3NULA

Profilin i from arabidopsis thaliana
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
130
structure length
130
Chain Sequence
SWQSYVDDHLMCDVEGNHLTAAAILGQDGSVWAQSAKFPQLKPQEIDGIKKDFEEPGFLAPTGLFLGGEKYMVIQGEQGAVIRGKKGPGGVTIKKTNQALVFGFYDEPMTGGQCNLVVERLGDYLIESEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROFILIN I
publication title The crystal structure of a major allergen from plants.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Actin binding protein
total genus 34
structure length 130
sequence length 130
ec nomenclature
pdb deposition date 1996-11-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.30 Alpha Beta 2-Layer Sandwich Beta-Lactamase Dynein light chain 2a, cytoplasmic 3nulA00
1VETB 3MSHA 1G5UA 3L9KA 2JKFA 2HZ5A 3CPTA 1CQAA 1SKOA 3UB5P 3CPTB 3T1RA 4X1MA 2BTFP 3T1SA 1SZVA 3CHWP 3U4LP 1Z09A 2PRFA 2E8JA 1AWIA 1CJFA 1FIKA 4QWOA 4X25A 5EM0A 3MS6A 3NECA 5FEFA 3LGOA 3KYEA 2JKGA 2VK3A 5EV0A 1CF0A 2B95A 1YPRA 1PRQA 4FTXA 3L7HA 3NULA 5EM1A 3DAVA 1HLUP 1J3WA 2PBDP 2ZL1A 1PNEA 3D9YA 2ZL1B 1A0KA 3T12B 3LEQA 1FILA 5FEGA 4FUWA 2ACGA 5EVEA 1F2KA 4D60A 4ESPA 1VEUA 2V8FA 2PAVP 1VEUB 1PFLA 1D1JA 3T1QB 3T1XA 1ACFA 1SKOB 4X1LA 1K0KA 2V8CA 5FDSA 1VETA 1Y4OA
chains in the Genus database with same CATH superfamily
1C3BA 3HVFA 3RJUA 3F1OA 1ERMA 3MSHA 3F1OB 3L9KA 3GMWA 2Y59A 4Y5FA 4OH0A 3UY6A 4R1GA 3CJMA 2FFYA 3HLEA 4HOIA 2ZQAA 3T1RA 1YLPA 4R38A 3HLWA 1F5MA 1JTDA 2OAQ1 1H8MA 4E6XA 1DP9A 4RYEA 1VB6A 5HARA 2YKHA 4HP9A 1UWPX 5DKKA 4KZ4A 3GDIA 4X25A 1LSVA 4H6JA 1S67L 1XJ3A 4JF6A 4WZ4A 5FQKA 3NCKA 1KE4A 2E8IA 3ZFZA 2Y2NA 5HL6A 3IWQA 1G68A 4NXBA 4GDBA 1L0EA 4DXBA 2GDNA 2JBFA 4K08A 1FOFA 3P7NA 2XROA 3VE4A 3LUQA 2Z6DA 3B42A 4CQHA 4OQGA 4IJGA 3UDXA 3UMEA 1YAXA 5HAQA 3FWLA 2K7SA 4EQ1A 2JKRM 2ZM2A 3LIAA 4EERA 3IHAA 1GSXA 4KZAA 1SKOB 3QP8A 1OTAA 1ZC2A 3LR3A 5FDSA 1VETA 2JN7A 4FH2A 1VETB 4Y0OA 3C4OA 1LSWA 2H5SA 1N9LA 3A3DA 5EE8A 1ES4A 2C6WB 2L4RA 3NDEA 1D7EA 2J8YA 4QPRA 2D02A 4NXGA 2V0WA 2VV6A 3RH8B 4OVDA 3GV9A 3HREA 4JKTA 4KG5A 4R3AA 3PAGA 2A24A 1I5QA 3JVVA 1CK3A 4PHTA 2JE5A 4PM8A 1Z6FA 5HSQA 2QZ6A 4PM9A 4CPKA 4PM7A 4KUKA 2PYRA 3FG8A 5HPFA 3UB7A 1ZTUA 3V3SA 2WADA 1S4SA 3OC2A 3BECA 3ZHHA 3E98A 5HWTA 1E25A 4EETB 2J7VA 1NLZA 3LIEA 2LB5A 4HNBA 2VGLM 3MFXA 3SH8A 2KX6A 4UQIM 3TW8A 1TS8A 1KDWA 2H0TA 3DAVA 5AQ7A 3S7NA 2HDQA 2PBDP 3OOVA 1GA9A 2ZC4B 1ONGA 3LY3A 1JWZA 3ULFA 4R4SA 3UE3A 3G35A 5EPHA 2ZQ9A 1PWGA 2Z2MB 3DTIA 3Q7VA 3LY4A 4GW9A 3WS1A 4R70A 4MN6A 1P0ZA 1EWZA 3LO7A 4XUXA 1L0GA 1BLHA 2M1CA 2W3GA 2XSSA 3K3DA 1BTLA 2HPBA 3C38A 4XT2A 3GRJA 1JNUA 5FI2A 1YLWA 2PBYA 3NOUC 4HI4A 4FD8A 1PZOA 4KZ7A 3BEBA 2A2LA 3WRTA 4O7DA 2RCXA 4P6BA 3Q1FA 4BL3A 5FI7A 3BY9A 2W3DA 2O0YA 1D06A 1ALQA 3BY8A 5FEFA 3T4OA 1Y54A 2UV0E 3TSGA 4BD1A 4C6YA 2B95A 2VGLS 2VZWA 4N1HA 4UQIS 1ES5A 5EVIB 3PBRA 1FR1A 1BT5A 2HGVA 1H0MA 2Y2KA 2FH5A 5FQ9A 5TJJA 3EEAA 4UEYA 4WN5A 1PWDA 4LRXC 3P98A 1S66L 3QP2A 3BFEA 3FC7A 1GSVA 2H0YA 3ZVWA 4P0MA 4E3IA 3VP2A 3T4TA 2ZC3B 4O8GA 3ZQ5A 2EFUA 3HCYA 1F98A 5DKLA 1K4EA 4ZJ2A 4F94A 3MJQA 5FASA 4Y0TA 3PBOA 4Y7PA 1XGIA 4Y13A 3IWIA 3CUEC 2B5RA 3ZNYA 4UA9A 4A5RA 5CGXA 4LV2A 3EEHA 4GJ4A 3NJAA 3VP0A 4OP5A 5FAQA 5CGWA 4ME4A 2DCFA 3OZHA 4DMZA 2VKSA 5DJUA 3TE8A 4QB8A 3OPPA 4RQ9A 5TFQA 2VGKA 4UAAA 2PRFA 3N8SA 3S7PA 3BQAA 4OPRA 1PI5A 1SDNA 1E4DA 1YQSA 1ESIA 4QJGA 3W4PA 1O07A 3UN7A 4DRTA 3WWXA 2CMNA 3FPWA 1LI0A 3CZDA 1FCNA 1I2SA 1MXOA 2ZMFA 4BBVA 3KO6A 5L8MA 2Z2LB 3PYPA 5FQQA 4WMCD 2O99A 2QJ5A 1OJGA 5GHZA 2DRWA 3DTMA 1K56D 1HLUP 3BWLA 3S4XA 2V20A 4IHQA 1S6RA 5DF9A 2M7UA 2WK0A 4LRYC 3NDGA 1UGUA 3S22A 3SS5A 1Q2PA 4DJ3A 1H8ZA 2Q9MA 2VA0A 3WS2A 1ONHA 2OLUA 1CEFA 1YLJA 2KLIA 5DFYA 4PM5A 1XJ6A 1XXMA 4ZBEA 4OOMA 4IUHA 4OP8A 4RX2A 3MXRA 3M6BA 4LGWA 2NUPC 2ZMVA 3MF0A 5AVFA 3VSKA 2JHEA 2EWWA 2X71A 3E2KA 2VV7A 4GLQA 4Q0HA 2JKFA 2J3TC 2YKFA 2V9AA 5J3WA 2I9VA 3BRMA 2Q9NA 3IX8A 1IKGA 1G28A 1W8YA 4IVIA 1H8YA 3NHQA 4EQIA 4ARZB 1YLZA 3AGFA 4NEED 4RX3A 3UO9A 2WGWB 3VOLA 1AWIA 1PZPA 1N9NA 5KMWA 1OTDA 2VGJA 4BD0A 1TEMA 1XFNA 2GX5A 2M7VA 4KUOA 3E4QA 4ETXA 3MKFA 3B3XA 2DNSA 2ZQCA 2VK3A 1LSXA 3BLMA 2L1MA 3OPHA 3EOIA 4L9EA 1K54C 4LV3A 3BLSA 4L9FA 3Q7ZA 4MMNA 1BULA 4LPZA 2D01A 1OT6A 4KZ9A 2FFFB 3QHYA 4G3WA 4CLCE 1EROA 3T12B 4E04A 4ZTKA 5FAOA 4JF4A 1FILA 2Y2PA 3SS4A 4FUWA 3RFBA 2XFSA 4GZBA 5EVID 4I39A 4PM6A 4IUKA 1AXBA 4N92A 3CG5A 3NBLA 5E2EA 1IELA 1YM1A 2ZOHA 5AQAA 1TF1A 3W4QA 4QY6A 3C4PA 1KGGA 1PW1A 3EWKA 1K0KA 4R0QA 2V8CA 1WE4A 5IHVA 3SS3A 5K5BA 2B02A 1K55C 3T4QA 1WYCA 3IF6C 4WZ5A 3IS2A 3ZCZA 3T50A 3IS2B 2IWCA 5CHJA 2HZ5A 4I3AA 3GR2A 3BFFA 1OTBA 1H3QA 3FZCA 4KQDA 4X55A 4E3LA 2XD1A 2BTFP 4BENA 1IKIA 1NXYA 2WYXA 3A3IA 2HJEA 5HD3A 2WZZA 3GECA 3HLCA 2OLVA 1HZOA 3R7WB 1XP4A 1NZOA 2FZ0A 3QP6A 3FKVA 4G3VA 5F68A 2WKPA 4OQIA 1T1AA 4S2NA 4KG6A 1RGZA 5CX7A 3MZEA 4GOGA 5GLAA 5L2FA 2P08A 4ID4A 5L07A 4E6WA 5F83A 3QNBA 3SW1A 1XA1A 4ZJ3A 3H7WA 1HVBA 3H7WB 4O0PA 4YNRA 4P87A 2JKTI 2VV8A 2HV1A 3MXQA 4D2OA 2W1RA 3LFVA 4QY5A 3N7WA 2XA7M 5AQ9A 4GS9B 1YLTA 4XXRA 1PFLA 3HLDA 3ZNTA 3T1QB 3IH9A 3H82B 4X1LA 5BOHA 5JYPA 3O88A 2XD5A 4PAUA 3HUMA 1KVMA 4IEDA 3G31A 4X69A 3IT9A 3TOIA 2XDMA 2V0UA 3G2YA 3UDFA 1SKOA 5EOOA 1W5DA 1QMEA 3ZG9B 4Q0IA 2ZC6B 2ZM0A 4AFIA 1DP8A 1F9IA 4MLLA 5TGFA 1DJBA 2XF3A 3EQUA 2IWDA 3T4SA 4IVKA 5HDDA 1S1YA 2Y2OA 5GLCA 1K38A 2X01A 1LL5A 4KZBA 4OONA 4M4XA 5GHYA 4L9GA 4FTXA 4WUJA 4HP4A 4WMCA 4HESA 5G18A 1MWUA 1K56A 4DE2A 3QP1A 2OSUA 3SH7A 4KQQA 2C5WB 4EEUA 1OPXA 4DKIA 5A90A 2HDUA 5AVEA 5FSRA 1YT4A 3N4IA 5TBMA 1STZA 1NZUA 2PD7A 2XA7S 5TBMB 5FQMA 3BQ8A 5J7EA 2ZOIA 5FATA 1VEUA 3S7OA 1VEUB 1D1JA 4OQHA 1IEMA 4I5SA 3E4OA 1LLBA 3PTEA 4JGQA 2WAFA 4RVAA 3OLOA 4EEPA 1V9ZA 5CEBA 2BASA 3K3CA 5M1AA 3KSFA 4GD6A 4KG2A 5CEDA 4Z1WA 5MC7A 5A92A 1G5UA 5L09A 1DJCA 4R23A 2Y91A 3DTEA 3IBRA 5CERA 2W0NA 4X1MA 3MKEA 5GLDA 1JWVA 4EBLA 1NRJA 4DDSA 2XQZA 1M6KA 4KZ8A 1BUEA 4BMWA 1CJFA 4UA7A 3DWKA 2AVXA 2Y55A 3NECA 1NYYA 2WKQA 3JYIA 2A3UA 3F1NA 1LL9A 3F1NB 5I94A 2P9VB 2ZM8A 5G4YA 3O5YA 3VSLA 3NOPC 4EWFA 5D3OA 1NYMA 5EM1A 1GHIA 3E4PA 3HL9A 5KSCA 5DJTA 1W63Q 1GHMA 3MQOA 4BJPA 3LYXA 1NWZA 1A0KA 4JBFA 1W7FA 4LCLA 3LEQA 5KZHA 4I3JA 1SCWA 4CLCD 3JVUA 3V67A 2INWA 2ZC7A 5EVIA 3MQ0A 2J3WA 1FCMA 3ZVTA 2J9OA 2ZC5B 2K2NA 4NKPA 3B47A 3PBNA 3RTYA 3A3EA 5AJGA 1E3UD 4BL2A 2Y79A 3V50A 4F3LB 2H28A 5HFOA 3WS5A 4HJ6A 1Y4OA 1OMEA 4KZ5A 2RL3A 3TJZC 1L3LA 4GDNA 1W8QA 1WA9A 1CEGA 3IXHA 1ODVA 1O7EA 2XLNA 3C5AA 1CQAA 3OCNA 5F5YA 2ZMAA 3A3FA 5G4ZA 2JC7A 5EFWA 1XA7A 1ZKJA 5A93A 5F6AA 3LI8A 4U3TA 2MJ6A 3BFCA 1P9RA 5F82A 2VJWA 4L0LA 4XUZA 2EXBA 3P01A 3Q82A 1RGYA 3MBZA 2OWHA 3MQQA 2Z6CA 3LIFA 2L0WA 2P74A 3C8CA 1PI4A 4X6TA 3UE1A 1IYSA 4E3NA 4HEFA 2VEAA 2KOIA 1MPLA 3NY4A 1SHVA 3ZGAB 4N9LA 2X02A 1K57A 4WM9A 2NUTC 4HBUA 3PBSA 1XJ2A 4OPYA 4GKUA 1F2KA 1MKMA 1RCJA 2PAVP 1EW0A 3BFGA 2QHKA 4PKYA 3VP4A 1ES3A 5I5LA 2O9AA 4DN0A 1BLSA 1MBLA 3EGDC 4JPMA 3U2AA 4YFMA 1XJ4A 4DE0A 3O3VA 4OKPA 1BSGA 4JXVA 5HW3A 4PMAA 1I2WA 2Y2HA 5FDHA 4C75A 1S0WA 3CPTA 4DXCA 2HP9A 3CPTB 3OPLA 3UPNA 4EV4A 3WS4A 2W3HA 1N9BA 1KDSA 2G2UA 3IF5A 1IYQA 3V3RA 1N9OA 4HJ4A 5HD5A 1KE3A 3QNCA 3G30A 3E2LA 4LLOB 3T4LA 2LB9A 3S1YA 4U0TA 4Y3IA 4HBTA 4GD8A 1M40A 3OBFA 1TDLA 1NRFA 2ZD8A 4ARZA 5HPIA 1NLYA 1BLCA 3DTKA 2WGWA 3IXDA 3DBAA 3EGXC 3V39A 5F1FA 3VE3A 4P6ZM 3HBRA 2XK1A 2ZL1A 1MKIA 5AQBA 2ZL1B 4MBKA 4Q8IA 1J9MA 4B93A 1PWCA 2WAEA 3IXGA 3HLBA 3G32A 5CGSA 1S4RA 4H8RA 4DF6A 4RA7A 5HL1A 4Y0UA 4LCMA 2PYPA 1SKFA 2WKHA 4DE3A 2Y4AA 1S1ZA 1ACFA 3LR5A 1T1BA 2ZBBA 4S2PA 1IFQA 3K2NA 4E3MA 4BQMA 4HY8A 2PU4A 4LV1A 5JYOA 1W63M 3CITA 5E2HA 5A8BA 3GSGA 4WZ5C 5FI6A 4R4RA 2DMWA 3WRZA 2EX8A 3BJNA 2ZJ9A 2V1BA 4JLFA 2E8JA 5CECA 2QYBA 2VLGA 2PDRA 4JGPA 4OLDA 2KDKA 3DWZA 3LIBA 3ZG5A 3ZG0A 1TVFA 2EFXA 5EM0A 3N8RA 4R3JA 3W2ZA 2ZQ7A 4YWZA 4JXSA 1FSWA 3IHBA 1RP5A 2Y8HA 3W8KA 1FR6A 2JKGA 2EWVA 2OOLA 3UNWA 3L7HA 1U60A 3VMAA 5M18A 4P6ZS 3R7WA 3VOYA 1TS7A 1IOUA 3F1PB 3IWOA 3PBQA 3MR0A 4CJNA 3IF6B 1OTIA 5GL9A 1YMSA 1FCOA 1XGJA 4CLCA 3E0YA 4KZ3A 1MWRA 4CLCB 4BWIA 2R9XA 4K0XA 1PIOA 2XGNA 4HH2A 3KX0X 5FEGA 3SZTA 5EVEA 3KSGA 1KOUA 1KGEA 3FYZA 4MBHA 1KGFA 2JCHA 2QJ7A 5HX9A 4E3JA 2BLSA 1E3UA 2GNXA 5CHMA 3IXBA 5DTSA 1ESUA 2HJ9C 3PR6A 3CMZA 3OCLA 5EECA 3M2KA 3PHYA 4WLAA 3AGDA 2CC1A 1MY8A 3N6IA 3UB8A 4GS9A 3P09A 2EXAA 1T19A 5E43A 3NIAA 5CHUA 5C5KA 1MC0A 2G2WA 2IA2A 3H82A 2Y2LA 2XRNA 3ITBA 4H6JB 2BG1A 3PAEA 1ZG6A 3HLGA 3BM6A 4GB7A 5FL3A 3LCEA 4EBPA 3U4LP 4EU0A 1DY6A 3D4FA 3GTCA 4DE1A 4R3BA 5J8XA 3EQVA 4OQ0A 1TS0A 3GVBA 3HUOA 3JPUA 4MDZA 3BYDA 3MS6A 4IBXA 4PKYG 3G4PA 2K31A 2WKRA 4EUZA 5EV0A 2PD8A 3LR4A 4EW7A 1YMXA 4S2LA 4NK3A 1MWTA 1ZG4A 5FQIA 1PW8A 1SDEA 4HIAA 5L10A 5EOEA 4S2KA 4KQOA 4MNRA 5EVLA 4EESA 2OAP1 1QMFA 3T4KA 4YINA 5IT5A 2VX8A 2QWSA 4B88A 1MZUA 4K0WA 4LV0A 5GLBA 3UPPA 1T18A 4WYYA 1KVLA 2ACGA 5U47A 2A49A 1HTZA 1EI5A 5F69A 4OPQA 1L2SA 1WYBA 2WGIA 4UA6A 3CAXA 5EUAA 4KENB 4BLMA 2PU2A 1KE0A 5J4EA 2R9WA 1NJ4A 2WUQA 2PR5A 2A24B 2J3TD 4II7A 3CI6A 4MBFA 1NY0A 4LFUA 3CLOA 4QU3A 5E2GA 1CI9A 5HDCA 1YSQA 5KIZA 5DF7A 1DJAA 4LENA 3UB5P 3A0VA 2O9BA 4GHIA 3HJIA 3A0RA 3FKWA 4JGOA 4GHIB 3T1SA 2PR6A 3IQAA 1Y28A 1FSYA 3CHWP 3ZDJA 2PHYA 3LEZA 2Y2QA 3B33A 2HF6A 1LI9A 3BW6A 3MZDA 4JXWA 1LT0A 5GHXA 3Q81A 3LGOA 2V2FF 3RXXA 1P9WA 1YPRA 3QP4A 3GQZA 4FCFA 1P97A 3I7JA 4GN2A 3ITAA 1ES2A 4B4ZA 4QD4A 3HJKA 5TR7A 1XKZA 3IH8A 3NC8A 1J3WA 3Q7VB 1TD5A 5M19A 2QKPA 3UE6A 1K6RA 1VM1A 4P85A 2P9VA 1GSWA 5LBRA 5FA7A 1GA0A 4S2IA 1TS6A 3UE0A 2V8FA 4XT2B 3NOTC 3UB6A 4ZAMA 4WELA 2WKIA 5EVIC 3BFDA 4HQAA 1IYOA 4FOFA 3UPOA 2ZLYA 3IBJA 3UMDA 3D72A 5DTTA 4JGRA 2R78A 1YSPA 3ZG7B 1ZHHB 2W1TA 2G7UA 1GHPA 3ICYA 1G6AA 2I72A 2W1TB 4F3LA 1BLPA 2Y2IA 2Y2JA 3M6HA 4B4XA 4N9KA 4Q0JA 5E2FA 4OPZA 2EX2A 4DJ2A 4HH3A 4I3IA 3IX4A 4N1XA 1JTGA 4WBGA 4UHUA 3KYEA 1VHMA 5KSHA 1CI8A 3NI9A 1PRQA 2V1ZA 2Y2MA 3TRCA 3FPVA 3LR0A 3ZYTA 5HAIA 3A3JA 4EBNA 4LRZE 4ETZA 1TDGA 2GZAA 4KQRA 1MWSA 5DVAA 3D9YA 3MZFA 5FQJA 1K4FA 2H10A 3IX3A 4K91A 2JKRI 4M3KA 4U0XA 4E3OA 4ESPA 4X68A 3CUEA 2XFTA 1K57C 5HDSA 4EUVA 3VFFA 1Q2QA 5FAPA 1OT9A 2JKTM 4GCZA 4X56A 3VOZA 4I38A 2HP6A 2XR0A 4NG2A 5DTKA 3R4KA 2IWBA 5HZHA 1XX2A 4BBTA 2WGVA 3MXSA 1LHYA 2XH9A 1K25A 1IYPA 1XFQA 5A91A 3VP1A 1JWPA 1SZVA 2UWXA 3OPRA 1Z09A 2Y2GA 4ZRRA 3G34A 4FSFA 3H9WA 4QWOA 4ZJ1A 1L0FA 3KSHA 1OTEA 5CTNA 2XEPA 3UB9A 3C2WA 3DW0A 2B18A 4Y17A 1G6OA 2J80A 4Z9QA 3N8LA 1CF0A 4JF5A 1X0OA 3NULA 4GNUA 4PPRA 3HLFA 3SOIA 3MMHA 3C7VA 3G6OA 4IBRA 4S2OA 2HDRA 2W27A 3V5MA 2OWJA 4WF0A 3VP3A 2ZQDA 3LICA 4HJ3A 3AGEA 3M2JA 4MEZA 4BBUA 3LI9A 1DP6A 4DDYA 3TG9A 4S2MA 4MCWA 4B9OA 1YLYA 5IS1A 2QPNA 3O86A 4C3QA 3C7UA 4G3KA 3ZG8B 2OV5A 4NXFA 3QP5A 1HD8A 3CWFA 4NETA 4E3KA 5F1GA 3T1XA 3FV7A 2P7JA 3D3OA 1DRMA 4R6LA 1VQQA 1BZAA 4WEJA 2W3EA 2W3FA 2J9PA 4Y15A 1W79A 1FQGA 2EX9A 5CXWA 2WKEA 3ISGA 3W4OA 3KYQA 3G2ZA 4WEKA 3LIDA 3PBTA 2PT7A 3MFDA 4JXGA 5HAPA 5IU1A 3HUNA 2GJ3A 2ZQ8A 2HDSA 1L0DA 4S2JA 4MN5A 4WL9A 4O01A 2V1AA 2EA9A 1FIKA 1K54A 4NXEA 5DFXA 3KYZA 3RXWA 1GCEA 5DF8A 4ZDXA 1XPBA 2EX6A 4EXOA 4MN7A 3T4JA 4OOLA 1JVJA 3S7QA 1ERQA 3SH9A 1K6SA 3VFHA 5HWWA 4YOFA 4Y2FA 1PNEA 2HP5A 1N4OA 3C30A 3Q07A 3VV4A 2WZXA 3UDIA 1OJ5A 4HHDA 1LL8A 4OLGA 2QMIA 1T1CA 1BYWA 5CRFA 3KSIA 4OOYA 4D60A 1PYYA 3WS0A 3F1PA 1K55A 4CLCC 1H5XA 4S2NC 4X53A 2Q0OA 3A0SA 3IF6A 4KZ6A 1UWNX 1YKDA 3PXPA 2P04A 3O87A 5HWVA 2O9CA 4FH4A 1V9YA 5CTMA 4QHCA
chains in the Genus database with same CATH topology
1VETB 3MSHA 1G5UA 3L9KA 2JKFA 2HZ5A 3CPTA 1CQAA 1SKOA 3UB5P 3CPTB 3T1RA 4X1MA 2BTFP 3T1SA 1SZVA 3CHWP 3U4LP 1Z09A 2PRFA 2E8JA 1AWIA 1CJFA 1FIKA 4QWOA 4X25A 5EM0A 3MS6A 3NECA 5FEFA 3LGOA 3KYEA 2JKGA 2VK3A 5EV0A 1CF0A 2B95A 1YPRA 1PRQA 4FTXA 3L7HA 3NULA 5EM1A 3DAVA 1HLUP 1J3WA 2PBDP 2ZL1A 1PNEA 3D9YA 2ZL1B 1A0KA 3T12B 3LEQA 1FILA 5FEGA 4FUWA 2ACGA 5EVEA 1F2KA 4D60A 4ESPA 1VEUA 2V8FA 2PAVP 1VEUB 1PFLA 1D1JA 3T1QB 3T1XA 1ACFA 1SKOB 4X1LA 1K0KA 2V8CA 5FDSA 1VETA 1Y4OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VET B;  3MSH A;  1G5U A;  3L9K A;  2JKF A;  2HZ5 A;  3CPT A;  1CQA A;  1SKO A;  3UB5 P;  3CPT B;  3T1R A;  4X1M A;  2BTF P;  3T1S A;  1SZV A;  3CHW P;  3U4L P;  1Z09 A;  2PRF A;  2E8J A;  1AWI A;  1CJF A;  1FIK A;  4QWO A;  4X25 A;  5EM0 A;  3MS6 A;  3NEC A;  5FEF A;  3LGO A;  3KYE A;  2JKG A;  2VK3 A;  5EV0 A;  1CF0 A;  2B95 A;  1YPR A;  1PRQ A;  4FTX A;  3L7H A;  3NUL A;  5EM1 A;  3DAV A;  1HLU P;  1J3W A;  2PBD P;  2ZL1 A;  1PNE A;  3D9Y A;  2ZL1 B;  1A0K A;  3T12 B;  3LEQ A;  1FIL A;  5FEG A;  4FUW A;  2ACG A;  5EVE A;  1F2K A;  4D60 A;  4ESP A;  1VEU A;  2V8F A;  2PAV P;  1VEU B;  1PFL A;  1D1J A;  3T1Q B;  3T1X A;  1ACF A;  1SKO B;  4X1L A;  1K0K A;  2V8C A;  5FDS A;  1VET A;  1Y4O A; 
#chains in the Genus database with same CATH topology
 1C3B A;  3HVF A;  3RJU A;  3F1O A;  1ERM A;  3MSH A;  3F1O B;  3L9K A;  3GMW A;  2Y59 A;  4Y5F A;  4OH0 A;  3UY6 A;  4R1G A;  3CJM A;  2FFY A;  3HLE A;  4HOI A;  2ZQA A;  3T1R A;  1YLP A;  4R38 A;  3HLW A;  1F5M A;  1JTD A;  2OAQ 1;  1H8M A;  4E6X A;  1DP9 A;  4RYE A;  1VB6 A;  5HAR A;  2YKH A;  4HP9 A;  1UWP X;  5DKK A;  4KZ4 A;  3GDI A;  4X25 A;  1LSV A;  4H6J A;  1S67 L;  1XJ3 A;  4JF6 A;  4WZ4 A;  5FQK A;  3NCK A;  1KE4 A;  2E8I A;  3ZFZ A;  2Y2N A;  5HL6 A;  3IWQ A;  1G68 A;  4NXB A;  4GDB A;  1L0E A;  4DXB A;  2GDN A;  2JBF A;  4K08 A;  1FOF A;  3P7N A;  2XRO A;  3VE4 A;  3LUQ A;  2Z6D A;  3B42 A;  4CQH A;  4OQG A;  4IJG A;  3UDX A;  3UME A;  1YAX A;  5HAQ A;  3FWL A;  2K7S A;  4EQ1 A;  2JKR M;  2ZM2 A;  3LIA A;  4EER A;  3IHA A;  1GSX A;  4KZA A;  1SKO B;  3QP8 A;  1OTA A;  1ZC2 A;  3LR3 A;  5FDS A;  1VET A;  2JN7 A;  4FH2 A;  1VET B;  4Y0O A;  3C4O A;  1LSW A;  2H5S A;  1N9L A;  3A3D A;  5EE8 A;  1ES4 A;  2C6W B;  2L4R A;  3NDE A;  1D7E A;  2J8Y A;  4QPR A;  2D02 A;  4NXG A;  2V0W A;  2VV6 A;  3RH8 B;  4OVD A;  3GV9 A;  3HRE A;  4JKT A;  4KG5 A;  4R3A A;  3PAG A;  2A24 A;  1I5Q A;  3JVV A;  1CK3 A;  4PHT A;  2JE5 A;  4PM8 A;  1Z6F A;  5HSQ A;  2QZ6 A;  4PM9 A;  4CPK A;  4PM7 A;  4KUK A;  2PYR A;  3FG8 A;  5HPF A;  3UB7 A;  1ZTU A;  3V3S A;  2WAD A;  1S4S A;  3OC2 A;  3BEC A;  3ZHH A;  3E98 A;  5HWT A;  1E25 A;  4EET B;  2J7V A;  1NLZ A;  3LIE A;  2LB5 A;  4HNB A;  2VGL M;  3MFX A;  3SH8 A;  2KX6 A;  4UQI M;  3TW8 A;  1TS8 A;  1KDW A;  2H0T A;  3DAV A;  5AQ7 A;  3S7N A;  2HDQ A;  2PBD P;  3OOV A;  1GA9 A;  2ZC4 B;  1ONG A;  3LY3 A;  1JWZ A;  3ULF A;  4R4S A;  3UE3 A;  3G35 A;  5EPH A;  2ZQ9 A;  1PWG A;  2Z2M B;  3DTI A;  3Q7V A;  3LY4 A;  4GW9 A;  3WS1 A;  4R70 A;  4MN6 A;  1P0Z A;  1EWZ A;  3LO7 A;  4XUX A;  1L0G A;  1BLH A;  2M1C A;  2W3G A;  2XSS A;  3K3D A;  1BTL A;  2HPB A;  3C38 A;  4XT2 A;  3GRJ A;  1JNU A;  5FI2 A;  1YLW A;  2PBY A;  3NOU C;  4HI4 A;  4FD8 A;  1PZO A;  4KZ7 A;  3BEB A;  2A2L A;  3WRT A;  4O7D A;  2RCX A;  4P6B A;  3Q1F A;  4BL3 A;  5FI7 A;  3BY9 A;  2W3D A;  2O0Y A;  1D06 A;  1ALQ A;  3BY8 A;  5FEF A;  3T4O A;  1Y54 A;  2UV0 E;  3TSG A;  4BD1 A;  4C6Y A;  2B95 A;  2VGL S;  2VZW A;  4N1H A;  4UQI S;  1ES5 A;  5EVI B;  3PBR A;  1FR1 A;  1BT5 A;  2HGV A;  1H0M A;  2Y2K A;  2FH5 A;  5FQ9 A;  5TJJ A;  3EEA A;  4UEY A;  4WN5 A;  1PWD A;  4LRX C;  3P98 A;  1S66 L;  3QP2 A;  3BFE A;  3FC7 A;  1GSV A;  2H0Y A;  3ZVW A;  4P0M A;  4E3I A;  3VP2 A;  3T4T A;  2ZC3 B;  4O8G A;  3ZQ5 A;  2EFU A;  3HCY A;  1F98 A;  5DKL A;  1K4E A;  4ZJ2 A;  4F94 A;  3MJQ A;  5FAS A;  4Y0T A;  3PBO A;  4Y7P A;  1XGI A;  4Y13 A;  3IWI A;  3CUE C;  2B5R A;  3ZNY A;  4UA9 A;  4A5R A;  5CGX A;  4LV2 A;  3EEH A;  4GJ4 A;  3NJA A;  3VP0 A;  4OP5 A;  5FAQ A;  5CGW A;  4ME4 A;  2DCF A;  3OZH A;  4DMZ A;  2VKS A;  5DJU A;  3TE8 A;  4QB8 A;  3OPP A;  4RQ9 A;  5TFQ A;  2VGK A;  4UAA A;  2PRF A;  3N8S A;  3S7P A;  3BQA A;  4OPR A;  1PI5 A;  1SDN A;  1E4D A;  1YQS A;  1ESI A;  4QJG A;  3W4P A;  1O07 A;  3UN7 A;  4DRT A;  3WWX A;  2CMN A;  3FPW A;  1LI0 A;  3CZD A;  1FCN A;  1I2S A;  1MXO A;  2ZMF A;  4BBV A;  3KO6 A;  5L8M A;  2Z2L B;  3PYP A;  5FQQ A;  4WMC D;  2O99 A;  2QJ5 A;  1OJG A;  5GHZ A;  2DRW A;  3DTM A;  1K56 D;  1HLU P;  3BWL A;  3S4X A;  2V20 A;  4IHQ A;  1S6R A;  5DF9 A;  2M7U A;  2WK0 A;  4LRY C;  3NDG A;  1UGU A;  3S22 A;  3SS5 A;  1Q2P A;  4DJ3 A;  1H8Z A;  2Q9M A;  2VA0 A;  3WS2 A;  1ONH A;  2OLU A;  1CEF A;  1YLJ A;  2KLI A;  5DFY A;  4PM5 A;  1XJ6 A;  1XXM A;  4ZBE A;  4OOM A;  4IUH A;  4OP8 A;  4RX2 A;  3MXR A;  3M6B A;  4LGW A;  2NUP C;  2ZMV A;  3MF0 A;  5AVF A;  3VSK A;  2JHE A;  2EWW A;  2X71 A;  3E2K A;  2VV7 A;  4GLQ A;  4Q0H A;  2JKF A;  2J3T C;  2YKF A;  2V9A A;  5J3W A;  2I9V A;  3BRM A;  2Q9N A;  3IX8 A;  1IKG A;  1G28 A;  1W8Y A;  4IVI A;  1H8Y A;  3NHQ A;  4EQI A;  4ARZ B;  1YLZ A;  3AGF A;  4NEE D;  4RX3 A;  3UO9 A;  2WGW B;  3VOL A;  1AWI A;  1PZP A;  1N9N A;  5KMW A;  1OTD A;  2VGJ A;  4BD0 A;  1TEM A;  1XFN A;  2GX5 A;  2M7V A;  4KUO A;  3E4Q A;  4ETX A;  3MKF A;  3B3X A;  2DNS A;  2ZQC A;  2VK3 A;  1LSX A;  3BLM A;  2L1M A;  3OPH A;  3EOI A;  4L9E A;  1K54 C;  4LV3 A;  3BLS A;  4L9F A;  3Q7Z A;  4MMN A;  1BUL A;  4LPZ A;  2D01 A;  1OT6 A;  4KZ9 A;  2FFF B;  3QHY A;  4G3W A;  4CLC E;  1ERO A;  3T12 B;  4E04 A;  4ZTK A;  5FAO A;  4JF4 A;  1FIL A;  2Y2P A;  3SS4 A;  4FUW A;  3RFB A;  2XFS A;  4GZB A;  5EVI D;  4I39 A;  4PM6 A;  4IUK A;  1AXB A;  4N92 A;  3CG5 A;  3NBL A;  5E2E A;  1IEL A;  1YM1 A;  2ZOH A;  5AQA A;  1TF1 A;  3W4Q A;  4QY6 A;  3C4P A;  1KGG A;  1PW1 A;  3EWK A;  1K0K A;  4R0Q A;  2V8C A;  1WE4 A;  5IHV A;  3SS3 A;  5K5B A;  2B02 A;  1K55 C;  3T4Q A;  1WYC A;  3IF6 C;  4WZ5 A;  3IS2 A;  3ZCZ A;  3T50 A;  3IS2 B;  2IWC A;  5CHJ A;  2HZ5 A;  4I3A A;  3GR2 A;  3BFF A;  1OTB A;  1H3Q A;  3FZC A;  4KQD A;  4X55 A;  4E3L A;  2XD1 A;  2BTF P;  4BEN A;  1IKI A;  1NXY A;  2WYX A;  3A3I A;  2HJE A;  5HD3 A;  2WZZ A;  3GEC A;  3HLC A;  2OLV A;  1HZO A;  3R7W B;  1XP4 A;  1NZO A;  2FZ0 A;  3QP6 A;  3FKV A;  4G3V A;  5F68 A;  2WKP A;  4OQI A;  1T1A A;  4S2N A;  4KG6 A;  1RGZ A;  5CX7 A;  3MZE A;  4GOG A;  5GLA A;  5L2F A;  2P08 A;  4ID4 A;  5L07 A;  4E6W A;  5F83 A;  3QNB A;  3SW1 A;  1XA1 A;  4ZJ3 A;  3H7W A;  1HVB A;  3H7W B;  4O0P A;  4YNR A;  4P87 A;  2JKT I;  2VV8 A;  2HV1 A;  3MXQ A;  4D2O A;  2W1R A;  3LFV A;  4QY5 A;  3N7W A;  2XA7 M;  5AQ9 A;  4GS9 B;  1YLT A;  4XXR A;  1PFL A;  3HLD A;  3ZNT A;  3T1Q B;  3IH9 A;  3H82 B;  4X1L A;  5BOH A;  5JYP A;  3O88 A;  2XD5 A;  4PAU A;  3HUM A;  1KVM A;  4IED A;  3G31 A;  4X69 A;  3IT9 A;  3TOI A;  2XDM A;  2V0U A;  3G2Y A;  3UDF A;  1SKO A;  5EOO A;  1W5D A;  1QME A;  3ZG9 B;  4Q0I A;  2ZC6 B;  2ZM0 A;  4AFI A;  1DP8 A;  1F9I A;  4MLL A;  5TGF A;  1DJB A;  2XF3 A;  3EQU A;  2IWD A;  3T4S A;  4IVK A;  5HDD A;  1S1Y A;  2Y2O A;  5GLC A;  1K38 A;  2X01 A;  1LL5 A;  4KZB A;  4OON A;  4M4X A;  5GHY A;  4L9G A;  4FTX A;  4WUJ A;  4HP4 A;  4WMC A;  4HES A;  5G18 A;  1MWU A;  1K56 A;  4DE2 A;  3QP1 A;  2OSU A;  3SH7 A;  4KQQ A;  2C5W B;  4EEU A;  1OPX A;  4DKI A;  5A90 A;  2HDU A;  5AVE A;  5FSR A;  1YT4 A;  3N4I A;  5TBM A;  1STZ A;  1NZU A;  2PD7 A;  2XA7 S;  5TBM B;  5FQM A;  3BQ8 A;  5J7E A;  2ZOI A;  5FAT A;  1VEU A;  3S7O A;  1VEU B;  1D1J A;  4OQH A;  1IEM A;  4I5S A;  3E4O A;  1LLB A;  3PTE A;  4JGQ A;  2WAF A;  4RVA A;  3OLO A;  4EEP A;  1V9Z A;  5CEB A;  2BAS A;  3K3C A;  5M1A A;  3KSF A;  4GD6 A;  4KG2 A;  5CED A;  4Z1W A;  5MC7 A;  5A92 A;  1G5U A;  5L09 A;  1DJC A;  4R23 A;  2Y91 A;  3DTE A;  3IBR A;  5CER A;  2W0N A;  4X1M A;  3MKE A;  5GLD A;  1JWV A;  4EBL A;  1NRJ A;  4DDS A;  2XQZ A;  1M6K A;  4KZ8 A;  1BUE A;  4BMW A;  1CJF A;  4UA7 A;  3DWK A;  2AVX A;  2Y55 A;  3NEC A;  1NYY A;  2WKQ A;  3JYI A;  2A3U A;  3F1N A;  1LL9 A;  3F1N B;  5I94 A;  2P9V B;  2ZM8 A;  5G4Y A;  3O5Y A;  3VSL A;  3NOP C;  4EWF A;  5D3O A;  1NYM A;  5EM1 A;  1GHI A;  3E4P A;  3HL9 A;  5KSC A;  5DJT A;  1W63 Q;  1GHM A;  3MQO A;  4BJP A;  3LYX A;  1NWZ A;  1A0K A;  4JBF A;  1W7F A;  4LCL A;  3LEQ A;  5KZH A;  4I3J A;  1SCW A;  4CLC D;  3JVU A;  3V67 A;  2INW A;  2ZC7 A;  5EVI A;  3MQ0 A;  2J3W A;  1FCM A;  3ZVT A;  2J9O A;  2ZC5 B;  2K2N A;  4NKP A;  3B47 A;  3PBN A;  3RTY A;  3A3E A;  5AJG A;  1E3U D;  4BL2 A;  2Y79 A;  3V50 A;  4F3L B;  2H28 A;  5HFO A;  3WS5 A;  4HJ6 A;  1Y4O A;  1OME A;  4KZ5 A;  2RL3 A;  3TJZ C;  1L3L A;  4GDN A;  1W8Q A;  1WA9 A;  1CEG A;  3IXH A;  1ODV A;  1O7E A;  2XLN A;  3C5A A;  1CQA A;  3OCN A;  5F5Y A;  2ZMA A;  3A3F A;  5G4Z A;  2JC7 A;  5EFW A;  1XA7 A;  1ZKJ A;  5A93 A;  5F6A A;  3LI8 A;  4U3T A;  2MJ6 A;  3BFC A;  1P9R A;  5F82 A;  2VJW A;  4L0L A;  4XUZ A;  2EXB A;  3P01 A;  3Q82 A;  1RGY A;  3MBZ A;  2OWH A;  3MQQ A;  2Z6C A;  3LIF A;  2L0W A;  2P74 A;  3C8C A;  1PI4 A;  4X6T A;  3UE1 A;  1IYS A;  4E3N A;  4HEF A;  2VEA A;  2KOI A;  1MPL A;  3NY4 A;  1SHV A;  3ZGA B;  4N9L A;  2X02 A;  1K57 A;  4WM9 A;  2NUT C;  4HBU A;  3PBS A;  1XJ2 A;  4OPY A;  4GKU A;  1F2K A;  1MKM A;  1RCJ A;  2PAV P;  1EW0 A;  3BFG A;  2QHK A;  4PKY A;  3VP4 A;  1ES3 A;  5I5L A;  2O9A A;  4DN0 A;  1BLS A;  1MBL A;  3EGD C;  4JPM A;  3U2A A;  4YFM A;  1XJ4 A;  4DE0 A;  3O3V A;  4OKP A;  1BSG A;  4JXV A;  5HW3 A;  4PMA A;  1I2W A;  2Y2H A;  5FDH A;  4C75 A;  1S0W A;  3CPT A;  4DXC A;  2HP9 A;  3CPT B;  3OPL A;  3UPN A;  4EV4 A;  3WS4 A;  2W3H A;  1N9B A;  1KDS A;  2G2U A;  3IF5 A;  1IYQ A;  3V3R A;  1N9O A;  4HJ4 A;  5HD5 A;  1KE3 A;  3QNC A;  3G30 A;  3E2L A;  4LLO B;  3T4L A;  2LB9 A;  3S1Y A;  4U0T A;  4Y3I A;  4HBT A;  4GD8 A;  1M40 A;  3OBF A;  1TDL A;  1NRF A;  2ZD8 A;  4ARZ A;  5HPI A;  1NLY A;  1BLC A;  3DTK A;  2WGW A;  3IXD A;  3DBA A;  3EGX C;  3V39 A;  5F1F A;  3VE3 A;  4P6Z M;  3HBR A;  2XK1 A;  2ZL1 A;  1MKI A;  5AQB A;  2ZL1 B;  4MBK A;  4Q8I A;  1J9M A;  4B93 A;  1PWC A;  2WAE A;  3IXG A;  3HLB A;  3G32 A;  5CGS A;  1S4R A;  4H8R A;  4DF6 A;  4RA7 A;  5HL1 A;  4Y0U A;  4LCM A;  2PYP A;  1SKF A;  2WKH A;  4DE3 A;  2Y4A A;  1S1Z A;  1ACF A;  3LR5 A;  1T1B A;  2ZBB A;  4S2P A;  1IFQ A;  3K2N A;  4E3M A;  4BQM A;  4HY8 A;  2PU4 A;  4LV1 A;  5JYO A;  1W63 M;  3CIT A;  5E2H A;  5A8B A;  3GSG A;  4WZ5 C;  5FI6 A;  4R4R A;  2DMW A;  3WRZ A;  2EX8 A;  3BJN A;  2ZJ9 A;  2V1B A;  4JLF A;  2E8J A;  5CEC A;  2QYB A;  2VLG A;  2PDR A;  4JGP A;  4OLD A;  2KDK A;  3DWZ A;  3LIB A;  3ZG5 A;  3ZG0 A;  1TVF A;  2EFX A;  5EM0 A;  3N8R A;  4R3J A;  3W2Z A;  2ZQ7 A;  4YWZ A;  4JXS A;  1FSW A;  3IHB A;  1RP5 A;  2Y8H A;  3W8K A;  1FR6 A;  2JKG A;  2EWV A;  2OOL A;  3UNW A;  3L7H A;  1U60 A;  3VMA A;  5M18 A;  4P6Z S;  3R7W A;  3VOY A;  1TS7 A;  1IOU A;  3F1P B;  3IWO A;  3PBQ A;  3MR0 A;  4CJN A;  3IF6 B;  1OTI A;  5GL9 A;  1YMS A;  1FCO A;  1XGJ A;  4CLC A;  3E0Y A;  4KZ3 A;  1MWR A;  4CLC B;  4BWI A;  2R9X A;  4K0X A;  1PIO A;  2XGN A;  4HH2 A;  3KX0 X;  5FEG A;  3SZT A;  5EVE A;  3KSG A;  1KOU A;  1KGE A;  3FYZ A;  4MBH A;  1KGF A;  2JCH A;  2QJ7 A;  5HX9 A;  4E3J A;  2BLS A;  1E3U A;  2GNX A;  5CHM A;  3IXB A;  5DTS A;  1ESU A;  2HJ9 C;  3PR6 A;  3CMZ A;  3OCL A;  5EEC A;  3M2K A;  3PHY A;  4WLA A;  3AGD A;  2CC1 A;  1MY8 A;  3N6I A;  3UB8 A;  4GS9 A;  3P09 A;  2EXA A;  1T19 A;  5E43 A;  3NIA A;  5CHU A;  5C5K A;  1MC0 A;  2G2W A;  2IA2 A;  3H82 A;  2Y2L A;  2XRN A;  3ITB A;  4H6J B;  2BG1 A;  3PAE A;  1ZG6 A;  3HLG A;  3BM6 A;  4GB7 A;  5FL3 A;  3LCE A;  4EBP A;  3U4L P;  4EU0 A;  1DY6 A;  3D4F A;  3GTC A;  4DE1 A;  4R3B A;  5J8X A;  3EQV A;  4OQ0 A;  1TS0 A;  3GVB A;  3HUO A;  3JPU A;  4MDZ A;  3BYD A;  3MS6 A;  4IBX A;  4PKY G;  3G4P A;  2K31 A;  2WKR A;  4EUZ A;  5EV0 A;  2PD8 A;  3LR4 A;  4EW7 A;  1YMX A;  4S2L A;  4NK3 A;  1MWT A;  1ZG4 A;  5FQI A;  1PW8 A;  1SDE A;  4HIA A;  5L10 A;  5EOE A;  4S2K A;  4KQO A;  4MNR A;  5EVL A;  4EES A;  2OAP 1;  1QMF A;  3T4K A;  4YIN A;  5IT5 A;  2VX8 A;  2QWS A;  4B88 A;  1MZU A;  4K0W A;  4LV0 A;  5GLB A;  3UPP A;  1T18 A;  4WYY A;  1KVL A;  2ACG A;  5U47 A;  2A49 A;  1HTZ A;  1EI5 A;  5F69 A;  4OPQ A;  1L2S A;  1WYB A;  2WGI A;  4UA6 A;  3CAX A;  5EUA A;  4KEN B;  4BLM A;  2PU2 A;  1KE0 A;  5J4E A;  2R9W A;  1NJ4 A;  2WUQ A;  2PR5 A;  2A24 B;  2J3T D;  4II7 A;  3CI6 A;  4MBF A;  1NY0 A;  4LFU A;  3CLO A;  4QU3 A;  5E2G A;  1CI9 A;  5HDC A;  1YSQ A;  5KIZ A;  5DF7 A;  1DJA A;  4LEN A;  3UB5 P;  3A0V A;  2O9B A;  4GHI A;  3HJI A;  3A0R A;  3FKW A;  4JGO A;  4GHI B;  3T1S A;  2PR6 A;  3IQA A;  1Y28 A;  1FSY A;  3CHW P;  3ZDJ A;  2PHY A;  3LEZ A;  2Y2Q A;  3B33 A;  2HF6 A;  1LI9 A;  3BW6 A;  3MZD A;  4JXW A;  1LT0 A;  5GHX A;  3Q81 A;  3LGO A;  2V2F F;  3RXX A;  1P9W A;  1YPR A;  3QP4 A;  3GQZ A;  4FCF A;  1P97 A;  3I7J A;  4GN2 A;  3ITA A;  1ES2 A;  4B4Z A;  4QD4 A;  3HJK A;  5TR7 A;  1XKZ A;  3IH8 A;  3NC8 A;  1J3W A;  3Q7V B;  1TD5 A;  5M19 A;  2QKP A;  3UE6 A;  1K6R A;  1VM1 A;  4P85 A;  2P9V A;  1GSW A;  5LBR A;  5FA7 A;  1GA0 A;  4S2I A;  1TS6 A;  3UE0 A;  2V8F A;  4XT2 B;  3NOT C;  3UB6 A;  4ZAM A;  4WEL A;  2WKI A;  5EVI C;  3BFD A;  4HQA A;  1IYO A;  4FOF A;  3UPO A;  2ZLY A;  3IBJ A;  3UMD A;  3D72 A;  5DTT A;  4JGR A;  2R78 A;  1YSP A;  3ZG7 B;  1ZHH B;  2W1T A;  2G7U A;  1GHP A;  3ICY A;  1G6A A;  2I72 A;  2W1T B;  4F3L A;  1BLP A;  2Y2I A;  2Y2J A;  3M6H A;  4B4X A;  4N9K A;  4Q0J A;  5E2F A;  4OPZ A;  2EX2 A;  4DJ2 A;  4HH3 A;  4I3I A;  3IX4 A;  4N1X A;  1JTG A;  4WBG A;  4UHU A;  3KYE A;  1VHM A;  5KSH A;  1CI8 A;  3NI9 A;  1PRQ A;  2V1Z A;  2Y2M A;  3TRC A;  3FPV A;  3LR0 A;  3ZYT A;  5HAI A;  3A3J A;  4EBN A;  4LRZ E;  4ETZ A;  1TDG A;  2GZA A;  4KQR A;  1MWS A;  5DVA A;  3D9Y A;  3MZF A;  5FQJ A;  1K4F A;  2H10 A;  3IX3 A;  4K91 A;  2JKR I;  4M3K A;  4U0X A;  4E3O A;  4ESP A;  4X68 A;  3CUE A;  2XFT A;  1K57 C;  5HDS A;  4EUV A;  3VFF A;  1Q2Q A;  5FAP A;  1OT9 A;  2JKT M;  4GCZ A;  4X56 A;  3VOZ A;  4I38 A;  2HP6 A;  2XR0 A;  4NG2 A;  5DTK A;  3R4K A;  2IWB A;  5HZH A;  1XX2 A;  4BBT A;  2WGV A;  3MXS A;  1LHY A;  2XH9 A;  1K25 A;  1IYP A;  1XFQ A;  5A91 A;  3VP1 A;  1JWP A;  1SZV A;  2UWX A;  3OPR A;  1Z09 A;  2Y2G A;  4ZRR A;  3G34 A;  4FSF A;  3H9W A;  4QWO A;  4ZJ1 A;  1L0F A;  3KSH A;  1OTE A;  5CTN A;  2XEP A;  3UB9 A;  3C2W A;  3DW0 A;  2B18 A;  4Y17 A;  1G6O A;  2J80 A;  4Z9Q A;  3N8L A;  1CF0 A;  4JF5 A;  1X0O A;  3NUL A;  4GNU A;  4PPR A;  3HLF A;  3SOI A;  3MMH A;  3C7V A;  3G6O A;  4IBR A;  4S2O A;  2HDR A;  2W27 A;  3V5M A;  2OWJ A;  4WF0 A;  3VP3 A;  2ZQD A;  3LIC A;  4HJ3 A;  3AGE A;  3M2J A;  4MEZ A;  4BBU A;  3LI9 A;  1DP6 A;  4DDY A;  3TG9 A;  4S2M A;  4MCW A;  4B9O A;  1YLY A;  5IS1 A;  2QPN A;  3O86 A;  4C3Q A;  3C7U A;  4G3K A;  3ZG8 B;  2OV5 A;  4NXF A;  3QP5 A;  1HD8 A;  3CWF A;  4NET A;  4E3K A;  5F1G A;  3T1X A;  3FV7 A;  2P7J A;  3D3O A;  1DRM A;  4R6L A;  1VQQ A;  1BZA A;  4WEJ A;  2W3E A;  2W3F A;  2J9P A;  4Y15 A;  1W79 A;  1FQG A;  2EX9 A;  5CXW A;  2WKE A;  3ISG A;  3W4O A;  3KYQ A;  3G2Z A;  4WEK A;  3LID A;  3PBT A;  2PT7 A;  3MFD A;  4JXG A;  5HAP A;  5IU1 A;  3HUN A;  2GJ3 A;  2ZQ8 A;  2HDS A;  1L0D A;  4S2J A;  4MN5 A;  4WL9 A;  4O01 A;  2V1A A;  2EA9 A;  1FIK A;  1K54 A;  4NXE A;  5DFX A;  3KYZ A;  3RXW A;  1GCE A;  5DF8 A;  4ZDX A;  1XPB A;  2EX6 A;  4EXO A;  4MN7 A;  3T4J A;  4OOL A;  1JVJ A;  3S7Q A;  1ERQ A;  3SH9 A;  1K6S A;  3VFH A;  5HWW A;  4YOF A;  4Y2F A;  1PNE A;  2HP5 A;  1N4O A;  3C30 A;  3Q07 A;  3VV4 A;  2WZX A;  3UDI A;  1OJ5 A;  4HHD A;  1LL8 A;  4OLG A;  2QMI A;  1T1C A;  1BYW A;  5CRF A;  3KSI A;  4OOY A;  4D60 A;  1PYY A;  3WS0 A;  3F1P A;  1K55 A;  4CLC C;  1H5X A;  4S2N C;  4X53 A;  2Q0O A;  3A0S A;  3IF6 A;  4KZ6 A;  1UWN X;  1YKD A;  3PXP A;  2P04 A;  3O87 A;  5HWV A;  2O9C A;  4FH4 A;  1V9Y A;  5CTM A;  4QHC A; 
#chains in the Genus database with same CATH homology
 1VET B;  3MSH A;  1G5U A;  3L9K A;  2JKF A;  2HZ5 A;  3CPT A;  1CQA A;  1SKO A;  3UB5 P;  3CPT B;  3T1R A;  4X1M A;  2BTF P;  3T1S A;  1SZV A;  3CHW P;  3U4L P;  1Z09 A;  2PRF A;  2E8J A;  1AWI A;  1CJF A;  1FIK A;  4QWO A;  4X25 A;  5EM0 A;  3MS6 A;  3NEC A;  5FEF A;  3LGO A;  3KYE A;  2JKG A;  2VK3 A;  5EV0 A;  1CF0 A;  2B95 A;  1YPR A;  1PRQ A;  4FTX A;  3L7H A;  3NUL A;  5EM1 A;  3DAV A;  1HLU P;  1J3W A;  2PBD P;  2ZL1 A;  1PNE A;  3D9Y A;  2ZL1 B;  1A0K A;  3T12 B;  3LEQ A;  1FIL A;  5FEG A;  4FUW A;  2ACG A;  5EVE A;  1F2K A;  4D60 A;  4ESP A;  1VEU A;  2V8F A;  2PAV P;  1VEU B;  1PFL A;  1D1J A;  3T1Q B;  3T1X A;  1ACF A;  1SKO B;  4X1L A;  1K0K A;  2V8C A;  5FDS A;  1VET A;  1Y4O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...