1A0KA

Profilin i from arabidopsis thaliana
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
130
structure length
130
Chain Sequence
b'SWQSYVDDHLMCDVEGNHLTAAAILGQDGSVWAQSAKFPQLKPQEIDGIKKDFEEPGFLAPTGLFLGGEKYMVIQGEQGAVIRGKKGPGGVTIKKTNQALVFGFYDEPMTGGQCNLVVERLGDYLIESEL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROFILIN
publication title The crystal structure of a major allergen from plants.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Cytoskeleton
total genus 34
structure length 130
sequence length 130
ec nomenclature
pdb deposition date 1997-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00235 Profilin Profilin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.30 Alpha Beta 2-Layer Sandwich Beta-Lactamase Dynein light chain 2a, cytoplasmic 1a0kA00
3MS6A 1SKOA 2PRFA 3KYEA 2VK3A 4FUWA 1VETA 5EV0A 2V8CA 4X1MA 5FEGA 1A0KA 1J3WA 1FILA 1VEUB 3CPTB 4ESPA 3T1SA 1Z09A 1ACFA 4D60A 2V8FA 4X25A 2ACGA 1Y4OA 2BTFP 5EM1A 1CF0A 4QWOA 3MSHA 2JKGA 1PNEA 1YPRA 1VEUA 3CPTA 4FTXA 3T12B 3L7HA 1CJFA 2PBDP 5EM0A 3LGOA 4X1LA 1SZVA 3CHWP 1SKOB 2HZ5A 1HLUP 2JKFA 1F2KA 3NULA 3U4LP 1FIKA 1CQAA 3D9YA 2PAVP 1D1JA 3T1QB 2B95A 1K0KA 1PRQA 5FDSA 1AWIA 3DAVA 2E8JA 3T1RA 5EVEA 2ZL1B 3LEQA 1G5UA 3NECA 3UB5P 3T1XA 2ZL1A 3L9KA 1VETB 1PFLA 5FEFA
chains in the Genus database with same CATH superfamily
1L0GA 4IBRA 3E98A 3TRCA 3LR3A 4Y0OA 3SS5A 3DTEA 1VETA 5AVEA 5IU1A 4OQIA 5E2GA 1YLTA 3UO9A 2J3TD 1DRMA 1FILA 5DJUA 4ESPA 1YAXA 1GSWA 4Y5FA 1ODVA 2ZOIA 3TE8A 4GKUA 4H6JB 3BFGA 2WK0A 5CERA 3Q07A 4YINA 3ZG7B 2JKTI 3EGXC 3P98A 1Y4OA 1KDSA 5I5LA 2ZOHA 3F1NA 4K91A 2ZQDA 2XR0A 4QB8A 5DF9A 3FV7A 4MCWA 3WS1A 5HX9A 3HLGA 3LO7A 3MKEA 1P9RA 4S2MA 1ZHHB 1IYSA 3SH8A 4UQIS 2VLGA 3VP4A 4XT2B 5HAQA 5HARA 1K54A 2Q9MA 1GSXA 2HZ5A 2VV8A 2XFSA 1XJ4A 2XFTA 4LV3A 1LSXA 2EX9A 3A3EA 2B18A 3OPRA 2PAVP 2B95A 1LL5A 3A3DA 3PHYA 1AWIA 2H5SA 5A91A 1S67L 3BQ8A 4NETA 3WWXA 4KG6A 1K4FA 2XF3A 3UB5P 3JVUA 2HDQA 4MLLA 4C3QA 2Y2HA 5KMWA 3MS6A 3ULFA 1SKOA 3ZGAB 5CTNA 4LRYC 2G2UA 2VK3A 4FUWA 3VE3A 3UDXA 4KZ6A 4G3VA 4ZBEA 4M3KA 4ARZB 3VV4A 5CHMA 1VHMA 4E3MA 1BLSA 3LICA 4BL2A 4Z1WA 4DKIA 4D60A 4RX2A 1L0EA 2XSSA 3M6HA 3D72A 1XFNA 2V8FA 3GDIA 4O01A 2ZJ9A 3GV9A 2QJ5A 2Y2IA 4FD8A 3G4PA 3HLWA 3HLFA 3UNWA 3BY8A 2ZMAA 2E8IA 1NRJA 4LGWA 5F68A 3CPTA 1PW8A 1Q2PA 4UQIM 3T12B 3T4LA 2HPBA 2A24A 1RGYA 3BYDA 1DP9A 3BY9A 3VFFA 3B47A 2Y4AA 2JBFA 3QP5A 1TS7A 3FPWA 5EE8A 4E3LA 2EX8A 4LRXC 1FIKA 3SS4A 1RCJA 3LUQA 1TDLA 4IVKA 1FSWA 3P01A 4WEKA 1T1BA 2HDSA 3HVFA 4MEZA 5KZHA 1ONHA 1E4DA 2VEAA 3JYIA 3Q82A 4MNRA 3IWIA 1T19A 3A3JA 4DXBA 4LCMA 2EWVA 1G5UA 3HLEA 3IXDA 2ZL1A 1L2SA 3BEBA 5FASA 1VETB 2Y2KA 1YSQA 4F94A 5DF7A 3LEZA 1KVMA 1ZTUA 3G32A 4HBUA 1F5MA 2PDRA 1MBLA 3GR2A 3S7QA 1ES3A 1KE3A 5HFOA 2WGVA 5EVLA 1LI9A 3FKWA 1IYPA 1S6RA 1CF0A 2FZ0A 1OPXA 3WRZA 1N4OA 1DP6A 2XLNA 3C4PA 1OTBA 2EA9A 2M1CA 5F1FA 3CJMA 3I7JA 1WYBA 2EXAA 4BWIA 4N9LA 2WKPA 5JYPA 4EEUA 3QP6A 4R3AA 2PBDP 4HQAA 2PD7A 2ZC4B 4PM9A 5J4EA 3NOUC 1HZOA 2W1TA 2QHKA 1ESUA 1LSWA 3FKVA 3T4TA 5F5YA 2QZ6A 4HESA 4EBNA 4HOIA 4MBFA 4JXGA 2BG1A 4JGPA 3UDIA 1XJ3A 1F9IA 4R38A 2Y2JA 1JTGA 4U0TA 1BT5A 3GECA 3W2ZA 3MF0A 1KGGA 3TG9A 2VGLS 3OPHA 4P6ZS 5L09A 1V9YA 1A0KA 1BYWA 5AQ7A 1KGEA 1ZG6A 4KQDA 4JF5A 4Y2FA 2H10A 4R4SA 2HF6A 3MQOA 4DJ3A 4BD0A 5E2EA 4R23A 2Y79A 3CI6A 1TD5A 2J9OA 1BLCA 4PM8A 1PZPA 2JKGA 3NDEA 4GZBA 3NI9A 3C8CA 4JXVA 5HWWA 3V3RA 3O86A 4E3JA 3CAXA 1V9ZA 1X0OA 3VP1A 4H6JA 4LFUA 2PYPA 3OPPA 4IUHA 3UB8A 5HPIA 4EERA 1LLBA 3FC7A 2UWXA 3QP4A 2OWJA 2K31A 3S4XA 2ZM8A 1F2KA 3TOIA 2P74A 1FR1A 2H28A 4Q0HA 3RH8B 4K0XA 4WYYA 4U3TA 4EWFA 4WZ4A 1S1YA 4PKYG 1ZC2A 4MBHA 1E25A 1OTAA 2ZL1B 4KUKA 5HZHA 3GSGA 1YKDA 5EPHA 1XKZA 2P9VB 1YLYA 3ITAA 2VGLM 5AJGA 4XT2A 2WKQA 3QNBA 2OLVA 3G30A 1PFLA 4CJNA 1ERMA 5FEFA 4P6ZM 1CI9A 2Y91A 2RCXA 5HSQA 2OOLA 3ZG9B 4HH2A 2ZLYA 2Z2LB 1JWPA 3PBSA 2FFFB 3UMDA 3Q7ZA 3C5AA 4ZAMA 3IH9A 1PWDA 1MWRA 1IELA 2HV1A 4HH3A 3ZDJA 3OCNA 3HUNA 1F98A 1TDGA 1I5QA 5TFQA 3HUMA 4EBPA 2V9AA 3BLSA 3LR5A 5A90A 1W8QA 2H0YA 3LIEA 4R3JA 4BBVA 3LIAA 3UY6A 1E3UA 5TBMB 1CEFA 1T18A 3HUOA 4JBFA 5FDHA 2L1MA 3OCLA 4FCFA 3DWZA 4JGRA 4L9FA 1NRFA 2P04A 3S22A 4I5SA 3AGEA 1WA9A 1J9MA 3DTKA 3PAEA 1FQGA 3LY4A 4GD8A 1ALQA 3HLCA 5EM0A 2Y2PA 2Z6CA 3UB9A 5GLCA 3G35A 2M7VA 4MMNA 4EETB 3NULA 4HIAA 4BL3A 1CEGA 5I94A 1MY8A 3BJNA 3A0VA 1TS0A 3A3IA 5HPFA 2E8JA 1H8MA 2JC7A 1TS8A 1W63Q 2J9PA 4P0MA 3V5MA 3QNCA 2ZC3B 5E2HA 2W3EA 1XA1A 5CEBA 4OPRA 3LYXA 2WGWB 3F1PB 3BFCA 3CUEC 1NZUA 2Q9NA 1J3WA 1NWZA 2ZQAA 1VEUB 4L0LA 2ZQCA 5KSCA 4UHUA 3BM6A 3HLBA 2R9WA 3IX4A 5HD3A 1GHIA 3FPVA 1XPBA 2HGVA 1HTZA 3OC2A 3TSGA 3ZCZA 4EUVA 4JLFA 3N8SA 4P85A 3GMWA 5EOOA 3CZDA 3PBQA 1EI5A 3GVBA 3E2LA 3T4KA 4OP5A 3TJZC 3SH7A 3BQAA 4L9GA 5FQMA 1P0ZA 4GHIB 2V1BA 4LRZE 1CJFA 4KZAA 3ZYTA 5KSHA 3W4QA 3ZVWA 3MZEA 3LR4A 5HDDA 2A3UA 3IWOA 2XH9A 1H5XA 3C4OA 1L0FA 5AQ9A 3NC8A 3GTCA 4IHQA 3LIBA 1D1JA 4E6XA 4QJGA 2UV0E 4KG5A 3BFFA 2GDNA 3VSKA 3OOVA 3DAVA 2Q0OA 2Y2LA 4KQQA 2FFYA 4UA9A 4WMCA 4II7A 3AGFA 4QD4A 5EVIB 5E2FA 3OBFA 4RA7A 3EQUA 1K25A 4HY8A 3LIFA 1BLPA 5FI7A 1BLHA 1JTDA 1NLYA 3ICYA 5EECA 1MC0A 1ZG4A 1MPLA 2LB5A 5HAPA 3PAGA 4X1MA 3NBLA 1FCMA 2J7VA 1N9NA 4R0QA 5CX7A 4WN5A 4IUKA 3LFVA 2EFXA 4QY5A 5FQKA 3P7NA 4ZJ2A 2WGIA 2JHEA 1IKIA 5IS1A 2FH5A 3IHAA 3BRMA 5EM1A 4ZJ3A 4JKTA 2WKEA 3ZVTA 4OP8A 2EWWA 4UA7A 1VQQA 3A3FA 1S4SA 3PR6A 3E4PA 2M7UA 3KSHA 4N92A 4JF4A 3MBZA 3ZQ5A 1Z6FA 4OH0A 2GZAA 1ERQA 1VB6A 4I3IA 5K5BA 2C6WB 5U47A 1HD8A 3LGOA 4LCLA 1QMFA 4YWZA 3W4OA 2HDUA 3B33A 3MZFA 3CHWP 1ES4A 4RX3A 4HEFA 4YFMA 1OJGA 2OV5A 4WM9A 3CUEA 2L0WA 3FZCA 1XFQA 3V39A 2NUPC 2YKHA 1EW0A 5DKKA 2D01A 2O9CA 2VJWA 3Q1FA 4WLAA 2VGKA 2WKRA 4K08A 2XRNA 3T1XA 1PWGA 5GL9A 1Z09A 4WL9A 4CPKA 1KDWA 3WS2A 4KUOA 1LL8A 4NXFA 4E6WA 3NCKA 3MXQA 1H0MA 3V50A 2Z6DA 3LY3A 1IKGA 3M2KA 3UDFA 4CLCB 1EWZA 1L0DA 3ZG8B 1NYMA 2XK1A 2P9VA 4LLOB 5HDSA 1W7FA 3R7WB 4FSFA 2ZMFA 5IHVA 4MN7A 4QWOA 4KZ8A 5FSRA 3MFDA 2JCHA 5FAPA 2VZWA 1C3BA 3WS4A 4KQRA 4FTXA 2Y2OA 2WADA 3MXSA 3CMZA 5F69A 3L7HA 1E3UD 4X68A 4R1GA 3HJIA 1LT0A 5EVIC 4BMWA 2D02A 2V1ZA 3IXBA 2GX5A 4KZ7A 5DFXA 4UA6A 3ZG5A 1ES5A 1N9OA 1L3LA 1FR6A 4N1XA 4FOFA 5TBMA 4E3NA 1PRQA 2KLIA 4I39A 5CTMA 3G31A 4EV4A 4WZ5C 1XX2A 4LV0A 5AQBA 4OLGA 1XGIA 2V0WA 4PPRA 3MZDA 1LL9A 3ZHHA 2AVXA 2V0UA 2ZQ8A 3JPUA 2VV6A 3E0YA 1UGUA 4Y7PA 2PRFA 1XXMA 2K2NA 4U0XA 2R9XA 3S7PA 4NXGA 1S0WA 2JKRI 4WEJA 4LV1A 3UE1A 2HJ9C 1UWPX 2XROA 5EOEA 1S4RA 2G7UA 2WZZA 1XJ6A 2Y8HA 1FOFA 3PBOA 3RTYA 4GD6A 1D06A 4JGOA 1GCEA 4GNUA 2WGWA 3F1PA 5CXWA 3T50A 3VFHA 3IF6A 2KX6A 4E04A 4LENA 4DDYA 1NXYA 4EQ1A 5J3WA 1M40A 1YPRA 3W4PA 3T4SA 3IS2B 3K3DA 1VEUA 3BWLA 1YLPA 2W0NA 4I3AA 3M6BA 4Q8IA 4KQOA 1OT9A 1K56A 3Q81A 3F1OB 2WZXA 5DTSA 3SOIA 4GDBA 1LI0A 4OLDA 2VV7A 3E2KA 4HNBA 4X69A 1SDNA 3BLMA 1GHMA 3UE0A 4Y15A 4JGQA 1S1ZA 2PHYA 1PZOA 4ETXA 4WELA 4OQGA 5TGFA 4DN0A 3LEQA 2VGJA 4CLCC 4RQ9A 3NECA 4GHIA 4DF6A 3SS3A 5FATA 5DF8A 4WMCD 3IH8A 1MKMA 4YOFA 1YSPA 2V8CA 4XUXA 4M4XA 5M1AA 4ZRRA 3IXGA 2ZQ9A 2EFUA 5GLDA 2PU4A 4OOMA 4HJ6A 4I3JA 2QYBA 3KYQA 5EVIA 5CHUA 5L07A 4IEDA 1FSYA 2ZQ7A 4BBTA 3LCEA 3C7UA 2GJ3A 4G3KA 5DTTA 5FQIA 3C2WA 3UB7A 1MKIA 1YQSA 1S66L 3KSGA 3MJQA 4JPMA 2K7SA 3UE3A 5CECA 2H0TA 5E43A 3S1YA 1YMSA 3UN7A 4PAUA 3LI9A 3M2JA 2OSUA 2O9BA 2PR6A 3LI8A 5DFYA 3G2ZA 4WZ5A 4YNRA 4IVIA 5AVFA 4XUZA 4QU3A 2JKFA 1Y54A 3R4KA 4S2OA 1VM1A 2OLUA 3CWFA 1STZA 3N6IA 4O0PA 1K0KA 4GCZA 1G28A 1FCOA 1U60A 5HDCA 2Y2MA 4R3BA 1I2SA 5CGXA 3K2NA 3WS0A 3HCYA 2B02A 5J8XA 5LBRA 4AFIA 3KSFA 4ZTKA 4DRTA 5IT5A 1CI8A 1QMEA 1YLZA 2DMWA 3EGDC 4P87A 2BASA 5CGWA 1KVLA 3OZHA 3RFBA 1JWVA 5DJTA 1PI4A 3DBAA 4OOYA 4PHTA 3VOYA 3GQZA 5CEDA 1BTLA 2BLSA 2Y2GA 3G34A 5F6AA 2IA2A 4B4ZA 1XJ2A 4DE2A 3IF6B 3VSLA 2QJ7A 3MQQA 2VX8A 2JKRM 2V20A 4HP4A 1ES2A 4HI4A 2MJ6A 4ETZA 2OWHA 4GB7A 1GA0A 3LIDA 3HL9A 1JNUA 4I38A 4EEPA 1T1AA 1MXOA 1BULA 3QP1A 3OPLA 1JVJA 3CLOA 2IWDA 2ZMVA 1WE4A 1PW1A 4CLCA 4KZBA 3T4JA 1W63M 5GHYA 4BBUA 5FQJA 1SZVA 1P97A 3ISGA 3R7WA 4PM5A 5FI2A 4Z9QA 3IBJA 1CQAA 2ZM0A 4HHDA 3T1QB 1OJ5A 4BJPA 1DJCA 4N1HA 4S2NC 3HREA 5D3OA 3Q7VB 4KZ4A 4FH4A 4HBTA 4DMZA 4S2LA 2WYXA 2X01A 4B9OA 4KZ3A 4OPZA 1MWUA 3UPOA 4E3IA 1ONGA 1WYCA 3DW0A 2PBYA 4K0WA 2J8YA 3NHQA 4EBLA 5TJJA 2XA7S 4KG2A 2YKFA 4CLCE 2Y2NA 4MN5A 4R6LA 3T1SA 5A8BA 1BUEA 4HJ4A 2W3GA 2HDRA 3DTMA 2RL3A 4PM6A 2ZD8A 2GNXA 1BZAA 3FG8A 1LSVA 2EXBA 3H7WB 3GRJA 3DTIA 2J3TC 3ZNTA 4DE1A 4E3KA 2BTFP 5CGSA 2IWCA 4N9KA 4QHCA 1OTIA 2A49A 3PTEA 1YM1A 1NJ4A 1W79A 4PM7A 1W5DA 3EOIA 4OQHA 3O88A 3IBRA 2EX6A 3MQ0A 3O5YA 5GHXA 4KZ9A 5BOHA 3VP2A 4OQ0A 5A92A 1K38A 2X02A 5FA7A 4GJ4A 2WKIA 3IXHA 1RGZA 4H8RA 3N8RA 3A0RA 2XEPA 1FCNA 1K57A 4RYEA 4EW7A 2V2FF 1K56D 4GLQA 3WS5A 5EFWA 3WRTA 1YT4A 1HVBA 4MBKA 5C5KA 4Q0JA 1K55C 2ZC6B 3C30A 3IS2A 2DCFA 3BW6A 3U2AA 5DVAA 5EVEA 4ZJ1A 2ZM2A 2B5RA 3QP2A 3RXXA 4DXCA 4GS9B 2I72A 2O9AA 3F1OA 5HW3A 1Q2QA 3ZFZA 3IX8A 3IF6C 2XA7M 3HBRA 2W3DA 3K3CA 4DJ2A 2XD1A 2HJEA 2I9VA 1DJAA 1M6KA 4OKPA 3C38A 5EUAA 3D3OA 3NDGA 4MN6A 3CITA 1PIOA 5FQQA 4F3LB 3O87A 2XQZA 3MR0A 4XXRA 4B88A 3EQVA 2IWBA 2WAEA 3VP3A 5FI6A 4S2JA 4A5RA 1O7EA 4OONA 2O0YA 1AXBA 5AQAA 1PNEA 4X53A 5EVID 1G6AA 2LB9A 1ESIA 3ZNYA 3VOLA 2JE5A 1T1CA 4S2NA 5F83A 4QY6A 2Y55A 1XA7A 1YLWA 2WUQA 1IYQA 4EQIA 2XDMA 2HP5A 5CHJA 3IF5A 2L4RA 4EESA 1YMXA 4G3WA 5M19A 2EX2A 1HLUP 3S7NA 4FH2A 1KOUA 2W3HA 1H3QA 5GLBA 5HWVA 4BQMA 3ITBA 1PI5A 4B93A 3BFDA 3EEHA 3V67A 4OPQA 5L8MA 2PR5A 3QP8A 1SKFA 3TW8A 5TR7A 3VP0A 4P6BA 1O07A 3LR0A 2R78A 1PYYA 3E4OA 5J7EA 3G6OA 3F1NB 3N8LA 4S2IA 1MWSA 3H82A 4JXSA 1SDEA 1IYOA 1KE0A 2JKTM 4UAAA 3ZG0A 1OMEA 4R4RA 3KYZA 4WUJA 2ACGA 3G2YA 3QHYA 4Q0IA 4Y0TA 5CRFA 1N9BA 4IBXA 4GOGA 4DDSA 1NY0A 3MSHA 2W3FA 4UEYA 2KDKA 4ME4A 1PWCA 2HP6A 3BECA 3UPPA 3EEAA 1MWTA 4OVDA 1K55A 4Y13A 3IQAA 4WBGA 1G68A 4L9EA 5HL1A 2CC1A 3RJUA 5G4ZA 1IFQA 2PU2A 3HLDA 3VE4A 1TS6A 2J80A 2WKHA 3A0SA 1Y28A 3IX3A 3OLOA 5HWTA 5KIZA 2ZC5B 2A2LA 4O7DA 4KZ5A 1SKOB 2W1RA 5FQ9A 1JWZA 1NZOA 4O8GA 2VA0A 3U4LP 4NXBA 5F82A 4CLCD 4HP9A 5HL6A 2QKPA 3FWLA 2PYRA 5L10A 4EXOA 1RP5A 4LV2A 3SZTA 5FDSA 4ID4A 4NG2A 1GHPA 1OT6A 3UB6A 1DP8A 4NK3A 3FYZA 1GSVA 5HAIA 3PXPA 3UE6A 3EWKA 4S2PA 3PBRA 4X56A 2Y2QA 1TVFA 3HJKA 2W27A 4QPRA 3BFEA 3KSIA 3CG5A 1YLJA 4NEED 3IT9A 4EUZA 5FEGA 1N9LA 4X6TA 4Y0UA 3CPTB 3S7OA 3Q7VA 5FAQA 3W8KA 2JN7A 1ACFA 2A24B 4MDZA 4X25A 1P9WA 4LPZA 4Y17A 1W8YA 2PD8A 3PYPA 2HP9A 1OTEA 3NOPC 4JXWA 3KO6A 2J3WA 1SCWA 5GHZA 3UPNA 2C5WB 3E4QA 1LHYA 1K4EA 5FL3A 1D7EA 1H8ZA 3H7WA 3AGDA 2Y59A 2XD5A 1TF1A 4DE3A 5FAOA 4HJ3A 2Z2MB 3RXWA 1K6SA 3VOZA 4JF6A 5M18A 4WF0A 2ZC7A 1XP4A 2V1AA 1IOUA 3MFXA 3C7VA 4DE0A 1XGJA 1H8YA 2QMIA 1I2WA 2QPNA 1NLZA 3PBNA 2OAP1 2X71A 1SHVA 5GLAA 3D4FA 1K54C 3L9KA 3N4IA 4R70A 3KYEA 3H82B 5EV0A 4Y3IA 1EROA 1OTDA 3B3XA 3N7WA 3NJAA 5JYOA 2O99A 1IEMA 3T4OA 3NOTC 1NYYA 5F1GA 3UMEA 4X55A 1KGFA 2DRWA 5G18A 4ARZA 1TEMA 4GS9A 1K57C 3DWKA 4C6YA 1KE4A 3O3VA 5HD5A 2W1TB 4IJGA 3IWQA 2G2WA 4BD1A 3T4QA 4ZDXA 4NKPA 2P08A 3IHBA 1MZUA 3NIAA 4CQHA 5DTKA 2DNSA 4OOLA 3P09A 1K6RA 5MC7A 4BENA 2WAFA 3B42A 1UWNX 5L2FA 2QWSA 5G4YA 1GA9A 2ZBBA 4BLMA 3KX0X 1ZKJA 4C75A 4F3LA 2XGNA 4RVAA 1DJBA 4NXEA 3MXRA 1DY6A 3JVVA 4OPYA 4D2OA 4PKYA 4X1LA 4PMAA 4EU0A 2NUTC 3SH9A 3MMHA 4S2KA 3MKFA 3D9YA 4GDNA 4KENB 5DKLA 1G6OA 1CK3A 3H9WA 3PBTA 4GN2A 2OAQ1 2VKSA 3T1RA 2KOIA 5A93A 2INWA 2P7JA 2PT7A 2CMNA 3V3SA 3VMAA 3NY4A 4GW9A 1BSGA 3SW1A 4B4XA 4E3OA
chains in the Genus database with same CATH topology
3MS6A 1SKOA 2PRFA 3KYEA 2VK3A 4FUWA 1VETA 5EV0A 2V8CA 4X1MA 5FEGA 1A0KA 1J3WA 1FILA 1VEUB 3CPTB 4ESPA 3T1SA 1Z09A 1ACFA 4D60A 2V8FA 4X25A 2ACGA 1Y4OA 2BTFP 5EM1A 1CF0A 4QWOA 3MSHA 2JKGA 1PNEA 1YPRA 1VEUA 3CPTA 4FTXA 3T12B 3L7HA 1CJFA 2PBDP 5EM0A 3LGOA 4X1LA 1SZVA 3CHWP 1SKOB 2HZ5A 1HLUP 2JKFA 1F2KA 3NULA 3U4LP 1FIKA 1CQAA 3D9YA 2PAVP 1D1JA 3T1QB 2B95A 1K0KA 1PRQA 5FDSA 1AWIA 3DAVA 2E8JA 3T1RA 5EVEA 2ZL1B 3LEQA 1G5UA 3NECA 3UB5P 3T1XA 2ZL1A 3L9KA 1VETB 1PFLA 5FEFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MS6 A;  1SKO A;  2PRF A;  3KYE A;  2VK3 A;  4FUW A;  1VET A;  5EV0 A;  2V8C A;  4X1M A;  5FEG A;  1A0K A;  1J3W A;  1FIL A;  1VEU B;  3CPT B;  4ESP A;  3T1S A;  1Z09 A;  1ACF A;  4D60 A;  2V8F A;  4X25 A;  2ACG A;  1Y4O A;  2BTF P;  5EM1 A;  1CF0 A;  4QWO A;  3MSH A;  2JKG A;  1PNE A;  1YPR A;  1VEU A;  3CPT A;  4FTX A;  3T12 B;  3L7H A;  1CJF A;  2PBD P;  5EM0 A;  3LGO A;  4X1L A;  1SZV A;  3CHW P;  1SKO B;  2HZ5 A;  1HLU P;  2JKF A;  1F2K A;  3NUL A;  3U4L P;  1FIK A;  1CQA A;  3D9Y A;  2PAV P;  1D1J A;  3T1Q B;  2B95 A;  1K0K A;  1PRQ A;  5FDS A;  1AWI A;  3DAV A;  2E8J A;  3T1R A;  5EVE A;  2ZL1 B;  3LEQ A;  1G5U A;  3NEC A;  3UB5 P;  3T1X A;  2ZL1 A;  3L9K A;  1VET B;  1PFL A;  5FEF A; 
#chains in the Genus database with same CATH topology
 1L0G A;  4IBR A;  3E98 A;  3TRC A;  3LR3 A;  4Y0O A;  3SS5 A;  3DTE A;  1VET A;  5AVE A;  5IU1 A;  4OQI A;  5E2G A;  1YLT A;  3UO9 A;  2J3T D;  1DRM A;  1FIL A;  5DJU A;  4ESP A;  1YAX A;  1GSW A;  4Y5F A;  1ODV A;  2ZOI A;  3TE8 A;  4GKU A;  4H6J B;  3BFG A;  2WK0 A;  5CER A;  3Q07 A;  4YIN A;  3ZG7 B;  2JKT I;  3EGX C;  3P98 A;  1Y4O A;  1KDS A;  5I5L A;  2ZOH A;  3F1N A;  4K91 A;  2ZQD A;  2XR0 A;  4QB8 A;  5DF9 A;  3FV7 A;  4MCW A;  3WS1 A;  5HX9 A;  3HLG A;  3LO7 A;  3MKE A;  1P9R A;  4S2M A;  1ZHH B;  1IYS A;  3SH8 A;  4UQI S;  2VLG A;  3VP4 A;  4XT2 B;  5HAQ A;  5HAR A;  1K54 A;  2Q9M A;  1GSX A;  2HZ5 A;  2VV8 A;  2XFS A;  1XJ4 A;  2XFT A;  4LV3 A;  1LSX A;  2EX9 A;  3A3E A;  2B18 A;  3OPR A;  2PAV P;  2B95 A;  1LL5 A;  3A3D A;  3PHY A;  1AWI A;  2H5S A;  5A91 A;  1S67 L;  3BQ8 A;  4NET A;  3WWX A;  4KG6 A;  1K4F A;  2XF3 A;  3UB5 P;  3JVU A;  2HDQ A;  4MLL A;  4C3Q A;  2Y2H A;  5KMW A;  3MS6 A;  3ULF A;  1SKO A;  3ZGA B;  5CTN A;  4LRY C;  2G2U A;  2VK3 A;  4FUW A;  3VE3 A;  3UDX A;  4KZ6 A;  4G3V A;  4ZBE A;  4M3K A;  4ARZ B;  3VV4 A;  5CHM A;  1VHM A;  4E3M A;  1BLS A;  3LIC A;  4BL2 A;  4Z1W A;  4DKI A;  4D60 A;  4RX2 A;  1L0E A;  2XSS A;  3M6H A;  3D72 A;  1XFN A;  2V8F A;  3GDI A;  4O01 A;  2ZJ9 A;  3GV9 A;  2QJ5 A;  2Y2I A;  4FD8 A;  3G4P A;  3HLW A;  3HLF A;  3UNW A;  3BY8 A;  2ZMA A;  2E8I A;  1NRJ A;  4LGW A;  5F68 A;  3CPT A;  1PW8 A;  1Q2P A;  4UQI M;  3T12 B;  3T4L A;  2HPB A;  2A24 A;  1RGY A;  3BYD A;  1DP9 A;  3BY9 A;  3VFF A;  3B47 A;  2Y4A A;  2JBF A;  3QP5 A;  1TS7 A;  3FPW A;  5EE8 A;  4E3L A;  2EX8 A;  4LRX C;  1FIK A;  3SS4 A;  1RCJ A;  3LUQ A;  1TDL A;  4IVK A;  1FSW A;  3P01 A;  4WEK A;  1T1B A;  2HDS A;  3HVF A;  4MEZ A;  5KZH A;  1ONH A;  1E4D A;  2VEA A;  3JYI A;  3Q82 A;  4MNR A;  3IWI A;  1T19 A;  3A3J A;  4DXB A;  4LCM A;  2EWV A;  1G5U A;  3HLE A;  3IXD A;  2ZL1 A;  1L2S A;  3BEB A;  5FAS A;  1VET B;  2Y2K A;  1YSQ A;  4F94 A;  5DF7 A;  3LEZ A;  1KVM A;  1ZTU A;  3G32 A;  4HBU A;  1F5M A;  2PDR A;  1MBL A;  3GR2 A;  3S7Q A;  1ES3 A;  1KE3 A;  5HFO A;  2WGV A;  5EVL A;  1LI9 A;  3FKW A;  1IYP A;  1S6R A;  1CF0 A;  2FZ0 A;  1OPX A;  3WRZ A;  1N4O A;  1DP6 A;  2XLN A;  3C4P A;  1OTB A;  2EA9 A;  2M1C A;  5F1F A;  3CJM A;  3I7J A;  1WYB A;  2EXA A;  4BWI A;  4N9L A;  2WKP A;  5JYP A;  4EEU A;  3QP6 A;  4R3A A;  2PBD P;  4HQA A;  2PD7 A;  2ZC4 B;  4PM9 A;  5J4E A;  3NOU C;  1HZO A;  2W1T A;  2QHK A;  1ESU A;  1LSW A;  3FKV A;  3T4T A;  5F5Y A;  2QZ6 A;  4HES A;  4EBN A;  4HOI A;  4MBF A;  4JXG A;  2BG1 A;  4JGP A;  3UDI A;  1XJ3 A;  1F9I A;  4R38 A;  2Y2J A;  1JTG A;  4U0T A;  1BT5 A;  3GEC A;  3W2Z A;  3MF0 A;  1KGG A;  3TG9 A;  2VGL S;  3OPH A;  4P6Z S;  5L09 A;  1V9Y A;  1A0K A;  1BYW A;  5AQ7 A;  1KGE A;  1ZG6 A;  4KQD A;  4JF5 A;  4Y2F A;  2H10 A;  4R4S A;  2HF6 A;  3MQO A;  4DJ3 A;  4BD0 A;  5E2E A;  4R23 A;  2Y79 A;  3CI6 A;  1TD5 A;  2J9O A;  1BLC A;  4PM8 A;  1PZP A;  2JKG A;  3NDE A;  4GZB A;  3NI9 A;  3C8C A;  4JXV A;  5HWW A;  3V3R A;  3O86 A;  4E3J A;  3CAX A;  1V9Z A;  1X0O A;  3VP1 A;  4H6J A;  4LFU A;  2PYP A;  3OPP A;  4IUH A;  3UB8 A;  5HPI A;  4EER A;  1LLB A;  3FC7 A;  2UWX A;  3QP4 A;  2OWJ A;  2K31 A;  3S4X A;  2ZM8 A;  1F2K A;  3TOI A;  2P74 A;  1FR1 A;  2H28 A;  4Q0H A;  3RH8 B;  4K0X A;  4WYY A;  4U3T A;  4EWF A;  4WZ4 A;  1S1Y A;  4PKY G;  1ZC2 A;  4MBH A;  1E25 A;  1OTA A;  2ZL1 B;  4KUK A;  5HZH A;  3GSG A;  1YKD A;  5EPH A;  1XKZ A;  2P9V B;  1YLY A;  3ITA A;  2VGL M;  5AJG A;  4XT2 A;  2WKQ A;  3QNB A;  2OLV A;  3G30 A;  1PFL A;  4CJN A;  1ERM A;  5FEF A;  4P6Z M;  1CI9 A;  2Y91 A;  2RCX A;  5HSQ A;  2OOL A;  3ZG9 B;  4HH2 A;  2ZLY A;  2Z2L B;  1JWP A;  3PBS A;  2FFF B;  3UMD A;  3Q7Z A;  3C5A A;  4ZAM A;  3IH9 A;  1PWD A;  1MWR A;  1IEL A;  2HV1 A;  4HH3 A;  3ZDJ A;  3OCN A;  3HUN A;  1F98 A;  1TDG A;  1I5Q A;  5TFQ A;  3HUM A;  4EBP A;  2V9A A;  3BLS A;  3LR5 A;  5A90 A;  1W8Q A;  2H0Y A;  3LIE A;  4R3J A;  4BBV A;  3LIA A;  3UY6 A;  1E3U A;  5TBM B;  1CEF A;  1T18 A;  3HUO A;  4JBF A;  5FDH A;  2L1M A;  3OCL A;  4FCF A;  3DWZ A;  4JGR A;  4L9F A;  1NRF A;  2P04 A;  3S22 A;  4I5S A;  3AGE A;  1WA9 A;  1J9M A;  3DTK A;  3PAE A;  1FQG A;  3LY4 A;  4GD8 A;  1ALQ A;  3HLC A;  5EM0 A;  2Y2P A;  2Z6C A;  3UB9 A;  5GLC A;  3G35 A;  2M7V A;  4MMN A;  4EET B;  3NUL A;  4HIA A;  4BL3 A;  1CEG A;  5I94 A;  1MY8 A;  3BJN A;  3A0V A;  1TS0 A;  3A3I A;  5HPF A;  2E8J A;  1H8M A;  2JC7 A;  1TS8 A;  1W63 Q;  2J9P A;  4P0M A;  3V5M A;  3QNC A;  2ZC3 B;  5E2H A;  2W3E A;  1XA1 A;  5CEB A;  4OPR A;  3LYX A;  2WGW B;  3F1P B;  3BFC A;  3CUE C;  1NZU A;  2Q9N A;  1J3W A;  1NWZ A;  2ZQA A;  1VEU B;  4L0L A;  2ZQC A;  5KSC A;  4UHU A;  3BM6 A;  3HLB A;  2R9W A;  3IX4 A;  5HD3 A;  1GHI A;  3FPV A;  1XPB A;  2HGV A;  1HTZ A;  3OC2 A;  3TSG A;  3ZCZ A;  4EUV A;  4JLF A;  3N8S A;  4P85 A;  3GMW A;  5EOO A;  3CZD A;  3PBQ A;  1EI5 A;  3GVB A;  3E2L A;  3T4K A;  4OP5 A;  3TJZ C;  3SH7 A;  3BQA A;  4L9G A;  5FQM A;  1P0Z A;  4GHI B;  2V1B A;  4LRZ E;  1CJF A;  4KZA A;  3ZYT A;  5KSH A;  3W4Q A;  3ZVW A;  3MZE A;  3LR4 A;  5HDD A;  2A3U A;  3IWO A;  2XH9 A;  1H5X A;  3C4O A;  1L0F A;  5AQ9 A;  3NC8 A;  3GTC A;  4IHQ A;  3LIB A;  1D1J A;  4E6X A;  4QJG A;  2UV0 E;  4KG5 A;  3BFF A;  2GDN A;  3VSK A;  3OOV A;  3DAV A;  2Q0O A;  2Y2L A;  4KQQ A;  2FFY A;  4UA9 A;  4WMC A;  4II7 A;  3AGF A;  4QD4 A;  5EVI B;  5E2F A;  3OBF A;  4RA7 A;  3EQU A;  1K25 A;  4HY8 A;  3LIF A;  1BLP A;  5FI7 A;  1BLH A;  1JTD A;  1NLY A;  3ICY A;  5EEC A;  1MC0 A;  1ZG4 A;  1MPL A;  2LB5 A;  5HAP A;  3PAG A;  4X1M A;  3NBL A;  1FCM A;  2J7V A;  1N9N A;  4R0Q A;  5CX7 A;  4WN5 A;  4IUK A;  3LFV A;  2EFX A;  4QY5 A;  5FQK A;  3P7N A;  4ZJ2 A;  2WGI A;  2JHE A;  1IKI A;  5IS1 A;  2FH5 A;  3IHA A;  3BRM A;  5EM1 A;  4ZJ3 A;  4JKT A;  2WKE A;  3ZVT A;  4OP8 A;  2EWW A;  4UA7 A;  1VQQ A;  3A3F A;  1S4S A;  3PR6 A;  3E4P A;  2M7U A;  3KSH A;  4N92 A;  4JF4 A;  3MBZ A;  3ZQ5 A;  1Z6F A;  4OH0 A;  2GZA A;  1ERQ A;  1VB6 A;  4I3I A;  5K5B A;  2C6W B;  5U47 A;  1HD8 A;  3LGO A;  4LCL A;  1QMF A;  4YWZ A;  3W4O A;  2HDU A;  3B33 A;  3MZF A;  3CHW P;  1ES4 A;  4RX3 A;  4HEF A;  4YFM A;  1OJG A;  2OV5 A;  4WM9 A;  3CUE A;  2L0W A;  3FZC A;  1XFQ A;  3V39 A;  2NUP C;  2YKH A;  1EW0 A;  5DKK A;  2D01 A;  2O9C A;  2VJW A;  3Q1F A;  4WLA A;  2VGK A;  2WKR A;  4K08 A;  2XRN A;  3T1X A;  1PWG A;  5GL9 A;  1Z09 A;  4WL9 A;  4CPK A;  1KDW A;  3WS2 A;  4KUO A;  1LL8 A;  4NXF A;  4E6W A;  3NCK A;  3MXQ A;  1H0M A;  3V50 A;  2Z6D A;  3LY3 A;  1IKG A;  3M2K A;  3UDF A;  4CLC B;  1EWZ A;  1L0D A;  3ZG8 B;  1NYM A;  2XK1 A;  2P9V A;  4LLO B;  5HDS A;  1W7F A;  3R7W B;  4FSF A;  2ZMF A;  5IHV A;  4MN7 A;  4QWO A;  4KZ8 A;  5FSR A;  3MFD A;  2JCH A;  5FAP A;  2VZW A;  1C3B A;  3WS4 A;  4KQR A;  4FTX A;  2Y2O A;  2WAD A;  3MXS A;  3CMZ A;  5F69 A;  3L7H A;  1E3U D;  4X68 A;  4R1G A;  3HJI A;  1LT0 A;  5EVI C;  4BMW A;  2D02 A;  2V1Z A;  3IXB A;  2GX5 A;  4KZ7 A;  5DFX A;  4UA6 A;  3ZG5 A;  1ES5 A;  1N9O A;  1L3L A;  1FR6 A;  4N1X A;  4FOF A;  5TBM A;  4E3N A;  1PRQ A;  2KLI A;  4I39 A;  5CTM A;  3G31 A;  4EV4 A;  4WZ5 C;  1XX2 A;  4LV0 A;  5AQB A;  4OLG A;  1XGI A;  2V0W A;  4PPR A;  3MZD A;  1LL9 A;  3ZHH A;  2AVX A;  2V0U A;  2ZQ8 A;  3JPU A;  2VV6 A;  3E0Y A;  1UGU A;  4Y7P A;  2PRF A;  1XXM A;  2K2N A;  4U0X A;  2R9X A;  3S7P A;  4NXG A;  1S0W A;  2JKR I;  4WEJ A;  4LV1 A;  3UE1 A;  2HJ9 C;  1UWP X;  2XRO A;  5EOE A;  1S4R A;  2G7U A;  2WZZ A;  1XJ6 A;  2Y8H A;  1FOF A;  3PBO A;  3RTY A;  4GD6 A;  1D06 A;  4JGO A;  1GCE A;  4GNU A;  2WGW A;  3F1P A;  5CXW A;  3T50 A;  3VFH A;  3IF6 A;  2KX6 A;  4E04 A;  4LEN A;  4DDY A;  1NXY A;  4EQ1 A;  5J3W A;  1M40 A;  1YPR A;  3W4P A;  3T4S A;  3IS2 B;  3K3D A;  1VEU A;  3BWL A;  1YLP A;  2W0N A;  4I3A A;  3M6B A;  4Q8I A;  4KQO A;  1OT9 A;  1K56 A;  3Q81 A;  3F1O B;  2WZX A;  5DTS A;  3SOI A;  4GDB A;  1LI0 A;  4OLD A;  2VV7 A;  3E2K A;  4HNB A;  4X69 A;  1SDN A;  3BLM A;  1GHM A;  3UE0 A;  4Y15 A;  4JGQ A;  1S1Z A;  2PHY A;  1PZO A;  4ETX A;  4WEL A;  4OQG A;  5TGF A;  4DN0 A;  3LEQ A;  2VGJ A;  4CLC C;  4RQ9 A;  3NEC A;  4GHI A;  4DF6 A;  3SS3 A;  5FAT A;  5DF8 A;  4WMC D;  3IH8 A;  1MKM A;  4YOF A;  1YSP A;  2V8C A;  4XUX A;  4M4X A;  5M1A A;  4ZRR A;  3IXG A;  2ZQ9 A;  2EFU A;  5GLD A;  2PU4 A;  4OOM A;  4HJ6 A;  4I3J A;  2QYB A;  3KYQ A;  5EVI A;  5CHU A;  5L07 A;  4IED A;  1FSY A;  2ZQ7 A;  4BBT A;  3LCE A;  3C7U A;  2GJ3 A;  4G3K A;  5DTT A;  5FQI A;  3C2W A;  3UB7 A;  1MKI A;  1YQS A;  1S66 L;  3KSG A;  3MJQ A;  4JPM A;  2K7S A;  3UE3 A;  5CEC A;  2H0T A;  5E43 A;  3S1Y A;  1YMS A;  3UN7 A;  4PAU A;  3LI9 A;  3M2J A;  2OSU A;  2O9B A;  2PR6 A;  3LI8 A;  5DFY A;  3G2Z A;  4WZ5 A;  4YNR A;  4IVI A;  5AVF A;  4XUZ A;  4QU3 A;  2JKF A;  1Y54 A;  3R4K A;  4S2O A;  1VM1 A;  2OLU A;  3CWF A;  1STZ A;  3N6I A;  4O0P A;  1K0K A;  4GCZ A;  1G28 A;  1FCO A;  1U60 A;  5HDC A;  2Y2M A;  4R3B A;  1I2S A;  5CGX A;  3K2N A;  3WS0 A;  3HCY A;  2B02 A;  5J8X A;  5LBR A;  4AFI A;  3KSF A;  4ZTK A;  4DRT A;  5IT5 A;  1CI8 A;  1QME A;  1YLZ A;  2DMW A;  3EGD C;  4P87 A;  2BAS A;  5CGW A;  1KVL A;  3OZH A;  3RFB A;  1JWV A;  5DJT A;  1PI4 A;  3DBA A;  4OOY A;  4PHT A;  3VOY A;  3GQZ A;  5CED A;  1BTL A;  2BLS A;  2Y2G A;  3G34 A;  5F6A A;  2IA2 A;  4B4Z A;  1XJ2 A;  4DE2 A;  3IF6 B;  3VSL A;  2QJ7 A;  3MQQ A;  2VX8 A;  2JKR M;  2V20 A;  4HP4 A;  1ES2 A;  4HI4 A;  2MJ6 A;  4ETZ A;  2OWH A;  4GB7 A;  1GA0 A;  3LID A;  3HL9 A;  1JNU A;  4I38 A;  4EEP A;  1T1A A;  1MXO A;  1BUL A;  3QP1 A;  3OPL A;  1JVJ A;  3CLO A;  2IWD A;  2ZMV A;  1WE4 A;  1PW1 A;  4CLC A;  4KZB A;  3T4J A;  1W63 M;  5GHY A;  4BBU A;  5FQJ A;  1SZV A;  1P97 A;  3ISG A;  3R7W A;  4PM5 A;  5FI2 A;  4Z9Q A;  3IBJ A;  1CQA A;  2ZM0 A;  4HHD A;  3T1Q B;  1OJ5 A;  4BJP A;  1DJC A;  4N1H A;  4S2N C;  3HRE A;  5D3O A;  3Q7V B;  4KZ4 A;  4FH4 A;  4HBT A;  4DMZ A;  4S2L A;  2WYX A;  2X01 A;  4B9O A;  4KZ3 A;  4OPZ A;  1MWU A;  3UPO A;  4E3I A;  1ONG A;  1WYC A;  3DW0 A;  2PBY A;  4K0W A;  2J8Y A;  3NHQ A;  4EBL A;  5TJJ A;  2XA7 S;  4KG2 A;  2YKF A;  4CLC E;  2Y2N A;  4MN5 A;  4R6L A;  3T1S A;  5A8B A;  1BUE A;  4HJ4 A;  2W3G A;  2HDR A;  3DTM A;  2RL3 A;  4PM6 A;  2ZD8 A;  2GNX A;  1BZA A;  3FG8 A;  1LSV A;  2EXB A;  3H7W B;  3GRJ A;  3DTI A;  2J3T C;  3ZNT A;  4DE1 A;  4E3K A;  2BTF P;  5CGS A;  2IWC A;  4N9K A;  4QHC A;  1OTI A;  2A49 A;  3PTE A;  1YM1 A;  1NJ4 A;  1W79 A;  4PM7 A;  1W5D A;  3EOI A;  4OQH A;  3O88 A;  3IBR A;  2EX6 A;  3MQ0 A;  3O5Y A;  5GHX A;  4KZ9 A;  5BOH A;  3VP2 A;  4OQ0 A;  5A92 A;  1K38 A;  2X02 A;  5FA7 A;  4GJ4 A;  2WKI A;  3IXH A;  1RGZ A;  4H8R A;  3N8R A;  3A0R A;  2XEP A;  1FCN A;  1K57 A;  4RYE A;  4EW7 A;  2V2F F;  1K56 D;  4GLQ A;  3WS5 A;  5EFW A;  3WRT A;  1YT4 A;  1HVB A;  4MBK A;  5C5K A;  4Q0J A;  1K55 C;  2ZC6 B;  3C30 A;  3IS2 A;  2DCF A;  3BW6 A;  3U2A A;  5DVA A;  5EVE A;  4ZJ1 A;  2ZM2 A;  2B5R A;  3QP2 A;  3RXX A;  4DXC A;  4GS9 B;  2I72 A;  2O9A A;  3F1O A;  5HW3 A;  1Q2Q A;  3ZFZ A;  3IX8 A;  3IF6 C;  2XA7 M;  3HBR A;  2W3D A;  3K3C A;  4DJ2 A;  2XD1 A;  2HJE A;  2I9V A;  1DJA A;  1M6K A;  4OKP A;  3C38 A;  5EUA A;  3D3O A;  3NDG A;  4MN6 A;  3CIT A;  1PIO A;  5FQQ A;  4F3L B;  3O87 A;  2XQZ A;  3MR0 A;  4XXR A;  4B88 A;  3EQV A;  2IWB A;  2WAE A;  3VP3 A;  5FI6 A;  4S2J A;  4A5R A;  1O7E A;  4OON A;  2O0Y A;  1AXB A;  5AQA A;  1PNE A;  4X53 A;  5EVI D;  1G6A A;  2LB9 A;  1ESI A;  3ZNY A;  3VOL A;  2JE5 A;  1T1C A;  4S2N A;  5F83 A;  4QY6 A;  2Y55 A;  1XA7 A;  1YLW A;  2WUQ A;  1IYQ A;  4EQI A;  2XDM A;  2HP5 A;  5CHJ A;  3IF5 A;  2L4R A;  4EES A;  1YMX A;  4G3W A;  5M19 A;  2EX2 A;  1HLU P;  3S7N A;  4FH2 A;  1KOU A;  2W3H A;  1H3Q A;  5GLB A;  5HWV A;  4BQM A;  3ITB A;  1PI5 A;  4B93 A;  3BFD A;  3EEH A;  3V67 A;  4OPQ A;  5L8M A;  2PR5 A;  3QP8 A;  1SKF A;  3TW8 A;  5TR7 A;  3VP0 A;  4P6B A;  1O07 A;  3LR0 A;  2R78 A;  1PYY A;  3E4O A;  5J7E A;  3G6O A;  3F1N B;  3N8L A;  4S2I A;  1MWS A;  3H82 A;  4JXS A;  1SDE A;  1IYO A;  1KE0 A;  2JKT M;  4UAA A;  3ZG0 A;  1OME A;  4R4R A;  3KYZ A;  4WUJ A;  2ACG A;  3G2Y A;  3QHY A;  4Q0I A;  4Y0T A;  5CRF A;  1N9B A;  4IBX A;  4GOG A;  4DDS A;  1NY0 A;  3MSH A;  2W3F A;  4UEY A;  2KDK A;  4ME4 A;  1PWC A;  2HP6 A;  3BEC A;  3UPP A;  3EEA A;  1MWT A;  4OVD A;  1K55 A;  4Y13 A;  3IQA A;  4WBG A;  1G68 A;  4L9E A;  5HL1 A;  2CC1 A;  3RJU A;  5G4Z A;  1IFQ A;  2PU2 A;  3HLD A;  3VE4 A;  1TS6 A;  2J80 A;  2WKH A;  3A0S A;  1Y28 A;  3IX3 A;  3OLO A;  5HWT A;  5KIZ A;  2ZC5 B;  2A2L A;  4O7D A;  4KZ5 A;  1SKO B;  2W1R A;  5FQ9 A;  1JWZ A;  1NZO A;  4O8G A;  2VA0 A;  3U4L P;  4NXB A;  5F82 A;  4CLC D;  4HP9 A;  5HL6 A;  2QKP A;  3FWL A;  2PYR A;  5L10 A;  4EXO A;  1RP5 A;  4LV2 A;  3SZT A;  5FDS A;  4ID4 A;  4NG2 A;  1GHP A;  1OT6 A;  3UB6 A;  1DP8 A;  4NK3 A;  3FYZ A;  1GSV A;  5HAI A;  3PXP A;  3UE6 A;  3EWK A;  4S2P A;  3PBR A;  4X56 A;  2Y2Q A;  1TVF A;  3HJK A;  2W27 A;  4QPR A;  3BFE A;  3KSI A;  3CG5 A;  1YLJ A;  4NEE D;  3IT9 A;  4EUZ A;  5FEG A;  1N9L A;  4X6T A;  4Y0U A;  3CPT B;  3S7O A;  3Q7V A;  5FAQ A;  3W8K A;  2JN7 A;  1ACF A;  2A24 B;  4MDZ A;  4X25 A;  1P9W A;  4LPZ A;  4Y17 A;  1W8Y A;  2PD8 A;  3PYP A;  2HP9 A;  1OTE A;  3NOP C;  4JXW A;  3KO6 A;  2J3W A;  1SCW A;  5GHZ A;  3UPN A;  2C5W B;  3E4Q A;  1LHY A;  1K4E A;  5FL3 A;  1D7E A;  1H8Z A;  3H7W A;  3AGD A;  2Y59 A;  2XD5 A;  1TF1 A;  4DE3 A;  5FAO A;  4HJ3 A;  2Z2M B;  3RXW A;  1K6S A;  3VOZ A;  4JF6 A;  5M18 A;  4WF0 A;  2ZC7 A;  1XP4 A;  2V1A A;  1IOU A;  3MFX A;  3C7V A;  4DE0 A;  1XGJ A;  1H8Y A;  2QMI A;  1I2W A;  2QPN A;  1NLZ A;  3PBN A;  2OAP 1;  2X71 A;  1SHV A;  5GLA A;  3D4F A;  1K54 C;  3L9K A;  3N4I A;  4R70 A;  3KYE A;  3H82 B;  5EV0 A;  4Y3I A;  1ERO A;  1OTD A;  3B3X A;  3N7W A;  3NJA A;  5JYO A;  2O99 A;  1IEM A;  3T4O A;  3NOT C;  1NYY A;  5F1G A;  3UME A;  4X55 A;  1KGF A;  2DRW A;  5G18 A;  4ARZ A;  1TEM A;  4GS9 A;  1K57 C;  3DWK A;  4C6Y A;  1KE4 A;  3O3V A;  5HD5 A;  2W1T B;  4IJG A;  3IWQ A;  2G2W A;  4BD1 A;  3T4Q A;  4ZDX A;  4NKP A;  2P08 A;  3IHB A;  1MZU A;  3NIA A;  4CQH A;  5DTK A;  2DNS A;  4OOL A;  3P09 A;  1K6R A;  5MC7 A;  4BEN A;  2WAF A;  3B42 A;  1UWN X;  5L2F A;  2QWS A;  5G4Y A;  1GA9 A;  2ZBB A;  4BLM A;  3KX0 X;  1ZKJ A;  4C75 A;  4F3L A;  2XGN A;  4RVA A;  1DJB A;  4NXE A;  3MXR A;  1DY6 A;  3JVV A;  4OPY A;  4D2O A;  4PKY A;  4X1L A;  4PMA A;  4EU0 A;  2NUT C;  3SH9 A;  3MMH A;  4S2K A;  3MKF A;  3D9Y A;  4GDN A;  4KEN B;  5DKL A;  1G6O A;  1CK3 A;  3H9W A;  3PBT A;  4GN2 A;  2OAQ 1;  2VKS A;  3T1R A;  2KOI A;  5A93 A;  2INW A;  2P7J A;  2PT7 A;  2CMN A;  3V3S A;  3VMA A;  3NY4 A;  4GW9 A;  1BSG A;  3SW1 A;  4B4X A;  4E3O A; 
#chains in the Genus database with same CATH homology
 3MS6 A;  1SKO A;  2PRF A;  3KYE A;  2VK3 A;  4FUW A;  1VET A;  5EV0 A;  2V8C A;  4X1M A;  5FEG A;  1A0K A;  1J3W A;  1FIL A;  1VEU B;  3CPT B;  4ESP A;  3T1S A;  1Z09 A;  1ACF A;  4D60 A;  2V8F A;  4X25 A;  2ACG A;  1Y4O A;  2BTF P;  5EM1 A;  1CF0 A;  4QWO A;  3MSH A;  2JKG A;  1PNE A;  1YPR A;  1VEU A;  3CPT A;  4FTX A;  3T12 B;  3L7H A;  1CJF A;  2PBD P;  5EM0 A;  3LGO A;  4X1L A;  1SZV A;  3CHW P;  1SKO B;  2HZ5 A;  1HLU P;  2JKF A;  1F2K A;  3NUL A;  3U4L P;  1FIK A;  1CQA A;  3D9Y A;  2PAV P;  1D1J A;  3T1Q B;  2B95 A;  1K0K A;  1PRQ A;  5FDS A;  1AWI A;  3DAV A;  2E8J A;  3T1R A;  5EVE A;  2ZL1 B;  3LEQ A;  1G5U A;  3NEC A;  3UB5 P;  3T1X A;  2ZL1 A;  3L9K A;  1VET B;  1PFL A;  5FEF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...