5A8BA

Structure of a parallel dimer of the aureochrome 1a lov domain from phaeodactylum tricornutum
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
132
structure length
132
Chain Sequence
FSFIKALQTAQQNFVVTDPSLPDNPIVYASQGFLNLTGYSLDQILGRNCRFLQGPETDPKAVERIRKAIEQGNDMSVCLLNYRVDGTTFWNQFFIAALRDAGGNVTNFVGVQCKVSDQYAATVTKQQEEEEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PTAUREO1A LOV2 DOMAIN
publication title Structure of a Native-Like Aureochrome 1A Lov Domain Dimer from Phaeodactylum Tricornutum.
pubmed doi rcsb
source organism Phaeodactylum tricornutum
molecule tags Unknown function
total genus 41
structure length 132
sequence length 132
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 5a8bA00
2ZOHA 3UMEA 3OLOA 5J3WA 2QJ7A 4I5SA 4KUOA 1S4SA 2QJ5A 4I3IA 2D02A 3E4OA 4WLAA 2HV1A 4HOIA 1XJ6A 4EEPA 4WN5A 4HH2A 3F1OB 1OTBA 2GJ3A 2CMNA 2V1BA 3B33A 3K3CA 3UB7A 3IS2B 4XT2B 5DJTA 3F1NA 1JNUA 1OTDA 3P7NA 5J4EA 3E4QA 4EQ1A 2B02A 4EEUA 5F68A 3NJAA 3E4PA 2VV8A 3VOLA 4RQ9A 2ZBBA 3RH8B 2PD8A 2WKPA 3BY8A 1DP8A 4I39A 3SW1A 1V9ZA 5AVEA 2BASA 5I5LA 4I3JA 3FG8A 1OTIA 1T1AA 4HNBA 3MFXA 2JHEA 2L4RA 5HD5A 4R70A 1OT9A 3LIDA 4LLOB 1LSWA 1TS6A 4F3LB 4HQAA 3FC7A 4R3AA 1BYWA 3EEHA 2OWJA 1LT0A 2VLGA 2QWSA 3EWKA 2WKQA 2VEAA 3IBRA 3ICYA 2EA9A 3F1OA 2PR6A 4GS9B 3MR0A 3MJQA 1G28A 1T19A 1T18A 4EERA 2PR5A 1KOUA 4PKYG 1LSXA 1OTAA 3IS2A 5HWWA 4XT2A 5J7EA 5F69A 3UB8A 1LSVA 3F1PA 3H82B 4MN5A 1S1YA 4NXFA 5IS1A 1N9OA 1XJ3A 1T1CA 4LRXC 2YKHA 4LPZA 3GDIA 1S67L 1D7EA 2PHYA 3LUQA 4WL9A 5TBMB 4JGOA 2PDRA 3F1PB 2PYPA 3C2WA 2L1MA 4KUKA 1V9YA 5DKKA 5HDCA 1OJ5A 1TS7A 1DP6A 4EETB 2Z6DA 3PHYA 2KDKA 2WKRA 1GSWA 4EW7A 3LIFA 4B9OA 1UGUA 4JGQA 2A24A 4JGRA 3LYXA 3UB9A 4EESA 2YKFA 3CWFA 5HDSA 4BBUA 4R6LA 2V1AA 4HJ3A 4R38A 3UMDA 1P0ZA 2H28A 4HJ4A 4F3LA 3MXQA 1VB6A 3BY9A 1OJGA 2L0WA 1NWZA 2INWA 2Z6CA 3LIBA 2A24B 4HP9A 3VE4A 3C8CA 5HWTA 1X0OA 4GS9A 3G6OA 4HP4A 4M4XA 1XFQA 1S1ZA 1DRMA 1TS8A 3H7WB 3H82A 4HH3A 4HI4A 3HJKA 1T1BA 4PKYA 4GHIA 1UWNX 5F6AA 4JGPA 4GW9A 4MN6A 4DJ2A 2M1CA 1MZUA 2JN7A 1XJ2A 2K7SA 1TS0A 5TBMA 2V9AA 5HSQA 4LRYC 3HJIA 1UWPX 3CLOA 3MQQA 1OTEA 4I3AA 4KQDA 4WUJA 2W27A 4BBTA 4EXOA 2PYRA 1XFNA 3A0SA 3LIAA 4GHIB 5HD3A 4HJ6A 3A0VA 1DP9A 4HIAA 4L9GA 1LL8A 2QHKA 2P7JA 2OWHA 3RTYA 3NOUC 4HHDA 3K3DA 3UB6A 3A0RA 3H9WA 5IU1A 3LI8A 1N9LA 3LICA 2J80A 1F98A 1P97A 3D72A 3CAXA 1OT6A 3VE3A 3BWLA 3ULFA 1WA9A 4L9FA 5HZHA 1N9NA 4DJ3A 3NOPC 2D01A 2ZOIA 2VV6A 4BBVA 2V0WA 3PYPA 1EW0A 3NOTC 3KX0X 2R78A 4GCZA 5DJUA 1S66L 1GSXA 3H7WA 4H6JA 5HDDA 2OOLA 4HY8A 4K08A 3F1NB 5AVFA 3UE6A 4E04A 5DKLA 2QKPA 1XJ4A 3GECA 2PD7A 4NXEA 3LI9A 2W0NA 3MQOA 1S4RA 2KX6A 4H6JB 4YWZA 5F5YA 1GSVA 1Y28A 3ZQ5A 3NHQA 5HWVA 5G4YA 4I38A 5A8BA 2V0UA 3LIEA 4WF0A 2VV7A 4NXBA 5KIZA 1D06A 4LRZE 5EFWA 1ODVA 5G4ZA 2I9VA 4NXGA 3T50A 4L9EA 1F9IA
chains in the Genus database with same CATH superfamily
2ZOHA 3OLOA 5J3WA 1STZA 3HLBA 1NJ4A 2OAQ1 2ZD8A 4I5SA 3FZCA 4DKIA 4KUOA 3TSGA 1IKIA 4IEDA 4Y0OA 4I3IA 5U47A 4QY6A 2QMIA 1PW8A 4MN7A 1SZVA 3E4OA 4HOIA 5E2GA 3E2LA 4GZBA 2ZC3B 4OQGA 3F1OB 1OTBA 2CMNA 3B33A 3K3CA 4DDSA 3CHWP 3G35A 2ZMAA 1SKOA 5MC7A 1GHPA 1EI5A 3AGFA 4E3IA 4FCFA 4ZBEA 5HAPA 3P7NA 3T4JA 5J4EA 1XA7A 1CQAA 3IWOA 4KQOA 3T1XA 4BL2A 2VA0A 3E4QA 4P6ZS 2XA7M 1EWZA 1FCNA 3IXBA 2B02A 4ID4A 3M2KA 1J9MA 1LL9A 1Z09A 5F68A 4EV4A 3TOIA 4GD8A 3E4PA 3QP4A 1W63Q 2ZC7A 1GA0A 3IXHA 3LEQA 2P9VA 1P9WA 4L0LA 1K57A 1DP8A 1VEUB 3W2ZA 4ZAMA 2H5SA 1BUEA 3OPPA 2BASA 3GMWA 5A91A 4I3JA 4R3BA 3FG8A 1LHYA 1OTIA 1T1AA 5EV0A 4GJ4A 4HNBA 3MFXA 5HD5A 2I72A 4OLGA 3OCLA 4LLOB 5CTNA 5DF7A 2HDQA 3DWKA 5F1GA 5DTTA 4F3LB 2E8JA 1QMFA 3A3JA 2DNSA 1ONHA 1YT4A 1LT0A 2UV0E 3WRTA 5KSHA 5HPFA 2VEAA 3IBRA 3ICYA 3FKWA 2XDMA 4LV3A 2PR6A 4S2OA 3IX8A 1T19A 1WE4A 2JBFA 2PR5A 1LSXA 4MDZA 1LSVA 3H82B 5CECA 1FCOA 3PTEA 1FQGA 4NXFA 3GV9A 4OVDA 3CUEC 1XJ3A 2YKHA 3GDIA 4BD0A 3LUQA 3O88A 4YFMA 3BFFA 5E43A 4OLDA 5FDHA 3QNCA 4S2LA 2VJWA 3T4LA 4N92A 1JWVA 5CHUA 3C2WA 1Z6FA 2L1MA 3IT9A 3V39A 4ZTKA 1OJ5A 1DP6A 1W8YA 2Z6DA 4BLMA 5FAOA 1VETB 1AXBA 4E6XA 2QYBA 4DE2A 4O8GA 2A24A 2R9XA 4JGRA 3SZTA 4KZ8A 5TFQA 4EESA 5TR7A 1GA9A 2WKEA 4OOMA 4UHUA 4R6LA 3HUMA 3UMDA 1P0ZA 3Q81A 4HJ4A 1WYCA 2W1TA 3ISGA 3G4PA 3S7OA 2ZL1A 2EFUA 2L0WA 2OSUA 4LCMA 5DF8A 1YLPA 4HP9A 2W3HA 3LR5A 3SS5A 4GS9A 1SDEA 1H8ZA 5FAPA 3EGDC 4LFUA 4M4XA 1XFQA 1YMXA 1DRMA 4Z1WA 4BJPA 1MKIA 2LB5A 5AQBA 3HJKA 1T1BA 2JKRM 2Y55A 1CF0A 2V2FF 1PWCA 1BLHA 5F6AA 4QJGA 1MBLA 4GW9A 5CXWA 5K5BA 3BJNA 1MZUA 2IWCA 5E2FA 5TBMA 2V9AA 2M7VA 2XR0A 4I3AA 2W27A 4WELA 1BTLA 1HZOA 1L0FA 1QMEA 3IX4A 2GNXA 3FPWA 1KVLA 5CERA 3E0YA 1DP9A 3DTMA 3JYIA 1MXOA 3PAGA 5GHYA 4ME4A 2RL3A 1ES3A 1JTGA 3LFVA 2P7JA 3V50A 1PW1A 4R3JA 1ERMA 5DFXA 3RTYA 1ESIA 3NOUC 4HBUA 3HL9A 5LBRA 1FIKA 3NECA 3LI8A 4DE3A 3KO6A 3U4LP 3ZFZA 4L9FA 3CZDA 1EROA 2D01A 3N8RA 4XXRA 5L07A 2V0WA 1TF1A 2HF6A 4BWIA 4YINA 4KZAA 4NKPA 3QP2A 4GCZA 5DJUA 5FQIA 5JYPA 1XKZA 3H7WA 3UE0A 5HDDA 4K08A 3IHBA 3IQAA 2Y2HA 3QP5A 4NETA 4E04A 5TGFA 4S2IA 5DKLA 4EQIA 1GHMA 2QKPA 4ZDXA 4IJGA 3WS4A 3VP2A 3GECA 2A49A 2PD7A 4NXEA 2O9AA 2FZ0A 1JWZA 1WYBA 3LEZA 1S4RA 2ZM0A 1KVMA 1ZG4A 4H6JB 4QY5A 3ZYTA 4C75A 4DDYA 2P9VB 1GSVA 1PNEA 1C3BA 2VZWA 2B5RA 1Y28A 3G31A 2HP5A 5EVEA 3MZDA 5G4YA 1XGIA 3EQVA 1MKMA 3PBRA 1Y54A 5FI2A 3MKEA 2Y2OA 1XPBA 1H0MA 3UO9A 2J9PA 2VV7A 4NXBA 1L0DA 4X55A 2X71A 2M7UA 1RP5A 2Y59A 1D06A 1IELA 3IH9A 3HLDA 4OONA 3WS5A 5FASA 2JCHA 1PIOA 2W3EA 3ZNYA 1IYSA 1F9IA 2WZZA 4ETXA 2FFYA 2WKHA 1G6OA 3UY6A 3O3VA 5KMWA 2QJ7A 3SOIA 3R7WA 4JPMA 2D02A 3M6HA 2R9WA 2HV1A 1XJ6A 1YLZA 3B42A 4WN5A 3W8KA 4HH2A 4P6ZM 4Y2FA 1ES4A 3LO7A 4JXGA 3BFDA 5EOEA 3UB7A 4E3JA 2W3FA 4N1HA 3F1NA 1OTDA 4K0XA 5G18A 3OZHA 5CHMA 4ESPA 3NULA 4FH2A 4A5RA 4EEUA 5DFYA 4NG2A 3N7WA 4KENB 4P85A 2VV8A 2P04A 2V1ZA 4KZ3A 4HBTA 4EBNA 4Q8IA 4LGWA 1ONGA 2ZBBA 4IHQA 5DF9A 2WKPA 3N8LA 4EUZA 3I7JA 5FL3A 1O7EA 1MWSA 2XLNA 1V9ZA 5I5LA 3DBAA 1I2WA 4GLQA 1MWRA 2EXAA 2XROA 5GHZA 2Q9MA 1NYYA 4D2OA 2JHEA 3TRCA 1YMSA 3IWIA 2Z2MB 4F94A 2J3TD 1TS6A 4IUKA 1J3WA 2W1TB 2HPBA 3LCEA 2OWJA 3T12B 2WGVA 2JKGA 2DMWA 4GS9B 4BMWA 2OLVA 2Y2LA 4S2KA 1KOUA 4EWFA 1M40A 3IS2A 1BLSA 2Y2PA 5HWWA 5J7EA 3UPNA 1Q2QA 3G34A 3M2JA 3IX3A 1CI8A 5FQJA 1YAXA 2ZMFA 4RX2A 2O9CA 4LPZA 3V5MA 3KYQA 2PHYA 1HD8A 2FH5A 4II7A 3ZHHA 5TBMB 4JGOA 2PDRA 4ZJ1A 4OQ0A 4U0XA 3F1PB 1KDWA 1E4DA 5JYOA 3UB5P 1W7FA 1YSPA 3MS6A 2JKRI 3P98A 3Q82A 4PAUA 3UE3A 4E3NA 2VGLS 3UPOA 5FATA 2FFFB 3PHYA 5IT5A 1L0GA 1ZC2A 3G32A 3LR3A 1GSWA 4EW7A 2IWDA 4B9OA 1UGUA 5A93A 3B47A 4XUZA 3IF6A 1S6RA 4JLFA 4Q0IA 1FR1A 4K91A 3UB9A 3S22A 4Y3IA 4QWOA 5CTMA 4BBUA 2C5WB 4GDNA 5EE8A 1ES5A 2H28A 2LB9A 2PT7A 3D3OA 2Y79A 3N8SA 4DN0A 5HPIA 4UA7A 1PYYA 1NWZA 2INWA 2Z6CA 3LIBA 5IHVA 4YNRA 2ZC5B 2EXBA 3RXXA 1BULA 2WZXA 4KZ5A 3VV4A 3PAEA 4FH4A 4JF4A 1IKGA 3CJMA 2Y2QA 1TS8A 3A3FA 5FQQA 3H7WB 4WEJA 1PZOA 1IFQA 4MMNA 4GB7A 2J7VA 4HI4A 4WMCA 4RVAA 2HZ5A 3GSGA 2WAEA 3DWZA 3PBTA 4B4ZA 2BLSA 1L2SA 4GHIA 4X69A 2H0TA 4BQMA 2XQZA 4Y13A 4MN6A 3U2AA 2M1CA 5EUAA 3W4OA 2K7SA 3S7QA 1TS0A 1FILA 1K55A 5HSQA 3IBJA 1M6KA 5FA7A 4KG6A 3HJIA 3FYZA 3LY3A 1BZAA 3A3DA 5CRFA 2PYRA 1XFNA 3A0SA 1L0EA 3LIAA 5HD3A 2XD5A 3A0VA 2WUQA 3ZG5A 3QP1A 5AQAA 3T4SA 5AQ9A 1OMEA 4B4XA 1HTZA 4OKPA 5EPHA 1XXMA 3V3RA 4HHDA 3ZGAB 4DXBA 1BSGA 3UB6A 3H9WA 3FPVA 5IU1A 2HJ9C 4ZJ3A 2HDRA 3UPPA 1F2KA 3GQZA 3B3XA 3WS0A 1OT6A 3R7WB 5HZHA 3TJZC 1N9NA 3O5YA 3IH8A 3NOPC 1S0WA 2VV6A 2ZOIA 4Y17A 4BBVA 3FV7A 3PYPA 2VGJA 1EW0A 3NOTC 3KX0X 2WADA 3C4OA 1K6RA 3G2YA 4ARZA 3F1NB 1NRFA 5AVFA 3UE6A 1ES2A 2C6WB 1VHMA 5EVIA 4MBKA 4OPRA 1IYQA 4FSFA 4NEED 3OPHA 5FI6A 4DRTA 5L2FA 4OPQA 3EQUA 5KSCA 5HAIA 2K2NA 2Y2JA 4FOFA 4KZ7A 5DTKA 2ZQ9A 1BLCA 3ZQ5A 4E3OA 2IA2A 3NHQA 3T1RA 2HDSA 3O86A 5HWVA 1XGJA 1SHVA 2H10A 4KZ4A 4KQRA 1FSWA 3EGXC 5EECA 2PU2A 4Y0UA 2XK1A 1W63M 1NZOA 3HLGA 3VP1A 3CI6A 4DE1A 1H5XA 1MC0A 5CGWA 1KE4A 5G4ZA 3MXSA 2JC7A 4NXGA 3MZEA 4JF5A 3UMEA 3CPTB 3S4XA 1PWDA 4MBHA 4R0QA 4JBFA 1S4SA 4MBFA 5EM0A 2Z2LB 5FAQA 3VMAA 1K56A 4EEPA 5GLAA 3GVBA 4WZ5A 3VFFA 2GJ3A 3NC8A 4QHCA 4Y7PA 5L10A 3VFHA 2ZJ9A 3WWXA 2QZ6A 3IS2B 5DJTA 3ZG7B 4DMZA 3E2KA 4XUXA 1JNUA 2Y2IA 2E8IA 5C5KA 4FD8A 4R4SA 3PBNA 5F1FA 4EQ1A 1PI5A 3R4KA 2WGIA 1G5UA 5HARA 1DJCA 5CHJA 1SKOB 2XFSA 1Q2PA 4WEKA 3Q1FA 3OC2A 3JVUA 2Y2GA 3ZDJA 1E3UD 5J8XA 3VOLA 3ZCZA 4RQ9A 3E98A 5EOOA 2ZLYA 3BY8A 2ZC6B 2Y2MA 3HVFA 5M1AA 4B88A 5GHXA 5CEBA 2A3UA 4G3KA 1TDLA 2RCXA 5BOHA 5EVLA 4OPYA 3IF6B 3K2NA 3KYEA 1GCEA 2JE5A 3OCNA 4PM9A 2L4RA 4R70A 4Y0TA 1OT9A 2B18A 4KZ6A 3IF5A 2VX8A 1LSWA 2ZQCA 4DF6A 2AVXA 1XA1A 4S2PA 3JVVA 3FC7A 3MXRA 4RYEA 2HGVA 2H0YA 2EX2A 4R3AA 3Q07A 3IXDA 3EEHA 4Y5FA 1NLYA 4E6WA 3IWQA 1K38A 4O0PA 1PFLA 5A92A 2VLGA 2QWSA 3EWKA 3NI9A 1K0KA 3OBFA 2WKQA 3NCKA 4PM5A 3QHYA 3SH8A 5CX7A 1IOUA 4OQIA 5FDSA 4UA6A 1G28A 3NY4A 2HDUA 1T18A 4FUWA 4EU0A 1OTAA 4QB8A 1GHIA 1YQSA 4XT2A 3HLWA 5F69A 3UB8A 2O9BA 4FTXA 3M6BA 3SH7A 4LV0A 4X53A 1N9OA 1T1CA 2XD1A 3KSGA 4GNUA 4RX3A 1W5DA 1D7EA 1PWGA 4WL9A 2VGLM 3BFEA 3DTEA 5HL1A 2XRNA 4KG2A 3FWLA 4O7DA 2PYPA 4R4RA 4P6BA 2GDNA 4PMAA 3GR2A 4KUKA 1V9YA 3C5AA 5HDCA 4BD1A 1TS7A 3IF6C 5GL9A 4EETB 2KDKA 5TJJA 5L09A 1RGZA 3ITAA 4CJNA 5M19A 4WYYA 3D4FA 4RA7A 3N4IA 3LYXA 1BT5A 2YKFA 3CWFA 5HDSA 1HLUP 2UWXA 2V1AA 1H8YA 4HJ3A 1KE0A 1NYMA 4R1GA 2WAFA 1P9RA 1NRJA 4CLCA 4P87A 1OJGA 4Q0HA 2ZQ7A 1PRQA 2A24B 3VE4A 1ACFA 3TE8A 4U3TA 2PBYA 4PM6A 4WBGA 1W79A 2ZQ8A 4HP4A 4LCLA 1S1ZA 3QP6A 1KDSA 1YPRA 4G3VA 3BQ8A 1TD5A 4ARZB 4HH3A 3DW0A 1ZG6A 1HVBA 1K55C 2WK0A 3W4PA 2ZL1B 4GKUA 5EM1A 1TVFA 5EVIB 3DTKA 1LL5A 2HJEA 4JKTA 4DJ2A 1XJ2A 4S2JA 1MY8A 3BECA 4EBLA 2GZAA 3VSKA 4LRYC 1BLPA 1UWPX 3DTIA 3CLOA 1OTEA 4LV2A 4WUJA 4EXOA 2KLIA 1JTDA 3C30A 4ETZA 4HJ6A 4X6TA 3UDXA 3PR6A 4QU3A 1YKDA 2X01A 4HIAA 3HCYA 1CK3A 4G3WA 5FEGA 4OP5A 2PU4A 4IUHA 3QP8A 2OWHA 4PM7A 3W4QA 2PAVP 3RJUA 2XH9A 1DY6A 3A0RA 1H8MA 4E3KA 2WGWA 1F98A 3D72A 3G30A 2Y2KA 1MWTA 1N4OA 1WA9A 4BL3A 3CITA 3VP0A 2EX9A 2W3GA 5HFOA 2O0YA 1F5MA 5EVID 3RFBA 1K54A 4S2NA 3QNBA 3UE1A 2XF3A 4S2MA 5FQMA 1PI4A 2R78A 5EVIC 3T1SA 3AGEA 3MKFA 1JVJA 3C7VA 4Z9QA 1GSXA 4H6JA 1ALQA 1E25A 2EFXA 2OOLA 3C4PA 4HY8A 3KYZA 1ZHHB 3G2ZA 3NDGA 4CLCE 5DTSA 2G2WA 4UA9A 2XFTA 2IWBA 1IEMA 1XJ4A 1TEMA 2JKTM 1NXYA 3LI9A 1FR6A 4YOFA 3MQOA 2ZQAA 3SH9A 4E3LA 2DRWA 4BENA 2XGNA 3NBLA 1NY0A 1CEFA 3IHAA 4UQIS 2HP6A 4KG5A 2ZM2A 3V3SA 4K0WA 5A8BA 2V0UA 3LIEA 3O87A 4PHTA 3BQAA 4WF0A 4KZBA 2Y4AA 2ZMVA 5HL6A 4C6YA 3S7PA 2O99A 2OLUA 3FKVA 4LRZE 1ZTUA 5EFWA 5FQ9A 3C38A 1K56D 2VGKA 3T50A 4L9EA 2XEPA 3ZVWA 3L9KA 2J8YA 4WZ5C 2XSSA 2QJ5A 2WKIA 3ITBA 3NIAA 2J9OA 5FEFA 4WLAA 4JF6A 3VOZA 4X68A 3GRJA 3LR4A 3Q7VA 1FOFA 4MNRA 4OQHA 1K4FA 3VP3A 2V1BA 3TG9A 2Q9NA 1XP4A 1LI0A 2HP9A 3BM6A 4XT2B 4UAAA 3KSFA 1ESUA 4EBPA 4QPRA 1I2SA 3VSLA 5E2EA 3NJAA 4OP8A 2OAP1 3SS4A 2Y2NA 4PM8A 4IBXA 1KE3A 2XA7S 1KGEA 3A3IA 3RH8B 4WZ4A 2ZC4B 2PD8A 3KSHA 3ZG9B 2K31A 4OH0A 1KGGA 3LR0A 5F83A 4I39A 5GLCA 3SW1A 5AVEA 2ZQDA 3UDIA 5I94A 4ZJ2A 3MMHA 1YSQA 3LIDA 4D60A 3P01A 4QD4A 5L8MA 3PBOA 1JWPA 3CG5A 4HQAA 4IVKA 1BYWA 4CLCB 3WRZA 1YLYA 1IYOA 1YM1A 3C7UA 3ZNTA 1RCJA 4X56A 1CEGA 2EA9A 3F1OA 4CQHA 5AQ7A 4OOYA 3UNWA 3MR0A 3BFGA 3MJQA 4EERA 2JKFA 4DXCA 4PKYG 2P08A 4JXWA 2G2UA 3A3EA 4OOLA 3F1PA 4MN5A 1IYPA 2A2LA 1FSYA 5E2HA 2X02A 4MLLA 5KZHA 1S1YA 2J3WA 5IS1A 4LRXC 3Q7ZA 1S67L 3UDFA 1NZUA 3BEBA 1W8QA 2EWVA 3T4KA 3CUEA 4MEZA 3BRMA 1LLBA 4ZRRA 4LENA 5FI7A 2EX8A 3D9YA 5DKKA 1H3QA 4PPRA 1VEUA 5AJGA 2MJ6A 1DJBA 2WKRA 2ZM8A 2OV5A 1SKFA 3HBRA 5CEDA 4Y15A 2B95A 1D1JA 4GOGA 3LIFA 2EWWA 4CLCD 1FCMA 3AGDA 4JGQA 3VOYA 1MPLA 5HW3A 2V8FA 1I5QA 4CLCC 3WS2A 1CJFA 5HAQA 4EUVA 4R38A 2WGWB 3JPUA 4F3LA 4O01A 1K4EA 3MXQA 1VB6A 3BY9A 2V20A 4P0MA 3T4TA 3L7HA 3HUNA 3NDEA 3PBQA 1YLTA 4M3KA 2Y91A 3C8CA 3ZG0A 5HWTA 1X0OA 4IVIA 2WYXA 3G6OA 3OPLA 3DAVA 1N9BA 1VM1A 1LI9A 3H82A 3EEAA 3BLSA 1SDNA 2NUTC 4PKYA 2VK3A 4JXVA 2EX6A 1UWNX 2QPNA 4JGPA 3EOIA 3IXGA 2JN7A 3HREA 1G6AA 1K25A 4MCWA 3T4OA 2Q0OA 2KOIA 1O07A 4N1XA 1YLJA 4Q0JA 3BYDA 3V67A 3MQQA 4KQQA 4KQDA 4BBTA 3MQ0A 2CC1A 3OPRA 4GHIB 3T1QB 3MSHA 4HESA 4H8RA 3RXWA 2ACGA 1VQQA 1VETA 1YLWA 4N9KA 3ZG8B 1A0KA 2JKTI 4X25A 3BFCA 4L9GA 4DE0A 1DJAA 1LL8A 2QHKA 3TW8A 5HX9A 3N6IA 5F82A 5CGXA 5CGSA 3SS3A 3K3DA 1XX2A 3GTCA 4CPKA 1K6SA 1N9LA 3LICA 2J80A 1K54C 4S2NC 1P97A 3CMZA 3CAXA 2BG1A 3PXPA 4AFIA 2NUPC 4N9LA 3VE3A 1OPXA 3BWLA 4JXSA 3ULFA 1NLZA 4KZ9A 3ZVTA 2VKSA 4DJ3A 5A90A 1ERQA 3Q7VB 4WM9A 3S7NA 3MF0A 3OOVA 4X1MA 2PRFA 3HLEA 3LGOA 1K57C 4X1LA 2BTFP 4U0TA 2GX5A 1S66L 3BW6A 5D3OA 4WMCD 1Y4OA 3P09A 4OPZA 1PZPA 5M18A 4UQIM 5FQKA 3BLMA 1AWIA 1TDGA 5DVAA 3HLCA 1SCWA 2G7UA 1CI9A 2W0NA 3PBSA 5GLDA 2KX6A 1MWUA 4B93A 4YWZA 1E3UA 2Y8HA 4GD6A 3MZFA 5F5YA 3KSIA 3UN7A 2PBDP 1RGYA 1U60A 1G68A 1KGFA 3CPTA 2W1RA 3VP4A 4I38A 1L3LA 1ZKJA 3T4QA 3S1YA 3HUOA 4R23A 5FSRA 5GLBA 2V8CA 5KIZA 4NK3A 4GDBA 3MFDA 2J3TC 2DCFA 3HLFA 4E3MA 2P74A 3MBZA 3WS1A 4GN2A 4C3QA 1ODVA 4IBRA 3LY4A 2I9VA 2W3DA 4UEYA 4LV1A 4HEFA
chains in the Genus database with same CATH topology
2ZOHA 3UMEA 4ETXA 3OLOA 5J3WA 1G6OA 1STZA 2OAQ1 2QJ7A 4I5SA 4KUOA 2XSSA 1S4SA 2QJ5A 4I3IA 3R7WA 4MN7A 2D02A 3E4OA 4WLAA 2HV1A 4HOIA 1XJ6A 3LR4A 4EEPA 3B42A 4WN5A 4HH2A 4P6ZM 4Y2FA 3F1OB 1OTBA 2GJ3A 2CMNA 2V1BA 3B33A 3K3CA 5MC7A 3UB7A 2W3FA 3IS2B 4XT2B 5DJTA 3F1NA 3KSFA 4DMZA 1JNUA 1OTDA 3P7NA 3T4JA 5C5KA 5J4EA 4QPRA 4KQOA 3PBNA 2VA0A 3E4QA 4P6ZS 2XA7M 4EQ1A 2B02A 3R4KA 4EEUA 5DFYA 5F68A 3NJAA 3E4PA 2VV8A 4WEKA 2OAP1 2P04A 1W63Q 3OC2A 3JVUA 3VOLA 1P9WA 2XA7S 4RQ9A 5DF9A 2ZBBA 4IHQA 3RH8B 3E98A 4L0LA 2PD8A 2WKPA 3KSHA 3BY8A 1DP8A 2K31A 3W2ZA 3LR0A 5FL3A 4I39A 3SW1A 1V9ZA 4G3KA 5AVEA 2BASA 5I5LA 3DBAA 4I3JA 3FG8A 4GLQA 2XROA 1OTIA 1T1AA 3K2NA 3OCNA 4GJ4A 4HNBA 3MFXA 2JHEA 2L4RA 5HD5A 3MMHA 4R70A 3TRCA 1YSQA 1OT9A 2B18A 3LIDA 3OCLA 2J3TD 3P01A 4LLOB 2VX8A 5L8MA 3PBOA 1LSWA 1TS6A 4F3LB 4HQAA 4IUKA 3JVVA 2W1TB 3FC7A 2HGVA 4R3AA 1BYWA 4CLCB 3EEHA 2OWJA 4Y5FA 1NLYA 4O0PA 1LT0A 2VLGA 2QWSA 3EWKA 5KSHA 5HPFA 3OBFA 2WKQA 2VEAA 3IBRA 3ICYA 3F1OA 2DMWA 2EA9A 4CQHA 2PR6A 5CX7A 1IOUA 4GS9B 3MR0A 4BMWA 3MJQA 1G28A 1T19A 1T18A 4EERA 2PR5A 1KOUA 4PKYG 1LSXA 4EU0A 1OTAA 2P08A 3IS2A 5HWWA 4XT2A 5J7EA 5F69A 4MDZA 1LSVA 4OOLA 2O9BA 3F1PA 3H82B 4MN5A 3UB8A 2A2LA 1S1YA 2J3WA 4NXFA 5IS1A 1YAXA 3CUEC 1N9OA 2ZMFA 1XJ3A 1T1CA 2O9CA 4LRXC 2YKHA 3KSGA 4LPZA 3GDIA 1S67L 1D7EA 2PHYA 3KYQA 3LUQA 4WL9A 2VGLM 2FH5A 4II7A 5TBMB 4JGOA 2PDRA 2EWVA 3T4KA 2XRNA 2VJWA 3T4LA 3CUEA 3F1PB 4ZRRA 2PYPA 3C2WA 1YSPA 2L1MA 2JKRI 4KUKA 1V9YA 5DKKA 5HDCA 1H3QA 1OJ5A 1TS7A 4PAUA 3UE3A 2VGLS 1DP6A 4EETB 5AJGA 2Z6DA 3PHYA 5IT5A 2MJ6A 2KDKA 2WKRA 5TJJA 3LR3A 1GSWA 4EW7A 3LIFA 4B9OA 1UGUA 2EWWA 3B47A 4CLCD 2QYBA 4O8GA 4JGQA 2A24A 4JGRA 4Q0IA 4CLCC 3LYXA 3UB9A 4EESA 4Y3IA 2YKFA 3CWFA 4OOMA 5HDSA 4BBUA 4R6LA 2V1AA 4EUVA 4HJ3A 4R38A 3UMDA 1P0ZA 2H28A 2LB9A 2PT7A 4HJ4A 1P9RA 4F3LA 4O01A 2W1TA 3MXQA 3S7OA 1VB6A 1NRJA 3BY9A 3D3OA 4CLCA 2Y79A 1OJGA 3T4TA 4Q0HA 4DN0A 5HPIA 2L0WA 1NWZA 2INWA 2Z6CA 3PBQA 3LIBA 2A24B 4HP9A 3VE4A 4YNRA 3C8CA 2W3HA 3LR5A 3TE8A 5HWTA 1X0OA 4GS9A 3G6OA 4HP4A 3EGDC 3VV4A 4M4XA 1XFQA 1S1ZA 1DRMA 1TS8A 4Z1WA 4G3VA 4BJPA 3BQ8A 1TD5A 3H7WB 4WEJA 4ARZB 1IFQA 4MMNA 3H82A 3EEAA 4HH3A 2LB5A 4HI4A 3HJKA 1T1BA 2NUTC 2JKRM 4PKYA 3PBTA 4GHIA 1UWNX 5F6AA 4JGPA 2HJEA 3EOIA 4GW9A 4MN6A 3U2AA 4DJ2A 5K5BA 2M1CA 3BJNA 1MZUA 2JN7A 1XJ2A 2K7SA 3S7QA 1TS0A 5TBMA 2V9AA 4MCWA 5HSQA 2M7VA 3IBJA 2GZAA 3T4OA 2KOIA 4LRYC 3HJIA 1UWPX 3CLOA 4Q0JA 3V67A 3MQQA 1OTEA 4I3AA 4KQDA 4WUJA 2W27A 4BBTA 4EXOA 3MQ0A 2PYRA 1XFNA 2KLIA 3A0SA 3C30A 3LIAA 4GHIB 4WELA 5HD3A 4ETZA 4HJ6A 3PR6A 3A0VA 1YKDA 2GNXA 3FPWA 3E0YA 1DP9A 2JKTI 4HIAA 3T4SA 3HCYA 4G3WA 4L9GA 4ME4A 1LL8A 2QHKA 3TW8A 3LFVA 2P7JA 4IUHA 5DFXA 2OWHA 3RTYA 3NOUC 4HHDA 3K3DA 5LBRA 3UB6A 3A0RA 3H9WA 3FPVA 5IU1A 1H8MA 2HJ9C 3LI8A 1N9LA 3LICA 2J80A 1F98A 3KO6A 1P97A 3D72A 3CAXA 4AFIA 1OT6A 3PXPA 3R7WB 2NUPC 3VE3A 1OPXA 3BWLA 3ULFA 1WA9A 1NLZA 4L9FA 5HZHA 3CITA 3TJZC 1N9NA 2VKSA 3O5YA 4DJ3A 2W3GA 3NOPC 2D01A 2ZOIA 2O0YA 1F5MA 2VV6A 3RFBA 3S7NA 4BBVA 3MF0A 3OOVA 2V0WA 1TF1A 3PYPA 1EW0A 2HF6A 4BWIA 3NOTC 3KX0X 2R78A 4NKPA 2GX5A 4GCZA 5DJUA 1S66L 3BW6A 1GSXA 3H7WA 4H6JA 5HDDA 4ARZA 2OOLA 4HY8A 4K08A 3F1NB 3KYZA 1ZHHB 5AVFA 3UE6A 4CLCE 4E04A 5DKLA 2QKPA 1VHMA 4IJGA 4UQIM 1XJ4A 3GECA 4FSFA 4NEED 2PD7A 4NXEA 2JKTM 2O9AA 3LI9A 2FZ0A 2G7UA 4YOFA 2W0NA 3MQOA 3PBSA 3EQUA 1S4RA 2KX6A 4B93A 3ZYTA 4H6JB 2K2NA 4YWZA 2Y8HA 5F5YA 1GSVA 3KSIA 4FOFA 2VZWA 1Y28A 3ZQ5A 4UQIS 2IA2A 3NHQA 2W1RA 5HWVA 5G4YA 4I38A 5A8BA 3EQVA 1MKMA 2V0UA 3LIEA 3PBRA 3T4QA 3EGXC 4PHTA 3BQAA 4WF0A 2VV7A 4NXBA 5KIZA 2M7UA 1W63M 2ZMVA 2J3TC 5HL6A 1D06A 3S7PA 2O99A 3CI6A 1MC0A 4LRZE 1ZTUA 5EFWA 1ODVA 5G4ZA 2I9VA 2W3DA 4UEYA 3C38A 4NXGA 2W3EA 3T50A 4L9EA 1F9IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZOH A;  3UME A;  3OLO A;  5J3W A;  2QJ7 A;  4I5S A;  4KUO A;  1S4S A;  2QJ5 A;  4I3I A;  2D02 A;  3E4O A;  4WLA A;  2HV1 A;  4HOI A;  1XJ6 A;  4EEP A;  4WN5 A;  4HH2 A;  3F1O B;  1OTB A;  2GJ3 A;  2CMN A;  2V1B A;  3B33 A;  3K3C A;  3UB7 A;  3IS2 B;  4XT2 B;  5DJT A;  3F1N A;  1JNU A;  1OTD A;  3P7N A;  5J4E A;  3E4Q A;  4EQ1 A;  2B02 A;  4EEU A;  5F68 A;  3NJA A;  3E4P A;  2VV8 A;  3VOL A;  4RQ9 A;  2ZBB A;  3RH8 B;  2PD8 A;  2WKP A;  3BY8 A;  1DP8 A;  4I39 A;  3SW1 A;  1V9Z A;  5AVE A;  2BAS A;  5I5L A;  4I3J A;  3FG8 A;  1OTI A;  1T1A A;  4HNB A;  3MFX A;  2JHE A;  2L4R A;  5HD5 A;  4R70 A;  1OT9 A;  3LID A;  4LLO B;  1LSW A;  1TS6 A;  4F3L B;  4HQA A;  3FC7 A;  4R3A A;  1BYW A;  3EEH A;  2OWJ A;  1LT0 A;  2VLG A;  2QWS A;  3EWK A;  2WKQ A;  2VEA A;  3IBR A;  3ICY A;  2EA9 A;  3F1O A;  2PR6 A;  4GS9 B;  3MR0 A;  3MJQ A;  1G28 A;  1T19 A;  1T18 A;  4EER A;  2PR5 A;  1KOU A;  4PKY G;  1LSX A;  1OTA A;  3IS2 A;  5HWW A;  4XT2 A;  5J7E A;  5F69 A;  3UB8 A;  1LSV A;  3F1P A;  3H82 B;  4MN5 A;  1S1Y A;  4NXF A;  5IS1 A;  1N9O A;  1XJ3 A;  1T1C A;  4LRX C;  2YKH A;  4LPZ A;  3GDI A;  1S67 L;  1D7E A;  2PHY A;  3LUQ A;  4WL9 A;  5TBM B;  4JGO A;  2PDR A;  3F1P B;  2PYP A;  3C2W A;  2L1M A;  4KUK A;  1V9Y A;  5DKK A;  5HDC A;  1OJ5 A;  1TS7 A;  1DP6 A;  4EET B;  2Z6D A;  3PHY A;  2KDK A;  2WKR A;  1GSW A;  4EW7 A;  3LIF A;  4B9O A;  1UGU A;  4JGQ A;  2A24 A;  4JGR A;  3LYX A;  3UB9 A;  4EES A;  2YKF A;  3CWF A;  5HDS A;  4BBU A;  4R6L A;  2V1A A;  4HJ3 A;  4R38 A;  3UMD A;  1P0Z A;  2H28 A;  4HJ4 A;  4F3L A;  3MXQ A;  1VB6 A;  3BY9 A;  1OJG A;  2L0W A;  1NWZ A;  2INW A;  2Z6C A;  3LIB A;  2A24 B;  4HP9 A;  3VE4 A;  3C8C A;  5HWT A;  1X0O A;  4GS9 A;  3G6O A;  4HP4 A;  4M4X A;  1XFQ A;  1S1Z A;  1DRM A;  1TS8 A;  3H7W B;  3H82 A;  4HH3 A;  4HI4 A;  3HJK A;  1T1B A;  4PKY A;  4GHI A;  1UWN X;  5F6A A;  4JGP A;  4GW9 A;  4MN6 A;  4DJ2 A;  2M1C A;  1MZU A;  2JN7 A;  1XJ2 A;  2K7S A;  1TS0 A;  5TBM A;  2V9A A;  5HSQ A;  4LRY C;  3HJI A;  1UWP X;  3CLO A;  3MQQ A;  1OTE A;  4I3A A;  4KQD A;  4WUJ A;  2W27 A;  4BBT A;  4EXO A;  2PYR A;  1XFN A;  3A0S A;  3LIA A;  4GHI B;  5HD3 A;  4HJ6 A;  3A0V A;  1DP9 A;  4HIA A;  4L9G A;  1LL8 A;  2QHK A;  2P7J A;  2OWH A;  3RTY A;  3NOU C;  4HHD A;  3K3D A;  3UB6 A;  3A0R A;  3H9W A;  5IU1 A;  3LI8 A;  1N9L A;  3LIC A;  2J80 A;  1F98 A;  1P97 A;  3D72 A;  3CAX A;  1OT6 A;  3VE3 A;  3BWL A;  3ULF A;  1WA9 A;  4L9F A;  5HZH A;  1N9N A;  4DJ3 A;  3NOP C;  2D01 A;  2ZOI A;  2VV6 A;  4BBV A;  2V0W A;  3PYP A;  1EW0 A;  3NOT C;  3KX0 X;  2R78 A;  4GCZ A;  5DJU A;  1S66 L;  1GSX A;  3H7W A;  4H6J A;  5HDD A;  2OOL A;  4HY8 A;  4K08 A;  3F1N B;  5AVF A;  3UE6 A;  4E04 A;  5DKL A;  2QKP A;  1XJ4 A;  3GEC A;  2PD7 A;  4NXE A;  3LI9 A;  2W0N A;  3MQO A;  1S4R A;  2KX6 A;  4H6J B;  4YWZ A;  5F5Y A;  1GSV A;  1Y28 A;  3ZQ5 A;  3NHQ A;  5HWV A;  5G4Y A;  4I38 A;  5A8B A;  2V0U A;  3LIE A;  4WF0 A;  2VV7 A;  4NXB A;  5KIZ A;  1D06 A;  4LRZ E;  5EFW A;  1ODV A;  5G4Z A;  2I9V A;  4NXG A;  3T50 A;  4L9E A;  1F9I A; 
#chains in the Genus database with same CATH topology
 2ZOH A;  3OLO A;  5J3W A;  1STZ A;  3HLB A;  1NJ4 A;  2OAQ 1;  2ZD8 A;  4I5S A;  3FZC A;  4DKI A;  4KUO A;  3TSG A;  1IKI A;  4IED A;  4Y0O A;  4I3I A;  5U47 A;  4QY6 A;  2QMI A;  1PW8 A;  4MN7 A;  1SZV A;  3E4O A;  4HOI A;  5E2G A;  3E2L A;  4GZB A;  2ZC3 B;  4OQG A;  3F1O B;  1OTB A;  2CMN A;  3B33 A;  3K3C A;  4DDS A;  3CHW P;  3G35 A;  2ZMA A;  1SKO A;  5MC7 A;  1GHP A;  1EI5 A;  3AGF A;  4E3I A;  4FCF A;  4ZBE A;  5HAP A;  3P7N A;  3T4J A;  5J4E A;  1XA7 A;  1CQA A;  3IWO A;  4KQO A;  3T1X A;  4BL2 A;  2VA0 A;  3E4Q A;  4P6Z S;  2XA7 M;  1EWZ A;  1FCN A;  3IXB A;  2B02 A;  4ID4 A;  3M2K A;  1J9M A;  1LL9 A;  1Z09 A;  5F68 A;  4EV4 A;  3TOI A;  4GD8 A;  3E4P A;  3QP4 A;  1W63 Q;  2ZC7 A;  1GA0 A;  3IXH A;  3LEQ A;  2P9V A;  1P9W A;  4L0L A;  1K57 A;  1DP8 A;  1VEU B;  3W2Z A;  4ZAM A;  2H5S A;  1BUE A;  3OPP A;  2BAS A;  3GMW A;  5A91 A;  4I3J A;  4R3B A;  3FG8 A;  1LHY A;  1OTI A;  1T1A A;  5EV0 A;  4GJ4 A;  4HNB A;  3MFX A;  5HD5 A;  2I72 A;  4OLG A;  3OCL A;  4LLO B;  5CTN A;  5DF7 A;  2HDQ A;  3DWK A;  5F1G A;  5DTT A;  4F3L B;  2E8J A;  1QMF A;  3A3J A;  2DNS A;  1ONH A;  1YT4 A;  1LT0 A;  2UV0 E;  3WRT A;  5KSH A;  5HPF A;  2VEA A;  3IBR A;  3ICY A;  3FKW A;  2XDM A;  4LV3 A;  2PR6 A;  4S2O A;  3IX8 A;  1T19 A;  1WE4 A;  2JBF A;  2PR5 A;  1LSX A;  4MDZ A;  1LSV A;  3H82 B;  5CEC A;  1FCO A;  3PTE A;  1FQG A;  4NXF A;  3GV9 A;  4OVD A;  3CUE C;  1XJ3 A;  2YKH A;  3GDI A;  4BD0 A;  3LUQ A;  3O88 A;  4YFM A;  3BFF A;  5E43 A;  4OLD A;  5FDH A;  3QNC A;  4S2L A;  2VJW A;  3T4L A;  4N92 A;  1JWV A;  5CHU A;  3C2W A;  1Z6F A;  2L1M A;  3IT9 A;  3V39 A;  4ZTK A;  1OJ5 A;  1DP6 A;  1W8Y A;  2Z6D A;  4BLM A;  5FAO A;  1VET B;  1AXB A;  4E6X A;  2QYB A;  4DE2 A;  4O8G A;  2A24 A;  2R9X A;  4JGR A;  3SZT A;  4KZ8 A;  5TFQ A;  4EES A;  5TR7 A;  1GA9 A;  2WKE A;  4OOM A;  4UHU A;  4R6L A;  3HUM A;  3UMD A;  1P0Z A;  3Q81 A;  4HJ4 A;  1WYC A;  2W1T A;  3ISG A;  3G4P A;  3S7O A;  2ZL1 A;  2EFU A;  2L0W A;  2OSU A;  4LCM A;  5DF8 A;  1YLP A;  4HP9 A;  2W3H A;  3LR5 A;  3SS5 A;  4GS9 A;  1SDE A;  1H8Z A;  5FAP A;  3EGD C;  4LFU A;  4M4X A;  1XFQ A;  1YMX A;  1DRM A;  4Z1W A;  4BJP A;  1MKI A;  2LB5 A;  5AQB A;  3HJK A;  1T1B A;  2JKR M;  2Y55 A;  1CF0 A;  2V2F F;  1PWC A;  1BLH A;  5F6A A;  4QJG A;  1MBL A;  4GW9 A;  5CXW A;  5K5B A;  3BJN A;  1MZU A;  2IWC A;  5E2F A;  5TBM A;  2V9A A;  2M7V A;  2XR0 A;  4I3A A;  2W27 A;  4WEL A;  1BTL A;  1HZO A;  1L0F A;  1QME A;  3IX4 A;  2GNX A;  3FPW A;  1KVL A;  5CER A;  3E0Y A;  1DP9 A;  3DTM A;  3JYI A;  1MXO A;  3PAG A;  5GHY A;  4ME4 A;  2RL3 A;  1ES3 A;  1JTG A;  3LFV A;  2P7J A;  3V50 A;  1PW1 A;  4R3J A;  1ERM A;  5DFX A;  3RTY A;  1ESI A;  3NOU C;  4HBU A;  3HL9 A;  5LBR A;  1FIK A;  3NEC A;  3LI8 A;  4DE3 A;  3KO6 A;  3U4L P;  3ZFZ A;  4L9F A;  3CZD A;  1ERO A;  2D01 A;  3N8R A;  4XXR A;  5L07 A;  2V0W A;  1TF1 A;  2HF6 A;  4BWI A;  4YIN A;  4KZA A;  4NKP A;  3QP2 A;  4GCZ A;  5DJU A;  5FQI A;  5JYP A;  1XKZ A;  3H7W A;  3UE0 A;  5HDD A;  4K08 A;  3IHB A;  3IQA A;  2Y2H A;  3QP5 A;  4NET A;  4E04 A;  5TGF A;  4S2I A;  5DKL A;  4EQI A;  1GHM A;  2QKP A;  4ZDX A;  4IJG A;  3WS4 A;  3VP2 A;  3GEC A;  2A49 A;  2PD7 A;  4NXE A;  2O9A A;  2FZ0 A;  1JWZ A;  1WYB A;  3LEZ A;  1S4R A;  2ZM0 A;  1KVM A;  1ZG4 A;  4H6J B;  4QY5 A;  3ZYT A;  4C75 A;  4DDY A;  2P9V B;  1GSV A;  1PNE A;  1C3B A;  2VZW A;  2B5R A;  1Y28 A;  3G31 A;  2HP5 A;  5EVE A;  3MZD A;  5G4Y A;  1XGI A;  3EQV A;  1MKM A;  3PBR A;  1Y54 A;  5FI2 A;  3MKE A;  2Y2O A;  1XPB A;  1H0M A;  3UO9 A;  2J9P A;  2VV7 A;  4NXB A;  1L0D A;  4X55 A;  2X71 A;  2M7U A;  1RP5 A;  2Y59 A;  1D06 A;  1IEL A;  3IH9 A;  3HLD A;  4OON A;  3WS5 A;  5FAS A;  2JCH A;  1PIO A;  2W3E A;  3ZNY A;  1IYS A;  1F9I A;  2WZZ A;  4ETX A;  2FFY A;  2WKH A;  1G6O A;  3UY6 A;  3O3V A;  5KMW A;  2QJ7 A;  3SOI A;  3R7W A;  4JPM A;  2D02 A;  3M6H A;  2R9W A;  2HV1 A;  1XJ6 A;  1YLZ A;  3B42 A;  4WN5 A;  3W8K A;  4HH2 A;  4P6Z M;  4Y2F A;  1ES4 A;  3LO7 A;  4JXG A;  3BFD A;  5EOE A;  3UB7 A;  4E3J A;  2W3F A;  4N1H A;  3F1N A;  1OTD A;  4K0X A;  5G18 A;  3OZH A;  5CHM A;  4ESP A;  3NUL A;  4FH2 A;  4A5R A;  4EEU A;  5DFY A;  4NG2 A;  3N7W A;  4KEN B;  4P85 A;  2VV8 A;  2P04 A;  2V1Z A;  4KZ3 A;  4HBT A;  4EBN A;  4Q8I A;  4LGW A;  1ONG A;  2ZBB A;  4IHQ A;  5DF9 A;  2WKP A;  3N8L A;  4EUZ A;  3I7J A;  5FL3 A;  1O7E A;  1MWS A;  2XLN A;  1V9Z A;  5I5L A;  3DBA A;  1I2W A;  4GLQ A;  1MWR A;  2EXA A;  2XRO A;  5GHZ A;  2Q9M A;  1NYY A;  4D2O A;  2JHE A;  3TRC A;  1YMS A;  3IWI A;  2Z2M B;  4F94 A;  2J3T D;  1TS6 A;  4IUK A;  1J3W A;  2W1T B;  2HPB A;  3LCE A;  2OWJ A;  3T12 B;  2WGV A;  2JKG A;  2DMW A;  4GS9 B;  4BMW A;  2OLV A;  2Y2L A;  4S2K A;  1KOU A;  4EWF A;  1M40 A;  3IS2 A;  1BLS A;  2Y2P A;  5HWW A;  5J7E A;  3UPN A;  1Q2Q A;  3G34 A;  3M2J A;  3IX3 A;  1CI8 A;  5FQJ A;  1YAX A;  2ZMF A;  4RX2 A;  2O9C A;  4LPZ A;  3V5M A;  3KYQ A;  2PHY A;  1HD8 A;  2FH5 A;  4II7 A;  3ZHH A;  5TBM B;  4JGO A;  2PDR A;  4ZJ1 A;  4OQ0 A;  4U0X A;  3F1P B;  1KDW A;  1E4D A;  5JYO A;  3UB5 P;  1W7F A;  1YSP A;  3MS6 A;  2JKR I;  3P98 A;  3Q82 A;  4PAU A;  3UE3 A;  4E3N A;  2VGL S;  3UPO A;  5FAT A;  2FFF B;  3PHY A;  5IT5 A;  1L0G A;  1ZC2 A;  3G32 A;  3LR3 A;  1GSW A;  4EW7 A;  2IWD A;  4B9O A;  1UGU A;  5A93 A;  3B47 A;  4XUZ A;  3IF6 A;  1S6R A;  4JLF A;  4Q0I A;  1FR1 A;  4K91 A;  3UB9 A;  3S22 A;  4Y3I A;  4QWO A;  5CTM A;  4BBU A;  2C5W B;  4GDN A;  5EE8 A;  1ES5 A;  2H28 A;  2LB9 A;  2PT7 A;  3D3O A;  2Y79 A;  3N8S A;  4DN0 A;  5HPI A;  4UA7 A;  1PYY A;  1NWZ A;  2INW A;  2Z6C A;  3LIB A;  5IHV A;  4YNR A;  2ZC5 B;  2EXB A;  3RXX A;  1BUL A;  2WZX A;  4KZ5 A;  3VV4 A;  3PAE A;  4FH4 A;  4JF4 A;  1IKG A;  3CJM A;  2Y2Q A;  1TS8 A;  3A3F A;  5FQQ A;  3H7W B;  4WEJ A;  1PZO A;  1IFQ A;  4MMN A;  4GB7 A;  2J7V A;  4HI4 A;  4WMC A;  4RVA A;  2HZ5 A;  3GSG A;  2WAE A;  3DWZ A;  3PBT A;  4B4Z A;  2BLS A;  1L2S A;  4GHI A;  4X69 A;  2H0T A;  4BQM A;  2XQZ A;  4Y13 A;  4MN6 A;  3U2A A;  2M1C A;  5EUA A;  3W4O A;  2K7S A;  3S7Q A;  1TS0 A;  1FIL A;  1K55 A;  5HSQ A;  3IBJ A;  1M6K A;  5FA7 A;  4KG6 A;  3HJI A;  3FYZ A;  3LY3 A;  1BZA A;  3A3D A;  5CRF A;  2PYR A;  1XFN A;  3A0S A;  1L0E A;  3LIA A;  5HD3 A;  2XD5 A;  3A0V A;  2WUQ A;  3ZG5 A;  3QP1 A;  5AQA A;  3T4S A;  5AQ9 A;  1OME A;  4B4X A;  1HTZ A;  4OKP A;  5EPH A;  1XXM A;  3V3R A;  4HHD A;  3ZGA B;  4DXB A;  1BSG A;  3UB6 A;  3H9W A;  3FPV A;  5IU1 A;  2HJ9 C;  4ZJ3 A;  2HDR A;  3UPP A;  1F2K A;  3GQZ A;  3B3X A;  3WS0 A;  1OT6 A;  3R7W B;  5HZH A;  3TJZ C;  1N9N A;  3O5Y A;  3IH8 A;  3NOP C;  1S0W A;  2VV6 A;  2ZOI A;  4Y17 A;  4BBV A;  3FV7 A;  3PYP A;  2VGJ A;  1EW0 A;  3NOT C;  3KX0 X;  2WAD A;  3C4O A;  1K6R A;  3G2Y A;  4ARZ A;  3F1N B;  1NRF A;  5AVF A;  3UE6 A;  1ES2 A;  2C6W B;  1VHM A;  5EVI A;  4MBK A;  4OPR A;  1IYQ A;  4FSF A;  4NEE D;  3OPH A;  5FI6 A;  4DRT A;  5L2F A;  4OPQ A;  3EQU A;  5KSC A;  5HAI A;  2K2N A;  2Y2J A;  4FOF A;  4KZ7 A;  5DTK A;  2ZQ9 A;  1BLC A;  3ZQ5 A;  4E3O A;  2IA2 A;  3NHQ A;  3T1R A;  2HDS A;  3O86 A;  5HWV A;  1XGJ A;  1SHV A;  2H10 A;  4KZ4 A;  4KQR A;  1FSW A;  3EGX C;  5EEC A;  2PU2 A;  4Y0U A;  2XK1 A;  1W63 M;  1NZO A;  3HLG A;  3VP1 A;  3CI6 A;  4DE1 A;  1H5X A;  1MC0 A;  5CGW A;  1KE4 A;  5G4Z A;  3MXS A;  2JC7 A;  4NXG A;  3MZE A;  4JF5 A;  3UME A;  3CPT B;  3S4X A;  1PWD A;  4MBH A;  4R0Q A;  4JBF A;  1S4S A;  4MBF A;  5EM0 A;  2Z2L B;  5FAQ A;  3VMA A;  1K56 A;  4EEP A;  5GLA A;  3GVB A;  4WZ5 A;  3VFF A;  2GJ3 A;  3NC8 A;  4QHC A;  4Y7P A;  5L10 A;  3VFH A;  2ZJ9 A;  3WWX A;  2QZ6 A;  3IS2 B;  5DJT A;  3ZG7 B;  4DMZ A;  3E2K A;  4XUX A;  1JNU A;  2Y2I A;  2E8I A;  5C5K A;  4FD8 A;  4R4S A;  3PBN A;  5F1F A;  4EQ1 A;  1PI5 A;  3R4K A;  2WGI A;  1G5U A;  5HAR A;  1DJC A;  5CHJ A;  1SKO B;  2XFS A;  1Q2P A;  4WEK A;  3Q1F A;  3OC2 A;  3JVU A;  2Y2G A;  3ZDJ A;  1E3U D;  5J8X A;  3VOL A;  3ZCZ A;  4RQ9 A;  3E98 A;  5EOO A;  2ZLY A;  3BY8 A;  2ZC6 B;  2Y2M A;  3HVF A;  5M1A A;  4B88 A;  5GHX A;  5CEB A;  2A3U A;  4G3K A;  1TDL A;  2RCX A;  5BOH A;  5EVL A;  4OPY A;  3IF6 B;  3K2N A;  3KYE A;  1GCE A;  2JE5 A;  3OCN A;  4PM9 A;  2L4R A;  4R70 A;  4Y0T A;  1OT9 A;  2B18 A;  4KZ6 A;  3IF5 A;  2VX8 A;  1LSW A;  2ZQC A;  4DF6 A;  2AVX A;  1XA1 A;  4S2P A;  3JVV A;  3FC7 A;  3MXR A;  4RYE A;  2HGV A;  2H0Y A;  2EX2 A;  4R3A A;  3Q07 A;  3IXD A;  3EEH A;  4Y5F A;  1NLY A;  4E6W A;  3IWQ A;  1K38 A;  4O0P A;  1PFL A;  5A92 A;  2VLG A;  2QWS A;  3EWK A;  3NI9 A;  1K0K A;  3OBF A;  2WKQ A;  3NCK A;  4PM5 A;  3QHY A;  3SH8 A;  5CX7 A;  1IOU A;  4OQI A;  5FDS A;  4UA6 A;  1G28 A;  3NY4 A;  2HDU A;  1T18 A;  4FUW A;  4EU0 A;  1OTA A;  4QB8 A;  1GHI A;  1YQS A;  4XT2 A;  3HLW A;  5F69 A;  3UB8 A;  2O9B A;  4FTX A;  3M6B A;  3SH7 A;  4LV0 A;  4X53 A;  1N9O A;  1T1C A;  2XD1 A;  3KSG A;  4GNU A;  4RX3 A;  1W5D A;  1D7E A;  1PWG A;  4WL9 A;  2VGL M;  3BFE A;  3DTE A;  5HL1 A;  2XRN A;  4KG2 A;  3FWL A;  4O7D A;  2PYP A;  4R4R A;  4P6B A;  2GDN A;  4PMA A;  3GR2 A;  4KUK A;  1V9Y A;  3C5A A;  5HDC A;  4BD1 A;  1TS7 A;  3IF6 C;  5GL9 A;  4EET B;  2KDK A;  5TJJ A;  5L09 A;  1RGZ A;  3ITA A;  4CJN A;  5M19 A;  4WYY A;  3D4F A;  4RA7 A;  3N4I A;  3LYX A;  1BT5 A;  2YKF A;  3CWF A;  5HDS A;  1HLU P;  2UWX A;  2V1A A;  1H8Y A;  4HJ3 A;  1KE0 A;  1NYM A;  4R1G A;  2WAF A;  1P9R A;  1NRJ A;  4CLC A;  4P87 A;  1OJG A;  4Q0H A;  2ZQ7 A;  1PRQ A;  2A24 B;  3VE4 A;  1ACF A;  3TE8 A;  4U3T A;  2PBY A;  4PM6 A;  4WBG A;  1W79 A;  2ZQ8 A;  4HP4 A;  4LCL A;  1S1Z A;  3QP6 A;  1KDS A;  1YPR A;  4G3V A;  3BQ8 A;  1TD5 A;  4ARZ B;  4HH3 A;  3DW0 A;  1ZG6 A;  1HVB A;  1K55 C;  2WK0 A;  3W4P A;  2ZL1 B;  4GKU A;  5EM1 A;  1TVF A;  5EVI B;  3DTK A;  1LL5 A;  2HJE A;  4JKT A;  4DJ2 A;  1XJ2 A;  4S2J A;  1MY8 A;  3BEC A;  4EBL A;  2GZA A;  3VSK A;  4LRY C;  1BLP A;  1UWP X;  3DTI A;  3CLO A;  1OTE A;  4LV2 A;  4WUJ A;  4EXO A;  2KLI A;  1JTD A;  3C30 A;  4ETZ A;  4HJ6 A;  4X6T A;  3UDX A;  3PR6 A;  4QU3 A;  1YKD A;  2X01 A;  4HIA A;  3HCY A;  1CK3 A;  4G3W A;  5FEG A;  4OP5 A;  2PU4 A;  4IUH A;  3QP8 A;  2OWH A;  4PM7 A;  3W4Q A;  2PAV P;  3RJU A;  2XH9 A;  1DY6 A;  3A0R A;  1H8M A;  4E3K A;  2WGW A;  1F98 A;  3D72 A;  3G30 A;  2Y2K A;  1MWT A;  1N4O A;  1WA9 A;  4BL3 A;  3CIT A;  3VP0 A;  2EX9 A;  2W3G A;  5HFO A;  2O0Y A;  1F5M A;  5EVI D;  3RFB A;  1K54 A;  4S2N A;  3QNB A;  3UE1 A;  2XF3 A;  4S2M A;  5FQM A;  1PI4 A;  2R78 A;  5EVI C;  3T1S A;  3AGE A;  3MKF A;  1JVJ A;  3C7V A;  4Z9Q A;  1GSX A;  4H6J A;  1ALQ A;  1E25 A;  2EFX A;  2OOL A;  3C4P A;  4HY8 A;  3KYZ A;  1ZHH B;  3G2Z A;  3NDG A;  4CLC E;  5DTS A;  2G2W A;  4UA9 A;  2XFT A;  2IWB A;  1IEM A;  1XJ4 A;  1TEM A;  2JKT M;  1NXY A;  3LI9 A;  1FR6 A;  4YOF A;  3MQO A;  2ZQA A;  3SH9 A;  4E3L A;  2DRW A;  4BEN A;  2XGN A;  3NBL A;  1NY0 A;  1CEF A;  3IHA A;  4UQI S;  2HP6 A;  4KG5 A;  2ZM2 A;  3V3S A;  4K0W A;  5A8B A;  2V0U A;  3LIE A;  3O87 A;  4PHT A;  3BQA A;  4WF0 A;  4KZB A;  2Y4A A;  2ZMV A;  5HL6 A;  4C6Y A;  3S7P A;  2O99 A;  2OLU A;  3FKV A;  4LRZ E;  1ZTU A;  5EFW A;  5FQ9 A;  3C38 A;  1K56 D;  2VGK A;  3T50 A;  4L9E A;  2XEP A;  3ZVW A;  3L9K A;  2J8Y A;  4WZ5 C;  2XSS A;  2QJ5 A;  2WKI A;  3ITB A;  3NIA A;  2J9O A;  5FEF A;  4WLA A;  4JF6 A;  3VOZ A;  4X68 A;  3GRJ A;  3LR4 A;  3Q7V A;  1FOF A;  4MNR A;  4OQH A;  1K4F A;  3VP3 A;  2V1B A;  3TG9 A;  2Q9N A;  1XP4 A;  1LI0 A;  2HP9 A;  3BM6 A;  4XT2 B;  4UAA A;  3KSF A;  1ESU A;  4EBP A;  4QPR A;  1I2S A;  3VSL A;  5E2E A;  3NJA A;  4OP8 A;  2OAP 1;  3SS4 A;  2Y2N A;  4PM8 A;  4IBX A;  1KE3 A;  2XA7 S;  1KGE A;  3A3I A;  3RH8 B;  4WZ4 A;  2ZC4 B;  2PD8 A;  3KSH A;  3ZG9 B;  2K31 A;  4OH0 A;  1KGG A;  3LR0 A;  5F83 A;  4I39 A;  5GLC A;  3SW1 A;  5AVE A;  2ZQD A;  3UDI A;  5I94 A;  4ZJ2 A;  3MMH A;  1YSQ A;  3LID A;  4D60 A;  3P01 A;  4QD4 A;  5L8M A;  3PBO A;  1JWP A;  3CG5 A;  4HQA A;  4IVK A;  1BYW A;  4CLC B;  3WRZ A;  1YLY A;  1IYO A;  1YM1 A;  3C7U A;  3ZNT A;  1RCJ A;  4X56 A;  1CEG A;  2EA9 A;  3F1O A;  4CQH A;  5AQ7 A;  4OOY A;  3UNW A;  3MR0 A;  3BFG A;  3MJQ A;  4EER A;  2JKF A;  4DXC A;  4PKY G;  2P08 A;  4JXW A;  2G2U A;  3A3E A;  4OOL A;  3F1P A;  4MN5 A;  1IYP A;  2A2L A;  1FSY A;  5E2H A;  2X02 A;  4MLL A;  5KZH A;  1S1Y A;  2J3W A;  5IS1 A;  4LRX C;  3Q7Z A;  1S67 L;  3UDF A;  1NZU A;  3BEB A;  1W8Q A;  2EWV A;  3T4K A;  3CUE A;  4MEZ A;  3BRM A;  1LLB A;  4ZRR A;  4LEN A;  5FI7 A;  2EX8 A;  3D9Y A;  5DKK A;  1H3Q A;  4PPR A;  1VEU A;  5AJG A;  2MJ6 A;  1DJB A;  2WKR A;  2ZM8 A;  2OV5 A;  1SKF A;  3HBR A;  5CED A;  4Y15 A;  2B95 A;  1D1J A;  4GOG A;  3LIF A;  2EWW A;  4CLC D;  1FCM A;  3AGD A;  4JGQ A;  3VOY A;  1MPL A;  5HW3 A;  2V8F A;  1I5Q A;  4CLC C;  3WS2 A;  1CJF A;  5HAQ A;  4EUV A;  4R38 A;  2WGW B;  3JPU A;  4F3L A;  4O01 A;  1K4E A;  3MXQ A;  1VB6 A;  3BY9 A;  2V20 A;  4P0M A;  3T4T A;  3L7H A;  3HUN A;  3NDE A;  3PBQ A;  1YLT A;  4M3K A;  2Y91 A;  3C8C A;  3ZG0 A;  5HWT A;  1X0O A;  4IVI A;  2WYX A;  3G6O A;  3OPL A;  3DAV A;  1N9B A;  1VM1 A;  1LI9 A;  3H82 A;  3EEA A;  3BLS A;  1SDN A;  2NUT C;  4PKY A;  2VK3 A;  4JXV A;  2EX6 A;  1UWN X;  2QPN A;  4JGP A;  3EOI A;  3IXG A;  2JN7 A;  3HRE A;  1G6A A;  1K25 A;  4MCW A;  3T4O A;  2Q0O A;  2KOI A;  1O07 A;  4N1X A;  1YLJ A;  4Q0J A;  3BYD A;  3V67 A;  3MQQ A;  4KQQ A;  4KQD A;  4BBT A;  3MQ0 A;  2CC1 A;  3OPR A;  4GHI B;  3T1Q B;  3MSH A;  4HES A;  4H8R A;  3RXW A;  2ACG A;  1VQQ A;  1VET A;  1YLW A;  4N9K A;  3ZG8 B;  1A0K A;  2JKT I;  4X25 A;  3BFC A;  4L9G A;  4DE0 A;  1DJA A;  1LL8 A;  2QHK A;  3TW8 A;  5HX9 A;  3N6I A;  5F82 A;  5CGX A;  5CGS A;  3SS3 A;  3K3D A;  1XX2 A;  3GTC A;  4CPK A;  1K6S A;  1N9L A;  3LIC A;  2J80 A;  1K54 C;  4S2N C;  1P97 A;  3CMZ A;  3CAX A;  2BG1 A;  3PXP A;  4AFI A;  2NUP C;  4N9L A;  3VE3 A;  1OPX A;  3BWL A;  4JXS A;  3ULF A;  1NLZ A;  4KZ9 A;  3ZVT A;  2VKS A;  4DJ3 A;  5A90 A;  1ERQ A;  3Q7V B;  4WM9 A;  3S7N A;  3MF0 A;  3OOV A;  4X1M A;  2PRF A;  3HLE A;  3LGO A;  1K57 C;  4X1L A;  2BTF P;  4U0T A;  2GX5 A;  1S66 L;  3BW6 A;  5D3O A;  4WMC D;  1Y4O A;  3P09 A;  4OPZ A;  1PZP A;  5M18 A;  4UQI M;  5FQK A;  3BLM A;  1AWI A;  1TDG A;  5DVA A;  3HLC A;  1SCW A;  2G7U A;  1CI9 A;  2W0N A;  3PBS A;  5GLD A;  2KX6 A;  1MWU A;  4B93 A;  4YWZ A;  1E3U A;  2Y8H A;  4GD6 A;  3MZF A;  5F5Y A;  3KSI A;  3UN7 A;  2PBD P;  1RGY A;  1U60 A;  1G68 A;  1KGF A;  3CPT A;  2W1R A;  3VP4 A;  4I38 A;  1L3L A;  1ZKJ A;  3T4Q A;  3S1Y A;  3HUO A;  4R23 A;  5FSR A;  5GLB A;  2V8C A;  5KIZ A;  4NK3 A;  4GDB A;  3MFD A;  2J3T C;  2DCF A;  3HLF A;  4E3M A;  2P74 A;  3MBZ A;  3WS1 A;  4GN2 A;  4C3Q A;  1ODV A;  4IBR A;  3LY4 A;  2I9V A;  2W3D A;  4UEY A;  4LV1 A;  4HEF A; 
#chains in the Genus database with same CATH homology
 2ZOH A;  3UME A;  4ETX A;  3OLO A;  5J3W A;  1G6O A;  1STZ A;  2OAQ 1;  2QJ7 A;  4I5S A;  4KUO A;  2XSS A;  1S4S A;  2QJ5 A;  4I3I A;  3R7W A;  4MN7 A;  2D02 A;  3E4O A;  4WLA A;  2HV1 A;  4HOI A;  1XJ6 A;  3LR4 A;  4EEP A;  3B42 A;  4WN5 A;  4HH2 A;  4P6Z M;  4Y2F A;  3F1O B;  1OTB A;  2GJ3 A;  2CMN A;  2V1B A;  3B33 A;  3K3C A;  5MC7 A;  3UB7 A;  2W3F A;  3IS2 B;  4XT2 B;  5DJT A;  3F1N A;  3KSF A;  4DMZ A;  1JNU A;  1OTD A;  3P7N A;  3T4J A;  5C5K A;  5J4E A;  4QPR A;  4KQO A;  3PBN A;  2VA0 A;  3E4Q A;  4P6Z S;  2XA7 M;  4EQ1 A;  2B02 A;  3R4K A;  4EEU A;  5DFY A;  5F68 A;  3NJA A;  3E4P A;  2VV8 A;  4WEK A;  2OAP 1;  2P04 A;  1W63 Q;  3OC2 A;  3JVU A;  3VOL A;  1P9W A;  2XA7 S;  4RQ9 A;  5DF9 A;  2ZBB A;  4IHQ A;  3RH8 B;  3E98 A;  4L0L A;  2PD8 A;  2WKP A;  3KSH A;  3BY8 A;  1DP8 A;  2K31 A;  3W2Z A;  3LR0 A;  5FL3 A;  4I39 A;  3SW1 A;  1V9Z A;  4G3K A;  5AVE A;  2BAS A;  5I5L A;  3DBA A;  4I3J A;  3FG8 A;  4GLQ A;  2XRO A;  1OTI A;  1T1A A;  3K2N A;  3OCN A;  4GJ4 A;  4HNB A;  3MFX A;  2JHE A;  2L4R A;  5HD5 A;  3MMH A;  4R70 A;  3TRC A;  1YSQ A;  1OT9 A;  2B18 A;  3LID A;  3OCL A;  2J3T D;  3P01 A;  4LLO B;  2VX8 A;  5L8M A;  3PBO A;  1LSW A;  1TS6 A;  4F3L B;  4HQA A;  4IUK A;  3JVV A;  2W1T B;  3FC7 A;  2HGV A;  4R3A A;  1BYW A;  4CLC B;  3EEH A;  2OWJ A;  4Y5F A;  1NLY A;  4O0P A;  1LT0 A;  2VLG A;  2QWS A;  3EWK A;  5KSH A;  5HPF A;  3OBF A;  2WKQ A;  2VEA A;  3IBR A;  3ICY A;  3F1O A;  2DMW A;  2EA9 A;  4CQH A;  2PR6 A;  5CX7 A;  1IOU A;  4GS9 B;  3MR0 A;  4BMW A;  3MJQ A;  1G28 A;  1T19 A;  1T18 A;  4EER A;  2PR5 A;  1KOU A;  4PKY G;  1LSX A;  4EU0 A;  1OTA A;  2P08 A;  3IS2 A;  5HWW A;  4XT2 A;  5J7E A;  5F69 A;  4MDZ A;  1LSV A;  4OOL A;  2O9B A;  3F1P A;  3H82 B;  4MN5 A;  3UB8 A;  2A2L A;  1S1Y A;  2J3W A;  4NXF A;  5IS1 A;  1YAX A;  3CUE C;  1N9O A;  2ZMF A;  1XJ3 A;  1T1C A;  2O9C A;  4LRX C;  2YKH A;  3KSG A;  4LPZ A;  3GDI A;  1S67 L;  1D7E A;  2PHY A;  3KYQ A;  3LUQ A;  4WL9 A;  2VGL M;  2FH5 A;  4II7 A;  5TBM B;  4JGO A;  2PDR A;  2EWV A;  3T4K A;  2XRN A;  2VJW A;  3T4L A;  3CUE A;  3F1P B;  4ZRR A;  2PYP A;  3C2W A;  1YSP A;  2L1M A;  2JKR I;  4KUK A;  1V9Y A;  5DKK A;  5HDC A;  1H3Q A;  1OJ5 A;  1TS7 A;  4PAU A;  3UE3 A;  2VGL S;  1DP6 A;  4EET B;  5AJG A;  2Z6D A;  3PHY A;  5IT5 A;  2MJ6 A;  2KDK A;  2WKR A;  5TJJ A;  3LR3 A;  1GSW A;  4EW7 A;  3LIF A;  4B9O A;  1UGU A;  2EWW A;  3B47 A;  4CLC D;  2QYB A;  4O8G A;  4JGQ A;  2A24 A;  4JGR A;  4Q0I A;  4CLC C;  3LYX A;  3UB9 A;  4EES A;  4Y3I A;  2YKF A;  3CWF A;  4OOM A;  5HDS A;  4BBU A;  4R6L A;  2V1A A;  4EUV A;  4HJ3 A;  4R38 A;  3UMD A;  1P0Z A;  2H28 A;  2LB9 A;  2PT7 A;  4HJ4 A;  1P9R A;  4F3L A;  4O01 A;  2W1T A;  3MXQ A;  3S7O A;  1VB6 A;  1NRJ A;  3BY9 A;  3D3O A;  4CLC A;  2Y79 A;  1OJG A;  3T4T A;  4Q0H A;  4DN0 A;  5HPI A;  2L0W A;  1NWZ A;  2INW A;  2Z6C A;  3PBQ A;  3LIB A;  2A24 B;  4HP9 A;  3VE4 A;  4YNR A;  3C8C A;  2W3H A;  3LR5 A;  3TE8 A;  5HWT A;  1X0O A;  4GS9 A;  3G6O A;  4HP4 A;  3EGD C;  3VV4 A;  4M4X A;  1XFQ A;  1S1Z A;  1DRM A;  1TS8 A;  4Z1W A;  4G3V A;  4BJP A;  3BQ8 A;  1TD5 A;  3H7W B;  4WEJ A;  4ARZ B;  1IFQ A;  4MMN A;  3H82 A;  3EEA A;  4HH3 A;  2LB5 A;  4HI4 A;  3HJK A;  1T1B A;  2NUT C;  2JKR M;  4PKY A;  3PBT A;  4GHI A;  1UWN X;  5F6A A;  4JGP A;  2HJE A;  3EOI A;  4GW9 A;  4MN6 A;  3U2A A;  4DJ2 A;  5K5B A;  2M1C A;  3BJN A;  1MZU A;  2JN7 A;  1XJ2 A;  2K7S A;  3S7Q A;  1TS0 A;  5TBM A;  2V9A A;  4MCW A;  5HSQ A;  2M7V A;  3IBJ A;  2GZA A;  3T4O A;  2KOI A;  4LRY C;  3HJI A;  1UWP X;  3CLO A;  4Q0J A;  3V67 A;  3MQQ A;  1OTE A;  4I3A A;  4KQD A;  4WUJ A;  2W27 A;  4BBT A;  4EXO A;  3MQ0 A;  2PYR A;  1XFN A;  2KLI A;  3A0S A;  3C30 A;  3LIA A;  4GHI B;  4WEL A;  5HD3 A;  4ETZ A;  4HJ6 A;  3PR6 A;  3A0V A;  1YKD A;  2GNX A;  3FPW A;  3E0Y A;  1DP9 A;  2JKT I;  4HIA A;  3T4S A;  3HCY A;  4G3W A;  4L9G A;  4ME4 A;  1LL8 A;  2QHK A;  3TW8 A;  3LFV A;  2P7J A;  4IUH A;  5DFX A;  2OWH A;  3RTY A;  3NOU C;  4HHD A;  3K3D A;  5LBR A;  3UB6 A;  3A0R A;  3H9W A;  3FPV A;  5IU1 A;  1H8M A;  2HJ9 C;  3LI8 A;  1N9L A;  3LIC A;  2J80 A;  1F98 A;  3KO6 A;  1P97 A;  3D72 A;  3CAX A;  4AFI A;  1OT6 A;  3PXP A;  3R7W B;  2NUP C;  3VE3 A;  1OPX A;  3BWL A;  3ULF A;  1WA9 A;  1NLZ A;  4L9F A;  5HZH A;  3CIT A;  3TJZ C;  1N9N A;  2VKS A;  3O5Y A;  4DJ3 A;  2W3G A;  3NOP C;  2D01 A;  2ZOI A;  2O0Y A;  1F5M A;  2VV6 A;  3RFB A;  3S7N A;  4BBV A;  3MF0 A;  3OOV A;  2V0W A;  1TF1 A;  3PYP A;  1EW0 A;  2HF6 A;  4BWI A;  3NOT C;  3KX0 X;  2R78 A;  4NKP A;  2GX5 A;  4GCZ A;  5DJU A;  1S66 L;  3BW6 A;  1GSX A;  3H7W A;  4H6J A;  5HDD A;  4ARZ A;  2OOL A;  4HY8 A;  4K08 A;  3F1N B;  3KYZ A;  1ZHH B;  5AVF A;  3UE6 A;  4CLC E;  4E04 A;  5DKL A;  2QKP A;  1VHM A;  4IJG A;  4UQI M;  1XJ4 A;  3GEC A;  4FSF A;  4NEE D;  2PD7 A;  4NXE A;  2JKT M;  2O9A A;  3LI9 A;  2FZ0 A;  2G7U A;  4YOF A;  2W0N A;  3MQO A;  3PBS A;  3EQU A;  1S4R A;  2KX6 A;  4B93 A;  3ZYT A;  4H6J B;  2K2N A;  4YWZ A;  2Y8H A;  5F5Y A;  1GSV A;  3KSI A;  4FOF A;  2VZW A;  1Y28 A;  3ZQ5 A;  4UQI S;  2IA2 A;  3NHQ A;  2W1R A;  5HWV A;  5G4Y A;  4I38 A;  5A8B A;  3EQV A;  1MKM A;  2V0U A;  3LIE A;  3PBR A;  3T4Q A;  3EGX C;  4PHT A;  3BQA A;  4WF0 A;  2VV7 A;  4NXB A;  5KIZ A;  2M7U A;  1W63 M;  2ZMV A;  2J3T C;  5HL6 A;  1D06 A;  3S7P A;  2O99 A;  3CI6 A;  1MC0 A;  4LRZ E;  1ZTU A;  5EFW A;  1ODV A;  5G4Z A;  2I9V A;  2W3D A;  4UEY A;  3C38 A;  4NXG A;  2W3E A;  3T50 A;  4L9E A;  1F9I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...