3NULA

Profilin i from arabidopsis thaliana
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
130
structure length
130
Chain Sequence
SWQSYVDDHLMCDVEGNHLTAAAILGQDGSVWAQSAKFPQLKPQEIDGIKKDFEEPGFLAPTGLFLGGEKYMVIQGEQGAVIRGKKGPGGVTIKKTNQALVFGFYDEPMTGGQCNLVVERLGDYLIESEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of a major allergen from plants.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Actin binding protein
molecule keywords PROFILIN I
total genus 34
structure length 130
sequence length 130
ec nomenclature
pdb deposition date 1996-11-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.30 Alpha Beta 2-Layer Sandwich Beta-Lactamase Dynein light chain 2a, cytoplasmic 3nulA00
3NECA 1SZVA 4X1LA 1J3WA 1D1JA 5EVEA 3CHWP 5FDSA 3T12B 2PAVP 1CJFA 4FTXA 2ZL1A 3T1RA 3T1QB 1FILA 4D60A 1VETA 1VEUB 3L9KA 1SKOA 1PNEA 2ACGA 1A0KA 3L7HA 4X25A 3T1XA 1SKOB 3LEQA 1PRQA 3NULA 3DAVA 1CF0A 1VETB 4X1MA 5FEFA 3U4LP 3MSHA 4FUWA 1G5UA 1ACFA 2PRFA 2ZL1B 5EM1A 1VEUA 1F2KA 2V8CA 3MS6A 1Y4OA 3CPTB 3D9YA 2PBDP 2HZ5A 2JKFA 4ESPA 1YPRA 1Z09A 3T1SA 3CPTA 1HLUP 2V8FA 2E8JA 5FEGA 3LGOA 2JKGA 4QWOA 2VK3A 2B95A 1FIKA 3UB5P 2BTFP 5EV0A 1CQAA 3KYEA 1PFLA 1K0KA 1AWIA 5EM0A
chains in the Genus database with same CATH superfamily
1GHPA 3M2KA 2INWA 3A0RA 3NJAA 2W3FA 3BFGA 2PDRA 1PW1A 4X69A 2HV1A 4YOFA 1VEUA 3ZG5A 3WS4A 3BYDA 2V0WA 5HDCA 3PBNA 4E04A 3LI9A 2OWHA 4ZTKA 2FZ0A 3IF5A 5F1GA 4ETZA 1OPXA 3BEBA 3WS5A 1ES2A 3EEAA 1SDEA 2Y79A 4CLCC 3NCKA 2HDUA 1DRMA 4GDNA 3CUEA 2V8FA 3LIEA 5FEGA 4FH2A 4FSFA 1BLSA 1K57C 4E6WA 3HLFA 3Q82A 3BFDA 3BFEA 5HWVA 2ZMVA 4N9KA 4OQHA 4KQDA 3W8KA 5MC7A 5DKKA 4DDYA 1BLPA 4LRXC 5FQIA 4ZDXA 1N4OA 2PRFA 3O87A 4KQQA 2A2LA 1HD8A 3BRMA 3LIFA 5J3WA 3BLMA 4QWOA 1ZTUA 2V1ZA 5EVIC 3PAGA 4GN2A 1OJ5A 4FTXA 1FCMA 1K4EA 4IVIA 3S7OA 3C4PA 4BMWA 2XEPA 1XKZA 3OPHA 3T4SA 1NRFA 4P6BA 3FPWA 5DJUA 3MS6A 3MZFA 2EX2A 3HJKA 1G6AA 2WAFA 5FAQA 3OPPA 5AQ7A 2ZC7A 2MJ6A 3FZCA 5EVEA 2XA7S 2M1CA 4UA9A 4YWZA 4EV4A 4H6JB 5HFOA 5FEFA 2Y2JA 1FSWA 3H7WA 3GMWA 3KYEA 3HL9A 3CMZA 2O0YA 4HEFA 5FI6A 3TG9A 1YLZA 4OQGA 3E2LA 3V3RA 4B4XA 3LY3A 2EWWA 4NXBA 2JKTM 1PYYA 2W1RA 2Y2HA 3CITA 3VFFA 5CRFA 3IWIA 4Q0HA 3I7JA 5HW3A 3BLSA 3RTYA 2OLUA 4I38A 2ZQ9A 1XFNA 3MSHA 4JBFA 3ZG8B 2QJ5A 5HD5A 5CX7A 1E25A 4DRTA 3FKWA 2B02A 1MZUA 1EROA 3ZVWA 2DRWA 1PI5A 3L7HA 4OOLA 3EGDC 4Y3IA 2DMWA 5DTSA 5AVEA 3EEHA 1MXOA 2XROA 4HBUA 3MR0A 3G4PA 3EGXC 3IH8A 1JVJA 2JKGA 3MBZA 4GLQA 2PD8A 3LUQA 4F94A 3OCNA 4JXGA 3M2JA 4ZJ3A 1K25A 1F98A 3U2AA 5K5BA 1Y28A 3UDXA 1NWZA 3WS0A 2JKFA 4FH4A 2HDRA 4UAAA 1OJGA 3VSKA 2Y55A 2W3GA 4IBXA 2PR5A 3ZHHA 1H3QA 3IX8A 3IBJA 4LCLA 3E0YA 3PBRA 4GZBA 3UDFA 5TBMA 1SKOB 4LCMA 3PTEA 2QWSA 4P6ZM 2EFXA 5AQ9A 3JPUA 2PU2A 1S0WA 4KG2A 1PWDA 2WGIA 3T4QA 1LI0A 3L9KA 1OT6A 5A90A 3PHYA 5A93A 1CEGA 3T4LA 4IEDA 3VP1A 4GCZA 4JPMA 3DBAA 4BL3A 4WELA 2KOIA 3ZG7B 5E2EA 1E3UA 1HZOA 3ZNYA 2RCXA 2EXAA 2VK3A 4JF6A 2V2FF 1LSVA 3BM6A 3MKEA 4HH2A 1XFQA 1FR1A 4RVAA 5EE8A 3E2KA 4MDZA 4MLLA 1CEFA 3UN7A 2DCFA 2Y59A 3KX0X 4G3WA 4E3IA 1MPLA 4OP5A 4JGQA 3Q81A 4E3MA 2EX9A 4HJ4A 4PM9A 3T12B 1UGUA 4UEYA 5KIZA 4WL9A 5GL9A 5EECA 2BASA 3WWXA 2J3WA 1TF1A 5LBRA 5J4EA 4KZBA 3OC2A 3PAEA 2X02A 3P7NA 1LL5A 4X56A 1STZA 1H0MA 5EOOA 3TW8A 2C5WB 1VEUB 1XXMA 3QNCA 4PKYA 3IS2B 5DVAA 4HJ3A 1YLWA 4PM5A 2WKIA 4EBNA 4LGWA 4N1HA 1ES5A 3IQAA 2ZQ8A 4BBTA 1LL9A 5D3OA 5CHJA 4DJ3A 2OAQ1 4MN5A 5I94A 3KSFA 3GVBA 4OQIA 3UNWA 4HY8A 1GCEA 2OWJA 4GDBA 1PWCA 3SH9A 2J3TD 4B88A 4O8GA 1BTLA 4EUZA 4GHIA 3OLOA 3Q1FA 3T1QB 1S4SA 4Z9QA 2VV6A 4HOIA 5M1AA 1L0EA 1M6KA 3UE1A 5JYOA 3CPTA 3KSHA 1FOFA 2XFTA 3SS5A 3LY4A 2JKTI 2QMIA 4LENA 1YAXA 3A3JA 4O0PA 1CK3A 5E2HA 3UB7A 4Y15A 4II7A 3HUNA 1KVMA 2LB5A 2J9PA 1GSVA 3V50A 2Y2OA 1DJBA 1IKGA 5IU1A 5JYPA 2WYXA 2OSUA 5HWWA 3ZFZA 2XDMA 3G32A 3TJZC 1K6SA 3N8SA 2QHKA 5KSCA 4WMCD 5C5KA 5HD3A 5F83A 4JF5A 4E3KA 5DTTA 2WKEA 3O3VA 1IELA 1T1CA 3IXDA 3UMDA 2L0WA 3T1SA 4GB7A 1L0FA 2KDKA 4R4RA 1QMEA 2RL3A 1S67L 5HZHA 4NETA 1H8YA 1S66L 3O88A 5GHZA 1WYBA 4BWIA 4R70A 4MN7A 1KE4A 3LEQA 1W8YA 2QKPA 2HJEA 2VGKA 4CPKA 1LSWA 2V20A 3E4PA 2PBDP 4K08A 5CERA 3PYPA 3C4OA 4JGOA 4PPRA 1CQAA 2JHEA 3OCLA 2AVXA 5EPHA 5HX9A 3B47A 5GLAA 3MFDA 1VETB 4I5SA 1MWRA 4R3AA 3QP8A 4ESPA 3LR3A 1S4RA 5G4ZA 3T1XA 1MC0A 4NG2A 1OT9A 4LV0A 2JBFA 5FI7A 3JVVA 2WGWB 2BLSA 3W4QA 4R0QA 1GHIA 4C6YA 1Y4OA 1H8ZA 3K3DA 1FSYA 1N9BA 3Q7VA 4ZAMA 3EWKA 4DKIA 3ZG0A 3GR2A 5FDSA 3G31A 1NZOA 1K6RA 1GSXA 5KZHA 1ERQA 5A8BA 5HAPA 1H8MA 2ZBBA 2W3HA 1F2KA 1FCOA 3PXPA 3QP1A 1KGGA 3TOIA 2W27A 4X6TA 5L8MA 1J9MA 1ERMA 1SHVA 2ZC3B 3VE3A 5F6AA 2LB9A 3SOIA 2EXBA 5EM1A 1F9IA 4PM8A 1WE4A 2C6WB 4N1XA 5L2FA 4IJGA 2B95A 3MQ0A 2B5RA 3BY9A 5EM0A 3JVUA 4MCWA 4NK3A 3CI6A 2QPNA 3LIDA 1H5XA 4FOFA 3LYXA 3PBTA 4HIAA 3V67A 3HUOA 3T50A 1NYMA 1P9RA 3VP0A 3RXWA 1OTIA 3ZQ5A 4GNUA 1OTEA 1KOUA 3UY6A 1RGYA 2D01A 4M3KA 1UWPX 4DE3A 2DNSA 4KQOA 4LPZA 1YLTA 3Q7ZA 1IEMA 4ARZA 1IYOA 2W3DA 1Y54A 3QP4A 2XR0A 4HHDA 1YMSA 2WKQA 2ZC4B 5E43A 4GOGA 3BQ8A 1ES3A 4E3OA 5DF9A 4AFIA 4EBLA 4HP4A 4QY5A 5F82A 4MEZA 3VSLA 4R23A 4CLCD 4MN6A 1BULA 2GX5A 4BBUA 4JXWA 3ZCZA 2XSSA 5HAIA 1JNUA 3RFBA 5DKLA 2E8JA 4U3TA 1Q2PA 1D7EA 3LCEA 1XA7A 1GA0A 1P9WA 1KGEA 5TGFA 3IWOA 3SW1A 2HP9A 1IYSA 2IWDA 3F1PB 3FWLA 3V39A 3N8RA 3FPVA 4HQAA 4KQRA 5TJJA 2VZWA 2R9XA 1XP4A 3BY8A 3E4QA 2EX8A 4MBKA 3ULFA 2Z2LB 2O9BA 1FQGA 3NY4A 1XA1A 2WUQA 4I3AA 4YINA 2Z6CA 4WEJA 1BT5A 4F3LA 4LRZE 1NZUA 1S1ZA 3CG5A 2JKRM 4KZ8A 1LT0A 2K2NA 4X68A 5TFQA 1N9OA 4WN5A 3FKVA 2ZM8A 2BTFP 1QMFA 1JWVA 3QP2A 3SH7A 2J3TC 2ZOHA 1XPBA 1CF0A 4BBVA 3UE0A 2J80A 3SS4A 4O01A 5HL6A 2XF3A 3IWQA 3NOTC 5HSQA 3IBRA 3IT9A 4GS9B 4EEUA 2EFUA 3IHBA 3ZDJA 4IHQA 3CAXA 1E4DA 1PRQA 3ICYA 5EFWA 3IXGA 1N9LA 1NJ4A 4K0WA 2WGVA 1X0OA 1LHYA 4RYEA 1SDNA 3NDGA 4PAUA 5CTNA 3H7WB 5CEBA 3ZG9B 1D1JA 3IF6A 4C75A 4XT2B 4OLGA 4WZ4A 4GW9A 1G68A 2VGLM 4B93A 3QP5A 3B33A 4KZ9A 4ID4A 2QZ6A 1GSWA 3HLWA 2P9VA 4MBFA 1NLYA 2Q9MA 1M40A 4Y17A 2ZMAA 1S1YA 2V0UA 3G2YA 4OVDA 5M18A 2ZL1B 3RJUA 1U60A 3D9YA 4EUVA 1MBLA 5U47A 3NI9A 2XGNA 3G34A 2PU4A 4R1GA 4HNBA 5DFXA 4E3JA 3LIAA 2ZQAA 1W7FA 4D60A 2ZL1A 4S2IA 4KUOA 2B18A 2G2UA 5FA7A 1TS0A 1YKDA 2ZQDA 1I5QA 3A3IA 1HVBA 4WMCA 1DJCA 2Y91A 3HLBA 4LFUA 5DF8A 2P7JA 2HGVA 3NECA 4RX2A 1J3WA 1TEMA 1PZOA 3BFCA 3FG8A 3T1RA 4WLAA 1VETA 1YQSA 1SKFA 2HP5A 2ACGA 3LFVA 5AQBA 4BLMA 3UPNA 1PW8A 4EU0A 2WAEA 3IXHA 3P98A 4P0MA 1O7EA 4LV2A 4GKUA 2ZM2A 3P01A 1IKIA 2Y2NA 4R4SA 3EOIA 3HJIA 1MY8A 3ITAA 3C38A 4UQIM 5I5LA 1EWZA 1BLHA 5GLDA 1DP8A 3UB8A 3GDIA 3LICA 1VM1A 4WF0A 2Y2MA 4IVKA 4DE2A 4DN0A 3MFXA 5E2FA 2YKFA 3HBRA 3C2WA 3GTCA 2JE5A 1ESUA 4S2JA 4I3JA 3H9WA 4RX3A 5CHUA 3IXBA 4UQIS 4OOYA 2YKHA 1KE0A 4BENA 2HJ9C 5BOHA 4IUHA 3DWKA 3VOZA 1AWIA 3NIAA 1ZC2A 2JN7A 2WKHA 2IWBA 2XH9A 4JF4A 3O5YA 3GV9A 3CWFA 4X25A 4N9LA 1ACFA 1D06A 2Y2PA 3S1YA 4IBRA 2JKRI 4KENB 2PR6A 2W1TA 4MNRA 1I2WA 5CTMA 3A3EA 2G7UA 3O86A 1FILA 4JLFA 3T4TA 1K55A 3MXRA 5GHXA 5A91A 3IS2A 2Y2IA 4JGPA 3WRTA 3MJQA 4E3NA 2L4RA 1RGZA 1W79A 4S2NA 2J8YA 1V9ZA 2H10A 4X53A 4NXEA 2XD1A 4QHCA 1V9YA 4QY6A 1YT4A 5EVIA 2A24B 1K57A 3FV7A 5CECA 2V8CA 2M7VA 3EQVA 3RH8B 5FAOA 2KX6A 2PHYA 2VGLS 4HBTA 1UWNX 1XX2A 3SH8A 1W8QA 1NRJA 1T18A 1ZG4A 1PNEA 1L2SA 2GDNA 4OLDA 2XD5A 3WRZA 4PMAA 4EXOA 3HUMA 3K2NA 4C3QA 3LO7A 4OPZA 3SS3A 3S7NA 1Z09A 4Q0IA 3CLOA 3LI8A 3MXQA 4I39A 3TSGA 4FCFA 5GLBA 3MKFA 3UE3A 4X1MA 3C30A 3PBSA 2WGWA 2NUPC 5FQJA 3ZVTA 2Y8HA 3HLEA 1K38A 3S7QA 3LR0A 5F68A 3VOLA 1W5DA 4EESA 4CLCE 1FR6A 5EV0A 3G35A 3Q7VB 4OKPA 2VA0A 4OOMA 5FQ9A 3VP2A 3D3OA 3NBLA 4ETXA 2HP6A 3OPRA 5FASA 3NHQA 4NXGA 3GRJA 2W0NA 1P97A 3S4XA 2FH5A 3N4IA 3OBFA 3T4OA 3RXXA 2R78A 1YLPA 2K31A 1DJAA 1JWZA 3DW0A 4ARZB 3ZGAB 4DE0A 5E2GA 3Q07A 4S2NC 5AVFA 3F1OB 4L9FA 4Y2FA 4LLOB 1OTBA 5F69A 2ZLYA 3BWLA 1K55C 2Z6DA 2ZC5B 1IYQA 3F1OA 4OPRA 1MWUA 1GHMA 1LI9A 2HF6A 3GQZA 3D4FA 2UV0E 2Y4AA 1WA9A 3B42A 3IH9A 1HLUP 2KLIA 1LLBA 3UO9A 3AGEA 3G2ZA 3K3CA 1L0GA 2Y2KA 1I2SA 2VV7A 4U0TA 1OMEA 3KYQA 3DTMA 1P0ZA 4LV3A 4PHTA 4PM6A 2PD7A 1YLYA 3D72A 3DTEA 4OQ0A 4NEED 2HDSA 3MQQA 4Q8IA 4BL2A 3CJMA 4RQ9A 2IWCA 5FQQA 2PYPA 4EW7A 1CI8A 1WYCA 2ZOIA 5F5YA 4YNRA 4ZJ1A 3ITBA 3VP4A 3GSGA 1G5UA 5EUAA 1LL8A 3G30A 3H82A 3VE4A 1ONHA 2VJWA 4E3LA 4Q0JA 2A49A 3UB5P 1LSXA 1NYYA 1SZVA 3C7UA 3AGFA 2VKSA 4B9OA 3BW6A 5F1FA 1K54C 3FYZA 3OPLA 2UWXA 4FD8A 1Z6FA 2V9AA 4DDSA 5IS1A 4KZAA 2XFSA 3MZDA 1ODVA 2XRNA 3GECA 2P04A 2JCHA 1VB6A 1NXYA 4XXRA 4L0LA 1BLCA 5KMWA 5CEDA 2M7UA 2VEAA 2Y2GA 3UB9A 4DXBA 2P08A 1BSGA 4F3LB 2O9AA 2J7VA 2ZM0A 1OTDA 4HJ6A 4NKPA 1T1BA 2E8IA 3A0SA 4DE1A 4PM7A 4KUKA 4E6XA 3DTIA 5M19A 2X71A 3NC8A 1DY6A 3S7PA 4OPYA 5AQAA 1A0KA 2K7SA 3HLGA 4OP8A 4S2PA 1K56A 4WEKA 3W4OA 1KE3A 3HREA 1JWPA 4Y0TA 3P09A 4Y13A 4PKYG 2XK1A 2WKPA 3A3FA 1DP9A 3MF0A 4CJNA 4GD6A 1XJ4A 3CZDA 4BJPA 5CGWA 3QNBA 1XJ2A 2EA9A 1SKOA 3LIBA 4DMZA 5HPFA 4KG6A 2Y2LA 2XA7M 2V1BA 3DWZA 2ZC6B 5HL1A 1PI4A 3SZTA 2WK0A 4QD4A 2Q9NA 5GLCA 4Y0OA 4QPRA 4G3VA 3HCYA 2A24A 1MWTA 3PR6A 4GS9A 4JXVA 2I9VA 5CXWA 2OV5A 1JTGA 2W1TB 1RP5A 2P74A 5FQKA 1K54A 1IYPA 5EVLA 4WZ5C 2P9VB 2Z2MB 1PFLA 2NUTC 2I72A 4R3BA 5J7EA 2PAVP 3HLDA 5EVID 3WS1A 1W63M 5FSRA 3IX3A 4KZ7A 4Z1WA 4UA7A 3G6OA 4ZBEA 4UHUA 3S22A 2WADA 2GZAA 1YPRA 4HH3A 2J9OA 4L9EA 4QB8A 2ZJ9A 1K0KA 3VMAA 3TRCA 2X01A 3CHWP 1XJ3A 4IUKA 4DF6A 4GJ4A 5A92A 1PZPA 2L1MA 4O7DA 1Q2QA 3N6IA 4EERA 1YLJA 1N9NA 2EWVA 3ZNTA 3N7WA 4WUJA 3PBQA 4Y0UA 2R9WA 1VQQA 3F1NB 1G28A 4DJ2A 2VLGA 3UB6A 4KZ3A 5HPIA 4L9GA 2OAP1 1ES4A 2ZQCA 2FFFB 4I3IA 4B4ZA 4KZ6A 3LEZA 1ESIA 4HI4A 1DP6A 1BYWA 1TVFA 3LR4A 3T4KA 4D2OA 3LGOA 3MXSA 1ZKJA 3A0VA 3QP6A 3JYIA 3KYZA 5J8XA 3HVFA 3KSIA 1TS8A 2VX8A 3NULA 4H6JA 1NLZA 4RA7A 2H5SA 5L10A 2FFYA 4EQIA 3UMEA 3VP3A 4JKTA 3FC7A 5CGSA 4GHIB 4JGRA 1G6OA 1ONGA 3HLCA 1AXBA 2IA2A 1SCWA 5G18A 4EQ1A 3EQUA 3OZHA 4QJGA 1L3LA 2H0TA 1K56D 1T1AA 5TBMB 2BG1A 2EX6A 3N8LA 4XT2A 4K91A 4NXFA 1MWSA 2Q0OA 5KSHA 2O99A 2PBYA 1ZG6A 1K4FA 4OH0A 4R3JA 3E98A 4X1LA 1TDLA 1YM1A 2XLNA 2W3EA 1ALQA 3NDEA 4KZ5A 2GNXA 1TD5A 3DAVA 4S2OA 4DXCA 1W63Q 2WKRA 1ZHHB 3WS2A 1PWGA 2ZQ7A 5CHMA 1TDGA 5L07A 4ZRRA 2H28A 3NOUC 4UA6A 4P85A 3R7WA 4M4XA 4OPQA 1YSPA 4LV1A 5HWTA 4P6ZS 5HAQA 3AGDA 5IHVA 1EW0A 3BQAA 1HTZA 5DTKA 3BFFA 1CI9A 1OTAA 4EEPA 1KDSA 3W4PA 1BUEA 1KVLA 4JXSA 2HZ5A 1BZAA 5TR7A 1MKIA 2A3UA 4MMNA 4X55A 1FIKA 4CLCA 3CUEC 5FQMA 2G2WA 3F1PA 3H82B 2OOLA 4G3KA 4WYYA 4S2LA 3UPPA 4KG5A 4WZ5A 4Y5FA 3A3DA 5EVIB 2CC1A 1RCJA 5FATA 5DJTA 1O07A 1MKMA 4QU3A 3PBOA 4OONA 3UE6A 2QYBA 1S6RA 2XQZA 1TS6A 5FI2A 3C5AA 1XGIA 2QJ7A 1TS7A 1E3UD 1IOUA 3MQOA 4EBPA 3U4LP 3E4OA 4EWFA 1XGJA 2Y2QA 3VV4A 2WZZA 5IT5A 4CLCB 3DTKA 3TE8A 3F1NA 3V3SA 5AJGA 1EI5A 1CJFA 4S2MA 2GJ3A 1VHMA 1IFQA 3V5MA 4HP9A 4YFMA 1L0DA 4FUWA 4BQMA 4H8RA 4XUZA 3MZEA 1YMXA 3W2ZA 3IHAA 3VFHA 2HDQA 1GA9A 4EETB 5L09A 5HARA 2CMNA 2WZXA 5FL3A 2ZMFA 4U0XA 3UPOA 4ME4A 3MMHA 3OOVA 3QHYA 3T4JA 4K0XA 3ZYTA 5EOEA 3C7VA 3B3XA 3CPTB 3KO6A 4WBGA 4P87A 3IX4A 1JTDA 3M6BA 4A5RA 4CQHA 2VV8A 3BECA 4R6LA 3ISGA 2ZD8A 4LRYC 4ZJ2A 5FDHA 4GD8A 5HDSA 4BD0A 3NOPC 1T19A 2JC7A 1KGFA 2PT7A 2H0YA 3KSGA 3R7WB 2O9CA 4Y7PA 1KDWA 3VOYA 1PIOA 2HPBA 1F5MA 3C8CA 3M6HA 2V1AA 4XUXA 5FAPA 1YSQA 2OLVA 1FCNA 4KZ4A 5CGXA 1XJ6A 2VGJA 4HESA 2PYRA 4S2KA 3IF6B 4R38A 4WM9A 5HDDA 4N92A 4BD1A 4MBHA 3IF6C 5G4YA 1C3BA 3LR5A 5DFYA 3R4KA 5DF7A 3UDIA 2D02A 5GHYA 3BJNA 1NY0A
chains in the Genus database with same CATH topology
3NECA 1SZVA 4X1LA 1J3WA 1D1JA 5EVEA 3CHWP 5FDSA 3T12B 2PAVP 1CJFA 4FTXA 2ZL1A 3T1RA 3T1QB 1FILA 4D60A 1VETA 1VEUB 3L9KA 1SKOA 1PNEA 2ACGA 1A0KA 3L7HA 4X25A 3T1XA 1SKOB 3LEQA 1PRQA 3NULA 3DAVA 1CF0A 1VETB 4X1MA 5FEFA 3U4LP 3MSHA 4FUWA 1G5UA 1ACFA 2PRFA 2ZL1B 5EM1A 1VEUA 1F2KA 2V8CA 3MS6A 1Y4OA 3CPTB 3D9YA 2PBDP 2HZ5A 2JKFA 4ESPA 1YPRA 1Z09A 3T1SA 3CPTA 1HLUP 2V8FA 2E8JA 5FEGA 3LGOA 2JKGA 4QWOA 2VK3A 2B95A 1FIKA 3UB5P 2BTFP 5EV0A 1CQAA 3KYEA 1PFLA 1K0KA 1AWIA 5EM0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NEC A;  1SZV A;  4X1L A;  1J3W A;  1D1J A;  5EVE A;  3CHW P;  5FDS A;  3T12 B;  2PAV P;  1CJF A;  4FTX A;  2ZL1 A;  3T1R A;  3T1Q B;  1FIL A;  4D60 A;  1VET A;  1VEU B;  3L9K A;  1SKO A;  1PNE A;  2ACG A;  1A0K A;  3L7H A;  4X25 A;  3T1X A;  1SKO B;  3LEQ A;  1PRQ A;  3NUL A;  3DAV A;  1CF0 A;  1VET B;  4X1M A;  5FEF A;  3U4L P;  3MSH A;  4FUW A;  1G5U A;  1ACF A;  2PRF A;  2ZL1 B;  5EM1 A;  1VEU A;  1F2K A;  2V8C A;  3MS6 A;  1Y4O A;  3CPT B;  3D9Y A;  2PBD P;  2HZ5 A;  2JKF A;  4ESP A;  1YPR A;  1Z09 A;  3T1S A;  3CPT A;  1HLU P;  2V8F A;  2E8J A;  5FEG A;  3LGO A;  2JKG A;  4QWO A;  2VK3 A;  2B95 A;  1FIK A;  3UB5 P;  2BTF P;  5EV0 A;  1CQA A;  3KYE A;  1PFL A;  1K0K A;  1AWI A;  5EM0 A; 
#chains in the Genus database with same CATH topology
 1GHP A;  3M2K A;  2INW A;  3A0R A;  3NJA A;  2W3F A;  3BFG A;  2PDR A;  1PW1 A;  4X69 A;  2HV1 A;  4YOF A;  1VEU A;  3ZG5 A;  3WS4 A;  3BYD A;  2V0W A;  5HDC A;  3PBN A;  4E04 A;  3LI9 A;  2OWH A;  4ZTK A;  2FZ0 A;  3IF5 A;  5F1G A;  4ETZ A;  1OPX A;  3BEB A;  3WS5 A;  1ES2 A;  3EEA A;  1SDE A;  2Y79 A;  4CLC C;  3NCK A;  2HDU A;  1DRM A;  4GDN A;  3CUE A;  2V8F A;  3LIE A;  5FEG A;  4FH2 A;  4FSF A;  1BLS A;  1K57 C;  4E6W A;  3HLF A;  3Q82 A;  3BFD A;  3BFE A;  5HWV A;  2ZMV A;  4N9K A;  4OQH A;  4KQD A;  3W8K A;  5MC7 A;  5DKK A;  4DDY A;  1BLP A;  4LRX C;  5FQI A;  4ZDX A;  1N4O A;  2PRF A;  3O87 A;  4KQQ A;  2A2L A;  1HD8 A;  3BRM A;  3LIF A;  5J3W A;  3BLM A;  4QWO A;  1ZTU A;  2V1Z A;  5EVI C;  3PAG A;  4GN2 A;  1OJ5 A;  4FTX A;  1FCM A;  1K4E A;  4IVI A;  3S7O A;  3C4P A;  4BMW A;  2XEP A;  1XKZ A;  3OPH A;  3T4S A;  1NRF A;  4P6B A;  3FPW A;  5DJU A;  3MS6 A;  3MZF A;  2EX2 A;  3HJK A;  1G6A A;  2WAF A;  5FAQ A;  3OPP A;  5AQ7 A;  2ZC7 A;  2MJ6 A;  3FZC A;  5EVE A;  2XA7 S;  2M1C A;  4UA9 A;  4YWZ A;  4EV4 A;  4H6J B;  5HFO A;  5FEF A;  2Y2J A;  1FSW A;  3H7W A;  3GMW A;  3KYE A;  3HL9 A;  3CMZ A;  2O0Y A;  4HEF A;  5FI6 A;  3TG9 A;  1YLZ A;  4OQG A;  3E2L A;  3V3R A;  4B4X A;  3LY3 A;  2EWW A;  4NXB A;  2JKT M;  1PYY A;  2W1R A;  2Y2H A;  3CIT A;  3VFF A;  5CRF A;  3IWI A;  4Q0H A;  3I7J A;  5HW3 A;  3BLS A;  3RTY A;  2OLU A;  4I38 A;  2ZQ9 A;  1XFN A;  3MSH A;  4JBF A;  3ZG8 B;  2QJ5 A;  5HD5 A;  5CX7 A;  1E25 A;  4DRT A;  3FKW A;  2B02 A;  1MZU A;  1ERO A;  3ZVW A;  2DRW A;  1PI5 A;  3L7H A;  4OOL A;  3EGD C;  4Y3I A;  2DMW A;  5DTS A;  5AVE A;  3EEH A;  1MXO A;  2XRO A;  4HBU A;  3MR0 A;  3G4P A;  3EGX C;  3IH8 A;  1JVJ A;  2JKG A;  3MBZ A;  4GLQ A;  2PD8 A;  3LUQ A;  4F94 A;  3OCN A;  4JXG A;  3M2J A;  4ZJ3 A;  1K25 A;  1F98 A;  3U2A A;  5K5B A;  1Y28 A;  3UDX A;  1NWZ A;  3WS0 A;  2JKF A;  4FH4 A;  2HDR A;  4UAA A;  1OJG A;  3VSK A;  2Y55 A;  2W3G A;  4IBX A;  2PR5 A;  3ZHH A;  1H3Q A;  3IX8 A;  3IBJ A;  4LCL A;  3E0Y A;  3PBR A;  4GZB A;  3UDF A;  5TBM A;  1SKO B;  4LCM A;  3PTE A;  2QWS A;  4P6Z M;  2EFX A;  5AQ9 A;  3JPU A;  2PU2 A;  1S0W A;  4KG2 A;  1PWD A;  2WGI A;  3T4Q A;  1LI0 A;  3L9K A;  1OT6 A;  5A90 A;  3PHY A;  5A93 A;  1CEG A;  3T4L A;  4IED A;  3VP1 A;  4GCZ A;  4JPM A;  3DBA A;  4BL3 A;  4WEL A;  2KOI A;  3ZG7 B;  5E2E A;  1E3U A;  1HZO A;  3ZNY A;  2RCX A;  2EXA A;  2VK3 A;  4JF6 A;  2V2F F;  1LSV A;  3BM6 A;  3MKE A;  4HH2 A;  1XFQ A;  1FR1 A;  4RVA A;  5EE8 A;  3E2K A;  4MDZ A;  4MLL A;  1CEF A;  3UN7 A;  2DCF A;  2Y59 A;  3KX0 X;  4G3W A;  4E3I A;  1MPL A;  4OP5 A;  4JGQ A;  3Q81 A;  4E3M A;  2EX9 A;  4HJ4 A;  4PM9 A;  3T12 B;  1UGU A;  4UEY A;  5KIZ A;  4WL9 A;  5GL9 A;  5EEC A;  2BAS A;  3WWX A;  2J3W A;  1TF1 A;  5LBR A;  5J4E A;  4KZB A;  3OC2 A;  3PAE A;  2X02 A;  3P7N A;  1LL5 A;  4X56 A;  1STZ A;  1H0M A;  5EOO A;  3TW8 A;  2C5W B;  1VEU B;  1XXM A;  3QNC A;  4PKY A;  3IS2 B;  5DVA A;  4HJ3 A;  1YLW A;  4PM5 A;  2WKI A;  4EBN A;  4LGW A;  4N1H A;  1ES5 A;  3IQA A;  2ZQ8 A;  4BBT A;  1LL9 A;  5D3O A;  5CHJ A;  4DJ3 A;  2OAQ 1;  4MN5 A;  5I94 A;  3KSF A;  3GVB A;  4OQI A;  3UNW A;  4HY8 A;  1GCE A;  2OWJ A;  4GDB A;  1PWC A;  3SH9 A;  2J3T D;  4B88 A;  4O8G A;  1BTL A;  4EUZ A;  4GHI A;  3OLO A;  3Q1F A;  3T1Q B;  1S4S A;  4Z9Q A;  2VV6 A;  4HOI A;  5M1A A;  1L0E A;  1M6K A;  3UE1 A;  5JYO A;  3CPT A;  3KSH A;  1FOF A;  2XFT A;  3SS5 A;  3LY4 A;  2JKT I;  2QMI A;  4LEN A;  1YAX A;  3A3J A;  4O0P A;  1CK3 A;  5E2H A;  3UB7 A;  4Y15 A;  4II7 A;  3HUN A;  1KVM A;  2LB5 A;  2J9P A;  1GSV A;  3V50 A;  2Y2O A;  1DJB A;  1IKG A;  5IU1 A;  5JYP A;  2WYX A;  2OSU A;  5HWW A;  3ZFZ A;  2XDM A;  3G32 A;  3TJZ C;  1K6S A;  3N8S A;  2QHK A;  5KSC A;  4WMC D;  5C5K A;  5HD3 A;  5F83 A;  4JF5 A;  4E3K A;  5DTT A;  2WKE A;  3O3V A;  1IEL A;  1T1C A;  3IXD A;  3UMD A;  2L0W A;  3T1S A;  4GB7 A;  1L0F A;  2KDK A;  4R4R A;  1QME A;  2RL3 A;  1S67 L;  5HZH A;  4NET A;  1H8Y A;  1S66 L;  3O88 A;  5GHZ A;  1WYB A;  4BWI A;  4R70 A;  4MN7 A;  1KE4 A;  3LEQ A;  1W8Y A;  2QKP A;  2HJE A;  2VGK A;  4CPK A;  1LSW A;  2V20 A;  3E4P A;  2PBD P;  4K08 A;  5CER A;  3PYP A;  3C4O A;  4JGO A;  4PPR A;  1CQA A;  2JHE A;  3OCL A;  2AVX A;  5EPH A;  5HX9 A;  3B47 A;  5GLA A;  3MFD A;  1VET B;  4I5S A;  1MWR A;  4R3A A;  3QP8 A;  4ESP A;  3LR3 A;  1S4R A;  5G4Z A;  3T1X A;  1MC0 A;  4NG2 A;  1OT9 A;  4LV0 A;  2JBF A;  5FI7 A;  3JVV A;  2WGW B;  2BLS A;  3W4Q A;  4R0Q A;  1GHI A;  4C6Y A;  1Y4O A;  1H8Z A;  3K3D A;  1FSY A;  1N9B A;  3Q7V A;  4ZAM A;  3EWK A;  4DKI A;  3ZG0 A;  3GR2 A;  5FDS A;  3G31 A;  1NZO A;  1K6R A;  1GSX A;  5KZH A;  1ERQ A;  5A8B A;  5HAP A;  1H8M A;  2ZBB A;  2W3H A;  1F2K A;  1FCO A;  3PXP A;  3QP1 A;  1KGG A;  3TOI A;  2W27 A;  4X6T A;  5L8M A;  1J9M A;  1ERM A;  1SHV A;  2ZC3 B;  3VE3 A;  5F6A A;  2LB9 A;  3SOI A;  2EXB A;  5EM1 A;  1F9I A;  4PM8 A;  1WE4 A;  2C6W B;  4N1X A;  5L2F A;  4IJG A;  2B95 A;  3MQ0 A;  2B5R A;  3BY9 A;  5EM0 A;  3JVU A;  4MCW A;  4NK3 A;  3CI6 A;  2QPN A;  3LID A;  1H5X A;  4FOF A;  3LYX A;  3PBT A;  4HIA A;  3V67 A;  3HUO A;  3T50 A;  1NYM A;  1P9R A;  3VP0 A;  3RXW A;  1OTI A;  3ZQ5 A;  4GNU A;  1OTE A;  1KOU A;  3UY6 A;  1RGY A;  2D01 A;  4M3K A;  1UWP X;  4DE3 A;  2DNS A;  4KQO A;  4LPZ A;  1YLT A;  3Q7Z A;  1IEM A;  4ARZ A;  1IYO A;  2W3D A;  1Y54 A;  3QP4 A;  2XR0 A;  4HHD A;  1YMS A;  2WKQ A;  2ZC4 B;  5E43 A;  4GOG A;  3BQ8 A;  1ES3 A;  4E3O A;  5DF9 A;  4AFI A;  4EBL A;  4HP4 A;  4QY5 A;  5F82 A;  4MEZ A;  3VSL A;  4R23 A;  4CLC D;  4MN6 A;  1BUL A;  2GX5 A;  4BBU A;  4JXW A;  3ZCZ A;  2XSS A;  5HAI A;  1JNU A;  3RFB A;  5DKL A;  2E8J A;  4U3T A;  1Q2P A;  1D7E A;  3LCE A;  1XA7 A;  1GA0 A;  1P9W A;  1KGE A;  5TGF A;  3IWO A;  3SW1 A;  2HP9 A;  1IYS A;  2IWD A;  3F1P B;  3FWL A;  3V39 A;  3N8R A;  3FPV A;  4HQA A;  4KQR A;  5TJJ A;  2VZW A;  2R9X A;  1XP4 A;  3BY8 A;  3E4Q A;  2EX8 A;  4MBK A;  3ULF A;  2Z2L B;  2O9B A;  1FQG A;  3NY4 A;  1XA1 A;  2WUQ A;  4I3A A;  4YIN A;  2Z6C A;  4WEJ A;  1BT5 A;  4F3L A;  4LRZ E;  1NZU A;  1S1Z A;  3CG5 A;  2JKR M;  4KZ8 A;  1LT0 A;  2K2N A;  4X68 A;  5TFQ A;  1N9O A;  4WN5 A;  3FKV A;  2ZM8 A;  2BTF P;  1QMF A;  1JWV A;  3QP2 A;  3SH7 A;  2J3T C;  2ZOH A;  1XPB A;  1CF0 A;  4BBV A;  3UE0 A;  2J80 A;  3SS4 A;  4O01 A;  5HL6 A;  2XF3 A;  3IWQ A;  3NOT C;  5HSQ A;  3IBR A;  3IT9 A;  4GS9 B;  4EEU A;  2EFU A;  3IHB A;  3ZDJ A;  4IHQ A;  3CAX A;  1E4D A;  1PRQ A;  3ICY A;  5EFW A;  3IXG A;  1N9L A;  1NJ4 A;  4K0W A;  2WGV A;  1X0O A;  1LHY A;  4RYE A;  1SDN A;  3NDG A;  4PAU A;  5CTN A;  3H7W B;  5CEB A;  3ZG9 B;  1D1J A;  3IF6 A;  4C75 A;  4XT2 B;  4OLG A;  4WZ4 A;  4GW9 A;  1G68 A;  2VGL M;  4B93 A;  3QP5 A;  3B33 A;  4KZ9 A;  4ID4 A;  2QZ6 A;  1GSW A;  3HLW A;  2P9V A;  4MBF A;  1NLY A;  2Q9M A;  1M40 A;  4Y17 A;  2ZMA A;  1S1Y A;  2V0U A;  3G2Y A;  4OVD A;  5M18 A;  2ZL1 B;  3RJU A;  1U60 A;  3D9Y A;  4EUV A;  1MBL A;  5U47 A;  3NI9 A;  2XGN A;  3G34 A;  2PU4 A;  4R1G A;  4HNB A;  5DFX A;  4E3J A;  3LIA A;  2ZQA A;  1W7F A;  4D60 A;  2ZL1 A;  4S2I A;  4KUO A;  2B18 A;  2G2U A;  5FA7 A;  1TS0 A;  1YKD A;  2ZQD A;  1I5Q A;  3A3I A;  1HVB A;  4WMC A;  1DJC A;  2Y91 A;  3HLB A;  4LFU A;  5DF8 A;  2P7J A;  2HGV A;  3NEC A;  4RX2 A;  1J3W A;  1TEM A;  1PZO A;  3BFC A;  3FG8 A;  3T1R A;  4WLA A;  1VET A;  1YQS A;  1SKF A;  2HP5 A;  2ACG A;  3LFV A;  5AQB A;  4BLM A;  3UPN A;  1PW8 A;  4EU0 A;  2WAE A;  3IXH A;  3P98 A;  4P0M A;  1O7E A;  4LV2 A;  4GKU A;  2ZM2 A;  3P01 A;  1IKI A;  2Y2N A;  4R4S A;  3EOI A;  3HJI A;  1MY8 A;  3ITA A;  3C38 A;  4UQI M;  5I5L A;  1EWZ A;  1BLH A;  5GLD A;  1DP8 A;  3UB8 A;  3GDI A;  3LIC A;  1VM1 A;  4WF0 A;  2Y2M A;  4IVK A;  4DE2 A;  4DN0 A;  3MFX A;  5E2F A;  2YKF A;  3HBR A;  3C2W A;  3GTC A;  2JE5 A;  1ESU A;  4S2J A;  4I3J A;  3H9W A;  4RX3 A;  5CHU A;  3IXB A;  4UQI S;  4OOY A;  2YKH A;  1KE0 A;  4BEN A;  2HJ9 C;  5BOH A;  4IUH A;  3DWK A;  3VOZ A;  1AWI A;  3NIA A;  1ZC2 A;  2JN7 A;  2WKH A;  2IWB A;  2XH9 A;  4JF4 A;  3O5Y A;  3GV9 A;  3CWF A;  4X25 A;  4N9L A;  1ACF A;  1D06 A;  2Y2P A;  3S1Y A;  4IBR A;  2JKR I;  4KEN B;  2PR6 A;  2W1T A;  4MNR A;  1I2W A;  5CTM A;  3A3E A;  2G7U A;  3O86 A;  1FIL A;  4JLF A;  3T4T A;  1K55 A;  3MXR A;  5GHX A;  5A91 A;  3IS2 A;  2Y2I A;  4JGP A;  3WRT A;  3MJQ A;  4E3N A;  2L4R A;  1RGZ A;  1W79 A;  4S2N A;  2J8Y A;  1V9Z A;  2H10 A;  4X53 A;  4NXE A;  2XD1 A;  4QHC A;  1V9Y A;  4QY6 A;  1YT4 A;  5EVI A;  2A24 B;  1K57 A;  3FV7 A;  5CEC A;  2V8C A;  2M7V A;  3EQV A;  3RH8 B;  5FAO A;  2KX6 A;  2PHY A;  2VGL S;  4HBT A;  1UWN X;  1XX2 A;  3SH8 A;  1W8Q A;  1NRJ A;  1T18 A;  1ZG4 A;  1PNE A;  1L2S A;  2GDN A;  4OLD A;  2XD5 A;  3WRZ A;  4PMA A;  4EXO A;  3HUM A;  3K2N A;  4C3Q A;  3LO7 A;  4OPZ A;  3SS3 A;  3S7N A;  1Z09 A;  4Q0I A;  3CLO A;  3LI8 A;  3MXQ A;  4I39 A;  3TSG A;  4FCF A;  5GLB A;  3MKF A;  3UE3 A;  4X1M A;  3C30 A;  3PBS A;  2WGW A;  2NUP C;  5FQJ A;  3ZVT A;  2Y8H A;  3HLE A;  1K38 A;  3S7Q A;  3LR0 A;  5F68 A;  3VOL A;  1W5D A;  4EES A;  4CLC E;  1FR6 A;  5EV0 A;  3G35 A;  3Q7V B;  4OKP A;  2VA0 A;  4OOM A;  5FQ9 A;  3VP2 A;  3D3O A;  3NBL A;  4ETX A;  2HP6 A;  3OPR A;  5FAS A;  3NHQ A;  4NXG A;  3GRJ A;  2W0N A;  1P97 A;  3S4X A;  2FH5 A;  3N4I A;  3OBF A;  3T4O A;  3RXX A;  2R78 A;  1YLP A;  2K31 A;  1DJA A;  1JWZ A;  3DW0 A;  4ARZ B;  3ZGA B;  4DE0 A;  5E2G A;  3Q07 A;  4S2N C;  5AVF A;  3F1O B;  4L9F A;  4Y2F A;  4LLO B;  1OTB A;  5F69 A;  2ZLY A;  3BWL A;  1K55 C;  2Z6D A;  2ZC5 B;  1IYQ A;  3F1O A;  4OPR A;  1MWU A;  1GHM A;  1LI9 A;  2HF6 A;  3GQZ A;  3D4F A;  2UV0 E;  2Y4A A;  1WA9 A;  3B42 A;  3IH9 A;  1HLU P;  2KLI A;  1LLB A;  3UO9 A;  3AGE A;  3G2Z A;  3K3C A;  1L0G A;  2Y2K A;  1I2S A;  2VV7 A;  4U0T A;  1OME A;  3KYQ A;  3DTM A;  1P0Z A;  4LV3 A;  4PHT A;  4PM6 A;  2PD7 A;  1YLY A;  3D72 A;  3DTE A;  4OQ0 A;  4NEE D;  2HDS A;  3MQQ A;  4Q8I A;  4BL2 A;  3CJM A;  4RQ9 A;  2IWC A;  5FQQ A;  2PYP A;  4EW7 A;  1CI8 A;  1WYC A;  2ZOI A;  5F5Y A;  4YNR A;  4ZJ1 A;  3ITB A;  3VP4 A;  3GSG A;  1G5U A;  5EUA A;  1LL8 A;  3G30 A;  3H82 A;  3VE4 A;  1ONH A;  2VJW A;  4E3L A;  4Q0J A;  2A49 A;  3UB5 P;  1LSX A;  1NYY A;  1SZV A;  3C7U A;  3AGF A;  2VKS A;  4B9O A;  3BW6 A;  5F1F A;  1K54 C;  3FYZ A;  3OPL A;  2UWX A;  4FD8 A;  1Z6F A;  2V9A A;  4DDS A;  5IS1 A;  4KZA A;  2XFS A;  3MZD A;  1ODV A;  2XRN A;  3GEC A;  2P04 A;  2JCH A;  1VB6 A;  1NXY A;  4XXR A;  4L0L A;  1BLC A;  5KMW A;  5CED A;  2M7U A;  2VEA A;  2Y2G A;  3UB9 A;  4DXB A;  2P08 A;  1BSG A;  4F3L B;  2O9A A;  2J7V A;  2ZM0 A;  1OTD A;  4HJ6 A;  4NKP A;  1T1B A;  2E8I A;  3A0S A;  4DE1 A;  4PM7 A;  4KUK A;  4E6X A;  3DTI A;  5M19 A;  2X71 A;  3NC8 A;  1DY6 A;  3S7P A;  4OPY A;  5AQA A;  1A0K A;  2K7S A;  3HLG A;  4OP8 A;  4S2P A;  1K56 A;  4WEK A;  3W4O A;  1KE3 A;  3HRE A;  1JWP A;  4Y0T A;  3P09 A;  4Y13 A;  4PKY G;  2XK1 A;  2WKP A;  3A3F A;  1DP9 A;  3MF0 A;  4CJN A;  4GD6 A;  1XJ4 A;  3CZD A;  4BJP A;  5CGW A;  3QNB A;  1XJ2 A;  2EA9 A;  1SKO A;  3LIB A;  4DMZ A;  5HPF A;  4KG6 A;  2Y2L A;  2XA7 M;  2V1B A;  3DWZ A;  2ZC6 B;  5HL1 A;  1PI4 A;  3SZT A;  2WK0 A;  4QD4 A;  2Q9N A;  5GLC A;  4Y0O A;  4QPR A;  4G3V A;  3HCY A;  2A24 A;  1MWT A;  3PR6 A;  4GS9 A;  4JXV A;  2I9V A;  5CXW A;  2OV5 A;  1JTG A;  2W1T B;  1RP5 A;  2P74 A;  5FQK A;  1K54 A;  1IYP A;  5EVL A;  4WZ5 C;  2P9V B;  2Z2M B;  1PFL A;  2NUT C;  2I72 A;  4R3B A;  5J7E A;  2PAV P;  3HLD A;  5EVI D;  3WS1 A;  1W63 M;  5FSR A;  3IX3 A;  4KZ7 A;  4Z1W A;  4UA7 A;  3G6O A;  4ZBE A;  4UHU A;  3S22 A;  2WAD A;  2GZA A;  1YPR A;  4HH3 A;  2J9O A;  4L9E A;  4QB8 A;  2ZJ9 A;  1K0K A;  3VMA A;  3TRC A;  2X01 A;  3CHW P;  1XJ3 A;  4IUK A;  4DF6 A;  4GJ4 A;  5A92 A;  1PZP A;  2L1M A;  4O7D A;  1Q2Q A;  3N6I A;  4EER A;  1YLJ A;  1N9N A;  2EWV A;  3ZNT A;  3N7W A;  4WUJ A;  3PBQ A;  4Y0U A;  2R9W A;  1VQQ A;  3F1N B;  1G28 A;  4DJ2 A;  2VLG A;  3UB6 A;  4KZ3 A;  5HPI A;  4L9G A;  2OAP 1;  1ES4 A;  2ZQC A;  2FFF B;  4I3I A;  4B4Z A;  4KZ6 A;  3LEZ A;  1ESI A;  4HI4 A;  1DP6 A;  1BYW A;  1TVF A;  3LR4 A;  3T4K A;  4D2O A;  3LGO A;  3MXS A;  1ZKJ A;  3A0V A;  3QP6 A;  3JYI A;  3KYZ A;  5J8X A;  3HVF A;  3KSI A;  1TS8 A;  2VX8 A;  3NUL A;  4H6J A;  1NLZ A;  4RA7 A;  2H5S A;  5L10 A;  2FFY A;  4EQI A;  3UME A;  3VP3 A;  4JKT A;  3FC7 A;  5CGS A;  4GHI B;  4JGR A;  1G6O A;  1ONG A;  3HLC A;  1AXB A;  2IA2 A;  1SCW A;  5G18 A;  4EQ1 A;  3EQU A;  3OZH A;  4QJG A;  1L3L A;  2H0T A;  1K56 D;  1T1A A;  5TBM B;  2BG1 A;  2EX6 A;  3N8L A;  4XT2 A;  4K91 A;  4NXF A;  1MWS A;  2Q0O A;  5KSH A;  2O99 A;  2PBY A;  1ZG6 A;  1K4F A;  4OH0 A;  4R3J A;  3E98 A;  4X1L A;  1TDL A;  1YM1 A;  2XLN A;  2W3E A;  1ALQ A;  3NDE A;  4KZ5 A;  2GNX A;  1TD5 A;  3DAV A;  4S2O A;  4DXC A;  1W63 Q;  2WKR A;  1ZHH B;  3WS2 A;  1PWG A;  2ZQ7 A;  5CHM A;  1TDG A;  5L07 A;  4ZRR A;  2H28 A;  3NOU C;  4UA6 A;  4P85 A;  3R7W A;  4M4X A;  4OPQ A;  1YSP A;  4LV1 A;  5HWT A;  4P6Z S;  5HAQ A;  3AGD A;  5IHV A;  1EW0 A;  3BQA A;  1HTZ A;  5DTK A;  3BFF A;  1CI9 A;  1OTA A;  4EEP A;  1KDS A;  3W4P A;  1BUE A;  1KVL A;  4JXS A;  2HZ5 A;  1BZA A;  5TR7 A;  1MKI A;  2A3U A;  4MMN A;  4X55 A;  1FIK A;  4CLC A;  3CUE C;  5FQM A;  2G2W A;  3F1P A;  3H82 B;  2OOL A;  4G3K A;  4WYY A;  4S2L A;  3UPP A;  4KG5 A;  4WZ5 A;  4Y5F A;  3A3D A;  5EVI B;  2CC1 A;  1RCJ A;  5FAT A;  5DJT A;  1O07 A;  1MKM A;  4QU3 A;  3PBO A;  4OON A;  3UE6 A;  2QYB A;  1S6R A;  2XQZ A;  1TS6 A;  5FI2 A;  3C5A A;  1XGI A;  2QJ7 A;  1TS7 A;  1E3U D;  1IOU A;  3MQO A;  4EBP A;  3U4L P;  3E4O A;  4EWF A;  1XGJ A;  2Y2Q A;  3VV4 A;  2WZZ A;  5IT5 A;  4CLC B;  3DTK A;  3TE8 A;  3F1N A;  3V3S A;  5AJG A;  1EI5 A;  1CJF A;  4S2M A;  2GJ3 A;  1VHM A;  1IFQ A;  3V5M A;  4HP9 A;  4YFM A;  1L0D A;  4FUW A;  4BQM A;  4H8R A;  4XUZ A;  3MZE A;  1YMX A;  3W2Z A;  3IHA A;  3VFH A;  2HDQ A;  1GA9 A;  4EET B;  5L09 A;  5HAR A;  2CMN A;  2WZX A;  5FL3 A;  2ZMF A;  4U0X A;  3UPO A;  4ME4 A;  3MMH A;  3OOV A;  3QHY A;  3T4J A;  4K0X A;  3ZYT A;  5EOE A;  3C7V A;  3B3X A;  3CPT B;  3KO6 A;  4WBG A;  4P87 A;  3IX4 A;  1JTD A;  3M6B A;  4A5R A;  4CQH A;  2VV8 A;  3BEC A;  4R6L A;  3ISG A;  2ZD8 A;  4LRY C;  4ZJ2 A;  5FDH A;  4GD8 A;  5HDS A;  4BD0 A;  3NOP C;  1T19 A;  2JC7 A;  1KGF A;  2PT7 A;  2H0Y A;  3KSG A;  3R7W B;  2O9C A;  4Y7P A;  1KDW A;  3VOY A;  1PIO A;  2HPB A;  1F5M A;  3C8C A;  3M6H A;  2V1A A;  4XUX A;  5FAP A;  1YSQ A;  2OLV A;  1FCN A;  4KZ4 A;  5CGX A;  1XJ6 A;  2VGJ A;  4HES A;  2PYR A;  4S2K A;  3IF6 B;  4R38 A;  4WM9 A;  5HDD A;  4N92 A;  4BD1 A;  4MBH A;  3IF6 C;  5G4Y A;  1C3B A;  3LR5 A;  5DFY A;  3R4K A;  5DF7 A;  3UDI A;  2D02 A;  5GHY A;  3BJN A;  1NY0 A; 
#chains in the Genus database with same CATH homology
 3NEC A;  1SZV A;  4X1L A;  1J3W A;  1D1J A;  5EVE A;  3CHW P;  5FDS A;  3T12 B;  2PAV P;  1CJF A;  4FTX A;  2ZL1 A;  3T1R A;  3T1Q B;  1FIL A;  4D60 A;  1VET A;  1VEU B;  3L9K A;  1SKO A;  1PNE A;  2ACG A;  1A0K A;  3L7H A;  4X25 A;  3T1X A;  1SKO B;  3LEQ A;  1PRQ A;  3NUL A;  3DAV A;  1CF0 A;  1VET B;  4X1M A;  5FEF A;  3U4L P;  3MSH A;  4FUW A;  1G5U A;  1ACF A;  2PRF A;  2ZL1 B;  5EM1 A;  1VEU A;  1F2K A;  2V8C A;  3MS6 A;  1Y4O A;  3CPT B;  3D9Y A;  2PBD P;  2HZ5 A;  2JKF A;  4ESP A;  1YPR A;  1Z09 A;  3T1S A;  3CPT A;  1HLU P;  2V8F A;  2E8J A;  5FEG A;  3LGO A;  2JKG A;  4QWO A;  2VK3 A;  2B95 A;  1FIK A;  3UB5 P;  2BTF P;  5EV0 A;  1CQA A;  3KYE A;  1PFL A;  1K0K A;  1AWI A;  5EM0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...