5HDS A;  3E98 A;  3MZE A;  3O88 A;  2D02 A;  4UA6 A;  4N9L A;  4NG2 A;  2O9C A;  3P01 A;  5C5K A;  5EM1 A;  5FA7 A;  1SDN A;  2Y2G A;  4NET A;  1PWD A;  3QP8 A;  2PHY A;  3T50 A;  2JE5 A;  2PU2 A;  3A3D A;  4IUK A;  1TDL A;  1O7E A;  5L10 A;  3CUE C;  5HL1 A;  5KIZ A;  1S4S A;  4I39 A;  5HW3 A;  1LI0 A;  2O9A A;  2WKH A;  3W4O A;  3FPV A;  1MWR A;  2O0Y A;  2A24 A;  3LI8 A;  2IWB A;  3FWL A;  1OME A;  2P74 A;  3OBF A;  2W3D A;  5F83 A;  4N1X A;  2HJE A;  2M1C A;  1YLW A;  2XD1 A;  3O87 A;  4GNU A;  2O9B A;  3HLG A;  4EUZ A;  4P6B A;  5FQK A;  2ZC5 B;  2W0N A;  2VGL M;  4WEJ A;  3N7W A;  3Q7Z A;  5AQ7 A;  1JWV A;  4QU3 A;  2A49 A;  1DJA A;  2ZLY A;  4YWZ A;  4HNB A;  4B93 A;  1KGF A;  4F3L B;  4S2N A;  3KX0 X;  1I5Q A;  3NI9 A;  3RXX A;  3JYI A;  3BM6 A;  4WYY A;  4U0X A;  1BUL A;  2HJ9 C;  2H0T A;  4BBV A;  5CXW A;  1GSV A;  3PBQ A;  4Y0T A;  2ZC4 B;  2FZ0 A;  4O01 A;  1FCN A;  2WAE A;  3LEQ A;  3LFV A;  3ITA A;  3SZT A;  2K31 A;  1EI5 A;  4D60 A;  1SCW A;  2DNS A;  3ZYT A;  2IWD A;  5G18 A;  4UQI M;  4H8R A;  1KVL A;  3DTK A;  4KEN B;  1M40 A;  3MQQ A;  3DTE A;  3HUM A;  3EOI A;  1K4F A;  2EX2 A;  5F5Y A;  1STZ A;  2ZM2 A;  1U60 A;  4HBU A;  4S2I A;  1D1J A;  3ZFZ A;  3SS5 A;  1LL8 A;  3QNB A;  3C30 A;  5EOE A;  3FV7 A;  3HUN A;  1H5X A;  5EM0 A;  1BTL A;  4KG6 A;  5HAR A;  3QHY A;  3A3F A;  3NY4 A;  3P98 A;  3E4P A;  1XXM A;  1LI9 A;  2Y2Q A;  4GN2 A;  1OTA A;  1K38 A;  5K5B A;  2QJ5 A;  2OOL A;  2W3H A;  5HFO A;  3A3J A;  1DY6 A;  3QP5 A;  2ZJ9 A;  2I72 A;  1CEF A;  1YLZ A;  3ZNT A;  5EVI C;  2Y2M A;  4MCW A;  4GD6 A;  2I9V A;  4X68 A;  4R23 A;  5AQ9 A;  3IHA A;  3RTY A;  1DP9 A;  4HQA A;  1W8Q A;  4KQO A;  1IOU A;  1N9O A;  3BWL A;  4GZB A;  5FAQ A;  1FSW A;  3OOV A;  2EXA A;  3KO6 A;  4CLC B;  5F6A A;  2IWC A;  1GSX A;  2EXB A;  2Z2M B;  1SDE A;  2JKR M;  2JCH A;  3C2W A;  3UE0 A;  3BY8 A;  3G2Y A;  1Q2P A;  2OAP 1;  4MMN A;  1TF1 A;  2VGK A;  1K54 A;  1W63 M;  4HJ3 A;  5GL9 A;  3BRM A;  1T1B A;  3MXS A;  1YMS A;  2NUP C;  2WGW B;  3G35 A;  4JKT A;  1S0W A;  5TR7 A;  4XUX A;  2KLI A;  2H0Y A;  3NJA A;  2VLG A;  2V8C A;  2JKT I;  3JVU A;  1MWT A;  3VFH A;  3EQU A;  2V0U A;  1G6A A;  2Q9M A;  1KDW A;  4UAA A;  1E4D A;  5KSC A;  4C6Y A;  4HEF A;  4DE0 A;  2EX9 A;  1XA1 A;  1PZP A;  4Q0H A;  3KYQ A;  4GCZ A;  4R3B A;  5CEC A;  2QHK A;  1S66 L;  1ESI A;  4LEN A;  3IBR A;  4NXF A;  1T1C A;  2PD8 A;  1IYO A;  4OH0 A;  2LB5 A;  4E3N A;  3Q7V A;  5AQA A;  1HD8 A;  4ARZ B;  1NYM A;  1NXY A;  1VEU A;  4GHI B;  3IXG A;  3C4O A;  3PBR A;  3UB8 A;  3C8C A;  4B4X A;  5HZH A;  4HH2 A;  4E3L A;  1FCO A;  4PM9 A;  3UN7 A;  5GHY A;  3LEZ A;  5DF8 A;  5A92 A;  3N8L A;  3HLE A;  4UA7 A;  3K3D A;  3VP0 A;  2YKH A;  2W1T B;  3S7Q A;  2VV8 A;  4ME4 A;  4WEK A;  4K0X A;  4I3J A;  1PI4 A;  2ZC6 B;  3OLO A;  5CGX A;  3FC7 A;  5KZH A;  3T4O A;  2Y2N A;  3SH7 A;  4UEY A;  2J3T C;  3D4F A;  2XR0 A;  5EVL A;  5DFY A;  3MS6 A;  4LV1 A;  3Q07 A;  1XP4 A;  2XQZ A;  3LR4 A;  4LCM A;  5AVE A;  3NOT C;  3LIC A;  3H7W A;  4ZBE A;  1DP6 A;  4EU0 A;  1OPX A;  4DE3 A;  5CRF A;  1J3W A;  2Y2L A;  2Y8H A;  2XGN A;  3OPR A;  5HL6 A;  3W8K A;  5J8X A;  4CLC D;  4MLL A;  3ISG A;  2Y2O A;  1PFL A;  1G28 A;  3CZD A;  3VV4 A;  2VX8 A;  3LGO A;  1FIL A;  1C3B A;  2UV0 E;  3PHY A;  2JKF A;  3E0Y A;  1NLY A;  2A3U A;  3KYE A;  4E3J A;  3R4K A;  4OQG A;  4FSF A;  4WZ4 A;  3CHW P;  4RX2 A;  5A8B A;  1I2S A;  1FSY A;  4G3V A;  1Z6F A;  5IHV A;  4E3M A;  4II7 A;  1PZO A;  3HJK A;  4CLC E;  4I3A A;  3VP3 A;  5E2H A;  1KE3 A;  3V5M A;  3OPP A;  4OQI A;  1H8M A;  5TBM A;  5HPI A;  4PPR A;  1ONH A;  4OPY A;  5CGW A;  3MBZ A;  3N4I A;  2EFU A;  5HWV A;  3NEC A;  5IT5 A;  1ZTU A;  1RP5 A;  3T4T A;  1SZV A;  3FYZ A;  1H8Z A;  1WE4 A;  3T4K A;  3FKV A;  4R4S A;  3OC2 A;  2P9V A;  3UPO A;  3F1O A;  4XT2 B;  2WZX A;  3V67 A;  3QP1 A;  2WKE A;  1TDG A;  4QJG A;  1YT4 A;  4FD8 A;  2XFT A;  3IXD A;  4JXV A;  1D7E A;  4P0M A;  3IXH A;  3MXQ A;  4GB7 A;  3LY3 A;  5HDD A;  3PAG A;  4G3K A;  3IS2 B;  1SKO B;  5FDH A;  4KZ3 A;  1L0E A;  4WMC D;  3OPL A;  3T1R A;  3HL9 A;  2ZL1 A;  3NDE A;  1K54 C;  5DJU A;  5DKL A;  5HPF A;  3GMW A;  3IXB A;  2A2L A;  4MN7 A;  2HDU A;  4OOY A;  4DDS A;  4UA9 A;  4QD4 A;  3S22 A;  3ITB A;  1FOF A;  5HAP A;  3B42 A;  3QP4 A;  2ZOH A;  1Y4O A;  4JLF A;  4OQ0 A;  2WZZ A;  1MPL A;  1JWZ A;  3H82 B;  4RX3 A;  3LY4 A;  4N1H A;  2JN7 A;  4EBL A;  2G7U A;  5EUA A;  2C5W B;  4S2J A;  2QJ7 A;  4KZ9 A;  4HI4 A;  5AQB A;  5GLB A;  1OTE A;  3WS0 A;  1XGJ A;  4HES A;  4KUO A;  1IYP A;  4X1L A;  4QY5 A;  4YNR A;  2WK0 A;  3FZC A;  4ESP A;  4Z9Q A;  4PKY A;  2BAS A;  3IF6 A;  5A91 A;  5F1F A;  2Q0O A;  3LO7 A;  5FAS A;  4ZJ2 A;  4AFI A;  4EXO A;  4IVI A;  3FKW A;  3VSL A;  3F1N B;  4ZTK A;  1S1Z A;  2HP9 A;  3V3S A;  2INW A;  3PAE A;  2VA0 A;  2XFS A;  3BJN A;  3GDI A;  3HBR A;  4N9K A;  1BLC A;  4KZA A;  4S2K A;  1MY8 A;  1VET B;  2B18 A;  2M7U A;  3UE1 A;  4KG2 A;  1H0M A;  4Q8I A;  1F2K A;  1CJF A;  3N8S A;  5EFW A;  4K91 A;  5TJJ A;  2ZOI A;  3BFD A;  1JNU A;  4LRX C;  1MZU A;  3UDF A;  2WGI A;  4ZJ3 A;  2BG1 A;  4FCF A;  1KOU A;  1NY0 A;  1ODV A;  3IQA A;  4LV2 A;  5HDC A;  2ACG A;  1LT0 A;  2H28 A;  4H6J B;  1OJ5 A;  2GNX A;  1G5U A;  3MKE A;  5F1G A;  3ZG8 B;  3HLD A;  2OLU A;  1FQG A;  4KZ4 A;  1Y54 A;  1AWI A;  3TE8 A;  4B4Z A;  3LIF A;  3UY6 A;  5M19 A;  3IX4 A;  3T4L A;  2Z6C A;  4EES A;  2KOI A;  4ZJ1 A;  2Y4A A;  2Y59 A;  5HAQ A;  3HRE A;  2HP5 A;  2Z2L B;  4ETZ A;  1RGY A;  1NJ4 A;  5EPH A;  4LRY C;  3B47 A;  1NZU A;  1F5M A;  4EV4 A;  4Z1W A;  4YOF A;  3EQV A;  5M18 A;  4QHC A;  3AGF A;  3MFD A;  3D9Y A;  4NEE D;  1L2S A;  3T4Q A;  2XA7 S;  4JBF A;  4U0T A;  4X53 A;  3S1Y A;  3AGD A;  4EEU A;  4X25 A;  3B33 A;  4DF6 A;  4X56 A;  3BQA A;  3ZVT A;  2FH5 A;  1ES2 A;  2EX6 A;  1MC0 A;  3HCY A;  2PR6 A;  4ZRR A;  3NC8 A;  1L3L A;  2E8I A;  4GLQ A;  4WLA A;  3M6B A;  1YLY A;  3BEB A;  4R3A A;  4DE1 A;  1K4E A;  5L8M A;  2JC7 A;  2O99 A;  5FSR A;  2OV5 A;  2K2N A;  1ERO A;  4BD1 A;  2K7S A;  2J3W A;  1S6R A;  3K3C A;  2HP6 A;  1OT9 A;  1ZG6 A;  2BLS A;  3IWQ A;  2ZM8 A;  1G6O A;  4S2P A;  3SOI A;  3MKF A;  1UGU A;  4BEN A;  5EEC A;  2PAV P;  1N9B A;  1X0O A;  4GW9 A;  1K25 A;  4DKI A;  3O5Y A;  4DJ3 A;  4X6T A;  3GRJ A;  3MZF A;  2JKR I;  3ZDJ A;  2Y79 A;  4PM7 A;  3TRC A;  4I3I A;  2PD7 A;  3VP1 A;  2HDS A;  3C7U A;  4NXG A;  2RL3 A;  3WS5 A;  4E3I A;  3KSH A;  1XJ2 A;  3G6O A;  1MXO A;  3UNW A;  1ES3 A;  1QMF A;  3OCN A;  4EQI A;  2WKI A;  2XLN A;  2LB9 A;  2WUQ A;  2V0W A;  4PM6 A;  2VEA A;  3LR0 A;  1LL5 A;  2H10 A;  1PWG A;  1ZHH B;  2ZQA A;  3FG8 A;  5L2F A;  3LI9 A;  2L0W A;  2X71 A;  4FUW A;  1UWN X;  3UME A;  3C5A A;  1KDS A;  1QME A;  3KYZ A;  3S7O A;  1TS8 A;  4EER A;  4RVA A;  1DJB A;  1FCM A;  4WM9 A;  3DWK A;  2KDK A;  4GS9 B;  4R38 A;  1KGE A;  3E2L A;  5I5L A;  3G31 A;  3L9K A;  1EWZ A;  3BFC A;  3IX8 A;  3S7P A;  3UB7 A;  1BT5 A;  2J9O A;  2PDR A;  5CHJ A;  1P9W A;  4JXW A;  3SS4 A;  4WL9 A;  3ZCZ A;  4K0W A;  3IF6 C;  1YLJ A;  2PBY A;  4LLO B;  2GDN A;  1GHP A;  3PBO A;  5G4Y A;  3A3E A;  4LV3 A;  3DBA A;  3JPU A;  2WAF A;  1YQS A;  4GDB A;  3ZHH A;  3G2Z A;  3GQZ A;  4HP4 A;  4LRZ E;  3V3R A;  3UPN A;  3KSG A;  4C3Q A;  3D72 A;  5DF7 A;  2PYP A;  4PAU A;  4ZAM A;  4M4X A;  1NWZ A;  4IJG A;  2L4R A;  1K0K A;  3EEA A;  4KZ8 A;  5FQI A;  5GLC A;  2HV1 A;  3WRZ A;  5EVI B;  5FI2 A;  5HD3 A;  4D2O A;  1V9Y A;  3BQ8 A;  1AXB A;  3CPT B;  2AVX A;  4F94 A;  5AJG A;  2BTF P;  2DCF A;  2QMI A;  3MSH A;  3H9W A;  4I38 A;  1GHM A;  4OPQ A;  1TS7 A;  3VOL A;  4F3L A;  1XPB A;  4QWO A;  2V1B A;  5KSH A;  1XKZ A;  2D01 A;  3BEC A;  3RXW A;  1GA0 A;  3GR2 A;  1P9R A;  4L9G A;  4O0P A;  4IUH A;  3R7W B;  3MFX A;  1FR6 A;  1S4R A;  3DAV A;  4HP9 A;  4L9F A;  4P85 A;  4S2N C;  1OTI A;  1W8Y A;  5EV0 A;  3V50 A;  1YAX A;  2JKT M;  2W3E A;  5HX9 A;  1ERQ A;  3MQO A;  3NCK A;  5FEG A;  4KQR A;  2GZA A;  4JGO A;  2QYB A;  4KZ5 A;  3RH8 B;  2Y2K A;  5BOH A;  3PBT A;  1K6S A;  2C6W B;  3VP4 A;  1KE0 A;  1KVM A;  4BBU A;  3VE3 A;  1K55 A;  2VGL S;  2XA7 M;  2Q9N A;  5FL3 A;  1PW8 A;  2P7J A;  4QB8 A;  3C38 A;  2HZ5 A;  2ZMF A;  1F9I A;  1GCE A;  1ES5 A;  4O8G A;  3EGX C;  3CIT A;  4KUK A;  3GV9 A;  3WWX A;  3MMH A;  3GSG A;  1BLS A;  3ZQ5 A;  2MJ6 A;  3SW1 A;  2A24 B;  4DMZ A;  1WA9 A;  1BLH A;  2FFF B;  4MBF A;  2EA9 A;  2HPB A;  2V9A A;  3Q81 A;  4Y17 A;  2VK3 A;  5HWT A;  4JF4 A;  4X55 A;  2UWX A;  3S4X A;  2B02 A;  2W27 A;  5DVA A;  2PU4 A;  1ZC2 A;  3E2K A;  3VOZ A;  3IBJ A;  1T18 A;  3NIA A;  2CC1 A;  3IX3 A;  1YMX A;  1E3U D;  3ZG5 A;  3BW6 A;  3EWK A;  1ONG A;  1VQQ A;  4UQI S;  1IYQ A;  1DJC A;  2FFY A;  5J3W A;  3UE3 A;  3C4P A;  1DP8 A;  1XX2 A;  3DTI A;  3T1X A;  3G4P A;  4LFU A;  4CLC A;  4C75 A;  4IHQ A;  5EVI D;  4DDY A;  1CF0 A;  1IKI A;  3UDX A;  5EE8 A;  3ZG7 B;  1K57 A;  3WRT A;  3RJU A;  5HSQ A;  2R9X A;  3PXP A;  4S2L A;  1K56 D;  3E4Q A;  4IED A;  3PYP A;  1HLU P;  2ZQ8 A;  2Z6D A;  4OON A;  4EW7 A;  2PYR A;  4JGP A;  1ACF A;  3ZNY A;  4B9O A;  2WKQ A;  4ID4 A;  3LYX A;  1T1A A;  2WGW A;  5KMW A;  3LR5 A;  4Y5F A;  2Y2I A;  4LGW A;  3NUL A;  2WYX A;  5IS1 A;  1VHM A;  2WKR A;  2G2W A;  1LSW A;  2OSU A;  3UDI A;  3LIA A;  4BQM A;  1H8Y A;  4DRT A;  1NLZ A;  1OT6 A;  2PR5 A;  4DJ2 A;  3HLC A;  1V9Z A;  1A0K A;  3ICY A;  5GLD A;  3O3V A;  2J80 A;  4OPZ A;  4BL3 A;  4XUZ A;  2X02 A;  2V2F F;  4Y0O A;  4WBG A;  1XJ3 A;  3QP2 A;  2VZW A;  4E04 A;  3BYD A;  4ARZ A;  1MKM A;  4GHI A;  2XSS A;  1W79 A;  2V1A A;  1IKG A;  1W63 Q;  3OZH A;  4OOM A;  3QP6 A;  3IH8 A;  5DJT A;  5J4E A;  3FPW A;  3UPP A;  2B95 A;  4HY8 A;  4IBR A;  4HHD A;  4MN6 A;  4NK3 A;  2G2U A;  4XXR A;  4YFM A;  1L0G A;  4ZDX A;  2W1T A;  1ALQ A;  4WMC A;  5FI6 A;  4DXB A;  1NZO A;  4OVD A;  3T1S A;  2WAD A;  4O7D A;  1IFQ A;  3ZG0 A;  3OCL A;  1ES4 A;  5J7E A;  1K6R A;  3HVF A;  4BJP A;  1T19 A;  1ERM A;  1GSW A;  4NKP A;  3F1P B;  2M7V A;  4B88 A;  5CHM A;  3DWZ A;  4ETX A;  4R3J A;  4FTX A;  4PHT A;  4S2M A;  1CI9 A;  5IU1 A;  2J3T D;  4KG5 A;  2HDR A;  2Y2H A;  4OOL A;  4Y13 A;  4MBH A;  4MBK A;  4E3K A;  1YLT A;  2E8J A;  2WGV A;  2ZMA A;  1K55 C;  4OP5 A;  3MZD A;  3T4S A;  4KQD A;  1YSP A;  1G68 A;  4IBX A;  3IF5 A;  3A0S A;  3N6I A;  2Y91 A;  1XFQ A;  4MN5 A;  2QWS A;  2V8F A;  1N4O A;  4Y7P A;  2QKP A;  2VV7 A;  1IEL A;  3Q7V B;  5CGS A;  1D06 A;  5GLA A;  1VEU B;  3AGE A;  5FEF A;  2IA2 A;  2VKS A;  4U3T A;  2PT7 A;  4OLD A;  1N9L A;  1ESU A;  3LCE A;  4WZ5 A;  1HVB A;  4PKY G;  1XFN A;  4MEZ A;  2ZBB A;  1BUE A;  4QPR A;  1S1Y A;  3CAX A;  4CJN A;  3P7N A;  1L0D A;  5M1A A;  4KZ7 A;  2VGJ A;  3HUO A;  4WF0 A;  5TGF A;  5CX7 A;  3SH8 A;  1HTZ A;  4LV0 A;  5F68 A;  4BWI A;  2JHE A;  1UWP X;  4EBP A;  4EET B;  1FIK A;  2NUT C;  4XT2 A;  4Y15 A;  5FQ9 A;  3V39 A;  5DF9 A;  5A93 A;  4OP8 A;  1F98 A;  3B3X A;  1GHI A;  4DXC A;  1S67 L;  4CLC C;  3CLO A;  3CI6 A;  4FOF A;  3IS2 A;  1SKO A;  1K57 C;  4HBT A;  4NXE A;  1PNE A;  2XF3 A;  3HJI A;  3H7W B;  4P87 A;  5E2G A;  4R6L A;  1PWC A;  3IT9 A;  1LL9 A;  2DMW A;  2PBD P;  3IWI A;  5F69 A;  3WS4 A;  4RA7 A;  4JGQ A;  4HJ6 A;  5E43 A;  4OQH A;  3E4O A;  4OLG A;  5CER A;  5DFX A;  4NXB A;  4A5R A;  1JVJ A;  1JTG A;  1SKF A;  4S2O A;  4CPK A;  1WYB A;  4EBN A;  2CMN A;  1RCJ A;  3VE4 A;  3H82 A;  1MKI A;  4MNR A;  3OPH A;  3BLS A;  1Q2Q A;  3G34 A;  1SHV A;  1TS6 A;  4KQQ A;  2P08 A;  1YSQ A;  3WS1 A;  4X1M A;  3HLB A;  4JPM A;  4JXG A;  5HAI A;  4WN5 A;  4K08 A;  4BD0 A;  1I2W A;  3KSI A;  3W4Q A;  4JXS A;  3EGD C;  4P6Z S;  4R0Q A;  4Q0J A;  1BYW A;  1VB6 A;  3DW0 A;  2ZMV A;  4JF6 A;  5TBM B;  3IHB A;  5I94 A;  5FAO A;  3PTE A;  4FH2 A;  2W3G A;  3F1N A;  1W7F A;  2W3F A;  2VJW A;  1PW1 A;  4LCL A;  5HWW A;  4GDN A;  4MDZ A;  5CTM A;  1VET A;  2V20 A;  3S7N A;  3LIB A;  3IH9 A;  2P9V B;  3F1O B;  5CED A;  2ZD8 A;  3F1P A;  3NOP C;  4PMA A;  1RGZ A;  1O07 A;  2KX6 A;  5FQM A;  4HH3 A;  3BFF A;  1NRJ A;  2WKP A;  4M3K A;  3Q1F A;  3D3O A;  3TG9 A;  2XEP A;  2ZQC A;  2OAQ 1;  2Y55 A;  1VM1 A;  2HF6 A;  4H6J A;  3HLW A;  1LSV A;  3NHQ A;  5EVE A;  3N8R A;  1KE4 A;  4LPZ A;  2ZL1 B;  5DTK A;  2EWW A;  3LIE A;  3LUQ A;  1NRF A;  2OLV A;  2L1M A;  4R1G A;  2Y2J A;  4PM8 A;  1OTB A;  4GD8 A;  4R4R A;  1ZKJ A;  4HJ4 A;  5G4Z A;  1XA7 A;  4CQH A;  3HLF A;  4OKP A;  5HD5 A;  1Y28 A;  2ZQ7 A;  5CHU A;  1JTD A;  1CQA A;  1YPR A;  5FQJ A;  3T4J A;  5L09 A;  2B5R A;  1XJ4 A;  4X69 A;  5CTN A;  4IVK A;  1XJ6 A;  3NDG A;  2OWH A;  3I7J A;  3P09 A;  3GEC A;  4L9E A;  4E3O A;  3VSK A;  3BY9 A;  3IF6 B;  4Y3I A;  1N9N A;  2Y2P A;  3NBL A;  2QZ6 A;  3JVV A;  3UE6 A;  1MBL A;  4BL2 A;  5JYP A;  2J9P A;  1BSG A;  3T12 B;  2EFX A;  3U2A A;  3CUE A;  4WZ5 C;  4RYE A;  3U4L P;  5F82 A;  2ZQ9 A;  4Y2F A;  1PRQ A;  4JGR A;  2XK1 A;  4Y0U A;  5E2F A;  2ZC7 A;  1KGG A;  4JF5 A;  5LBR A;  4KZ6 A;  3T1Q B;  4HIA A;  3CG5 A;  2R78 A;  1MWS A;  5GHX A;  4EUV A;  1LSX A;  1GA9 A;  3A0R A;  1YLP A;  5GHZ A;  2P04 A;  1IEM A;  3SH9 A;  1IYS A;  1BZA A;  4RQ9 A;  3VFF A;  2PRF A;  3LR3 A;  2RCX A;  1TD5 A;  5U47 A;  2XD5 A;  5JYO A;  1Z09 A;  4E6X A;  2JBF A;  1H3Q A;  4N92 A;  2V1Z A;  3QNC A;  3UB6 A;  3W2Z A;  4DN0 A;  3SS3 A;  4FH4 A;  2R9W A;  3NOU C;  3VP2 A;  4E6W A;  4YIN A;  3M2K A;  1P0Z A;  3K2N A;  2ZC3 B;  3TW8 A;  4G3W A;  2H5S A;  4QY6 A;  5DTS A;  3DTM A; 
#chains in the Genus database with same CATH homology
 2ACG A;  2JKF A;  1HLU P;  1G5U A;  3KYE A;  3UB5 P;  1ACF A;  1FIK A;  1AWI A;  3CHW P;  2PAV P;  1VET A;  1Y4O A;  3L7H A;  3T12 B;  2HZ5 A;  1VEU A;  4FTX A;  3U4L P;  3NUL A;  1PRQ A;  1SKO A;  1PNE A;  5FDS A;  1K0K A;  3T1Q B;  2PBD P;  2E8J A;  4X1L A;  4ESP A;  3LEQ A;  2JKG A;  1A0K A;  3CPT B;  3D9Y A;  3NEC A;  5EM1 A;  5EVE A;  2VK3 A;  2BTF P;  3MSH A;  2ZL1 B;  1SZV A;  4D60 A;  4QWO A;  4FUW A;  4X25 A;  2V8F A;  2PRF A;  1Z09 A;  3MS6 A;  1VET B;  1F2K A;  1CJF A;  1VEU B;  4X1M A;  2B95 A;  3L9K A;  5FEF A;  3DAV A;  1CQA A;  1D1J A;  1YPR A;  3T1X A;  5EV0 A;  1J3W A;  1SKO B;  2V8C A;  5FEG A;  1CF0 A;  5EM0 A;  3CPT A;  3T1R A;  1PFL A;  3T1S A;  2ZL1 A;  3LGO A;  1FIL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...