2EWWA

Crystal structure of the pilus retraction motor pilt and bound atp
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
350
structure length
343
Chain Sequence
ELKILEIIKEAIELGASDIHLTAGAPPAVRIDGYIKFLKDFPRLTPEDTQKLAYSVMSEKHRQKLEENGQVDFSFGVRGVGRFRANVFYQRGSVAAALRSLPAEIPEFKKLGLPDKVLELCHRKMGLILVTGPTGSGKSTTIASMIDYINQTKSYHIITIEDPIEYVFKHKKSIVNQREVGEDTKSFADALRAALREDPDVIFVGEMRDLETVETALRAAETGHLVFGTLHTNTAIDTIHRIVDIFPLNQQEQVRIVLSFILQGIISQRLLPKIGGGRVLAYELLIPNTAIRNLIRENKLQQVYSLMQMQTMNQTLYKLYKQGLITLEDAMEASPDPKELERM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the pilus retraction motor PilT suggest large domain movements and subunit cooperation drive motility.
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Protein transport
molecule keywords twitching motility protein PilT
total genus 84
structure length 343
sequence length 350
ec nomenclature
pdb deposition date 2005-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00437 T2SSE Type II/IV secretion system protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.90 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2ewwA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2ewwA02
2RGDA 3D8BA 5CDFA 1WA5A 1XEFA 4CEIB 5F98A 3BS4A 1HYQA 4QNRA 2DFKB 1DTSA 2SHKA 1DADA 2QY9A 1JNYA 4M1YA 4YMSA 4HUQA 1S3GA 2FFQA 2WWGA 3ND8A 5JSZB 2OV2A 4HUTA 2B92A 4O25A 3KQUA 2YVUA 3O8CA 3TH5A 1GWNA 5EQTA 3MWLA 1D9XA 3SJAA 2ZRDA 3WYAA 2ZVPX 4QKQA 2ZAOA 5HKKD 1OKKD 1OHHA 1Z0FA 5FL7A 3ZIAD 2XZLA 3TUJC 2ZJAA 2IWRA 2IYVA 1Z0JA 4A0GA 4KBGA 4GNKA 4CF7A 5FOSA 3CRW1 1F60A 1KJZA 4ERNA 1Z0KA 2PX3A 2QUZA 4D81A 3CPEA 3DPUA 4BUJA 4D6PA 4KO8A 1Y63A 2HCJB 3OF5A 2VHUA 1W46A 4M1SA 5J4VA 5FUYA 4GOXA 1ZM4A 1Z2CA 2OCBA 1CXZA 5C2JB 3BAFA 4KVGA 5FTMA 5BW8A 4LOAA 2JAQA 4KYUA 5IK2A 1U8AA 2DR3A 1D8TA 2JJ2A 4PPFA 1E9FA 1ZW6A 5KNBA 4KLZA 4CVNA 2EFEB 3VR1A 1PV4A 3N70A 2H57A 2WJJA 1LF5A 4NCHA 3K70C 4GOKA 1XJCA 3TE6A 2BM0A 221PA 4W9MC 4DCSA 4C0SA 4BZQA 4E09A 4V0NA 2ZJ5A 5KNDA 1KI1A 2E1RA 1N6RA 4Q4HB 2ZE5A 3VKGA 4B73A 5B64A 1XFAA 1XB2A 1MH1A 3HR7A 3A1TA 4EQ6A 3EPLA 4BWYA 4BZXA 2CLDX 3BB1A 4R2HA 1SVWA 2W6JA 2JLWA 3RC8A 4BFUA 4ZDIA 3Q5DA 4NCKA 5L3RA 1AGPA 3UPUA 3A36A 1XDBA 1NVVR 2PX0A 1P2TA 4V0OA 3AEZA 4ZIRA 3R9IA 5G41A 2WICA 4JLOA 1HUQA 4LBZA 1U98A 3A6PC 3HPQA 2ZRIA 1X8LA 3QKTA 3BB3A 3HR8A 1R0ZA 2QMUA 3Q85A 1Z6XA 1ZU4A 3VKWA 1G8GA 2Z4RA 3BWDD 3DHWC 4NTZA 5KPDA 2ZROA 2ZE8A 5L3SB 4IVRA 3UMSA 3QSYA 5H8WA 4KBFA 3BE4A 4GBMA 3MCAA 2GA8A 1ZNYA 4EQ6B 2WAYA 1D9ZA 1U0LA 1OJLA 3KFXA 1JI0A 5BXQC 2BBTA 5JI3E 821PA 3MWKA 1COWA 3TUIC 2IYXA 3KZ1E 2D2FA 4QBFA 1CEEA 1JR3A 1W47A 2J9RA 5B2ZA 1XWIA 4DDTA 1D2NA 1KDPA 4DDUA 5JECA 1UDXA 3VR4A 4Q7JB 4BASA 1RZ3A 2QE7A 1BMFD 2R6FA 5DGXA 4A6PA 4AK9A 4YONB 3GPLA 5EP3A 3AB3A 1S1MA 2DWQA 1NY5A 1PUIA 4FMDB 4LHXA 1TUEA 2WOJA 5K8IA 1Z6YA 1RC8A 3TAHA 1KO1A 3FFAA 3THWA 4KITB 2BVNA 1YR6A 2GEDA 3SJZA 3I72A 3W3AA 2VSOA 4L9SA 1VCIA 4IEIA 4ABYA 4PQRA 2R65A 3CO5A 4OQMA 1UBCA 2WTUA 2CJWB 1EESA 3CH4B 1CF4A 1ZUIA 2ATVA 1E0KA 2I4IA 4HZIA 4WXPA 3RRMA 2REBA 2X2EA 2FH5B 1YKSA 2P65A 3UATA 2V6IA 1OH8A 3AF3A 2VP9A 1KMHB 2C98A 3NC0C 4QBIA 2V4ZA 4KSCA 3VQTA 2R8RA 4EJSC 4Q7LA 5C4MA 2XGJA 3IGFA 3IBGA 1CU1A 3OESA 1QZXA 2G77B 1XCGB 2V7QD 3ASZA 2KWIA 5DI3A 2OXCA 1HA3A 1CP2A 4LV6A 4U00A 5FUVA 2Q3FA 4QGFA 3LFUA 4XWAA 3HDTA 4OKSA 3W9YA 2CCKA 1UEIA 2AK2A 5CK4A 1US8A 2A9KA 2CK3D 4Y0VA 2ZRKA 4M2LA 4X8MA 3X2SA 2AXNA 3D3QA 4IJMA 4C0KA 1KKLA 5FUXA 2IL1A 2ZJYA 5AUPB 5B57C 4M0LA 5B30A 1JR3E 4EJSB 1FW6A 4Q9IA 4TL8A 1ZD9A 4IDQA 4Z1MA 1YVDA 1FPMA 1GUAA 5D3MA 5JZVA 2AXPA 2PL3A 3LAWA 5EP2A 3WNCA 3RC3A 3AVQA 1WF3A 4PAOA 4UNQA 1JALA 3QXCA 5EE1A 2EFGA 2JLXA 2OM2A 4US2R 3GEEA 2PZFA 2XOKA 4HLUA 1ODFA 1COWD 1WMSA 2VEDA 2CLCX 2JIZD 1H8HA 2MSEB 4PANA 2ZR7A 2REXB 1X1SA 2ZSAA 5FBRB 4CRWB 3L2OB 1FL9A 1P72A 4TMKA 3BH7A 3QKSA 4QJ3A 3QUSA 1TMKA 4B3XA 2HJVA 3VX4A 4OK3A 2X77A 2NIPA 3EWSA 4WW0A 4LI0A 4OK6A 2DB3A 4ZV4A 2PJRA 3X1XA 1VDZA 4JT2A 1FOEB 4FMDF 2OAQ1 5AJYA 2DY1A 3IEUA 1GL7A 1XMJA 4M21A 1P2VA 421PA 4M1MA 3R9WA 4LHYA 2ORWA 2B8WA 1J2JA 4ZCIA 4ZIRB 3SOPA 5BWMA 5C18A 2IS1A 4B6EA 3QPUA 3REFA 2Z0MA 5AJWA 4Q7MB 2H16A 3M1IA 2BOVA 2NO1A 1Q1EA 1GM5A 1G7CA 1E69A 1ZC3A 2OUKA 4C2TA 2HT1A 2Q21A 3Q3JB 2V1UA 1RKBA 4BEBA 3PENA 1IHUA 1KY2A 3ZH9B 2J7PA 4TLDA 3O47A 2FFAA 1L4UA 4RD1A 1EX7A 2FV8A 1U0HC 1U8YA 2JDIA 3P26A 1R5BA 721PA 2A7QA 4JVLA 4ZDWA 5JWOA 3B1ZA 2WJHA 2GJAA 4NCNA 4ZDKA 4DIEA 1CJUC 2AKAB 4HAXA 4Z8XA 2OBMA 2NO7A 3GJ0A 3EPKA 3OEHA 4R7ZA 2GCNA 3B1WA 2IX3A 3WRXC 1J90A 1YZGA 2I1QA 4DCVA 1IY2A 4QRHA 3AVPA 2Y8EA 5CDFE 3TSWA 1P3JA 3U7FB 3ZD7A 1SXJB 1FMLA 2CE2X 2BV3A 3EIEA 5FPHA 1GITA 1N6OA 4NU0A 4RD6A 1W5TA 4LJ7A 2XSZD 3GLHB 4JLPA 1XX6A 2VF7A 2BKUA 3P27A 3AM1A 1N6HA 1EFHA 1F2UB 2IHBA 3PEUA 3PG5A 3GJ6A 2QTHA 2ORIA 5DYGA 2G6BA 3U3JA 1E9CA 2VLIA 2IHYA 1W36B 5EZ5A 4IKEA 1Q57A 4LYFA 1W4CA 5DHFA 1UBEA 4XD7D 1DG3A 1VYUA 5EP4A 3U7GA 3CH5A 4TYYA 1ZNWA 1UPTA 2A3RA 1G20E 1OYYA 3ND9A 2G9NA 4NCJA 3V9PA 1H8HD 3T5GA 1OYWA 2GJKA 4D4KA 4OQNA 1TAGA 3NHBA 2F55A 4D80A 1OH6A 1KZ7B 4P4SA 4ZDJA 3OE7D 4C7OB 4JYCA 4HAZA 1AZTA 1TL7C 2V9PA 1TX4B 4D2IA 1RYHA 1IM2A 2WKRA 1Z07A 1OH7A 2UZIR 2WWHA 5LBIA 4B44A 5AUQA 3NBYC 621PA 3DMNA 1TEVA 5P21A 4JJZA 1Z08A 1FQJA 3G82C 1L2TA 2WPDD 1P4SA 3HYRA 1TNDA 4I81A 3ASYA 5E3HA 4GRAA 2N46A 3GLHE 5J47A 2ODNA 4DIDA 3AUXA 1JJVA 4NP6A 2QM7A 4DEXA 1G18A 3N2IA 2ZRNA 1HT1E 4BRWA 4DHEA 4LJAA 2RHDA 3FYHA 3Q9LA 4IEEA 1P75A 1FP6A 1ONBA 3K70D 2QSZA 5L3VA 4CEHB 4HLCA 5JWHA 2XAUA 3B9QA 1GZSA 2WJIA 4Q21A 3BERA 3GLFA 1R8QA 2G0TA 3GD7A 4MGZR 4DT1A 2AKYA 2V1XA 2ONJA 4TSFD 1GFIA 2FPLA 3H86A 3MAAC 4ZO4A 3CZQA 4KV9A 3DM5A 3W3ZB 1Z63A 1US8B 4M9ZA 2BCGY 2BDTA 5FOXA 1LTQA 3SZRA 1BH2A 3LV8A 4HYYA 1UFQA 2JJ1A 3LQQA 1RE0A 3PR1A 2W2VA 2KJQA 2CLSA 1MABA 3SQWA 3RDPA 3A1UA 3I92A 1ZC4A 1X3SA 1XP8A 2OFWA 2VP5A 2VO1A 4B3CA 4KYIB 3MRSA 5CK5A 3E2IA 4P32A 2J0VA 1U9IC 2QAGB 3T12A 4Q4LA 3T06B 1JXMA 2YINC 4C30A 5JCPA 2ZR9A 2J5XA 2AL7A 3E1SA 1G5RA 4RFSB 4YDHB 1M74A 4WVFA 1DG1G 3QOFA 4DSUA 5DN6D 2JIZA 3HWSA 2A30A 2OG2A 2O0HA 2VSXA 3EZFA 4D0LB 3WBJA 5KSOA 2KSQA 3MUFA 5EJEA 3BFXA 2WZQA 1LVGA 2ZSEA 1KZGB 4C0AC 4DLZA 1BYUA 1T8TA 4R71A 1NN1A 3RHFA 4FCVA 3GLGA 1VCMA 1FFHA 4EPVA 1S4QA 2ZQ5A 5FTKA 3NEYA 1T3HA 1G8HA 2ZYUX 3Q5EA 5JS8A 1KYIA 2REOA 4OK5A 3WY9A 3X1ZA 3DOFA 2Q3HA 2R2AA 2O8EB 4RZXA 4XTRA 4Y0AA 1YU9A 3V00A 5F9HA 4EFMA 2F1IA 1EWQA 5FOWA 3IQWA 4M9QA 1VHTA 4RD0A 1X1RA 3QI2A 4KCGA 4RSGA 4U02A 5E7IA 4PSVA 3PQCA 3SDZA 3Q8XB 4NBSA 4PSKA 4DLRA 2QL6A 2VTKA 4C3ZA 5CM8B 1N5LA 3JZAA 1DO2A 3CNNA 1Z0AA 1G291 4OHVA 4IVPA 1JPJA 4ESVA 3L0SA 4R9UC 3NHAA 3IPYA 5DI9A 2CCGA 2OSBA 3T1OA 3EC1A 1HE1C 2NTYC 3L43A 2PT7A 3KB2A 2ZRPA 4YMUA 3TRFA 3BBPA 2IF0A 3WXMA 2ZYVX 4GP6A 4OI0A 1KI8A 4Q1FA 3AKEA 4AY2A 2B7BA 2PZGA 2GZAA 2RKOA 2OFXA 3WP1B 5LDDC 4PC7A 4JSYA 3WMGA 2IYRA 5DH9A 4QGAA 1NMZA 1NVVQ 4NHOA 4UXIA 2IUTA 3I61A 3AQ4A 2ZR0A 3KTAA 3QKRB 1BOFA 3TLXA 3FMFA 2XZOA 3CW2A 1GP2A 2RB4A 2VP0A 1M1YE 3MJHA 1FNNA 1Z22A 1R5OA 1BS1A 1K5DA 2GXUA 3L0OA 4DRZA 2VF8A 3P4XA 2A5YB 1E1RA 1DAIA 1H8EA 2F1JA 3DOEA 1BO6A 3ZZTA 2VP4A 1OB5A 4TL9A 2QPTA 2ZRBA 3SBDA 1Z29A 3QF4B 4MRRA 3VNVA 5M04A 1K5GA 3IKJA 4MRPA 1KNQA 4RD3A 3SN6A 3DMDA 1XPOA 3PITA 1CTQA 1KSFX 1YR9A 2AD1A 4BEJA 1DVRA 5JFGA 4RKFA 2IS6A 1NL3A 2FEOA 2OT3B 4YMWA 1XPUA 2QN6A 3A1SA 2D62A 4LHVA 2OFOA 1T91A 4AKIA 1EFRA 1Z47A 3CF2A 2OBLA 1IN7A 3TR0A 1HV8A 2H7VA 3B82A 4LJ9A 2GRJA 4NH0A 3P32A 3CKLA 1AKEA 4JZKA 4CZ2A 5C46F 3LH5A 2B8TA 2XNDD 5F2EA 1G7TA 1W2GA 5ELXA 1CR0A 4Q1BA 2RGGA 4DKXA 3I8SA 2BBSA 4MKIA 3ICEA 2HYIC 2BKEA 3OEED 4MYTA 3U7HB 2R6DA 3CONA 2F1RA 1KAOA 2FFBA 5SZJA 1IN4A 1NJGA 4ZI3A 4PQYA 1MKYA 2H92A 3I5XA 1JQLB 1AKYA 3IUYA 4LC0A 4A0HA 3WHLA 3RVBA 1TF5A 2A2ZA 3RWMB 4LJ8A 3I73A 3B85A 4LJ6A 3UWOA 1OXVA 2O8BB 1J8YF 3KUCA 1T4GA 2XB4A 1GTVA 3M6AA 3ADKA 4IW3B 1AQUA 2CHQA 1E2DA 3I3SR 2CNWD 3MJRA 2MMCA 3FKSD 2FNAA 4HSEA 3QG5A 1G4AE 2OHFA 4QFMA 1G8FA 2O8DB 4CEIA 4AI6A 2RMKA 1ETUA 4PSAA 4MKHA 2GF0A 3RWOA 1UJ2A 2YJTD 1AS3A 1P60A 4RCYA 1ZMXA 1RPZA 4IXNA 2H1LA 3NVAA 2DFLA 2ATXA 1W44A 4TMXA 5AWFC 3VTKA 1L8QA 3NH9A 4TQ9A 2C04A 2UVQA 3RYTC 1E3MA 4MH0R 2X19A 2BEJA 1J7KA 2JASA 1P2UA 1G8YA 2YWFA 5DISB 4UNNA 2VHCA 4G5RA 2EFDB 1WQ1R 1NIJA 3W8NA 3HP1A 2CL7X 1S9DA 1ANKA 1VG8A 3KXIA 3ZQ6A 2AN9A 4DUGA 2D7DA 3TSZA 3C4JA 5BYJA 4C0HA 3SJBA 4LY6A 4E22A 2D2EA 3IDQA 4PO8A 4D0NA 3EW9A 3GMTA 2J46A 2YV5A 1G3QA 3L8YA 4RVCA 1ZP6A 4HLQB 4RD2A 4MUBA 1JECA 1OW3B 3U7EB 3TVTA 4A4DA 2YWGA 4Q9JA 5BQ5A 1XEWX 1NNEA 5JJLA 4N0DA 1TQDA 1E0AA 4N0EA 2ZYTX 1SULA 3K0FB 3GP8A 2V6JA 2O5VA 1Z0IA 4Q4JB 4B33A 1DAMA 2F3RA 2D06A 1XXHB 2WJVA 3QXXA 5DIFA 2W2XA 4GSYA 3ZS8A 1TQ2A 4K8OA 1UBFA 1KI2A 1Z0DA 2F1HA 4TL7A 1DARA 2FMXA 4BFSA 4YDSA 2EVWX 1YJ5A 1R2QA 1OXXK 3CR8A 1C4OA 5EP1A 4HAWA 3IBYA 1UBGA 2VP6A 4EIWA 2ZRLA 2FG5A 2FWRA 4PPGA 1QHNA 2CMKA 4G01B 4PC3A 5KTYA 3VNUA 1P9RA 1E2QA 3K53A 4JLJA 3CRQA 2DFNA 4NL4H 3PUVA 2OLJA 3D31A 2J0SA 3QEOA 4PQFA 3PEWA 2ASEA 5BN3A 5SZHB 5BN4A 4C2UA 3HYTA 3AVTA 2AFHE 3MLEA 5LB4A 3AP2A 2PZEA 2C99A 4GMDA 1QRAA 1RJ9B 2OESA 1EX6A 1XZQA 2VHQA 1EFCA 3RLFA 4A2QA 4OI4A 4DSOA 1S3SA 3ZVRA 3LD9A 5FPTA 4MUAA 4QXAA 1ZCAA 3OE7A 4FCTA 3VHXA 4B3FX 5CLQA 1P9WA 1RRFA 2VIIA 2GAAA 1D2EA 4OJKA 3AVXA 3I8XA 1KO5A 2E9SA 5JJKA 4CDGA 1UF9A 4AYWA 1IXZA 3R7WA 3RS4A 3U61B 2WKPA 3RS0A 1CJKC 2QM8A 3LQRA 1NLYA 3WNBA 5KDDA 3PUWA 2BJVA 2GEUA 2CE7A 4RFVA 4V02A 5CIWA 4PFSA 4GP7A 2DWPA 1NVUQ 1ZIPA 4ZKDA 1MRNA 2IYWA 5G3ZA 4EPTA 2MMGA 1NBMD 2R44A 2V54A 5J40A 3X1DA 1DEKA 5HCIA 3QEJA 1OFHA 2H17A 4IDHA 4B3GA 5GVRA 4QL3A 3TAUA 2XB2A 3HU1A 4M1OA 2ODBA 1XTQA 4KFSA 1LB1B 1KDRA 2BMFA 1OF1A 3LBHA 3QIAA 5GADl 4KXFB 3U2QA 3FB4A 1NLFA 2O8BA 3LWNA 3CRVA 3TW4A 4HLDA 4HATA 2BMJA 2ZUBA 2JDID 4OHYA 2FSIA 2AHOA 2P2LA 1KY3A 2YWHA 3DVLA 4G5QA 1NBME 2NO6A 3W34A 1KMHA 1V5WA 1FTSA 3RAPR 1CRPA 1G8PA 4OQLA 2J87A 4RD4A 2PMDA 1PJRA 5KHOC 2YHSA 3QXSA 3Q7QA 5CB6A 3GLFB 3K0AA 1EWRA 3T35A 4EPYA 2XEXA 4JBXA 2O0JA 3CUEF 2VSFA 4DXAA 5F9FA 2H18A 2JEOA 2IWHA 3AVVA 4WZAE 4JBWA 2LKDA 4RCZA 3OHMA 5FUWA 1E1QD 2HJGA 1PLLA 3KQKA 1ZU5A 4I1SA 2GETA 3NBZC 5KDOA 1Q21A 3WMFA 1M7HA 4GFDA 2HUPA 2OCYC 3PXGA 1G3RA 2ZU6A 4PZYA 5FOTA 4XH9B 5JEDA 1N3BA 4G1UC 4G5SA 3DEFA 4XVUA 2JCSA 2J1LA 2P6UA 4IVQA 2NO9A 3GFPA 2GBLC 4NYIQ 3NWJA 3R8CA 4EFLA 1YRBA 2XNSA 2BMDA 3DM9B 3SNHA 5EUMA 1PVOA 3CLVA 5L3QA 1CJMA 2D3WA 1OXSC 1O3YA 1Z5ZA 1TU4A 2AR7A 3S1AA 2FJUA 1YZUA 2XTMA 2CDNA 4B48A 1JBKA 1MR3F 2OCAA 4P4SB 1HTWA 4EFNA 2JLYA 2IBMA 4POAA 3P1JA 4IHQA 2UZ3A 3QKRA 4JVMA 3THYB 1NP6A 1Y3AA 2ODWA 5KNCA 2CVFA 1PUJA 1Z6TA 4I1OA 4P4UA 4A8JC 2IXEA 2GILA 3C5HA 1N6PA 4LUCA 4OI1A 5DNYB 1N0VC 1GOTA 4LSGA 2GCPA 1TUIA 3C5CA 2G1KA 4AURA 3IO5A 1NN5A 1X86B 1X8JA 1QBKC 2WPDA 3QJYA 4E5UA 1TF7A 1G16A 2WIBA 3ZDQA 1NLZA 3GJ7A 1OIVA 2ZI3A 3GQBA 5G3YA 3TGPA 8OHMA 4FW9A 3LW7A 1QHIA 3LVRE 3BC1A 1F2TB 4PHHA 2W83A 4X8LA 3U3KA 3EZ9A 1SXJA 1OH5A 3GJ4A 2ZM5A 1TTTA 3OAAA 3KKMA 3RSOA 3TKLA 3GLIB 1QHHB 1WDTA 4KODA 4DUGD 3ZVNA 3TSOA 4D4MA 4GDFA 3BGWA 4GZMA 4TL6A 4TT3A 1W36C 3IEVA 1KMQA 4MITA 1EG7A 2YOGA 2FSFA 1QVRA 5GJCA 3R7WB 2ZRFA 1SVLA 3P20A 1OB2A 2ZI7A 3FE2A 4JBYA 4DLVA 2ERXA 4TLCA 3KXKA 3KJEA 4A8JB 1QHGA 4LHZA 1RRCA 2W00A 4KFTA 3GLGB 1T5LA 2X2FA 4P3YA 4NMMA 4Q03A 2RGEA 4LJ4A 3AGQA 5LPNA 2N1BA 2OEPA 3BRWD 3CWQA 4LBVA 1KSJA 1M6NA 1B23P 1AK2A 1EGAA 4YLGA 4AG6A 3ZZ0A 3OIWA 4XVRA 1SKYE 3QPWA 5KOYA 1U81A 4DJTA 2JLQA 2ZANA 1XTJA 4WOPA 4H1UA 2RGXA 3WP0A 4WA7A 2GK6A 2Z83A 4KSBA 2ZRMA 3V4FA 1XRJA 2DWOA 3X1YA 3A4MA 1I4TD 1KJYA 2HT6A 4DLSA 4HLUC 1G1MA 1HQYE 3JVUA 1J70A 1GKIA 3CB4A 2IYYA 3WNDA 4DB2A 2ANBA 1XU4A 3W6OA 2O8CB 2QRNA 3O8BA 5IHPA 1ZUHA 2GKSA 2FE4A 4XIGS 1WBBA 3K70B 1S2MA 2J0QA 3M4YA 1MABB 1XEXA 4IOLA 1HH4A 5FTJA 2DCUA 2A5DA 2WVJA 2JJ8A 1OFUX 2RH5A 4B2LA 2OAP1 1II0A 2P6NA 4OI2A 4Q66C 5EZ6B 3LBIA 3DKPA 5DSZA 1VECA 3RRZA 3WBKA 1AGRA 5AUNB 1KO4A 3CRRA 1FZQA 4BFTA 2CBZA 1CKEA 3C8UA 5JWRA 5K8LA 3CRMA 3FHCB 4FMCB 4A15A 1E94E 1W0KD 3T1TA 2XZPA 1KNXA 1E9DA 2XX3A 4LRWA 4FIDA 1EFRD 2PEZA 3QVUA 2QTFA 3QPVA 3WHKA 3ADBA 4GMXA 2YNMA 1ZD8A 2Q9BA 3H84A 4JL5A 3PCRB 3B5JA 1IXSB 4F38A 2AWOA 2OE2A 1ZINA 4V0KA 3NXSA 3SE0A 3IHLA 2BM1A 4HDCA 1A82A 1LV7A 1II9A 2AD5A 4A9AA 4BFXA 3VKHA 2B6HA 2O8EA 5TY0A 1SQ5A 3H4MA 3IO3A 3D6TB 3SJCA 1Q1QA 2QU8A 3VHLB 2FU5C 3A4LA 3PIRA 4TLBA 4EJSA 2Z4SA 1GVNB 3THXA 4DEYA 2Q6TA 4AD8A 1VIAA 5JRJA 2W0SA 5HPYB 4ZCMA 1P7CA 2QI9C 3B60A 5JMTA 5DYIA 1NSFA 2R6AA 1G6HA 1HQCA 2PH1A 1YZQA 4FD2A 2F7SA 2O8DA 3UIEA 1KI4A 3TK1A 4MDEA 2GAOA 4NYMQ 3CX8A 1FMJA 2ZS8A 2C78A 5EE3A 1G5PA 4TZ6A 2ZRAA 1I4DD 3E5HA 4LWZA 5FOUA 2ZRHA 1IJFA 1G7SA 2GXSA 3UG6A 4UJ5A 1KIMA 4LC1A 2GXAA 2ZYWX 3EZ7A 5GJVC 2XTNA 1QVAA 4MQBA 521PA 3SYLA 3GJ3A 2ZXUA 4JMPA 1UKVY 2AX4A 2W58A 4IDNA 2WMOB 5CJPA 5FBWB 5H68A 3QF7A 3R8FA 2RGBA 1CRQA 3OFNA 2P3SA 4DCTA 3CNOA 1DS6A 1WE2A 2JJ2D 2NPFA 1E9RA 1E79D 4M4SA 1R10A 3CBQA 2IYUA 3B2EA 2R62A 4W5HA 5TMPA 1MO3A 4ZPXA 1ZCBA 4NKRA 3NC1C 4LDJA 1R0YA 3EXAA 4JLKA 4O2LA 2JATA 4OQXA 4TMTA 4O3MA 1DOAA 2WSSD 2ZETA 1CR2A 4LHWA 5GVSA 4XWKA 1XCMA 4J0QA 5J5CA 4CEJA 5JLJA 4E03A 2G0NA 5AJXA 1CULC 1YQTA 5SZIA 1UEJA 1A2BA 1SHKA 2ZUCA 4DLWA 4CEHA 2BHRA 5KU1A 1C9KA 2DFTA 1U9IA 4JS0A 4UXJA 3VR3A 4AC9A 2CEAA 4LGMA 4PO9A 5EUQB 2JLSA 4Q01A 4UKDA 4DDVA 1Q20A 3EZ6A 4BZPA 2NMVA 2FPKA 4XD7A 1D5CA 4TLAA 3ZVMA 4M9XA 5CLLA 3UWKA 1QG2A 1VCOA 1NJFA 1X8KA 1ESNA 4GZLA 4XJXA 4CYMA 3PUZA 1OV4A 2GVDC 4Q47A 4C4PA 2ZE7A 1P62B 2XJ9A 3VU9B 5KSPA 4H1VA 1MOZA 4Q4AA 1KK2A 1W48A 3CF6R 2QBYB 4GOJA 3X1WA 1E2LA 4DLUA 2IA5A 2O0KA 3I4LA 1E2JA 4BFZA 1IONA 1G64A 2WMNB 2DPXA 4DLTA 2W6ID 2NZJA 4AYXA 5B58C 1CR1A 4KJZA 4NE2A 2RGAA 1ZUNB 4N1AA 1SGWA 1OIXA 3QVVA 3VMFA 4PC1A 4ASUD 4A92A 1KKMA 1JAIA 3EZ2A 3UXMA 2GNOA 1RRGA 3K9HA 4V0ME 3VR6A 1DO0A 4TTQA 3KQNA 1GDDA 1GL6A 3A1VA 4AG5A 4BGDA 3AF1A 1VTKA 4EPXA 1XEWY 2QP4A 2ZVQX 3S1AB 4US0R 3IIKA 4BLTA 1XTIA 4BFYA 5BN5A 3FHOA 3CM0A 4HDOB 1K6MA 3EIHA 4XVQA 5C4GB 4MKFA 3I32A 2J45A 3KFVA 4LYHA 1AQYA 4G5OA 1NMXA 3RNLA 1A1VA 4I99A 1SZPA 4PAMA 1IBRA 3AVYA 1E0SA 2C5LA 5IDVA 4D25A 3B78A 1E79A 1TADA 3CNLA 3LX8A 1P61B 3NG1A 1G17A 4LK2A 4FMCF 5KO2A 4M22A 1JPNA 3OFND 3N5CA 2PMKA 1IXRC 3U4QB 1G3MA 3DZ8A 2AWNA 3EA0A 2BBWA 1DPFA 2IEYA 4DCUA 2G88A 3PEVA 3CIOA 5DN6A 1E2FA 1FX0A 5D3QA 3HU2A 1KOFA 1N5JA 4QC2A 4URWR 4PHTA 4FCWA 2EFHB 4HAUA 4B74A 3KKQA 5TV2A 4TMVA 2RGNA 1E2GA 1I2DA 1AIPA 1SVSA 4P33A 1Z2AA 2A5GA 3KXLA 4UXHA 4C0QC 3I62A 2HXSA 4QBGB 1F48A 2FX3A 4NCIA 3T5DA 1S1CA 4Z8YA 4LV5B 4JSTA 1P5ZB 2WBLC 4Q9KA 3NBXX 2W2TA 5FBQB 1IOZA 1E6CA 1F5NA 5EXSA 1GNPA 4PR0A 2IYLD 4F4CA 5A4JA 4OBEA 2GBLA 3B1VA 2JJ1D 3B7GA 3O8RA 4HI0E 2OILA 1CBUA 4BFWA 3TR5A 1RVDA 1ZD1A 1AZSC 1ZNXA 3RS7A 1E2MA 2ZU0C 2ZIAA 4JLMA 5CYPA 3TW8B 1E9SA 1A2KC 1Q1ZA 3VAAA 2F9LA 4XSGA 1MRSA 1MV5A 3QBTA 3LA6A 3QNUA 4JYBA 1XTRA 2QEQA 1GL9B 3TIFA 2GZHA 3QKUA 4PC2A 4Z51A 1KO8A 4W5WA 3BFVA 1I4LD 2C03A 4PZZA 3VU9A 4WAUA 3ZVLA 3MGCA 2OBNA 1SVKA 3WYGA 1JR6A 4JKYA 4R98A 5DHAA 3OEEA 1N5IA 3R9XA 4C0BA 4X8OA 4C0JA 3LDAA 1D6JA 4URUR 3REGA 2ZSFA 3UK6A 1IY0A 1E2KA 3LXXA 3R20A 1DELA 3DZDA 4HB4A 2ZI5A 3LY5A 1XTSA 2CCJA 2ZSDA 5FL7D 1SVMA 4L4UA 4NZYA 1ZM9A 4KU4A 1VCNA 3KKPA 2VQSA 1R7RA 4KI0A 1V43A 1LS1A 5TARA 3NBFA 3NH6A 3KQHA 1T0JB 1A4RA 1GRQA 5DO9A 3U3RA 3KKNA 4W5JA 1Q0UA 1W2HA 4TYNA 3U6BA 2RAPA 5TB5A 3BH6A 3ZQJA 4GPTA 2A78A 4G5GA 2CVHA 1Z6AA 2MSDB 4TQUS 1E1RD 4AWXA 1H8ED 2X8AA 2AK3A 2DHRA 5FPSA 1XD9A 1W0JD 3C14C 5FL3A 1KHTA 4PZLA 4ZKEA 5JEEA 5JBQA 2IS2A 1XEXB 5AUOB 2EWVA 4EDHA 3K8YA 1N6KA 1S8FA 3F8TA 4TQAA 1ZM7A 1HY3A 2VP2A 3EC2A 4Q18A 4MRSA 3VR2A 1CS4C 4YXWD 4ZCLA 2IUUA 4M1TA 1YR7A 3D7MA 4Q9HA 4C9BA 4CGZA 4PTLA 4A6XA 1WB9A 2DYKA 2NPIA 3BD9A 5KDLA 2QRZA 5F3WB 1KSHA 1E2NA 3ZS9A 4RKEA 4NDZA 3W6PA 1WCV1 3EARA 1Q3TA 3UMFA 1ZYUA 3F3YA 3FWYA 4Q9LA 4HZUB 4R2IA 2OCPA 3FPAA 5FR1A 3NTUA 4BLQA 3GJXC 2QAJA 4D0GA 1JAHA 4Z54A 3U5ZB 4P31A 1OFIA 1U90A 5AJVB 2WV9A 4Q1AA 4B3DA 4A82A 4TWZA 1BKDR 1O87A 4EPRA 2X1VA 1ZM2A 4B76A 1XMIA 5LD2C 4E07A 2EU8A 1UDWA 4LCBA 3K0CA 2QAGC 4B75A 1E9AA 3H0KA 3EWAA 3MSXA 2YYZA 1BIFA 1VYVA 4FI3C 5BYKA 4DLXA 1W4RA 1FTNA 3KQLA 5J4HA 5C1BA 3THWB 5TDHA 3ECCA 3FKSA 4FWIB 3LRPA 3QBVA 1C1YA 4CEJB 2QMEA 2YOFA 3UANA 4B6FA 1OKKA 1OHHD 4OHWA 1IN8A 1KK0A 2ONKA 3L0PA 1DAHA 1QHYA 2EQBA 5A0FA 3K0EA 3W5IA 1F2TA 1EFUA 2QG6A 1VYTA 3AH8A 2R6GA 5H1YA 5SZKB 5KPJA 3U6KA 1CLUA 1Q12A 3N2EA 2ZREA 1NY6A 1XD2A 4NYJQ 4OJQA 4CIDA 5AR1A 5G40A 2ZJZA 5JI2E 3ZIAA 1MO4A 3AKYA 4JIMA 5K8TA 2CHVA 1B0UA 1E4VA 3FHTA 2IXGA 2IYTA 3DO6A 2ODEA 3LLMA 4Q1DA 2GJSA 2RCNA 2C9OA 5IF9A 2BBOA 3AGPA 4NPHA 2C9YA 3K0CC 3TMKA 4DSTA 3BB4A 4TT3D 5CIQA 2QP3A 2GEVA 1R4AA 1Z83A 1ZIOA 4O2RA 1NVWQ 1G7RA 4F92B 3A1WA 4US1R 4MGKR 3AF4A 4MDFA 3CX6A 1FUUA 2KB0A 1YZKA 4A1FA 1YRAA 1YZNA 5AJZA 3PEYA 1TQ4A 2C8VA 1YR8A 4FXPA 4DC9A 3BORA 2IXFA 1IN5A 2Q9CA 1ZJ6A 3KKOA 4B32A 1RYFA 1KDTA 1XBTA 3FDIA 1FP7A 5HTKA 1E0JA 3FTQA 3L0IB 4TTPA 2QA5A 5CYOA 2VL7A 4TSFA 4PHFA 4TYWA 1T5IA 2V7QA 4GT1A 1JB1A 2FSGA 1N6IA 2ZI6A 3ZLJA 1N5KA 1QG4A 1SKQA 3W5JA 2QNRA 2ANCA 2Z43A 3TJZA 1XCPA 2ZPTX 3QG1A 1W0JA 3GFTA 1CIPA 1RRPA 2VBCA 3ETLA 1NSTA 3NDPA 2IYZA 1GSIA 1NG9A 2J41A 1E32A 2IUSA 3QQ5A 4YXWA 2V8OA 3BK7A 3EPJA 3LXRA 2V55B 2VPPA 2QGNA 1QHHA 3KL4A 2BIFA 4UJ3A 4A2PA 1MO5A 1GAJA 2HV8A 3QXJA 5FI1B 4IFBA 4DBLC 4YQFA 2J3EA 1YE8A 1K8RA 2W0MA 3SC3A 3LX5A 1XJ0A 4RZUA 3HJNA 1VG1A 4OYHA 2OZEA 4TMWA 2WM9B 3AVOA 4RY2A 3KX2A 4ESHA 4JKIA 3SYKA 4EKDA 3SHFA 1M8PA 2QE7D 1PLJA 3MG9A 4ARZA 3EG5A 3L8ZA 3CPJB 1OFTA 2WHXA 4I1VA 4JLAA 4LYAA 4YMVA 2WSSA 1GNQA 2VA8A 1G3IA 4MGYR 1F6BA 2GK7A 3IQXA 3LBNA 5J4LA 2D4HA 2GESA 4HAYA 2ZRJA 5GJBA 1W5SA 3KJHA 3U44A 4TYQA 4Q1EA 4IRUB 1E2HA 2ZEJA 1NKTA 3BOSA 4LPKA 5DE3A 1U0JA 3THYA 4HUQB 2VH5R 3VX3A 2G3YA 3ZYCA 5CJ2A 5EXTA 4AIIA 3ZGXA 3FMPB 3ADDA 5KSZA 5J4KA 4X8HA 1YZLA 1DAEA 1HEIA 3RRNA 1N6NA 3AKDA 3WRYC 3K09C 2A5FA 1SXJE 3K1JA 4B2IA 1GNRA 3T34A 3C16C 3UMRA 4BLRA 1LNZA 2PCLA 2YC2C 1II8A 4LZZA 2Q9AA 2ORVA 1QDEA 2O52A 4UQOA 1NN0A 1RJ9A 1XMVA 2WSMA 5JRZA 4S35A 3AP1A 1R6BX 4ZI2A 4OL0A 2CL0X 2VHTA 1KGDA 2O8FA 4F4JA 2JLVA 3V4RA 5D3MB 4CT5A 4BQSA 3GLIA 1M7BA 4Z1MD 1SXJD 1UAAA 5EE0A 1J99A 1ZBDA 1QHSA 4TN1A 1OXTA 2F43A 4IDPA 2KE5A 5DLQC 1A5TA 4WZ6A 1NMYA 4JT4A 5EE9A 4B34A 1S0UA 3LVQE 2VHJA 1RW4A 4U7DA 5AK0A 2FF7A 4PAQA 1DAFA 2BWJA 2QTVB 3ICQB 3MFYA 2PT5A 1NKSA 2CK3A 4ILEA 3LLUA 1KSGA 4KLNA 3K9LA 5KYKA 2ZJBA 2ZJ2A 3K0SA 1GKUB 3ZZUA 3NIBA 4OHXA 2XOKD 4LYJA 3AVUA 3I5YA 4IFEA 3HU3A 3U60B 5FBVB 2EYQA 4LX0A 1N2CE 3W6NA 2F43B 3L82B 2HYDA 5FOVA 4B47A 2YKGA 4V03A 4Q4HA 1G4UR 1RIFA 1NBMA 5L3QB 1NVXQ 1UKYA 4MYHA 2WKQA 3PUYA 4KAXA 5EXXA 2JGNA 2Q0HA 4MYCA 2CXXA 3SBEA 4KVAA 3OEHD 3CWZA 3B1YA 2CJWA 4P4TA 5FTLA 3U3OA 5IT5A 4H9GA 4URVR 3MD0A 5LB2A 1XNJA 1XF9A 4WXRA 2G83A 2GVZC 2V3CC 4TZ0A 3U4QA 4AYTA 2QORA 1XTKA 3NKVA 4P0TA 3B6EA 2FGJA 3VR5A 2WWIA 2WIAA 3GCGA 2A5JA 2RHMA 3GEHA 1R0XA 4PXAA 1T3SA 1R8SA 1NI3A 2PLRA 4QM6A 2GCOB 3FFBA 3AUYA 3TQCA 2NOAA 3IHWA 1ZRHA 2WJYA 3PFIA 4JLDA 2VRWA 1UM8A 4NONA 4QHYA 2CNWA 1OIWA 1OT3A 2F3TA 4M8NE 1W1WA 2JLUA 3RS5A 1W36D 5CITA 3MWYW 4RFSA 1WBDA 4K46A 4UNSA 1E99A 4JVSB 4Q19A 4WIAA 2LWIA 5TXGA 2XXAA 5IRCD 3GLIE 2P6RA 1U94A 3RS3A 3WYFA 1G41A 1JQJC 3FKQA 4FWTA 1X6VA 2XTZA 4AKEA 3MWJA 3WMEA 1F2UA 1LS6A 2I1VB 1VG0B 1XXHA 5JS7A 1ESMA 5LD2B 1G6OA 1XD2B 1RFLA 2IS4A 4Q1CA 1U2RA 3OAAD 4L16A 3SEAA 1GG2A 1KTVA 1Q44A 4DLYA 2FPMA 3NEJA 6Q21A 4MA4A 4DB4A 2HLDA 5J4YA 4TMZA 2H8KA 4D26A 3CF0A 3KJIA 3W8RA 4F7WA 3SHWA 5KUTA 3GFOA 1KAGA 4Q4AB 3T61A 2ECKA 1P2SA 1E2EA 1DAKA 5HE8A 121PA 4NYIR 2IW3A 2N42A 1OLOA 1CJVC 1S96A 2XSZA 3TBKA 4BLSA 3MMPA 3THXB 1NIPA 2EYUA 1XMSA 4JLBA 3UG7A 4BPBA 3QF4A 2HF9A 5HE9A 1XPRA 3JZMA 1JEDA 4MKGA 5FFMA 3SU8A 3SFZA 3NDBB 1ZVQA 1AA9A 3SQXA 3B8HA 4XOIA 2F9MA 2Q3MA 2IEZA 2HEIA 2PJZA 5FBLB 3EX7C 2WWYA 4Q48A 2QMOA 2QT0A 2YOHA 2Z5FA 4Q5IA 5TVKA 1M34E 4BECA 2EWWA 4AKHA 3T1VA 2YC4C 2WOOA 1GRNA 3KB1A 2IK8A 2XITA 4L5BA 4YC7A 4B71A 1UKEA 4URXR 4EUNA 2GWHA 3KUDA 2FGKA 2GF9A 2NO0A 4HEJA 1MT0A 2BMEA 1OPXA 3K0AB 3THOA 2D7CA 3CX7A 1KI6B 3EASA 5FI0B 1TU3A 3FGNA 1LY1A 3I1FA 4PC6A 2GJ9A 3IIJA 4FN5A 4ITRC 1WXQA 3K09A 1Q3HA 1YHNA 2Z6VA 2WWXA 2OLKA 2EW1A 2WAXA 3FMIA 1SVOA 1XJQA 1Z6GA 1PZNA 2ZRCA 3K9NA 4BFVA 4CT4B 3CPHA 3LO5A 4JLVA 4NYMR 2K5UA 4PX9A 2IT1A 3Q7PA 1E96A 2TMKA 3GJ5A 5E95A 4Q02A 3A58B 4B2PA 5JCZA 1WP9A 1NRJB 1G21E 2GDJA 1TF2A 1I2MA 1ZAKA 4MRVA 2PCJA 2KBEA 1KK3A 2ZITA 3LNCA 4QOSA 4ACBA 3AVWA 1G5TA 4EAQA 1W4AA 4UNRA 2GJ8A 1ZNZA 3BIFA 4LJ5A 4GL2A 2J0UB 4L8GA 3EAQA 2UKDA 2QP9X 2BC9A 1IAQA 4KFUA 2XJ4A 4WZBE 4M1KA 1II8B 1W0KA 2OO7A 4S2EA 3BFKA 2NQ2C 2JLRA 2W6IA 3EA5A 1P9NA 1IN6A 2IYQA 4HB0A 2ZS7A 2C77A 1SVIA 3U3MA 4A0FA 2ZI4A 1U8ZA 5E7MA 4URZR 1JR3D 2PLFA 2FFHA 4XTCS 4F93B 3ZJYA 3FVQA 2FZLA 2L0XA 1LW7A 4LBWA 1T8UA 3FMOB 4EPWA 1UADA 2J7KA 1S9HA 4TLEA 5FPYA 2ZAMA 3RANA 3B13B 2J0UA 2WWFA 5CB8A 1QHXA 4HZUA 4RZ3A 2CHGA 1T6NA 4MRNA 1KK1A 3B9PA 3TQFA 3JVVA 2QT1A 2VYFA 4L9WA 3GEIA 4M53A 5EXPA 4QGGA 4DWJA 2IYSA 5CM9C 5DI3B 5UKDA 4AKGA 4MYUA 2OXRA 3C7KA 3KDSE 3O8DA 1AM4D 4QHSA 3H2YA 2F6RA 2RGCA 1E1QA 1T9HA 3W90A 4TTRA 2HF8A 3K9GA 1TQ6A 5FPKA 3TUZC 3C15C 3TVDA 3J81k 1KDOA 4DVGA 1H65A 4QG7A 3M0EA 2QSYA 2B7CA 2NZ8A 5FH9A 2O8CA 3OIVA 1SXJC 1KI6A 1M7GA 2HXYA 3K0FA 2D74A 2YZ2A 3HPRA 4IXMA 1DE0A 1GILA 4DSNA 2LKCA 3IILA 1P73A 5EE5B 2P67A 3A4NA 3RABA 2O8FB 2HDNB 1W49A 4B35A 5FTNA 1G19A 1A7JA 3G5UA 5JHHB 4LBYA 1VMAA 4A0RA 2PEYA 3G0HA 1E4YA 1D2MA 3SFVA 1VIYA 3SYNA 2E87A 3SS8A 3VFDA 2HCBA 1HE8B 1OSNA 3T15A 1FUKA 4PHGA 4A8JA 3DKVA 4BE7B 2FSHA 2C96A 4W7SA 3PJRA 1NF3A 4O0MA 2ZSBA 1OXUA 4BRUA 2J7PD 3P4YA 4IOJA 4M1WA 4JJKA 4HDQB 2IC5A 4MGIR 4A36A 3PUXA 4C7OA 1Q1BA 4B43A 4XWOA 2C95A 1GRRA 2GXQA 1KI9A 3IIMA 2DBYA 3KTAB 1VG9B 2GTPA 3AF2A 2C9CA 4I1UA 1U99A 5HKKA 4Q7KA 1R0WA 1VKJA 3BJIC 1KI3A 2FEMA 1P6XA 2KBFA 3DL0A 3U44B 2FN4A 3OIUA 1E98A 1ELOA 2BEKA 1KJWA 1L4YA 3EPHA 4PO1A 3GLGE 2QAGA 4HB3A 5A5GA 2WWWA 2ZUDA 3A37A 1IJEA 3LW8A 4U5XA 4LPSA 4D4JA 5K8UA 4OHZA 1LFDB 4JL6A 4LJYA 4QNMA 4ARZB 3AP3A 1AN0A 2QBYA 2ZJ8A 3B1XA 1YZTA 3E70C 2P0EA 1ZM3A 1CR4A 1XD8A 2ZE6A 3C41J 2ZI9A 4G3XA 2XXAB 1BYIA 2I3BA 2YWEA 3OZXA 4V0LA 4HB2A 4OQFA 4G0NA 2ERYA 4DT1B 4YMTA 3SR0A 3OIYA 1FX0B 5HZKA 1T3LA 1TPZA 2QQ0A 4PPQA 1QF9A 2G1JA 4F91B 3IPXA 4M9SA 4LV8B 2NGRA 2P5TB 2GCOA 5JHGB 2ZTSA 1E9BA 3QE0A 1Z28A 4ACAA 1N6LA 4Q00A 2QENA 3TNFA 1OE0A 2R6CA 4DZZA 1FQKA 3RSLA 1EFTA 4L15A 1AS2A 1XZPA 4B3BA 4N3NA 2ZJOA 3BH0A 2FZ4A 2JLZA 4ASUA 2AFIE 1IY1A 3QXHA 2R9VA 2GHIA 2ZRGA 1J8MF 5HCNA 4QJ4A 4XSHA 2BCJQ 1Q22A 2KI5A 4IOKA 4ON9A 2QPOA 1VHLA 2QMHA 5E4FA 5KSYA 1JXOA 3FOZA 2PBRA 4DCNA 1SHZA 2QPAA 4A2WA 1E2IA 4IDOA 1KI7A 1N0WA 4PPNA 4QBHA 4D82A 3SI7A 1M2OB 4JLNA 3DDCA 1JEEA 4BLOA 3UKDA 5L3SA 3PVSA 1WRBA 3H1TA 4KHZA 1L7VC 4K81B 3GLFE 1W7AA 1MO6A 5HZHA 5JSZA 1NG1A 4WBSA 4NYJR 1GIAA 1Z8FA 3T1QA 1HT2E 2W6JD 1E2PA 3KJGA 1DAGA 4IOMA 4Q4JA 4URYR 3BXZA 2B21A 3QY0A 3ONWA 3RRYA 2FOLA 2C2HA 2QGZA 1N25A 3QKSB 4FMBB 4JL8A 2MSCB 2J59A 4FINA 1Z3IX 1VPLA 5GJWC 4BLPA 5IK2D 3ZD6A 4I4LA 1IQPA 1BMFA 1CJTC 2GZDA 2XNDA 1AS0A 4F4IA 3GLHA 1UKZA 3AKCA 3F5FA 2FDCA 1AJEA 4DDWA 1T0HB 2QQEA 3EIQA 2H5EA 4TYPA 1FNMA 1XXHE 5HR5A 5L8VA 1JJ7A 2ZS9A 3AF0A 4CW7A 4QHTA 1N0UA 3QENA 4C0LA 4RZ2A 4D4LA 5FR2A 2IF2A 1F3OA 1SKYB 4QJ5A 3AV0B 1DBSA 2LCFA 1KO7A 2QZ4A 2EFCB 1G9XA 2P5SA 3CZPA 2CL6X 4GI7A 2HLDD 2FA9A 5G53C 3RS2A 4II7A 3GJ8A 3ADCA 2NG1A 1EK0A 2QROA 3F0TA 1W4BA 3PV0A 4HAVA 4QGHA 4UNPA 4V0MA 4JVNA 5JJIA 1PLKA 1Z06A 5ANRB 1LF0A 2WJGA 3A8TA 1TEXA 1EXMA 1G3UA 1R5NA 5E7JA 2RGNC 2BJWA 4QM7A 1NN3A 3CR7A 1HURA 5H70A 1E9EA 4KFRA 3Q72A 1GKYA 2JA1A 4RJLA
chains in the Genus database with same CATH superfamily
1DJBA 1B6SA 4Y2SA 5CDFA 1XEFA 1ORRA 1THMA 3LCEA 1KYWA 3BS4A 1NLMA 3ILVA 4KRXA 2QXUA 1U9ZA 3HUEA 4FYXA 4O59O 4QNRA 2HMTA 3GVCA 2JGAA 4M1YA 4HUQA 4JEUA 2HA5A 4NECA 4DREA 3ZD6A 4OQYA 1YI8A 4X1IA 2BT4A 2YDYA 2B92A 2DX7A 4L9EA 3QI7A 4DGSA 1LU9A 4ZI7A 1W63M 3P9RA 2EJWA 3MA0A 2RGYA 3BTUA 2O2ZA 3F1KA 1QE0A 4G41A 3MWLA 4ZYVA 3NTRA 1QIDA 1N2ZA 1W87A 2FK8A 2JIRA 3GR2A 1PR6A 2VJKA 2ZRDA 4QOFA 3QPBA 1ID8A 4C75A 2XUPA 1XRQA 1Z0FA 4OXXA 5FL7A 3H42B 3K1AB 3BILA 3TUJC 5CD9A 1AQNA 1VPVA 2HKIA 5H9VA 1Z0JA 4RGYA 3ID6C 1ADJA 4KBGA 1X0XA 4X85A 3M9XA 5EFOA 5IN4A 1GN9A 3NHLA 3R09A 5KTOA 3CRW1 3L8FA 4F12A 1PR1A 2J9XB 4FJ0A 1F9EA 4R1MA 2A58A 4KMSA 1R4MA 2BISA 3HRIA 4Z9YA 2W70A 1QTRA 2AN1A 2OXEA 2W7TA 3LF2A 3RAGA 2H0RA 5GIPE 4LRQA 4PS1A 1YM1A 3R6GA 2VHUA 3MQ4A 4PG8A 3D3OA 1W46A 4M1SA 4E5KA 2YYYA 4H7HA 5FUYA 3DGEC 5H3LA 4RGBA 1D1TA 2YYAA 3FVWA 4GLLA 3W4QA 2DMRA 3G2NA 1JVJA 5FTMA 1WCWA 1MA3A 1ZI9A 2DR3A 4PV7A 5JANA 2B37A 2JJ2A 1TM3E 3GGPA 3PGVA 3D7RA 4G4JA 1ZKDA 4CU2A 4KLZA 1KQPA 3T4JA 3NIAA 1NPYA 1R16A 1GCOA 1LF5A 1OI7A 4FH2A 2H57A 3OPHA 4MR7A 5I7WA 4GZ3A 4GOKA 4E3KA 3C4OA 1XJCA 2XGNA 3B8EA 3E3LA 4R8MA 5HQJA 1EUYA 4C0SA 4BZQA 4E09A 1U80A 3CLOA 2J09A 1PYGA 5EL0A 2B20A 5KNDA 3UB8A 2VJCA 1N6RA 4R05A 4R6WA 2R7MA 5PGMA 4BP3A 4B73A 4BO5A 1CW2B 4KC0A 4BMDA 3HR7A 3A1TA 2QAIA 2VV6A 1PWHA 4FDVA 3EPLA 3G30A 5DU2A 5TQ2A 4CUJA 1JMYA 2GHTA 2YJGA 5DGTA 1ZIXA 1VMDA 3KJNA 1VFNA 2YS6A 3DNPA 5AVYA 5G2OA 3ZEIA 5LOVB 1EROA 5LIPA 1IWPB 2PS9A 1O58A 1XL0A 2W6QA 3E23A 1N0HA 1E63A 1YJQA 3OF2A 2EZ8A 1ESDA 2TYSB 3JYIA 2XMRA 1VJGA 4UCQA 4E70A 3EEQA 5LQCA 4FHGA 3HUMA 1W19A 1GPBA 4KV7A 4PFKA 3HSSA 5I47A 3A6PC 1Y7IA 4O1MA 2B9EA 3K73O 1X8LA 3QKTA 1JHAA 3BB3A 4BWGA 4EO9A 1NJ5A 2D7JA 1JT2A 2QMUA 1D0IA 1T24A 3C7VA 1JHZA 3DHWC 3Q85A 4IILA 3OPXA 4PXSA 5EFZA 2P7HA 3F97A 3N0XA 2RI0A 5TS2A 4C76A 5L3SB 2XFSA 1URPA 4NLLA 1KPIA 3Q15C 2WRZA 3QKIA 1AH2A 1O03A 1PJSA 1XU7A 5M3BA 1D9ZA 1U0LA 2AQHA 1PNQA 3B42A 1OLXB 5BXQC 1EINA 2H2DA 2CNBA 3NHWA 4OKNA 4NMXB 3QYAA 5ERXA 5DCUA 3CSSA 3MWKA 4TWAA 1COWA 2ZZKA 1XJ2A 3N75A 1WMAA 4J1TA 4QBFA 4D9JA 1UC9A 2YHUA 2QZZA 1IYZA 1KBZA 3HYLA 4YAEA 1CJSA 4UAAA 4DDTA 2BRUC 4YDRA 3D4IA 3GNQA 3PRJA 4G9EA 3LXMA 4Y1RB 5JECA 4BNJA 3IWIA 4G0QA 2BEWA 2V45A 1GL3A 2C7VA 3OIDA 1RZ3A 3OQ6A 4OGLA 4Q7JB 1Z12A 3WLRA 1TCAA 5JO9A 4A6PA 3ZOKA 1AO0A 3IPCA 5DYWA 1PUIA 4TS4A 4KR2A 5CEJA 1TUEA 4DDKA 2JK0A 1SZVA 2VAVA 3SJ7A 3ZQUA 1R18A 4ABTA 2WAFA 5B2EA 2HZBA 4KPYA 4BNMA 2AJ8A 1YR6A 3SJZA 3I72A 4H08A 4L9SA 4IEIA 4ABYA 1QOZA 1VHQA 4R2WA 4OMUA 2F1KA 2WAOA 3CO5A 3QU5A 3I04M 1R66A 1WKVA 3QU7A 4M7OA 4OQMA 2CJWB 4PF1A 4BC0A 4AP9A 1SXQA 1U3DA 1C1XB 3FSEA 2CVZA 5G4LA 2CLKB 3RRMA 3IBSA 2X2EA 4PLVA 2FH5B 2J9YB 2ZBUA 2P65A 7GPBA 3SIWA 3UATA 3LPNA 1U1EA 2VP9A 3AF3A 4W9NA 3NC0C 3B20A 2PQ2A 1DUIA 3MXSA 2KMLA 2NUAA 3DDWA 4PG6A 3GZ4A 1YE5A 2DCMA 5BVHA 4YRSA 1EA5A 1VLHA 2FWMX 1DIHA 3GNSA 1XALA 2CY0A 5C4MA 3G8DA 3A0RB 5AKJA 5LJIA 2YJ5A 4UMFA 1WQ3A 4UHKA 4RPLA 5FKJA 4NV3A 2WVGA 1WB6A 1AU9A 2AFIB 4GX2A 4JBLA 2Q6IA 3MT7A 2CFSA 3PD7A 3RYHB 4ZAYA 1JYSA 3V42A 5AW1A 3F6YA 3HE3A 5FPQA 4E31A 3H6GA 1T8WA 1CEQA 2WIJA 1NJ8A 4XWAA 3Q3CA 4IMJB 1CUZA 4HYQA 1G8SA 2VDWB 1O96B 1KH1A 1EW0A 3IT3A 3RVOA 1US8A 3D4OA 1WCXA 4H4DA 4Y0VA 1DOZA 2H1VA 1W79A 3VSLA 1P1RA 3LIEA 3ZWKA 5TMBA 3AR8A 3SC2A 1OILA 1WNFA 2VNIA 3IQZA 2CMNA 3R6WA 4G26A 4ROSA 4JI2B 4XLLA 2VWHA 2PA0A 5LBRA 1HQKA 5FUXA 5KNCD 3CLTD 5KTNA 5JS2A 2Z8YA 4MDZA 4QDJA 1FW6A 1T9AA 5AW5A 3L7CA 2P2CA 4Q9IA 5I7UA 2EJVA 3TTVA 3DV2A 4JGOA 1GUAA 5D3MA 2R79A 1Z68A 5EP2A 1QANA 5H80A 5JZVA 4Z4IA 1V7PC 4Y15A 1EK5A 1H5UA 2WINI 2GM9A 1XQWA 2EFGA 3CEJA 1SKOA 3IP1A 3MOSA 3OZ7A 3ZGAB 1J25A 1C7RA 1GN8A 3DOIA 1CYDA 1K54C 1TM2A 1Z7YA 4KQOA 1AXEA 1ODFA 2QTWB 2XOKA 2Y99A 3KPVA 2CLCX 3KFLA 4EKNB 4XUXA 1LI0A 4B3RB 2YIVX 1NAIA 2MSEB 1PFYA 3BWCA 5KSCA 3GY0A 4PZ0A 3BMCB 4KR9A 1NHWA 1L7NA 3U4LP 3U4IA 5FBRB 2GHRA 1E1KA 2FR0A 1G2PA 1EFVB 1P4HA 3L2OB 1GUZA 4UTOA 5E9JA 2M1CA 3AO0B 3M2PA 3TG9A 1TYCA 2IUFA 5ALSA 3ZDXB 1ES4A 3TRCA 2QRLA 3DDUA 2IWCA 4WV3A 3AY0A 1M83A 3CLKA 2HC9A 4TMKA 5IC5A 3S2FA 1W30A 4QJ3A 1RWNA 1TMKA 2V5UA 1JHXA 2PIDA 4OK3A 2W6OA 1CERA 3EWSA 2MIIA 3T99A 2K2QB 3V8PA 3GAMA 3KNZA 3RG2A 2QF7A 2ZTLA 4ZV4A 7ABPA 3TQQA 1D06A 4NK4A 1I80A 4HZIA 4J0HA 5IYZB 1IHXA 3TSCA 5A6SB 3AEXA 5CJJA 3V8RA 4IIVA 2BSQA 4H4CA 4X91A 2FHPA 4OXRA 2ZJ7A 4X6UA 3SZLA 1C0KA 2OK7A 3GCWA 1E3WA 4M21A 3FPFA 5AJGA 5CRFA 2Q4DA 4LHYA 1GARA 3H11A 5AOCA 2ECPA 2P35A 1FU8A 1MAAA 1NYQA 3A9TA 3C1OA 3KU4A 5C18A 1SU7A 2Z0MA 5AJWA 1E92A 1EVIA 3KPYA 4Q7MB 4X1IB 4IP0A 4DIMA 1V7CA 2BOVA 2NO1A 1Q1EA 1G7CA 3O2NA 1XDWA 2P9JA 3KJFA 2IV3A 2Q21A 2V1UA 4DXDA 1ARZA 1T29A 2EARA 3QOXA 5AVOA 4OYYA 5FX2A 4B3HA 2AZXA 2J3TC 4HHDA 3ELUA 2H4JA 5SY6A 1LHYA 4KUOA 3CUYA 3GN1A 1O5IA 1WL8A 4AMBA 4PKYG 3HL0A 1KY2A 4JEHA 3ZH9B 4FFOA 3D0KA 1EX7A 1U0HC 4YJ3F 4B83A 3M3DA 3OKCA 4P9NA 3O3MB 4KQCA 5JWOA 3HB5X 1BXKA 3PNPA 3RIEA 4BQRA 3B1ZA 4B3SB 4HY8A 3BW6A 2OKCA 4NCNA 3OCUA 4UEOA 3DW0A 1XMXA 1CJUC 1YGYA 2FUCA 2P2GA 1L5SA 1EAMA 2NO7A 4OB6A 1WPRA 5C1DA 3GJ0A 1J5EB 1N2XA 2HPVA 1OXBB 2GCNA 2P7IA 3KBOA 1MP0A 3OEHA 3OQJA 4R7ZA 3WS7A 4DCVA 4FHFA 4EY7A 3AETA 1LL8A 2GRUA 3O4FA 1ES9A 2Y8EA 4RHYA 3KR1A 1ZGCA 3OA2A 4UHEA 5IS1A 4YFVA 3TL3A 3UN7A 5HGXA 3LP5A 2IEIA 5EPUA 1ENPA 4HWTA 3E7DA 4BO7A 3WIBA 5HKOA 2ZOSA 2A9PA 2CE2X 3HR4A 1TAQA 3DOCA 3L05A 4J0JA 4JLWA 5EMJA 4RDHA 2BV3A 3EIEA 4L4YA 1RPZA 4HVAA 2QVCA 3ZGOA 4EW7A 1UP4A 2CLMB 2D59A 3C3KA 3IUJA 4RD6A 5F21A 4JI7B 5J9FA 3GLHB 3ZHRA 3HZHA 1R6TA 4Z9BA 5AICA 2JKYA 2AZDA 3PEUA 2CF5A 1EVKA 2CBGA 5F2OA 4LRTB 3IHKA 2GD2A 4MUYA 4ZC1A 3PXUA 2G6BA 1QFSA 3QELA 1JB9A 3FDZB 5DYGA 1E9CA 3G8CA 2VHXA 3QX3A 4IKEA 1Q57A 2A3UA 4LYFA 1W4CA 4MWZA 4Q12A 4UU0A 1M2WA 4OD0A 3PCXA 2UVPB 4XD7D 3S4YA 5KC8A 3GIDA 3U7GA 2IE8A 2QRGA 5JD5A 4TYYA 2A7XA 2YN2A 3SSNA 3OZDA 2QTAA 3AZPA 4WYYA 5HOQA 3IV6A 1C14A 1SCKA 3M1AA 3OO0A 5F1PA 1H8HD 2NVOA 3V9PA 3NX4A 4F9TA 2GJKA 4TWIA 1H1LB 4O33A 5ADVA 5JTUA 2LVBA 1LW6E 1OU0A 4LPZA 1PJCA 3NHBA 1JEOA 3NU1A 3R3VA 2INWA 4FBMA 5DTSA 3O03A 3WA6A 3GLTA 5I5GA 4I4NA 3MIIA 1C9EA 3FYUB 3HYSA 3MC1A 2Q0QA 3QPCA 1VE1A 1TX4B 2V9PA 5I48A 1RYHA 3SF8A 5JCOA 2UZIR 4R1TA 4B44A 1IOWA 2XMCA 3RT9A 1TEVA 1R9MA 2HW8A 1I2WA 3HBAA 4UAUA 4QU5A 3LDFA 3CLSC 2H51A 4ZI7F 3FPVA 1XTUA 1N9ZA 1X9HA 1B7GO 1P4SA 2WPDD 4HJRA 4GKVA 2E4ZA 1IEVA 4R0VA 3SF0A 1H2BA 3N0RA 1RYYA 2WUEA 1QMGA 2FOXA 2FP4A 3FOAA 3SJUA 3S1SA 1IG3A 1PNRA 1JJVA 3MPOA 4RV5A 1ZEMA 1GSAA 3A3DA 3E4DA 4RX3A 3T9AA 4BRWA 3TLBA 1JEYA 2BTQB 1N8SA 1YT4A 4LJAA 3AETB 3OQBA 2G2UA 2RHDA 3F2VA 1P75A 2FFRA 4LV2A 2C3PA 4K28A 3DWZA 4FZJA 4MQ4A 2GYYA 3A3YA 4NKPA 1VIDA 2Q5IA 2QSZA 3DEYX 4IXWA 4QXRA 2OWHA 5ARCA 1JMKC 4HLCA 5K99A 3IOYA 1XKLA 4NR0A 4DARA 3COPA 5DCLA 1KH3A 2W6PA 3BERA 2OZVA 1GFWA 3KC2A 3JASB 1RQ2A 2P6OA 5T4FA 1B3RA 2G0TA 3TEJA 4BAZA 3MILA 3GROA 2B0CA 1Z39A 2V1XA 2Q5QA 1GFIA 2FPLA 4PSCA 2DPMA 3G8AA 3RS9A 1L7PA 4PVCA 4WFIA 2Q41A 4EB0A 2DOKA 4F06A 5IAKA 3BLMA 1SA0A 1Z63A 4YRRA 5IWCA 4ZAXA 3MSHA 1O96A 1UFQA 1MUUA 4CI9A 4WSOA 1FS6A 2NACA 3LGSA 1O4WA 2W2VA 4WLAA 3GQBB 3X43A 5E6RA 3PXDA 1TUGA 3TYXA 3SQWA 3N6RA 4QQ8A 2Y93A 1XP8A 1OC4A 2BEUB 4BD1A 1ACFA 1AY0A 1C3LA 1P2GA 4MPDA 1VFPA 2RHTA 4N5MA 4B3CA 3E2IA 3HDJA 4P32A 4HJ3A 1H6BA 1WUHS 4XYGA 1A4IA 5JBIA 1QPZA 1H3QA 1JXMA 4X92A 5KSWB 4PPRA 3CLUD 4BAGA 1EK1A 1RQ7A 1YLTA 2J5XA 2J85A 2XVZA 4RFSB 3ZV6A 4A6EA 1EFAA 1K8XB 2GN8A 2BFCB 3H5OA 5C8DA 3PGXA 5C81A 5E4YA 1P44A 5ES3A 3HWSA 3QPDA 3TBFA 4E5SA 5DN6D 1N2EA 2TECE 4GLQA 4XUZA 3OCJA 4P98A 4JLFA 3L8CA 4E13A 2DPYA 5F52A 5I7AA 2IYFA 3C1UA 2EHDA 2Z1NA 5KSOA 4M3KA 4BY9E 2Y9PB 3LUJA 1MBZA 3MUFA 4P3KA 5DHPA 4YWJA 4C0AC 3FMVA 1PEDA 5EOEA 1TI7A 5A3QA 1T8TA 3NCTA 3RHFA 2WQ6A 3GUVA 4FCVA 4X6LA 1E6LA 1GEEA 1AHPA 3GLGA 1E8MA 3DZCA 3JQAA 2BTOA 1OGJA 1JDBB 4KPUB 4NNPA 1YGPA 3FNBA 5E9WA 1E5DA 5FTKA 3RSGA 1VKZA 4F4FA 1T3HA 1G8HA 4DMKA 2GH1A 3QE4A 3VISA 1KYIA 2Z98A 2VDQB 1M1UA 1D07A 1JXQA 1MCZA 2DE0X 2REOA 4OK5A 1ZX1A 4CL0A 1LLUA 3X1ZA 5JH7A 3DOFA 3V6MA 2R2AA 2NAPA 1F7VA 2V8CA 2X13A 1YU9A 1T9ZA 3V00A 1QO0A 1SVNA 3EA4A 1Q7GA 2P4EA 2K7SA 3OCVA 1RR6A 5E7IA 2VJPA 2IEGA 1C8LA 3QI2A 1XHLA 2BHNA 2P2YA 4MV5A 1AKMA 2VTKA 2JAWA 4JWKA 5CM8B 3WL6A 5AW3A 1DO2A 4BKQA 4EL5A 4GC9A 2Y2PA 4NENB 4ESVA 2NTEA 2JIQA 3J7TA 4MEAA 2A1UA 4RNDB 5ADUS 3REQA 4H1HA 2YXDA 2VPTA 3BUSA 4R9UC 3VR6H 3IPYA 1ZA1A 4AY5A 5BSFA 5JYCA 2OSBA 1SC1A 4D6YA 2OCKA 2ZRPA 5JVDA 1V95A 1F6DA 3OZEA 1IC6A 3MCWA 4W5OA 3LOUA 3GVPA 4GD6A 4GP6A 3UFXB 4OI0A 1SOAA 5AI6A 2Y3IA 1SEPA 2PZGA 5TQVA 2RKOA 5LDDC 4FSFA 3WP1B 1G55A 4F71A 1K68A 1AMOA 4JSYA 1Y5RA 2FEPA 2IYRA 4IVKA 3ET5A 3M5WA 1Z3CA 4J29A 1H69A 1UMDB 4RHUA 5DH9A 1Y1QA 4ZQGA 4B6JA 5HS6A 5EJ8A 5C8ZA 5JAHA 4YRNA 1PFQA 2WU0A 3ONEA 3N59A 3I61A 4EUFA 5TF0A 1BOFA 3FMFA 4ECEA 3LUQA 1Y1PA 3CW2A 3OTGA 5K1ZA 1GP2A 4P87A 1I9CA 2G09A 2VP0A 2ZYAA 3R7LA 3MJHA 3UMJA 1FNNA 4MV7A 1O0BA 5F1FA 3AZOA 2VRBA 2HSDA 2GXUA 4GSKA 1QS0A 3AONB 3ZX4A 4DRZA 1XZLA 1LDGA 1NE2A 1PEKE 3E53A 4YYEA 2I66A 2A5YB 5HFJA 1LQUA 2YV3A 1OXMA 1LI7A 4X6XA 3DOEA 3DTMA 4RF4A 1NOIA 2IXAA 1YLWA 1IHPA 2RBGA 2D13A 2G6TA 5B4UA 2BUCA 1VA4A 1UDAA 1K5GA 1M6KA 4Y2VA 1P9OA 1WEKA 1J1UA 1BW9A 5DYTA 2PKRA 5KKNB 1IZ8A 5C32A 2W5UA 3TZBA 1NL3A 3WZMA 2FPXA 2WTAA 1JFRA 5EJ2A 1A5SB 2QN6A 2C20A 2R5NA 3O7WA 1MC5A 1UXGA 1XFDA 1T91A 4HPJB 1QK4A 3HBRA 3O86A 5KTPA 1DJCA 2DKFA 2JEYA 2PG3A 5K2OA 1KTIA 3I01M 3TZKA 4A91A 3EDRA 3AFGA 2BMAA 1L1EA 2GRJA 2XEDA 5GTDA 3I4FA 2QVGA 4O08A 2IYOA 3I45A 4J94A 1AKEA 1IQ0A 4JZKA 3V4PB 3LH5A 4CZ2A 2B8TA 2Y1CA 3UUFA 3BXOA 1CR0A 4Q1BA 1UFKA 2O2GA 5FQ9A 2RGGA 4DKXA 1ZH4A 2P3OA 5AJTA 3MXRA 3ICEA 4E94A 4CMIB 2BKEA 3OEED 4MYTA 2R6DA 5C9ZA 4NESA 5FNVA 4KQWA 4LF7B 3P52A 1ADFA 1NJGA 1YR1A 3ZTYA 4CQMA 5CLHA 3MBZA 3KSUA 3VYSB 3HFGA 3WHLA 4GRDA 5EQJB 1EE2A 1G8AA 3FCYA 2A2ZA 5BRNA 3RVBA 4C4RA 5B7GA 1G38A 4JX9A 1M0TA 1QU2A 3ZDCA 1G2QA 2W2LA 5JAIA 3WAGA 1PWCA 2M98A 3LT5A 1H4VB 1SQSA 4CKBB 1DBPA 1UBJS 4XQGA 4R2XA 2XB4A 2BGTA 4J0IA 3A7DA 4I8XA 4R5HA 1AQUA 2WV7A 3C5AA 4GL4A 4UAJA 2HNAA 1GGJA 1XAIA 1EUZA 4BGVA 2YV1A 3BE8A 4KOEC 3WYDA 2Y0PA 5FOQA 1E4EA 3IQDB 3TGWA 1G8FA 4G97A 1EDZA 3VM6A 3RO7A 3ZNQA 2CFIA 1DCMA 5F5YA 3JYQA 1NJSA 2C2OA 4K1XA 3RWOA 1QYWA 4ENTA 1Y4OA 1KIFA 3P2YA 1GQ2A 1TOAA 1UJ2A 2OFFA 1LD3A 1W35A 3RJ9A 4HVTA 4Y1GA 1P0MA 3ZDJA 1EM8A 1FB5A 1TRKA 4CMGA 2Y2IA 4KR7A 3U7IA 4R31A 3WB1A 2Y1XA 5KQSA 3S7OA 1ISSA 3SHOA 1FJ2A 3C3YA 1WF6A 4TMXA 5AWFC 3L6RA 1FSYA 3LPAA 3T5AA 1F1BA 4RANA 4S2OA 1E3MA 3KB8A 2X19A 4OL9A 2BEJA 2ZPUA 1POXA 4E46A 4PIMA 1P2UA 4QXMA 1ZDMA 1V7QA 3UK1A 4G5RA 2GPWA 1KVRA 1NIJA 3P96A 3W8NA 1CWUA 5CA1B 5ALXA 1EA7A 4OPRA 1ANKA 2Q5JA 3KSDO 3HFSA 2D7DA 3BKWA 3NDRA 5BYJA 4TKUB 1XPBA 1Z4LA 2F3QA 3GMTA 3GDGA 3L8YA 4JGIA 4RVCA 1PJ2A 1C5KA 4HLQB 3GJRA 2NP7A 1P4RA 3ED1A 3MZ0A 1JECA 4MS1B 3U7EB 3X2EA 3QYJA 1XUOA 5CCBA 2YW9A 1NNEA 4N3BA 3WL4A 1TQDA 1E0AA 4N0EA 1Z4MA 2ZYTX 3NHZA 5CXSA 1SUBA 3P0RA 4BO9A 1N8NA 1SBTA 4G24A 1SKMA 1GRCA 5DJTA 4QRDA 3ZHYA 1C30A 5IM4A 1DAMA 4IJ6A 4OXQA 3WWPA 1CE8B 1T9BA 2BI7A 3AXSA 3L6CA 2GD6A 4MI9A 5ALWA 1KEUA 1M1YB 4QTYA 2DFVA 3E2LA 5I4CA 2GCEA 1Z0DA 1L4HA 1SKAA 2JLBA 1VE5A 2FMXA 1D2CA 1G5HA 1QGDA 2AYYA 1FDIA 1MD9A 2EVWX 3JPWA 1C30B 1IYOA 1EP9A 2O2SA 1C81A 3E1GA 5D85A 4B7XA 2J9GA 4OFXA 4AQDA 4YJGB 1UXHA 3CR8A 2FLKA 1C4OA 3PQ2A 3IBYA 3LM8A 4EPTA 4DV4B 2L4RA 3MIZA 1JSZA 3LL7A 3OBIA 4PC3A 4BTVA 3B2QA 4F86A 3VNUA 4F94A 1V6CA 2XMQA 3K53A 4JLJA 4ZVRA 1OQAA 2ZL1B 2DFNA 2HADA 2OCIA 2OLJA 3BRCA 3D31A 3F67A 3FFXA 4FXOA 2ASEA 2C9MA 2G9ZA 3WDKA 5AVSA 3AVTA 1U0TA 2P0AA 4F1KA 2I2AA 3T3MB 2FMHA 2FEKA 2ZM2A 2J0EA 1X13A 2PZEA 3AP2A 4BVLA 2YZKA 4RM2A 2Z9CA 4D3YA 2C99A 2JRLA 1RJ9B 1U4OA 1EX6A 3ZWBA 2PGAA 2PJDA 1HQDA 2VHQA 3RLFA 4ZZ3A 5IM4F 3HLCA 1JHMA 2G5GX 5FPTA 1SCDA 4DYDA 1VKHA 1WR8A 3EC7A 2C7QA 4KPUA 4G65A 1DUSA 1CFJA 1RE1A 3G0CA 4FIZA 2O8CB 5CLQA 4CTJA 4W5NA 3W4IA 1RRFA 2CW5A 2O57A 3AVXA 1YK0A 2P5YA 1IXZA 2JC7A 4J2TA 3RS4A 1TC1A 3VO9A 4YV1A 3HJGA 2EKPA 3HDHA 2WKPA 3VMAA 1A9XB 1AKNA 1Z34A 1CJKC 2QM8A 2YWJA 3HZZA 3RS0A 5DW3A 4FONA 4DXCA 4GZBA 4RW0A 1G20A 2BJVA 1Q77A 2GEUA 1O97C 5CGXA 1HLFA 2JKRI 2R751 2A59A 3C7AA 4KQJA 4G0OA 1NVUQ 2B36A 3ELYA 2R00A 3DOOA 1MRNA 2CLIB 4ML3A 5B4VA 1JTVA 2MMGA 3L6OO 4RZSA 2OCXA 3X1DA 2WQ7A 1DEKA 1ZKMA 3QEJA 2JD1A 3CHWP 3N2NA 3T5PA 1G1AA 5D5HA 2XB2A 4RK6A 2IFTA 3PJGA 4M1OA 2ODBA 4KFSA 4WNIA 4QXPA 2H2FA 1UWPX 3C98A 5FRDA 2Q5OA 4CMJA 1UT8A 3TBHA 2C4NA 3ET4A 3LBHA 1XDUA 1UMDA 1ND6A 1SBZA 2WLTA 5CT4A 2MT9A 1NLFA 1UMCB 3ND7A 2W43A 4TKZA 3U2QA 4BJHB 1YBAA 2HF2A 1Z4IA 4OATA 4OHYA 2AHOA 5BWOA 1JKXA 1KP3A 1Q0HA 3DA8A 1N36B 1KY3A 1QDUA 2GNAA 2XI4A 1P7PA 4U2CA 1NBME 3EGDB 1CYEA 6REQB 3GZNB 3HO1A 4FPXA 4OQQA 3ZE9A 1RPNA 3HGTA 5HBGA 3ILSA 2GOYA 1Q11A 3ABRB 5TX7A 1OTDA 5KTSA 1GPNA 1E61A 5K05A 4ITVA 5LN1A 4O4LF 5LQDA 1I5QA 5EJ9A 4CTNA 2DEUA 1V16A 2BSAA 3Q7QA 5CB6A 1G98A 1NRFA 3CA8A 3GLFB 1EE1A 3JRNA 3JQGB 1OASA 1I5EA 3PC4A 4I50B 5DEOA 3OCWA 2PJUA 4EPYA 4LF4B 2O1SA 4X3OA 5LYJB 2O0JA 1NBAA 3CUEF 4GLOA 2VSFA 3A9SA 3FTEA 1TT5B 3FF1A 1KR2A 3IR7A 3R41A 5A5FA 2Z6AA 1MIOA 1B8PA 3OHMA 1GGEA 4G4IA 5FUWA 4LJRA 1PT8A 3TTUA 1DPGA 2Q4RA 3G2QA 3IUPA 1ZU5A 2ZJ6A 3K96A 5ICCA 1U3GA 4KPGA 1Q21A 2J3LA 4WCFC 2P8SA 5LSAA 1M7HA 2MJ6A 1L8OA 3DWFA 3KR9A 4FR5A 2QTNA 4GFDA 4WEKA 4L28A 5FOTA 3PXGA 1ZR4A 4XH9B 1YDHA 4YIKA 1IOUA 1F4LA 3SZUA 4G1UC 3DEFA 3LU1A 5ERGB 2CNKA 2QLMA 3K2NA 4C43A 2JARA 4IVQA 2DBRA 4R0QA 1HK7A 1YRBA 1AF7A 5DF7A 5EINA 4GI1A 4RJ2A 5DGDA 3SNHA 5KX5F 1OXSC 3WLEA 1T4CB 2AR7A 3IVMA 3B48A 1LBHA 1X80B 4IHJF 4MR9B 3TRJA 4QU3A 2ERCA 1CUXA 2AR9A 1QORA 5JNLA 2QW1A 2WNIA 2DP4E 1B0AA 1MR3F 1E3SA 4CQHA 1NVBA 3M3PA 2A1TR 4FGSA 4GM4A 4NJOA 1Y8CA 4POAA 3RBZA 3ROKA 4GM0A 5DSXA 3THYB 4EGSA 5JCJD 1GR1A 2VZEA 1NVMB 1P9LA 3F4LA 5I8ZA 3BMQA 4P4UA 1W5BA 1OFGA 3WLOA 3WZ2A 2GILA 4EGJA 4EATA 4YMGA 2F67A 5DNYB 2BEVB 1I30A 2VDWA 1GOTA 4LSGA 2XTJA 5DVZA 4HMPA 2XTAA 1TUIA 3G5MA 3C5CA 4RLQA 4AURA 3IMKA 4MW0A 1H2EA 3FZYA 2VBFA 1X86B 1X8JA 3K32A 3GPCA 5D3OA 3OJEA 3FDZA 4PHCA 3TB6A 4KQXA 3RIXA 3WWOA 4A7PA 2HPHA 4YEDA 4E5UA 4LXQA 3PI7A 3PU6A 4WK0B 2WUVA 3PWZA 1OAKA 5F5NA 3VJLA 1WMBA 2DT8A 1ZICA 3C8CA 1T6BY 2H2WA 3BD8A 4MVCA 1TAHA 3GJ7A 4K9NA 2E55A 4EX7A 1OIVA 1YQEA 3GQBA 3KD2A 4X00A 3FPHA 1LKZA 4AW9A 4OA5A 4FW9A 5KYGA 2P9YA 1N3IA 3LEZA 5JZBA 4TKVB 4KIGA 4YMIA 3VJRA 2QE6A 1YH3A 3U3KA 2Z8ZA 1SXJA 2XH9A 2DBZA 4PG7A 5L09A 4ZYZA 1HE3A 3D43A 3JU3A 3OAAA 3ZJ5A 4DPLA 1WSAA 4KODA 4UZEA 1W88A 4MWEA 1UIRA 3ZVNA 4WN5A 1I2CA 1RWMA 4CM1A 4GDFA 1YTLA 2M6RA 4Y0OA 1KHHA 4C78A 1UMBA 4MITA 2B94A 1GFZA 4U5QA 4LIPD 3ETNA 3DYIA 3AHIA 3S7ZA 1EG2A 2CLEB 1NW6A 4YRTA 2HQBA 1Y5NA 4MWGA 3RIMA 5J23A 3FE2A 3EFBA 4N8EA 4HQFA 4YAWA 4W1QA 5K4HA 1K55A 4A8JB 4BRZA 2P40A 1QHGA 1QNFA 4WESB 4YACA 4KMOA 4PBSA 4K26A 5EWJA 4ZZIA 3EXIA 4ENPA 3GLGB 1N1EA 1U2GC 2OHHA 2WYWA 4ZVLA 2W6ZA 3VU0A 5B7NA 3UWMA 1BW9B 5JNVA 3LICA 3OZGA 5TJJA 2GUWA 3AEQB 3DTEA 3IT9A 4ZXFA 3FVTA 2I2CA 4FYJA 5BUSA 2E6KA 3BCRA 2NUTB 1IK4A 1AK2A 5H4GA 3GTCA 3RC1A 2FPUA 3ZBTA 4KN5A 4BVAA 1QRUA 1J56A 5HWVA 3W3AD 1EX1A 4OBXA 3L4EA 4XVRA 7ADHA 2PE5A 3H4IA 4DJTA 4H1UA 1G5FA 1W5FA 2RGXA 3WP0A 5CDGA 4GHIB 4KSBA 4OM7A 4MJXA 3V1UA 1G9SA 3I1YA 1UT5A 3T5CA 1ZMTA 3QVGA 2F8MA 1H0SA 1WUYA 4ZTZB 3T1NA 3R5SA 3ZBQA 5JPDA 1GKIA 3P97A 4JEIA 3IAM1 3WNDA 3JQFC 1QH1B 2ANBA 1K9SA 1XU4A 3W6OA 3WAKA 3UMYA 1VEUA 1H2XA 2DRWA 3C3WA 4Y3UA 1PN3A 1TTQB 3VR4D 5IHPA 1ZUHA 1XK7A 5K3OA 2FE4A 3NTXA 4B6OA 2ZIEA 4I4TA 1UWLA 1FX1A 2J4CA 3M4YA 2C4TA 4PM5A 3NZEA 1HDXA 4J0CA 4OF4A 2RBKA 3TRDA 4C08A 2VC2B 2DCUA 2A5DA 3OQ1A 4J4TA 2P6NA 3L41A 4I66A 4Q66C 1EXDA 3DKPA 1BTLA 4JXXA 4OOYA 3KSMA 4TVBA 4A2CA 2B2CA 1AGRA 4RYLA 1KO4A 4BFTA 4DZRA 1PL7A 1JG2A 2IX9A 4AT1A 4G1CA 3FHCB 1E94E 3T1TA 2H85A 4XM1A 2GGSA 4NV0A 1EFRD 3Q3IA 5JSYA 5FDHA 2P79A 5JLAA 1KQGA 3QPVA 5IJAA 2YNMA 1ZD8A 4ZK2A 3B5JA 3VSAA 4ALLA 3PP8A 1TD1A 3SLKA 4F38A 2YKHA 1ZINA 1KBOA 4LRXA 3IHLA 1LV7A 2AD5A 3LQ4A 4WN9A 4MR7B 3N7UA 3FW1A 4DV2B 1JEYB 5TY0A 3L4BA 3BA1A 3IB6A 2Z95A 3SM3A 3EHEA 3NOPC 1GQFA 4BB9A 3UAZA 3VC3A 2FP4B 5DHAA 5FI7A 1OX4B 5CDHA 5KJFA 4RMGA 4DEYA 3TG8A 1M5UA 2AIRA 4IR7A 1BFUA 4OAPA 4HEFA 2J48A 3IP8A 3M3HA 5HPYB 4E08A 3PXAA 5A5EA 3TXYA 1P7CA 4ZCMA 3B60A 3VNAA 5JMTA 3GLRA 4V39A 1I33A 1NSYA 1H42A 1NSFA 4ZARA 4P1ZA 3TO5A 1CS0A 2DAPA 1ODSA 2PH1A 3WGNA 4AMUA 4B4KA 2J32A 2CC2A 2F7SA 5ES4B 1T1BA 4YTEA 4YP7A 1QWSA 1GZVA 2GAOA 5IPFA 2JE5A 1FDWA 1FMJA 3NVKI 3KLBA 2C78A 3TZ6A 4PNEA 1A0KA 2I2FA 4TV8B 4WEQA 5EE3A 2ZRAA 4RVGA 3E5HA 3SXUB 4RJTA 2XB8A 3G34A 4YMHA 2GARA 2G82A 4UJ5A 4CNBA 4HV4A 3MQOA 3RS7A 3FIJA 3HWRA 1JWZA 3HKEA 4DJ2A 1FFSA 5GJVC 3IAS1 4BP8A 2OPBA 3SYLA 2FW7A 4Q0JA 5IMSA 2C61A 3RUIA 2R1TB 1T6ZA 5LCXA 1UKVY 2AX4A 2W58A 3AJ8A 4IDNA 4P54A 4QWOA 2CKDA 1D0VA 4UFNA 1XNQB 1CUUA 4R3NA 4L5JA 1PNTA 2E48A 2AMLA 3E7XA 2PFSA 4NHEA 1SMKA 1X19A 4CQMB 1ZH8A 3VV3A 2NPFA 1EVJA 4ALJA 1E9RA 2MSWA 4RIEA 5AQBA 5DASA 5FEMA 4DR1B 4M4SA 7MHTA 5G0UA 4EKYA 3IA2A 1I51A 5KWJA 5KTTA 1SURA 1ES3A 3B2EA 1XHEA 2VGKA 3FI9A 4JJEA 1MO3A 4RK5A 2DSNA 1NV9A 3LPDA 4ZPXA 5ECDA 4PONA 4F3YA 1PR5A 4NKRA 1ZXBA 3GARA 4FDLA 1DO8A 5SY9A 3O9ZA 3CITA 3WRZA 1A5AB 3G7NA 4O2LA 3ONDA 3G85A 4OQXA 1NBWB 4TMTA 4IPTA 4UVDA 4E7OA 1YR3A 2VXYA 3U1BA 4O3MA 1BCSB 2PD6A 3D81A 1CR2A 2C54A 3TJMA 4J0QA 2FKAA 2A86A 3S5UA 2WKEA 1DV2A 1NOJA 2OO3A 2VRNA 1J33A 3WKBA 3PZRA 2X0NA 5AJXA 4NAVA 1JBEA 1E2UA 2UYOA 3SC4A 1B26A 5EMNA 4DLWA 2XR0A 4PYJA 4QLAA 2O0YA 4KQEA 2BHRA 2BEWB 1C9KA 2D5IA 2DFTA 2ZCVA 3FYZA 3EXG1 4JS0A 1Y9DA 5AXBA 5BR8B 4RENA 2F64A 4U7JA 4LGMA 3IAXA 4Q3LA 2JLSA 1B4DA 1SUWA 4UKDA 4ER3A 3F49S 3O0DA 3SLRA 3OOWA 3TCXB 2IYEA 3AWDA 3O3VA 2RHJA 1BSVA 5TMEA 1K27A 3KQYA 2O1EA 4R2LA 4XD7A 3VZDA 4UOEA 3ZVMA 5CLLA 5K0JA 3UE3A 5J4EA 3KJZA 2Y68A 4IKPA 2WFMA 1ESNA 5LMZA 4JYZA 5CYGA 4I3IA 1FP4A 1G6AA 4OH0A 3AFNA 1OV4A<