2EWWA

Crystal structure of the pilus retraction motor pilt and bound atp
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
350
structure length
343
Chain Sequence
ELKILEIIKEAIELGASDIHLTAGAPPAVRIDGYIKFLKDFPRLTPEDTQKLAYSVMSEKHRQKLEENGQVDFSFGVRGVGRFRANVFYQRGSVAAALRSLPAEIPEFKKLGLPDKVLELCHRKMGLILVTGPTGSGKSTTIASMIDYINQTKSYHIITIEDPIEYVFKHKKSIVNQREVGEDTKSFADALRAALREDPDVIFVGEMRDLETVETALRAAETGHLVFGTLHTNTAIDTIHRIVDIFPLNQQEQVRIVLSFILQGIISQRLLPKIGGGRVLAYELLIPNTAIRNLIRENKLQQVYSLMQMQTMNQTLYKLYKQGLITLEDAMEASPDPKELERM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords twitching motility protein PilT
publication title Crystal structures of the pilus retraction motor PilT suggest large domain movements and subunit cooperation drive motility.
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Protein transport
total genus 84
structure length 343
sequence length 350
ec nomenclature
pdb deposition date 2005-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00437 T2SSE Type II/IV secretion system protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.90 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2ewwA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2ewwA02
1QHHA 1R5OA 1VG8A 1P60A 5J4HA 4OL0A 4EDHA 4V0LA 2NIPA 4DWJA 4F7WA 2V1XA 4KFSA 5FTKA 3DO6A 1L4YA 2FG5A 4BPBA 3BRWD 3K09A 3B1VA 3HWSA 2LCFA 3AF1A 4WA7A 2MSCB 1E9RA 3A4NA 3OHMA 4BRUA 4FCVA 2FFAA 4BE7B 1XX6A 4EPWA 4EPXA 3OIYA 1ANKA 1DAHA 3K0EA 2CCJA 2YKGA 5M04A 1J7KA 3NEYA 1G7RA 1QF9A 1XRJA 5DHAA 1US8B 2C98A 5AJXA 5SZHB 1X86B 3CR7A 5HKKA 4AKIA 1G7SA 1G9XA 5C4GB 1OFIA 2H57A 1NVUQ 4FMDB 4TL9A 2VP0A 2QP3A 3THYA 5JCZA 5P21A 4LPSA 2REBA 4GNKA 3Q3JB 4IJMA 2A2ZA 5K8UA 2ZTSA 3BB3A 4GI7A 1VYUA 1ZUHA 3SJZA 3CRQA 1XMVA 1P73A 1KI3A 1GRNA 1UDXA 4DEYA 3F5FA 3QVUA 4LHWA 4LCBA 5HZKA 2IXEA 2WPDA 1COWA 3IPXA 1E2HA 1KK2A 2AR7A 3REGA 4IHQA 4UXJA 2GCOA 4PPNA 4TYWA 2FZLA 4PHFA 4D0GA 2QMHA 4LY6A 2XXAA 3UMSA 2G9NA 1W2HA 2JAQA 1KI6B 4P32A 2WM9B 3AF3A 3KKOA 3L8ZA 2VHUA 1JALA 1X3SA 4A0HA 3PR1A 4LYFA 1MRSA 1RFLA 2MMGA 3VNVA 3QI2A 4M1WA 4IDOA 2BBOA 2HXYA 3U3JA 1KKLA 3OFND 3QF7A 4QXAA 2ZEJA 4PC2A 1YE8A 2IYXA 4XVRA 4ESHA 4URVR 2EVWX 1SVWA 1XU4A 2JIZD 4M2LA 4E5UA 4DLZA 5B30A 1U9IC 1NN1A 4BZXA 2B8TA 4MKGA 5LB4A 2E9SA 1G5PA 3KJHA 1RRCA 1VKJA 3A37A 1JAHA 1JPNA 3KUDA 1F2TB 1G8YA 1GILA 2I1QA 4EAQA 1T6NA 1YZLA 4QGGA 3ZQ6A 2W2TA 4RKEA 2Z4RA 3KKQA 2ZR0A 4R71A 5SZIA 3M0EA 4LJ6A 1W47A 3T1VA 2NPIA 1G41A 4RJLA 3DMDA 5DHFA 2LKCA 3BB4A 4HATA 4UNPA 3P26A 1GTVA 2QY9A 3CLVA 3L0SA 2IYUA 4B6EA 4H9GA 1CBUA 2DY1A 2O0KA 3I92A 1V43A 2C9YA 3C4JA 4AURA 4ARZA 2VEDA 1C9KA 3N5CA 1XMJA 4G5SA 5BN5A 3TMKA 2CK3D 3BJIC 1OFUX 1QVRA 1D2MA 1IAQA 4US0R 3PXGA 3QPVA 4KFTA 3LXRA 3GLIA 4NYJR 1M7HA 1Q1EA 5JHHB 1ZM3A 2GZDA 3ZS8A 4PAMA 4LHVA 1DG3A 3K09C 1SXJA 5L3VA 5ANRB 3U7GA 1TPZA 3FHOA 4P4UA 4IFBA 4DCTA 3EC1A 5CDFA 1WBDA 5LD2C 3UG6A 1SKYB 2ECKA 4DEXA 4KU4A 2W2XA 4XD7A 2IL1A 2BMFA 2P2LA 2JCSA 4IDHA 2CLCX 2FN4A 2ZJYA 2IYRA 3K9GA 1AS3A 3EXAA 1SHZA 4HAVA 1QZXA 1CKEA 1XMIA 2WWGA 4E09A 3O8BA 1YR8A 3E5HA 3HDTA 1G64A 1JR3D 3NIBA 3A1UA 3D7MA 3K0FB 2F1IA 4LWZA 1CIPA 3DEFA 2XZLA 1F60A 1FFHA 3AKCA 3B7GA 3SC3A 2X1VA 3B2EA 3W6PA 3MWYW 1W4AA 3C41J 3TSWA 4UNRA 2H1LA 2VP2A 5HCIA 2RH5A 5KDLA 4OI4A 2IX3A 1W4RA 2PT5A 1SVKA 2OCBA 2WJIA 4P4SB 3RAPR 5FUYA 2W6ID 5LPNA 4PSVA 3VFDA 4KXFB 4B3CA 3JZMA 4GFDA 2JLYA 4IEEA 4B2IA 5IK2D 4QJ4A 3G82C 3HYRA 4KV9A 4I4LA 4F4JA 2ZSEA 3RVBA 1RC8A 4L16A 3QSYA 1XXHA 2OBMA 4ZDWA 3R9XA 2GJSA 2AN9A 4DDTA 3RABA 4DLXA 1Z0IA 3E70C 1MABA 3T06B 4DLRA 5J4LA 1W48A 3OESA 1E1QD 2PBRA 4ITRC 4YDHB 2ZU6A 4KLNA 3TBKA 4C0JA 2OAQ1 1FOEB 1RVDA 4LYAA 1A2BA 1X1RA 2V6IA 1KK1A 1JECA 4QG7A 3ZZ0A 2V9PA 1ZINA 5AJWA 3ZDQA 3C16C 2X77A 3GJ6A 3DZDA 3P27A 1YZKA 3RRMA 1HQYE 5AUQA 2J7PA 1FTNA 3FYHA 1AJEA 2HCBA 5C4MA 3K0AB 4JS0A 4B34A 3BAFA 5TV2A 1ZIPA 2HYIC 3UANA 1X8LA 3I4LA 3KQHA 5GJCA 4DLUA 2W2VA 2WMOB 3W6OA 1GRQA 2ZS7A 3CONA 3ZD7A 3QKSB 621PA 3V4RA 1CULC 2AD1A 4DHEA 1WMSA 3QXHA 3K70C 1OFHA 1E9AA 4LJAA 4A2QA 3L0OA 4KI0A 4Z1MD 3U44B 1B0UA 2WJYA 4FMCF 2DR3A 1ZAKA 4LBVA 4Q1DA 2XTNA 2ZE8A 1Z22A 3Q7QA 3PJRA 3BBPA 3FWYA 1P4SA 1SXJC 1N6RA 2DPXA 4DIEA 2OAP1 1NN5A 5B64A 4M9SA 3CX8A 3Q5DA 4Q9IA 1ZVQA 3AVYA 4ON9A 1OIXA 3T12A 1QHIA 3LW7A 5DE3A 1SQ5A 3O8DA 1TNDA 1KDOA 5JS7A 3THOA 3MWJA 2JLZA 3BXZA 1LW7A 4PC3A 2VP4A 2GXQA 2PX3A 3GLHE 2XSZD 1KZGB 1CR0A 4GOJA 5J5CA 4V02A 2NO7A 4D6PA 1JEEA 2RAPA 2BM0A 1M8PA 1AA9A 1II8A 4V0OA 1YZNA 1CU1A 2QSZA 1MKYA 2XJ4A 4HZUA 4GT1A 2EFHB 2F3RA 1NVVR 1E3MA 1MO6A 2VP6A 4EPRA 5JJKA 4TMZA 3RNLA 3QXXA 2ZJBA 4BLQA 5C18A 5JHGB 2PCJA 5JCPA 1XP8A 4R2HA 2QBYA 5FUVA 2IK8A 3LO5A 3Q72A 2WKQA 3FKSA 3W3AA 1P6XA 3CPEA 4KYIB 2ONJA 3WYAA 3NC0C 2EWWA 1JI0A 1XNJA 2PH1A 1EG7A 5FBVB 4AD8A 3ETLA 5GJVC 1E79D 1KO7A 1UADA 4ZKEA 4NP6A 3IILA 4LBZA 4DB4A 1CRPA 3L2OB 2O8BB 4PC6A 1EFTA 1H8HA 1Z83A 1CS4C 4LV8B 3EZ9A 4GP6A 3BH6A 3TQFA 4EPYA 2QRNA 2BKUA 3AP1A 3D3QA 4RD0A 1F5NA 4MH0R 1DO0A 1XD8A 1UDWA 1X1SA 5FTMA 1TU3A 3A8TA 1N0WA 3KXKA 4LJYA 3NG1A 5KPDA 4XWOA 3VR2A 1VHTA 2R2AA 2RGGA 3CX6A 1D2NA 4JVNA 2YOHA 3TNFA 3PFIA 2GJ9A 2O8DA 1GWNA 3DPUA 1GM5A 3NH6A 3WNCA 1LF0A 2CL7X 3WBJA 5CDFE 2UZ3A 1NRJB 4JVSB 2RGXA 2J46A 1UKVY 2IHBA 4PC7A 4KITB 1PVOA 5TDHA 3WMEA 4A0GA 1JJVA 1FX0A 3ZIAD 5FR1A 2ZJ5A 1SVLA 1ZYUA 1N6PA 2CJWA 2NO0A 1UF9A 4FMBB 3SHFA 4C0LA 1KY2A 1VYTA 1DAFA 3RRYA 2O8EA 4IDPA 4A8JA 1KDPA 4IOKA 3UPUA 1G8PA 4DUGD 5FPSA 2EYUA 2CHVA 4L5BA 4PSKA 3F3YA 4GRAA 2DWQA 2PEYA 5F2EA 1A1VA 4RD2A 1DELA 3KX2A 4Z8YA 3SJBA 4QC2A 2WJJA 1WCV1 2X2FA 4XSGA 2WWYA 4CEIB 1W49A 4XJXA 1E1RD 1YKSA 2AFHE 2QZ4A 2ZROA 1XF9A 1Z2AA 2ZUCA 4JJZA 3GFOA 3KKMA 4MYCA 4NHOA 4ZCLA 5JWHA 3JVUA 1WF3A 4F4IA 2ZRGA 3SR0A 2X19A 1KHTA 4CT4B 2OV2A 5J40A 4XSHA 4KFUA 3I61A 1G4AE 4QHYA 5B57C 5KU1A 4V0ME 5H70A 4LHYA 4QM6A 3RANA 4WZAE 4JLBA 4OI1A 1E9CA 4NU0A 521PA 4UQOA 4EQ6A 1JEDA 4K81B 4URXR 1XJCA 5BQ5A 3AGPA 3THXB 1R4AA 5CK5A 4D80A 1KJYA 2CE2X 2QM8A 3IKJA 1CJKC 2ZRKA 3TQCA 5TXGA 3VR4A 4GZLA 2AX4A 2FFQA 2Q3MA 3TE6A 3CBQA 4XVUA 1G3RA 2C99A 4B6FA 2ZJZA 2AK2A 1W36D 1EWQA 4PFSA 2ZAOA 4FWTA 4QKQA 1EFRD 2ZREA 4ZDIA 2C2HA 2FX3A 2BJVA 3EG5A 3MJHA 4TQAA 3RS7A 3T34A 4Q1CA 5C2JB 4Q48A 3AVTA 2GESA 2VSXA 4EFMA 2R9VA 4QHSA 2W0MA 2FE4A 4JJKA 1BO6A 3GJ0A 1BIFA 4IXMA 4LGMA 2P5TB 4GDFA 1NVWQ 1P7CA 2YOFA 3LX8A 3GFPA 4IEIA 2F55A 4PSAA 3IPYA 1FW6A 1IN8A 1XJQA 4R2IA 4ZCMA 4BRWA 1TAGA 2NTYC 4D0NA 2Q21A 3H0KA 5HR5A 1OYYA 1Z5ZA 4Q4AB 4F91B 3TW8B 1OLOA 2P5SA 4Q1BA 4XH9B 2E1RA 3WNBA 3RS3A 5CYOA 5B58C 4OQXA 5DN6D 4M1KA 2G6BA 2CCGA 2RGDA 2J0SA 4HAYA 4Q1FA 2O8FA 4QGHA 3NVAA 2R6DA 4FW9A 3KJEA 2IC5A 2F1RA 1RKBA 4B3DA 1OIVA 4DSUA 3LA6A 1TX4B 4NCNA 1MT0A 3HU1A 5J4VA 5EXSA 1GFIA 4C0QC 1OT3A 2H5EA 4Q01A 3RS5A 1W2GA 4TTRA 3TH5A 5L3RA 1NSFA 4AG5A 4P4TA 4C30A 1OYWA 3LLUA 4AWXA 2XB2A 2GEDA 4MYHA 3NH9A 3NHAA 4NYIQ 3OEHA 4Q7KA 1W0JD 1Z8FA 5FI1B 3T1TA 4WXRA 4A8JC 2NO9A 1P62B 4DLTA 1SULA 3X1DA 4DB2A 3PUZA 2CVHA 2P3SA 2IHYA 2C03A 4IRUB 4YMSA 1G21E 1GG2A 1NSTA 2OFWA 3TAUA 1AKYA 1TADA 4DC9A 1E2DA 1G19A 1QDEA 1YU9A 3RS2A 1J99A 1I4TD 2IT1A 3VU9B 2QPOA 3H1TA 2OHFA 4BASA 4JYBA 4BLTA 3V9PA 5F98A 1GL7A 4LYJA 5EXXA 1ZU4A 4D81A 2FPKA 1VCMA 3OFNA 4G01B 1OXUA 4URUR 2QP4A 1H8ED 3BIFA 3QBVA 4HI0E 1GRRA 2ZYUX 3DVLA 1R0XA 2JIZA 2P6UA 2FPLA 4IW3B 4MYTA 5G3ZA 2JEOA 1DVRA 1T3LA 3MWKA 5EP1A 1R0ZA 4X8HA 4NKRA 2FPMA 2J0QA 5GVSA 4NYIR 4US2R 4WBSA 2IS4A 1DG1G 2QGZA 2KBEA 1F2UB 1XPOA 2QTHA 3U5ZB 2ZITA 2DCUA 4OJKA 1KNXA 2RGEA 1GOTA 1S9DA 4TSFD 3GLHB 2Q3FA 5DO9A 1P3JA 4Q47A 3TJZA 4UJ5A 3UWKA 1BYIA 1OHHD 3MLEA 5L3QA 1NVXQ 5A4JA 4OHWA 3T15A 3AVUA 2HJGA 1E2PA 2GRJA 1N0VC 3EIEA 3KB2A 1LS6A 4CDGA 2OG2A 5HZHA 2CK3A 1VG9B 1Z6XA 4OK5A 1Q3TA 3EA5A 1X8JA 4A6XA 4CGZA 1Z47A 4HZIA 2AKAB 2O5VA 3FMFA 3BOSA 3W5JA 1JAIA 3CZPA 3AF4A 4U00A 2KJQA 1N6OA 3L82B 4MUAA 1U0HC 1FNNA 2ZPTX 2C9OA 4ACBA 3A36A 5KTYA 4OYHA 4BLRA 2W0SA 2ASEA 1CR4A 3M6AA 3L43A 4KVAA 2ZM5A 3RYTC 1G7TA 1R6BX 1FQKA 4HLCA 5E95A 4B35A 1RRPA 4RZUA 5TY0A 3ZZTA 2W83A 4KBGA 3FMOB 2OLJA 5B2ZA 3RSOA 4OJQA 1T0JB 3TLXA 1JR3A 3PVSA 4M9QA 2JLUA 2ZRLA 2WKRA 3MJRA 1XMSA 1A2KC 1KAOA 3I8SA 4C0AC 3E1SA 4K46A 4URZR 4DJTA 3R20A 2J0UB 2IWRA 2HJVA 2XJ9A 4Y0AA 2EFEB 4UNSA 4OHYA 4PTLA 4Z8XA 3WP1B 4X8MA 3Q85A 1SHKA 2WJHA 4W7SA 4RKFA 2B8WA 1BS1A 2R6CA 5F9HA 1NN3A 1UM8A 2Z83A 1FZQA 4HB3A 3QF4A 5EUMA 2JJ1D 5FUWA 3ICQB 4AKGA 2V7QD 1UBCA 4ZIRB 1QRAA 1K6MA 4C0SA 2Q9BA 1RYHA 1KMQA 1UEJA 5AJZA 5IK2A 1NBME 1VCOA 3ZVMA 1N6LA 2FGKA 3S1AA 2KBFA 3LY5A 1T3SA 1RJ9B 3UXMA 2KSQA 3B1WA 1CEEA 3I72A 4LJ5A 3L8YA 5E7JA 1S4QA 4ZDJA 3BERA 3TUJC 3BWDD 4JLNA 2Y8EA 2ZR7A 4OI0A 2EWVA 3OIVA 3BH0A 5BW8A 2BOVA 3DDCA 2GJKA 2HEIA 2WOJA 3VX3A 1E0KA 2YZ2A 3CB4A 3CUEF 4ASUD 3QKRA 3SBEA 1ZUIA 4DLWA 4NYMR 3X1WA 1RPZA 1W36B 4GZMA 3I32A 3CIOA 2NGRA 4NH0A 3MGCA 2OZEA 1OIWA 1QHXA 1Z0KA 4N0DA 4Q7JB 3TGPA 2VBCA 1K5DA 1XTRA 1H65A 1KMHB 3LBNA 3GLFA 3AP2A 2ANCA 1F3OA 3M1IA 1Q1ZA 2QE7D 1YZTA 3DM9B 3X1YA 2QN6A 2ZU0C 4YMTA 1XEFA 3EPLA 1QHGA 3LFUA 2AK3A 1QHNA 3QXJA 4M21A 1UAAA 1UBFA 4C2TA 1FMLA 4D4MA 4RFSB 5UKDA 4PHTA 1EWRA 2ZI5A 2GK6A 2ZRFA 3EASA 4DT1B 4LDJA 3WRXC 4Z1MA 3PEYA 4I1OA 1Z6TA 4MQBA 2ANBA 5JEDA 4MDEA 1KI7A 2VA8A 3ASZA 3B9QA 5AJVB 4OHZA 4ACAA 2HT1A 1GITA 1J8MF 3MSXA 3LBIA 2W00A 4V0NA 2I4IA 5C46F 1KO4A 1KNQA 4HB4A 5FOTA 3NHBA 4AG6A 1S3GA 3B1ZA 3PV0A 4M9XA 1G8HA 2WWHA 3DOFA 1W44A 1Z63A 3AM1A 3HPRA 2OSBA 4TMVA 3VNUA 3K1JA 1CJVC 1E2LA 1W4CA 1XFAA 1XEXB 5GJWC 4GL2A 2VQSA 2IYYA 5GJBA 3LDAA 3U3MA 1GP2A 3ZH9B 1E69A 4A9AA 3UG7A 2PLRA 2XSZA 1FP6A 2QRZA 4LBYA 5D3MA 5CB6A 4BFUA 2FF7A 5G40A 3QBTA 4DDVA 3IO3A 2QPTA 1NLFA 3BFKA 2EFCB 3VR3A 3U4QB 2F1HA 5FOSA 5JBQA 2OESA 1IY1A 3F0TA 3EWAA 2WVJA 1A7JA 1U0JA 3GD7A 4URWR 4B3BA 3P4XA 2YNMA 3NDPA 1WE2A 2ZE7A 4CW7A 3GEHA 1G1MA 3CRMA 3QG1A 2AHOA 2G77B 4JBWA 1PLKA 2OCYC 3E2IA 3KTAA 4YXWD 4L15A 1L7VC 2J59A 3PIRA 3LVQE 2IUTA 2XNDD 5DGXA 1YJ5A 4Z51A 4JYCA 3U3KA 1E79A 3KFVA 2XEXA 3AUYA 3MCAA 5K8TA 4W5HA 1ZM7A 1M1YE 3QNUA 2ZRJA 3WYFA 1J90A 1N6IA 1R2QA 1IN4A 2RGAA 2FSFA 1B23P 5EZ5A 2DWPA 2WSSD 3A6PC 4RCZA 2QAGA 2H17A 2HLDA 5KSOA 2GCNA 4LJ4A 2OFXA 4PPFA 1FNMA 3IDQA 4OI2A 3T35A 1UKZA 4CEHA 4TMWA 1E2EA 4HAXA 4U5XA 3ONWA 3CF2A 1W4BA 3A4LA 4XTRA 2JLXA 2CEAA 3QKTA 4NL4H 3ICEA 5EP4A 4C0HA 3GLGB 4FWIB 1N6HA 1G6OA 1IY0A 3D31A 4PZLA 3IHLA 1HUQA 2VLIA 2IS1A 3ZIAA 2ZIAA 2RGCA 4IVQA 4L4UA 1NJFA 4G5OA 3N2IA 1Z0DA 4F92B 3LWNA 2QG6A 2CNWD 1XEWX 1N6NA 1T91A 2D74A 3GEIA 5FPTA 4RD3A 1QHYA 1N6KA 3B9PA 5FOVA 4DUGA 4C2UA 1U99A 4P31A 1N3BA 1XTJA 3SDZA 3L0PA 4TTPA 2ZRMA 2QENA 2JASA 3BFXA 5TMPA 2I3BA 2OEPA 2WAXA 3WY9A 1IQPA 3BORA 1G8FA 2O8CA 2J7KA 2ODBA 3EZFA 1ONBA 2JDIA 1AQYA 1JQLB 2KI5A 3FE2A 3QXSA 4GMDA 1OH5A 1II0A 1UBEA 2ZJAA 4W9MC 5JSZA 1RRFA 3KL4A 1Q22A 1QG2A 2QAJA 3LX5A 4RD6A 1ZNYA 4QM7A 5EXPA 1M74A 4PPGA 5BXQC 4BFTA 4F38A 1E1RA 2GCPA 3U3RA 4EJSA 4RVCA 2C8VA 2ZVQX 4DCSA 1VG1A 4NDZA 2VRWA 4XIGS 5DI3B 4I81A 2ZRBA 2CHGA 1HV8A 3UIEA 1GSIA 1XPUA 2NQ2C 3AKDA 3V4FA 5BN4A 3OEED 2V54A 1ZCAA 4CEJA 4R98A 3UWOA 3X1XA 2GETA 2QM7A 1T4GA 1ZJ6A 3A1SA 4MKFA 1P2UA 2CXXA 1XWIA 3QG5A 4HLQB 3AF0A 4D4KA 4BFVA 1XEWY 2WHXA 2ZRIA 2IXFA 4E07A 4A0FA 3GLFE 1IOZA 2IF2A 1PZNA 3TUZC 5JI2E 3QPUA 1CLUA 5KNBA 1D6JA 1EFRA 2BIFA 3BS4A 4TLDA 4HLDA 2QPAA 5KDOA 1XTQA 4FCTA 4ZO4A 5CYPA 1NNEA 1KDRA 4G5GA 1GDDA 4B32A 4JLVA 2PZEA 3DMNA 4V0KA 4AI6A 3TUIC 3TSOA 4Q4JB 3CZQA 3LW8A 3UK6A 2KE5A 3KQUA 1XD9A 4DZZA 2VO1A 5CIQA 4TLCA 2QAGC 1IM2A 4JBYA 1EESA 3PENA 2HUPA 2DFLA 3IIMA 3AEZA 4B74A 3LBHA 4FIDA 5DNYB 1YZUA 5LBIA 4IKEA 4JIMA 2WJGA 2PMKA 4IDQA 2PX0A 3EZ7A 5DN6A 3EC2A 1US8A 2EYQA 2E87A 2QTVB 4JBXA 2CVFA 2QEQA 2Z5FA 2G1JA 3A1WA 2QT1A 4TL8A 1ZM2A 3WBKA 1HA3A 4QGAA 5FBRB 3RC8A 5FBLB 4G0NA 3B60A 4YDSA 3DL0A 3UMFA 1I2MA 4B33A 1YRBA 3RSLA 4B47A 4HUQB 1A82A 3A1TA 1OXXK 2WSMA 1R7RA 4NCHA 4QHTA 1JJ7A 1Y3AA 4XVQA 2QU8A 5EJEA 3R7WB 2IBMA 3PEVA 4QFMA 1VPLA 3U6BA 1KJZA 3ND8A 4W5WA 1G3QA 1LF5A 1W0JA 3TR5A 1FQJA 1QG4A 1X8KA 1G8GA 1KJWA 4OQNA 3NXSA 3AVOA 3GJ3A 1NJGA 4V03A 2ZYWX 3KXLA 4BFSA 1TQ4A 2BC9A 4D82A 2OE2A 1IXZA 1KI6A 1HQCA 2ORIA 3DZ8A 1XCMA 4Y0VA 4M4SA 3O47A 4RZXA 5FOXA 3CX7A 1W46A 5G53C 4NPHA 5E4FA 3THWB 2V6JA 2IA5A 4YMVA 4DXAA 2WICA 5BWMA 1E94E 5KNCA 3K9NA 2V3CC 3GPLA 3OZXA 4C7OB 1IBRA 4QRHA 1H8EA 4EJSC 2JJ2D 3RDPA 4HB2A 1EFHA 1Z6AA 1EFUA 2ZVPX 3AVPA 1W5TA 3QQ5A 1G3IA 3CM0A 4PX9A 4IVPA 5KDDA 2V1UA 1CR2A 1P2TA 4P0TA 4W5JA 3U6KA 3ADDA 1F2TA 5EP2A 1PJRA 2VHQA 1KI1A 4OQMA 3SHWA 5LDDC 2OFOA 1Q3HA 1KI8A 3I8XA 1Y63A 1W0KD 4TSFA 3UKDA 4JL6A 1PLLA 5JEEA 1KGDA 1OHHA 2G88A 1Z28A 2FMXA 1ZCBA 2YOGA 4B3FX 4CYMA 3OE7D 1KTVA 2EW1A 4DSNA 2ZI3A 3KQNA 3AGQA 5KSPA 3VTKA 1Z0JA 1W36C 1ESMA 3CW2A 2CCKA 1K5GA 2GDJA 3HU3A 3GLIE 3AQ4A 4Q1EA 2ZI4A 4E03A 4WW0A 5AUNB 1VECA 1KI2A 1KDTA 2V8OA 4JT4A 1E6CA 4JT2A 1SXJE 2XZPA 1S1MA 1OB5A 2P65A 3B78A 1T9HA 2ZJOA 4ABYA 1S2MA 1II9A 3QPWA 4HLUC 5FTLA 2ERYA 3PEWA 4JKYA 5FR2A 3NBZC 4G5QA 2PT7A 4C3ZA 4EPVA 2WZQA 1S96A 3QOFA 2GZAA 4Q5IA 4QBGB 3ZS9A 4XWKA 1HYQA 2AXPA 1JNYA 2YWEA 1ZP6A 1NY5A 1E0SA 3JZAA 2IEZA 3EIHA 3CH4B 3QE0A 5K8LA 1ZC3A 3SJAA 3TVTA 2BV3A 1SVMA 4RSGA 1FUKA 2VTKA 2XZOA 1NMYA 4TTQA 1DTSA 1DAMA 1MR3F 2AWNA 1ZUNB 1P2SA 3K0FA 3BC1A 4EKDA 3WNDA 3B1YA 4HEJA 5G41A 3R8CA 4B48A 4C0KA 3QXCA 4H1VA 1IXSB 4BEJA 4A2WA 3I62A 1SVSA 3U60B 4A1FA 1DBSA 1E2GA 1OXSC 5JLJA 5EP3A 2A9KA 4KCGA 2BKEA 3SQXA 1UFQA 1R0YA 2JJ1A 1ZRHA 2ORWA 4DSTA 2V7QA 5E7IA 4M9ZA 4P4SA 1XXHE 2PZGA 5EQTA 3K8YA 2ZS9A 3WYGA 3L0IB 3ASYA 4GP7A 2CLDX 1MO5A 4OQLA 1JQJC 3KUCA 4UXHA 2GXUA 2ZSFA 4TT3D 4UNQA 2RB4A 2NPFA 3SYLA 1G7CA 3GJ4A 3HPQA 2PL3A 4ZKDA 3FDIA 2H92A 4WVFA 4M1SA 3WXMA 1YVDA 1AN0A 2FZ4A 2BBTA 4MGIR 2PZFA 1JPJA 4HAZA 3EA0A 4ASUA 2H18A 2JLVA 5L3SB 2OM2A 4Q4HB 1R5BA 5J4YA 2OO7A 5EUQB 1O87A 2BDTA 5JRZA 2MSDB 3VAAA 5HTKA 4YMUA 2BVNA 1L4UA 3AUXA 1E9SA 2G3YA 2JLSA 3K0AA 4NONA 1BMFD 2QE7A 5TARA 4KSCA 2PJRA 3TAHA 1KO8A 5EXTA 2WWIA 2NMVA 3PITA 4JSYA 3FPAA 3EPJA 3QKSA 1AK2A 1DAEA 1SVIA 2ATXA 2OXCA 4FMCB 1TF2A 1AKEA 2CMKA 2FFBA 2RGNA 2BMDA 3KQKA 2B92A 4YONB 3WHLA 2WMNB 2GAOA 3KDSE 5JS8A 3AKYA 1AIPA 3HR7A 1E99A 1TEVA 1AS0A 1L8QA 1TEXA 1XD2B 4BQSA 3U44A 3MG9A 3CNOA 2HV8A 1TTTA 1D9ZA 5KSYA 4O25A 2OBNA 1Z6GA 3ZJYA 3U7FB 1I4LD 1QHHB 4JLDA 4NCKA 4QBHA 3J81k 3GLFB 5JFGA 5IT5A 3IBGA 2G0TA 1Z07A 4L9SA 2NG1A 4MKHA 2NO6A 4DIDA 1G3MA 3SI7A 4POAA 5CLLA 2VF8A 4R7ZA 3N70A 4HAUA 3QEOA 1GL9B 2JATA 3TSZA 2ZUDA 2QT0A 2IUSA 5TB5A 4KFRA 2IYVA 1GKUB 2OILA 3R9IA 1VIAA 1W7AA 2HXSA 1KK3A 2CL6X 3FB4A 4L8GA 4PC1A 2F9MA 4WXPA 4HB0A 1Q0UA 1V5WA 1CXZA 1TQDA 2J9RA 2GF9A 4OBEA 1UKYA 2J3EA 1KZ7B 5FI0B 1OH7A 3C14C 4PXAA 3AB3A 2D06A 3THYB 2R6FA 1CJTC 2GKSA 3ZGXA 4YMWA 3NKVA 2VL7A 2XNDA 2MMCA 1XB2A 4FMDF 4AIIA 3U7HB 2AL7A 1P9WA 2SHKA 4AKEA 1CRQA 2B21A 4FXPA 2CLSA 4FI3C 2FH5B 4KODA 3AF2A 5H1YA 4PAQA 4ZPXA 4AK9A 4LJ8A 4M53A 2O8BA 4Q9KA 3OIUA 2GCOB 4A4DA 2XXAB 2WSSA 1TL7C 4JKIA 2EQBA 1S8FA 1T8TA 5DIFA 4C0BA 2AWOA 4TLBA 4LRWA 2PLFA 2QL6A 1E4YA 4MGYR 5JMTA 3W34A 1RIFA 2BJWA 4DLSA 3IQWA 1VIYA 5JECA 3PUYA 4KJZA 3FKSD 3KJGA 1KI4A 1S3SA 1NKSA 1G291 3K0CA 2JA1A 4RD4A 4NCJA 4IDNA 3RRNA 5IHPA 2N46A 3MMPA 5IDVA 1W5SA 1KO5A 5E3HA 3GJXC 1KAGA 1G4UR 2ODEA 3O8RA 3P4YA 3PUWA 4D4LA 3T1QA 1NIJA 4EFNA 3K9LA 4ESVA 3CR8A 1CP2A 1OJLA 5A5GA 2RGNC 1EX6A 3EIQA 4DRZA 2BMEA 4BLOA 4QJ5A 4LHXA 4B71A 1HT2E 3B13B 3SE0A 1E9DA 2ZUBA 3AP3A 4IVRA 1E9BA 2REXB 2D62A 1LTQA 4I1VA 4PHGA 3RS4A 3K70B 2QROA 2JJ8A 1G17A 4ARZB 2D3WA 2ZE5A 4MITA 4TZ6A 4Q18A 2OUKA 4GBMA 1X6VA 1P61B 2ZSDA 3NDBB 5CIWA 2BEKA 4TYPA 3GLIB 2IS2A 2NOAA 4CEIA 2GTPA 1FP7A 2XOKD 1SXJB 1U98A 2XGJA 1E2IA 3EZ2A 1XJ0A 3KJIA 3W5IA 2R6GA 1Q21A 4BLPA 2G0NA 3Q7PA 4M8NE 2QORA 4LJ7A 1N5KA 2W6IA 121PA 3SBDA 5DYIA 3OEEA 4CIDA 2JLQA 1UJ2A 3TVDA 2R65A 2J0VA 1N5LA 3NBXX 2K5UA 1PLJA 2VP9A 1AS2A 4XOIA 4HDOB 5KNDA 3HP1A 3IGFA 1E9FA 4MRNA 1GAJA 3THXA 2C96A 3FMIA 3N2EA 3EWSA 1D9XA 5BYKA 3GMTA 5ELXA 4HUTA 1E1QA 2X8AA 2ERXA 4AC9A 1D8TA 3MWLA 3NTUA 3TIFA 1JXOA 1ZNXA 3VR1A 5DYGA 3ADCA 3IEUA 2WTUA 2WWWA 4D0LB 4YLGA 1NIPA 3B5JA 2YV5A 1GKIA 3WHKA 3QJYA 4MRPA 4HDCA 2ZXUA 4Q7LA 5J4KA 4TL7A 2CE7A 1EX7A 1P2VA 4AYWA 1HY3A 1N0UA 1FUUA 2ORVA 3P1JA 4O3MA 1NLYA 3LAWA 5F3WB 4WIAA 3AVWA 4HSEA 1XXHB 5TVKA 2FV8A 4XWAA 3U61B 1JB1A 1KSJA 2LKDA 2ZS8A 3KXIA 4JZKA 4KYUA 1MABB 5KSZA 1UPTA 5CM8B 1DS6A 3VR5A 1NBMD 2VHJA 4DCVA 2HF9A 3EARA 4Q4AA 421PA 2GK7A 3AVVA 3K0CC 1SGWA 1YZQA 1Q1BA 4Z54A 5FL7D 1BYUA 2CDNA 2RHDA 1IJFA 4AYXA 4DCNA 2QP9X 3X1ZA 721PA 3G5UA 3DKVA 4JLMA 5DI9A 2WWXA 1OXTA 2WIBA 1KSHA 4LPKA 2HDNB 4DKXA 4EIWA 2H8KA 3UATA 2ZQ5A 3GQBA 1Z6YA 5FUXA 3KB1A 4TYNA 1WRBA 3SEAA 3I5YA 4UXIA 1KYIA 2IXGA 3VX4A 2A30A 3FFBA 5BN3A 4C9BA 3SNHA 3RRZA 1Z29A 1VG0B 4OHVA 1ZD1A 5IF9A 2C04A 1CJUC 3OAAD 1QBKC 1U8ZA 4RFVA 4Q03A 1JXMA 2F43A 1ZNWA 1SKQA 3I1FA 3K9HA 4Q1AA 3QIAA 4E22A 1EGAA 4TWZA 1N2CE 4PR0A 4O0MA 2R6AA 3CNLA 5AR1A 3O8CA 2NZ8A 4QBIA 3VU9A 3X2SA 1U0LA 2KB0A 3CPJB 5FOWA 2RHMA 2XTMA 3NBFA 3OF5A 2A78A 1M34E 1NMXA 3UMRA 1Z0FA 3GFTA 2JJ2A 4CF7A 4IXNA 2F6RA 4WOPA 3EPHA 3KKNA 4HAWA 4ZI2A 3VKGA 2IS6A 3IQXA 4FCWA 2FOLA 2HYDA 4ZV4A 4CRWB 2C77A 2ZI6A 1DARA 4LOAA 3OEHD 1F48A 1P75A 1U94A 2UZIR 2QMEA 3T5GA 3DM5A 2QQ0A 1R8QA 221PA 3EPKA 1HURA 1DAIA 1F2UA 4IOLA 1DAKA 3AVXA 1W0KA 1E2KA 3GJ8A 2BCGY 4G3XA 3GLHA 5DSZA 1II8B 3OE7A 1S0UA 2VF7A 3EW9A 3NWJA 4HZUB 2VHTA 1U90A 1W1WA 2GJ8A 3A1VA 2RCNA 2ZJ8A 2PJZA 1RE0A 4KVGA 3SOPA 5FPKA 1IONA 4M1TA 2J45A 3SJCA 2BWJA 2QBYB 2RGBA 1OPXA 4M0LA 1T8UA 3FVQA 3V00A 2A5JA 3IEVA 1KY3A 1XCPA 4NYJQ 3VKWA 4JL8A 4B75A 3I73A 4G5RA 4H1UA 4MRVA 2IUUA 2YHSA 2W6JD 1E98A 1LY1A 4LZZA 3SFVA 3DHWC 4PAOA 2AXNA 4DSOA 5FOUA 4DBLC 1AZSC 4MRRA 1TU4A 4M1YA 2FSIA 1YZGA 3GEEA 4LX0A 5CK4A 2XNSA 3TRFA 4P3YA 1G16A 1OB2A 3OIWA 4PANA 3SZRA 1KOFA 2BBSA 1BOFA 2OT3B 1M7BA 2ZR9A 1ZD9A 1ZM4A 1JR3E 5EE3A 2YWFA 4AKHA 2IEYA 3KFXA 3H86A 4PO9A 1DE0A 4MRSA 5SZKB 3TKLA 2GVZC 3PEUA 2FGJA 1ZD8A 3HU2A 2IYLD 4NBSA 4TN1A 2QTFA 5DH9A 4YQFA 4N0EA 1E32A 2O8DB 2GBLA 2BBWA 3PQCA 3VHXA 4ZDKA 1LVGA 1D2EA 2YWHA 5FTNA 5EE9A 2J0UA 2FSGA 4TLAA 4B2LA 1Q20A 2FEOA 4Q66C 2GXAA 2VPPA 2YC4C 4C4PA 1FX0B 2QQEA 3MFYA 4Q00A 4LC1A 4Q21A 5KOYA 2AFIE 1VDZA 2VHCA 1J2JA 2ATVA 5IRCD 4B43A 2CJWB 4TQUS 4ZIRA 2Z4SA 1NY6A 3ZD6A 1ZC4A 2F7SA 2CBZA 4MGZR 2F3TA 1OKKD 1IHUA 1M6NA 2CL0X 2WOOA 5C1BA 1NMZA 3LRPA 5FH9A 2O8EB 4M1MA 3HR8A 4X8OA 4A8JB 1G3UA 4N3NA 1LB1B 1VTKA 1MO3A 4TT3A 1E2JA 2C5LA 1ETUA 2R44A 1E2FA 1RJ9A 4TQ9A 3RWMB 4A15A 1RZ3A 1N5IA 1TUEA 2P67A 3WP0A 1DAGA 2RKOA 5JJIA 5JJLA 1SVOA 3PUVA 3BE4A 2ODWA 1OE0A 2A5YB 1TF5A 3TW4A 4US1R 4NZYA 3BH7A 3TR0A 3W3ZB 1EFCA 2VP5A 4BWYA 2MSEB 4DLVA 3SYKA 2D7CA 1Q1QA 4QL3A 2LWIA 1RYFA 2QMOA 5JZVA 1NP6A 3CRVA 1YHNA 1Q57A 2ZI7A 3U7EB 2PCLA 4HDQB 1XPRA 2GAAA 2YYZA 1CTQA 1AGPA 4PZYA 1BMFA 1KMHA 2W58A 4OK6A 1WA5A 5CM9C 5EE5B 4LHZA 1MH1A 4DVGA 1Z0AA 4A36A 1G6HA 2NZJA 1AGRA 4HLUA 1GNQA 3CF0A 4EQ6B 2PMDA 1ELOA 1G18A 3IO5A 4KSBA 4RFSA 4V0MA 4BFYA 5CITA 1P72A 2H16A 1ZNZA 4DT1A 3B8HA 4GSYA 4PO1A 4U02A 2IF0A 3W6NA 4BEBA 1T5IA 4Q7MB 3BD9A 4II7A 3A58B 2FFHA 3AV0B 2FU5C 4OK3A 3ZZUA 1HTWA 1XDBA 2D2FA 3AKEA 2ZRDA 5G3YA 4B2PA 2O0JA 5SZJA 4EFLA 1KKMA 4PQFA 1FMJA 1GIAA 3Q5EA 1XEXA 2WV9A 4NMMA 5HE9A 3K0SA 4UNNA 5FFMA 5J47A 2GEUA 1GVNB 2C9CA 3HJNA 1EK0A 3CH5A 2Q0HA 5EE0A 1WP9A 4PZZA 1E2QA 3LXXA 3VKHA 4PO8A 1ZU5A 2Q9CA 4BFZA 2VSOA 1XTKA 2GWHA 4ZCIA 3U4QA 2GBLC 1NVVQ 1NLZA 4TL6A 3NC1C 2O8FB 2L0XA 5HKKD 2DHRA 3DOEA 2GF0A 2ZETA 4OQFA 4GOKA 1U2RA 1P9NA 1P9RA 1E96A 1HH4A 1QVAA 1IN7A 4TYYA 1MOZA 3QEJA 1XTSA 4Q4LA 1N25A 1VCNA 4A92A 4O2LA 4FD2A 1ZMXA 4URYR 4DLYA 2ZAMA 1MV5A 1A4RA 2WPDD 4NCIA 4Q9JA 3G0HA 1COWD 1EXMA 4XTCS 2ZSAA 3Q8XB 4ERNA 1HEIA 1HE8B 5FPHA 5L8VA 2C78A 2GNOA 5GVRA 2FJUA 4BUJA 2Q9AA 2ZJ2A 3CNNA 1J8YF 2GXSA 3T1OA 4IFEA 3B1XA 2O52A 2CHQA 4JVLA 3F8TA 2J87A 1OFTA 5KUTA 4GPTA 2VIIA 3H2YA 3IIJA 4RZ3A 4JVMA 2UKDA 2TMKA 2BMJA 3CWZA 2IWHA 5AUPB 1D5CA 2FWRA 1E9EA 1TF7A 1JR6A 3LLMA 2X2EA 3GLGA 2XTZA 1AM4D 3SS8A 4IOJA 1C1YA 2B6HA 2R62A 1U8YA 4LK2A 1GZSA 2OCPA 5DISB 2FNAA 2D2EA 2HT6A 5DLQC 3K53A 1OH8A 1YR6A 5JRJA 3QKUA 4A6PA 2GILA 1OW3B 1MO4A 4B73A 1CR1A 4JLKA 2QI9C 4FINA 1G5RA 2XX3A 2DFKB 2HLDD 3DKPA 1NG9A 4TMXA 4MA4A 5L3QB 4WZ6A 4GMXA 1Z3IX 5A0FA 1OH6A 2H7VA 1M7GA 4CT5A 2WBLC 2ONKA 3FFAA 1YR7A 4MGKR 2QA5A 2UVQA 2ZRAA 2BM1A 3H4MA 3PG5A 4OKSA 3K70D 1XZPA 4TMKA 2WIAA 4IOMA 1OSNA 3CF6R 1GKYA 2BEJA 5D3QA 3VQTA 4LC0A 2N1BA 3FOZA 1VHLA 3RLFA 4U7DA 2IYTA 2XOKA 2OLKA 1E4VA 4PQYA 4Q9LA 2DFTA 2OCAA 3HYTA 1FL9A 1SXJD 5H68A 1T0HB 1G5TA 3C5CA 5DI3A 2JLRA 4LSGA 1R10A 5EZ6B 1UEIA 1J70A 1N5JA 1HE1C 1I2DA 5CB8A 4XD7D 1T5LA 3GJ7A 1TUIA 3RHFA 3IIKA 2D7DA 5FL3A 3QY0A 1I4DD 3ADKA 4FN5A 4EUNA 4ZI3A 5CLQA 2JGNA 3W9YA 5AJYA 2J5XA 5GADl 1A5TA 3W8NA 2JDID 3EZ6A 4P33A 1F6BA 1IN5A 5AK0A 2B7CA 2FSHA 4RD1A 1LNZA 2ZSBA 3FHCB 4JMPA 5JWOA 2VYFA 4O2RA 4B3XA 1SZPA 2DFNA 4KLZA 2A5GA 3WMFA 4RZ2A 3EAQA 3QUSA 3C5HA 3B85A 2F9LA 3WMGA 1GNPA 4TZ0A 1NN0A 3QF4B 5H8WA 4JSTA 2GVDC 3ZLJA 1NG1A 1NI3A 4KO8A 1WDTA 2WKPA 2OBLA 4KAXA 1KSGA 4S35A 4Q4JA 2J41A 2WWFA 2GZHA 4K8OA 3QENA 4UJ3A 3KQLA 4QNMA 1TMKA 2QNRA 1P5ZB 2Z6VA 3EX7C 3S1AB 4D25A 2ODNA 2EFDB 3D6TB 2GEVA 2HF8A 2VSFA 1NBMA 3W90A 2KWIA 1E2NA 2P6NA 1R8SA 3T5DA 1IY2A 5FBQB 4I1SA 2VH5R 4QNRA 1DADA 1XBTA 2Q6TA 4JLAA 4RCYA 5FL7A 4B44A 2BCJQ 3SU8A 1GL6A 2DBYA 1Q44A 2N42A 4KHZA 2P6RA 3U2QA 3KKPA 3QKRB 4S2EA 5K8IA 5EE1A 1TQ2A 2WAYA 3C7KA 2ZRPA 4M1OA 2V4ZA 1CJMA 4D4JA 5JWRA 2WJVA 4DCUA 4JLOA 4HUQA 3SYNA 3LH5A 2J7PD 4D2IA 1OV4A 3RC3A 3FMPB 3R7WA 3ZVLA 1CF4A 2REOA 1GUAA 4QOSA 1R0WA 1E0AA 1WXQA 4D26A 2QSYA 1BKDR 3OAAA 3B82A 1M2OB 5E7MA 5FPYA 3H84A 1KO1A 4LBWA 5LD2B 1S1CA 4MUBA 1YR9A 3CWQA 2Q3HA 4MKIA 1Z08A 2BHRA 3THWA 1U81A 3BFVA 5KYKA 3P20A 1WBBA 3GCGA 4GOXA 1IXRC 2Z43A 1S9HA 3U3OA 2AKYA 3AVQA 2IYSA 2ZRCA 3SFZA 1XTIA 2O0HA 4C7OA 1TQ6A 3I3SR 3CO5A 5AUOB 2YWGA 4YXWA 3C15C 3JVVA 4M22A 5HPYB 3CKLA 2IYWA 4QJ3A 5KHOC 5KPJA 3FTQA 2JLWA 3LNCA 3AH8A 1VMAA 2YINC 3MAAC 4TLEA 2D4HA 1LFDB 1DPFA 3ZQJA 1ZM9A 2GA8A 5CJPA 3LVRE 3RS0A 5D3MB 4A0RA 2F43B 4BECA 1HT1E 1GNRA 2ZRNA 1XCGB 3R8FA 3IBYA 3TK1A 4X8LA 2QGNA 4B76A 4TMTA 3IUYA 1E0JA 1L2TA 1VCIA 3MUFA 1WB9A 5LB2A 3ZVNA 3GLGE 3FKQA 4PQRA 1QHSA 2GJAA 3ECCA 1RW4A 4Q19A 4JL5A 1XZQA 2EU8A 4KBFA 2NO1A 4BFXA 3KTAB 2XAUA 5KO2A 3FHTA 1AZTA 4F4CA 5FBWB 1LS1A 3NEJA 2F1JA 4F93B 2W6JA 1SKYE 4LJ9A 5CJ2A 4TYQA 2Z0MA 2V55B 4G1UC 4I1UA 1OXVA 3BK7A 4LUCA 4WAUA 1ZBDA 4Q9HA 5FTJA 2I1VB 4JLJA 2B7BA 2YJTD 1H8HD 3C8UA 3PUXA 3VHLB 3FGNA 4DDWA 8OHMA 4BGDA 2FDCA 2ZYVX 1YQTA 2DB3A 2QAGB 4CZ2A 4LYHA 1IJEA 3D8BA 2HCJB 2CNWA 1ZIOA 2IW3A 3KZ1E 1YRAA 3Q9LA 3LQRA 1NKTA 1PUJA 4LV5B 4RY2A 6Q21A 4CEHB 1RRGA 2ZANA 2ZYTX 4I99A 4MYUA 4B3GA 4MDFA 3SQWA 1UKEA 2P0EA 4BFWA 2IYQA 2XB4A 1DO2A 3CRW1 3T61A 1LV7A 4BZPA 3VR6A 1K8RA 2FEMA 3QVVA 4Q02A 1JBKA 4DDUA 3R9WA 3ZYCA 1Q12A 4NE2A 4EPTA 2YVUA 1PV4A 1AQUA 1Z06A 4LI0A 1KIMA 3IHWA 3ZVRA 2XITA 3ADBA 3A4MA 2DWOA 3BGWA 3P32A 4BLSA 4A82A 2PEZA 2GHIA 4PHHA 3RWOA 3WRYC 2A5FA 1OKKA 2R8RA 5F9FA 2A3RA 3BB1A 2AD5A 1U8AA 2RMKA 3LV8A 4QBFA 1ODFA 1R5NA 1DEKA 3B6EA 4AY2A 3REFA 4YC7A 2A7QA 1PUIA 1KSFX 1KI9A 2O8CB 1FTSA 2G1KA 2QMUA 4ILEA 4OHXA 4NTZA 3W8RA 3M4YA 4HYYA 2ZE6A 2DYKA 2A5DA 5JSZB 3LQQA 4NYMQ 3ND9A 3LD9A 4N1AA 1VYVA 5AWFC 3NBYC 5L3SA 4WZBE 4Q4HA 4A2PA 4BZQA 1DOAA 1NL3A 5HCNA 1NF3A 2C95A 2ZI9A 4EJSB 1T3HA 4J0QA 3PCRB 3MRSA 1E2MA 1OF1A 4L9WA 4R9UC 3GP8A 4LV6A 1U9IA 2QUZA 1WQ1R 5JI3E 4CEJB 1ESNA 2J1LA 821PA 3I5XA 1Z2CA 1KK0A 3VMFA 1MRNA 3CPHA 4AYTA 1BH2A 4JLPA 3SN6A 1ZW6A 2YC2C 1O3YA 1UBGA 3CRRA 2EFGA 1G20E 2IYZA 2G83A 4PPQA 2ZRHA 3GJ5A 2OXRA 1FPMA 4QGFA 4UKDA 1IN6A 1C4OA 1XD2A 2FA9A 3MD0A 5BYJA 5HE8A 4CVNA
chains in the Genus database with same CATH superfamily
3GARA 3WLOA 3E81A 2CLOB 1UOEA 5DASA 1YS4A 4F7WA 3IDZA 4XDGA 4PBRA 3K09A 4IMRA 4EQZA 4WA7A 1WBJB 3FVWA 5C3UA 4EPXA 1AY0A 5AW0A 5TQ0A 1G7RA 4TS4A 3TQQA 2CFSA 4NXBA 5H3HA 4M0MA 2HREA 4MUIA 4PLGA 3A2MA 3BB3A 2BP7B 4E5KA 1GA1A 2YJNA 2JJQA 2PS9A 4UXJA 4QICA 2YKHA 4PBSA 3OT1A 3CCBA 4YNRA 3U4HA 5DJUA 3RARA 4MVJF 5F6AA 3QBJA 2X71A 3NTLA 4PC2A 4BKMA 1Q50A 1LLQA 2BHLA 3A37A 4OPRA 3AM5A 2O3QA 1XKXA 2W2OA 5IAKA 3BTOA 3T1VA 3P26A 4H9GA 1ESIA 3TLYA 2CNOA 3QYPA 4AB1A 3N5CA 1UK9A 3ULKA 5BSFA 5IU6A 3MQQA 3HUEA 1YDEA 4BVKA 4PAMA 3K09C 4R3AA 5L3VA 1JIKA 2JFNA 4BTVA 2XMBA 1KERA 2EATA 1Y4SA 4XD7A 5HRCA 1HKUA 4X45A 1EHIA 1SHZA 2AOVA 2BLNA 4C75A 1ADBA 3HDTA 4F46A 4WELA 1GAEO 1QH8A 3TTUA 3MWYW 3C41J 3R2JA 3F1LA 4MW1A 1F8XA 2CNBA 4IEEA 4OP3A 1B6GA 5DRTA 2PBRA 1QFJA 4S1OA 1QK4A 3KU4A 1MKIA 1FFXB 1DP6A 4IZ6A 2EKZA 3K5PA 3DZDA 4YUVA 3V8PA 2X5NA 1YDFA 3S70A 1X8LA 1CT9A 3BCHA 4RYDA 4X90A 3V4RA 1CRWG 3K70C 2QN1A 3NIAA 3G2KA 3OHPA 2WJYA 2X7XA 5HM6A 3Q7QA 3PJRA 3DBOB 2GPSA 3OQBA 1XFNA 1DDOA 4ON9A 4GI1A 2NUPB 1RJEA 3BN3A 2W3FA 2J4FA 2PWZA 3MCUA 3UDIA 4J75A 4GOJA 5J5CA 1CNEA 1M8PA 3SSNA 1NT2A 2BFAA 4LTMA 1DJBA 1CIJA 1P1BA 2VP6A 1ECFA 4JU8A 5C18A 3H82A 4KP7A 5AI9A 3ETLA 2O05A 3V1YA 2XCSB 1QUFA 3LYXA 2F1OA 1DRMA 2QX6A 3GLVA 1P7PA 3KXKA 4TUYF 3UJDA 4HXFB 4O4LB 3TNFA 1O95D 2F59A 1AB6A 1T0PA 1XQ1A 1OI4A 1ENPA 2HBYA 1U1EA 1MPTA 3W4KA 2W71A 4HAIA 5U4XA 4UFOA 3PGLA 1DAFA 4KN9S 5JAPA 1K92A 4IDPA 1VXOA 2X15A 5FPSA 4UM8B 2ZAYA 4PFKA 3S1SA 1DUIA 3SIPA 1N33B 4MMYB 1ZRNA 1YKSA 5DKKA 5BQXA 1U28A 1C1HA 1FFYA 1T4CA 1QGOA 2PV0A 2ZG6A 3I61A 2PL9A 4WZAE 4HMQA 4URXR 4MEJA 1K54A 1OFVA 4ZAFA 4N8EA 3EK2A 2G5CA 3BA1A 3CBQA 1HL7A 4JYMA 1U80A 5HJ2A 1HF3A 4U9UA 4FSFA 3LUGA 2ONCA 3GGOA 4DWVA 2B98A 1GO2A 1SHTX 1KH3A 2NTYC 3DZIA 4F91B 3OICA 3ETDA 1NBEA 1PYDA 4UUPA 1FFBA 5T64A 3Q8LA 4DSUA 4PX2A 2GDZA 1BXRA 3DMGA 3GQBB 3F6CA 1VBMA 4TTRA 5BOVA 1UDAA 2VWPA 2CXNA 3F9CA 2O2JA 3AZPA 2CVHA 4MP6A 2WDPA 4WINA 2C03A 1G21E 3QNCA 3TAUA 4J03A 3L06A 4D9FA 3MJQA 1GZHB 2FPKA 1NASA 1OXUA 3TEMA 1FMFA 2FN7A 1U28C 2Y2GA 3M2JA 5EP1A 5JD3A 1JV2B 4RZQA 1ZVKA 1PI5A 4NYIR 4RJTA 4NMWA 5JYDA 1IBLB 1BDIA 3CF4A 3QKWA 2QGFA 2HP6A 2ZITA 2RGEA 4EQIA 4D96A 2QTNA 4WE3A 3UWKA 1DZIA 3O4RA 1E2BA 1EWYA 3MQ0A 1PJAA 4R2WA 2XR0A 5ITZA 3B6MA 2V98A 2OG2A 4A6XA 3AFGA 4TRNA 5FA8A 1RLTA 2EG9A 1YLWA 2RG7A 3JRNA 5K3AA 1TM2A 3JR7A 3TLJA 1QIGA 1FSFA 3BEBA 3FCSB 4RZUA 2IBTA 1I0ZA 3ZK7A 1IK6A 4KBGA 4RJKA 2OLJA 5IDXA 1BE1A 1SCIA 4URZR 3R20A 3WIBA 1NVEA 2WJHA 4W7SA 4B79A 5CB4F 4BX2A 2VS1A 2WVGA 1NVFA 2KBFA 2YYYA 1Z16A 4LPZA 4OOMA 4RO0A 1DXYA 3BWDD 3SXUA 1IAVA 2PH5A 2RHJA 1T6XA 3M9LA 1CQJA 3OA2A 4GZMA 4Y0OA 2GN6A 3STWA 1SUCA 3TGPA 4TYMA 5ALUA 1LBTA 3N28A 4UVHA 1WPGA 1SJ9A 2JKZA 1QHNA 8LDHA 3HUOA 4BXOB 1EWRA 4Z1MA 5EZQA 5HMLA 3TD6A 3EZLA 1AUXA 4WY2A 2HT1A 2EJUA 2XYHA 1SEPA 3EGXB 4QJIA 4N9QA 3WWOA 1PQUA 1D4AA 5FO0A 3N8GA 4LVCA 2HPBA 3BUSA 4NABA 2XSZA 1IXKA 1RQPA 3Q10A 2WD7A 4MWBA 3CZCA 1ERQA 3T54A 3I1IA 1IY1A 3EWAA 2WVJA 3TMYA 2UWXA 1QYCA 3AEQA 1MB4A 2WAMA 2XVZA 2NXEA 3ZY6A 1HO3A 1YONA 1VKOA 3UWSA 2Z58A 4L51A 5BNFA 4I2NA 1ECPA 4PLPA 1HEUA 2VA0A 4LRQA 3DE2X 5I3CA 2PLAA 3WYFA 4ITVA 3DFUA 1EFDN 4EKNB 3LUAA 3W8DA 2WHPA 4UE2A 1FP1D 3AZOA 2UU9B 1UKZA 3QFTA 4CEHA 4EA7A 2SKDA 2QZSA 3K5HA 3QTTA 4LVUA 1QQBA 2BTEA 1OMOA 5I8WA 2ZYHA 5EP4A 4FWIB 3AETA 1YIOA 3IHLA 4XVCA 2Q5LA 4CCWA 1F6DA 2O1WA 2KX6A 4E1BA 1NJFA 4CKZA 4FFNA 1DI0A 1KVLA 2QG6A 3GEIA 1P7YA 3DWGA 1Y81A 3EISA 5IN4A 2WAXA 3FZEA 1UJ4A 3QHYA 4ZOQI 1HRDA 3LX5A 3CEJA 5I51A 3BY8A 1DMSA 3U3RA 1SBTA 1HX7A 4QATA 2ZB2A 3CY6A 1A77A 1TS7A 2W4MA 1RCJA 3R0XA 1CJFA 1QV6A 4UDOA 2EF1A 2QQGA 2OCDA 1EUQA 4A0FA 3VZDA 1D6JA 1KP2A 4TLDA 5CR9A 5CYPA 4B32A 1J8VA 5HCUA 3D6NB 4JBYA 1UMKA 3LIAA 1VSUA 1UOQA 2Q99A 3G23A 3IIMA 3E5MA 2OCGA 2JAWA 1PJTA 4QEDA 3WHPA 2BW0A 4GKBA 4RV5A 2WJGA 3QP5A 5DN6A 5JBIA 3IXMA 2Z5FA 4CQLA 4HWPA 3DL0A 3WLHA 2HA3A 3RSLA 1M6VB 3A1EA 4XVQA 3UB6A 2VQFB 3I9OA 5LZ7A 1JQ5A 3EXIA 1D7OA 2GI4A 2QN7A 4KUKA 5ALHA 2ZYWX 5HIIA 3UFBA 3V2IA 1MZPA 3BX1A 3HKCB 1TJ5A 2YHBA 2IA5A 5BNZA 4DMKA 2H4FA 3DE0X 2DGDA 3CU5A 2JJ2D 5I9MA 2SECE 2ZVPX 3TXYA 3F1PB 5F5NA 4QWOA 2PR6A 4TWAA 3NHJA 3G0DA 3EGEA 4KUGA 4GAEA 2Q7XA 4M38A 3OE7D 4NEGA 2VDKB 4B82A 1SBCA 4ZU6X 4EMBA 2W4IA 5FQIA 2CFTA 4UM9B 4BNNA 4E03A 1VECA 1KDTA 3OZIA 2QXTA 3MT8A 1OB5A 4PXYA 1C7RA 1OLXA 2J6HA 3HDGA 3C7TA 5LZ5A 4C3ZA 3HSKA 4OKIA 4EPVA 4MIYA 3ET4A 3BF7A 4YVFA 4DABA 3C7CB 1NY5A 3U9TA 2IEZA 1MNAA 1AKNA 1YBHA 4JP3A 4RQ9A 1MR3F 4E11A 4E14A 3K0FA 3DZGA 3I62A 1ECCA 1DFHA 4AS3A 4NEED 4E2ZA 2XNJA 1GGMA 2Q4OA 2ZC3B 1E1MA 3ZZ1A 2YIVX 3BDAA 3GJ4A 3CGWA 3R8XA 3V7UA 3WXMA 1U3TA 2JGFA 1LRKA 3RNOA 1I4WA 4YUZA 2OO7A 3H99A 3VAAA 1Q1NA 4PSDA 4IR7A 2BTQA 3T4EA 4G3WA 4NBLA 4UE6A 5CT4A 1SN7A 4AICA 3TINA 2QJFA 2BMDA 3LDGA 1E99A 3WJ2A 2CZQA 3V2GA 2XLBA 3RJTA 4FEGA 1Y48E 3DMPA 3E22A 4B93A 5JFGA 1KFCB 2G0TA 4HPXB 4WEQA 2ZJ9A 5BOSB 3AONB 1GGHA 2PT9A 3L0BA 4R7ZA 4OQ0A 1Y89A 3CMZA 1FTYA 4HDSA 2L19A 4DG5A 1VSVA 4TV8F 4WXPA 2CVQA 5ALMA 3UJPA 4QELA 2J9RA 4CM8B 3IE2A 1P9WA 4KZPA 4FXPA 5K6TA 4ZPXA 3C6XA 4A4DA 3EWIA 2XYRA 5G1NA 1PR2A 2ADMA 5IJXA 1GGJA 2QL6A 4MGYR 2BE7A 4N7RA 2WHRA 4K0XA 2P8SA 4M7RA 2JD1A 1QPGA 1KO5A 5IYZF 1IB6A 2JKRM 1NW5A 1VQ1A 2KPOA 4PHCA 3P4YA 1V4VA 1UXKA 2XUIA 4LTDA 1JFFB 4DMMA 5ILQA 4GX1A 3ZWWA 3ZV5A 1HT2E 3E8XA 2JGIA 5H7XA 4QU5A 4FDLA 5AVQA 1SXJB 5BN1A 5BSUA 2G0NA 2G9VA 3L0ZA 2PFGA 4MI6A 2PLWA 1N5LA 3CBGA 1WMFA 2VP9A 3UY4A 1WM1A 5E2FA 2IVZA 1XA4A 1L5WA 3FOCA 3O3NB 4KFCA 2F8LA 3B5JA 4E5VA 1K0FA 4FBMA 4IIBA 2XUQA 2XRMA 2HXGA 5JSFA 4HSEA 3U61B 2FPRA 2FV8A 1I5QA 1XZAA 3L79A 3GLTA 3H3JA 421PA 3DR5A 1GPWB 3WE7A 2X8LA 4IH9A 3I05A 2P9VB 3JD3A 4MWGA 1RP7A 1E6EA 4LPKA 1JHUA 3U09A 3GFSA 5CNJA 4TV8B 5FI7A 4MR7B 3V8NA 4KQHA 1FIKA 2K2NA 4HN2A 4AMBA 3I0NA 3QU2A 2PUJA 4E5SA 2W93A 1L5LA 3SWWA 5EKXA 4RF2A 5ALDA 1D2HA 3WVNA 3FY4A 3LCJA 4XDZA 5HDDA 4MS4B 5EVCA 3GLHA 1JL3A 2JFUA 1S0UA 3UHOA 3EW9A 2CXHA 5A3VA 2XR1A 5ICGA 5CAEB 3ZHQA 5HBGA 1KXJA 4M60A 5BWNA 3H9UA 4PZEA 2DWUA 4UU7A 4JF6A 3SW1A 2WMDA 3V4LA 4LX0A 4O63O 2Z2LB 1F1JA 1TM3E 5BXYA 5HQ3A 1C3VA 2X5JO 1SBIA 2B1IA 1BLHA 1BH6A 8AT1A 1NQUA 2VPPA 3PR3A 3G17A 3AK4A 5LJLA 2AFIE 1VDZA 3HXPA 2VDNB 3K2BA 2V7WA 3N0TA 4GMFA 1ETUA 2BHTA 3ZHXA 2P67A 1UOPA 3WB0A 1H0MA 3RAFC 2HBZA 1GQYA 4US1R 2BUBA 4DLVA 2QMOA 1MEOA 2ZI7A 1JSLA 4QEKA 5AOCA 1I5OA 4PZYA 4GF5A 1JDTA 4KIWA 4KN8A 1S4MA 1P72A 2V9ZA 5IUKC 2D00A 4IS3A 4PFJA 1H2EA 3GY0A 4MJXA 4EERA 2WLTA 1W73A 5HOEA 4L0MA 3OCUA 3G0OA 2Z8YM 1I9GA 2BFBB 2O0JA 4RF4A 1KKMA 5HE9A 3K0SA 2GEUA 3L8MA 5EHXA 1E2QA 3RYFA 2Q9CA 1Z5WA 4JP5A 3VZQA 4BIIA 4MRMA 4RPKA 4BVBA 4UPEA 3JCZA 2XE4A 1P9RA 1HH4A 4QYTA 3OM8A 4K9MA 3BICA 4Q4LA 4PS0A 1VCNA 4NZMA 2G09A 4Z4IA 3EFBA 3JSXA 4O1HA 3VR3D 4FKMA 3FIUA 4BUJA 1JYSA 1J8YF 2B18A 3R3ZA 1RQNA 3PEFA 1ZJJA 2VIIA 5FQQA 1CC1S 5AUPB 3EEYA 4XGIA 2GEFA 2ECOA 3HCBA 2DR2A 3GECA 2HWKA 4Y6LA 1IG3A 2OCPA 1U04A 5DISB 3ZGZA 1IHPA 1OVGA 2VLBA 3K53A 2X1LA 2J5RA 1UK6A 2QG4A 4OG2A 1IIBA 4RMGA 4NAUA 1NG9A 3LC7O 2AVXA 1IBMB 2UVQA 4FPXA 4LFAB 2PD8A 2WIAA 5ESXA 3SXJA 4H4CA 4ZCSA 3WLQA 3TD2A 4XPZA 4YCCA 1G5TA 4MEAA 1FJGB 4TROA 1LBEA 3QY0A 4EUNA 3KR1A 2XDQA 2GHQA 3W9YA 5DEIA 4O2RA 4YRGA 3UE6A 2EIXA 4RZ2A 1HDRA 2G6TA 1NI3A 4N3AA 2J41A 2RONA 3QENA 2GPTA 1M66A 5ITWA 4IJVA 2GYYA 4CLCE 4EO9A 2A2LA 4KGDA 3QZUA 5LQSA 1UL1X 2QTVA 2QRVB 4M1EA 4NMLA 3V8QA 1WETA 5EE1A 2AEMA 3C7KA 3AR3A 4D4JA 1STZA 1RJGA 1NYTA 4BKPA 1JHPA 3FMPB 1CF4A 1GUAA 4QOSA 1R0WA 4BNKA 3H84A 4LBWA 4BVLA 3CWQA 1U81A 2R6HA 3P20A 3VUEA 3EODA 2PX4A 2Z43A 3HCWA 1YT5A 4UEKA 1FRFS 2VK1A 3Q1KA 2JI7A 2YWGA 3T4LA 5D3MB 4A0RA 4BECA 2BHNA 3L9WA 3JQ8B 3D2LA 3MUFA 1KPGA 1V41E 2NAFA 4U0TA 4LHEA 1GV1A 1NRIA 1SQGA 4P84A 1NAHA 4LXIA 2NZYA 3OJFA 2QL5A 1LS1A 4O4JF 2HZ5A 5TSDA 4I1UA 4RHEA 4MI9A 3U7IA 3HRHA 1C0LA 5BW4A 2X6QA 3RHTA 2P91A 4LYHA 4ZJZA 2IW3A 1YRAA 4LV5B 1BA3A 4R70A 3F2VA 4GS5A 2O54A 1L5FA 3C45A 1M6WA 4FP9A 3QVVA 4R84A 4FGZA 3O38A 3O2JA 2ZGVA 3LF2A 2WKSA 3N8LA 5EG5A 4QXQA 1P7WA 3FF4A 3VO2A 1UT5A 4JJ8A 5IAGA 2IEAA 3FOWA 5IVPA 3CG4A 1JHXA 3IE0A 1L3IA 4WZBE 4R9UC 3HMQA 1UZUA 1G5HA 1GTRA 5DFYA 2PXHA 1WKBA 3N8NA 3F74A 1DL5A 1GTG1 4Y2XA 4X53A 1U2ZA 1XD2A 3FYTA 5DOVA 5LFAA 3D3EA 5LDHA 4ZODA 4AZ3B 3MSHA 4D4IA 3OIYA 3K0EA 1IOLA 5AJXA 3L8GA 3PA8A 5E1OA 4GBED 2ZTSA 4R8LA 4GI7A 4S0ZA 3GT0A 5FTWA 4XT2B 2AR7A 4HR7A 4FMPA 1G8KA 4YRJA 1FFSA 3AF3A 1KE2A 1SOUA 4EUKA 4WNAA 4JJGA 4JBFA 3QNBA 2DLCX 1JFVA 1T43A 4Z99A 3HXQA 3P0RA 1ESUA 3BHNA 4BX3A 3GZNB 4CLRB 4KAJA 4ZOLB 1KEEA 5JRDS 4YTEA 4UNPA 1D7EA 1LSSA 4FFOA 2G7UA 3A4YA 1RGZA 2H2WA 1LNQA 2HWUA 4LFUA 5TMEA 4AURA 3HVKA 1C9KA 5A62A 2X02A 5IEJA 2ZRQA 3WKAA 4G4JA 3ZS8A 3CVJA 2QVYX 3EC1A 1WBDA 3RVSA 2IL1A 4IDHA 3D6JA 1G64A 2X2OA 3TQHA 2FWIA 4HYEA 4S24A 5HCIA 1A9PA 3A4IA 1JG2A 4P4SB 4BWGA 4DBLE 3OFKA 4Y6RA 2J67A 5G4YA 2XRNA 1CVIA 1E1QD 1P0FA 3L7DA 5CCDA 4ZT3A 1LL8A 3HZHA 3AY6A 3KELA 4AO7A 3DSRA 2J9XB 4QDUA 3I4LA 3GYBA 4MPTA 4JP8A 1XI2A 3QU9A 2PQ6A 3AHFA 1Q2PA 5CT6A 5ALQA 4A2QA 5EEHA 1IN1A 4BNXA 2HSWA 3HP4A 3WICA 1SKBA 5B64A 1X7YA 2PRIA 1OIXA 4ZU1X 2FMHA 1SG6A 3BXZA 1L7RA 2EJTA 5PNTA 2R1TB 3OPVA 3SHQA 4WRRA 2AFRA 3L7IA 2F3RA 3OCLA 1MGOA 4HQAA 3DB1A 1DBRA 5U47A 2BKAA 3W3AA 1N2CB 5BMOA 1EG7A 2H5SA 2WT4A 1CB7A 1UADA 5KJFA 4LF9B 1SB9A 1CS4C 5TJHA 4OV6B 2I9VA 3D3QA 2PG3A 1RMTA 1XD8A 4BQEA 3BMOA 3NG1A 2BFCA 3TYXA 4IQ4A 3SAJA 1K1EA 4NFSA 1ZCJA 2HQ1A 4B87A 1UKVY 5TDHA 3IE1A 1YQ9A 4I7EA 4OH0A 3R0JA 1ES3A 2CJWA 2FN8A 1OLSA 4MVXA 1SQ6A 3SHFA 1J2UA 3HKBB 5EJ6A 4DUGD 4GP9A 1BEZA 2IFTA 5TS2A 5EESA 1DELA 3OQMA 4RW0A 3TQSA 2ZUFA 2JAPA 1I5RA 4MYCA 3S8EA 1GN9A 2C9DA 4KGZA 2BDEA 4AUNA 1G4AE 2GT1A 1FA9A 5JJCA 3JARB 1E9CA 4FUQA 3T50A 5K6AA 2YX1A 4ZT2A 2X9GA 1H8MA 4B6FA 3FZGA 4FWTA 1AQJA 4RJIA 4TQAA 3ILHA 3BQAA 5HF5A 3UWPA 4AUMA 1J0CA 2JAXA 3LKDA 5JADA 1MY8A 3WQSB 4J0KA 1BCSA 3EVGA 5DGDA 3H0KA 4Q4AB 1OLOA 1N9NA 5C8YB 3SD7A 4XUEA 1U3GA 1F4VA 4B3DA 5CEBA 2OHXA 4NSNA 3NLLA 3LA6A 1LLUA 2YV3A 5EXSA 1L9XA 1GFIA 4C0QC 2UXCB 1XG5A 4NYIQ 3UT6A 3KX0X 4RTKA 2GEJA 1P62B 3HI4A 1MEJA 5H9VA 3TIGA 1E3DA 4R81A 4YAEA 3HM2A 3VNQA 3GUYA 1ZSNA 4JB0A 2DPLA 2IT1A 2OHFA 5KREA 1IHDA 3HSSA 1I10A 4QJGA 2FPLA 3KSHA 1G0NA 4WKCA 3R23A 4H27A 4ZMSA 4Y3UA 3U49A 2DCUA 1J2EA 1ZOLA 3ANMA 3H1PA 3CLUC 3F71A 4D9NA 5K6AC 3JQAD 3S99A 3T15A 2YQ4A 5EIEA 2CK3A 4BJ6A 4J3NA 4CGZA 1Z47A 2X4LA 3BOSA 5L4SA 2GN2A 4MR9A 4TRRA 5KTYA 4OYHA 4Z9QA 4J7CA 2Z2XA 4F1KA 5TY0A 3RG2A 5B2ZA 1TA9A 2EQAA 5BSEA 2I03A 4ZVKA 4O2BF 3VAZA 4I4IA 5DNWA 2XH8A 4HB3A 1FZQA 4P4LA 1UBCA 3S1AA 5A2GA 3DC2A 1DEXA 2GZ3A 4PAUA 3I72A 3I4CA 3SBXA 1YFJA 3KP1A 2AZDA 3I53A 5JW6A 2BSXA 5ALVA 3CLKA 1O4WA 4M88A 4W5OA 2V0NA 4NH0A 1IHYA 3NHKA 1Q1ZA 1OAOA 1V11B 3C3BA 3LFUA 5DTMA 4E12A 2PZBA 2ZI5A 4Z49A 1Z6TA 3NJ8A 4ALLA 1QTRA 2GD1O 5JEDA 3VSDA 2G67A 8ADHA 4F3TA 5TQVA 1LLFA 4I5FA 1KO4A 2MTBA 1X0VA 1P0IA 1A9ZA 3VNUA 5D6NA 2H0QA 4HP8A 4UHKA 1ZH4A 2XTAA 2VTDA 2ETXA 4F2HA 1HTTA 3DYIA 4V0SA 2WAFA 2AX3A 3UPDA 1X80A 4B3SB 4MEZA 3B3XA 3SH8A 4J16A 4MJ3A 2GERA 3LVQE 4KQRA 5TNXA 4Z0HO 4FOOA 3QNUA 3DL7A 1IYZA 2RGAA 1CDOA 1QIHA 2DWPA 1M2NA 2OK7A 3JD2A 2SICE 2EBUA 3GAZA 4HV4A 1W4LA 1NVMB 4NG5A 3MMXA 4S12A 2F3SA 3Q7VA 1U1CA 4L4UA 4RDXA 4NH4A 1LDMA 3OC2A 3BAZA 3CSSA 3FI0A 3TBFA 3A6DA 3EEFA 3C3PA 2I7CA 4Z1OA 3L0PA 1KVQA 4QVKA 1MWSA 3EZFA 2KI5A 4GMDA 4W9MC 4D3SA 4F6LA 3KL4A 3R3UA 5EXPA 2C9MA 5BXQC 4EJSA 4BQIA 4NDZA 5B2EA 2CUTA 5ALEA 4UOQA 2WC1A 1GSIA 1XPUA 4NG2A 1PNEA 1K3UB 4RAOA 3HJHA 1LUAA 3A3NA 2G2UA 2B3DA 4PNHA 3KUXA 4BFVA 4BNFA 4GL4A 4ZJ3A 1J9ZA 2NT3A 4WJZA 1KDRA 1S8NA 2XF3A 2EIHA 1YLJA 1STOA 4GBGA 5E0OA 3ETNA 1G42A 4HHDA 3CX4A 2QT1A 1JMYA 2ID7A 3RSZA 3SQMA 2WSMA 1O96B 3Q9UA 5A3SA 3MBKA 2QU8A 2EX1A 4QFMA 3EGVA 2C4VA 4FGKA 3UMYA 3O7WA 3H0CA 3AVOA 3DHYA 1KZ1A 2WUDA 3S7ZA 3DEIA 1PVDA 4KACA 1IXZA 1J09A 5BURA 3CX7A 2GFHA 2F4VB 4YUWA 3BFDA 1V1MA 1Y7LA 2XIJA 3OZXA 6GPBA 4EUHA 1IBRA 4EJSC 3ONVA 4LV1A 3AVPA 3ZCXA 2P30A 1G3IA 3V33A 3LICA 1JI3A 4GPBA 2VHQA 2C57A 2G88A 2V6BA 3PBTA 5KSPA 3VTKA 1VLJA 4URFA 3RK1A 5KYWA 5IKOA 1VB6A 2PYRA 4PVDA 3RH0A 3DV9A 1MGPA 4HGOA 3OLZA 1TVCA 5EWJB 2B2XA 4QBGB 5MFPA 1CF9A 3CH4B 2Y67A 1H0RA 1SVMA 3NCTA 5EYPB 1TS6A 5DM0A 3A3KA 3BXXA 4Q0MA 5E7IA 2KDKA 5J2UB 4KENB 5L07A 1OTEA 1UPUA 4HN9A 3DOIA 1JPUA 4TM8A 3O86A 1TTPB 4FZVA 3OLOA 1Q0HA 4KR3A 1J2RA 2LNDA 4OQZA 2JLVA 5KX5F 2I66A 1WD7A 1BFKA 5A3RA 1QHFA 1BMFD 3LU1A 1WU7A 3T3DA 1L4FA 2XQVA 3AR5A 4BCDA 1P39A 2H29A 1U11A 3V55A 4DCJA 1AT1A 4D5EA 3GLFB 1JSRA 4J0EA 4DIDA 1CQWA 4CTOA 1WA9A 3DNMA 4HMPA 4I66A 4QT4A 4V3BA 4BWFB 1KEVA 2QVLA 2FXIA 3MQOA 3JWPA 1PZMA 2GF9A 1Y4DE 3FNBA 5FWYB 1V3VA 1NX9A 1PFQA 4EJMA 2Q1YA 4UAJA 4EGCB 4ZC8A 2JFYA 3RBXA 1E8NA 5CX7A 4RE6A 5H1YA 4MLDA 4J0HA 1EW0A 4C4XA 2EQBA 1JDPA 1E0DA 3KLNA 3K05A 1NKSA 2N46A 1GPBA 1T9ZA 4AJ4A 1Y9JA 4IEFB 4ESVA 1B6TA 3FWPA 3GUCA 5IH7A 1ODIA 3RS4A 1U7OA 4NFYA 5DF7A 1NUQA 4CIWA 1X6VA 3NDBB 2XOKD 2QF7A 4ZFNA 2IEGA 4ESEA 3S2YA 2QYTA 2X8BA 2OHOA 3MXOA 2J31A 5FEGA 1XDSA 2XTJA 4XOIA 3LQYA 1JJBA 4CM3A 3F7TA 3O74A 3EWSA 2CJYA 2LPMA 1BX3A 1OT9A 1NIPA 4H3HB 2Y76A 3VSAA 3H2GA 1IZZA 3ZHCA 4WFJA 5F3WB 1KKUA 1OGJA 3H16A 2VDVE 2FTKE 1REQA 3EARA 1EJBA 5GOZA 2ACVA 3E3MA 4Z54A 1YS2X 4R8SA 3BMQA 4MV6A 3M6UA 1CSEE 1IKIA 2CV1A 3H65A 3EOZA 3SNHA 4OHVA 5IF9A 3IRUA 1EH5A 1U8ZA 5CXXA 1INLA 2UYOA 2OCLA 1BTLA 3O8CA 4G1BA 1VKZA 1LSXA 4CF7A 4I3AA 4HAWA 2C1ZA 2BGMA 3IOEA 1R8QA 2YH2A 1G9TA 3EPKA 4IOLA 1DAKA 3JWJA 4D3ZA 2A58A 1L4KA 1XN1A 4X6YA 4F6CA 3Q3EA 1IONA 4M1TA 1RWOA 3T7AA 4GYJA 3LR5A 4ED9A 3DDUA 3VMMA 4RVOA 5JYPA 3IVCA 4QUDA 4LZZA 1XT6A 2AXNA 2P3OA 3PDUA 4JGRA 1RM5A 5D85A 1D1TA 1YR1A 1T8SA 3FA2A 1PNVA 1T2FA 2WP0A 4L07A 3O8OB 4O5OA 3PEUA 3JVIA 1ITZA 5AH0A 4S2MA 1E32A 1H5UA 2H1HA 4LXUA 3RRBA 3VR6D 4BVFA 2FSGA 3KBBA 1GQSA 4J9VA 4O4LF 5JZBA 3SX4A 4JWKA 2Y1GA 3F6YA 4QDXA 2A84A 1NY6A 1BN7A 1P0PA 3ZV4A 3F1OA 4N3NA 5T8KA 3PR2B 3Q6MA 1RZ3A 1N5IA 5JJLA 3V6MA 3ER6A 1M67A 2GN4A 4BWYA 4FDTA 2WGVA 1I2BA 1ND6A 3AUUA 1RPNA 5DU2A 2PS0A 2PCLA 2GAAA 5CXSA 2QE6A 4GKJB 5EE5B 2J7VA 4O08A 4UARA 3IBFA 4L28A 4DQ0A 4JGBA 1OBOA 3ZG8B 5AXAA 1U8XX 1JJAA 1BDMA 4QLBA 3AV0B 4ZJ1A 5G1PA 2AEJA 1FX1A 1M1NA 1K6IA 4DE5A 2QTLA 1OCEA 3S7TA 2DT5A 1KQNA 5KVCA 2GWHA 2C29D 1TUGA 2L0XA 2GF0A 2YWXA 1JA9A 3ZGLA 1W52X 1IN7A 3PZRA 3NGLA 1R27A 3RRXA 1P5HA 3TZKA 3WGMA 4YROA 1XDUA 3TXAA 4FWBA 1MV5A 1T8PA 2E4AA 1Y3CE 5T8KC 1QAMA 4ERNA 2YUTA 2C78A 1WXWA 4KRGA 3NQ41 2R85A 2B1JA 2LZ0A 4UTPA 2R1VA 2I6UA 2TMKA 3NYWA 3AHJA 2MWMA 3ZOZA 1IYQA 1AM4D 2AFVA 2OBFA 3LJKA 4I1RA 1NI5A 2AYYA 3A7EA 2Q5CA 4U7PB 4Z86A 3FI9A 2YMMA 3EQZA 3K15A 1M2KA 3FYUB 3OX2A 4D2OA 2JIOA 7ABPA 2NP7A 4FSDA 4ALJA 3DZKA 3KIPA 3BWYA 4LRSB 1XVAA 3O3VA 4OGFA 2QTMA 1RI4A 4YNBA 3WWCA 1QIEA 5EWLA 3ZD8A 2OLKA 3N87A 4IH1A 3HA5A 1LJ8A 2J5KA 2B6NA 4YJGB 4Z4FA 3IAS6 2XQKA 1J9EA 1HC7A 3W5SA 5ALZA 5I8PA 3KLOA 4GQIA 4G2TA 3UN7A 2NUAB 4KTTE 1D2GA 4ETZA 3DAOA 1NDQA 2VYFA 3C5HA 3K96A 4OAPA 4ARVA 4D8VA 3LIPA 1A9OA 1UMBA 2NO4A 1C8LA 2D02A 1ULBA 4XARA 4MHTA 3X1MA 4ID9A 1DBWA 4K8OA 5AKHA 2XLCA 4MDZA 4AZTA 4TWRA 3EX7C 1WY5A 4TKLA 2ODNA 3H11A 4OUKX 1EDBA 2JGLA 2VTEA 4G67A 1FCJA 2JKRI 4W1QA 1N2EA 5DBHX 1Q44A 5HX9A 3OOHA 1YPRA 1N77A 4JF4A 2X13A 2FPPA 3DZHA 2J7PD 4Y9SA 3WWZA 2P78A 1HYGA 2FFRA 4PNZA 1NVKA 3ISVA 2PX2A 5BR7A 2LXNA 3VR6H 3VDXA 4MBFA 3KT3A 2OV6A 1JHMA 3CO5A 3B6JA 3JVVA 3NYRA 3QX7A 2QZ9A 3M6MD 2WG0A 3AQIA 1RWPA 2JD2A 4C21A 1QRSA 1W4ZA 3DEHA 4X8LA 2E4ZA 2QGNA 4GR9A 4KG2A 2H51A 4Q19A 4BYGA 2WK0A 1YZ3A 5DTTA 4QNNA 3QHQA 4F4CA 2PUAA 2W6JA 4DREA 2IQ5A 2ZM8A 1Z0SA 1Q84A 2HIMA 2I1VB 4LF7B 1K54C 2FX2A 2DB3A 2P6OA 5TBMB 2R7NA 3KZ1E 1NKTA 3H2BA 4P1ZA 3THSA 4MYUA 2IYQA 3AESA 3L8CA 4QFBA 4TKVA 1K8RA 3ZYZA 3I83A 4JI7B 2FI1A 2DT8A 3HJFA 4DMFA 1JUDA 1AQUA 1Z06A 3T3GA 4BLSA 2W8BB 1XGJA 2A5FA 2HF7A 4PLHA 4FB5A 2A3RA 2P69A 1GHIA 4JI8B 3N2KA 1ENZA 1R6UA 4N12A 2Y59A 2H1IA 4C0WA 2W6PA 4F9GA 2A7QA 1QHEA 4TS9A 2V7EA 1V3UA 4QIHA 4F3LA 4R51A 1KIAA 4Q4HA 3OD5A 2C3PA 1H3QA 5NLLA 1S3IA 2QUZA 4WJLA 1MD9A 2JKYA 3NKLA 4QWMA 2A14A 3RU7A 5B3KA 3DOJA 4JBLA 1ZW6A 2PSEA 4MCAA 1N1MA 4Q24A 4PM6A 2FA9A 1B1CA 1D0IA 3T0IA 5BYJA 1HLPA 1J25A 4FYKA 1W19A 4DV4B 2PJDA 3EGDA 3KYEA 2PNFA 4FZRA 1FFGA 1L5KA 3PWSA 4MZXA 2PGJA 3PD1A 1BHO1 2XH9A 1VKRA 3VKVA 3BXHA 3OHMA 4JOCA 1ANKA 2PSHA 3TZBA 2GX6A 4OHBA 1XRJA 3EUWA 3LGXA 1Y1KE 1G9XA 2P7HA 2JGKA 4YJ3A 5LQAA 5JCZA 2Q9MA 1EK1A 3NC4A 4PLTA 2EGGA 4GNKA 2ABWA 2A92A 1UXJA 3TFOA 1GRNA 3LUDA 1C3EA 3GWZA 2RAUA 2VCEA 5JMWA 1KI6B 2WNHA 5IT9A 3NHSA 3ROZA 4OFBA 4PYNA 3PFWO 4GYKA 2C7VA 2HXYA 2P9YA 1KF0A 5CBKA 1ZK0A 4BNDA 2KQUA 1F4PA 3VNRA 1YRQA 2B8TA 3QI7A 4MKGA 1XRPA 2G04A 5B1DA 1V47A 2JC7A 3I52A 3DWZA 1CEXA 3TE7A 1XDGA 2CMFA 2HJEA 1MX3A 2HNKA 1YUMA 3JQAB 9ABPA 2XRYA 2DY1A 4E5NA 3DWIA 1L5OA 3EGDC 3K6JA 4MUGA 2B2CA 1CQIA 3UG6A 1SKYB 3BRMA 1IWBB 5E1MA 3USCS 1U3UA 4C3OB 1XV5A 4Z7OB 2IYAA 3BQ8A 3O8BA 3EIOA 4BJ3A 4ZYWA 3BXGA 3NJRA 1U0OC 5MF6A 2X1VA 1QH1B 4IKOA 5DB4A 1CVRA 2HSJA 4BLMA 2WVHA 2E4YA 2JLYA 4QJ4A 3KSUA 1CDZA 2ZB4A 2ZUEA 2Q27A 1P77A 2CSUA 2A33A 5TPWB 2B8NA 2VV6A 5ADUS 4GLBA 4V0RA 2CMHA 4QYMA 2Y4AA 1W93A 1RBYA 5AJWA 3NOXA 5AKJA 3ZDQA 2QLJA 3NHLA 1NUPA 1AJEA 1Y9ZA 1ECLA 1YZVA 1UMCB 4MLCA 3DE4X 4UU8A 3F6EX 3LT0A 1CULC 1XZLA 4W82A 6REQA 5DFXA 4Q9NA 2OR3A 1B0UA 2QLTA 4DXBA 1MW9X 3LR0A 2VFAA 3Q5DA 3OPHA 2EERA 3W5UA 2P74A 3KK0A 3THOA 3BD8A 3GLHE 4N5LA 1P7ZA 4AP5A 1K7EB 2WTNA 1JEEA 2Y1LA 3UXEA 2WNSA 2YNMD 3BWLA 1DKOA 1APBA 3T3IA 1ENOA 1EB8A 3MFDA 5FQKA 1XNJA 4CKXA 4JBNA 4LBZA 3P9PA 1KEKA 3EZ9A 3TQFA 1WZUA 4N3GA 2G36A 1YQQA 3KPYA 3PPIA 2BEUA 4S2PA 1D2NA 1UK7A 4M99A 4H0NA 5EMKA 3E4OA 1NRJB 5T7BA 4KITB 4KE6A 2WKEA 4KEAA 3EDMA 1RHJA 2VPIA 1EHCA 2HRQA 4EYEA 1EU1A 2QVCA 4TXLA 1KDPA 2RC5A 3UPUA 2VPWA 1O9GA 3KX2A 4CETA 3LK6A 4M87A 3G0IA 4XSGA 4D8UA 2BDUA 3SE7A 5CW2A 4CT4B 1CE8A 5B57C 4NXMB