1A0KA

Profilin i from arabidopsis thaliana
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
130
structure length
130
Chain Sequence
SWQSYVDDHLMCDVEGNHLTAAAILGQDGSVWAQSAKFPQLKPQEIDGIKKDFEEPGFLAPTGLFLGGEKYMVIQGEQGAVIRGKKGPGGVTIKKTNQALVFGFYDEPMTGGQCNLVVERLGDYLIESEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROFILIN
publication title The crystal structure of a major allergen from plants.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Cytoskeleton
total genus 34
structure length 130
sequence length 130
ec nomenclature
pdb deposition date 1997-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00235 Profilin Profilin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.30 Alpha Beta 2-Layer Sandwich Beta-Lactamase Dynein light chain 2a, cytoplasmic 1a0kA00
4ESPA 2V8CA 2VK3A 1J3WA 5FEGA 5EVEA 3U4LP 3T1QB 3NULA 2V8FA 5FDSA 1AWIA 1CJFA 1VEUA 3CHWP 3L7HA 4X1LA 2B95A 4X1MA 4QWOA 4X25A 1CF0A 5EM1A 3NECA 1YPRA 1Y4OA 2ZL1B 1PFLA 3MSHA 1D1JA 1VETA 4D60A 3LGOA 5EV0A 1A0KA 3D9YA 4FUWA 2JKGA 1FIKA 5EM0A 4FTXA 1G5UA 1FILA 3T1XA 3KYEA 1SKOB 3UB5P 3T1SA 2ZL1A 1Z09A 3DAVA 3L9KA 2PBDP 1HLUP 3MS6A 2HZ5A 3CPTB 1PRQA 1ACFA 2JKFA 3T1RA 1SKOA 2BTFP 5FEFA 2PAVP 2ACGA 3T12B 1K0KA 1F2KA 2E8JA 3CPTA 1PNEA 1SZVA 2PRFA 1VETB 1VEUB 1CQAA 3LEQA
chains in the Genus database with same CATH superfamily
4WL9A 2HDUA 4EQ1A 5EVEA 1XFNA 3QP2A 4WELA 3ZCZA 1XX2A 3PBOA 4XT2B 2XF3A 2FH5A 2XA7S 5FDSA 3FPWA 1K38A 4LRYC 2HP5A 1NWZA 3QP1A 3A3FA 5HL6A 2W3FA 3HLEA 3BECA 1XKZA 2PD7A 4Y0TA 2QHKA 2Y55A 3QNCA 3G34A 4EBNA 3W2ZA 3F1OA 5HWTA 2Y2HA 3ITAA 4P6BA 3MSHA 2A2LA 3TJZC 1LT0A 2JKGA 1LSVA 3LIEA 4IUKA 1MKIA 4BBVA 4L9EA 4O0PA 2HDSA 5HD5A 2O9CA 3T1SA 5HZHA 4NXBA 1N9OA 4EUVA 3DW0A 1EI5A 3Q82A 3NI9A 4OPYA 5HARA 2V1BA 2WKRA 4KG6A 4E6WA 4I3AA 1JVJA 1LI0A 3MXRA 4HJ4A 2ZQDA 2Z6DA 1KVLA 1GSVA 3DBAA 4Q0HA 2PU4A 5AQBA 1W7FA 3OBFA 1NJ4A 2Z2LB 3ITBA 4IVKA 2Y2IA 3NIAA 4Z1WA 3BFGA 4JPMA 4WBGA 1S4RA 3CITA 4GLQA 4WF0A 2QKPA 3Q7ZA 3IF6B 1KGFA 4X56A 4B88A 3O3VA 3ZG0A 4JF5A 4RVAA 1NLZA 2VV7A 2ZMAA 1CJFA 3LI8A 4EEUA 3EOIA 4WN5A 4JXVA 5CHMA 4DDSA 4X1MA 1DJAA 1WYCA 3Q7VA 2W0NA 4PAUA 3O87A 1WYBA 3BQAA 2P7JA 4X6TA 1YPRA 4CLCB 4F3LA 4RX3A 3PTEA 1P97A 4PPRA 2C5WB 3LI9A 5FAOA 2ZQAA 5EM0A 3CWFA 3MQOA 3V3SA 3T4LA 1LL8A 4ME4A 5EOOA 5HAPA 3HLBA 5KSCA 4Y3IA 2H5SA 4U3TA 1IEMA 5HD3A 2I72A 1ES4A 4S2IA 5GLAA 2KX6A 2XQZA 3NHQA 5J3WA 1N9NA 5TBMA 4OLGA 4QY6A 1DP6A 4M3KA 1J9MA 3EQUA 4KZ9A 4CJNA 3IH8A 3ZG5A 4HH2A 1YM1A 3ZNTA 1CK3A 4R4SA 4B9OA 1NXYA 4LPZA 1MBLA 2VK3A 1PIOA 3BFDA 4EETB 5DF7A 3VOYA 1YLWA 2Y79A 5G4YA 3UB7A 3UPNA 3N8RA 2DCFA 3EGXC 1OTEA 1DP9A 1RCJA 2J3WA 2O99A 1BLHA 2IA2A 3VP3A 4HI4A 3RXWA 3OCNA 3IWQA 2XK1A 1Q2QA 4S2LA 1SDNA 4JBFA 5GHYA 1LSWA 3VV4A 4IJGA 5F83A 3MKEA 2K2NA 5FI6A 3SW1A 5M18A 2EX2A 2WKHA 4MEZA 2JE5A 4R70A 5J7EA 1LI9A 4OQ0A 5FQMA 3A0VA 1S66L 3UPPA 4NXFA 3FWLA 1BLCA 4GS9A 3D4FA 3F1NB 2M7VA 5TGFA 3MR0A 1L3LA 4P85A 2AVXA 3OCLA 5FATA 2JKTI 2IWDA 2VX8A 4KQQA 2H28A 3G31A 2GDNA 4E3OA 3L9KA 3T4OA 4S2MA 4JGPA 3QP4A 5EVIB 5DKKA 2WGVA 2JKFA 2EXBA 3H9WA 1W79A 3BFEA 4OPQA 5FEFA 4DJ2A 3HVFA 1MKMA 4EW7A 3IH9A 2EWWA 2EFUA 1F2KA 5M1AA 2VKSA 5BOHA 4BENA 4KZ6A 4IUHA 3D3OA 4ZJ1A 5L8MA 3DWZA 3KO6A 3HLCA 4M4XA 1K56D 1BTLA 5EPHA 4YWZA 4GKUA 3T50A 3GSGA 2GZAA 1LL5A 4H8RA 4R3BA 3BY9A 3DWKA 3TE8A 2K31A 5IU1A 1GCEA 2ZQ7A 4C3QA 2O0YA 3OPHA 4KZ8A 3PXPA 2QWSA 4DN0A 5FL3A 2OLVA 4Z9QA 4G3WA 3S7QA 2ZD8A 3H7WA 1SKFA 2JKRM 4DDYA 3PBQA 2PU2A 1MPLA 5GLDA 3GMWA 2B18A 4OVDA 3LGOA 5JYOA 2MJ6A 4K0WA 2BG1A 4UA7A 3V50A 4PKYG 5E2EA 1CI9A 3BYDA 4QB8A 1CI8A 4I3IA 1OPXA 4BLMA 3T1XA 3LR5A 1EROA 5CECA 2GNXA 2D01A 4UQIM 2I9VA 3DAVA 3LR3A 1H8MA 4G3KA 1BLPA 1ESUA 1G6OA 4I5SA 4ZJ2A 3MJQA 4WUJA 5E2HA 2VJWA 2PAVP 4JF4A 3BLSA 1OTDA 4DKIA 2HP9A 4MLLA 2W1RA 1ZKJA 3VE3A 4QY5A 2V20A 1D06A 2ZLYA 4OQGA 1CEFA 1OTIA 3LY4A 2B02A 1G68A 1J3WA 2WYXA 3BEBA 3A3DA 4X53A 5HAQA 3ZDJA 1MZUA 3F1OB 1S67L 1N4OA 1AWIA 3LIBA 1JTDA 1EW0A 1S6RA 4OKPA 3UDIA 3QHYA 3N4IA 5F5YA 3IX8A 3NOTC 2JBFA 4OQIA 5CX7A 4QWOA 1CF0A 3UB6A 2PHYA 5DTTA 4OOMA 3E98A 4WEKA 3LEZA 1PFLA 3RH8B 3S7PA 4HJ6A 1EWZA 2QZ6A 3W8KA 4OP5A 3LICA 1PWGA 3BFFA 5L10A 4S2KA 4PM9A 3LFVA 1GHMA 1X0OA 1GHIA 4EXOA 4LLOB 3MS6A 3K3DA 4UQIS 1U60A 4NXEA 3OOVA 3LIAA 4X69A 4GB7A 3HUOA 4DMZA 4L9GA 2G7UA 3KSHA 1H0MA 4WEJA 1N9BA 1DRMA 1SKOA 1F98A 5AQ9A 2VA0A 3PAGA 2OOLA 1JWVA 3HCYA 5F6AA 3P01A 3IHBA 3PAEA 2GJ3A 4EV4A 2XFTA 4PM5A 3GVBA 3HREA 4R23A 4NETA 3Q7VB 1UGUA 1YMXA 5CGSA 2Y91A 2PR5A 3NC8A 5U47A 2V8FA 5DKLA 3IS2A 3PBNA 4GNUA 5HWVA 5CERA 2ZC3B 3SH7A 5IHVA 5HW3A 4FOFA 3OPRA 1IFQA 2ZC5B 1YKDA 1KGGA 4R6LA 2J9OA 4S2JA 1YLZA 2VGJA 3HLDA 4WZ4A 3DTEA 3FV7A 3UDFA 3NDEA 3B47A 1ZHHB 3G35A 3E0YA 3S1YA 3A0RA 3JVVA 3N7WA 3BW6A 2P9VA 1MWTA 1W5DA 1PI5A 4IEDA 5TBMB 4QD4A 1I2WA 3C7VA 1GSWA 1BZAA 2D02A 3OLOA 4PM7A 1K57A 2XFSA 5KMWA 3CG5A 1KGEA 4AFIA 2ZC7A 1Y28A 4B4XA 1GA0A 1T18A 2OLUA 4KQDA 2Y2OA 1DJBA 2ACGA 4I38A 4E6XA 3LCEA 4EERA 5IS1A 1M40A 3MMHA 3UPOA 2PRFA 2QJ7A 1ES5A 1P9WA 4EU0A 1SHVA 5CHUA 1E3UD 1L2SA 5TFQA 5F82A 5EE8A 3ZFZA 3K2NA 5GLCA 4PHTA 1T1BA 3B42A 2VV6A 5FQKA 5GL9A 4R3AA 2EX8A 4R4RA 2ZQ9A 1HZOA 2L4RA 4OPRA 3RFBA 4NG2A 4GS9B 1XP4A 1BUEA 1E25A 4LCMA 4P6ZM 3OPLA 4MNRA 4HOIA 4Q0JA 5TR7A 4K08A 1NLYA 5EM1A 3E2KA 5L07A 3C30A 1JWZA 3FYZA 3MQ0A 1ZG6A 3CMZA 2ZOHA 3HLFA 4KZ5A 2CC1A 3ZG8B 2VV8A 2P04A 4B93A 2WAEA 4KG2A 4JXSA 4WM9A 2Q0OA 4FTXA 4WYYA 3E4QA 3GV9A 3IQAA 4E3IA 3SZTA 1LHYA 4F94A 3C4PA 5LBRA 1AXBA 2KDKA 1DJCA 4CQHA 4UA9A 2PBDP 3IX3A 2ZM2A 4E3NA 2HV1A 4PKYA 4IBXA 2JN7A 1G6AA 1LSXA 4LGWA 1D7EA 4MDZA 2XROA 2LB9A 2QPNA 1BULA 3E4PA 1XJ4A 3C4OA 3PHYA 1K56A 4ZJ3A 3CPTA 3P7NA 2M1CA 1T1AA 5CXWA 2VGLM 3NOUC 4KZAA 3QP5A 4BMWA 3SS5A 3WRTA 4GCZA 4S2OA 2Y2JA 3H7WB 1QMFA 3C7UA 3O86A 2XH9A 3AGDA 2VZWA 4K91A 2A49A 2PYPA 3PBTA 1IYSA 4Y13A 5FSRA 1YT4A 3AGEA 4MN7A 4N92A 3IBRA 1NRFA 4KQRA 2ZMVA 3TG9A 1C3BA 2Y2NA 3M6HA 3QP6A 2XDMA 4YINA 4LFUA 4P6ZS 5CGXA 3CAXA 5G18A 3CZDA 3IT9A 4YFMA 1Y4OA 3T4QA 1OT6A 1W8YA 4FSFA 4LV1A 3LR4A 3RXXA 1TVFA 5FA7A 4E3MA 3IXBA 4I39A 1TS8A 3OC2A 2P08A 3LIFA 4DXBA 1TEMA 5CGWA 4JGRA 4Y5FA 5F69A 1K4FA 3MXSA 2DRWA 1P0ZA 4ZDXA 3ZQ5A 1YLJA 2HJ9C 2GX5A 3WS1A 4EESA 1PI4A 4MBKA 5MC7A 1YMSA 3VMAA 3R7WB 1IKIA 2H0TA 5C5KA 3T12B 2E8JA 3VP0A 2J80A 1F5MA 3G2YA 4N1HA 5DVAA 1NYMA 3G32A 1IYQA 2J3TC 5A92A 3N8LA 4WLAA 5A91A 3R4KA 4JGQA 2VGLS 3MKFA 3ICYA 4KENB 5KIZA 3NULA 3FG8A 2OAP1 4MCWA 4QHCA 2Z6CA 5CRFA 3DTMA 4EQIA 4X1LA 2OWJA 3OZHA 4Y15A 2XR0A 4EWFA 4JF6A 1IYOA 4DF6A 1IOUA 3EEHA 4S2NC 3C38A 3AGFA 1XJ3A 2CMNA 2DNSA 3LY3A 2Y59A 2B5RA 4Y17A 1K4EA 2HDQA 2ZOIA 3U2AA 2L0WA 3Q81A 2WZXA 3VP2A 4RX2A 1Q2PA 3MZDA 3W4QA 3GECA 3KSGA 1ZG4A 4O01A 2FFYA 3O5YA 4OOYA 1PWDA 3BRMA 4QJGA 5EVLA 4KG5A 2QJ5A 4HIAA 2WKIA 1SKOB 4HJ3A 1YQSA 3V5MA 5HSQA 3MFDA 3A3EA 3V39A 3UE1A 4WMCD 4BBUA 1XGIA 2WKEA 2Y2MA 4ETZA 3HL9A 1I2SA 4WZ5C 4Y0UA 3IS2B 1HTZA 4CPKA 3WWXA 1PW1A 4S2NA 4HEFA 1VQQA 5JYPA 1FSWA 3NDGA 2C6WB 4NXGA 1VM1A 4HQAA 5F1FA 1NRJA 3CJMA 1PZPA 4ARZB 5EOEA 3VFFA 1OTAA 1L0GA 3SH8A 3LIDA 5HL1A 3KSIA 1WE4A 1L0DA 3M2JA 2EXAA 2K7SA 3ZVTA 2R78A 2P9VB 3T4KA 3UE3A 3TOIA 1BYWA 4UEYA 3R7WA 5IT5A 5EUAA 2ZJ9A 4ZAMA 5D3OA 1FCMA 3T4SA 1XA1A 2XEPA 4EUZA 2RCXA 4D60A 1KDSA 4IHQA 1KVMA 3D9YA 5EFWA 1FIKA 2Y2LA 4WZ5A 3UO9A 2E8IA 1XGJA 4GHIA 1E4DA 4DE3A 2W3GA 3WRZA 1DY6A 3CI6A 3HJIA 2QMIA 3HJKA 3ZNYA 2ZL1A 5F1GA 3VP4A 3H82A 5GHZA 3DTIA 4P0MA 3FZCA 4CLCD 4OQHA 1V9YA 2PDRA 1PRQA 1XJ2A 4XUZA 4RQ9A 2JKRI 1KDWA 1E3UA 1STZA 1W63Q 4YNRA 3UN7A 3T4JA 4FCFA 5FQ9A 1ERMA 5FQQA 1JNUA 1L0FA 1ES2A 1F9IA 3T1QB 5AVFA 4RA7A 5TJJA 5HWWA 1PWCA 1K25A 2WADA 1UWPX 1TD5A 4E04A 1ODVA 1K55C 1VEUA 3E4OA 3NJAA 4GD6A 4BBTA 1K57C 4H6JA 1ALQA 4FD8A 1S1YA 1KOUA 4R38A 2WGIA 1N9LA 2EA9A 2XD1A 4LRXC 4X25A 2WGWA 2PT7A 4DE1A 5M19A 1MXOA 3UDXA 3HBRA 4DE2A 3RJUA 2ZM8A 1A0KA 4MMNA 3N6IA 4ARZA 5A93A 3TSGA 2X01A 4Q0IA 2A3UA 2W1TB 3BLMA 1YSQA 3S22A 3NCKA 3F1PB 1LL9A 1MWSA 2XSSA 3HUMA 4C6YA 3CPTB 1FOFA 4UA6A 1FSYA 4LV3A 2XRNA 5GLBA 2H0YA 3UE6A 1ACFA 1TDGA 3P09A 5F68A 1QMEA 1ES3A 2HJEA 5DFYA 3JYIA 3VOLA 1K55A 3EGDC 1PW8A 1M6KA 2J9PA 4KZ7A 3UY6A 5G4ZA 3ZGAB 5DJTA 2KLIA 5DF8A 2VEAA 3A0SA 3LEQA 4BL2A 4D2OA 1K6SA 4GDBA 2A24A 5FEGA 3U4LP 2H10A 5EVID 3B33A 3IBJA 1XXMA 3PYPA 3VOZA 1VHMA 2FZ0A 2L1MA 3CHWP 4CLCE 3UB9A 3IXDA 2Y2GA 1OT9A 4GJ4A 1CEGA 3FKVA 4OONA 2NUTC 5KZHA 1YAXA 3KSFA 4Y7PA 1NZUA 3CUEC 4KUOA 2WK0A 5HDCA 4DRTA 3QNBA 1ZTUA 4KZ3A 4BD1A 3MXQA 3PR6A 4PMAA 1HVBA 1S4SA 4K0XA 1ONHA 1SCWA 3EWKA 3WS5A 1G5UA 3GQZA 2W3EA 1RGYA 2HPBA 3KYEA 3G2ZA 4UAAA 3BWLA 4X55A 3LYXA 2WKPA 1HLUP 2HZ5A 3ISGA 4Y2FA 5GHXA 3VP1A 4MBFA 2Y2KA 3ZG7B 2BASA 3JVUA 2R9WA 2Y2QA 2X71A 3VE4A 2HGVA 2BTFP 2RL3A 5L09A 3LO7A 2J7VA 3MFXA 4P87A 3IXHA 5FI2A 1YLTA 5FI7A 3CUEA 4ESPA 4PM6A 3BFCA 1Z6FA 2P74A 1H8ZA 4PM8A 2W1TA 4L0LA 2JKTM 5FAPA 3MBZA 4QPRA 3F1PA 3SS3A 4JKTA 2QYBA 1ONGA 3V3RA 1KE4A 1FCOA 2Q9NA 2ZC6B 3HUNA 4OPZA 1IYPA 3TRCA 2HDRA 3KYZA 3L7HA 1P9RA 5HPIA 1MY8A 4EEPA 1K54C 3FKWA 3S7OA 1K6RA 3UMEA 2IWBA 1FR1A 3VFHA 2J8YA 4XT2A 1YLPA 1FR6A 2X02A 3I7JA 1TS6A 5E2GA 1SDEA 5AQAA 3C2WA 4LENA 3KX0X 3GDIA 2XGNA 3C8CA 5EV0A 2V0WA 3SOIA 1NY0A 2WKQA 3MZEA 1FILA 3EEAA 3C5AA 4LCLA 3WS0A 4OH0A 1BSGA 1YLYA 4FH2A 3IF6C 4WMCA 1BT5A 1Z09A 2ZM0A 2PR6A 4G3VA 2ZQCA 1XJ6A 4IVIA 4O8GA 3UMDA 3M6BA 5DTKA 1RGZA 1FCNA 3GR2A 4HBTA 3WS2A 2PD8A 2BLSA 1K54A 1OTBA 1K0KA 1ESIA 1XPBA 3IWOA 3S4XA 1Y54A 4R1GA 2V2FF 4CLCC 4MN6A 1TF1A 2OAQ1 1S0WA 1KE3A 2V8CA 1ZC2A 3M2KA 3A3JA 1DP8A 1O07A 3UNWA 1I5QA 3BJNA 1HD8A 2ZBBA 2EFXA 1W63M 4X68A 1XFQA 1L0EA 4BD0A 1IELA 1IKGA 1GA9A 2YKHA 3ZVWA 3MQQA 1TS7A 4I3JA 4Q8IA 2XD5A 4NEED 2B95A 3FPVA 3SS4A 2ZMFA 4EBLA 4C75A 3IF6A 4GN2A 4HP9A 5I5LA 4GD8A 4GHIB 1UWNX 1XA7A 1H5XA 5CHJA 3NECA 1H3QA 4GOGA 2G2UA 2ZL1B 3Q07A 4ZTKA 2OV5A 4UHUA 3H82B 3SH9A 5A90A 3IF5A 4IBRA 5KSHA 4FH4A 5EECA 2V9AA 2VLGA 3G30A 4BWIA 2Y8HA 3W4OA 1T19A 4N1XA 4CLCA 3UE0A 3UB5P 5AVEA 4N9LA 4DJ3A 4ETXA 2W3DA 2WUQA 4GZBA 3Q1FA 5HFOA 5J8XA 2W27A 4ID4A 4II7A 2ZQ8A 5HX9A 1JWPA 1NYYA 1OJ5A 4DXCA 3T4TA 2OWHA 1BLSA 1PNEA 5CEDA 1VETB 1VEUB 1S1ZA 3HLWA 4LRZE 3ZYTA 3QP8A 3P98A 2UWXA 4H6JB 4U0TA 5FQJA 2XLNA 5CTMA 5AJGA 5FQIA 2VGKA 5I94A 4JXGA 4L9FA 4OOLA 5E43A 4KZBA 1MC0A 2WGWB 4KUKA 3ZG9B 4S2PA 5HDDA 5CEBA 3RTYA 3S7NA 4B4ZA 2W3HA 3NBLA 3EQVA 2PYRA 4Y0OA 3CLOA 4QU3A 1LLBA 5EVIC 2Z2MB 3D72A 2HP6A 1FQGA 3G4PA 4GW9A 4EBPA 3ULFA 2INWA 1D1JA 1YSPA 1WA9A 3DTKA 2FFFB 2Q9MA 1OJGA 4R3JA 4JGOA 3LUQA 1MWUA 4U0XA 1KE0A 2EWVA 2IWCA 3B3XA 4HNBA 2JC7A 3G6OA 4NKPA 2NUPC 3FC7A 3VSLA 4HY8A 3GRJA 3MZFA 2UV0E 4XUXA 2V1AA 3A3IA 3N8SA 2YKFA 3UB8A 1MWRA 1T1CA 2M7UA 4OP8A 3E2LA 1TS0A 2PBYA 1G28A 1H8YA 4E3LA 3F1NA 5DJUA 3VSKA 5FAQA 5A8BA 2JCHA 4BJPA 4MBHA 2A24B 2Y4AA 2ZC4B 2Y2PA 3IHAA 2R9XA 3OPPA 2G2WA 5AQ7A 1OMEA 3BY8A 3BM6A 3IX4A 1GHPA 2WZZA 1CQAA 4LV2A 5EVIA 5FASA 5L2FA 5DF9A 3PBRA 5J4EA 1PZOA 4YOFA 1GSXA 1ERQA 2XA7M 3IXGA 2LB5A 4HESA 4RYEA 2OSUA 4XXRA 3NOPC 5HAIA 3V67A 2V1ZA 4KZ4A 5FDHA 1O7EA 3K3CA 1JTGA 3PBSA 4OLDA 5E2FA 2DMWA 4ZBEA 3TW8A 4HBUA 4ZRRA 1PYYA 4A5RA 2EX6A 3HLGA 3GTCA 4LV0A 4HH3A 4R0QA 4JXWA 4NK3A 1VETA 5DFXA 3LR0A 3MF0A 4FUWA 3IWIA 1TDLA 5DTSA 2J3TD 4HP4A 2O9AA 2V0UA 1W8QA 4N9KA 4HHDA 4BL3A 3KYQA 4JLFA 3BQ8A 1VB6A 4E3JA 5K5BA 3W4PA 2EX9A 2KOIA 4GDNA 2JHEA 1NZOA 4DE0A 1V9ZA 3ZHHA 5HDSA 3T1RA 3JPUA 2O9BA 4KQOA 2WAFA 4F3LB 3WS4A 4E3KA 1RP5A 4O7DA 4MN5A 2HF6A 1SZVA 3NY4A 4BQMA 5CTNA 3O88A 5HPFA
chains in the Genus database with same CATH topology
4ESPA 2V8CA 2VK3A 1J3WA 5FEGA 5EVEA 3U4LP 3T1QB 3NULA 2V8FA 5FDSA 1AWIA 1CJFA 1VEUA 3CHWP 3L7HA 4X1LA 2B95A 4X1MA 4QWOA 4X25A 1CF0A 5EM1A 3NECA 1YPRA 1Y4OA 2ZL1B 1PFLA 3MSHA 1D1JA 1VETA 4D60A 3LGOA 5EV0A 1A0KA 3D9YA 4FUWA 2JKGA 1FIKA 5EM0A 4FTXA 1G5UA 1FILA 3T1XA 3KYEA 1SKOB 3UB5P 3T1SA 2ZL1A 1Z09A 3DAVA 3L9KA 2PBDP 1HLUP 3MS6A 2HZ5A 3CPTB 1PRQA 1ACFA 2JKFA 3T1RA 1SKOA 2BTFP 5FEFA 2PAVP 2ACGA 3T12B 1K0KA 1F2KA 2E8JA 3CPTA 1PNEA 1SZVA 2PRFA 1VETB 1VEUB 1CQAA 3LEQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ESP A;  2V8C A;  2VK3 A;  1J3W A;  5FEG A;  5EVE A;  3U4L P;  3T1Q B;  3NUL A;  2V8F A;  5FDS A;  1AWI A;  1CJF A;  1VEU A;  3CHW P;  3L7H A;  4X1L A;  2B95 A;  4X1M A;  4QWO A;  4X25 A;  1CF0 A;  5EM1 A;  3NEC A;  1YPR A;  1Y4O A;  2ZL1 B;  1PFL A;  3MSH A;  1D1J A;  1VET A;  4D60 A;  3LGO A;  5EV0 A;  1A0K A;  3D9Y A;  4FUW A;  2JKG A;  1FIK A;  5EM0 A;  4FTX A;  1G5U A;  1FIL A;  3T1X A;  3KYE A;  1SKO B;  3UB5 P;  3T1S A;  2ZL1 A;  1Z09 A;  3DAV A;  3L9K A;  2PBD P;  1HLU P;  3MS6 A;  2HZ5 A;  3CPT B;  1PRQ A;  1ACF A;  2JKF A;  3T1R A;  1SKO A;  2BTF P;  5FEF A;  2PAV P;  2ACG A;  3T12 B;  1K0K A;  1F2K A;  2E8J A;  3CPT A;  1PNE A;  1SZV A;  2PRF A;  1VET B;  1VEU B;  1CQA A;  3LEQ A; 
#chains in the Genus database with same CATH topology
 4WL9 A;  2HDU A;  4EQ1 A;  5EVE A;  1XFN A;  3QP2 A;  4WEL A;  3ZCZ A;  1XX2 A;  3PBO A;  4XT2 B;  2XF3 A;  2FH5 A;  2XA7 S;  5FDS A;  3FPW A;  1K38 A;  4LRY C;  2HP5 A;  1NWZ A;  3QP1 A;  3A3F A;  5HL6 A;  2W3F A;  3HLE A;  3BEC A;  1XKZ A;  2PD7 A;  4Y0T A;  2QHK A;  2Y55 A;  3QNC A;  3G34 A;  4EBN A;  3W2Z A;  3F1O A;  5HWT A;  2Y2H A;  3ITA A;  4P6B A;  3MSH A;  2A2L A;  3TJZ C;  1LT0 A;  2JKG A;  1LSV A;  3LIE A;  4IUK A;  1MKI A;  4BBV A;  4L9E A;  4O0P A;  2HDS A;  5HD5 A;  2O9C A;  3T1S A;  5HZH A;  4NXB A;  1N9O A;  4EUV A;  3DW0 A;  1EI5 A;  3Q82 A;  3NI9 A;  4OPY A;  5HAR A;  2V1B A;  2WKR A;  4KG6 A;  4E6W A;  4I3A A;  1JVJ A;  1LI0 A;  3MXR A;  4HJ4 A;  2ZQD A;  2Z6D A;  1KVL A;  1GSV A;  3DBA A;  4Q0H A;  2PU4 A;  5AQB A;  1W7F A;  3OBF A;  1NJ4 A;  2Z2L B;  3ITB A;  4IVK A;  2Y2I A;  3NIA A;  4Z1W A;  3BFG A;  4JPM A;  4WBG A;  1S4R A;  3CIT A;  4GLQ A;  4WF0 A;  2QKP A;  3Q7Z A;  3IF6 B;  1KGF A;  4X56 A;  4B88 A;  3O3V A;  3ZG0 A;  4JF5 A;  4RVA A;  1NLZ A;  2VV7 A;  2ZMA A;  1CJF A;  3LI8 A;  4EEU A;  3EOI A;  4WN5 A;  4JXV A;  5CHM A;  4DDS A;  4X1M A;  1DJA A;  1WYC A;  3Q7V A;  2W0N A;  4PAU A;  3O87 A;  1WYB A;  3BQA A;  2P7J A;  4X6T A;  1YPR A;  4CLC B;  4F3L A;  4RX3 A;  3PTE A;  1P97 A;  4PPR A;  2C5W B;  3LI9 A;  5FAO A;  2ZQA A;  5EM0 A;  3CWF A;  3MQO A;  3V3S A;  3T4L A;  1LL8 A;  4ME4 A;  5EOO A;  5HAP A;  3HLB A;  5KSC A;  4Y3I A;  2H5S A;  4U3T A;  1IEM A;  5HD3 A;  2I72 A;  1ES4 A;  4S2I A;  5GLA A;  2KX6 A;  2XQZ A;  3NHQ A;  5J3W A;  1N9N A;  5TBM A;  4OLG A;  4QY6 A;  1DP6 A;  4M3K A;  1J9M A;  3EQU A;  4KZ9 A;  4CJN A;  3IH8 A;  3ZG5 A;  4HH2 A;  1YM1 A;  3ZNT A;  1CK3 A;  4R4S A;  4B9O A;  1NXY A;  4LPZ A;  1MBL A;  2VK3 A;  1PIO A;  3BFD A;  4EET B;  5DF7 A;  3VOY A;  1YLW A;  2Y79 A;  5G4Y A;  3UB7 A;  3UPN A;  3N8R A;  2DCF A;  3EGX C;  1OTE A;  1DP9 A;  1RCJ A;  2J3W A;  2O99 A;  1BLH A;  2IA2 A;  3VP3 A;  4HI4 A;  3RXW A;  3OCN A;  3IWQ A;  2XK1 A;  1Q2Q A;  4S2L A;  1SDN A;  4JBF A;  5GHY A;  1LSW A;  3VV4 A;  4IJG A;  5F83 A;  3MKE A;  2K2N A;  5FI6 A;  3SW1 A;  5M18 A;  2EX2 A;  2WKH A;  4MEZ A;  2JE5 A;  4R70 A;  5J7E A;  1LI9 A;  4OQ0 A;  5FQM A;  3A0V A;  1S66 L;  3UPP A;  4NXF A;  3FWL A;  1BLC A;  4GS9 A;  3D4F A;  3F1N B;  2M7V A;  5TGF A;  3MR0 A;  1L3L A;  4P85 A;  2AVX A;  3OCL A;  5FAT A;  2JKT I;  2IWD A;  2VX8 A;  4KQQ A;  2H28 A;  3G31 A;  2GDN A;  4E3O A;  3L9K A;  3T4O A;  4S2M A;  4JGP A;  3QP4 A;  5EVI B;  5DKK A;  2WGV A;  2JKF A;  2EXB A;  3H9W A;  1W79 A;  3BFE A;  4OPQ A;  5FEF A;  4DJ2 A;  3HVF A;  1MKM A;  4EW7 A;  3IH9 A;  2EWW A;  2EFU A;  1F2K A;  5M1A A;  2VKS A;  5BOH A;  4BEN A;  4KZ6 A;  4IUH A;  3D3O A;  4ZJ1 A;  5L8M A;  3DWZ A;  3KO6 A;  3HLC A;  4M4X A;  1K56 D;  1BTL A;  5EPH A;  4YWZ A;  4GKU A;  3T50 A;  3GSG A;  2GZA A;  1LL5 A;  4H8R A;  4R3B A;  3BY9 A;  3DWK A;  3TE8 A;  2K31 A;  5IU1 A;  1GCE A;  2ZQ7 A;  4C3Q A;  2O0Y A;  3OPH A;  4KZ8 A;  3PXP A;  2QWS A;  4DN0 A;  5FL3 A;  2OLV A;  4Z9Q A;  4G3W A;  3S7Q A;  2ZD8 A;  3H7W A;  1SKF A;  2JKR M;  4DDY A;  3PBQ A;  2PU2 A;  1MPL A;  5GLD A;  3GMW A;  2B18 A;  4OVD A;  3LGO A;  5JYO A;  2MJ6 A;  4K0W A;  2BG1 A;  4UA7 A;  3V50 A;  4PKY G;  5E2E A;  1CI9 A;  3BYD A;  4QB8 A;  1CI8 A;  4I3I A;  1OPX A;  4BLM A;  3T1X A;  3LR5 A;  1ERO A;  5CEC A;  2GNX A;  2D01 A;  4UQI M;  2I9V A;  3DAV A;  3LR3 A;  1H8M A;  4G3K A;  1BLP A;  1ESU A;  1G6O A;  4I5S A;  4ZJ2 A;  3MJQ A;  4WUJ A;  5E2H A;  2VJW A;  2PAV P;  4JF4 A;  3BLS A;  1OTD A;  4DKI A;  2HP9 A;  4MLL A;  2W1R A;  1ZKJ A;  3VE3 A;  4QY5 A;  2V20 A;  1D06 A;  2ZLY A;  4OQG A;  1CEF A;  1OTI A;  3LY4 A;  2B02 A;  1G68 A;  1J3W A;  2WYX A;  3BEB A;  3A3D A;  4X53 A;  5HAQ A;  3ZDJ A;  1MZU A;  3F1O B;  1S67 L;  1N4O A;  1AWI A;  3LIB A;  1JTD A;  1EW0 A;  1S6R A;  4OKP A;  3UDI A;  3QHY A;  3N4I A;  5F5Y A;  3IX8 A;  3NOT C;  2JBF A;  4OQI A;  5CX7 A;  4QWO A;  1CF0 A;  3UB6 A;  2PHY A;  5DTT A;  4OOM A;  3E98 A;  4WEK A;  3LEZ A;  1PFL A;  3RH8 B;  3S7P A;  4HJ6 A;  1EWZ A;  2QZ6 A;  3W8K A;  4OP5 A;  3LIC A;  1PWG A;  3BFF A;  5L10 A;  4S2K A;  4PM9 A;  3LFV A;  1GHM A;  1X0O A;  1GHI A;  4EXO A;  4LLO B;  3MS6 A;  3K3D A;  4UQI S;  1U60 A;  4NXE A;  3OOV A;  3LIA A;  4X69 A;  4GB7 A;  3HUO A;  4DMZ A;  4L9G A;  2G7U A;  3KSH A;  1H0M A;  4WEJ A;  1N9B A;  1DRM A;  1SKO A;  1F98 A;  5AQ9 A;  2VA0 A;  3PAG A;  2OOL A;  1JWV A;  3HCY A;  5F6A A;  3P01 A;  3IHB A;  3PAE A;  2GJ3 A;  4EV4 A;  2XFT A;  4PM5 A;  3GVB A;  3HRE A;  4R23 A;  4NET A;  3Q7V B;  1UGU A;  1YMX A;  5CGS A;  2Y91 A;  2PR5 A;  3NC8 A;  5U47 A;  2V8F A;  5DKL A;  3IS2 A;  3PBN A;  4GNU A;  5HWV A;  5CER A;  2ZC3 B;  3SH7 A;  5IHV A;  5HW3 A;  4FOF A;  3OPR A;  1IFQ A;  2ZC5 B;  1YKD A;  1KGG A;  4R6L A;  2J9O A;  4S2J A;  1YLZ A;  2VGJ A;  3HLD A;  4WZ4 A;  3DTE A;  3FV7 A;  3UDF A;  3NDE A;  3B47 A;  1ZHH B;  3G35 A;  3E0Y A;  3S1Y A;  3A0R A;  3JVV A;  3N7W A;  3BW6 A;  2P9V A;  1MWT A;  1W5D A;  1PI5 A;  4IED A;  5TBM B;  4QD4 A;  1I2W A;  3C7V A;  1GSW A;  1BZA A;  2D02 A;  3OLO A;  4PM7 A;  1K57 A;  2XFS A;  5KMW A;  3CG5 A;  1KGE A;  4AFI A;  2ZC7 A;  1Y28 A;  4B4X A;  1GA0 A;  1T18 A;  2OLU A;  4KQD A;  2Y2O A;  1DJB A;  2ACG A;  4I38 A;  4E6X A;  3LCE A;  4EER A;  5IS1 A;  1M40 A;  3MMH A;  3UPO A;  2PRF A;  2QJ7 A;  1ES5 A;  1P9W A;  4EU0 A;  1SHV A;  5CHU A;  1E3U D;  1L2S A;  5TFQ A;  5F82 A;  5EE8 A;  3ZFZ A;  3K2N A;  5GLC A;  4PHT A;  1T1B A;  3B42 A;  2VV6 A;  5FQK A;  5GL9 A;  4R3A A;  2EX8 A;  4R4R A;  2ZQ9 A;  1HZO A;  2L4R A;  4OPR A;  3RFB A;  4NG2 A;  4GS9 B;  1XP4 A;  1BUE A;  1E25 A;  4LCM A;  4P6Z M;  3OPL A;  4MNR A;  4HOI A;  4Q0J A;  5TR7 A;  4K08 A;  1NLY A;  5EM1 A;  3E2K A;  5L07 A;  3C30 A;  1JWZ A;  3FYZ A;  3MQ0 A;  1ZG6 A;  3CMZ A;  2ZOH A;  3HLF A;  4KZ5 A;  2CC1 A;  3ZG8 B;  2VV8 A;  2P04 A;  4B93 A;  2WAE A;  4KG2 A;  4JXS A;  4WM9 A;  2Q0O A;  4FTX A;  4WYY A;  3E4Q A;  3GV9 A;  3IQA A;  4E3I A;  3SZT A;  1LHY A;  4F94 A;  3C4P A;  5LBR A;  1AXB A;  2KDK A;  1DJC A;  4CQH A;  4UA9 A;  2PBD P;  3IX3 A;  2ZM2 A;  4E3N A;  2HV1 A;  4PKY A;  4IBX A;  2JN7 A;  1G6A A;  1LSX A;  4LGW A;  1D7E A;  4MDZ A;  2XRO A;  2LB9 A;  2QPN A;  1BUL A;  3E4P A;  1XJ4 A;  3C4O A;  3PHY A;  1K56 A;  4ZJ3 A;  3CPT A;  3P7N A;  2M1C A;  1T1A A;  5CXW A;  2VGL M;  3NOU C;  4KZA A;  3QP5 A;  4BMW A;  3SS5 A;  3WRT A;  4GCZ A;  4S2O A;  2Y2J A;  3H7W B;  1QMF A;  3C7U A;  3O86 A;  2XH9 A;  3AGD A;  2VZW A;  4K91 A;  2A49 A;  2PYP A;  3PBT A;  1IYS A;  4Y13 A;  5FSR A;  1YT4 A;  3AGE A;  4MN7 A;  4N92 A;  3IBR A;  1NRF A;  4KQR A;  2ZMV A;  3TG9 A;  1C3B A;  2Y2N A;  3M6H A;  3QP6 A;  2XDM A;  4YIN A;  4LFU A;  4P6Z S;  5CGX A;  3CAX A;  5G18 A;  3CZD A;  3IT9 A;  4YFM A;  1Y4O A;  3T4Q A;  1OT6 A;  1W8Y A;  4FSF A;  4LV1 A;  3LR4 A;  3RXX A;  1TVF A;  5FA7 A;  4E3M A;  3IXB A;  4I39 A;  1TS8 A;  3OC2 A;  2P08 A;  3LIF A;  4DXB A;  1TEM A;  5CGW A;  4JGR A;  4Y5F A;  5F69 A;  1K4F A;  3MXS A;  2DRW A;  1P0Z A;  4ZDX A;  3ZQ5 A;  1YLJ A;  2HJ9 C;  2GX5 A;  3WS1 A;  4EES A;  1PI4 A;  4MBK A;  5MC7 A;  1YMS A;  3VMA A;  3R7W B;  1IKI A;  2H0T A;  5C5K A;  3T12 B;  2E8J A;  3VP0 A;  2J80 A;  1F5M A;  3G2Y A;  4N1H A;  5DVA A;  1NYM A;  3G32 A;  1IYQ A;  2J3T C;  5A92 A;  3N8L A;  4WLA A;  5A91 A;  3R4K A;  4JGQ A;  2VGL S;  3MKF A;  3ICY A;  4KEN B;  5KIZ A;  3NUL A;  3FG8 A;  2OAP 1;  4MCW A;  4QHC A;  2Z6C A;  5CRF A;  3DTM A;  4EQI A;  4X1L A;  2OWJ A;  3OZH A;  4Y15 A;  2XR0 A;  4EWF A;  4JF6 A;  1IYO A;  4DF6 A;  1IOU A;  3EEH A;  4S2N C;  3C38 A;  3AGF A;  1XJ3 A;  2CMN A;  2DNS A;  3LY3 A;  2Y59 A;  2B5R A;  4Y17 A;  1K4E A;  2HDQ A;  2ZOI A;  3U2A A;  2L0W A;  3Q81 A;  2WZX A;  3VP2 A;  4RX2 A;  1Q2P A;  3MZD A;  3W4Q A;  3GEC A;  3KSG A;  1ZG4 A;  4O01 A;  2FFY A;  3O5Y A;  4OOY A;  1PWD A;  3BRM A;  4QJG A;  5EVL A;  4KG5 A;  2QJ5 A;  4HIA A;  2WKI A;  1SKO B;  4HJ3 A;  1YQS A;  3V5M A;  5HSQ A;  3MFD A;  3A3E A;  3V39 A;  3UE1 A;  4WMC D;  4BBU A;  1XGI A;  2WKE A;  2Y2M A;  4ETZ A;  3HL9 A;  1I2S A;  4WZ5 C;  4Y0U A;  3IS2 B;  1HTZ A;  4CPK A;  3WWX A;  1PW1 A;  4S2N A;  4HEF A;  1VQQ A;  5JYP A;  1FSW A;  3NDG A;  2C6W B;  4NXG A;  1VM1 A;  4HQA A;  5F1F A;  1NRJ A;  3CJM A;  1PZP A;  4ARZ B;  5EOE A;  3VFF A;  1OTA A;  1L0G A;  3SH8 A;  3LID A;  5HL1 A;  3KSI A;  1WE4 A;  1L0D A;  3M2J A;  2EXA A;  2K7S A;  3ZVT A;  2R78 A;  2P9V B;  3T4K A;  3UE3 A;  3TOI A;  1BYW A;  4UEY A;  3R7W A;  5IT5 A;  5EUA A;  2ZJ9 A;  4ZAM A;  5D3O A;  1FCM A;  3T4S A;  1XA1 A;  2XEP A;  4EUZ A;  2RCX A;  4D60 A;  1KDS A;  4IHQ A;  1KVM A;  3D9Y A;  5EFW A;  1FIK A;  2Y2L A;  4WZ5 A;  3UO9 A;  2E8I A;  1XGJ A;  4GHI A;  1E4D A;  4DE3 A;  2W3G A;  3WRZ A;  1DY6 A;  3CI6 A;  3HJI A;  2QMI A;  3HJK A;  3ZNY A;  2ZL1 A;  5F1G A;  3VP4 A;  3H82 A;  5GHZ A;  3DTI A;  4P0M A;  3FZC A;  4CLC D;  4OQH A;  1V9Y A;  2PDR A;  1PRQ A;  1XJ2 A;  4XUZ A;  4RQ9 A;  2JKR I;  1KDW A;  1E3U A;  1STZ A;  1W63 Q;  4YNR A;  3UN7 A;  3T4J A;  4FCF A;  5FQ9 A;  1ERM A;  5FQQ A;  1JNU A;  1L0F A;  1ES2 A;  1F9I A;  3T1Q B;  5AVF A;  4RA7 A;  5TJJ A;  5HWW A;  1PWC A;  1K25 A;  2WAD A;  1UWP X;  1TD5 A;  4E04 A;  1ODV A;  1K55 C;  1VEU A;  3E4O A;  3NJA A;  4GD6 A;  4BBT A;  1K57 C;  4H6J A;  1ALQ A;  4FD8 A;  1S1Y A;  1KOU A;  4R38 A;  2WGI A;  1N9L A;  2EA9 A;  2XD1 A;  4LRX C;  4X25 A;  2WGW A;  2PT7 A;  4DE1 A;  5M19 A;  1MXO A;  3UDX A;  3HBR A;  4DE2 A;  3RJU A;  2ZM8 A;  1A0K A;  4MMN A;  3N6I A;  4ARZ A;  5A93 A;  3TSG A;  2X01 A;  4Q0I A;  2A3U A;  2W1T B;  3BLM A;  1YSQ A;  3S22 A;  3NCK A;  3F1P B;  1LL9 A;  1MWS A;  2XSS A;  3HUM A;  4C6Y A;  3CPT B;  1FOF A;  4UA6 A;  1FSY A;  4LV3 A;  2XRN A;  5GLB A;  2H0Y A;  3UE6 A;  1ACF A;  1TDG A;  3P09 A;  5F68 A;  1QME A;  1ES3 A;  2HJE A;  5DFY A;  3JYI A;  3VOL A;  1K55 A;  3EGD C;  1PW8 A;  1M6K A;  2J9P A;  4KZ7 A;  3UY6 A;  5G4Z A;  3ZGA B;  5DJT A;  2KLI A;  5DF8 A;  2VEA A;  3A0S A;  3LEQ A;  4BL2 A;  4D2O A;  1K6S A;  4GDB A;  2A24 A;  5FEG A;  3U4L P;  2H10 A;  5EVI D;  3B33 A;  3IBJ A;  1XXM A;  3PYP A;  3VOZ A;  1VHM A;  2FZ0 A;  2L1M A;  3CHW P;  4CLC E;  3UB9 A;  3IXD A;  2Y2G A;  1OT9 A;  4GJ4 A;  1CEG A;  3FKV A;  4OON A;  2NUT C;  5KZH A;  1YAX A;  3KSF A;  4Y7P A;  1NZU A;  3CUE C;  4KUO A;  2WK0 A;  5HDC A;  4DRT A;  3QNB A;  1ZTU A;  4KZ3 A;  4BD1 A;  3MXQ A;  3PR6 A;  4PMA A;  1HVB A;  1S4S A;  4K0X A;  1ONH A;  1SCW A;  3EWK A;  3WS5 A;  1G5U A;  3GQZ A;  2W3E A;  1RGY A;  2HPB A;  3KYE A;  3G2Z A;  4UAA A;  3BWL A;  4X55 A;  3LYX A;  2WKP A;  1HLU P;  2HZ5 A;  3ISG A;  4Y2F A;  5GHX A;  3VP1 A;  4MBF A;  2Y2K A;  3ZG7 B;  2BAS A;  3JVU A;  2R9W A;  2Y2Q A;  2X71 A;  3VE4 A;  2HGV A;  2BTF P;  2RL3 A;  5L09 A;  3LO7 A;  2J7V A;  3MFX A;  4P87 A;  3IXH A;  5FI2 A;  1YLT A;  5FI7 A;  3CUE A;  4ESP A;  4PM6 A;  3BFC A;  1Z6F A;  2P74 A;  1H8Z A;  4PM8 A;  2W1T A;  4L0L A;  2JKT M;  5FAP A;  3MBZ A;  4QPR A;  3F1P A;  3SS3 A;  4JKT A;  2QYB A;  1ONG A;  3V3R A;  1KE4 A;  1FCO A;  2Q9N A;  2ZC6 B;  3HUN A;  4OPZ A;  1IYP A;  3TRC A;  2HDR A;  3KYZ A;  3L7H A;  1P9R A;  5HPI A;  1MY8 A;  4EEP A;  1K54 C;  3FKW A;  3S7O A;  1K6R A;  3UME A;  2IWB A;  1FR1 A;  3VFH A;  2J8Y A;  4XT2 A;  1YLP A;  1FR6 A;  2X02 A;  3I7J A;  1TS6 A;  5E2G A;  1SDE A;  5AQA A;  3C2W A;  4LEN A;  3KX0 X;  3GDI A;  2XGN A;  3C8C A;  5EV0 A;  2V0W A;  3SOI A;  1NY0 A;  2WKQ A;  3MZE A;  1FIL A;  3EEA A;  3C5A A;  4LCL A;  3WS0 A;  4OH0 A;  1BSG A;  1YLY A;  4FH2 A;  3IF6 C;  4WMC A;  1BT5 A;  1Z09 A;  2ZM0 A;  2PR6 A;  4G3V A;  2ZQC A;  1XJ6 A;  4IVI A;  4O8G A;  3UMD A;  3M6B A;  5DTK A;  1RGZ A;  1FCN A;  3GR2 A;  4HBT A;  3WS2 A;  2PD8 A;  2BLS A;  1K54 A;  1OTB A;  1K0K A;  1ESI A;  1XPB A;  3IWO A;  3S4X A;  1Y54 A;  4R1G A;  2V2F F;  4CLC C;  4MN6 A;  1TF1 A;  2OAQ 1;  1S0W A;  1KE3 A;  2V8C A;  1ZC2 A;  3M2K A;  3A3J A;  1DP8 A;  1O07 A;  3UNW A;  1I5Q A;  3BJN A;  1HD8 A;  2ZBB A;  2EFX A;  1W63 M;  4X68 A;  1XFQ A;  1L0E A;  4BD0 A;  1IEL A;  1IKG A;  1GA9 A;  2YKH A;  3ZVW A;  3MQQ A;  1TS7 A;  4I3J A;  4Q8I A;  2XD5 A;  4NEE D;  2B95 A;  3FPV A;  3SS4 A;  2ZMF A;  4EBL A;  4C75 A;  3IF6 A;  4GN2 A;  4HP9 A;  5I5L A;  4GD8 A;  4GHI B;  1UWN X;  1XA7 A;  1H5X A;  5CHJ A;  3NEC A;  1H3Q A;  4GOG A;  2G2U A;  2ZL1 B;  3Q07 A;  4ZTK A;  2OV5 A;  4UHU A;  3H82 B;  3SH9 A;  5A90 A;  3IF5 A;  4IBR A;  5KSH A;  4FH4 A;  5EEC A;  2V9A A;  2VLG A;  3G30 A;  4BWI A;  2Y8H A;  3W4O A;  1T19 A;  4N1X A;  4CLC A;  3UE0 A;  3UB5 P;  5AVE A;  4N9L A;  4DJ3 A;  4ETX A;  2W3D A;  2WUQ A;  4GZB A;  3Q1F A;  5HFO A;  5J8X A;  2W27 A;  4ID4 A;  4II7 A;  2ZQ8 A;  5HX9 A;  1JWP A;  1NYY A;  1OJ5 A;  4DXC A;  3T4T A;  2OWH A;  1BLS A;  1PNE A;  5CED A;  1VET B;  1VEU B;  1S1Z A;  3HLW A;  4LRZ E;  3ZYT A;  3QP8 A;  3P98 A;  2UWX A;  4H6J B;  4U0T A;  5FQJ A;  2XLN A;  5CTM A;  5AJG A;  5FQI A;  2VGK A;  5I94 A;  4JXG A;  4L9F A;  4OOL A;  5E43 A;  4KZB A;  1MC0 A;  2WGW B;  4KUK A;  3ZG9 B;  4S2P A;  5HDD A;  5CEB A;  3RTY A;  3S7N A;  4B4Z A;  2W3H A;  3NBL A;  3EQV A;  2PYR A;  4Y0O A;  3CLO A;  4QU3 A;  1LLB A;  5EVI C;  2Z2M B;  3D72 A;  2HP6 A;  1FQG A;  3G4P A;  4GW9 A;  4EBP A;  3ULF A;  2INW A;  1D1J A;  1YSP A;  1WA9 A;  3DTK A;  2FFF B;  2Q9M A;  1OJG A;  4R3J A;  4JGO A;  3LUQ A;  1MWU A;  4U0X A;  1KE0 A;  2EWV A;  2IWC A;  3B3X A;  4HNB A;  2JC7 A;  3G6O A;  4NKP A;  2NUP C;  3FC7 A;  3VSL A;  4HY8 A;  3GRJ A;  3MZF A;  2UV0 E;  4XUX A;  2V1A A;  3A3I A;  3N8S A;  2YKF A;  3UB8 A;  1MWR A;  1T1C A;  2M7U A;  4OP8 A;  3E2L A;  1TS0 A;  2PBY A;  1G28 A;  1H8Y A;  4E3L A;  3F1N A;  5DJU A;  3VSK A;  5FAQ A;  5A8B A;  2JCH A;  4BJP A;  4MBH A;  2A24 B;  2Y4A A;  2ZC4 B;  2Y2P A;  3IHA A;  2R9X A;  3OPP A;  2G2W A;  5AQ7 A;  1OME A;  3BY8 A;  3BM6 A;  3IX4 A;  1GHP A;  2WZZ A;  1CQA A;  4LV2 A;  5EVI A;  5FAS A;  5L2F A;  5DF9 A;  3PBR A;  5J4E A;  1PZO A;  4YOF A;  1GSX A;  1ERQ A;  2XA7 M;  3IXG A;  2LB5 A;  4HES A;  4RYE A;  2OSU A;  4XXR A;  3NOP C;  5HAI A;  3V67 A;  2V1Z A;  4KZ4 A;  5FDH A;  1O7E A;  3K3C A;  1JTG A;  3PBS A;  4OLD A;  5E2F A;  2DMW A;  4ZBE A;  3TW8 A;  4HBU A;  4ZRR A;  1PYY A;  4A5R A;  2EX6 A;  3HLG A;  3GTC A;  4LV0 A;  4HH3 A;  4R0Q A;  4JXW A;  4NK3 A;  1VET A;  5DFX A;  3LR0 A;  3MF0 A;  4FUW A;  3IWI A;  1TDL A;  5DTS A;  2J3T D;  4HP4 A;  2O9A A;  2V0U A;  1W8Q A;  4N9K A;  4HHD A;  4BL3 A;  3KYQ A;  4JLF A;  3BQ8 A;  1VB6 A;  4E3J A;  5K5B A;  3W4P A;  2EX9 A;  2KOI A;  4GDN A;  2JHE A;  1NZO A;  4DE0 A;  1V9Z A;  3ZHH A;  5HDS A;  3T1R A;  3JPU A;  2O9B A;  4KQO A;  2WAF A;  4F3L B;  3WS4 A;  4E3K A;  1RP5 A;  4O7D A;  4MN5 A;  2HF6 A;  1SZV A;  3NY4 A;  4BQM A;  5CTN A;  3O88 A;  5HPF A; 
#chains in the Genus database with same CATH homology
 4ESP A;  2V8C A;  2VK3 A;  1J3W A;  5FEG A;  5EVE A;  3U4L P;  3T1Q B;  3NUL A;  2V8F A;  5FDS A;  1AWI A;  1CJF A;  1VEU A;  3CHW P;  3L7H A;  4X1L A;  2B95 A;  4X1M A;  4QWO A;  4X25 A;  1CF0 A;  5EM1 A;  3NEC A;  1YPR A;  1Y4O A;  2ZL1 B;  1PFL A;  3MSH A;  1D1J A;  1VET A;  4D60 A;  3LGO A;  5EV0 A;  1A0K A;  3D9Y A;  4FUW A;  2JKG A;  1FIK A;  5EM0 A;  4FTX A;  1G5U A;  1FIL A;  3T1X A;  3KYE A;  1SKO B;  3UB5 P;  3T1S A;  2ZL1 A;  1Z09 A;  3DAV A;  3L9K A;  2PBD P;  1HLU P;  3MS6 A;  2HZ5 A;  3CPT B;  1PRQ A;  1ACF A;  2JKF A;  3T1R A;  1SKO A;  2BTF P;  5FEF A;  2PAV P;  2ACG A;  3T12 B;  1K0K A;  1F2K A;  2E8J A;  3CPT A;  1PNE A;  1SZV A;  2PRF A;  1VET B;  1VEU B;  1CQA A;  3LEQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...