3SW1A

Structure of a full-length bacterial lov protein
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
134
structure length
134
Chain Sequence
MINAQLLQSMVDASNDGIVVAEKEGDDTILIYVNAAFEYLTGYSRDEILYQDCRFLQGDDRDQLGRARIRKAMAEGRPCREVLRNYRKDGSAFWNELSITPVKSDFDQRTYFIGIQKDVSRQVELERELAELRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Sensory box protein
publication title Structural Basis for the Slow Dark Recovery of a Full-Length LOV Protein from Pseudomonas putida.
pubmed doi rcsb
source organism Pseudomonas putida
total genus 41
structure length 134
sequence length 134
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3sw1A00
4JGOA 5DJTA 2QWSA 2L0WA 3LYXA 3OLOA 5HDSA 5HWTA 4KUOA 3UB6A 1WA9A 3K3CA 4KQDA 5HWWA 3RTYA 4NXGA 3A0RA 3E4OA 3CAXA 5TBMB 5IU1A 2Z6DA 4MN6A 2L1MA 3EWKA 4L9EA 5HD5A 3H7WA 3T50A 2OOLA 4WN5A 3C8CA 5DKKA 4R3AA 4PKYA 4DJ3A 3E4PA 5J7EA 4HOIA 2OWJA 2WKPA 1NWZA 4EXOA 3UB7A 3E4QA 1GSWA 2HV1A 4HJ6A 1S1ZA 3A0SA 2W0NA 2D02A 5G4YA 4GS9A 4EETB 1XJ2A 3FC7A 2JHEA 1KOUA 1OTAA 3CLOA 3GDIA 4HNBA 1UWNX 2PD7A 2A24A 3F1NB 3LUQA 4WUJA 2KDKA 2QJ5A 1UGUA 2WKQA 1N9NA 3NOTC 2PR5A 2JN7A 4BBUA 2VEAA 3H82A 1LT0A 5HWVA 3HJKA 1LSVA 2L4RA 2M1CA 3LIBA 2R78A 2V1BA 4E04A 1TS7A 3K3DA 2ZOIA 4NXEA 5AVFA 1F9IA 3VE4A 4B9OA 4LLOB 4HH2A 4HJ3A 3A0VA 2QJ7A 3MJQA 3H9WA 2B02A 2WKRA 3F1PA 4WL9A 5DKLA 3RH8B 3PYPA 4EEUA 2GJ3A 1GSVA 4F3LA 3IS2A 3NOUC 1ODVA 3D72A 4GCZA 2J80A 2KX6A 4K08A 4WF0A 1D06A 3GECA 3ULFA 4XT2B 3LIEA 1JNUA 1TS0A 4RQ9A 4NXFA 1MZUA 4I39A 1DP6A 5F69A 2QHKA 4M4XA 1P0ZA 5F68A 2P7JA 2V9AA 4GHIB 1OT9A 1S4RA 2PYPA 3UB9A 2H28A 1S4SA 3LICA 4LRXC 1T1AA 4R6LA 3P7NA 5F5YA 4I5SA 1D7EA 5TBMA 4JGRA 4BBVA 4R38A 3EEHA 3LI9A 2K7SA 3C2WA 1TS8A 4HY8A 1OJGA 3BY9A 2ZBBA 3NOPC 4HH3A 4DJ2A 1DP9A 3CWFA 3F1OB 4H6JB 5DJUA 3UB8A 5IS1A 2EA9A 2QKPA 2V1AA 2YKFA 5HSQA 1N9LA 1BYWA 4L9FA 4L9GA 3F1NA 4HP4A 4HP9A 4KUKA 5AVEA 3VE3A 5J3WA 1X0OA 5HDCA 1VB6A 4BBTA 1UWPX 1S66L 2YKHA 2VV7A 1TS6A 5HZHA 1OT6A 4JGQA 2CMNA 1DP8A 3MR0A 2VLGA 3IBRA 4LRZE 3H7WB 1XFNA 1XJ6A 3LI8A 4EQ1A 1XFQA 4HQAA 2I9VA 2D01A 3UE6A 2OWHA 4LRYC 2PDRA 3VOLA 1S67L 3BY8A 5J4EA 4JGPA 1LSXA 1XJ4A 4EW7A 2V0UA 4GS9B 3LIAA 2W27A 3NHQA 2A24B 3PHYA 2PD8A 1DRMA 1OTDA 3LIFA 5KIZA 1T1BA 4GW9A 4R70A 4HJ4A 1N9OA 3MQOA 3MXQA 1OTIA 4HHDA 1LSWA 2BASA 1T18A 1Y28A 4XT2A 3H82B 3UMDA 2VV6A 5HD3A 2V0WA 4EESA 1LL8A 2VV8A 2PHYA 4I3AA 2PYRA 1F98A 4I38A 3KX0X 1OJ5A 4LPZA 4GHIA 4HIAA 1V9ZA 3MFXA 1V9YA 3NJAA 1S1YA 3SW1A 5F6AA 3ZQ5A 4EERA 4I3JA 1XJ3A 5EFWA 4NXBA 1P97A 1GSXA 1OTBA 3HJIA 1G28A 2PR6A 1OTEA 3BWLA 2INWA 1EW0A 4EEPA 3ICYA 2ZOHA 3F1PB 4PKYG 4MN5A 5HDDA 3F1OA 4H6JA 4F3LB 3IS2B 3FG8A 1T1CA 4YWZA 1T19A 3B33A 5A8BA 4I3IA 4WLAA 3UMEA 5I5LA 3LIDA 3MQQA 5G4ZA 4HI4A 3G6OA 2Z6CA
chains in the Genus database with same CATH superfamily
2Y91A 4O8GA 5EUAA 2O9BA 5HWTA 1XA7A 3ZNYA 4KUOA 3PR6A 4BENA 1WA9A 3K3CA 3ZFZA 5M19A 4G3KA 3PXPA 3CAXA 4LFUA 5IU1A 3Q7ZA 4BD1A 4MN6A 2Z2MB 4L9EA 3H7WA 3T1QB 2OOLA 1YMSA 4N1HA 2WGWA 1S0WA 5J7EA 3ITBA 3RJUA 1MC0A 2OWJA 4PMAA 4EXOA 1IFQA 3UB7A 1BLPA 1VEUB 3M2JA 4BL2A 2Q9NA 3L7HA 4HJ6A 4JPMA 2FH5A 2EX2A 2D02A 2W3EA 4RX2A 2B18A 4NK3A 3KSGA 1PZPA 3SH8A 3GDIA 3T12B 3IH8A 4C3QA 5FI2A 3GSGA 2PD7A 2Q9MA 2A24A 3C38A 3HREA 2KDKA 4KQQA 4FD8A 1UGUA 1I2SA 2WKQA 3OPHA 2RCXA 1FR1A 2ZQCA 3UDIA 3O88A 2VEAA 1IEMA 1LT0A 3AGEA 3M6HA 4GNUA 2EX9A 2L4RA 3Q07A 4IVIA 4JF5A 3LFVA 3MF0A 3Q7VB 3K3DA 2Y2KA 2ZOIA 2XD1A 5AVFA 5M1AA 3T4TA 4QY6A 4KZAA 1F9IA 4KG2A 4EQIA 4LV2A 2W1RA 2OV5A 4R23A 4BLMA 3T1SA 2A49A 2QJ7A 2KLIA 3FYZA 3O5YA 3NIAA 3SS3A 1O7EA 2Y79A 4F94A 2WKRA 5EVIB 4LGWA 4WMCD 2WAFA 5DKLA 4QWOA 3LEQA 3RH8B 4OLGA 2HPBA 4II7A 1GSVA 1HZOA 3D72A 4GCZA 5F82A 1ZHHB 1BZAA 4E3JA 1XGJA 1PNEA 1PRQA 3T4QA 1NYYA 2J3TC 1TS0A 1MZUA 2QYBA 3O86A 4I39A 3ZDJA 2VGJA 1H3QA 3EQUA 3IWIA 3NULA 3UE1A 4OQGA 1PW8A 5F68A 3WRZA 1OT9A 2JBFA 2ZMFA 2H28A 3GR2A 2PRFA 3IXBA 1S4SA 3LICA 1PWGA 1OPXA 2HDQA 2XSSA 4LRXC 3S7OA 1LL5A 4JF6A 4R6LA 5F5YA 4I5SA 1D7EA 3FKVA 5TBMA 2XLNA 2PU4A 2W3DA 4BBVA 4QJGA 4HEFA 1KE0A 2K7SA 2ZQ7A 4MN7A 3ZG7B 3FZCA 2I72A 2MJ6A 2WGVA 2EX8A 3MKFA 4X53A 2JC7A 3IBJA 3VSKA 3OPLA 3N4IA 4P6BA 2V20A 2J7VA 4BJPA 1I5QA 3HVFA 5AQAA 2QKPA 2V1AA 4FH2A 2YKFA 3G2YA 1K55C 5EOEA 3DWKA 1ZC2A 3OPPA 3TSGA 4ZRRA 3F1NA 2XRNA 2M7VA 3IWOA 1NRFA 1E3UA 1CJFA 4S2PA 4GDNA 4K91A 4KUKA 3OOVA 1AWIA 5J3WA 2X71A 2YKHA 2XQZA 2Y4AA 5DF8A 1W5DA 1YT4A 4LCMA 1YAXA 1Y4OA 1K6RA 4OP5A 2G7UA 4Y5FA 4Q8IA 1DJBA 4EBLA 1VQQA 2E8JA 1E4DA 5FEGA 3MR0A 4LV3A 3IBRA 1XFNA 1TDGA 2ZMVA 5DF9A 4DF6A 1XFQA 3EQVA 1OMEA 3HLDA 1S67L 1ONHA 2KOIA 2ZC6B 1CI9A 3BY8A 3A3IA 4PM8A 5EM0A 4E6XA 4E3KA 1MWSA 3G32A 3OBFA 1ZG6A 5E2GA 1JVJA 2P74A 4Z1WA 2W27A 4GZBA 4ZAMA 1XP4A 1HLUP 1DRMA 3S7QA 2WADA 3UO9A 3T1RA 1OTDA 3LIFA 5KZHA 3PTEA 1SKOA 4R70A 3MQOA 1PIOA 3MXQA 1OTIA 1LSWA 4OQ0A 4KENB 4P6ZS 4XT2A 1YKDA 3SH7A 4EESA 1W7FA 4MDZA 1WYBA 2PYRA 1K54C 5EOOA 3OC2A 4LPZA 4FSFA 5CEBA 3MFXA 3LR5A 2W3FA 4S2JA 4BMWA 3BFCA 4Y7PA 4I3JA 5EFWA 1K38A 1ESUA 1GSXA 2O99A 4MCWA 3HJIA 1SKFA 4FTXA 4KZ9A 3PBQA 5TFQA 1EW0A 3LO7A 4ARZB 4Z9QA 3MQ0A 3N7WA 4QHCA 2DCFA 5FEFA 2FFFB 2ZLYA 4HBTA 5EM1A 3OZHA 3T4OA 4PHTA 4PKYG 2CC1A 2WZZA 4CLCB 5HDDA 4IUKA 1ES2A 1T19A 1FR6A 3TRCA 2W1TB 5EVID 2Y2LA 3OPRA 5CX7A 4NG2A 3LIDA 4KZ3A 4KZ4A 1YSPA 1PWCA 3UPPA 4CQHA 4HI4A 3T4LA 3VP1A 4NETA 4HESA 3CI6A 2QWSA 4E3MA 2L0WA 3LYXA 5HDSA 4BD0A 4KG5A 1YLZA 1DY6A 3SS5A 3DW0A 3FV7A 4PM9A 5FAQA 3TE8A 3R4KA 1BLHA 3U4LP 4L0LA 2Z6DA 4P6ZM 2XK1A 1HD8A 4OPYA 3EWKA 4ZDXA 1XXMA 1GA9A 3SZTA 4EBPA 4XXRA 3C8CA 5DKKA 4B93A 1KE3A 1BULA 5MC7A 1IOUA 3IF6A 1NWZA 1VETB 3IXHA 5DFYA 3B3XA 3V5MA 3MSHA 2G2WA 3DTKA 3G35A 4DN0A 4WMCA 3E4QA 1U60A 4C75A 2BG1A 1IKGA 3QP5A 2Y2HA 3FC7A 4FCFA 4DXBA 2JHEA 4EUZA 1ONGA 4B4ZA 1HVBA 1F5MA 4BQMA 1UWNX 4DE3A 4O7DA 1YLPA 3LUQA 4WZ5A 5DTSA 3MBZA 3JYIA 3OCNA 1N9NA 4EUVA 3NOTC 4PM5A 2PR5A 2JN7A 3CMZA 3Q1FA 3BQAA 2J3WA 3P09A 5HWVA 3HJKA 4MEZA 3JVVA 4DKIA 4X68A 1YSQA 5HPFA 2C6WB 4OP8A 1TS7A 1S6RA 3IT9A 2XD5A 2X02A 3VE4A 1A0KA 3E2KA 2EFUA 4OPQA 1ZKJA 3BYDA 2WZXA 4U0TA 3MKEA 1M40A 4LLOB 3PAEA 5A93A 3U2AA 3LCEA 2JKRI 4HJ3A 1FCNA 5E2FA 4YINA 3A0VA 2A2LA 1BLSA 2B02A 1SDEA 3F1PA 4ID4A 2GJ3A 4GLQA 2ZD8A 5EVLA 4F3LA 3S7NA 3TW8A 4MMNA 1CF0A 2XH9A 2Y2NA 1L2SA 1PZOA 1ODVA 4S2NA 2KX6A 5L09A 3GECA 3ZG8B 4ETZA 3T4KA 3C30A 3LIEA 1JNUA 1JWPA 1ES5A 4OQIA 1VM1A 1CI8A 5LBRA 1DP6A 5F69A 2QHKA 3E0YA 4M4XA 1KGFA 2GNXA 4GHIB 5L8MA 5JYPA 3WS5A 2VGLM 1RCJA 1EWZA 1W79A 3BECA 2Y2PA 3BLSA 3UB5P 1NJ4A 4UA9A 1IYSA 5I94A 2ZJ9A 2PBDP 5HL1A 5AQ7A 3C2WA 4WM9A 1OJGA 4JBFA 4YNRA 3KYQA 4GKUA 4QU3A 1J3WA 1PW1A 3S4XA 4HH3A 1VEUA 3G2ZA 1DP9A 4DJ2A 3F1OB 3NBLA 4H6JB 2ZC4B 3NDEA 4G3VA 4KZBA 2EWWA 2EA9A 4UQIS 3MZFA 2K2NA 4CLCD 4L9FA 2EWVA 2Y2JA 3QP4A 4KQRA 4U0XA 3R7WB 4HP4A 2V2FF 5CERA 1LI0A 5CHJA 4HP9A 4D60A 3N8LA 3VE3A 5A90A 1JTGA 1LHYA 4GB7A 3A3DA 1WYCA 3PBNA 3OCLA 1UWPX 2A3UA 1TS6A 4GN2A 5FQQA 2B5RA 2W3GA 3VP0A 5CEDA 2ZM0A 1K55A 5KMWA 3UPOA 2P04A 4LRZE 2Y2MA 3MXSA 4ZBEA 2GX5A 1RGZA 1RP5A 3Q7VA 4OQHA 4HQAA 1CK3A 4ZJ3A 5D3OA 3LR3A 3B42A 3N6IA 4XUZA 3C7UA 5E2HA 2OWHA 4LRYC 3IX8A 2HDRA 5CECA 3GRJA 1PI5A 3CPTB 5HW3A 2HP5A 5J4EA 3JVUA 2XFSA 4EW7A 3HUNA 4GD8A 2P9VB 3WWXA 1IYQA 4JXWA 3ZG9B 4GS9B 2XF3A 3B47A 3CUEA 4X69A 4YFMA 3DTMA 2O9CA 5EVIA 3NHQA 4OKPA 1G6OA 3IQAA 1GA0A 2NUTC 3S7PA 1G5UA 3PBOA 5KIZA 1T1BA 4P87A 1H8YA 4HJ4A 2ZQAA 5CGXA 5CGWA 1NY0A 1YLTA 3DTEA 4PAUA 4S2OA 1MWTA 4UQIM 3H82B 1QMFA 1AXBA 2OLVA 3S22A 1XX2A 2PHYA 4I3AA 3AGDA 1Z6FA 4DDSA 5EE8A 3VFFA 1C3BA 3SW1A 5FQJA 3D4FA 1Z09A 5FI7A 1F2KA 4NKPA 4G3WA 2ZC5B 1P97A 1DJCA 3HUOA 1OTBA 3ZG0A 3HLBA 3KSFA 1YLWA 1JWVA 5GLAA 1K57A 3NI9A 4EEPA 2HF6A 3ICYA 1W63M 2XFTA 1KE4A 4MN5A 3IS2B 2JKTI 5FQKA 1D1JA 1IYOA 2H0YA 3B33A 3HLFA 3SH9A 4E3NA 2O0YA 3WS4A 3TJZC 4WLAA 3VP4A 4JXGA 2ZL1B 3UMEA 3Q82A 3G6OA 2Z6CA 2V1ZA 5FSRA 5DJTA 3WS0A 1NZUA 3IX3A 4K0WA 2ZMAA 3UB6A 4JF4A 3DTIA 2J3TD 5HWWA 2LB5A 4NXGA 4K0XA 3A0RA 3C7VA 4B88A 5GHZA 5E43A 3CHWP 5HAIA 4R4RA 1ZG4A 1ERMA 1K56D 3BJNA 2L1MA 3VSLA 3JPUA 4WN5A 5FAOA 1N4OA 3W4PA 3NCKA 4N92A 4S2MA 3E4PA 3FPVA 5IT5A 5FAPA 2WKPA 2V8CA 3BFFA 2Y59A 1O07A 2HV1A 4PM7A 1S1ZA 2WK0A 4YOFA 1LL9A 5G4YA 4EETB 3SOIA 1YLYA 4XUXA 1SCWA 2Y2QA 1KOUA 2WKEA 4ZJ2A 3IX4A 4KQOA 5GLBA 4P85A 3CLOA 3BW6A 3ZVTA 4HNBA 2WKHA 1GHMA 4RYEA 4WUJA 1YQSA 1XKZA 2QJ5A 1L0EA 3GQZA 3VP2A 4R1GA 2JKFA 2ZM8A 4GJ4A 4KZ8A 2K31A 3UN7A 1NLZA 5AJGA 1BSGA 2BLSA 3CITA 1LSVA 4OVDA 5L2FA 3SS4A 3LY3A 1ERQA 1LLBA 4MBKA 3LIBA 2R78A 5DTTA 4E04A 4NXEA 3P01A 1MPLA 1NLYA 3PBRA 3HL9A 4B9OA 4WZ4A 2OAP1 4HH2A 5DFXA 1W8QA 4U3TA 3FPWA 2UV0E 3A3FA 3IF5A 3UNWA 4ARZA 2HJEA 4C6YA 4PM6A 1JTDA 2J9OA 5HAQA 2AVXA 2V8FA 3NECA 4WL9A 1K0KA 5GLDA 3PYPA 4EEUA 4CLCA 3L9KA 3I7JA 4Y13A 3WRTA 4K08A 4WF0A 2W1TA 4X1LA 1D06A 1EROA 4X25A 3MXRA 4Y15A 2VJWA 3BFEA 3ULFA 1FSYA 4GOGA 4M3KA 5FA7A 3IXDA 4S2LA 4GD6A 4RQ9A 4NXFA 3T4SA 4UA6A 3CZDA 2P7JA 4KZ6A 2V9AA 1FCMA 2G2UA 2ACGA 2PYPA 3UB9A 4R0QA 4EBNA 3UDFA 2VA0A 5HL6A 5L07A 4UA7A 3MZEA 2DMWA 3P7NA 2P08A 3BEBA 3FWLA 4OH0A 3MMHA 4OOLA 4JKTA 5CHMA 4RVAA 3BRMA 4IHQA 1L0DA 4R38A 3IH9A 1I2WA 3VFHA 1TS8A 3BY9A 2ZBBA 3S1YA 1VETA 3NOPC 2VX8A 2Y8HA 3HLWA 3KO6A 1PFLA 4ESPA 4X6TA 3PBTA 5DJUA 2HDSA 3UB8A 5IS1A 1KGGA 5A92A 1IKIA 1BYWA 1N9LA 1P9RA 2JKRM 4MBHA 4OOYA 2H5SA 5FQIA 2IWDA 3M2KA 3MZDA 3EOIA 1NZOA 2JE5A 1TDLA 4N9LA 1L0FA 2XA7S 3DWZA 5M18A 1BLCA 1QMEA 5AVEA 1FCOA 1KDSA 4ETXA 3A3EA 4PPRA 1ACFA 2E8IA 1PYYA 4AFIA 2PU2A 5HZHA 3BFGA 3QHYA 1MKIA 4Q0IA 3QP8A 5DVAA 3Q81A 3HLEA 1DP8A 3V39A 2VLGA 3H7WB 1SDNA 2PT7A 3ZVWA 3LI8A 4EQ1A 2WGWB 2I9VA 1DJAA 1FQGA 4JLFA 3NDGA 2PDRA 3IF6C 3VOLA 4Q0HA 3IXGA 3C4OA 1SHVA 1K4EA 5EPHA 1LSXA 1XJ4A 4O0PA 3RXWA 1H8ZA 3GTCA 4WELA 4JXVA 3RXXA 4CPKA 1NXYA 2NUPC 4IVKA 4X1MA 3ZCZA 2EFXA 2A24B 3PHYA 4S2KA 4ZTKA 4WZ5C 4IBRA 4HBUA 4UEYA 2BASA 1NRJA 1T18A 5TGFA 2PAVP 1Y28A 2VK3A 1M6KA 5HD3A 4KG6A 3O87A 3W2ZA 1LL8A 2VV8A 2Z2LB 4Y0UA 4GDBA 4LENA 3KX0X 4IEDA 2QZ6A 1K56A 4GHIA 4EV4A 4HIAA 4E3LA 1V9ZA 2OLUA 1GHPA 4WEJA 2XA7M 1V9YA 3QNCA 2FZ0A 4OPZA 5F6AA 5L10A 1XJ3A 4NXBA 5C5KA 3VP3A 4P0MA 1ES4A 2VKSA 2HZ5A 2PR6A 1L3LA 5CXWA 1ALQA 1OTEA 5GHXA 4DMZA 3BWLA 3UE0A 1MXOA 4IBXA 1TVFA 2WYXA 4UHUA 3CG5A 4R3JA 3V50A 3W4QA 3V67A 2GDNA 1TF1A 3F1OA 4H6JA 3FG8A 3GVBA 2DRWA 1CEFA 5GLCA 2IWCA 2OAQ1 1EI5A 4S2NC 5A8BA 3TOIA 4I3IA 5FI6A 1GHIA 4LCLA 3R7WA 4N1XA 4OLDA 5G4ZA 4BL3A 3QP2A 4JGOA 3V3RA 3OLOA 1K4FA 3P98A 3EGXC 4IUHA 2O9AA 3TG9A 5GHYA 3LY4A 4KQDA 4MLLA 2LB9A 3RTYA 1LI9A 2WAEA 1L0GA 3E4OA 3A3JA 2IA2A 2Y2IA 5TBMB 3QP1A 4QPRA 5HD5A 3G30A 3DAVA 3FKWA 5CRFA 1TD5A 3W8KA 5A91A 3T50A 3UE3A 3V3SA 5U47A 4R3AA 4PKYA 4DJ3A 1YPRA 5E2EA 5AQ9A 3KSHA 4HOIA 3MFDA 5F1GA 1FILA 2ZQ8A 3NY4A 3CPTA 4WYYA 3T1XA 1GSWA 3VOZA 2H10A 3A0SA 1MBLA 2P9VA 2W0NA 3IHBA 1H5XA 4GS9A 1XJ2A 1W63Q 1OTAA 4Y3IA 1PI4A 1MWRA 3BFDA 3BM6A 2Q0OA 1E25A 3T4JA 3CJMA 1ZTUA 5CTNA 3F1NB 3KYZA 2FFYA 3E2LA 4Y0OA 1Q2PA 2C5WB 4A5RA 4BBUA 2XGNA 4FH4A 1FOFA 2H0TA 2JKTM 3ZHHA 4QY5A 3H82A 2Y55A 5HX9A 2EX6A 4O01A 3WS2A 1K54A 2XROA 1KVMA 2X01A 4DE0A 2M1CA 2V1BA 1MKMA 2RL3A 1KVLA 2GZAA 5BOHA 1BTLA 4RX3A 3QP6A 3G4PA 4R4SA 5F83A 3LR0A 3ISGA 1G68A 4MNRA 3MJQA 5FQMA 3C5AA 1YM1A 3CUEC 4CLCE 3PAGA 3VOYA 3H9WA 5F1FA 5EVIC 1YLJA 3N8SA 4DE1A 3IS2A 3D9YA 2Y2OA 2BTFP 2W3HA 3NOUC 4OPRA 4B4XA 1SKOB 2J80A 2ZC3B 5JYOA 3DBAA 2ZL1A 3ITAA 1KGEA 4Y0TA 4XT2B 2ZC7A 1IYPA 3LR4A 4E6WA 3O3VA 5DF7A 3GV9A 4DDYA 1P0ZA 1S4RA 5FDHA 5FASA 4LV0A 5G18A 1T1AA 2HP9A 4QD4A 1IELA 3EGDC 1TEMA 1W8YA 2XR0A 2J9PA 4N9KA 4JGRA 2Y2GA 1MWUA 3EEHA 3LI9A 4ZJ1A 1PWDA 1K57C 4HY8A 2DNSA 3HCYA 4R3BA 2XDMA 1H8MA 2JCHA 2ZQDA 3VV4A 5K5BA 2EXAA 4S2IA 2HDUA 3CWFA 1K6SA 1KDWA 1FIKA 1N9BA 3VMAA 3IWQA 2HJ9C 3KYEA 3BQ8A 5HSQA 2HGVA 2UWXA 5CHUA 4BWIA 2R9XA 4L9GA 5EV0A 3UDXA 1XPBA 3ZNTA 5CTMA 4OONA 1CEGA 2ZQ9A 1WE4A 1K25A 3HUMA 3QNBA 2R9WA 2JKGA 2HP6A 5HPIA 2WKIA 3MS6A 4DE2A 4KZ7A 1X0OA 3GMWA 5HDCA 1VB6A 5FL3A 2VZWA 2IWBA 2M7UA 1XA1A 4BBTA 1S66L 2VV7A 1J9MA 1NYMA 4X55A 1OT6A 4OOMA 4JGQA 1G6AA 4IJGA 1HTZA 2CMNA 3HLCA 1CQAA 5HFOA 4E3IA 1XJ6A 3UPNA 3IHAA 4Q0JA 2OSUA 4WBGA 4UAAA 2D01A 3LEZA 3UE6A 3IF6B 5KSHA 4X56A 3ZYTA 4EU0A 4LV1A 1JWZA 4JGPA 3HLGA 3BLMA 2J8YA 5FQ9A 2V0UA 4DRTA 3LIAA 3ZGAB 2XEPA 5TR7A 5AQBA 3LGOA 2PD8A 3E98A 4FUWA 2EXBA 4WEKA 4GW9A 3HBRA 1BUEA 1N9OA 3EEAA 4HHDA 3K2NA 4Y2FA 3W4OA 4D2OA 1Q2QA 1E3UD 3UMDA 2VV6A 3M6BA 2V0WA 3KSIA 1ES3A 1H0MA 1ESIA 5CGSA 1F98A 4I38A 4Y17A 3UY6A 4E3OA 1OJ5A 2VGKA 1XGIA 3N8RA 2QMIA 4KZ5A 1SZVA 3C4PA 3AGFA 5EVEA 4DXCA 4H8RA 3NJAA 1Y54A 5IHVA 1S1YA 3ZQ5A 4EERA 4NEED 4EWFA 2VGLS 5TJJA 5FDSA 1BT5A 3RFBA 1STZA 5EECA 1MY8A 1G28A 5HAPA 1P9WA 3PBSA 4FOFA 2ZM2A 2INWA 4QB8A 1GCEA 3G34A 3D3OA 5KSCA 2ZOHA 1FSWA 4CJNA 3F1PB 2QPNA 3NC8A 3WS1A 2B95A 4CLCC 4JXSA 4F3LB 2PBYA 4RA7A 1T1CA 4YWZA 4MBFA 5J8XA 2WGIA 5FATA 2WUQA 3G31A 1RGYA 3ZG5A 4ME4A 5I5LA 1VHMA 5GL9A 3MQQA 5HARA 1YMXA 5DTKA
chains in the Genus database with same CATH topology
4JGOA 3CI6A 2QWSA 4O8GA 5DJTA 2L0WA 3LYXA 3OLOA 5HDSA 2O9BA 5HWTA 3EGXC 4IUHA 2O9AA 4KUOA 3PR6A 3UB6A 1WA9A 3K3CA 2J3TD 4KQDA 5HWWA 2LB5A 2LB9A 3PXPA 4G3KA 3RTYA 3TE8A 4NXGA 3R4KA 3A0RA 3E4OA 2IA2A 4L0LA 3CAXA 5TBMB 5IU1A 2Z6DA 4P6ZM 4MN6A 3BJNA 4QPRA 2L1MA 3EWKA 4L9EA 5HD5A 1TD5A 3H7WA 3T50A 3UE3A 2OOLA 4WN5A 3C8CA 5DKKA 4B93A 4R3AA 4PKYA 4DJ3A 3E4PA 3FPVA 5J7EA 5MC7A 1IOUA 5IT5A 3KSHA 4HOIA 1MC0A 2OWJA 2WKPA 1NWZA 4EXOA 1IFQA 3UB7A 5DFYA 4DN0A 3E4QA 1GSWA 2HV1A 4HJ6A 2FH5A 1S1ZA 3A0SA 4YOFA 2W0NA 2D02A 5G4YA 4GS9A 4EETB 2W3EA 1XJ2A 1W63Q 3FC7A 2JHEA 2B18A 1KOUA 1OTAA 3KSGA 4Y3IA 4KQOA 3CLOA 3GDIA 3BW6A 1F5MA 4HNBA 1UWNX 3T4JA 2PD7A 1ZTUA 2A24A 3F1NB 3KYZA 3LUQA 4WUJA 3C38A 2KDKA 2QJ5A 1UGUA 3OCNA 2WKQA 1N9NA 4EUVA 3NOTC 4GJ4A 2PR5A 2JN7A 2K31A 4BBUA 2JKTM 2VEAA 3BQAA 1NLZA 2J3WA 3H82A 1LT0A 5AJGA 5HWVA 3CITA 3HJKA 3JVVA 4O01A 1LSVA 1YSQA 2XROA 5HPFA 2L4RA 2M1CA 3LIBA 3LFVA 2R78A 2V1BA 1MKMA 4E04A 3MF0A 1TS7A 3K3DA 2GZAA 2ZOIA 4NXEA 5AVFA 3T4TA 3P01A 1NLYA 1F9IA 3VE4A 3PBRA 2W1RA 4B9OA 4LLOB 2OAP1 3U2AA 4HH2A 5DFXA 2JKRI 3LR0A 4HJ3A 3A0VA 3FPWA 2QJ7A 2KLIA 3O5YA 3MJQA 2A2LA 4ARZA 2HJEA 3CUEC 4CLCE 2Y79A 3H9WA 2B02A 2WKRA 3F1PA 4WL9A 5DKLA 3RH8B 3PYPA 4EEUA 4II7A 2GJ3A 1GSVA 4CLCA 4GLQA 4F3LA 3IS2A 3S7NA 3TW8A 4MMNA 2W3HA 3NOUC 1ODVA 3D72A 4GCZA 2J80A 2KX6A 4K08A 4WF0A 1ZHHB 2W1TA 1D06A 3GECA 3DBAA 4ETZA 3T4KA 2VJWA 3ULFA 4XT2B 3C30A 3T4QA 3LIEA 2J3TC 1JNUA 1TS0A 3LR4A 4RQ9A 5LBRA 4NXFA 1MZUA 2QYBA 1DP6A 4I39A 5F69A 3T4SA 2QHKA 1H3QA 3E0YA 3EQUA 4M4XA 1P0ZA 2GNXA 2P7JA 2V9AA 4GHIB 1OT9A 1S4RA 2PYPA 5F68A 5L8MA 3UB9A 2ZMFA 2H28A 1S4SA 2VA0A 2VGLM 5HL6A 3LICA 1OPXA 2XSSA 4LRXC 3S7OA 1T1AA 2DMWA 4R6LA 3P7NA 3EGDC 4I5SA 5F5YA 1D7EA 2P08A 5TBMA 3MMHA 4OOLA 4IHQA 2W3DA 4JGRA 4BBVA 4R38A 3EEHA 3LI9A 2K7SA 4MN7A 3C2WA 1TS8A 4HY8A 3HCYA 1OJGA 2MJ6A 4YNRA 3BY9A 2ZBBA 1H8MA 3KYQA 3NOPC 2VX8A 3VV4A 4HH3A 5K5BA 2Y8HA 3IBJA 3KO6A 4DJ2A 1DP9A 3CWFA 3F1OB 4H6JB 4BJPA 3PBTA 4G3VA 2EWWA 5DJUA 3UB8A 5IS1A 2EA9A 2QKPA 4UQIS 2HJ9C 2V1AA 2YKFA 3BQ8A 5HSQA 1N9LA 1BYWA 2HGVA 2K2NA 1P9RA 4L9FA 4CLCD 2EWVA 2JKRM 4BWIA 4L9GA 4ZRRA 3F1NA 3R7WB 2XRNA 4HP4A 2M7VA 3EOIA 4HP9A 2XA7S 4KUKA 3OOVA 5AVEA 3VE3A 5HPIA 4ETXA 5J3WA 1X0OA 3PBNA 3OCLA 5HDCA 1VB6A 5FL3A 1UWPX 2VZWA 2M7UA 4BBTA 4AFIA 1S66L 2YKHA 2VV7A 1TS6A 5HZHA 1OT6A 1YAXA 4OOMA 4Q0IA 4JGQA 2G7UA 4Y5FA 2W3GA 4IJGA 2CMNA 1DP8A 3MR0A 2P04A 2VLGA 3IBRA 4LRZE 3H7WB 1XFNA 1XJ6A 2GX5A 2PT7A 2ZMVA 3LI8A 5DF9A 4EQ1A 1XFQA 4HQAA 4Q0JA 2I9VA 2D01A 3B42A 3LR3A 3UE6A 2OWHA 3EQVA 2PDRA 4LRYC 5KSHA 3VOLA 1S67L 4Q0HA 2KOIA 3ZYTA 4EU0A 3BY8A 5J4EA 4JGPA 1LSXA 3JVUA 1XJ4A 4O0PA 4EW7A 3OBFA 4WELA 2V0UA 4GS9B 3LIAA 3B47A 3CUEA 2O9CA 4Z1WA 2W27A 2NUPC 3NHQA 1G6OA 2A24B 3PHYA 2PD8A 3E98A 1DRMA 2NUTC 3S7QA 3S7PA 3PBOA 1OTDA 3LIFA 4WEKA 5KIZA 1T1BA 4GW9A 4R70A 4HJ4A 1N9OA 3MQOA 3MXQA 1OTIA 3EEAA 4HHDA 1LSWA 4UEYA 4PAUA 3K2NA 2BASA 4Y2FA 1NRJA 1T18A 4P6ZS 1Y28A 4UQIM 4XT2A 3H82B 1YKDA 3UMDA 2VV6A 5HD3A 2V0WA 3W2ZA 4MDZA 4EESA 1LL8A 2VV8A 3KSIA 2PHYA 4I3AA 2PYRA 1F98A 4I38A 3KX0X 3OC2A 1OJ5A 4LPZA 4FSFA 4GHIA 4HIAA 1V9ZA 3MFXA 3LR5A 4WEJA 2W3FA 2XA7M 1V9YA 3NJAA 4BMWA 1S1YA 3SW1A 2FZ0A 5F6AA 3ZQ5A 4EERA 4NEED 2VGLS 4I3JA 5TJJA 4NKPA 1XJ3A 4G3WA 5EFWA 4NXBA 3RFBA 1P97A 1GSXA 1STZA 5C5KA 2O99A 1OTBA 3HJIA 2VKSA 4MCWA 1G28A 2PR6A 1P9WA 3PBSA 1OTEA 3KSFA 4DMZA 4FOFA 3PBQA 3BWLA 2INWA 1EW0A 4EEPA 2HF6A 4ARZB 3ICYA 3MQ0A 3D3OA 2ZOHA 1W63M 3F1PB 3T4OA 4PHTA 4PKYG 3V67A 4CLCB 1TF1A 4MN5A 5HDDA 4CLCC 3F1OA 4H6JA 4F3LB 3IS2B 3FG8A 4IUKA 2JKTI 1T1CA 4YWZA 1T19A 2OAQ1 3B33A 3TRCA 2O0YA 2W1TB 3TJZC 5A8BA 4I3IA 4WLAA 3UMEA 5CX7A 4ME4A 5I5LA 3LIDA 1VHMA 1YSPA 3MQQA 5G4ZA 4HI4A 3R7WA 4CQHA 3G6OA 3T4LA 2Z6CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JGO A;  5DJT A;  2QWS A;  2L0W A;  3LYX A;  3OLO A;  5HDS A;  5HWT A;  4KUO A;  3UB6 A;  1WA9 A;  3K3C A;  4KQD A;  5HWW A;  3RTY A;  4NXG A;  3A0R A;  3E4O A;  3CAX A;  5TBM B;  5IU1 A;  2Z6D A;  4MN6 A;  2L1M A;  3EWK A;  4L9E A;  5HD5 A;  3H7W A;  3T50 A;  2OOL A;  4WN5 A;  3C8C A;  5DKK A;  4R3A A;  4PKY A;  4DJ3 A;  3E4P A;  5J7E A;  4HOI A;  2OWJ A;  2WKP A;  1NWZ A;  4EXO A;  3UB7 A;  3E4Q A;  1GSW A;  2HV1 A;  4HJ6 A;  1S1Z A;  3A0S A;  2W0N A;  2D02 A;  5G4Y A;  4GS9 A;  4EET B;  1XJ2 A;  3FC7 A;  2JHE A;  1KOU A;  1OTA A;  3CLO A;  3GDI A;  4HNB A;  1UWN X;  2PD7 A;  2A24 A;  3F1N B;  3LUQ A;  4WUJ A;  2KDK A;  2QJ5 A;  1UGU A;  2WKQ A;  1N9N A;  3NOT C;  2PR5 A;  2JN7 A;  4BBU A;  2VEA A;  3H82 A;  1LT0 A;  5HWV A;  3HJK A;  1LSV A;  2L4R A;  2M1C A;  3LIB A;  2R78 A;  2V1B A;  4E04 A;  1TS7 A;  3K3D A;  2ZOI A;  4NXE A;  5AVF A;  1F9I A;  3VE4 A;  4B9O A;  4LLO B;  4HH2 A;  4HJ3 A;  3A0V A;  2QJ7 A;  3MJQ A;  3H9W A;  2B02 A;  2WKR A;  3F1P A;  4WL9 A;  5DKL A;  3RH8 B;  3PYP A;  4EEU A;  2GJ3 A;  1GSV A;  4F3L A;  3IS2 A;  3NOU C;  1ODV A;  3D72 A;  4GCZ A;  2J80 A;  2KX6 A;  4K08 A;  4WF0 A;  1D06 A;  3GEC A;  3ULF A;  4XT2 B;  3LIE A;  1JNU A;  1TS0 A;  4RQ9 A;  4NXF A;  1MZU A;  4I39 A;  1DP6 A;  5F69 A;  2QHK A;  4M4X A;  1P0Z A;  5F68 A;  2P7J A;  2V9A A;  4GHI B;  1OT9 A;  1S4R A;  2PYP A;  3UB9 A;  2H28 A;  1S4S A;  3LIC A;  4LRX C;  1T1A A;  4R6L A;  3P7N A;  5F5Y A;  4I5S A;  1D7E A;  5TBM A;  4JGR A;  4BBV A;  4R38 A;  3EEH A;  3LI9 A;  2K7S A;  3C2W A;  1TS8 A;  4HY8 A;  1OJG A;  3BY9 A;  2ZBB A;  3NOP C;  4HH3 A;  4DJ2 A;  1DP9 A;  3CWF A;  3F1O B;  4H6J B;  5DJU A;  3UB8 A;  5IS1 A;  2EA9 A;  2QKP A;  2V1A A;  2YKF A;  5HSQ A;  1N9L A;  1BYW A;  4L9F A;  4L9G A;  3F1N A;  4HP4 A;  4HP9 A;  4KUK A;  5AVE A;  3VE3 A;  5J3W A;  1X0O A;  5HDC A;  1VB6 A;  4BBT A;  1UWP X;  1S66 L;  2YKH A;  2VV7 A;  1TS6 A;  5HZH A;  1OT6 A;  4JGQ A;  2CMN A;  1DP8 A;  3MR0 A;  2VLG A;  3IBR A;  4LRZ E;  3H7W B;  1XFN A;  1XJ6 A;  3LI8 A;  4EQ1 A;  1XFQ A;  4HQA A;  2I9V A;  2D01 A;  3UE6 A;  2OWH A;  4LRY C;  2PDR A;  3VOL A;  1S67 L;  3BY8 A;  5J4E A;  4JGP A;  1LSX A;  1XJ4 A;  4EW7 A;  2V0U A;  4GS9 B;  3LIA A;  2W27 A;  3NHQ A;  2A24 B;  3PHY A;  2PD8 A;  1DRM A;  1OTD A;  3LIF A;  5KIZ A;  1T1B A;  4GW9 A;  4R70 A;  4HJ4 A;  1N9O A;  3MQO A;  3MXQ A;  1OTI A;  4HHD A;  1LSW A;  2BAS A;  1T18 A;  1Y28 A;  4XT2 A;  3H82 B;  3UMD A;  2VV6 A;  5HD3 A;  2V0W A;  4EES A;  1LL8 A;  2VV8 A;  2PHY A;  4I3A A;  2PYR A;  1F98 A;  4I38 A;  3KX0 X;  1OJ5 A;  4LPZ A;  4GHI A;  4HIA A;  1V9Z A;  3MFX A;  1V9Y A;  3NJA A;  1S1Y A;  3SW1 A;  5F6A A;  3ZQ5 A;  4EER A;  4I3J A;  1XJ3 A;  5EFW A;  4NXB A;  1P97 A;  1GSX A;  1OTB A;  3HJI A;  1G28 A;  2PR6 A;  1OTE A;  3BWL A;  2INW A;  1EW0 A;  4EEP A;  3ICY A;  2ZOH A;  3F1P B;  4PKY G;  4MN5 A;  5HDD A;  3F1O A;  4H6J A;  4F3L B;  3IS2 B;  3FG8 A;  1T1C A;  4YWZ A;  1T19 A;  3B33 A;  5A8B A;  4I3I A;  4WLA A;  3UME A;  5I5L A;  3LID A;  3MQQ A;  5G4Z A;  4HI4 A;  3G6O A;  2Z6C A; 
#chains in the Genus database with same CATH topology
 2Y91 A;  4O8G A;  5EUA A;  2O9B A;  5HWT A;  1XA7 A;  3ZNY A;  4KUO A;  3PR6 A;  4BEN A;  1WA9 A;  3K3C A;  3ZFZ A;  5M19 A;  4G3K A;  3PXP A;  3CAX A;  4LFU A;  5IU1 A;  3Q7Z A;  4BD1 A;  4MN6 A;  2Z2M B;  4L9E A;  3H7W A;  3T1Q B;  2OOL A;  1YMS A;  4N1H A;  2WGW A;  1S0W A;  5J7E A;  3ITB A;  3RJU A;  1MC0 A;  2OWJ A;  4PMA A;  4EXO A;  1IFQ A;  3UB7 A;  1BLP A;  1VEU B;  3M2J A;  4BL2 A;  2Q9N A;  3L7H A;  4HJ6 A;  4JPM A;  2FH5 A;  2EX2 A;  2D02 A;  2W3E A;  4RX2 A;  2B18 A;  4NK3 A;  3KSG A;  1PZP A;  3SH8 A;  3GDI A;  3T12 B;  3IH8 A;  4C3Q A;  5FI2 A;  3GSG A;  2PD7 A;  2Q9M A;  2A24 A;  3C38 A;  3HRE A;  2KDK A;  4KQQ A;  4FD8 A;  1UGU A;  1I2S A;  2WKQ A;  3OPH A;  2RCX A;  1FR1 A;  2ZQC A;  3UDI A;  3O88 A;  2VEA A;  1IEM A;  1LT0 A;  3AGE A;  3M6H A;  4GNU A;  2EX9 A;  2L4R A;  3Q07 A;  4IVI A;  4JF5 A;  3LFV A;  3MF0 A;  3Q7V B;  3K3D A;  2Y2K A;  2ZOI A;  2XD1 A;  5AVF A;  5M1A A;  3T4T A;  4QY6 A;  4KZA A;  1F9I A;  4KG2 A;  4EQI A;  4LV2 A;  2W1R A;  2OV5 A;  4R23 A;  4BLM A;  3T1S A;  2A49 A;  2QJ7 A;  2KLI A;  3FYZ A;  3O5Y A;  3NIA A;  3SS3 A;  1O7E A;  2Y79 A;  4F94 A;  2WKR A;  5EVI B;  4LGW A;  4WMC D;  2WAF A;  5DKL A;  4QWO A;  3LEQ A;  3RH8 B;  4OLG A;  2HPB A;  4II7 A;  1GSV A;  1HZO A;  3D72 A;  4GCZ A;  5F82 A;  1ZHH B;  1BZA A;  4E3J A;  1XGJ A;  1PNE A;  1PRQ A;  3T4Q A;  1NYY A;  2J3T C;  1TS0 A;  1MZU A;  2QYB A;  3O86 A;  4I39 A;  3ZDJ A;  2VGJ A;  1H3Q A;  3EQU A;  3IWI A;  3NUL A;  3UE1 A;  4OQG A;  1PW8 A;  5F68 A;  3WRZ A;  1OT9 A;  2JBF A;  2ZMF A;  2H28 A;  3GR2 A;  2PRF A;  3IXB A;  1S4S A;  3LIC A;  1PWG A;  1OPX A;  2HDQ A;  2XSS A;  4LRX C;  3S7O A;  1LL5 A;  4JF6 A;  4R6L A;  5F5Y A;  4I5S A;  1D7E A;  3FKV A;  5TBM A;  2XLN A;  2PU4 A;  2W3D A;  4BBV A;  4QJG A;  4HEF A;  1KE0 A;  2K7S A;  2ZQ7 A;  4MN7 A;  3ZG7 B;  3FZC A;  2I72 A;  2MJ6 A;  2WGV A;  2EX8 A;  3MKF A;  4X53 A;  2JC7 A;  3IBJ A;  3VSK A;  3OPL A;  3N4I A;  4P6B A;  2V20 A;  2J7V A;  4BJP A;  1I5Q A;  3HVF A;  5AQA A;  2QKP A;  2V1A A;  4FH2 A;  2YKF A;  3G2Y A;  1K55 C;  5EOE A;  3DWK A;  1ZC2 A;  3OPP A;  3TSG A;  4ZRR A;  3F1N A;  2XRN A;  2M7V A;  3IWO A;  1NRF A;  1E3U A;  1CJF A;  4S2P A;  4GDN A;  4K91 A;  4KUK A;  3OOV A;  1AWI A;  5J3W A;  2X71 A;  2YKH A;  2XQZ A;  2Y4A A;  5DF8 A;  1W5D A;  1YT4 A;  4LCM A;  1YAX A;  1Y4O A;  1K6R A;  4OP5 A;  2G7U A;  4Y5F A;  4Q8I A;  1DJB A;  4EBL A;  1VQQ A;  2E8J A;  1E4D A;  5FEG A;  3MR0 A;  4LV3 A;  3IBR A;  1XFN A;  1TDG A;  2ZMV A;  5DF9 A;  4DF6 A;  1XFQ A;  3EQV A;  1OME A;  3HLD A;  1S67 L;  1ONH A;  2KOI A;  2ZC6 B;  1CI9 A;  3BY8 A;  3A3I A;  4PM8 A;  5EM0 A;  4E6X A;  4E3K A;  1MWS A;  3G32 A;  3OBF A;  1ZG6 A;  5E2G A;  1JVJ A;  2P74 A;  4Z1W A;  2W27 A;  4GZB A;  4ZAM A;  1XP4 A;  1HLU P;  1DRM A;  3S7Q A;  2WAD A;  3UO9 A;  3T1R A;  1OTD A;  3LIF A;  5KZH A;  3PTE A;  1SKO A;  4R70 A;  3MQO A;  1PIO A;  3MXQ A;  1OTI A;  1LSW A;  4OQ0 A;  4KEN B;  4P6Z S;  4XT2 A;  1YKD A;  3SH7 A;  4EES A;  1W7F A;  4MDZ A;  1WYB A;  2PYR A;  1K54 C;  5EOO A;  3OC2 A;  4LPZ A;  4FSF A;  5CEB A;  3MFX A;  3LR5 A;  2W3F A;  4S2J A;  4BMW A;  3BFC A;  4Y7P A;  4I3J A;  5EFW A;  1K38 A;  1ESU A;  1GSX A;  2O99 A;  4MCW A;  3HJI A;  1SKF A;  4FTX A;  4KZ9 A;  3PBQ A;  5TFQ A;  1EW0 A;  3LO7 A;  4ARZ B;  4Z9Q A;  3MQ0 A;  3N7W A;  4QHC A;  2DCF A;  5FEF A;  2FFF B;  2ZLY A;  4HBT A;  5EM1 A;  3OZH A;  3T4O A;  4PHT A;  4PKY G;  2CC1 A;  2WZZ A;  4CLC B;  5HDD A;  4IUK A;  1ES2 A;  1T19 A;  1FR6 A;  3TRC A;  2W1T B;  5EVI D;  2Y2L A;  3OPR A;  5CX7 A;  4NG2 A;  3LID A;  4KZ3 A;  4KZ4 A;  1YSP A;  1PWC A;  3UPP A;  4CQH A;  4HI4 A;  3T4L A;  3VP1 A;  4NET A;  4HES A;  3CI6 A;  2QWS A;  4E3M A;  2L0W A;  3LYX A;  5HDS A;  4BD0 A;  4KG5 A;  1YLZ A;  1DY6 A;  3SS5 A;  3DW0 A;  3FV7 A;  4PM9 A;  5FAQ A;  3TE8 A;  3R4K A;  1BLH A;  3U4L P;  4L0L A;  2Z6D A;  4P6Z M;  2XK1 A;  1HD8 A;  4OPY A;  3EWK A;  4ZDX A;  1XXM A;  1GA9 A;  3SZT A;  4EBP A;  4XXR A;  3C8C A;  5DKK A;  4B93 A;  1KE3 A;  1BUL A;  5MC7 A;  1IOU A;  3IF6 A;  1NWZ A;  1VET B;  3IXH A;  5DFY A;  3B3X A;  3V5M A;  3MSH A;  2G2W A;  3DTK A;  3G35 A;  4DN0 A;  4WMC A;  3E4Q A;  1U60 A;  4C75 A;  2BG1 A;  1IKG A;  3QP5 A;  2Y2H A;  3FC7 A;  4FCF A;  4DXB A;  2JHE A;  4EUZ A;  1ONG A;  4B4Z A;  1HVB A;  1F5M A;  4BQM A;  1UWN X;  4DE3 A;  4O7D A;  1YLP A;  3LUQ A;  4WZ5 A;  5DTS A;  3MBZ A;  3JYI A;  3OCN A;  1N9N A;  4EUV A;  3NOT C;  4PM5 A;  2PR5 A;  2JN7 A;  3CMZ A;  3Q1F A;  3BQA A;  2J3W A;  3P09 A;  5HWV A;  3HJK A;  4MEZ A;  3JVV A;  4DKI A;  4X68 A;  1YSQ A;  5HPF A;  2C6W B;  4OP8 A;  1TS7 A;  1S6R A;  3IT9 A;  2XD5 A;  2X02 A;  3VE4 A;  1A0K A;  3E2K A;  2EFU A;  4OPQ A;  1ZKJ A;  3BYD A;  2WZX A;  4U0T A;  3MKE A;  1M40 A;  4LLO B;  3PAE A;  5A93 A;  3U2A A;  3LCE A;  2JKR I;  4HJ3 A;  1FCN A;  5E2F A;  4YIN A;  3A0V A;  2A2L A;  1BLS A;  2B02 A;  1SDE A;  3F1P A;  4ID4 A;  2GJ3 A;  4GLQ A;  2ZD8 A;  5EVL A;  4F3L A;  3S7N A;  3TW8 A;  4MMN A;  1CF0 A;  2XH9 A;  2Y2N A;  1L2S A;  1PZO A;  1ODV A;  4S2N A;  2KX6 A;  5L09 A;  3GEC A;  3ZG8 B;  4ETZ A;  3T4K A;  3C30 A;  3LIE A;  1JNU A;  1JWP A;  1ES5 A;  4OQI A;  1VM1 A;  1CI8 A;  5LBR A;  1DP6 A;  5F69 A;  2QHK A;  3E0Y A;  4M4X A;  1KGF A;  2GNX A;  4GHI B;  5L8M A;  5JYP A;  3WS5 A;  2VGL M;  1RCJ A;  1EWZ A;  1W79 A;  3BEC A;  2Y2P A;  3BLS A;  3UB5 P;  1NJ4 A;  4UA9 A;  1IYS A;  5I94 A;  2ZJ9 A;  2PBD P;  5HL1 A;  5AQ7 A;  3C2W A;  4WM9 A;  1OJG A;  4JBF A;  4YNR A;  3KYQ A;  4GKU A;  4QU3 A;  1J3W A;  1PW1 A;  3S4X A;  4HH3 A;  1VEU A;  3G2Z A;  1DP9 A;  4DJ2 A;  3F1O B;  3NBL A;  4H6J B;  2ZC4 B;  3NDE A;  4G3V A;  4KZB A;  2EWW A;  2EA9 A;  4UQI S;  3MZF A;  2K2N A;  4CLC D;  4L9F A;  2EWV A;  2Y2J A;  3QP4 A;  4KQR A;  4U0X A;  3R7W B;  4HP4 A;  2V2F F;  5CER A;  1LI0 A;  5CHJ A;  4HP9 A;  4D60 A;  3N8L A;  3VE3 A;  5A90 A;  1JTG A;  1LHY A;  4GB7 A;  3A3D A;  1WYC A;  3PBN A;  3OCL A;  1UWP X;  2A3U A;  1TS6 A;  4GN2 A;  5FQQ A;  2B5R A;  2W3G A;  3VP0 A;  5CED A;  2ZM0 A;  1K55 A;  5KMW A;  3UPO A;  2P04 A;  4LRZ E;  2Y2M A;  3MXS A;  4ZBE A;  2GX5 A;  1RGZ A;  1RP5 A;  3Q7V A;  4OQH A;  4HQA A;  1CK3 A;  4ZJ3 A;  5D3O A;  3LR3 A;  3B42 A;  3N6I A;  4XUZ A;  3C7U A;  5E2H A;  2OWH A;  4LRY C;  3IX8 A;  2HDR A;  5CEC A;  3GRJ A;  1PI5 A;  3CPT B;  5HW3 A;  2HP5 A;  5J4E A;  3JVU A;  2XFS A;  4EW7 A;  3HUN A;  4GD8 A;  2P9V B;  3WWX A;  1IYQ A;  4JXW A;  3ZG9 B;  4GS9 B;  2XF3 A;  3B47 A;  3CUE A;  4X69 A;  4YFM A;  3DTM A;  2O9C A;  5EVI A;  3NHQ A;  4OKP A;  1G6O A;  3IQA A;  1GA0 A;  2NUT C;  3S7P A;  1G5U A;  3PBO A;  5KIZ A;  1T1B A;  4P87 A;  1H8Y A;  4HJ4 A;  2ZQA A;  5CGX A;  5CGW A;  1NY0 A;  1YLT A;  3DTE A;  4PAU A;  4S2O A;  1MWT A;  4UQI M;  3H82 B;  1QMF A;  1AXB A;  2OLV A;  3S22 A;  1XX2 A;  2PHY A;  4I3A A;  3AGD A;  1Z6F A;  4DDS A;  5EE8 A;  3VFF A;  1C3B A;  3SW1 A;  5FQJ A;  3D4F A;  1Z09 A;  5FI7 A;  1F2K A;  4NKP A;  4G3W A;  2ZC5 B;  1P97 A;  1DJC A;  3HUO A;  1OTB A;  3ZG0 A;  3HLB A;  3KSF A;  1YLW A;  1JWV A;  5GLA A;  1K57 A;  3NI9 A;  4EEP A;  2HF6 A;  3ICY A;  1W63 M;  2XFT A;  1KE4 A;  4MN5 A;  3IS2 B;  2JKT I;  5FQK A;  1D1J A;  1IYO A;  2H0Y A;  3B33 A;  3HLF A;  3SH9 A;  4E3N A;  2O0Y A;  3WS4 A;  3TJZ C;  4WLA A;  3VP4 A;  4JXG A;  2ZL1 B;  3UME A;  3Q82 A;  3G6O A;  2Z6C A;  2V1Z A;  5FSR A;  5DJT A;  3WS0 A;  1NZU A;  3IX3 A;  4K0W A;  2ZMA A;  3UB6 A;  4JF4 A;  3DTI A;  2J3T D;  5HWW A;  2LB5 A;  4NXG A;  4K0X A;  3A0R A;  3C7V A;  4B88 A;  5GHZ A;  5E43 A;  3CHW P;  5HAI A;  4R4R A;  1ZG4 A;  1ERM A;  1K56 D;  3BJN A;  2L1M A;  3VSL A;  3JPU A;  4WN5 A;  5FAO A;  1N4O A;  3W4P A;  3NCK A;  4N92 A;  4S2M A;  3E4P A;  3FPV A;  5IT5 A;  5FAP A;  2WKP A;  2V8C A;  3BFF A;  2Y59 A;  1O07 A;  2HV1 A;  4PM7 A;  1S1Z A;  2WK0 A;  4YOF A;  1LL9 A;  5G4Y A;  4EET B;  3SOI A;  1YLY A;  4XUX A;  1SCW A;  2Y2Q A;  1KOU A;  2WKE A;  4ZJ2 A;  3IX4 A;  4KQO A;  5GLB A;  4P85 A;  3CLO A;  3BW6 A;  3ZVT A;  4HNB A;  2WKH A;  1GHM A;  4RYE A;  4WUJ A;  1YQS A;  1XKZ A;  2QJ5 A;  1L0E A;  3GQZ A;  3VP2 A;  4R1G A;  2JKF A;  2ZM8 A;  4GJ4 A;  4KZ8 A;  2K31 A;  3UN7 A;  1NLZ A;  5AJG A;  1BSG A;  2BLS A;  3CIT A;  1LSV A;  4OVD A;  5L2F A;  3SS4 A;  3LY3 A;  1ERQ A;  1LLB A;  4MBK A;  3LIB A;  2R78 A;  5DTT A;  4E04 A;  4NXE A;  3P01 A;  1MPL A;  1NLY A;  3PBR A;  3HL9 A;  4B9O A;  4WZ4 A;  2OAP 1;  4HH2 A;  5DFX A;  1W8Q A;  4U3T A;  3FPW A;  2UV0 E;  3A3F A;  3IF5 A;  3UNW A;  4ARZ A;  2HJE A;  4C6Y A;  4PM6 A;  1JTD A;  2J9O A;  5HAQ A;  2AVX A;  2V8F A;  3NEC A;  4WL9 A;  1K0K A;  5GLD A;  3PYP A;  4EEU A;  4CLC A;  3L9K A;  3I7J A;  4Y13 A;  3WRT A;  4K08 A;  4WF0 A;  2W1T A;  4X1L A;  1D06 A;  1ERO A;  4X25 A;  3MXR A;  4Y15 A;  2VJW A;  3BFE A;  3ULF A;  1FSY A;  4GOG A;  4M3K A;  5FA7 A;  3IXD A;  4S2L A;  4GD6 A;  4RQ9 A;  4NXF A;  3T4S A;  4UA6 A;  3CZD A;  2P7J A;  4KZ6 A;  2V9A A;  1FCM A;  2G2U A;  2ACG A;  2PYP A;  3UB9 A;  4R0Q A;  4EBN A;  3UDF A;  2VA0 A;  5HL6 A;  5L07 A;  4UA7 A;  3MZE A;  2DMW A;  3P7N A;  2P08 A;  3BEB A;  3FWL A;  4OH0 A;  3MMH A;  4OOL A;  4JKT A;  5CHM A;  4RVA A;  3BRM A;  4IHQ A;  1L0D A;  4R38 A;  3IH9 A;  1I2W A;  3VFH A;  1TS8 A;  3BY9 A;  2ZBB A;  3S1Y A;  1VET A;  3NOP C;  2VX8 A;  2Y8H A;  3HLW A;  3KO6 A;  1PFL A;  4ESP A;  4X6T A;  3PBT A;  5DJU A;  2HDS A;  3UB8 A;  5IS1 A;  1KGG A;  5A92 A;  1IKI A;  1BYW A;  1N9L A;  1P9R A;  2JKR M;  4MBH A;  4OOY A;  2H5S A;  5FQI A;  2IWD A;  3M2K A;  3MZD A;  3EOI A;  1NZO A;  2JE5 A;  1TDL A;  4N9L A;  1L0F A;  2XA7 S;  3DWZ A;  5M18 A;  1BLC A;  1QME A;  5AVE A;  1FCO A;  1KDS A;  4ETX A;  3A3E A;  4PPR A;  1ACF A;  2E8I A;  1PYY A;  4AFI A;  2PU2 A;  5HZH A;  3BFG A;  3QHY A;  1MKI A;  4Q0I A;  3QP8 A;  5DVA A;  3Q81 A;  3HLE A;  1DP8 A;  3V39 A;  2VLG A;  3H7W B;  1SDN A;  2PT7 A;  3ZVW A;  3LI8 A;  4EQ1 A;  2WGW B;  2I9V A;  1DJA A;  1FQG A;  4JLF A;  3NDG A;  2PDR A;  3IF6 C;  3VOL A;  4Q0H A;  3IXG A;  3C4O A;  1SHV A;  1K4E A;  5EPH A;  1LSX A;  1XJ4 A;  4O0P A;  3RXW A;  1H8Z A;  3GTC A;  4WEL A;  4JXV A;  3RXX A;  4CPK A;  1NXY A;  2NUP C;  4IVK A;  4X1M A;  3ZCZ A;  2EFX A;  2A24 B;  3PHY A;  4S2K A;  4ZTK A;  4WZ5 C;  4IBR A;  4HBU A;  4UEY A;  2BAS A;  1NRJ A;  1T18 A;  5TGF A;  2PAV P;  1Y28 A;  2VK3 A;  1M6K A;  5HD3 A;  4KG6 A;  3O87 A;  3W2Z A;  1LL8 A;  2VV8 A;  2Z2L B;  4Y0U A;  4GDB A;  4LEN A;  3KX0 X;  4IED A;  2QZ6 A;  1K56 A;  4GHI A;  4EV4 A;  4HIA A;  4E3L A;  1V9Z A;  2OLU A;  1GHP A;  4WEJ A;  2XA7 M;  1V9Y A;  3QNC A;  2FZ0 A;  4OPZ A;  5F6A A;  5L10 A;  1XJ3 A;  4NXB A;  5C5K A;  3VP3 A;  4P0M A;  1ES4 A;  2VKS A;  2HZ5 A;  2PR6 A;  1L3L A;  5CXW A;  1ALQ A;  1OTE A;  5GHX A;  4DMZ A;  3BWL A;  3UE0 A;  1MXO A;  4IBX A;  1TVF A;  2WYX A;  4UHU A;  3CG5 A;  4R3J A;  3V50 A;  3W4Q A;  3V67 A;  2GDN A;  1TF1 A;  3F1O A;  4H6J A;  3FG8 A;  3GVB A;  2DRW A;  1CEF A;  5GLC A;  2IWC A;  2OAQ 1;  1EI5 A;  4S2N C;  5A8B A;  3TOI A;  4I3I A;  5FI6 A;  1GHI A;  4LCL A;  3R7W A;  4N1X A;  4OLD A;  5G4Z A;  4BL3 A;  3QP2 A;  4JGO A;  3V3R A;  3OLO A;  1K4F A;  3P98 A;  3EGX C;  4IUH A;  2O9A A;  3TG9 A;  5GHY A;  3LY4 A;  4KQD A;  4MLL A;  2LB9 A;  3RTY A;  1LI9 A;  2WAE A;  1L0G A;  3E4O A;  3A3J A;  2IA2 A;  2Y2I A;  5TBM B;  3QP1 A;  4QPR A;  5HD5 A;  3G30 A;  3DAV A;  3FKW A;  5CRF A;  1TD5 A;  3W8K A;  5A91 A;  3T50 A;  3UE3 A;  3V3S A;  5U47 A;  4R3A A;  4PKY A;  4DJ3 A;  1YPR A;  5E2E A;  5AQ9 A;  3KSH A;  4HOI A;  3MFD A;  5F1G A;  1FIL A;  2ZQ8 A;  3NY4 A;  3CPT A;  4WYY A;  3T1X A;  1GSW A;  3VOZ A;  2H10 A;  3A0S A;  1MBL A;  2P9V A;  2W0N A;  3IHB A;  1H5X A;  4GS9 A;  1XJ2 A;  1W63 Q;  1OTA A;  4Y3I A;  1PI4 A;  1MWR A;  3BFD A;  3BM6 A;  2Q0O A;  1E25 A;  3T4J A;  3CJM A;  1ZTU A;  5CTN A;  3F1N B;  3KYZ A;  2FFY A;  3E2L A;  4Y0O A;  1Q2P A;  2C5W B;  4A5R A;  4BBU A;  2XGN A;  4FH4 A;  1FOF A;  2H0T A;  2JKT M;  3ZHH A;  4QY5 A;  3H82 A;  2Y55 A;  5HX9 A;  2EX6 A;  4O01 A;  3WS2 A;  1K54 A;  2XRO A;  1KVM A;  2X01 A;  4DE0 A;  2M1C A;  2V1B A;  1MKM A;  2RL3 A;  1KVL A;  2GZA A;  5BOH A;  1BTL A;  4RX3 A;  3QP6 A;  3G4P A;  4R4S A;  5F83 A;  3LR0 A;  3ISG A;  1G68 A;  4MNR A;  3MJQ A;  5FQM A;  3C5A A;  1YM1 A;  3CUE C;  4CLC E;  3PAG A;  3VOY A;  3H9W A;  5F1F A;  5EVI C;  1YLJ A;  3N8S A;  4DE1 A;  3IS2 A;  3D9Y A;  2Y2O A;  2BTF P;  2W3H A;  3NOU C;  4OPR A;  4B4X A;  1SKO B;  2J80 A;  2ZC3 B;  5JYO A;  3DBA A;  2ZL1 A;  3ITA A;  1KGE A;  4Y0T A;  4XT2 B;  2ZC7 A;  1IYP A;  3LR4 A;  4E6W A;  3O3V A;  5DF7 A;  3GV9 A;  4DDY A;  1P0Z A;  1S4R A;  5FDH A;  5FAS A;  4LV0 A;  5G18 A;  1T1A A;  2HP9 A;  4QD4 A;  1IEL A;  3EGD C;  1TEM A;  1W8Y A;  2XR0 A;  2J9P A;  4N9K A;  4JGR A;  2Y2G A;  1MWU A;  3EEH A;  3LI9 A;  4ZJ1 A;  1PWD A;  1K57 C;  4HY8 A;  2DNS A;  3HCY A;  4R3B A;  2XDM A;  1H8M A;  2JCH A;  2ZQD A;  3VV4 A;  5K5B A;  2EXA A;  4S2I A;  2HDU A;  3CWF A;  1K6S A;  1KDW A;  1FIK A;  1N9B A;  3VMA A;  3IWQ A;  2HJ9 C;  3KYE A;  3BQ8 A;  5HSQ A;  2HGV A;  2UWX A;  5CHU A;  4BWI A;  2R9X A;  4L9G A;  5EV0 A;  3UDX A;  1XPB A;  3ZNT A;  5CTM A;  4OON A;  1CEG A;  2ZQ9 A;  1WE4 A;  1K25 A;  3HUM A;  3QNB A;  2R9W A;  2JKG A;  2HP6 A;  5HPI A;  2WKI A;  3MS6 A;  4DE2 A;  4KZ7 A;  1X0O A;  3GMW A;  5HDC A;  1VB6 A;  5FL3 A;  2VZW A;  2IWB A;  2M7U A;  1XA1 A;  4BBT A;  1S66 L;  2VV7 A;  1J9M A;  1NYM A;  4X55 A;  1OT6 A;  4OOM A;  4JGQ A;  1G6A A;  4IJG A;  1HTZ A;  2CMN A;  3HLC A;  1CQA A;  5HFO A;  4E3I A;  1XJ6 A;  3UPN A;  3IHA A;  4Q0J A;  2OSU A;  4WBG A;  4UAA A;  2D01 A;  3LEZ A;  3UE6 A;  3IF6 B;  5KSH A;  4X56 A;  3ZYT A;  4EU0 A;  4LV1 A;  1JWZ A;  4JGP A;  3HLG A;  3BLM A;  2J8Y A;  5FQ9 A;  2V0U A;  4DRT A;  3LIA A;  3ZGA B;  2XEP A;  5TR7 A;  5AQB A;  3LGO A;  2PD8 A;  3E98 A;  4FUW A;  2EXB A;  4WEK A;  4GW9 A;  3HBR A;  1BUE A;  1N9O A;  3EEA A;  4HHD A;  3K2N A;  4Y2F A;  3W4O A;  4D2O A;  1Q2Q A;  1E3U D;  3UMD A;  2VV6 A;  3M6B A;  2V0W A;  3KSI A;  1ES3 A;  1H0M A;  1ESI A;  5CGS A;  1F98 A;  4I38 A;  4Y17 A;  3UY6 A;  4E3O A;  1OJ5 A;  2VGK A;  1XGI A;  3N8R A;  2QMI A;  4KZ5 A;  1SZV A;  3C4P A;  3AGF A;  5EVE A;  4DXC A;  4H8R A;  3NJA A;  1Y54 A;  5IHV A;  1S1Y A;  3ZQ5 A;  4EER A;  4NEE D;  4EWF A;  2VGL S;  5TJJ A;  5FDS A;  1BT5 A;  3RFB A;  1STZ A;  5EEC A;  1MY8 A;  1G28 A;  5HAP A;  1P9W A;  3PBS A;  4FOF A;  2ZM2 A;  2INW A;  4QB8 A;  1GCE A;  3G34 A;  3D3O A;  5KSC A;  2ZOH A;  1FSW A;  4CJN A;  3F1P B;  2QPN A;  3NC8 A;  3WS1 A;  2B95 A;  4CLC C;  4JXS A;  4F3L B;  2PBY A;  4RA7 A;  1T1C A;  4YWZ A;  4MBF A;  5J8X A;  2WGI A;  5FAT A;  2WUQ A;  3G31 A;  1RGY A;  3ZG5 A;  4ME4 A;  5I5L A;  1VHM A;  5GL9 A;  3MQQ A;  5HAR A;  1YMX A;  5DTK A; 
#chains in the Genus database with same CATH homology
 4JGO A;  3CI6 A;  2QWS A;  4O8G A;  5DJT A;  2L0W A;  3LYX A;  3OLO A;  5HDS A;  2O9B A;  5HWT A;  3EGX C;  4IUH A;  2O9A A;  4KUO A;  3PR6 A;  3UB6 A;  1WA9 A;  3K3C A;  2J3T D;  4KQD A;  5HWW A;  2LB5 A;  2LB9 A;  3PXP A;  4G3K A;  3RTY A;  3TE8 A;  4NXG A;  3R4K A;  3A0R A;  3E4O A;  2IA2 A;  4L0L A;  3CAX A;  5TBM B;  5IU1 A;  2Z6D A;  4P6Z M;  4MN6 A;  3BJN A;  4QPR A;  2L1M A;  3EWK A;  4L9E A;  5HD5 A;  1TD5 A;  3H7W A;  3T50 A;  3UE3 A;  2OOL A;  4WN5 A;  3C8C A;  5DKK A;  4B93 A;  4R3A A;  4PKY A;  4DJ3 A;  3E4P A;  3FPV A;  5J7E A;  5MC7 A;  1IOU A;  5IT5 A;  3KSH A;  4HOI A;  1MC0 A;  2OWJ A;  2WKP A;  1NWZ A;  4EXO A;  1IFQ A;  3UB7 A;  5DFY A;  4DN0 A;  3E4Q A;  1GSW A;  2HV1 A;  4HJ6 A;  2FH5 A;  1S1Z A;  3A0S A;  4YOF A;  2W0N A;  2D02 A;  5G4Y A;  4GS9 A;  4EET B;  2W3E A;  1XJ2 A;  1W63 Q;  3FC7 A;  2JHE A;  2B18 A;  1KOU A;  1OTA A;  3KSG A;  4Y3I A;  4KQO A;  3CLO A;  3GDI A;  3BW6 A;  1F5M A;  4HNB A;  1UWN X;  3T4J A;  2PD7 A;  1ZTU A;  2A24 A;  3F1N B;  3KYZ A;  3LUQ A;  4WUJ A;  3C38 A;  2KDK A;  2QJ5 A;  1UGU A;  3OCN A;  2WKQ A;  1N9N A;  4EUV A;  3NOT C;  4GJ4 A;  2PR5 A;  2JN7 A;  2K31 A;  4BBU A;  2JKT M;  2VEA A;  3BQA A;  1NLZ A;  2J3W A;  3H82 A;  1LT0 A;  5AJG A;  5HWV A;  3CIT A;  3HJK A;  3JVV A;  4O01 A;  1LSV A;  1YSQ A;  2XRO A;  5HPF A;  2L4R A;  2M1C A;  3LIB A;  3LFV A;  2R78 A;  2V1B A;  1MKM A;  4E04 A;  3MF0 A;  1TS7 A;  3K3D A;  2GZA A;  2ZOI A;  4NXE A;  5AVF A;  3T4T A;  3P01 A;  1NLY A;  1F9I A;  3VE4 A;  3PBR A;  2W1R A;  4B9O A;  4LLO B;  2OAP 1;  3U2A A;  4HH2 A;  5DFX A;  2JKR I;  3LR0 A;  4HJ3 A;  3A0V A;  3FPW A;  2QJ7 A;  2KLI A;  3O5Y A;  3MJQ A;  2A2L A;  4ARZ A;  2HJE A;  3CUE C;  4CLC E;  2Y79 A;  3H9W A;  2B02 A;  2WKR A;  3F1P A;  4WL9 A;  5DKL A;  3RH8 B;  3PYP A;  4EEU A;  4II7 A;  2GJ3 A;  1GSV A;  4CLC A;  4GLQ A;  4F3L A;  3IS2 A;  3S7N A;  3TW8 A;  4MMN A;  2W3H A;  3NOU C;  1ODV A;  3D72 A;  4GCZ A;  2J80 A;  2KX6 A;  4K08 A;  4WF0 A;  1ZHH B;  2W1T A;  1D06 A;  3GEC A;  3DBA A;  4ETZ A;  3T4K A;  2VJW A;  3ULF A;  4XT2 B;  3C30 A;  3T4Q A;  3LIE A;  2J3T C;  1JNU A;  1TS0 A;  3LR4 A;  4RQ9 A;  5LBR A;  4NXF A;  1MZU A;  2QYB A;  1DP6 A;  4I39 A;  5F69 A;  3T4S A;  2QHK A;  1H3Q A;  3E0Y A;  3EQU A;  4M4X A;  1P0Z A;  2GNX A;  2P7J A;  2V9A A;  4GHI B;  1OT9 A;  1S4R A;  2PYP A;  5F68 A;  5L8M A;  3UB9 A;  2ZMF A;  2H28 A;  1S4S A;  2VA0 A;  2VGL M;  5HL6 A;  3LIC A;  1OPX A;  2XSS A;  4LRX C;  3S7O A;  1T1A A;  2DMW A;  4R6L A;  3P7N A;  3EGD C;  4I5S A;  5F5Y A;  1D7E A;  2P08 A;  5TBM A;  3MMH A;  4OOL A;  4IHQ A;  2W3D A;  4JGR A;  4BBV A;  4R38 A;  3EEH A;  3LI9 A;  2K7S A;  4MN7 A;  3C2W A;  1TS8 A;  4HY8 A;  3HCY A;  1OJG A;  2MJ6 A;  4YNR A;  3BY9 A;  2ZBB A;  1H8M A;  3KYQ A;  3NOP C;  2VX8 A;  3VV4 A;  4HH3 A;  5K5B A;  2Y8H A;  3IBJ A;  3KO6 A;  4DJ2 A;  1DP9 A;  3CWF A;  3F1O B;  4H6J B;  4BJP A;  3PBT A;  4G3V A;  2EWW A;  5DJU A;  3UB8 A;  5IS1 A;  2EA9 A;  2QKP A;  4UQI S;  2HJ9 C;  2V1A A;  2YKF A;  3BQ8 A;  5HSQ A;  1N9L A;  1BYW A;  2HGV A;  2K2N A;  1P9R A;  4L9F A;  4CLC D;  2EWV A;  2JKR M;  4BWI A;  4L9G A;  4ZRR A;  3F1N A;  3R7W B;  2XRN A;  4HP4 A;  2M7V A;  3EOI A;  4HP9 A;  2XA7 S;  4KUK A;  3OOV A;  5AVE A;  3VE3 A;  5HPI A;  4ETX A;  5J3W A;  1X0O A;  3PBN A;  3OCL A;  5HDC A;  1VB6 A;  5FL3 A;  1UWP X;  2VZW A;  2M7U A;  4BBT A;  4AFI A;  1S66 L;  2YKH A;  2VV7 A;  1TS6 A;  5HZH A;  1OT6 A;  1YAX A;  4OOM A;  4Q0I A;  4JGQ A;  2G7U A;  4Y5F A;  2W3G A;  4IJG A;  2CMN A;  1DP8 A;  3MR0 A;  2P04 A;  2VLG A;  3IBR A;  4LRZ E;  3H7W B;  1XFN A;  1XJ6 A;  2GX5 A;  2PT7 A;  2ZMV A;  3LI8 A;  5DF9 A;  4EQ1 A;  1XFQ A;  4HQA A;  4Q0J A;  2I9V A;  2D01 A;  3B42 A;  3LR3 A;  3UE6 A;  2OWH A;  3EQV A;  2PDR A;  4LRY C;  5KSH A;  3VOL A;  1S67 L;  4Q0H A;  2KOI A;  3ZYT A;  4EU0 A;  3BY8 A;  5J4E A;  4JGP A;  1LSX A;  3JVU A;  1XJ4 A;  4O0P A;  4EW7 A;  3OBF A;  4WEL A;  2V0U A;  4GS9 B;  3LIA A;  3B47 A;  3CUE A;  2O9C A;  4Z1W A;  2W27 A;  2NUP C;  3NHQ A;  1G6O A;  2A24 B;  3PHY A;  2PD8 A;  3E98 A;  1DRM A;  2NUT C;  3S7Q A;  3S7P A;  3PBO A;  1OTD A;  3LIF A;  4WEK A;  5KIZ A;  1T1B A;  4GW9 A;  4R70 A;  4HJ4 A;  1N9O A;  3MQO A;  3MXQ A;  1OTI A;  3EEA A;  4HHD A;  1LSW A;  4UEY A;  4PAU A;  3K2N A;  2BAS A;  4Y2F A;  1NRJ A;  1T18 A;  4P6Z S;  1Y28 A;  4UQI M;  4XT2 A;  3H82 B;  1YKD A;  3UMD A;  2VV6 A;  5HD3 A;  2V0W A;  3W2Z A;  4MDZ A;  4EES A;  1LL8 A;  2VV8 A;  3KSI A;  2PHY A;  4I3A A;  2PYR A;  1F98 A;  4I38 A;  3KX0 X;  3OC2 A;  1OJ5 A;  4LPZ A;  4FSF A;  4GHI A;  4HIA A;  1V9Z A;  3MFX A;  3LR5 A;  4WEJ A;  2W3F A;  2XA7 M;  1V9Y A;  3NJA A;  4BMW A;  1S1Y A;  3SW1 A;  2FZ0 A;  5F6A A;  3ZQ5 A;  4EER A;  4NEE D;  2VGL S;  4I3J A;  5TJJ A;  4NKP A;  1XJ3 A;  4G3W A;  5EFW A;  4NXB A;  3RFB A;  1P97 A;  1GSX A;  1STZ A;  5C5K A;  2O99 A;  1OTB A;  3HJI A;  2VKS A;  4MCW A;  1G28 A;  2PR6 A;  1P9W A;  3PBS A;  1OTE A;  3KSF A;  4DMZ A;  4FOF A;  3PBQ A;  3BWL A;  2INW A;  1EW0 A;  4EEP A;  2HF6 A;  4ARZ B;  3ICY A;  3MQ0 A;  3D3O A;  2ZOH A;  1W63 M;  3F1P B;  3T4O A;  4PHT A;  4PKY G;  3V67 A;  4CLC B;  1TF1 A;  4MN5 A;  5HDD A;  4CLC C;  3F1O A;  4H6J A;  4F3L B;  3IS2 B;  3FG8 A;  4IUK A;  2JKT I;  1T1C A;  4YWZ A;  1T19 A;  2OAQ 1;  3B33 A;  3TRC A;  2O0Y A;  2W1T B;  3TJZ C;  5A8B A;  4I3I A;  4WLA A;  3UME A;  5CX7 A;  4ME4 A;  5I5L A;  3LID A;  1VHM A;  1YSP A;  3MQQ A;  5G4Z A;  4HI4 A;  3R7W A;  4CQH A;  3G6O A;  3T4L A;  2Z6C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...