5A8BA

Structure of a parallel dimer of the aureochrome 1a lov domain from phaeodactylum tricornutum
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
132
structure length
132
Chain Sequence
FSFIKALQTAQQNFVVTDPSLPDNPIVYASQGFLNLTGYSLDQILGRNCRFLQGPETDPKAVERIRKAIEQGNDMSVCLLNYRVDGTTFWNQFFIAALRDAGGNVTNFVGVQCKVSDQYAATVTKQQEEEEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of a Native-Like Aureochrome 1A Lov Domain Dimer from Phaeodactylum Tricornutum.
pubmed doi rcsb
source organism Phaeodactylum tricornutum
molecule tags Unknown function
molecule keywords PTAUREO1A LOV2 DOMAIN
total genus 41
structure length 132
sequence length 132
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 5a8bA00
3LIEA 4EEPA 4GHIA 4GW9A 4I3AA 4EESA 3KX0X 3NOUC 2INWA 3E4QA 3EEHA 2OWJA 5G4ZA 3A0VA 3UMDA 1F9IA 4EXOA 5KIZA 3HJIA 2QWSA 4LRYC 5F6AA 1GSXA 4EQ1A 5A8BA 1LSWA 5DJTA 4HY8A 5J3WA 4K08A 4PKYA 4LPZA 5HWTA 4I39A 2PR6A 5DKKA 4DJ3A 5HSQA 3GDIA 3NOTC 3P7NA 5F68A 3PYPA 3B33A 1T1CA 3ULFA 3H7WB 4EERA 2QKPA 4WLAA 2PYRA 3F1PB 1G28A 2WKRA 4HH3A 4WUJA 3ZQ5A 3H82B 2ZBBA 2L0WA 1OTIA 1S1ZA 1TS6A 1XJ3A 2Z6DA 3BWLA 3F1OB 3IS2A 4HQAA 1KOUA 4MN6A 5I5LA 5HZHA 1MZUA 3MQOA 2R78A 2OWHA 5J7EA 3IBRA 2M1CA 1LL8A 2VV8A 4HIAA 2PYPA 1OTBA 2QJ7A 3LIDA 4I5SA 5EFWA 1S4SA 1T18A 3NHQA 2P7JA 3E4PA 1OTEA 2I9VA 4HOIA 1LT0A 3A0RA 2KDKA 3LUQA 3T50A 5HDDA 2V0WA 2ZOIA 3VOLA 3HJKA 2EA9A 4F3LA 3OLOA 4DJ2A 2VV6A 4NXEA 3UB8A 3SW1A 4KUOA 1OJGA 2V1AA 1V9YA 4HP9A 4R38A 5HD5A 5TBMB 4EW7A 4KUKA 1BYWA 1TS0A 5IU1A 1P97A 4H6JA 3CWFA 1T1BA 3LI9A 1XFNA 5HDCA 3LICA 2D02A 2PD7A 4WN5A 3LIFA 4R3AA 1F98A 3UB9A 1TS7A 4R6LA 1N9OA 4NXFA 4RQ9A 1S66L 3MXQA 1GSWA 3LIAA 4LRXC 5F69A 1S4RA 3MR0A 1S67L 2L1MA 2YKFA 3A0SA 3G6OA 1UWPX 1OT6A 3NOPC 3PHYA 4KQDA 2H28A 4NXGA 2K7SA 1OTDA 4HNBA 1S1YA 5DJUA 2VEAA 2A24B 2V0UA 2JN7A 1OJ5A 4HH2A 3RH8B 2W0NA 2JHEA 2W27A 1DP8A 3C8CA 4GCZA 5DKLA 4BBTA 2PD8A 2L4RA 4I3JA 2OOLA 3EWKA 5HWWA 5J4EA 2PDRA 2V9AA 4MN5A 1P0ZA 1X0OA 4HJ6A 2GJ3A 4R70A 3LI8A 3RTYA 2B02A 1D7EA 2VV7A 2WKQA 3D72A 5F5YA 5G4YA 5HDSA 4L9EA 1D06A 1DP9A 4PKYG 4YWZA 3BY9A 4F3LB 2QHKA 2KX6A 4JGOA 3CAXA 4L9GA 1OTAA 1TS8A 4H6JB 5TBMA 2A24A 1N9NA 1LSXA 4GS9A 5HD3A 3UMEA 4BBVA 3GECA 4HHDA 2Z6CA 3MFXA 1VB6A 4E04A 5IS1A 1JNUA 4WF0A 5AVEA 2J80A 1XFQA 3VE4A 3BY8A 4WL9A 3UE6A 3H7WA 3F1NA 1DP6A 3MQQA 4JGQA 4EETB 3ICYA 4BBUA 3CLOA 2YKHA 4XT2A 4B9OA 3FC7A 4HJ4A 4HI4A 4M4XA 4NXBA 5AVFA 1T19A 1ODVA 3FG8A 1GSVA 1XJ4A 2HV1A 2ZOHA 3K3CA 2D01A 2VLGA 4HP4A 3LIBA 3LYXA 4LRZE 4JGRA 1EW0A 1UWNX 2PR5A 3VE3A 2V1BA 1NWZA 1OT9A 1UGUA 2PHYA 3NJAA 3F1NB 4GHIB 4HJ3A 3E4OA 2BASA 3C2WA 1V9ZA 3H9WA 3MJQA 4L9FA 4LLOB 4XT2B 1DRMA 1LSVA 1XJ6A 2CMNA 1T1AA 3F1PA 3K3DA 3H82A 4I3IA 1XJ2A 1Y28A 2QJ5A 3UB7A 3UB6A 5HWVA 1WA9A 3F1OA 3IS2B 4EEUA 1N9LA 4GS9B 4I38A 4JGPA 2WKPA
chains in the Genus database with same CATH superfamily
2RCXA 1DJBA 5LBRA 4YOFA 5G4ZA 1ERQA 1F9IA 1GSXA 4Q0IA 2WUQA 4IUHA 4K08A 3P01A 5HSQA 5HL1A 3NOTC 1K4FA 1MWUA 4HH3A 5CHUA 3VOLA 1TS6A 2ZC7A 4HQAA 3MQOA 3WS5A 1YLTA 1M6KA 2Y2HA 3NCKA 3QHYA 1SZVA 5EVIA 5HAPA 2XD5A 3E2LA 3GVBA 1ES3A 1QMEA 1XKZA 2NUPC 1VHMA 1GHMA 2W3EA 5TBMB 3KYQA 4LV0A 2RL3A 5M1AA 4R6LA 4IUKA 2EXAA 5F69A 1YLWA 3MR0A 3LR0A 3AGEA 2A24B 3WRZA 4GCZA 4LCLA 1EWZA 2OOLA 2OV5A 2PDRA 3LI8A 1D7EA 5A93A 4GD8A 1NRFA 2QHKA 1VEUA 4HBTA 5HD3A 3UMEA 3HVFA 4HHDA 4ZJ3A 3UE6A 1D1JA 1SKOB 1W8YA 3S7NA 4OPZA 3DTEA 1G5UA 1E3UD 5IT5A 1OT9A 1BTLA 4ZAMA 3VFFA 4OQIA 3T1QB 2PT7A 2XH9A 4Y0TA 3CMZA 2I72A 2E8JA 3F1OA 3QP4A 1FILA 3VP4A 3LIEA 3MBZA 3L9KA 4LV1A 4EESA 4FUWA 3TG9A 3NOUC 3EEHA 3KYZA 4IJGA 3TRCA 3T4TA 3DTMA 4DJ3A 1MKIA 3P09A 4KZAA 3HUOA 3TE8A 5E43A 3S7QA 4R0QA 4KQOA 1F2KA 1LL5A 1K55C 3VV4A 3NHQA 2H0TA 1GHPA 3LUQA 3ZNYA 2V0WA 2IWDA 3RJUA 2P08A 2VV6A 2ZC3B 2JKFA 4R38A 3B42A 4KUKA 1Y4OA 1PNEA 3U4LP 4E3OA 2C6WB 2D02A 3BQAA 1S4RA 4KQDA 2W3GA 4FH2A 1OTDA 1KE0A 2W0NA 5DKLA 1MY8A 5HW3A 1X0OA 2GJ3A 2DCFA 4YWZA 3KSGA 2HP6A 3A3IA 5DF9A 2Z6CA 5CERA 1XFQA 4O8GA 3BY8A 5CTMA 3T4LA 3ICYA 4QY5A 3HLGA 5AQBA 5CX7A 3GR2A 3A3DA 1STZA 1RCJA 5FQMA 4X53A 2PHYA 4GHIB 3E4OA 3CZDA 3BJNA 5KZHA 2ZL1B 2PU2A 1W8QA 2GDNA 3UY6A 4P85A 3O3VA 3AGFA 4KQRA 3JVVA 3IF6A 5EVID 2J7VA 3N4IA 5KMWA 4GLQA 4B4XA 5F68A 3LCEA 3B33A 4OPRA 5DTKA 3ITAA 4R4RA 5CRFA 4RYEA 3PXPA 1OTBA 2EXBA 2PU4A 3MZFA 1VETB 2PAVP 3T50A 3C38A 5EE8A 1TD5A 2V2FF 4C75A 4DJ2A 1V9YA 1F5MA 2WAEA 5MC7A 2B95A 3ZVWA 3UDFA 5EVIB 4O0PA 1N9OA 3G32A 1S66L 1GSWA 1PI4A 3LY3A 3UDIA 2L1MA 3PHYA 5AQ7A 1YAXA 1PFLA 1DP8A 3GQZA 2PD8A 1NRJA 1K56A 3SS5A 3EQVA 5G4YA 4WMCD 3PBSA 2WADA 4PPRA 1KDSA 5DFYA 1FCOA 5EM1A 4K91A 3QP1A 3MFXA 3AGDA 2J80A 2Y2OA 3G35A 4CLCB 5CTNA 3QP2A 4JGQA 3CG5A 3TSGA 1ALQA 1ODVA 3ZG8B 2XROA 3OPRA 2JC7A 4E6XA 1I5QA 3CPTA 2XLNA 3C2WA 4LLOB 1W7FA 3HLBA 4CQHA 4I3IA 1I2SA 1CEGA 4D2OA 4PHTA 4EV4A 4I38A 4EUVA 1ONHA 4I3AA 3IX8A 5FASA 5A8BA 4PM5A 5TFQA 4P6ZS 2EWWA 1IOUA 2XA7S 5J3WA 3N6IA 5CEBA 5FI2A 5TR7A 2JBFA 2Y4AA 1LHYA 1TDGA 3T4KA 5CHMA 2J3WA 1NY0A 4HBUA 2OWHA 2QMIA 3LIDA 2EWVA 1W79A 4UA6A 5F82A 3PBTA 1LT0A 4F3LA 4OQ0A 3LR4A 5U47A 2ZMAA 3NDEA 1K54A 1FQGA 5HARA 3TJZC 3LI9A 3FKWA 2BG1A 4DE1A 1NJ4A 1WYBA 2HDSA 4Q8IA 1N4OA 1OT6A 5HPIA 4MEZA 3IH9A 4R3BA 4R1GA 4Y0UA 5DTTA 4WYYA 2JKGA 1C3BA 2O9AA 4BBVA 2O99A 1E4DA 3VP2A 2P9VB 4ZTKA 1DP6A 5A91A 2ZM8A 4DRTA 5FAPA 3PBOA 1IYQA 4HP4A 5TGFA 5FQIA 4JGRA 3ZCZA 1K54C 2Y91A 3A3EA 5DFXA 4JKTA 3QP8A 3SS4A 3KO6A 4EBNA 5FDHA 4Z1WA 5L07A 2ZMVA 3E4QA 1OMEA 4M3KA 5AQAA 4GOGA 4B88A 5DKKA 5CECA 1XX2A 3RFBA 3QP6A 4FOFA 4WLAA 4NEED 4OLDA 3H82B 2ZBBA 3C4OA 3Q07A 2JKRM 1AWIA 1WYCA 2XSSA 3N8RA 2QJ7A 3IHAA 1JVJA 5EFWA 1W63M 2Y2JA 3IBJA 3VP1A 5G18A 4NKPA 1H3QA 3HBRA 2ZQ8A 2PBYA 4EW7A 3DTIA 4H6JA 2ZQDA 3MFDA 2X01A 3LICA 4R3AA 2JCHA 4E3MA 4CJNA 2H28A 4Z9QA 4GJ4A 2HGVA 4FSFA 2ZC4B 4KZ8A 4UA9A 5CGWA 2JHEA 5A92A 4ZRRA 4I3JA 5DVAA 3RTYA 3LY4A 1HVBA 5FSRA 3Q7ZA 4AFIA 1NZOA 1LLBA 3D3OA 2FH5A 3UE0A 3JYIA 4NK3A 1GSVA 1KVLA 3LYXA 4LRZE 1CJFA 3H9WA 5DTSA 4DE2A 3M6HA 4MN7A 3GTCA 2HDRA 5GHXA 4MNRA 4JGPA 2HZ5A 1L0DA 4GHIA 3IXHA 4OOMA 3W4QA 3UMDA 2W1RA 5CEDA 3VP3A 1BLCA 1IEMA 4C6YA 1TF1A 4I39A 1CI8A 3HUMA 3N8LA 4WUJA 2L0WA 3IS2A 2HDQA 4ID4A 1MC0A 1IYOA 4S2MA 4DMZA 3ZVTA 4CLCE 4N9LA 1SKFA 4U0XA 3A3FA 3S7OA 1J3WA 5CXWA 3UE1A 3MKEA 4O01A 4RVAA 2EA9A 1Z09A 2VZWA 4NXEA 5HD5A 2J9OA 3PBNA 1XFNA 1IYPA 1SDEA 2XD1A 4OP8A 1GCEA 3CITA 3LIAA 2WGIA 5E2HA 1J9MA 2LB5A 5D3OA 5FAQA 1FCMA 3QNCA 5J4EA 2B02A 5HPFA 3BY9A 2KX6A 4L9GA 4E3NA 2A24A 4GS9A 3GECA 3D9YA 3MKFA 3QP5A 4WL9A 1YLJA 4Y15A 4XT2A 2YKHA 4B9OA 2XEPA 3FC7A 4HJ4A 2ZQ7A 4WEJA 4XXRA 4BD0A 4FD8A 2ZOHA 4DDSA 2HV1A 2VGJA 3LIBA 3NBLA 4S2NC 3HLEA 3FKVA 4QY6A 3SZTA 3IXBA 4HJ3A 5EVEA 2A2LA 1XJ6A 1T1AA 1XJ2A 3PR6A 1TVFA 1WA9A 5EPHA 3IWQA 5JYOA 2EX2A 2HJ9C 4BL3A 1LSWA 2PR6A 3ULFA 2XQZA 2WKIA 4II7A 1O07A 5J7EA 1U60A 1YQSA 1EI5A 3E4PA 1OPXA 1E3UA 2FFYA 3OLOA 3ZG7B 3EEAA 4UA7A 1YSPA 1Y54A 3U2AA 3CJMA 4LV2A 4XUZA 2V8CA 1T1BA 4B4ZA 4E6WA 1KGGA 3FZCA 2G7UA 1H5XA 4OPYA 2M7VA 4FCFA 3S1YA 3G6OA 4IVIA 3KSIA 4N1XA 1FOFA 1LL9A 3HREA 4LENA 1N9BA 2L4RA 5HWWA 5HWVA 4L0LA 2WAFA 1L0EA 3T1RA 1TS8A 2LB9A 1WE4A 5FA7A 2P04A 3CI6A 2W3HA 4UAAA 4OP5A 3BFGA 4QWOA 3IF6B 2PBDP 4WBGA 5L8MA 2J3TC 1CK3A 1T19A 3UPPA 1NXYA 3C4PA 2ZC5B 4X25A 3G2ZA 5HWTA 3F1NB 5E2FA 1MPLA 3PAGA 3VE4A 1DRMA 2CMNA 1ZKJA 4NG2A 3UB6A 3UB7A 4GZBA 5EVLA 4D60A 2ZQ9A 4IBXA 3V67A 4K0WA 3C30A 2GZAA 4X69A 1IYSA 1ZG4A 4IVKA 3BFEA 3UB5P 3FV7A 3E98A 2QKPA 4WM9A 1PW1A 1JTGA 4Y2FA 1S1ZA 4KZ7A 4MN6A 4ARZB 2M1CA 4EQIA 2EX8A 5EOEA 4I5SA 2M7UA 1K0KA 3M2KA 3C7VA 3W4OA 4BJPA 3MQ0A 4U0TA 4F94A 3BLSA 3Q81A 3L7HA 4G3WA 1Z6FA 1NLZA 3MF0A 4GN2A 1S67L 2YKFA 4KG6A 1S1YA 5GHZA 1PWDA 3RH8B 2IWBA 4JXVA 3EWKA 2V9AA 3LEZA 1SCWA 1FCNA 5GLAA 5TJJA 5HAIA 3HLWA 4S2KA 2ZQAA 2ZM2A 1KDWA 5FQKA 1PYYA 4BMWA 5E2GA 2VLGA 1IKGA 3MS6A 2Y55A 1ZC2A 4Y17A 2XRNA 1CI9A 4L9FA 3CUEA 3IX3A 2WZXA 2Y2IA 4KQQA 5M18A 2Q9NA 3V39A 4EEPA 4MDZA 3Q82A 2INWA 4BQMA 4QHCA 5KIZA 4LRYC 5F6AA 3O88A 4PM6A 4WZ4A 4HY8A 2FZ0A 2V20A 1MBLA 3P7NA 4OLGA 1HD8A 4DDYA 1H8MA 4YNRA 2QZ6A 3ZQ5A 5EM0A 3MSHA 3TOIA 3PAEA 4HESA 5HZHA 2Q0OA 4E3IA 1LL8A 5M19A 5L09A 3DW0A 4BLMA 3G34A 1ES5A 1L0FA 1RGZA 1QMFA 3O87A 1S6RA 1P9RA 3MZEA 1OJGA 1G6AA 2XFSA 4OONA 3V5MA 2VGLS 5HX9A 2JE5A 1ES2A 4R3JA 1IFQA 4QU3A 4RQ9A 1JWZA 2O9CA 3NOPC 3E2KA 3SH9A 2VEAA 1YKDA 3SH7A 3FWLA 2BLSA 1D06A 4F3LB 4JGOA 3OOVA 5DF8A 3WWXA 4GKUA 1N9NA 1LSXA 4BBUA 4N9KA 1ZTUA 5I94A 4LV3A 4NXBA 2K2NA 3QNBA 3HLDA 3IWIA 1YMSA 5KSHA 1EROA 3NJAA 4DE3A 3F1PA 2Y79A 1SHVA 2H0YA 2HP9A 3V3SA 1PW8A 2O9BA 3TW8A 3WS1A 3GSGA 1L0GA 2HF6A 2Y2QA 1KGFA 2UV0E 2VJWA 4BL2A 5L2FA 1BLSA 4EXOA 1KE3A 3HJIA 3WS4A 1TDLA 1ACFA 1M40A 4KG5A 4JF6A 4DF6A 2HPBA 4CLCA 1SKOA 3F1PB 1XJ3A 4Y0OA 5FDSA 2EX9A 5C5KA 3S4XA 2X71A 3IBRA 2PYPA 3DAVA 1K57A 4QPRA 1G68A 4KENB 2P7JA 4HOIA 3FPWA 1YSQA 2Y59A 2ZOIA 3UNWA 2QYBA 5CGXA 2V1AA 1BULA 1MWTA 4HP9A 2UWXA 1RGYA 5IHVA 2Q9MA 4P87A 3W2ZA 2A3UA 5HDCA 3VP0A 3BRMA 3LIFA 4NETA 2HJEA 1GHIA 3LR5A 2VK3A 1K56D 1CEFA 4Y13A 4JXWA 5F1FA 4RX3A 5BOHA 3ZG5A 1OJ5A 1PZOA 4E3KA 3C8CA 1FR6A 2HDUA 3OPLA 3OCLA 4MMNA 4PKYG 4Y5FA 1Q2QA 1OTAA 3BFDA 3OCNA 4JXGA 1ERMA 5HFOA 4WF0A 5AVEA 2J9PA 1K55A 4DXCA 4HEFA 3MXRA 4O7DA 5E2EA 1LI0A 1W5DA 4OQGA 4N92A 3M6BA 2R9WA 1EW0A 1UWNX 1NWZA 2BASA 2WK0A 4KZ9A 3K3DA 3A3JA 1ONGA 4S2OA 5GLBA 2BTFP 3NIAA 1XA1A 1ZG6A 3IHBA 1P9WA 3MMHA 1HTZA 4OKPA 3JVUA 2ZL1A 1FSYA 4E3JA 4EERA 2R78A 4GB7A 4G3VA 4P6BA 2KLIA 4PAUA 4EU0A 3Q1FA 3T4OA 2I9VA 3A0RA 1BZAA 4ETXA 5FQQA 4X68A 5F83A 5FI6A 3EGDC 4OOYA 5JYPA 4ME4A 1H8ZA 1P97A 2P74A 3CWFA 2ZQCA 3ITBA 4U3TA 1F98A 1YPRA 2WGWB 3MXQA 3A0SA 1ESUA 3SOIA 1PRQA 4R23A 1AXBA 4WMCA 4BBTA 2Y2PA 4JLFA 4E3LA 4BWIA 1CQAA 1BLHA 4OPQA 4KG2A 1YMXA 2WGWA 2V8FA 4ZBEA 3LO7A 2W1TA 4WZ5C 3CHWP 3N7WA 3MQQA 4S2IA 2ACGA 2W3DA 5J8XA 4KZBA 4HI4A 5AVFA 2ZD8A 4RA7A 4MBKA 1VQQA 2D01A 3PBQA 2H10A 3JPUA 4OQHA 1K4EA 3BYDA 3IS2B 5K5BA 2PRFA 4BENA 4ESPA 5FEFA 2V1ZA 3R4KA 4X6TA 4GW9A 2AVXA 4S2JA 1FSWA 4KZ5A 3PTEA 1MWRA 3NECA 4EQ1A 1XPBA 4PKYA 1IELA 5FI7A 3D4FA 1T1CA 3H7WB 3BWLA 3T12B 2QPNA 3PBRA 3VFHA 2WKEA 1K38A 4ETZA 2Y2LA 1NYMA 1G6OA 2Z2MB 2ZM0A 2DNSA 1E25A 5AJGA 3HJKA 3IWOA 4KUOA 5EV0A 2R9XA 4G3KA 4EBLA 3HLCA 3MXSA 1SDNA 3BM6A 4WN5A 3ZGAB 4NXFA 1MWSA 2VGLM 1UWPX 4CPKA 4HH2A 1FR1A 1I2WA 1MXOA 1ZHHB 2WGVA 5FEGA 3O5YA 3UPNA 4JF4A 4E04A 1JNUA 3WRTA 3F1NA 1DJAA 3NDGA 3EQUA 4UHUA 4QB8A 1VM1A 3IXGA 4X56A 3VE3A 2PR5A 3ZG0A 3UO9A 1DJCA 3LR3A 5F1GA 4LCMA 1FIKA 3H82A 3UE3A 3VSKA 1Y28A 2QJ5A 3G4PA 3SH8A 3UDXA 3T1XA 3B3XA 2B5RA 1H8YA 4DE0A 5CHJA 4X55A 2OWJA 3A0VA 2JKTI 3S7PA 1BT5A 4PM8A 1K57C 3EOIA 2PYRA 3GRJA 3HUNA 3OBFA 1BLPA 3VMAA 4UQIS 2XF3A 4MLLA 4EWFA 4CLCC 4MBHA 2OLVA 1OTEA 4ZJ2A 5HDDA 3C5AA 4JBFA 4X1MA 3HL9A 3HCYA 3LGOA 2WYXA 3B47A 3BLMA 1ESIA 5HL6A 3C7UA 2PD7A 1ES4A 3UB9A 3OPPA 3FPVA 1XXMA 1MKMA 4QD4A 1IKIA 4R4SA 4MBFA 3ZYTA 1JTDA 1HLUP 4LGWA 3ISGA 3CPTB 1P0ZA 3ZDJA 2WKQA 2XDMA 3D72A 5HDSA 2OLUA 3UN7A 2XR0A 1VB6A 5IS1A 1BUEA 4EETB 3NULA 2IWCA 3VOZA 4C3QA 5CGSA 1A0KA 2V1BA 4XT2B 4YFMA 4H8RA 4X1LA 5HAQA 5DF7A 1YM1A 2KOIA 3IX4A 4GS9B 4P0MA 3KX0X 4KZ6A 1K6RA 1RP5A 2QWSA 3GMWA 3G30A 2E8IA 4LPZA 1HZOA 2ZLYA 1G28A 2WKRA 1OTIA 3BQ8A 2Z6DA 1S0WA 1BSGA 1VETA 3T1SA 5EECA 1K25A 3DBAA 3P98A 4KZ3A 2Y2GA 1S4SA 1T18A 3T4JA 1CF0A 4IHQA 2CC1A 3RXWA 2Y2KA 4GDBA 1Q2PA 5A90A 1L3LA 2A49A 5AQ9A 2GX5A 2K31A 3BFCA 4JPMA 3ZG9B 3SS3A 3NC8A 2IA2A 1PWCA 2XGNA 3T4SA 1XGIA 4NXGA 1XGJA 3R7WB 2H5SA 2JN7A 2W27A 4R70A 3E0YA 5F5YA 2VV7A 4FTXA 4JXSA 1H0MA 4K0XA 3N8SA 5FATA 3IXDA 4S2PA 3CLOA 3LEQA 5FQJA 4Q0HA 3NY4A 3FG8A 4DKIA 1JWPA 1XJ4A 4IBRA 3ZNTA 1PIOA 2WZZA 1UGUA 4N1HA 3WS2A 1V9ZA 2VKSA 1LSVA 4UQIM 3I7JA 5GLCA 3BEBA 4LFUA 3BW6A 4EEUA 1N9LA 3HLFA 4EUZA 3DWZA 2WKPA 3OC2A 1GA9A 5KSCA 4ARZA 2J3TD 4CLCD 2FFFB 1LI9A 2W1TB 3VSLA 4PMAA 3IQAA 3GDIA 3BFFA 3PYPA 3ZHHA 3M2JA 2G2WA 5FL3A 1KOUA 3V50A 3IT9A 2VV8A 1TEMA 2VGKA 2XA7M 2KDKA 1VEUB 4DN0A 2MJ6A 3SW1A 2VX8A 3MZDA 2EFUA 3KSHA 3S22A 3DWKA 1BYWA 1TS0A 3IF6C 1PI5A 3EGXC 4Q0JA 1YT4A 1TS7A 3FYZA 4B93A 1JWVA 1DY6A 4Y7PA 5GHYA 5EOOA 4HNBA 2V0UA 2OAP1 4KZ4A 5GLDA 3O86A 1DP9A 5L10A 4H6JB 1L2SA 5GL9A 3OPHA 3H7WA 4JF5A 2OSUA 2ZJ9A 1PWGA 2VA0A 3V3RA 4M4XA 3K2NA 2JKRI 3ZFZA 2OAQ1 1NYYA 3R7WA 3GV9A 3MJQA 4XUXA 5EUAA 1KGEA 3DTKA 2HP5A 1KVMA 5FQ9A 4ZDXA 3UPOA 3BECA 2Z2LB 4S2NA 4WZ5A 4ZJ1A 4GDNA 3G2YA 2EFXA 4YINA 1K6SA 1NLYA 4UEYA 4GNUA 5DJTA 5FAOA 1W63Q 1YLZA 2ZC6B 2C5WB 4A5RA 4FH4A 1XA7A 3F1OB 4IEDA 3KSFA 3W8KA 5I5LA 1MZUA 3T4QA 2Y2MA 4HIAA 1YLPA 2G2UA 2W3FA 1KE4A 2EX6A 4PM9A 3W4PA 4GD6A 4WELA 4DXBA 4EBPA 2X02A 4S2LA 3UB8A 4P6ZM 3LFVA 2ZMFA 1YLYA 3CUEC 3KYEA 1O7EA 2Y8HA 4MCWA 2NUTC 4LRXC 2P9VA 2B18A 2XFTA 2K7SA 3IH8A 5DJUA 4OH0A 3NI9A 1PZPA 2DMWA 3Q7VA 4MN5A 2DRWA 4HJ6A 3VOYA 4L9EA 4Y3IA 4RX2A 3RXXA 2J8YA 4QJGA 5TBMA 3CAXA 4PM7A 2WKHA 5EVIC 3OZHA 4WEKA 1NZUA 2Y2NA 3IF5A 4BD1A 2GNXA 3K3CA 5IU1A 3Q7VB 4OOLA 2O0YA 2XK1A 1XP4A 1GA0A 3WS0A 2JKTM 4OVDA 3G31A
chains in the Genus database with same CATH topology
4EEPA 4Z1WA 4MDZA 2ZMVA 5LBRA 4YOFA 2INWA 3E4QA 2OWJA 5G4ZA 3A0VA 1F9IA 5KIZA 2JKTI 3S7PA 4LRYC 5F6AA 1GSXA 4Q0IA 4HY8A 2FZ0A 4IUHA 4K08A 3P01A 5DKKA 5HSQA 3NOTC 3P7NA 3RFBA 1H8MA 3EOIA 2PYRA 4FOFA 4NEED 4WLAA 4HH3A 4YNRA 3ZQ5A 3H82B 2ZBBA 3VOLA 1TS6A 2JKRM 4HQAA 5HZHA 3MQOA 3OBFA 1LL8A 4UQIS 2XSSA 2QJ7A 5EFWA 4CLCC 1W63M 3IBJA 1OTEA 4NKPA 5HDDA 2NUPC 1P9RA 1VHMA 1H3QA 1OJGA 2W3EA 3HCYA 3B47A 5TBMB 4EW7A 4H6JA 5HL6A 2VGLS 3KYQA 3LICA 2PD7A 4R3AA 1IFQA 3UB9A 4R6LA 4RQ9A 4IUKA 3FPVA 5F69A 2O9CA 1MKMA 3MR0A 3NOPC 2H28A 4GJ4A 3ZYTA 2HGVA 3LR0A 4FSFA 2VEAA 1YKDA 2A24B 2JHEA 4GCZA 4ZRRA 4I3JA 2OOLA 2PDRA 3RTYA 1P0ZA 3LI8A 2WKQA 1D7EA 3D72A 5HDSA 1D06A 4F3LB 2QHKA 4JGOA 3OOVA 4BBUA 1N9NA 1LSXA 3UMEA 5HD3A 4HHDA 1VB6A 5IS1A 4AFIA 3UE6A 1ZTUA 3D3OA 3S7NA 2FH5A 4EETB 4NXBA 2K2NA 1GSVA 3LYXA 4LRZE 5KSHA 5IT5A 3NJAA 2V1BA 1OT9A 3H9WA 4XT2B 3F1PA 2Y79A 2PT7A 4MN7A 3F1OA 2O9BA 3TW8A 2KOIA 2HF6A 4GS9B 4JGPA 3LIEA 2VJWA 4GHIA 4EESA 3KX0X 4OOMA 3NOUC 3UMDA 2W1RA 3EEHA 4EXOA 3KYZA 3HJIA 4IJGA 3TRCA 2QWSA 3T4TA 4LPZA 1TF1A 4I39A 4DJ3A 4CLCA 3F1PB 1G28A 2WKRA 4WUJA 2L0WA 1OTIA 3BQ8A 1XJ3A 2Z6DA 3IS2A 3TE8A 5C5KA 1MC0A 3S7QA 3IBRA 4KQOA 3DBAA 2PYPA 4DMZA 4CLCE 3VV4A 1S4SA 1T18A 4QPRA 3NHQA 3T4JA 4IHQA 2P7JA 3S7OA 4HOIA 3FPWA 3LUQA 4O01A 1YSQA 2V0WA 2ZOIA 2EA9A 2QYBA 2P08A 2VV6A 2VZWA 4NXEA 2V1AA 4HP9A 4R38A 5HD5A 3B42A 2GX5A 2K31A 4KUKA 3W2ZA 3PBNA 1XFNA 2IA2A 5HDCA 2D02A 3LIFA 3CITA 3T4SA 2HJEA 3BQAA 3LR5A 3LIAA 1S4RA 4KQDA 2W3GA 4NXGA 1OTDA 3R7WB 2LB5A 2JN7A 1OJ5A 2W0NA 3C8CA 2W27A 5DKLA 5J4EA 4R70A 1X0OA 2GJ3A 3E0YA 2B02A 5F5YA 2VV7A 5HPFA 4YWZA 3OCLA 4MMNA 4PKYG 3KSGA 3BY9A 4Y5FA 2KX6A 4L9GA 1OTAA 3OCNA 2A24A 4GS9A 5DF9A 3GECA 2Z6CA 4WF0A 5AVEA 1XFQA 4O8GA 3BY8A 4WL9A 3T4LA 3ICYA 3CLOA 2YKHA 4XT2A 4B9OA 3FC7A 4HJ4A 4Q0HA 4WEJA 3FG8A 5CX7A 1XJ4A 2ZOHA 2HV1A 3LIBA 1STZA 1EW0A 1UWNX 1NWZA 1UGUA 2PHYA 4HJ3A 2A2LA 4GHIB 3E4OA 2BASA 1V9ZA 3BJNA 2VKSA 1LSVA 4UQIM 1XJ6A 1T1AA 3K3DA 1XJ2A 3PR6A 3BW6A 1WA9A 4EEUA 1N9LA 2WKPA 3OC2A 4ARZA 2J3TD 2HJ9C 4CLCD 3JVVA 1LSWA 2W1TB 1P9WA 3MMHA 4GLQA 2PR6A 3JVUA 3GDIA 5F68A 3ULFA 3PYPA 3B33A 4EERA 4II7A 5FL3A 1KOUA 2R78A 5J7EA 4G3VA 2VV8A 3PXPA 1OTBA 2KLIA 4PAUA 4EU0A 3T4OA 3E4PA 1OPXA 2I9VA 2XA7M 3A0RA 2KDKA 3C38A 3T50A 4DN0A 4ETXA 1TD5A 3OLOA 2MJ6A 3EEAA 4DJ2A 3SW1A 2VX8A 1YSPA 1V9YA 3EGDC 1F5MA 3U2AA 3KSHA 4ME4A 1BYWA 1TS0A 5MC7A 1P97A 3EGXC 3CWFA 1T1BA 4Q0JA 1F98A 4O0PA 1TS7A 1N9OA 2G7UA 1S66L 3MXQA 1GSWA 2M7VA 4B93A 2L1MA 3A0SA 3G6OA 3PHYA 3KSIA 4HNBA 1YAXA 2V0UA 2OAP1 1DP8A 4BBTA 2PD8A 2L4RA 5HWWA 1NRJA 3EQVA 4BWIA 5HWVA 5G4YA 4L0LA 1DP9A 3PBSA 5DFYA 1TS8A 2LB9A 4H6JB 3MFXA 2P04A 3CI6A 2W3HA 2J80A 4CLCB 2W1TA 3H7WA 4JGQA 3MQQA 2W3DA 5L8MA 2VA0A 2J3TC 4HI4A 4M4XA 5AVFA 1T19A 1ODVA 2XROA 2D01A 3PBQA 3K2NA 2JKRI 5HWTA 2OAQ1 3F1NB 3C2WA 3R7WA 3MJQA 4LLOB 3VE4A 1DRMA 2CMNA 4CQHA 4I3IA 3UB6A 3UB7A 3IS2B 5K5BA 4PHTA 4I38A 4EUVA 3V67A 3R4KA 4GW9A 4I3AA 3C30A 2GZAA 1NLYA 5A8BA 4EQ1A 4P6ZS 4UEYA 2EWWA 1IOUA 2XA7S 5DJTA 5J3WA 4PKYA 1W63Q 3E98A 1T1CA 3H7WB 2QKPA 3T4KA 2J3WA 3BWLA 4Y2FA 1S1ZA 3F1OB 3KSFA 4MN6A 4ARZB 3PBRA 5I5LA 1MZUA 2OWHA 3T4QA 2M1CA 4ETZA 4HIAA 3LIDA 4I5SA 2EWVA 2M7UA 1G6OA 2W3FA 3PBTA 1LT0A 5AJGA 3HJKA 4BJPA 4F3LA 4WELA 3LR4A 3MQ0A 3UB8A 4KUOA 4P6ZM 3LFVA 4G3KA 2ZMFA 3CUEC 3TJZC 3LI9A 2Y8HA 4WN5A 4G3WA 1NLZA 3MF0A 4MCWA 2NUTC 4NXFA 2VGLM 4LRXC 1S67L 2YKFA 1UWPX 1OT6A 2B18A 2K7SA 5HPIA 5DJUA 1S1YA 4HH2A 3RH8B 2DMWA 1ZHHB 3EWKA 4MN5A 2V9AA 4HJ6A 3O5YA 4L9EA 4Y3IA 5TJJA 5TBMA 3CAXA 2O9AA 4BBVA 2O99A 4E04A 1JNUA 4WEKA 3F1NA 1DP6A 3EQUA 2GNXA 4BMWA 3PBOA 4HP4A 3K3CA 2VLGA 4JGRA 3VE3A 2PR5A 2XRNA 5IU1A 4OOLA 2O0YA 3LR3A 4L9FA 3CUEA 3H82A 5DFXA 3UE3A 1Y28A 2QJ5A 2JKTM 3KO6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LIE A;  4EEP A;  4GHI A;  4GW9 A;  4I3A A;  4EES A;  3KX0 X;  3NOU C;  2INW A;  3E4Q A;  3EEH A;  2OWJ A;  5G4Z A;  3A0V A;  3UMD A;  1F9I A;  4EXO A;  5KIZ A;  3HJI A;  2QWS A;  4LRY C;  5F6A A;  1GSX A;  4EQ1 A;  5A8B A;  1LSW A;  5DJT A;  4HY8 A;  5J3W A;  4K08 A;  4PKY A;  4LPZ A;  5HWT A;  4I39 A;  2PR6 A;  5DKK A;  4DJ3 A;  5HSQ A;  3GDI A;  3NOT C;  3P7N A;  5F68 A;  3PYP A;  3B33 A;  1T1C A;  3ULF A;  3H7W B;  4EER A;  2QKP A;  4WLA A;  2PYR A;  3F1P B;  1G28 A;  2WKR A;  4HH3 A;  4WUJ A;  3ZQ5 A;  3H82 B;  2ZBB A;  2L0W A;  1OTI A;  1S1Z A;  1TS6 A;  1XJ3 A;  2Z6D A;  3BWL A;  3F1O B;  3IS2 A;  4HQA A;  1KOU A;  4MN6 A;  5I5L A;  5HZH A;  1MZU A;  3MQO A;  2R78 A;  2OWH A;  5J7E A;  3IBR A;  2M1C A;  1LL8 A;  2VV8 A;  4HIA A;  2PYP A;  1OTB A;  2QJ7 A;  3LID A;  4I5S A;  5EFW A;  1S4S A;  1T18 A;  3NHQ A;  2P7J A;  3E4P A;  1OTE A;  2I9V A;  4HOI A;  1LT0 A;  3A0R A;  2KDK A;  3LUQ A;  3T50 A;  5HDD A;  2V0W A;  2ZOI A;  3VOL A;  3HJK A;  2EA9 A;  4F3L A;  3OLO A;  4DJ2 A;  2VV6 A;  4NXE A;  3UB8 A;  3SW1 A;  4KUO A;  1OJG A;  2V1A A;  1V9Y A;  4HP9 A;  4R38 A;  5HD5 A;  5TBM B;  4EW7 A;  4KUK A;  1BYW A;  1TS0 A;  5IU1 A;  1P97 A;  4H6J A;  3CWF A;  1T1B A;  3LI9 A;  1XFN A;  5HDC A;  3LIC A;  2D02 A;  2PD7 A;  4WN5 A;  3LIF A;  4R3A A;  1F98 A;  3UB9 A;  1TS7 A;  4R6L A;  1N9O A;  4NXF A;  4RQ9 A;  1S66 L;  3MXQ A;  1GSW A;  3LIA A;  4LRX C;  5F69 A;  1S4R A;  3MR0 A;  1S67 L;  2L1M A;  2YKF A;  3A0S A;  3G6O A;  1UWP X;  1OT6 A;  3NOP C;  3PHY A;  4KQD A;  2H28 A;  4NXG A;  2K7S A;  1OTD A;  4HNB A;  1S1Y A;  5DJU A;  2VEA A;  2A24 B;  2V0U A;  2JN7 A;  1OJ5 A;  4HH2 A;  3RH8 B;  2W0N A;  2JHE A;  2W27 A;  1DP8 A;  3C8C A;  4GCZ A;  5DKL A;  4BBT A;  2PD8 A;  2L4R A;  4I3J A;  2OOL A;  3EWK A;  5HWW A;  5J4E A;  2PDR A;  2V9A A;  4MN5 A;  1P0Z A;  1X0O A;  4HJ6 A;  2GJ3 A;  4R70 A;  3LI8 A;  3RTY A;  2B02 A;  1D7E A;  2VV7 A;  2WKQ A;  3D72 A;  5F5Y A;  5G4Y A;  5HDS A;  4L9E A;  1D06 A;  1DP9 A;  4PKY G;  4YWZ A;  3BY9 A;  4F3L B;  2QHK A;  2KX6 A;  4JGO A;  3CAX A;  4L9G A;  1OTA A;  1TS8 A;  4H6J B;  5TBM A;  2A24 A;  1N9N A;  1LSX A;  4GS9 A;  5HD3 A;  3UME A;  4BBV A;  3GEC A;  4HHD A;  2Z6C A;  3MFX A;  1VB6 A;  4E04 A;  5IS1 A;  1JNU A;  4WF0 A;  5AVE A;  2J80 A;  1XFQ A;  3VE4 A;  3BY8 A;  4WL9 A;  3UE6 A;  3H7W A;  3F1N A;  1DP6 A;  3MQQ A;  4JGQ A;  4EET B;  3ICY A;  4BBU A;  3CLO A;  2YKH A;  4XT2 A;  4B9O A;  3FC7 A;  4HJ4 A;  4HI4 A;  4M4X A;  4NXB A;  5AVF A;  1T19 A;  1ODV A;  3FG8 A;  1GSV A;  1XJ4 A;  2HV1 A;  2ZOH A;  3K3C A;  2D01 A;  2VLG A;  4HP4 A;  3LIB A;  3LYX A;  4LRZ E;  4JGR A;  1EW0 A;  1UWN X;  2PR5 A;  3VE3 A;  2V1B A;  1NWZ A;  1OT9 A;  1UGU A;  2PHY A;  3NJA A;  3F1N B;  4GHI B;  4HJ3 A;  3E4O A;  2BAS A;  3C2W A;  1V9Z A;  3H9W A;  3MJQ A;  4L9F A;  4LLO B;  4XT2 B;  1DRM A;  1LSV A;  1XJ6 A;  2CMN A;  1T1A A;  3F1P A;  3K3D A;  3H82 A;  4I3I A;  1XJ2 A;  1Y28 A;  2QJ5 A;  3UB7 A;  3UB6 A;  5HWV A;  1WA9 A;  3F1O A;  3IS2 B;  4EEU A;  1N9L A;  4GS9 B;  4I38 A;  4JGP A;  2WKP A; 
#chains in the Genus database with same CATH topology
 2RCX A;  1DJB A;  5LBR A;  4YOF A;  5G4Z A;  1ERQ A;  1F9I A;  1GSX A;  4Q0I A;  2WUQ A;  4IUH A;  4K08 A;  3P01 A;  5HSQ A;  5HL1 A;  3NOT C;  1K4F A;  1MWU A;  4HH3 A;  5CHU A;  3VOL A;  1TS6 A;  2ZC7 A;  4HQA A;  3MQO A;  3WS5 A;  1YLT A;  1M6K A;  2Y2H A;  3NCK A;  3QHY A;  1SZV A;  5EVI A;  5HAP A;  2XD5 A;  3E2L A;  3GVB A;  1ES3 A;  1QME A;  1XKZ A;  2NUP C;  1VHM A;  1GHM A;  2W3E A;  5TBM B;  3KYQ A;  4LV0 A;  2RL3 A;  5M1A A;  4R6L A;  4IUK A;  2EXA A;  5F69 A;  1YLW A;  3MR0 A;  3LR0 A;  3AGE A;  2A24 B;  3WRZ A;  4GCZ A;  4LCL A;  1EWZ A;  2OOL A;  2OV5 A;  2PDR A;  3LI8 A;  1D7E A;  5A93 A;  4GD8 A;  1NRF A;  2QHK A;  1VEU A;  4HBT A;  5HD3 A;  3UME A;  3HVF A;  4HHD A;  4ZJ3 A;  3UE6 A;  1D1J A;  1SKO B;  1W8Y A;  3S7N A;  4OPZ A;  3DTE A;  1G5U A;  1E3U D;  5IT5 A;  1OT9 A;  1BTL A;  4ZAM A;  3VFF A;  4OQI A;  3T1Q B;  2PT7 A;  2XH9 A;  4Y0T A;  3CMZ A;  2I72 A;  2E8J A;  3F1O A;  3QP4 A;  1FIL A;  3VP4 A;  3LIE A;  3MBZ A;  3L9K A;  4LV1 A;  4EES A;  4FUW A;  3TG9 A;  3NOU C;  3EEH A;  3KYZ A;  4IJG A;  3TRC A;  3T4T A;  3DTM A;  4DJ3 A;  1MKI A;  3P09 A;  4KZA A;  3HUO A;  3TE8 A;  5E43 A;  3S7Q A;  4R0Q A;  4KQO A;  1F2K A;  1LL5 A;  1K55 C;  3VV4 A;  3NHQ A;  2H0T A;  1GHP A;  3LUQ A;  3ZNY A;  2V0W A;  2IWD A;  3RJU A;  2P08 A;  2VV6 A;  2ZC3 B;  2JKF A;  4R38 A;  3B42 A;  4KUK A;  1Y4O A;  1PNE A;  3U4L P;  4E3O A;  2C6W B;  2D02 A;  3BQA A;  1S4R A;  4KQD A;  2W3G A;  4FH2 A;  1OTD A;  1KE0 A;  2W0N A;  5DKL A;  1MY8 A;  5HW3 A;  1X0O A;  2GJ3 A;  2DCF A;  4YWZ A;  3KSG A;  2HP6 A;  3A3I A;  5DF9 A;  2Z6C A;  5CER A;  1XFQ A;  4O8G A;  3BY8 A;  5CTM A;  3T4L A;  3ICY A;  4QY5 A;  3HLG A;  5AQB A;  5CX7 A;  3GR2 A;  3A3D A;  1STZ A;  1RCJ A;  5FQM A;  4X53 A;  2PHY A;  4GHI B;  3E4O A;  3CZD A;  3BJN A;  5KZH A;  2ZL1 B;  2PU2 A;  1W8Q A;  2GDN A;  3UY6 A;  4P85 A;  3O3V A;  3AGF A;  4KQR A;  3JVV A;  3IF6 A;  5EVI D;  2J7V A;  3N4I A;  5KMW A;  4GLQ A;  4B4X A;  5F68 A;  3LCE A;  3B33 A;  4OPR A;  5DTK A;  3ITA A;  4R4R A;  5CRF A;  4RYE A;  3PXP A;  1OTB A;  2EXB A;  2PU4 A;  3MZF A;  1VET B;  2PAV P;  3T50 A;  3C38 A;  5EE8 A;  1TD5 A;  2V2F F;  4C75 A;  4DJ2 A;  1V9Y A;  1F5M A;  2WAE A;  5MC7 A;  2B95 A;  3ZVW A;  3UDF A;  5EVI B;  4O0P A;  1N9O A;  3G32 A;  1S66 L;  1GSW A;  1PI4 A;  3LY3 A;  3UDI A;  2L1M A;  3PHY A;  5AQ7 A;  1YAX A;  1PFL A;  1DP8 A;  3GQZ A;  2PD8 A;  1NRJ A;  1K56 A;  3SS5 A;  3EQV A;  5G4Y A;  4WMC D;  3PBS A;  2WAD A;  4PPR A;  1KDS A;  5DFY A;  1FCO A;  5EM1 A;  4K91 A;  3QP1 A;  3MFX A;  3AGD A;  2J80 A;  2Y2O A;  3G35 A;  4CLC B;  5CTN A;  3QP2 A;  4JGQ A;  3CG5 A;  3TSG A;  1ALQ A;  1ODV A;  3ZG8 B;  2XRO A;  3OPR A;  2JC7 A;  4E6X A;  1I5Q A;  3CPT A;  2XLN A;  3C2W A;  4LLO B;  1W7F A;  3HLB A;  4CQH A;  4I3I A;  1I2S A;  1CEG A;  4D2O A;  4PHT A;  4EV4 A;  4I38 A;  4EUV A;  1ONH A;  4I3A A;  3IX8 A;  5FAS A;  5A8B A;  4PM5 A;  5TFQ A;  4P6Z S;  2EWW A;  1IOU A;  2XA7 S;  5J3W A;  3N6I A;  5CEB A;  5FI2 A;  5TR7 A;  2JBF A;  2Y4A A;  1LHY A;  1TDG A;  3T4K A;  5CHM A;  2J3W A;  1NY0 A;  4HBU A;  2OWH A;  2QMI A;  3LID A;  2EWV A;  1W79 A;  4UA6 A;  5F82 A;  3PBT A;  1LT0 A;  4F3L A;  4OQ0 A;  3LR4 A;  5U47 A;  2ZMA A;  3NDE A;  1K54 A;  1FQG A;  5HAR A;  3TJZ C;  3LI9 A;  3FKW A;  2BG1 A;  4DE1 A;  1NJ4 A;  1WYB A;  2HDS A;  4Q8I A;  1N4O A;  1OT6 A;  5HPI A;  4MEZ A;  3IH9 A;  4R3B A;  4R1G A;  4Y0U A;  5DTT A;  4WYY A;  2JKG A;  1C3B A;  2O9A A;  4BBV A;  2O99 A;  1E4D A;  3VP2 A;  2P9V B;  4ZTK A;  1DP6 A;  5A91 A;  2ZM8 A;  4DRT A;  5FAP A;  3PBO A;  1IYQ A;  4HP4 A;  5TGF A;  5FQI A;  4JGR A;  3ZCZ A;  1K54 C;  2Y91 A;  3A3E A;  5DFX A;  4JKT A;  3QP8 A;  3SS4 A;  3KO6 A;  4EBN A;  5FDH A;  4Z1W A;  5L07 A;  2ZMV A;  3E4Q A;  1OME A;  4M3K A;  5AQA A;  4GOG A;  4B88 A;  5DKK A;  5CEC A;  1XX2 A;  3RFB A;  3QP6 A;  4FOF A;  4WLA A;  4NEE D;  4OLD A;  3H82 B;  2ZBB A;  3C4O A;  3Q07 A;  2JKR M;  1AWI A;  1WYC A;  2XSS A;  3N8R A;  2QJ7 A;  3IHA A;  1JVJ A;  5EFW A;  1W63 M;  2Y2J A;  3IBJ A;  3VP1 A;  5G18 A;  4NKP A;  1H3Q A;  3HBR A;  2ZQ8 A;  2PBY A;  4EW7 A;  3DTI A;  4H6J A;  2ZQD A;  3MFD A;  2X01 A;  3LIC A;  4R3A A;  2JCH A;  4E3M A;  4CJN A;  2H28 A;  4Z9Q A;  4GJ4 A;  2HGV A;  4FSF A;  2ZC4 B;  4KZ8 A;  4UA9 A;  5CGW A;  2JHE A;  5A92 A;  4ZRR A;  4I3J A;  5DVA A;  3RTY A;  3LY4 A;  1HVB A;  5FSR A;  3Q7Z A;  4AFI A;  1NZO A;  1LLB A;  3D3O A;  2FH5 A;  3UE0 A;  3JYI A;  4NK3 A;  1GSV A;  1KVL A;  3LYX A;  4LRZ E;  1CJF A;  3H9W A;  5DTS A;  4DE2 A;  3M6H A;  4MN7 A;  3GTC A;  2HDR A;  5GHX A;  4MNR A;  4JGP A;  2HZ5 A;  1L0D A;  4GHI A;  3IXH A;  4OOM A;  3W4Q A;  3UMD A;  2W1R A;  5CED A;  3VP3 A;  1BLC A;  1IEM A;  4C6Y A;  1TF1 A;  4I39 A;  1CI8 A;  3HUM A;  3N8L A;  4WUJ A;  2L0W A;  3IS2 A;  2HDQ A;  4ID4 A;  1MC0 A;  1IYO A;  4S2M A;  4DMZ A;  3ZVT A;  4CLC E;  4N9L A;  1SKF A;  4U0X A;  3A3F A;  3S7O A;  1J3W A;  5CXW A;  3UE1 A;  3MKE A;  4O01 A;  4RVA A;  2EA9 A;  1Z09 A;  2VZW A;  4NXE A;  5HD5 A;  2J9O A;  3PBN A;  1XFN A;  1IYP A;  1SDE A;  2XD1 A;  4OP8 A;  1GCE A;  3CIT A;  3LIA A;  2WGI A;  5E2H A;  1J9M A;  2LB5 A;  5D3O A;  5FAQ A;  1FCM A;  3QNC A;  5J4E A;  2B02 A;  5HPF A;  3BY9 A;  2KX6 A;  4L9G A;  4E3N A;  2A24 A;  4GS9 A;  3GEC A;  3D9Y A;  3MKF A;  3QP5 A;  4WL9 A;  1YLJ A;  4Y15 A;  4XT2 A;  2YKH A;  4B9O A;  2XEP A;  3FC7 A;  4HJ4 A;  2ZQ7 A;  4WEJ A;  4XXR A;  4BD0 A;  4FD8 A;  2ZOH A;  4DDS A;  2HV1 A;  2VGJ A;  3LIB A;  3NBL A;  4S2N C;  3HLE A;  3FKV A;  4QY6 A;  3SZT A;  3IXB A;  4HJ3 A;  5EVE A;  2A2L A;  1XJ6 A;  1T1A A;  1XJ2 A;  3PR6 A;  1TVF A;  1WA9 A;  5EPH A;  3IWQ A;  5JYO A;  2EX2 A;  2HJ9 C;  4BL3 A;  1LSW A;  2PR6 A;  3ULF A;  2XQZ A;  2WKI A;  4II7 A;  1O07 A;  5J7E A;  1U60 A;  1YQS A;  1EI5 A;  3E4P A;  1OPX A;  1E3U A;  2FFY A;  3OLO A;  3ZG7 B;  3EEA A;  4UA7 A;  1YSP A;  1Y54 A;  3U2A A;  3CJM A;  4LV2 A;  4XUZ A;  2V8C A;  1T1B A;  4B4Z A;  4E6W A;  1KGG A;  3FZC A;  2G7U A;  1H5X A;  4OPY A;  2M7V A;  4FCF A;  3S1Y A;  3G6O A;  4IVI A;  3KSI A;  4N1X A;  1FOF A;  1LL9 A;  3HRE A;  4LEN A;  1N9B A;  2L4R A;  5HWW A;  5HWV A;  4L0L A;  2WAF A;  1L0E A;  3T1R A;  1TS8 A;  2LB9 A;  1WE4 A;  5FA7 A;  2P04 A;  3CI6 A;  2W3H A;  4UAA A;  4OP5 A;  3BFG A;  4QWO A;  3IF6 B;  2PBD P;  4WBG A;  5L8M A;  2J3T C;  1CK3 A;  1T19 A;  3UPP A;  1NXY A;  3C4P A;  2ZC5 B;  4X25 A;  3G2Z A;  5HWT A;  3F1N B;  5E2F A;  1MPL A;  3PAG A;  3VE4 A;  1DRM A;  2CMN A;  1ZKJ A;  4NG2 A;  3UB6 A;  3UB7 A;  4GZB A;  5EVL A;  4D60 A;  2ZQ9 A;  4IBX A;  3V67 A;  4K0W A;  3C30 A;  2GZA A;  4X69 A;  1IYS A;  1ZG4 A;  4IVK A;  3BFE A;  3UB5 P;  3FV7 A;  3E98 A;  2QKP A;  4WM9 A;  1PW1 A;  1JTG A;  4Y2F A;  1S1Z A;  4KZ7 A;  4MN6 A;  4ARZ B;  2M1C A;  4EQI A;  2EX8 A;  5EOE A;  4I5S A;  2M7U A;  1K0K A;  3M2K A;  3C7V A;  3W4O A;  4BJP A;  3MQ0 A;  4U0T A;  4F94 A;  3BLS A;  3Q81 A;  3L7H A;  4G3W A;  1Z6F A;  1NLZ A;  3MF0 A;  4GN2 A;  1S67 L;  2YKF A;  4KG6 A;  1S1Y A;  5GHZ A;  1PWD A;  3RH8 B;  2IWB A;  4JXV A;  3EWK A;  2V9A A;  3LEZ A;  1SCW A;  1FCN A;  5GLA A;  5TJJ A;  5HAI A;  3HLW A;  4S2K A;  2ZQA A;  2ZM2 A;  1KDW A;  5FQK A;  1PYY A;  4BMW A;  5E2G A;  2VLG A;  1IKG A;  3MS6 A;  2Y55 A;  1ZC2 A;  4Y17 A;  2XRN A;  1CI9 A;  4L9F A;  3CUE A;  3IX3 A;  2WZX A;  2Y2I A;  4KQQ A;  5M18 A;  2Q9N A;  3V39 A;  4EEP A;  4MDZ A;  3Q82 A;  2INW A;  4BQM A;  4QHC A;  5KIZ A;  4LRY C;  5F6A A;  3O88 A;  4PM6 A;  4WZ4 A;  4HY8 A;  2FZ0 A;  2V20 A;  1MBL A;  3P7N A;  4OLG A;  1HD8 A;  4DDY A;  1H8M A;  4YNR A;  2QZ6 A;  3ZQ5 A;  5EM0 A;  3MSH A;  3TOI A;  3PAE A;  4HES A;  5HZH A;  2Q0O A;  4E3I A;  1LL8 A;  5M19 A;  5L09 A;  3DW0 A;  4BLM A;  3G34 A;  1ES5 A;  1L0F A;  1RGZ A;  1QMF A;  3O87 A;  1S6R A;  1P9R A;  3MZE A;  1OJG A;  1G6A A;  2XFS A;  4OON A;  3V5M A;  2VGL S;  5HX9 A;  2JE5 A;  1ES2 A;  4R3J A;  1IFQ A;  4QU3 A;  4RQ9 A;  1JWZ A;  2O9C A;  3NOP C;  3E2K A;  3SH9 A;  2VEA A;  1YKD A;  3SH7 A;  3FWL A;  2BLS A;  1D06 A;  4F3L B;  4JGO A;  3OOV A;  5DF8 A;  3WWX A;  4GKU A;  1N9N A;  1LSX A;  4BBU A;  4N9K A;  1ZTU A;  5I94 A;  4LV3 A;  4NXB A;  2K2N A;  3QNB A;  3HLD A;  3IWI A;  1YMS A;  5KSH A;  1ERO A;  3NJA A;  4DE3 A;  3F1P A;  2Y79 A;  1SHV A;  2H0Y A;  2HP9 A;  3V3S A;  1PW8 A;  2O9B A;  3TW8 A;  3WS1 A;  3GSG A;  1L0G A;  2HF6 A;  2Y2Q A;  1KGF A;  2UV0 E;  2VJW A;  4BL2 A;  5L2F A;  1BLS A;  4EXO A;  1KE3 A;  3HJI A;  3WS4 A;  1TDL A;  1ACF A;  1M40 A;  4KG5 A;  4JF6 A;  4DF6 A;  2HPB A;  4CLC A;  1SKO A;  3F1P B;  1XJ3 A;  4Y0O A;  5FDS A;  2EX9 A;  5C5K A;  3S4X A;  2X71 A;  3IBR A;  2PYP A;  3DAV A;  1K57 A;  4QPR A;  1G68 A;  4KEN B;  2P7J A;  4HOI A;  3FPW A;  1YSQ A;  2Y59 A;  2ZOI A;  3UNW A;  2QYB A;  5CGX A;  2V1A A;  1BUL A;  1MWT A;  4HP9 A;  2UWX A;  1RGY A;  5IHV A;  2Q9M A;  4P87 A;  3W2Z A;  2A3U A;  5HDC A;  3VP0 A;  3BRM A;  3LIF A;  4NET A;  2HJE A;  1GHI A;  3LR5 A;  2VK3 A;  1K56 D;  1CEF A;  4Y13 A;  4JXW A;  5F1F A;  4RX3 A;  5BOH A;  3ZG5 A;  1OJ5 A;  1PZO A;  4E3K A;  3C8C A;  1FR6 A;  2HDU A;  3OPL A;  3OCL A;  4MMN A;  4PKY G;  4Y5F A;  1Q2Q A;  1OTA A;  3BFD A;  3OCN A;  4JXG A;  1ERM A;  5HFO A;  4WF0 A;  5AVE A;  2J9P A;  1K55 A;  4DXC A;  4HEF A;  3MXR A;  4O7D A;  5E2E A;  1LI0 A;  1W5D A;  4OQG A;  4N92 A;  3M6B A;  2R9W A;  1EW0 A;  1UWN X;  1NWZ A;  2BAS A;  2WK0 A;  4KZ9 A;  3K3D A;  3A3J A;  1ONG A;  4S2O A;  5GLB A;  2BTF P;  3NIA A;  1XA1 A;  1ZG6 A;  3IHB A;  1P9W A;  3MMH A;  1HTZ A;  4OKP A;  3JVU A;  2ZL1 A;  1FSY A;  4E3J A;  4EER A;  2R78 A;  4GB7 A;  4G3V A;  4P6B A;  2KLI A;  4PAU A;  4EU0 A;  3Q1F A;  3T4O A;  2I9V A;  3A0R A;  1BZA A;  4ETX A;  5FQQ A;  4X68 A;  5F83 A;  5FI6 A;  3EGD C;  4OOY A;  5JYP A;  4ME4 A;  1H8Z A;  1P97 A;  2P74 A;  3CWF A;  2ZQC A;  3ITB A;  4U3T A;  1F98 A;  1YPR A;  2WGW B;  3MXQ A;  3A0S A;  1ESU A;  3SOI A;  1PRQ A;  4R23 A;  1AXB A;  4WMC A;  4BBT A;  2Y2P A;  4JLF A;  4E3L A;  4BWI A;  1CQA A;  1BLH A;  4OPQ A;  4KG2 A;  1YMX A;  2WGW A;  2V8F A;  4ZBE A;  3LO7 A;  2W1T A;  4WZ5 C;  3CHW P;  3N7W A;  3MQQ A;  4S2I A;  2ACG A;  2W3D A;  5J8X A;  4KZB A;  4HI4 A;  5AVF A;  2ZD8 A;  4RA7 A;  4MBK A;  1VQQ A;  2D01 A;  3PBQ A;  2H10 A;  3JPU A;  4OQH A;  1K4E A;  3BYD A;  3IS2 B;  5K5B A;  2PRF A;  4BEN A;  4ESP A;  5FEF A;  2V1Z A;  3R4K A;  4X6T A;  4GW9 A;  2AVX A;  4S2J A;  1FSW A;  4KZ5 A;  3PTE A;  1MWR A;  3NEC A;  4EQ1 A;  1XPB A;  4PKY A;  1IEL A;  5FI7 A;  3D4F A;  1T1C A;  3H7W B;  3BWL A;  3T12 B;  2QPN A;  3PBR A;  3VFH A;  2WKE A;  1K38 A;  4ETZ A;  2Y2L A;  1NYM A;  1G6O A;  2Z2M B;  2ZM0 A;  2DNS A;  1E25 A;  5AJG A;  3HJK A;  3IWO A;  4KUO A;  5EV0 A;  2R9X A;  4G3K A;  4EBL A;  3HLC A;  3MXS A;  1SDN A;  3BM6 A;  4WN5 A;  3ZGA B;  4NXF A;  1MWS A;  2VGL M;  1UWP X;  4CPK A;  4HH2 A;  1FR1 A;  1I2W A;  1MXO A;  1ZHH B;  2WGV A;  5FEG A;  3O5Y A;  3UPN A;  4JF4 A;  4E04 A;  1JNU A;  3WRT A;  3F1N A;  1DJA A;  3NDG A;  3EQU A;  4UHU A;  4QB8 A;  1VM1 A;  3IXG A;  4X56 A;  3VE3 A;  2PR5 A;  3ZG0 A;  3UO9 A;  1DJC A;  3LR3 A;  5F1G A;  4LCM A;  1FIK A;  3H82 A;  3UE3 A;  3VSK A;  1Y28 A;  2QJ5 A;  3G4P A;  3SH8 A;  3UDX A;  3T1X A;  3B3X A;  2B5R A;  1H8Y A;  4DE0 A;  5CHJ A;  4X55 A;  2OWJ A;  3A0V A;  2JKT I;  3S7P A;  1BT5 A;  4PM8 A;  1K57 C;  3EOI A;  2PYR A;  3GRJ A;  3HUN A;  3OBF A;  1BLP A;  3VMA A;  4UQI S;  2XF3 A;  4MLL A;  4EWF A;  4CLC C;  4MBH A;  2OLV A;  1OTE A;  4ZJ2 A;  5HDD A;  3C5A A;  4JBF A;  4X1M A;  3HL9 A;  3HCY A;  3LGO A;  2WYX A;  3B47 A;  3BLM A;  1ESI A;  5HL6 A;  3C7U A;  2PD7 A;  1ES4 A;  3UB9 A;  3OPP A;  3FPV A;  1XXM A;  1MKM A;  4QD4 A;  1IKI A;  4R4S A;  4MBF A;  3ZYT A;  1JTD A;  1HLU P;  4LGW A;  3ISG A;  3CPT B;  1P0Z A;  3ZDJ A;  2WKQ A;  2XDM A;  3D72 A;  5HDS A;  2OLU A;  3UN7 A;  2XR0 A;  1VB6 A;  5IS1 A;  1BUE A;  4EET B;  3NUL A;  2IWC A;  3VOZ A;  4C3Q A;  5CGS A;  1A0K A;  2V1B A;  4XT2 B;  4YFM A;  4H8R A;  4X1L A;  5HAQ A;  5DF7 A;  1YM1 A;  2KOI A;  3IX4 A;  4GS9 B;  4P0M A;  3KX0 X;  4KZ6 A;  1K6R A;  1RP5 A;  2QWS A;  3GMW A;  3G30 A;  2E8I A;  4LPZ A;  1HZO A;  2ZLY A;  1G28 A;  2WKR A;  1OTI A;  3BQ8 A;  2Z6D A;  1S0W A;  1BSG A;  1VET A;  3T1S A;  5EEC A;  1K25 A;  3DBA A;  3P98 A;  4KZ3 A;  2Y2G A;  1S4S A;  1T18 A;  3T4J A;  1CF0 A;  4IHQ A;  2CC1 A;  3RXW A;  2Y2K A;  4GDB A;  1Q2P A;  5A90 A;  1L3L A;  2A49 A;  5AQ9 A;  2GX5 A;  2K31 A;  3BFC A;  4JPM A;  3ZG9 B;  3SS3 A;  3NC8 A;  2IA2 A;  1PWC A;  2XGN A;  3T4S A;  1XGI A;  4NXG A;  1XGJ A;  3R7W B;  2H5S A;  2JN7 A;  2W27 A;  4R70 A;  3E0Y A;  5F5Y A;  2VV7 A;  4FTX A;  4JXS A;  1H0M A;  4K0X A;  3N8S A;  5FAT A;  3IXD A;  4S2P A;  3CLO A;  3LEQ A;  5FQJ A;  4Q0H A;  3NY4 A;  3FG8 A;  4DKI A;  1JWP A;  1XJ4 A;  4IBR A;  3ZNT A;  1PIO A;  2WZZ A;  1UGU A;  4N1H A;  3WS2 A;  1V9Z A;  2VKS A;  1LSV A;  4UQI M;  3I7J A;  5GLC A;  3BEB A;  4LFU A;  3BW6 A;  4EEU A;  1N9L A;  3HLF A;  4EUZ A;  3DWZ A;  2WKP A;  3OC2 A;  1GA9 A;  5KSC A;  4ARZ A;  2J3T D;  4CLC D;  2FFF B;  1LI9 A;  2W1T B;  3VSL A;  4PMA A;  3IQA A;  3GDI A;  3BFF A;  3PYP A;  3ZHH A;  3M2J A;  2G2W A;  5FL3 A;  1KOU A;  3V50 A;  3IT9 A;  2VV8 A;  1TEM A;  2VGK A;  2XA7 M;  2KDK A;  1VEU B;  4DN0 A;  2MJ6 A;  3SW1 A;  2VX8 A;  3MZD A;  2EFU A;  3KSH A;  3S22 A;  3DWK A;  1BYW A;  1TS0 A;  3IF6 C;  1PI5 A;  3EGX C;  4Q0J A;  1YT4 A;  1TS7 A;  3FYZ A;  4B93 A;  1JWV A;  1DY6 A;  4Y7P A;  5GHY A;  5EOO A;  4HNB A;  2V0U A;  2OAP 1;  4KZ4 A;  5GLD A;  3O86 A;  1DP9 A;  5L10 A;  4H6J B;  1L2S A;  5GL9 A;  3OPH A;  3H7W A;  4JF5 A;  2OSU A;  2ZJ9 A;  1PWG A;  2VA0 A;  3V3R A;  4M4X A;  3K2N A;  2JKR I;  3ZFZ A;  2OAQ 1;  1NYY A;  3R7W A;  3GV9 A;  3MJQ A;  4XUX A;  5EUA A;  1KGE A;  3DTK A;  2HP5 A;  1KVM A;  5FQ9 A;  4ZDX A;  3UPO A;  3BEC A;  2Z2L B;  4S2N A;  4WZ5 A;  4ZJ1 A;  4GDN A;  3G2Y A;  2EFX A;  4YIN A;  1K6S A;  1NLY A;  4UEY A;  4GNU A;  5DJT A;  5FAO A;  1W63 Q;  1YLZ A;  2ZC6 B;  2C5W B;  4A5R A;  4FH4 A;  1XA7 A;  3F1O B;  4IED A;  3KSF A;  3W8K A;  5I5L A;  1MZU A;  3T4Q A;  2Y2M A;  4HIA A;  1YLP A;  2G2U A;  2W3F A;  1KE4 A;  2EX6 A;  4PM9 A;  3W4P A;  4GD6 A;  4WEL A;  4DXB A;  4EBP A;  2X02 A;  4S2L A;  3UB8 A;  4P6Z M;  3LFV A;  2ZMF A;  1YLY A;  3CUE C;  3KYE A;  1O7E A;  2Y8H A;  4MCW A;  2NUT C;  4LRX C;  2P9V A;  2B18 A;  2XFT A;  2K7S A;  3IH8 A;  5DJU A;  4OH0 A;  3NI9 A;  1PZP A;  2DMW A;  3Q7V A;  4MN5 A;  2DRW A;  4HJ6 A;  3VOY A;  4L9E A;  4Y3I A;  4RX2 A;  3RXX A;  2J8Y A;  4QJG A;  5TBM A;  3CAX A;  4PM7 A;  2WKH A;  5EVI C;  3OZH A;  4WEK A;  1NZU A;  2Y2N A;  3IF5 A;  4BD1 A;  2GNX A;  3K3C A;  5IU1 A;  3Q7V B;  4OOL A;  2O0Y A;  2XK1 A;  1XP4 A;  1GA0 A;  3WS0 A;  2JKT M;  4OVD A;  3G31 A; 
#chains in the Genus database with same CATH homology
 4EEP A;  4Z1W A;  4MDZ A;  2ZMV A;  5LBR A;  4YOF A;  2INW A;  3E4Q A;  2OWJ A;  5G4Z A;  3A0V A;  1F9I A;  5KIZ A;  2JKT I;  3S7P A;  4LRY C;  5F6A A;  1GSX A;  4Q0I A;  4HY8 A;  2FZ0 A;  4IUH A;  4K08 A;  3P01 A;  5DKK A;  5HSQ A;  3NOT C;  3P7N A;  3RFB A;  1H8M A;  3EOI A;  2PYR A;  4FOF A;  4NEE D;  4WLA A;  4HH3 A;  4YNR A;  3ZQ5 A;  3H82 B;  2ZBB A;  3VOL A;  1TS6 A;  2JKR M;  4HQA A;  5HZH A;  3MQO A;  3OBF A;  1LL8 A;  4UQI S;  2XSS A;  2QJ7 A;  5EFW A;  4CLC C;  1W63 M;  3IBJ A;  1OTE A;  4NKP A;  5HDD A;  2NUP C;  1P9R A;  1VHM A;  1H3Q A;  1OJG A;  2W3E A;  3HCY A;  3B47 A;  5TBM B;  4EW7 A;  4H6J A;  5HL6 A;  2VGL S;  3KYQ A;  3LIC A;  2PD7 A;  4R3A A;  1IFQ A;  3UB9 A;  4R6L A;  4RQ9 A;  4IUK A;  3FPV A;  5F69 A;  2O9C A;  1MKM A;  3MR0 A;  3NOP C;  2H28 A;  4GJ4 A;  3ZYT A;  2HGV A;  3LR0 A;  4FSF A;  2VEA A;  1YKD A;  2A24 B;  2JHE A;  4GCZ A;  4ZRR A;  4I3J A;  2OOL A;  2PDR A;  3RTY A;  1P0Z A;  3LI8 A;  2WKQ A;  1D7E A;  3D72 A;  5HDS A;  1D06 A;  4F3L B;  2QHK A;  4JGO A;  3OOV A;  4BBU A;  1N9N A;  1LSX A;  3UME A;  5HD3 A;  4HHD A;  1VB6 A;  5IS1 A;  4AFI A;  3UE6 A;  1ZTU A;  3D3O A;  3S7N A;  2FH5 A;  4EET B;  4NXB A;  2K2N A;  1GSV A;  3LYX A;  4LRZ E;  5KSH A;  5IT5 A;  3NJA A;  2V1B A;  1OT9 A;  3H9W A;  4XT2 B;  3F1P A;  2Y79 A;  2PT7 A;  4MN7 A;  3F1O A;  2O9B A;  3TW8 A;  2KOI A;  2HF6 A;  4GS9 B;  4JGP A;  3LIE A;  2VJW A;  4GHI A;  4EES A;  3KX0 X;  4OOM A;  3NOU C;  3UMD A;  2W1R A;  3EEH A;  4EXO A;  3KYZ A;  3HJI A;  4IJG A;  3TRC A;  2QWS A;  3T4T A;  4LPZ A;  1TF1 A;  4I39 A;  4DJ3 A;  4CLC A;  3F1P B;  1G28 A;  2WKR A;  4WUJ A;  2L0W A;  1OTI A;  3BQ8 A;  1XJ3 A;  2Z6D A;  3IS2 A;  3TE8 A;  5C5K A;  1MC0 A;  3S7Q A;  3IBR A;  4KQO A;  3DBA A;  2PYP A;  4DMZ A;  4CLC E;  3VV4 A;  1S4S A;  1T18 A;  4QPR A;  3NHQ A;  3T4J A;  4IHQ A;  2P7J A;  3S7O A;  4HOI A;  3FPW A;  3LUQ A;  4O01 A;  1YSQ A;  2V0W A;  2ZOI A;  2EA9 A;  2QYB A;  2P08 A;  2VV6 A;  2VZW A;  4NXE A;  2V1A A;  4HP9 A;  4R38 A;  5HD5 A;  3B42 A;  2GX5 A;  2K31 A;  4KUK A;  3W2Z A;  3PBN A;  1XFN A;  2IA2 A;  5HDC A;  2D02 A;  3LIF A;  3CIT A;  3T4S A;  2HJE A;  3BQA A;  3LR5 A;  3LIA A;  1S4R A;  4KQD A;  2W3G A;  4NXG A;  1OTD A;  3R7W B;  2LB5 A;  2JN7 A;  1OJ5 A;  2W0N A;  3C8C A;  2W27 A;  5DKL A;  5J4E A;  4R70 A;  1X0O A;  2GJ3 A;  3E0Y A;  2B02 A;  5F5Y A;  2VV7 A;  5HPF A;  4YWZ A;  3OCL A;  4MMN A;  4PKY G;  3KSG A;  3BY9 A;  4Y5F A;  2KX6 A;  4L9G A;  1OTA A;  3OCN A;  2A24 A;  4GS9 A;  5DF9 A;  3GEC A;  2Z6C A;  4WF0 A;  5AVE A;  1XFQ A;  4O8G A;  3BY8 A;  4WL9 A;  3T4L A;  3ICY A;  3CLO A;  2YKH A;  4XT2 A;  4B9O A;  3FC7 A;  4HJ4 A;  4Q0H A;  4WEJ A;  3FG8 A;  5CX7 A;  1XJ4 A;  2ZOH A;  2HV1 A;  3LIB A;  1STZ A;  1EW0 A;  1UWN X;  1NWZ A;  1UGU A;  2PHY A;  4HJ3 A;  2A2L A;  4GHI B;  3E4O A;  2BAS A;  1V9Z A;  3BJN A;  2VKS A;  1LSV A;  4UQI M;  1XJ6 A;  1T1A A;  3K3D A;  1XJ2 A;  3PR6 A;  3BW6 A;  1WA9 A;  4EEU A;  1N9L A;  2WKP A;  3OC2 A;  4ARZ A;  2J3T D;  2HJ9 C;  4CLC D;  3JVV A;  1LSW A;  2W1T B;  1P9W A;  3MMH A;  4GLQ A;  2PR6 A;  3JVU A;  3GDI A;  5F68 A;  3ULF A;  3PYP A;  3B33 A;  4EER A;  4II7 A;  5FL3 A;  1KOU A;  2R78 A;  5J7E A;  4G3V A;  2VV8 A;  3PXP A;  1OTB A;  2KLI A;  4PAU A;  4EU0 A;  3T4O A;  3E4P A;  1OPX A;  2I9V A;  2XA7 M;  3A0R A;  2KDK A;  3C38 A;  3T50 A;  4DN0 A;  4ETX A;  1TD5 A;  3OLO A;  2MJ6 A;  3EEA A;  4DJ2 A;  3SW1 A;  2VX8 A;  1YSP A;  1V9Y A;  3EGD C;  1F5M A;  3U2A A;  3KSH A;  4ME4 A;  1BYW A;  1TS0 A;  5MC7 A;  1P97 A;  3EGX C;  3CWF A;  1T1B A;  4Q0J A;  1F98 A;  4O0P A;  1TS7 A;  1N9O A;  2G7U A;  1S66 L;  3MXQ A;  1GSW A;  2M7V A;  4B93 A;  2L1M A;  3A0S A;  3G6O A;  3PHY A;  3KSI A;  4HNB A;  1YAX A;  2V0U A;  2OAP 1;  1DP8 A;  4BBT A;  2PD8 A;  2L4R A;  5HWW A;  1NRJ A;  3EQV A;  4BWI A;  5HWV A;  5G4Y A;  4L0L A;  1DP9 A;  3PBS A;  5DFY A;  1TS8 A;  2LB9 A;  4H6J B;  3MFX A;  2P04 A;  3CI6 A;  2W3H A;  2J80 A;  4CLC B;  2W1T A;  3H7W A;  4JGQ A;  3MQQ A;  2W3D A;  5L8M A;  2VA0 A;  2J3T C;  4HI4 A;  4M4X A;  5AVF A;  1T19 A;  1ODV A;  2XRO A;  2D01 A;  3PBQ A;  3K2N A;  2JKR I;  5HWT A;  2OAQ 1;  3F1N B;  3C2W A;  3R7W A;  3MJQ A;  4LLO B;  3VE4 A;  1DRM A;  2CMN A;  4CQH A;  4I3I A;  3UB6 A;  3UB7 A;  3IS2 B;  5K5B A;  4PHT A;  4I38 A;  4EUV A;  3V67 A;  3R4K A;  4GW9 A;  4I3A A;  3C30 A;  2GZA A;  1NLY A;  5A8B A;  4EQ1 A;  4P6Z S;  4UEY A;  2EWW A;  1IOU A;  2XA7 S;  5DJT A;  5J3W A;  4PKY A;  1W63 Q;  3E98 A;  1T1C A;  3H7W B;  2QKP A;  3T4K A;  2J3W A;  3BWL A;  4Y2F A;  1S1Z A;  3F1O B;  3KSF A;  4MN6 A;  4ARZ B;  3PBR A;  5I5L A;  1MZU A;  2OWH A;  3T4Q A;  2M1C A;  4ETZ A;  4HIA A;  3LID A;  4I5S A;  2EWV A;  2M7U A;  1G6O A;  2W3F A;  3PBT A;  1LT0 A;  5AJG A;  3HJK A;  4BJP A;  4F3L A;  4WEL A;  3LR4 A;  3MQ0 A;  3UB8 A;  4KUO A;  4P6Z M;  3LFV A;  4G3K A;  2ZMF A;  3CUE C;  3TJZ C;  3LI9 A;  2Y8H A;  4WN5 A;  4G3W A;  1NLZ A;  3MF0 A;  4MCW A;  2NUT C;  4NXF A;  2VGL M;  4LRX C;  1S67 L;  2YKF A;  1UWP X;  1OT6 A;  2B18 A;  2K7S A;  5HPI A;  5DJU A;  1S1Y A;  4HH2 A;  3RH8 B;  2DMW A;  1ZHH B;  3EWK A;  4MN5 A;  2V9A A;  4HJ6 A;  3O5Y A;  4L9E A;  4Y3I A;  5TJJ A;  5TBM A;  3CAX A;  2O9A A;  4BBV A;  2O99 A;  4E04 A;  1JNU A;  4WEK A;  3F1N A;  1DP6 A;  3EQU A;  2GNX A;  4BMW A;  3PBO A;  4HP4 A;  3K3C A;  2VLG A;  4JGR A;  3VE3 A;  2PR5 A;  2XRN A;  5IU1 A;  4OOL A;  2O0Y A;  3LR3 A;  4L9F A;  3CUE A;  3H82 A;  5DFX A;  3UE3 A;  1Y28 A;  2QJ5 A;  2JKT M;  3KO6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...