3NULA

Profilin i from arabidopsis thaliana
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
130
structure length
130
Chain Sequence
SWQSYVDDHLMCDVEGNHLTAAAILGQDGSVWAQSAKFPQLKPQEIDGIKKDFEEPGFLAPTGLFLGGEKYMVIQGEQGAVIRGKKGPGGVTIKKTNQALVFGFYDEPMTGGQCNLVVERLGDYLIESEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROFILIN I
publication title The crystal structure of a major allergen from plants.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Actin binding protein
total genus 34
structure length 130
sequence length 130
ec nomenclature
pdb deposition date 1996-11-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.30 Alpha Beta 2-Layer Sandwich Beta-Lactamase Dynein light chain 2a, cytoplasmic 3nulA00
5EM1A 1HLUP 1PFLA 4X1LA 5FDSA 4FTXA 2E8JA 1CJFA 3L9KA 1SKOB 5EV0A 1YPRA 1AWIA 3UB5P 3D9YA 1VETB 1ACFA 3LEQA 3U4LP 3T1RA 1A0KA 1J3WA 1Y4OA 1CF0A 3NECA 2PRFA 5EM0A 4ESPA 5FEGA 1FILA 1D1JA 4QWOA 1CQAA 1VEUA 2HZ5A 3CPTA 1Z09A 2BTFP 3MS6A 3MSHA 3NULA 2B95A 2V8CA 2V8FA 1FIKA 4FUWA 1G5UA 3T1QB 1VEUB 3LGOA 2PBDP 3T1XA 2ZL1A 4X1MA 4X25A 1PNEA 2JKFA 5FEFA 3T1SA 4D60A 3DAVA 2VK3A 2ZL1B 1K0KA 5EVEA 3CHWP 3L7HA 3KYEA 3T12B 3CPTB 2PAVP 1SZVA 1SKOA 2ACGA 1F2KA 1PRQA 2JKGA 1VETA
chains in the Genus database with same CATH superfamily
1E25A 1ONHA 1S1YA 2W3FA 2FFYA 3UO9A 5F83A 2JCHA 4Q0JA 4Y2FA 4PKYA 2WADA 1M40A 4Q8IA 1ZKJA 5FDHA 4MN7A 4XT2B 4JGQA 3UE3A 2W1RA 1VETB 3GVBA 3NC8A 3QP4A 4WEJA 4P85A 4DJ3A 3V3RA 5CTMA 1XJ2A 4X56A 2Q0OA 3KSGA 3G2ZA 3BWLA 3Q7VB 3IT9A 4QWOA 2Y59A 2V0UA 5CTNA 5CX7A 5E2EA 2Y2NA 1E4DA 1MWTA 5AQ7A 3V3SA 2HDSA 4OOLA 4C3QA 4JXVA 4LGWA 3OZHA 3OPLA 2WUQA 2J3TC 3NY4A 4X1MA 1GA9A 5KMWA 2UV0E 1PW8A 5DF7A 1G68A 1NYYA 5HAQA 4IJGA 3ZHHA 3RJUA 2OSUA 3BFGA 1YMXA 2VV8A 4NK3A 1PZPA 3QP5A 5FQIA 2OWHA 2A3UA 3H7WA 2GDNA 5J8XA 2P08A 1I2SA 1H8MA 3D72A 3HLFA 5CHJA 2Z2MB 4X1LA 1MPLA 1VHMA 3MBZA 4HIAA 3BFFA 5CGWA 3JVUA 4OLGA 5HD5A 4I39A 2HDQA 3Q7ZA 2B5RA 4RVAA 1XPBA 4R0QA 3HLGA 3SH7A 2KDKA 1J3WA 4IVIA 3UDIA 2W3DA 5FQ9A 4HP4A 3ZVTA 5DTSA 5HL6A 3ZDJA 5FEGA 1S4SA 1MBLA 3HBRA 3M2KA 3WRZA 4N1XA 3IQAA 3UB7A 3MQQA 2J3TD 5G18A 4EBPA 3C7UA 3ISGA 3OC2A 1ZG6A 1F98A 4GW9A 2P7JA 1K4EA 1OTIA 2HGVA 4KZ3A 5HX9A 4KZAA 4MCWA 5FA7A 1HVBA 4HH2A 1IYQA 3IF6A 2W3GA 4ID4A 1K0KA 3IX4A 4S2NC 3TJZC 3EWKA 3VOYA 3H9WA 1SZVA 2ZJ9A 4WUJA 3VP3A 2IA2A 1H0MA 3CUEA 5DJUA 1M6KA 4QJGA 4HH3A 1XFQA 2M7UA 1NRJA 2PR5A 4KQRA 3JPUA 3Q07A 4OPYA 4BBTA 3H7WB 4I38A 3OCNA 1OJ5A 2HJEA 5EECA 4LV2A 2V1BA 3DWKA 1BUEA 3UPOA 4LV1A 2OAP1 4ZBEA 1O07A 1Y4OA 3S1YA 3BFCA 2XQZA 3LIAA 4E3LA 3M2JA 3KYQA 4H6JA 4WYYA 2Y2JA 4K0XA 1WE4A 2VLGA 3MMHA 3G34A 3EQUA 2BTFP 3MSHA 3BYDA 3ZG5A 2Y2GA 1PW1A 4MNRA 1BYWA 3G32A 5M1AA 1KGFA 1DP9A 1BLHA 1YLWA 2V2FF 4K08A 4N9LA 2PHYA 2QHKA 2HDRA 1EI5A 3NJAA 4KUKA 4U0XA 4XUZA 5FAPA 3E4QA 1BLSA 5EVIA 1MWRA 2GNXA 5F68A 2NUTC 3O5YA 4IBRA 3ZG0A 3LY3A 1S67L 3IHBA 2WKHA 2H10A 4UEYA 4JPMA 5FI2A 4DKIA 4KZ9A 1Y54A 4Y17A 5EFWA 3OPHA 1FR6A 1XA7A 3UB5P 1YKDA 4DE1A 3D9YA 4PM9A 1LL8A 3S4XA 2EWWA 3M6BA 1VM1A 3LEQA 3PXPA 2JBFA 4S2OA 4N1HA 5FL3A 4C75A 1ES4A 5MC7A 1BT5A 3BRMA 1OT6A 4KG6A 4LRYC 2ZM0A 3VSLA 3NOTC 4UHUA 2KX6A 3HVFA 5KZHA 2XD1A 5DFYA 5FQQA 4YINA 4ZAMA 3CAXA 3F1OA 5HPFA 1NY0A 4DMZA 1NZOA 1OT9A 3NDEA 1H5XA 1T1BA 2ZC4B 2AVXA 3DTKA 4FUWA 4CLCA 3T1QB 4B4ZA 3IH8A 5A91A 3R4KA 3TRCA 3PAEA 1QMFA 5CHUA 1K25A 2XEPA 1Q2QA 4GCZA 4A5RA 5KSHA 3T4LA 1IOUA 4HQAA 4R4SA 1BZAA 3EQVA 4BD1A 3Q81A 1S1ZA 3WS1A 1YSPA 1ERQA 1EWZA 3D4FA 4OPRA 3WWXA 2PAVP 2V0WA 4PMAA 3UB9A 4WZ5C 2Q9NA 5HPIA 1ESUA 3T4KA 4S2LA 5EVIB 1HLUP 3JYIA 4E3IA 2WAEA 2JKTM 3O3VA 5L8MA 3CLOA 4H8RA 3VE3A 2J8YA 4EUVA 1MWSA 4E3JA 3FV7A 3GMWA 3LR5A 3HLWA 2H0YA 2K2NA 3ZCZA 2E8IA 3RTYA 3BQAA 3VP4A 4BLMA 2ZOIA 3VFFA 2VJWA 3DW0A 1L0DA 4E3KA 2EXAA 3C4PA 4Q0HA 1XFNA 5F1FA 2JN7A 2DNSA 2XFSA 5DJTA 4WEKA 2K7SA 3CPTA 3NULA 3LIDA 1CI8A 2OOLA 5GLCA 1MZUA 2ZBBA 1W8YA 5D3OA 2J7VA 3F1OB 1MWUA 1SHVA 3SH8A 3CITA 3VV4A 3T1XA 4OOMA 4U0TA 2HP9A 5EE8A 1KVLA 1GSXA 4OP8A 1S4RA 5TFQA 4WM9A 4GDNA 5J7EA 4CLCB 2XR0A 3K3CA 3PBTA 4MN5A 5GL9A 4EQ1A 3DTEA 4HJ4A 5IT5A 4DE0A 3CHWP 3CMZA 4QY6A 4NEED 3VFHA 5JYOA 2ZLYA 1SKOA 4BQMA 2PT7A 1XX2A 1H8YA 1L0EA 4G3WA 3C4OA 4I3AA 2H5SA 3PHYA 1PFLA 5CGSA 2E8JA 5EV0A 4GN2A 1GSWA 4DXCA 4P6ZS 3ZG8B 1YLJA 5AVEA 4EV4A 5A92A 1PYYA 3PAGA 3BQ8A 4GB7A 3HJIA 4K0WA 1GHIA 3LR0A 4ZTKA 4KG2A 1NLYA 1K56D 3OOVA 3MQOA 3VMAA 3LIBA 1F5MA 3G6OA 1K6RA 1FSWA 3G30A 5GLDA 3PBRA 4OQGA 3G2YA 1YLPA 1K55C 3OCLA 1PI5A 4CPKA 1VEUA 4Y0UA 4X68A 5GLAA 2ZQ7A 1ZHHB 2BG1A 4JGRA 4XUXA 2XROA 2IWCA 2JKRM 3BLSA 4GD6A 3OPRA 3LR4A 5EOEA 2WZZA 1E3UA 3GSGA 2H28A 4GKUA 5HDSA 3ITBA 1PNEA 2JKFA 1T1AA 4HI4A 4D60A 2IWBA 4DE2A 2WKRA 3A0SA 5DF8A 1OTBA 5L2FA 1XP4A 4EETB 4JGPA 4HY8A 3VOZA 3SZTA 5FI7A 4RA7A 3DBAA 3T12B 2GZAA 3FYZA 3E4PA 4EWFA 3W4PA 1T19A 3C8CA 1X0OA 4GJ4A 3NDGA 4S2IA 2Z6CA 1MKIA 5CERA 1DJBA 3HUOA 3DWZA 3MJQA 3LO7A 4ETXA 2HP6A 3OBFA 1SKOB 1V9YA 3C30A 1RP5A 1TD5A 4JF5A 2CC1A 4Y5FA 2H0TA 3A3IA 4N9KA 4S2NA 1L3LA 4HBTA 3NCKA 2XA7M 1W8QA 2ZQDA 4II7A 4OPQA 4Z1WA 4B88A 1A0KA 3PR6A 5E2HA 1SDNA 4QHCA 4LV3A 1CF0A 1WYCA 1ONGA 1XGJA 2ZQ8A 1XJ3A 3S22A 1T1CA 4IBXA 4CLCE 2ZQCA 2QKPA 4RX3A 4JBFA 1K54C 3FWLA 2J3WA 2XLNA 2ZD8A 4OVDA 1TF1A 3FKVA 4R3JA 2V9AA 1OTAA 3WS5A 1BLPA 3MR0A 3S7NA 4BMWA 1VEUB 4I5SA 1OPXA 4HJ3A 3KO6A 2HP5A 2PDRA 2V1ZA 5HL1A 3ZFZA 4PM5A 2Y2QA 4GLQA 4EUZA 3S7QA 3BY8A 1VQQA 1JWVA 5HZHA 3UDFA 2VK3A 5CECA 5A93A 1RCJA 3IXDA 1OMEA 1ZG4A 5AQBA 5DFXA 3MZEA 1GA0A 1JTDA 4WZ4A 1P0ZA 2XA7S 2VGLM 4OH0A 3F1NA 1FQGA 1C3BA 1YT4A 1KE4A 2QJ7A 3W8KA 3EGDC 5HAPA 4NXEA 4E3MA 1D06A 1FOFA 4BL2A 3Q82A 3TW8A 1EROA 2J9OA 1ES2A 3KYZA 3D3OA 4EERA 3O88A 2QMIA 1SKFA 5EM0A 4S2PA 3HUNA 2JC7A 4HESA 3N8LA 3GV9A 1W63Q 1RGYA 4GD8A 5F69A 4OKPA 1XGIA 5EPHA 4HNBA 3CZDA 1Q2PA 1TDGA 1KDWA 3HLEA 2ZM8A 1P9RA 3NBLA 3Q1FA 3GR2A 4F3LA 2B02A 3G35A 1IELA 4UQIM 2UWXA 4DXBA 1UWPX 4WBGA 2LB5A 2WYXA 4OOYA 3DTIA 4WN5A 2Y2LA 2P04A 4RX2A 4YFMA 5FI6A 3T1SA 4ZDXA 3PBQA 4KQOA 2XF3A 5EVEA 2HPBA 3IXBA 5EOOA 2ZC6B 3FZCA 4HHDA 2JHEA 4HP9A 4KG5A 3KX0X 4ZJ1A 2Y2MA 4O0PA 2JKGA 4Z9QA 1DRMA 2IWDA 3C7VA 2BLSA 2YKHA 4EW7A 3ZNYA 1JTGA 1K57C 2L0WA 4KZ8A 1CJFA 3T4JA 3QP1A 2A24A 3UN7A 3A3EA 4LPZA 2B18A 3ZNTA 5TBMA 2OWJA 4NXBA 3NOUC 5GHYA 4RQ9A 1MXOA 2ZMAA 2XD5A 3GDIA 3W4OA 3IF6B 3F1NB 2Y55A 2Y2PA 1PZOA 1UGUA 3T1RA 5J4EA 4KZBA 4WZ5A 2M7VA 3IWIA 2PU4A 4BJPA 2YKFA 3KSHA 4IVKA 2A49A 1OTDA 4MN6A 1W5DA 4ESPA 2DRWA 3AGFA 3CUEC 5DVAA 1FILA 1N9LA 4GS9A 3TSGA 1I2WA 1FCNA 2HV1A 3WS2A 2PU2A 4LCMA 3NHQA 1K4FA 1VB6A 4IUKA 2QWSA 2M1CA 3A3FA 3N8RA 3R7WA 3LFVA 3LI8A 1MKMA 2PBDP 5HWVA 1ZTUA 1XA1A 3LIFA 3UB6A 1NWZA 4NG2A 2W3EA 3KSFA 1I5QA 3T4TA 3MXSA 3PBSA 4BD0A 3VSKA 4LRZE 1Z6FA 4C6YA 3ZGAB 1DP6A 2WKIA 4JLFA 2MJ6A 3DAVA 4F3LB 4PAUA 2Y4AA 4ZRRA 5GHXA 4H6JB 1L0GA 1SCWA 3UY6A 4FH2A 3O86A 3CJMA 4FH4A 4R3AA 2JKRI 1G6AA 2LB9A 1S66L 4JF6A 5FSRA 5HDDA 1F2KA 2NUPC 3UB8A 3ZVWA 3C38A 4HOIA 3H82A 4MBHA 3IWQA 1OTEA 5EM1A 2OV5A 2O9BA 3I7JA 4QB8A 1FR1A 2V1AA 2PD7A 4P87A 1J9MA 2EXBA 3GQZA 3U4LP 3ZG7B 5FATA 4R4RA 1H8ZA 5I5LA 2W1TA 3MXRA 3T4OA 1IKGA 3CI6A 4EEPA 3T4SA 2PRFA 5DKLA 3WS0A 4EBNA 5CHMA 4E6WA 1IKIA 2HJ9C 3IS2A 4DN0A 2WGWA 4Y7PA 5L09A 2VA0A 1Z09A 4R3BA 3UE1A 2XSSA 3BJNA 2V8FA 4E3OA 3LICA 4GS9B 3LI9A 3C2WA 4FSFA 2EX8A 3NOPC 3HLBA 3IF5A 3SW1A 1DJAA 4M3KA 1NLZA 1CI9A 2C6WB 5K5BA 1NYMA 2Y2IA 3W4QA 2FH5A 4EXOA 1K55A 3FPWA 4ZJ3A 5TR7A 2WKEA 5FASA 4UA7A 3EOIA 1LI9A 2Y2OA 1UWNX 4CJNA 3MZDA 1ODVA 2XDMA 4N92A 1SDEA 1WYBA 4AFIA 5M19A 3Q7VA 3UE0A 4BBVA 1MY8A 3IXGA 3RXXA 3MXQA 1EW0A 3LIEA 5FDSA 2O0YA 3L9KA 5EVID 4WMCD 3A0RA 1YPRA 4R70A 1XJ4A 3BFDA 2C5WB 2V20A 1TS8A 3AGDA 4XXRA 4O7DA 3TG9A 4JGOA 4D2OA 5DKKA 3MZFA 1LHYA 4RYEA 5L07A 1ES5A 4L9EA 1V9ZA 3PBNA 1FSYA 2WKQA 3MKFA 4LENA 2ZMVA 1TEMA 4QPRA 2W1TB 4G3KA 4KZ4A 1K38A 2QPNA 3MF0A 1YLZA 1YAXA 1YM1A 2A2LA 2V8CA 1W79A 5FAQA 5JYPA 4WLAA 2WGVA 5G4YA 1G5UA 3HLCA 4QY5A 4EBLA 1O7EA 3LGOA 2WGWB 4ME4A 4KUOA 4EQIA 4PKYG 1LSXA 3EEAA 4MMNA 4DE3A 1KVMA 1IYPA 4X69A 1KDSA 1K54A 2VGJA 1S6RA 2RL3A 4CLCD 4OONA 1LSWA 1RGZA 3C5AA 4LLOB 4X53A 2GX5A 1U60A 1NRFA 2Y91A 2WKPA 4CQHA 3FKWA 3CPTB 1ZC2A 4BBUA 4P0MA 4O8GA 4JXSA 4KZ6A 3LR3A 4L9FA 5FAOA 4JKTA 4QD4A 4PPRA 1NZUA 2P9VA 3LYXA 4FTXA 1LI0A 3B47A 2PYPA 4NETA 4I3IA 2K31A 2QJ5A 3A0VA 3UDXA 3UE6A 4KZ5A 3E4OA 3V5MA 3LUQA 4IHQA 4PHTA 4L0LA 5A8BA 2W0NA 3QHYA 3QP8A 4MBFA 4G3VA 4HJ6A 3OPPA 5AQAA 1BSGA 2PD8A 5C5KA 3VP0A 1CQAA 4FOFA 1FCMA 4NKPA 3TOIA 4OQ0A 1GHMA 4NXGA 4YWZA 5AVFA 3M6HA 2VZWA 1DY6A 4YNRA 3E2KA 3MKEA 4HEFA 3N7WA 4EESA 5F82A 1MC0A 2W27A 4F94A 2EFUA 1JWZA 2I72A 1N9OA 5G4ZA 3E0YA 4K91A 4P6BA 4HBUA 1CEGA 3K3DA 4LRXC 1KGGA 1YQSA 2KOIA 3N4IA 3SH9A 5L10A 4S2KA 2BASA 2J80A 5DF9A 3BM6A 3UNWA 1CEFA 3RH8B 2EA9A 4R6LA 3RXWA 3V50A 4U3TA 3B42A 2DMWA 4DJ2A 3IX8A 3SOIA 5IS1A 3P7NA 2OLUA 4E6XA 5LBRA 3A3DA 5CEDA 1BLCA 2P9VB 2GJ3A 2QZ6A 4JXWA 3MFXA 4WL9A 1IEMA 2ZC3B 3G4PA 1LL5A 2O9CA 2Y2HA 4GZBA 3PTEA 2X01A 5HFOA 3A3JA 4R1GA 3NECA 4BENA 1STZA 3EEHA 3G31A 1K57A 3HLDA 5GHZA 1LL9A 4IUHA 4BL3A 4LCLA 2XH9A 3PYPA 1PWCA 1Y28A 1ES3A 3BY9A 1IFQA 2ZOHA 3T50A 2VEAA 5IHVA 3IBRA 1TS0A 2JE5A 3GRJA 3WS4A 4EEUA 5HAIA 3LCEA 4OLDA 2ZL1A 3WRTA 5DTKA 1D7EA 3ITAA 2JKTI 4X25A 4QU3A 3E98A 3S7PA 5FQJA 2D01A 2INWA 2VV6A 3K2NA 1PI4A 2VX8A 3N6IA 1E3UD 2WAFA 3DTMA 3HREA 5HWWA 1W63M 3L7HA 1TS7A 2OLVA 3QP6A 3BLMA 2ZC5B 4Y13A 5KIZA 3EGXC 4MEZA 4Y0TA 3FC7A 1N9NA 3ZYTA 4S2MA 2Y2KA 2O99A 2G7UA 3T4QA 4MLLA 3MFDA 4Q0IA 2Y8HA 5DTTA 1L2SA 2G2WA 1H3QA 1JVJA 4KQDA 3FG8A 2EX2A 1AWIA 2VGLS 2XFTA 1GHPA 4Y15A 2OAQ1 4L9GA 3S7OA 5FQKA 3MQ0A 4DDSA 4EU0A 1YMSA 1KGEA 2PBYA 1LLBA 3IBJA 4E3NA 4JF4A 2XK1A 4IEDA 2EX9A 1ALQA 3FPVA 5AJGA 4MDZA 4DDYA 1QMEA 4ETZA 4LFUA 3IF6C 5HSQA 3MS6A 1N9BA 1F9IA 1AXBA 3P09A 3SS4A 2J9PA 1FIKA 4R23A 3HCYA 2RCXA 5CRFA 4O01A 3SS5A 4UAAA 2Z2LB 4WMCA 3IHAA 3UMEA 4KZ7A 2ZC7A 4E04A 1LSVA 3B3XA 2KLIA 1K6SA 4UQIS 3ICYA 5E2FA 4MBKA 3HJKA 4ZJ2A 3BFEA 2XRNA 4B4XA 1GCEA 2I9VA 3O87A 4DF6A 4FCFA 1ERMA 1FCOA 5A90A 5FQMA 1ESIA 1YLYA 5CGXA 2ZL1B 3N8SA 1W7FA 3GTCA 3QP2A 3KYEA 5HARA 4OP5A 5HD3A 1PWGA 3BECA 2VKSA 2WK0A 4X6TA 1K56A 2ZQAA 3IX3A 3P01A 5TGFA 1TDLA 4UA6A 1S0WA 4PM7A 2DCFA 4B93A 3F1PA 1NXYA 2HF6A 2HDUA 1ACFA 5GLBA 1WA9A 3NI9A 2X71A 3GECA 1JNUA 3RFBA 4GDBA 1KOUA 1TVFA 2O9AA 3ZQ5A 1KE0A 1G6OA 2Z6DA 1GSVA 4I3JA 3LY4A 2R9WA 5BOHA 3BW6A 3AGEA 3VOLA 3ULFA 1DJCA 5KSCA 1XXMA 2A24B 4NXFA 2B95A 1XJ6A 3BEBA 5CEBA 4OQHA 3QNCA 5EVIC 4BWIA 3CG5A 4PM6A 5TBMB 1G28A 5HW3A 1LT0A 5CXWA 2VV7A 3V39A 5J3WA 3PBOA 3ZG9B 1KE3A 5F1GA 4GNUA 4GHIA 2ZM2A 1P97A 5FEFA 3LEZA 1NJ4A 1L0FA 3VE4A 3KSIA 2Y79A 4OQIA 4M4XA 3HUMA 4ARZA 4KENB 5E2GA 3SS3A 3B33A 2EFXA 1TS6A 2CMNA 3IH9A 1HD8A 4R38A 4XT2A 3HL9A 3VP1A 1JWPA 3R7WB 1VETA 2FFFB 4P6ZM 2D02A 3IXHA 3U2AA 3UMDA 1IYOA 1BTLA 2PR6A 4YOFA 2PYRA 4DRTA 5I94A 4LV0A 3IWOA 4Y3IA 5AQ9A 3JVVA 1PIOA 4CLCC 1OJGA 1DP8A 1T18A 5E43A 3F1PB 3UPPA 5U47A 2L4RA 2QYBA 2R78A 5HDCA 3NIAA 5M18A 1CK3A 4S2JA 3H82B 4GOGA 1D1JA 4PM8A 2ZMFA 2FZ0A 5F5YA 4OPZA 2HZ5A 2G2UA 2ZQ9A 4B9OA 3OLOA 1BULA 2W3HA 2EWVA 4UA9A 4X55A 2EX6A 1P9WA 1PWDA 1HTZA 4KQQA 4Y0OA 3UPNA 1HZOA 1IYSA 2WGIA 1N4OA 3VP2A 4FD8A 2P74A 5EVLA 5F6AA 5TJJA 3QNBA 2X02A 2WZXA 3TE8A 1YSQA 5HWTA 4WF0A 1XKZA 1YLTA 3W2ZA 3CWFA 5EUAA 2VGKA 2R9XA 3E2LA 4WELA 2Q9MA 3IS2B 4GHIB 3V67A 5IU1A 2ACGA 2L1MA 3P98A 1PRQA 4ARZB 2XGNA 4JXGA
chains in the Genus database with same CATH topology
5EM1A 1HLUP 1PFLA 4X1LA 5FDSA 4FTXA 2E8JA 1CJFA 3L9KA 1SKOB 5EV0A 1YPRA 1AWIA 3UB5P 3D9YA 1VETB 1ACFA 3LEQA 3U4LP 3T1RA 1A0KA 1J3WA 1Y4OA 1CF0A 3NECA 2PRFA 5EM0A 4ESPA 5FEGA 1FILA 1D1JA 4QWOA 1CQAA 1VEUA 2HZ5A 3CPTA 1Z09A 2BTFP 3MS6A 3MSHA 3NULA 2B95A 2V8CA 2V8FA 1FIKA 4FUWA 1G5UA 3T1QB 1VEUB 3LGOA 2PBDP 3T1XA 2ZL1A 4X1MA 4X25A 1PNEA 2JKFA 5FEFA 3T1SA 4D60A 3DAVA 2VK3A 2ZL1B 1K0KA 5EVEA 3CHWP 3L7HA 3KYEA 3T12B 3CPTB 2PAVP 1SZVA 1SKOA 2ACGA 1F2KA 1PRQA 2JKGA 1VETA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EM1 A;  1HLU P;  1PFL A;  4X1L A;  5FDS A;  4FTX A;  2E8J A;  1CJF A;  3L9K A;  1SKO B;  5EV0 A;  1YPR A;  1AWI A;  3UB5 P;  3D9Y A;  1VET B;  1ACF A;  3LEQ A;  3U4L P;  3T1R A;  1A0K A;  1J3W A;  1Y4O A;  1CF0 A;  3NEC A;  2PRF A;  5EM0 A;  4ESP A;  5FEG A;  1FIL A;  1D1J A;  4QWO A;  1CQA A;  1VEU A;  2HZ5 A;  3CPT A;  1Z09 A;  2BTF P;  3MS6 A;  3MSH A;  3NUL A;  2B95 A;  2V8C A;  2V8F A;  1FIK A;  4FUW A;  1G5U A;  3T1Q B;  1VEU B;  3LGO A;  2PBD P;  3T1X A;  2ZL1 A;  4X1M A;  4X25 A;  1PNE A;  2JKF A;  5FEF A;  3T1S A;  4D60 A;  3DAV A;  2VK3 A;  2ZL1 B;  1K0K A;  5EVE A;  3CHW P;  3L7H A;  3KYE A;  3T12 B;  3CPT B;  2PAV P;  1SZV A;  1SKO A;  2ACG A;  1F2K A;  1PRQ A;  2JKG A;  1VET A; 
#chains in the Genus database with same CATH topology
 1E25 A;  1ONH A;  1S1Y A;  2W3F A;  2FFY A;  3UO9 A;  5F83 A;  2JCH A;  4Q0J A;  4Y2F A;  4PKY A;  2WAD A;  1M40 A;  4Q8I A;  1ZKJ A;  5FDH A;  4MN7 A;  4XT2 B;  4JGQ A;  3UE3 A;  2W1R A;  1VET B;  3GVB A;  3NC8 A;  3QP4 A;  4WEJ A;  4P85 A;  4DJ3 A;  3V3R A;  5CTM A;  1XJ2 A;  4X56 A;  2Q0O A;  3KSG A;  3G2Z A;  3BWL A;  3Q7V B;  3IT9 A;  4QWO A;  2Y59 A;  2V0U A;  5CTN A;  5CX7 A;  5E2E A;  2Y2N A;  1E4D A;  1MWT A;  5AQ7 A;  3V3S A;  2HDS A;  4OOL A;  4C3Q A;  4JXV A;  4LGW A;  3OZH A;  3OPL A;  2WUQ A;  2J3T C;  3NY4 A;  4X1M A;  1GA9 A;  5KMW A;  2UV0 E;  1PW8 A;  5DF7 A;  1G68 A;  1NYY A;  5HAQ A;  4IJG A;  3ZHH A;  3RJU A;  2OSU A;  3BFG A;  1YMX A;  2VV8 A;  4NK3 A;  1PZP A;  3QP5 A;  5FQI A;  2OWH A;  2A3U A;  3H7W A;  2GDN A;  5J8X A;  2P08 A;  1I2S A;  1H8M A;  3D72 A;  3HLF A;  5CHJ A;  2Z2M B;  4X1L A;  1MPL A;  1VHM A;  3MBZ A;  4HIA A;  3BFF A;  5CGW A;  3JVU A;  4OLG A;  5HD5 A;  4I39 A;  2HDQ A;  3Q7Z A;  2B5R A;  4RVA A;  1XPB A;  4R0Q A;  3HLG A;  3SH7 A;  2KDK A;  1J3W A;  4IVI A;  3UDI A;  2W3D A;  5FQ9 A;  4HP4 A;  3ZVT A;  5DTS A;  5HL6 A;  3ZDJ A;  5FEG A;  1S4S A;  1MBL A;  3HBR A;  3M2K A;  3WRZ A;  4N1X A;  3IQA A;  3UB7 A;  3MQQ A;  2J3T D;  5G18 A;  4EBP A;  3C7U A;  3ISG A;  3OC2 A;  1ZG6 A;  1F98 A;  4GW9 A;  2P7J A;  1K4E A;  1OTI A;  2HGV A;  4KZ3 A;  5HX9 A;  4KZA A;  4MCW A;  5FA7 A;  1HVB A;  4HH2 A;  1IYQ A;  3IF6 A;  2W3G A;  4ID4 A;  1K0K A;  3IX4 A;  4S2N C;  3TJZ C;  3EWK A;  3VOY A;  3H9W A;  1SZV A;  2ZJ9 A;  4WUJ A;  3VP3 A;  2IA2 A;  1H0M A;  3CUE A;  5DJU A;  1M6K A;  4QJG A;  4HH3 A;  1XFQ A;  2M7U A;  1NRJ A;  2PR5 A;  4KQR A;  3JPU A;  3Q07 A;  4OPY A;  4BBT A;  3H7W B;  4I38 A;  3OCN A;  1OJ5 A;  2HJE A;  5EEC A;  4LV2 A;  2V1B A;  3DWK A;  1BUE A;  3UPO A;  4LV1 A;  2OAP 1;  4ZBE A;  1O07 A;  1Y4O A;  3S1Y A;  3BFC A;  2XQZ A;  3LIA A;  4E3L A;  3M2J A;  3KYQ A;  4H6J A;  4WYY A;  2Y2J A;  4K0X A;  1WE4 A;  2VLG A;  3MMH A;  3G34 A;  3EQU A;  2BTF P;  3MSH A;  3BYD A;  3ZG5 A;  2Y2G A;  1PW1 A;  4MNR A;  1BYW A;  3G32 A;  5M1A A;  1KGF A;  1DP9 A;  1BLH A;  1YLW A;  2V2F F;  4K08 A;  4N9L A;  2PHY A;  2QHK A;  2HDR A;  1EI5 A;  3NJA A;  4KUK A;  4U0X A;  4XUZ A;  5FAP A;  3E4Q A;  1BLS A;  5EVI A;  1MWR A;  2GNX A;  5F68 A;  2NUT C;  3O5Y A;  4IBR A;  3ZG0 A;  3LY3 A;  1S67 L;  3IHB A;  2WKH A;  2H10 A;  4UEY A;  4JPM A;  5FI2 A;  4DKI A;  4KZ9 A;  1Y54 A;  4Y17 A;  5EFW A;  3OPH A;  1FR6 A;  1XA7 A;  3UB5 P;  1YKD A;  4DE1 A;  3D9Y A;  4PM9 A;  1LL8 A;  3S4X A;  2EWW A;  3M6B A;  1VM1 A;  3LEQ A;  3PXP A;  2JBF A;  4S2O A;  4N1H A;  5FL3 A;  4C75 A;  1ES4 A;  5MC7 A;  1BT5 A;  3BRM A;  1OT6 A;  4KG6 A;  4LRY C;  2ZM0 A;  3VSL A;  3NOT C;  4UHU A;  2KX6 A;  3HVF A;  5KZH A;  2XD1 A;  5DFY A;  5FQQ A;  4YIN A;  4ZAM A;  3CAX A;  3F1O A;  5HPF A;  1NY0 A;  4DMZ A;  1NZO A;  1OT9 A;  3NDE A;  1H5X A;  1T1B A;  2ZC4 B;  2AVX A;  3DTK A;  4FUW A;  4CLC A;  3T1Q B;  4B4Z A;  3IH8 A;  5A91 A;  3R4K A;  3TRC A;  3PAE A;  1QMF A;  5CHU A;  1K25 A;  2XEP A;  1Q2Q A;  4GCZ A;  4A5R A;  5KSH A;  3T4L A;  1IOU A;  4HQA A;  4R4S A;  1BZA A;  3EQV A;  4BD1 A;  3Q81 A;  1S1Z A;  3WS1 A;  1YSP A;  1ERQ A;  1EWZ A;  3D4F A;  4OPR A;  3WWX A;  2PAV P;  2V0W A;  4PMA A;  3UB9 A;  4WZ5 C;  2Q9N A;  5HPI A;  1ESU A;  3T4K A;  4S2L A;  5EVI B;  1HLU P;  3JYI A;  4E3I A;  2WAE A;  2JKT M;  3O3V A;  5L8M A;  3CLO A;  4H8R A;  3VE3 A;  2J8Y A;  4EUV A;  1MWS A;  4E3J A;  3FV7 A;  3GMW A;  3LR5 A;  3HLW A;  2H0Y A;  2K2N A;  3ZCZ A;  2E8I A;  3RTY A;  3BQA A;  3VP4 A;  4BLM A;  2ZOI A;  3VFF A;  2VJW A;  3DW0 A;  1L0D A;  4E3K A;  2EXA A;  3C4P A;  4Q0H A;  1XFN A;  5F1F A;  2JN7 A;  2DNS A;  2XFS A;  5DJT A;  4WEK A;  2K7S A;  3CPT A;  3NUL A;  3LID A;  1CI8 A;  2OOL A;  5GLC A;  1MZU A;  2ZBB A;  1W8Y A;  5D3O A;  2J7V A;  3F1O B;  1MWU A;  1SHV A;  3SH8 A;  3CIT A;  3VV4 A;  3T1X A;  4OOM A;  4U0T A;  2HP9 A;  5EE8 A;  1KVL A;  1GSX A;  4OP8 A;  1S4R A;  5TFQ A;  4WM9 A;  4GDN A;  5J7E A;  4CLC B;  2XR0 A;  3K3C A;  3PBT A;  4MN5 A;  5GL9 A;  4EQ1 A;  3DTE A;  4HJ4 A;  5IT5 A;  4DE0 A;  3CHW P;  3CMZ A;  4QY6 A;  4NEE D;  3VFH A;  5JYO A;  2ZLY A;  1SKO A;  4BQM A;  2PT7 A;  1XX2 A;  1H8Y A;  1L0E A;  4G3W A;  3C4O A;  4I3A A;  2H5S A;  3PHY A;  1PFL A;  5CGS A;  2E8J A;  5EV0 A;  4GN2 A;  1GSW A;  4DXC A;  4P6Z S;  3ZG8 B;  1YLJ A;  5AVE A;  4EV4 A;  5A92 A;  1PYY A;  3PAG A;  3BQ8 A;  4GB7 A;  3HJI A;  4K0W A;  1GHI A;  3LR0 A;  4ZTK A;  4KG2 A;  1NLY A;  1K56 D;  3OOV A;  3MQO A;  3VMA A;  3LIB A;  1F5M A;  3G6O A;  1K6R A;  1FSW A;  3G30 A;  5GLD A;  3PBR A;  4OQG A;  3G2Y A;  1YLP A;  1K55 C;  3OCL A;  1PI5 A;  4CPK A;  1VEU A;  4Y0U A;  4X68 A;  5GLA A;  2ZQ7 A;  1ZHH B;  2BG1 A;  4JGR A;  4XUX A;  2XRO A;  2IWC A;  2JKR M;  3BLS A;  4GD6 A;  3OPR A;  3LR4 A;  5EOE A;  2WZZ A;  1E3U A;  3GSG A;  2H28 A;  4GKU A;  5HDS A;  3ITB A;  1PNE A;  2JKF A;  1T1A A;  4HI4 A;  4D60 A;  2IWB A;  4DE2 A;  2WKR A;  3A0S A;  5DF8 A;  1OTB A;  5L2F A;  1XP4 A;  4EET B;  4JGP A;  4HY8 A;  3VOZ A;  3SZT A;  5FI7 A;  4RA7 A;  3DBA A;  3T12 B;  2GZA A;  3FYZ A;  3E4P A;  4EWF A;  3W4P A;  1T19 A;  3C8C A;  1X0O A;  4GJ4 A;  3NDG A;  4S2I A;  2Z6C A;  1MKI A;  5CER A;  1DJB A;  3HUO A;  3DWZ A;  3MJQ A;  3LO7 A;  4ETX A;  2HP6 A;  3OBF A;  1SKO B;  1V9Y A;  3C30 A;  1RP5 A;  1TD5 A;  4JF5 A;  2CC1 A;  4Y5F A;  2H0T A;  3A3I A;  4N9K A;  4S2N A;  1L3L A;  4HBT A;  3NCK A;  2XA7 M;  1W8Q A;  2ZQD A;  4II7 A;  4OPQ A;  4Z1W A;  4B88 A;  1A0K A;  3PR6 A;  5E2H A;  1SDN A;  4QHC A;  4LV3 A;  1CF0 A;  1WYC A;  1ONG A;  1XGJ A;  2ZQ8 A;  1XJ3 A;  3S22 A;  1T1C A;  4IBX A;  4CLC E;  2ZQC A;  2QKP A;  4RX3 A;  4JBF A;  1K54 C;  3FWL A;  2J3W A;  2XLN A;  2ZD8 A;  4OVD A;  1TF1 A;  3FKV A;  4R3J A;  2V9A A;  1OTA A;  3WS5 A;  1BLP A;  3MR0 A;  3S7N A;  4BMW A;  1VEU B;  4I5S A;  1OPX A;  4HJ3 A;  3KO6 A;  2HP5 A;  2PDR A;  2V1Z A;  5HL1 A;  3ZFZ A;  4PM5 A;  2Y2Q A;  4GLQ A;  4EUZ A;  3S7Q A;  3BY8 A;  1VQQ A;  1JWV A;  5HZH A;  3UDF A;  2VK3 A;  5CEC A;  5A93 A;  1RCJ A;  3IXD A;  1OME A;  1ZG4 A;  5AQB A;  5DFX A;  3MZE A;  1GA0 A;  1JTD A;  4WZ4 A;  1P0Z A;  2XA7 S;  2VGL M;  4OH0 A;  3F1N A;  1FQG A;  1C3B A;  1YT4 A;  1KE4 A;  2QJ7 A;  3W8K A;  3EGD C;  5HAP A;  4NXE A;  4E3M A;  1D06 A;  1FOF A;  4BL2 A;  3Q82 A;  3TW8 A;  1ERO A;  2J9O A;  1ES2 A;  3KYZ A;  3D3O A;  4EER A;  3O88 A;  2QMI A;  1SKF A;  5EM0 A;  4S2P A;  3HUN A;  2JC7 A;  4HES A;  3N8L A;  3GV9 A;  1W63 Q;  1RGY A;  4GD8 A;  5F69 A;  4OKP A;  1XGI A;  5EPH A;  4HNB A;  3CZD A;  1Q2P A;  1TDG A;  1KDW A;  3HLE A;  2ZM8 A;  1P9R A;  3NBL A;  3Q1F A;  3GR2 A;  4F3L A;  2B02 A;  3G35 A;  1IEL A;  4UQI M;  2UWX A;  4DXB A;  1UWP X;  4WBG A;  2LB5 A;  2WYX A;  4OOY A;  3DTI A;  4WN5 A;  2Y2L A;  2P04 A;  4RX2 A;  4YFM A;  5FI6 A;  3T1S A;  4ZDX A;  3PBQ A;  4KQO A;  2XF3 A;  5EVE A;  2HPB A;  3IXB A;  5EOO A;  2ZC6 B;  3FZC A;  4HHD A;  2JHE A;  4HP9 A;  4KG5 A;  3KX0 X;  4ZJ1 A;  2Y2M A;  4O0P A;  2JKG A;  4Z9Q A;  1DRM A;  2IWD A;  3C7V A;  2BLS A;  2YKH A;  4EW7 A;  3ZNY A;  1JTG A;  1K57 C;  2L0W A;  4KZ8 A;  1CJF A;  3T4J A;  3QP1 A;  2A24 A;  3UN7 A;  3A3E A;  4LPZ A;  2B18 A;  3ZNT A;  5TBM A;  2OWJ A;  4NXB A;  3NOU C;  5GHY A;  4RQ9 A;  1MXO A;  2ZMA A;  2XD5 A;  3GDI A;  3W4O A;  3IF6 B;  3F1N B;  2Y55 A;  2Y2P A;  1PZO A;  1UGU A;  3T1R A;  5J4E A;  4KZB A;  4WZ5 A;  2M7V A;  3IWI A;  2PU4 A;  4BJP A;  2YKF A;  3KSH A;  4IVK A;  2A49 A;  1OTD A;  4MN6 A;  1W5D A;  4ESP A;  2DRW A;  3AGF A;  3CUE C;  5DVA A;  1FIL A;  1N9L A;  4GS9 A;  3TSG A;  1I2W A;  1FCN A;  2HV1 A;  3WS2 A;  2PU2 A;  4LCM A;  3NHQ A;  1K4F A;  1VB6 A;  4IUK A;  2QWS A;  2M1C A;  3A3F A;  3N8R A;  3R7W A;  3LFV A;  3LI8 A;  1MKM A;  2PBD P;  5HWV A;  1ZTU A;  1XA1 A;  3LIF A;  3UB6 A;  1NWZ A;  4NG2 A;  2W3E A;  3KSF A;  1I5Q A;  3T4T A;  3MXS A;  3PBS A;  4BD0 A;  3VSK A;  4LRZ E;  1Z6F A;  4C6Y A;  3ZGA B;  1DP6 A;  2WKI A;  4JLF A;  2MJ6 A;  3DAV A;  4F3L B;  4PAU A;  2Y4A A;  4ZRR A;  5GHX A;  4H6J B;  1L0G A;  1SCW A;  3UY6 A;  4FH2 A;  3O86 A;  3CJM A;  4FH4 A;  4R3A A;  2JKR I;  1G6A A;  2LB9 A;  1S66 L;  4JF6 A;  5FSR A;  5HDD A;  1F2K A;  2NUP C;  3UB8 A;  3ZVW A;  3C38 A;  4HOI A;  3H82 A;  4MBH A;  3IWQ A;  1OTE A;  5EM1 A;  2OV5 A;  2O9B A;  3I7J A;  4QB8 A;  1FR1 A;  2V1A A;  2PD7 A;  4P87 A;  1J9M A;  2EXB A;  3GQZ A;  3U4L P;  3ZG7 B;  5FAT A;  4R4R A;  1H8Z A;  5I5L A;  2W1T A;  3MXR A;  3T4O A;  1IKG A;  3CI6 A;  4EEP A;  3T4S A;  2PRF A;  5DKL A;  3WS0 A;  4EBN A;  5CHM A;  4E6W A;  1IKI A;  2HJ9 C;  3IS2 A;  4DN0 A;  2WGW A;  4Y7P A;  5L09 A;  2VA0 A;  1Z09 A;  4R3B A;  3UE1 A;  2XSS A;  3BJN A;  2V8F A;  4E3O A;  3LIC A;  4GS9 B;  3LI9 A;  3C2W A;  4FSF A;  2EX8 A;  3NOP C;  3HLB A;  3IF5 A;  3SW1 A;  1DJA A;  4M3K A;  1NLZ A;  1CI9 A;  2C6W B;  5K5B A;  1NYM A;  2Y2I A;  3W4Q A;  2FH5 A;  4EXO A;  1K55 A;  3FPW A;  4ZJ3 A;  5TR7 A;  2WKE A;  5FAS A;  4UA7 A;  3EOI A;  1LI9 A;  2Y2O A;  1UWN X;  4CJN A;  3MZD A;  1ODV A;  2XDM A;  4N92 A;  1SDE A;  1WYB A;  4AFI A;  5M19 A;  3Q7V A;  3UE0 A;  4BBV A;  1MY8 A;  3IXG A;  3RXX A;  3MXQ A;  1EW0 A;  3LIE A;  5FDS A;  2O0Y A;  3L9K A;  5EVI D;  4WMC D;  3A0R A;  1YPR A;  4R70 A;  1XJ4 A;  3BFD A;  2C5W B;  2V20 A;  1TS8 A;  3AGD A;  4XXR A;  4O7D A;  3TG9 A;  4JGO A;  4D2O A;  5DKK A;  3MZF A;  1LHY A;  4RYE A;  5L07 A;  1ES5 A;  4L9E A;  1V9Z A;  3PBN A;  1FSY A;  2WKQ A;  3MKF A;  4LEN A;  2ZMV A;  1TEM A;  4QPR A;  2W1T B;  4G3K A;  4KZ4 A;  1K38 A;  2QPN A;  3MF0 A;  1YLZ A;  1YAX A;  1YM1 A;  2A2L A;  2V8C A;  1W79 A;  5FAQ A;  5JYP A;  4WLA A;  2WGV A;  5G4Y A;  1G5U A;  3HLC A;  4QY5 A;  4EBL A;  1O7E A;  3LGO A;  2WGW B;  4ME4 A;  4KUO A;  4EQI A;  4PKY G;  1LSX A;  3EEA A;  4MMN A;  4DE3 A;  1KVM A;  1IYP A;  4X69 A;  1KDS A;  1K54 A;  2VGJ A;  1S6R A;  2RL3 A;  4CLC D;  4OON A;  1LSW A;  1RGZ A;  3C5A A;  4LLO B;  4X53 A;  2GX5 A;  1U60 A;  1NRF A;  2Y91 A;  2WKP A;  4CQH A;  3FKW A;  3CPT B;  1ZC2 A;  4BBU A;  4P0M A;  4O8G A;  4JXS A;  4KZ6 A;  3LR3 A;  4L9F A;  5FAO A;  4JKT A;  4QD4 A;  4PPR A;  1NZU A;  2P9V A;  3LYX A;  4FTX A;  1LI0 A;  3B47 A;  2PYP A;  4NET A;  4I3I A;  2K31 A;  2QJ5 A;  3A0V A;  3UDX A;  3UE6 A;  4KZ5 A;  3E4O A;  3V5M A;  3LUQ A;  4IHQ A;  4PHT A;  4L0L A;  5A8B A;  2W0N A;  3QHY A;  3QP8 A;  4MBF A;  4G3V A;  4HJ6 A;  3OPP A;  5AQA A;  1BSG A;  2PD8 A;  5C5K A;  3VP0 A;  1CQA A;  4FOF A;  1FCM A;  4NKP A;  3TOI A;  4OQ0 A;  1GHM A;  4NXG A;  4YWZ A;  5AVF A;  3M6H A;  2VZW A;  1DY6 A;  4YNR A;  3E2K A;  3MKE A;  4HEF A;  3N7W A;  4EES A;  5F82 A;  1MC0 A;  2W27 A;  4F94 A;  2EFU A;  1JWZ A;  2I72 A;  1N9O A;  5G4Z A;  3E0Y A;  4K91 A;  4P6B A;  4HBU A;  1CEG A;  3K3D A;  4LRX C;  1KGG A;  1YQS A;  2KOI A;  3N4I A;  3SH9 A;  5L10 A;  4S2K A;  2BAS A;  2J80 A;  5DF9 A;  3BM6 A;  3UNW A;  1CEF A;  3RH8 B;  2EA9 A;  4R6L A;  3RXW A;  3V50 A;  4U3T A;  3B42 A;  2DMW A;  4DJ2 A;  3IX8 A;  3SOI A;  5IS1 A;  3P7N A;  2OLU A;  4E6X A;  5LBR A;  3A3D A;  5CED A;  1BLC A;  2P9V B;  2GJ3 A;  2QZ6 A;  4JXW A;  3MFX A;  4WL9 A;  1IEM A;  2ZC3 B;  3G4P A;  1LL5 A;  2O9C A;  2Y2H A;  4GZB A;  3PTE A;  2X01 A;  5HFO A;  3A3J A;  4R1G A;  3NEC A;  4BEN A;  1STZ A;  3EEH A;  3G31 A;  1K57 A;  3HLD A;  5GHZ A;  1LL9 A;  4IUH A;  4BL3 A;  4LCL A;  2XH9 A;  3PYP A;  1PWC A;  1Y28 A;  1ES3 A;  3BY9 A;  1IFQ A;  2ZOH A;  3T50 A;  2VEA A;  5IHV A;  3IBR A;  1TS0 A;  2JE5 A;  3GRJ A;  3WS4 A;  4EEU A;  5HAI A;  3LCE A;  4OLD A;  2ZL1 A;  3WRT A;  5DTK A;  1D7E A;  3ITA A;  2JKT I;  4X25 A;  4QU3 A;  3E98 A;  3S7P A;  5FQJ A;  2D01 A;  2INW A;  2VV6 A;  3K2N A;  1PI4 A;  2VX8 A;  3N6I A;  1E3U D;  2WAF A;  3DTM A;  3HRE A;  5HWW A;  1W63 M;  3L7H A;  1TS7 A;  2OLV A;  3QP6 A;  3BLM A;  2ZC5 B;  4Y13 A;  5KIZ A;  3EGX C;  4MEZ A;  4Y0T A;  3FC7 A;  1N9N A;  3ZYT A;  4S2M A;  2Y2K A;  2O99 A;  2G7U A;  3T4Q A;  4MLL A;  3MFD A;  4Q0I A;  2Y8H A;  5DTT A;  1L2S A;  2G2W A;  1H3Q A;  1JVJ A;  4KQD A;  3FG8 A;  2EX2 A;  1AWI A;  2VGL S;  2XFT A;  1GHP A;  4Y15 A;  2OAQ 1;  4L9G A;  3S7O A;  5FQK A;  3MQ0 A;  4DDS A;  4EU0 A;  1YMS A;  1KGE A;  2PBY A;  1LLB A;  3IBJ A;  4E3N A;  4JF4 A;  2XK1 A;  4IED A;  2EX9 A;  1ALQ A;  3FPV A;  5AJG A;  4MDZ A;  4DDY A;  1QME A;  4ETZ A;  4LFU A;  3IF6 C;  5HSQ A;  3MS6 A;  1N9B A;  1F9I A;  1AXB A;  3P09 A;  3SS4 A;  2J9P A;  1FIK A;  4R23 A;  3HCY A;  2RCX A;  5CRF A;  4O01 A;  3SS5 A;  4UAA A;  2Z2L B;  4WMC A;  3IHA A;  3UME A;  4KZ7 A;  2ZC7 A;  4E04 A;  1LSV A;  3B3X A;  2KLI A;  1K6S A;  4UQI S;  3ICY A;  5E2F A;  4MBK A;  3HJK A;  4ZJ2 A;  3BFE A;  2XRN A;  4B4X A;  1GCE A;  2I9V A;  3O87 A;  4DF6 A;  4FCF A;  1ERM A;  1FCO A;  5A90 A;  5FQM A;  1ESI A;  1YLY A;  5CGX A;  2ZL1 B;  3N8S A;  1W7F A;  3GTC A;  3QP2 A;  3KYE A;  5HAR A;  4OP5 A;  5HD3 A;  1PWG A;  3BEC A;  2VKS A;  2WK0 A;  4X6T A;  1K56 A;  2ZQA A;  3IX3 A;  3P01 A;  5TGF A;  1TDL A;  4UA6 A;  1S0W A;  4PM7 A;  2DCF A;  4B93 A;  3F1P A;  1NXY A;  2HF6 A;  2HDU A;  1ACF A;  5GLB A;  1WA9 A;  3NI9 A;  2X71 A;  3GEC A;  1JNU A;  3RFB A;  4GDB A;  1KOU A;  1TVF A;  2O9A A;  3ZQ5 A;  1KE0 A;  1G6O A;  2Z6D A;  1GSV A;  4I3J A;  3LY4 A;  2R9W A;  5BOH A;  3BW6 A;  3AGE A;  3VOL A;  3ULF A;  1DJC A;  5KSC A;  1XXM A;  2A24 B;  4NXF A;  2B95 A;  1XJ6 A;  3BEB A;  5CEB A;  4OQH A;  3QNC A;  5EVI C;  4BWI A;  3CG5 A;  4PM6 A;  5TBM B;  1G28 A;  5HW3 A;  1LT0 A;  5CXW A;  2VV7 A;  3V39 A;  5J3W A;  3PBO A;  3ZG9 B;  1KE3 A;  5F1G A;  4GNU A;  4GHI A;  2ZM2 A;  1P97 A;  5FEF A;  3LEZ A;  1NJ4 A;  1L0F A;  3VE4 A;  3KSI A;  2Y79 A;  4OQI A;  4M4X A;  3HUM A;  4ARZ A;  4KEN B;  5E2G A;  3SS3 A;  3B33 A;  2EFX A;  1TS6 A;  2CMN A;  3IH9 A;  1HD8 A;  4R38 A;  4XT2 A;  3HL9 A;  3VP1 A;  1JWP A;  3R7W B;  1VET A;  2FFF B;  4P6Z M;  2D02 A;  3IXH A;  3U2A A;  3UMD A;  1IYO A;  1BTL A;  2PR6 A;  4YOF A;  2PYR A;  4DRT A;  5I94 A;  4LV0 A;  3IWO A;  4Y3I A;  5AQ9 A;  3JVV A;  1PIO A;  4CLC C;  1OJG A;  1DP8 A;  1T18 A;  5E43 A;  3F1P B;  3UPP A;  5U47 A;  2L4R A;  2QYB A;  2R78 A;  5HDC A;  3NIA A;  5M18 A;  1CK3 A;  4S2J A;  3H82 B;  4GOG A;  1D1J A;  4PM8 A;  2ZMF A;  2FZ0 A;  5F5Y A;  4OPZ A;  2HZ5 A;  2G2U A;  2ZQ9 A;  4B9O A;  3OLO A;  1BUL A;  2W3H A;  2EWV A;  4UA9 A;  4X55 A;  2EX6 A;  1P9W A;  1PWD A;  1HTZ A;  4KQQ A;  4Y0O A;  3UPN A;  1HZO A;  1IYS A;  2WGI A;  1N4O A;  3VP2 A;  4FD8 A;  2P74 A;  5EVL A;  5F6A A;  5TJJ A;  3QNB A;  2X02 A;  2WZX A;  3TE8 A;  1YSQ A;  5HWT A;  4WF0 A;  1XKZ A;  1YLT A;  3W2Z A;  3CWF A;  5EUA A;  2VGK A;  2R9X A;  3E2L A;  4WEL A;  2Q9M A;  3IS2 B;  4GHI B;  3V67 A;  5IU1 A;  2ACG A;  2L1M A;  3P98 A;  1PRQ A;  4ARZ B;  2XGN A;  4JXG A; 
#chains in the Genus database with same CATH homology
 5EM1 A;  1HLU P;  1PFL A;  4X1L A;  5FDS A;  4FTX A;  2E8J A;  1CJF A;  3L9K A;  1SKO B;  5EV0 A;  1YPR A;  1AWI A;  3UB5 P;  3D9Y A;  1VET B;  1ACF A;  3LEQ A;  3U4L P;  3T1R A;  1A0K A;  1J3W A;  1Y4O A;  1CF0 A;  3NEC A;  2PRF A;  5EM0 A;  4ESP A;  5FEG A;  1FIL A;  1D1J A;  4QWO A;  1CQA A;  1VEU A;  2HZ5 A;  3CPT A;  1Z09 A;  2BTF P;  3MS6 A;  3MSH A;  3NUL A;  2B95 A;  2V8C A;  2V8F A;  1FIK A;  4FUW A;  1G5U A;  3T1Q B;  1VEU B;  3LGO A;  2PBD P;  3T1X A;  2ZL1 A;  4X1M A;  4X25 A;  1PNE A;  2JKF A;  5FEF A;  3T1S A;  4D60 A;  3DAV A;  2VK3 A;  2ZL1 B;  1K0K A;  5EVE A;  3CHW P;  3L7H A;  3KYE A;  3T12 B;  3CPT B;  2PAV P;  1SZV A;  1SKO A;  2ACG A;  1F2K A;  1PRQ A;  2JKG A;  1VET A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...