2EWWA

Crystal structure of the pilus retraction motor pilt and bound atp
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
350
structure length
343
Chain Sequence
b'ELKILEIIKEAIELGASDIHLTAGAPPAVRIDGYIKFLKDFPRLTPEDTQKLAYSVMSEKHRQKLEENGQVDFSFGVRGVGRFRANVFYQRGSVAAALRSLPAEIPEFKKLGLPDKVLELCHRKMGLILVTGPTGSGKSTTIASMIDYINQTKSYHIITIEDPIEYVFKHKKSIVNQREVGEDTKSFADALRAALREDPDVIFVGEMRDLETVETALRAAETGHLVFGTLHTNTAIDTIHRIVDIFPLNQQEQVRIVLSFILQGIISQRLLPKIGGGRVLAYELLIPNTAIRNLIRENKLQQVYSLMQMQTMNQTLYKLYKQGLITLEDAMEASPDPKELERM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords twitching motility protein PilT
publication title Crystal structures of the pilus retraction motor PilT suggest large domain movements and subunit cooperation drive motility.
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Protein transport
total genus 84
structure length 343
sequence length 350
ec nomenclature
pdb deposition date 2005-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00437 T2SSE Type II/IV secretion system protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.90 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2ewwA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2ewwA02
4K46A 4V03A 2VEDA 5HE8A 3REFA 3L8YA 5CM8B 2HJGA 2QAGC 3NH6A 4I81A 5KPJA 2EFEB 3EAQA 1SKYB 4URUR 5CK4A 2ZANA 3B78A 4A8JB 2R6CA 5EE1A 4EFNA 1UBFA 5HZKA 1A5TA 1XCMA 5FPSA 1TEXA 1PUJA 3MCAA 1U99A 4CEJB 1PJRA 4LHYA 3GMTA 1JALA 1SKYE 4GOXA 4D4MA 3CNNA 1UKYA 3KXIA 4LGMA 1E2IA 1Z6XA 2ODNA 4R98A 3P4YA 2O5VA 2BMFA 3LXXA 3SZRA 3MJHA 3A1UA 3OESA 3D31A 4NONA 5DSZA 3TSOA 5BN4A 4ZPXA 1EFRD 3BE4A 3OIYA 4MUBA 3UWKA 2ZRCA 1KI3A 4P31A 1Z8FA 2CNWA 4C9BA 1MRNA 1ZINA 5L3VA 3K8YA 4I99A 5CJ2A 2OBLA 4D80A 4PHTA 4M1MA 1FW6A 4MYCA 1Q1BA 2ONKA 3BJIC 2F9LA 3C4JA 4LYJA 2QQEA 4MYUA 3SI7A 3GEEA 4U5XA 4L15A 1IN6A 2OBMA 4LHWA 2GZAA 3QKSA 3FHTA 2PJZA 1RJ9A 2MSDB 4JS0A 3OF5A 1E2FA 4JKIA 4OHXA 1JQLB 3KKMA 1CJKC 2WKPA 3EZFA 1BYIA 2V55B 3CF2A 4I1OA 4NYIR 3W3AA 2D06A 1Z08A 2RMKA 3T12A 2FOLA 3KTAA 1T5LA 3KJIA 4NP6A 4RD4A 4ZDKA 5JEDA 2WPDA 4KV9A 3L0SA 2HLDA 3EW9A 4TTPA 2BMJA 2ZJZA 2JLYA 1SVWA 1Z83A 1II8A 3BAFA 1NVUQ 3HR8A 4B71A 1VHTA 2K5UA 2BBTA 3OHMA 5BYKA 3L82B 3SE0A 2Z4SA 3KXKA 2OFXA 4JT2A 5EUQB 4ZDIA 4PO1A 2CCJA 1ZM9A 2HYDA 3TW4A 4TSFD 2BM1A 1HV8A 5KU1A 3AEZA 2FFAA 4QHSA 4C0HA 3Q7QA 3CRVA 3KJEA 2PCLA 2H57A 1LFDB 4HAWA 3AVWA 1PLKA 4B48A 3K53A 5FUYA 5AUOB 1W44A 1M7GA 3E70C 1Z0FA 4OHWA 1S8FA 2XSZD 2BKUA 1JXMA 2C8VA 1BYUA 3QPWA 5KSYA 2JLXA 1P3JA 1G6HA 5KO2A 4D4JA 3TMKA 2NPFA 1GWNA 1RRFA 1W7AA 2W0MA 4Z8YA 2V4ZA 4IEIA 3KFXA 1ZM3A 5KDLA 1E2HA 4JLJA 4FN5A 4U7DA 5EE9A 3DM9B 4RFSB 2CJWA 1C1YA 4JZKA 4CZ2A 1J99A 1OFHA 2G77B 2ZJ5A 2OBNA 4LHXA 4WA7A 4RJLA 3AUYA 4GZMA 1AM4D 3CPHA 4D6PA 1TTTA 1NN0A 4KAXA 2XJ9A 5IT5A 4PX9A 4LI0A 4LYHA 4QKQA 2JJ8A 1OFUX 5FL7D 3VTKA 3VR3A 4WZAE 3OIWA 3S1AA 4UXHA 1U2RA 3MWLA 1NVWQ 2R6AA 4GNKA 3WMFA 3SC3A 4Q4JA 4BEBA 2QBYB 3CR7A 1G64A 2DCUA 2D62A 2IHYA 2QENA 3FFAA 2WZQA 5CLQA 5B2ZA 4WIAA 1FQKA 4BZQA 4LJ9A 3QKRA 1G291 3TE6A 3IGFA 3U7GA 2ZI9A 2A2ZA 3ZD7A 2GZDA 4HB2A 3OAAA 1S9HA 3T35A 3QG5A 1OXUA 1ZW6A 3AP2A 3MFYA 2GK6A 2WVJA 1IN8A 2QMUA 1UDXA 2ZSEA 1BO6A 2HEIA 3DZDA 1NBMD 1G8FA 4HAVA 1LW7A 1JEEA 1MR3F 4FCVA 2D3WA 4AK9A 1WBBA 3N2IA 2Q3FA 5TVKA 2J59A 1Q3HA 4A6XA 2ZJYA 1NVXQ 3RS0A 5K8IA 3T1OA 1WF3A 3K9NA 2WOJA 2QPTA 4CGZA 1DVRA 1XD2A 2DFNA 3ZGXA 1DAGA 1WP9A 2Z5FA 1UBCA 1R0YA 1R6BX 2W2TA 3EZ7A 2V9PA 5FFMA 4DVGA 5L8VA 1R2QA 2YWHA 1LS1A 2CVHA 1L7VC 4N1AA 4FD2A 1KDPA 4IVQA 4N3NA 2W6JD 3IO3A 4QJ4A 1GKUB 3IPXA 3C16C 4Q9JA 3C41J 5AJWA 3BB1A 1QG2A 1VG9B 1Z47A 2F1HA 4KSBA 5GVRA 1KO5A 2WJJA 4NDZA 3GLFB 1UM8A 1E6CA 5F9HA 1E96A 1OPXA 3IIJA 4AKEA 3FPAA 4L5BA 1E9RA 1M1YE 2FZ4A 3GJ7A 4FMCF 1GNRA 2ZSAA 3M6AA 3NHAA 1Z0AA 3NC0C 1QDEA 4RCYA 2DWQA 1U0LA 3TK1A 4E03A 4PZLA 3GLFE 4QGAA 2HXSA 1GUAA 3RVBA 4ZCLA 5SZIA 1AZTA 1IBRA 4C0QC 1US8B 1VIYA 4C0LA 4I1SA 1N6PA 2B6HA 1KI6A 1UEIA 3K0CA 1OXVA 1XTRA 2EFDB 4BFTA 5F3WB 1XJCA 1OF1A 1YR6A 3MRSA 4HATA 4E09A 3SNHA 2I1QA 1ZD1A 3K0EA 3WNDA 5J4HA 3FKSA 4RCZA 4CT5A 2JEOA 2ZPTX 2OM2A 1FMLA 1XEFA 2XITA 2KWIA 1JB1A 3R9IA 4L16A 4W5JA 5BYJA 1PZNA 4MKHA 3W9YA 3QSYA 2WTUA 4OK5A 3GLIE 1IONA 1M7HA 1YU9A 1IN7A 3TH5A 1GSIA 1XD8A 1ZIPA 2AR7A 4FMDB 2GXAA 1RW4A 4GL2A 2QPOA 3FGNA 3H2YA 1FTNA 3KL4A 4KYUA 1BMFD 1TF5A 3LBHA 1XJ0A 5GJCA 2GETA 1IXZA 1JNYA 1Z0KA 3I61A 3AP3A 4A2QA 5AUPB 2V8OA 2G6BA 4Q48A 3VX4A 5D3QA 2C96A 4ZI3A 3FVQA 3LLUA 4P4UA 5ANRB 5C46F 2O8EB 4NU0A 3SHWA 2A7QA 3E2IA 4IFBA 3KUCA 3N70A 1HA3A 5EE3A 2C77A 2YWGA 4Q02A 4YMWA 3RS3A 4V0ME 2DWOA 3RC8A 4PPGA 2N42A 4NL4H 1UADA 4DIEA 1KI7A 1F2TA 1W4BA 1Z0DA 2JATA 3UMRA 1FX0A 5GVSA 1QHSA 1NRJB 4NTZA 5JWRA 5KNCA 5L3SA 1FUUA 4WZBE 1NLFA 3GJXC 2QRNA 1IJEA 1JBKA 1KO1A 4L4UA 2HF8A 4LJ5A 4Z8XA 1RYFA 1A2KC 3NIBA 4M9XA 3SYNA 1KJZA 5SZJA 2FV8A 1XEXB 4XH9B 4ZKEA 1N3BA 4F38A 1G4AE 1OKKD 4EJSB 3QVUA 4TLAA 4UNNA 2OSBA 4XVUA 3JZMA 2AX4A 3DKVA 5LB2A 3TVDA 1YJ5A 4YDSA 1YZGA 4DDUA 2WV9A 5H70A 2WICA 3GJ3A 3UMSA 2PLRA 4B2PA 3U44B 121PA 1GRRA 3NBZC 2DB3A 1OB5A 4G01B 4RZ3A 4ZCMA 1HE1C 1W4CA 4O0MA 3SU8A 4B74A 5BW8A 4AYTA 3Q7PA 4QNMA 4B47A 4TSFA 3TQCA 4Q01A 3K09C 3AVTA 1E79D 1W0JD 3L0PA 2VP6A 1CJVC 1OV4A 3B1XA 4I4LA 4MQBA 4A2PA 4EQ6B 3NWJA 3HU3A 2XSZA 2OCBA 2XB4A 2A5YB 1CJTC 3RRNA 5KYKA 1NVVR 3QKUA 4BZXA 1TNDA 1N6HA 3BBPA 3DL0A 2B92A 4J0QA 1G5RA 1UFQA 4DLWA 5DIFA 3R7WA 3M4YA 3MJRA 3E5HA 3KXLA 4KFTA 1V5WA 3WNCA 1U8ZA 4Q1AA 4Q47A 1Z06A 3HU1A 1T0JB 4DLSA 2GCOB 2PJRA 1AJEA 3IDQA 1J8YF 1Q1EA 1P61B 3PUYA 3AM1A 1XWIA 3AH8A 4AC9A 3UK6A 3A1WA 2ZYTX 3AGQA 4JLBA 5EP4A 5FL7A 4YXWD 1KK2A 4BFYA 1NF3A 2VBCA 3QXSA 2MMGA 2ODWA 2ZRDA 4HAUA 2HV8A 1E0SA 3BS4A 1CRPA 1CLUA 2G0NA 1W36B 3CUEF 1WCV1 4KFRA 3U7HB 5CK5A 3W8NA 4CEIA 2IS4A 4BFXA 1IN5A 1FPMA 3OEHD 1IJFA 2EYQA 1TPZA 1LS6A 3BXZA 3GJ5A 3U3RA 4F92B 1KI4A 3W34A 5FOXA 4TWZA 1KMHB 4B75A 1NBMA 1ZRHA 2JJ2D 2UVQA 4IEEA 1CXZA 1HY3A 2J7PA 1GL6A 3I62A 2BBSA 3QXJA 3W5JA 1KZGB 2HDNB 4K8OA 5JRZA 5CDFE 4HSEA 1CTQA 1D2NA 1FUKA 1E2MA 3FB4A 3TQFA 2O8DB 1TMKA 1MH1A 4FINA 5F2EA 5K8TA 1VG0B 1YQTA 2OE2A 4JYBA 2IYWA 2J0UA 4TTRA 4NKRA 4PSKA 2P3SA 5FOWA 2W6JA 2FE4A 3H84A 1XEXA 2IUTA 1N0UA 2R6GA 3LY5A 4BLRA 1KYIA 4EJSA 5FOUA 4ZIRB 1D9ZA 1P5ZB 2QN6A 3PENA 4PC7A 3X1DA 3HR7A 2Z0MA 2REXB 4G5RA 4I1UA 2HXYA 4B2IA 4P33A 5KPDA 2IS6A 5FBVB 1YVDA 2QE7D 1X8LA 3T06B 5C4GB 1AGPA 1D2MA 3B1YA 3QIAA 3T34A 4F91B 4A92A 2RGDA 4Q00A 3P1JA 3KKQA 4C0KA 2QGZA 3AVYA 2GDJA 2G83A 2JLQA 2F43B 2RH5A 1R5NA 3U3OA 2ZJ8A 2VPPA 2QMEA 2HLDD 5AJYA 2XZPA 2Q9AA 1Z6YA 3SQXA 2JJ1D 5DNYB 3VR1A 1I4LD 1ZMXA 3NBYC 4A9AA 1W5TA 4ON9A 4LK2A 4OJQA 1N6RA 1Z0JA 4TMXA 1D8TA 1NP6A 2IK8A 4AURA 2ORIA 2ZR7A 3PEYA 5SZHB 1OXTA 4KFSA 3AKYA 2X8AA 2J1LA 1CU1A 2ZYWX 3ASZA 4KCGA 3WMEA 2BVNA 4C7OB 4OK6A 4LV8B 1OFTA 4JT4A 6Q21A 1ZM7A 3U6BA 4BFWA 3ICQB 1IY0A 3NHBA 5LB4A 4DT1B 3B1VA 4OI0A 1BMFA 1EX7A 4RZXA 4EFLA 3CKLA 2QI9C 1DE0A 3SEAA 3ONWA 4GMDA 2AFIE 5JSZA 1W48A 3RS5A 4FMDF 5DHFA 1M7BA 2GILA 2WJVA 2ZAMA 4DUGD 4BRWA 5JMTA 4NCNA 4AIIA 3HPQA 2VHCA 3BH7A 2JA1A 3K0FA 1U94A 1WE2A 4GBMA 4LSGA 4ZV4A 2ASEA 3NTUA 1G1MA 1XXHA 1KY2A 1KAOA 4GOJA 4W5WA 3W6PA 3R9XA 1XMJA 3MLEA 5B58C 2B8TA 3EZ6A 3BERA 3IIKA 4OI1A 1UF9A 3LRPA 2PEYA 3CF6R 4PHGA 5JBQA 4YQFA 2ZSFA 5FOVA 2Q3HA 3JVUA 3AKCA 5G41A 1KI1A 4R9UC 3X1YA 1XNJA 4XJXA 1XCGB 1ZUHA 4LC1A 1OIWA 1E2KA 4A15A 2IUUA 1P9NA 3BK7A 3W90A 3CF0A 5H8WA 1OKKA 3CH5A 3LNCA 3K1JA 4NH0A 3LXRA 3B7GA 2WWWA 4DZZA 1CULC 2JLUA 5J4KA 1EGAA 1KOFA 1LTQA 1SHZA 3IQWA 3NKVA 4DCTA 2F1IA 4H9GA 1K8RA 3W5IA 3QKSB 1SVIA 4QM7A 4CVNA 1RJ9B 2O0HA 1QF9A 3GJ6A 1C9KA 2ZRBA 4CDGA 1G8GA 2Z83A 4IVPA 2RGCA 1BOFA 4Q03A 4KI0A 2KJQA 1I2DA 4EJSC 2A78A 3KTAB 5C1BA 3LX8A 3SYLA 1QHIA 1XDBA 2YV5A 3IPYA 4GOKA 3EPLA 3PXGA 3ZQJA 3ZD6A 1XTIA 2FN4A 4QHTA 3LAWA 1E79A 4WW0A 3TBKA 4MRNA 1II8B 2VF8A 2HCJB 4KXFB 3ADCA 1AKEA 1O3YA 1QZXA 4BZPA 2D7DA 421PA 4PR0A 1VCNA 1DO0A 4MRSA 1ZU5A 3T61A 1E9AA 4RY2A 3I3SR 2JGNA 4YMVA 1SVSA 2DY1A 2FX3A 2JIZD 3QBTA 3SJBA 3CWQA 2WWYA 1GTVA 4D0LB 2V3CC 2PMDA 1OXSC 3KKNA 3QKTA 1DAIA 1NY6A 4K81B 1MV5A 2OILA 2H17A 1NJFA 1KI9A 4HAZA 2ZVPX 4NYMQ 1VYVA 5E7MA 3FOZA 2GF0A 2C9YA 2I1VB 2VYFA 5CLLA 3IUYA 2VHJA 4AD8A 1R7RA 1XB2A 3AF2A 2YOGA 3P27A 4EIWA 4ZDJA 3HP1A 4XWAA 4TL8A 4GDFA 2GXQA 3TKLA 1E94E 2V7QD 4M1WA 1GITA 1KGDA 5DYGA 2YC4C 3H0KA 1OH7A 2NO1A 4NMMA 5KUTA 1CIPA 1U0JA 2WHXA 2ECKA 4F93B 3KKPA 1P75A 2YWFA 2H8KA 1FZQA 3G82C 2CJWB 4B44A 4AYWA 2W6ID 3OEHA 5GJWC 1UAAA 2ZQ5A 3AKEA 3HWSA 3EPHA 1ZBDA 2A9KA 1EFHA 4D25A 1G7TA 4IOLA 2OAP1 1P62B 3PV0A 2ZR9A 2KI5A 3QPUA 2JJ2A 1T0HB 2ZRHA 3S1AB 3ADBA 3VX3A 1RIFA 3O47A 4Q4JB 1Q12A 3T15A 3IEUA 1E99A 2G3YA 2QEQA 2WM9B 1E98A 3AVOA 4BRUA 1W36C 1JEDA 1X1SA 3QKRB 4ZKDA 4RD0A 1P9WA 4C0SA 1Q22A 3U6KA 1TU3A 1DBSA 4NPHA 2QP9X 2EFGA 4C2UA 2FA9A 4BGDA 4LJ6A 2HCBA 2P65A 2ZU0C 2IYVA 2B7BA 5FPKA 1ZNWA 3QJYA 1Q0UA 3LX5A 3LBIA 3LH5A 3VR2A 1AKYA 1RZ3A 3IKJA 3EC2A 2R6DA 4RKFA 3CB4A 1Z28A 4FI3C 3MSXA 3I5XA 1U98A 5FUXA 1XD2B 2A3RA 4XSHA 4MDFA 1QHGA 3LV8A 1IM2A 2OHFA 2QE7A 1II9A 5FUVA 1XPRA 2J41A 1T91A 2EVWX 3MUFA 5EZ5A 4DSNA 4PPFA 2QROA 4LJ7A 5JJIA 3PUWA 2PCJA 4A6PA 4A2WA 1N5KA 2ZXUA 4JJKA 4TMWA 5HCIA 2C9CA 2NZ8A 3THXA 4P4SA 5DGXA 3WYGA 2XX3A 4F4JA 2O8FA 3W8RA 3GP8A 4WVFA 3VKWA 3FHOA 3C5CA 1KJYA 5KSPA 1E2GA 4ARZA 3SS8A 3V4RA 2FSFA 1DAFA 2ZR0A 1RRPA 2C2HA 3MAAC 3UIEA 5E7IA 4TN1A 2JJ1A 2QQ0A 4PHHA 2KE5A 1W2GA 2FDCA 2XTNA 4DB2A 4AKIA 2QG6A 4B6EA 3GQBA 1CR2A 2WJHA 3QXHA 1IY1A 4R2HA 4MYHA 3RAPR 3RNLA 1U0HC 4TZ6A 2QL6A 1E0JA 1TEVA 3R20A 5AWFC 3TW8B 1SXJD 2ZRLA 4ZCIA 4FIDA 5JFGA 4L9WA 1ONBA 5A5GA 4BECA 1I4DD 5JRJA 1KI6B 2FNAA 3LQRA 4DSUA 2GESA 1KK0A 5FOSA 5FPHA 2H18A 4PAOA 3I8XA 2HT1A 2DHRA 2QAJA 1YHNA 4DUGA 1P9RA 2NG1A 3BWDD 3VR4A 1Z6AA 1T3LA 4TYYA 2VTKA 4B3BA 3TNFA 5KNDA 2WWHA 1GOTA 1JR3D 3B60A 5P21A 2ONJA 2GEDA 3MMPA 2KBFA 5EP3A 2AKYA 5DLQC 3BIFA 4UXIA 2WWFA 2LCFA 1XJQA 4A82A 4OQXA 1U9IA 4V0KA 4IKEA 4URZR 3L8ZA 4B32A 4UXJA 3AUXA 3GLHA 2JLSA 5G40A 3UMFA 3ZYCA 3CZPA 2DFTA 1OYWA 5AJXA 4US1R 1D6JA 2WWGA 3VNVA 1Z3IX 2IA5A 4O2RA 4OHVA 1WMSA 2ATVA 3ADDA 1T3SA 5HE9A 1DS6A 1WRBA 3M0EA 4UJ3A 2REBA 2ZSDA 2WKQA 1R10A 1U8YA 1E0AA 5FTMA 3QF7A 1DPFA 1IY2A 2EWVA 3PQCA 4PQYA 5JJLA 4V0OA 1F2TB 2L0XA 2XNDD 5DHAA 1G7RA 2IYSA 1FX0B 1M2OB 3DMDA 4ERNA 4B3CA 2BV3A 5L3SB 3U60B 3CRMA 3GPLA 1NJGA 2RKOA 2C78A 2G88A 3AP1A 1MT0A 4DDVA 1SVMA 5CYPA 2ZROA 4G0NA 2J7PD 4NYJR 4Q1DA 3X1XA 1KI8A 2PBRA 2GNOA 4MH0R 1KHTA 2IS1A 1SKQA 2IYLD 1Z2AA 3TLXA 4B73A 2MMCA 4BFUA 4GFDA 2KB0A 3WMGA 3CH4B 1RE0A 1D9XA 2I3BA 4HUQB 4DEYA 3M1IA 2RGEA 2DR3A 2Z43A 4D0NA 3ADKA 4LJ8A 3O8RA 1RRCA 2H92A 3Q9LA 1DADA 2ZRJA 3K70D 1TU4A 2J0SA 4BWYA 1KY3A 2PZEA 1A82A 4FXPA 2BWJA 5TXGA 1E2DA 3U7FB 3FDIA 1UBGA 2BM0A 3B1ZA 4M8NE 4NCJA 1JXOA 4R71A 2JLZA 1NKTA 1KDRA 3I5YA 1X6VA 2JIZA 3I8SA 4OYHA 1GG2A 1RC8A 3P32A 2WJIA 2ZJ2A 4AKGA 1RYHA 2FZLA 2QTHA 3K9LA 5EXSA 1N6OA 3IHLA 4TT3D 3NVAA 2XOKD 1OE0A 1Q3TA 4NYJQ 2UKDA 4UNPA 3DEFA 4DCSA 1S9DA 2VA8A 3AVPA 2FSGA 5DO9A 2JDIA 3PUZA 1G3MA 1W49A 2ZUCA 2V7QA 1H65A 4KSCA 1XPOA 1XTQA 1FP7A 3PITA 3WP0A 4DWJA 1DAKA 4PHFA 2B8WA 2ZETA 3LW7A 4IHQA 1TF7A 4DCUA 3U5ZB 3R7WB 3PCRB 2OESA 1WBDA 3K9HA 4B34A 2IXFA 4OHYA 221PA 2KBEA 3CRQA 4PPQA 4PFSA 2W6IA 4FCWA 4OL0A 3RRZA 3F3YA 4Q5IA 1Z5ZA 4Q1BA 4Q7LA 1XMIA 1FOEB 1WA5A 1AZSC 1KTVA 2XJ4A 1G9XA 1SHKA 1IHUA 3LWNA 1AGRA 1KO4A 3CNLA 4Q9LA 3THWB 3E1SA 3IBYA 3RABA 1U9IC 3B2EA 3I73A 4S35A 4DBLC 4CEIB 2IYZA 2ERXA 3DKPA 4IDHA 3V9PA 3MWKA 1SZPA 2ZITA 1XTKA 5DI3A 4Q9IA 1TX4B 2AHOA 2WSSD 4MGYR 4RZUA 1F6BA 1VMAA 3AB3A 4G3XA 3I4LA 1G7CA 4P32A 1KI2A 1R0ZA 2IX3A 4QBFA 4RD2A 3LQQA 4KU4A 1OSNA 1KO7A 2ZJAA 1S96A 1TAGA 4AG6A 2JAQA 5FL3A 2MSEB 2ZRNA 1N6NA 3BD9A 4DCVA 4IJMA 4DLXA 3A1VA 3ZZTA 3TVTA 5DYIA 3QY0A 1ZJ6A 2IF0A 1G6OA 3GJ8A 2ZM5A 4QGGA 4EPTA 1NBME 3GFTA 4TLCA 4TMVA 4LHVA 5FTKA 1TF2A 3LDAA 4Q7MB 2EFCB 2RGNA 2P6UA 2YYZA 4PQFA 5FTJA 2IF2A 2TMKA 2NO0A 2G9NA 1GILA 2V1UA 2JASA 3VKGA 2R62A 2J0UB 1I2MA 4PZZA 2FSIA 1VCMA 3WHKA 3X1ZA 3N2EA 3CBQA 2OFOA 2P5TB 3U3KA 3TGPA 3SJCA 4WBSA 4Q7KA 1VCOA 4DCNA 2WOOA 2FMXA 3GCGA 3EPJA 1G8HA 1G4UR 3ZVRA 4HLQB 4W7SA 4M21A 2XZLA 1YR9A 5HKKD 3RSLA 1GNQA 1PLJA 2ATXA 1OIVA 2WJYA 4FCTA 1KIMA 3A1SA 4HUQA 4JLKA 2ZVQX 4XOIA 3CW2A 4Y0AA 4FW9A 1TQDA 3QEOA 1P7CA 2WAYA 3FMOB 4TYQA 5KHOC 2E1RA 4W5HA 4JVLA 5KSOA 1CJMA 1P2TA 4OJKA 3VU9A 4D26A 5EP2A 4O25A 2QMHA 2ZEJA 4MYTA 1SXJA 1NMZA 3SHFA 5H1YA 1DEKA 2HT6A 4JMPA 5CB6A 5HZHA 4I1VA 5GJVC 1GNPA 3Q8XB 1Y3AA 3A37A 1P60A 4N0DA 1MO5A 2CXXA 4QXAA 4V0LA 3VR6A 4EUNA 5AK0A 2FF7A 1I4TD 3R9WA 2WIBA 2QM7A 4A36A 1Z2CA 2GVZC 3W6OA 4ACBA 1GRQA 2RGXA 5CB8A 1VTKA 4Z51A 2WJGA 1SVKA 1CP2A 1ZUIA 2N1BA 4LY6A 2H5EA 3B85A 1JR3A 4ZDWA 4H1VA 4CT4B 1YZUA 1E2NA 1JPJA 2OCPA 3B9PA 1EFUA 3K0CC 4DLRA 2OXRA 3HJNA 4ABYA 2EWWA 1KKMA 4EPVA 1V43A 3GFOA 4LBZA 4D81A 3IIMA 3K0AA 4BLTA 5JSZB 4PC1A 1E2LA 4M9SA 3KJGA 1D2EA 4QJ3A 3CLVA 1F5NA 3FE2A 3QQ5A 4DRZA 5J4LA 1XRJA 1TQ6A 3K0FB 1G5PA 1P72A 1X8KA 1XP8A 1XXHB 3ZS8A 5JHHB 2PT5A 1TL7C 3THWA 4O2LA 5EQTA 4Q19A 4LOAA 4BFSA 3TAUA 4NBSA 4GT1A 2YOFA 3NEJA 1RRGA 5EP1A 2OAQ1 2W2VA 4KITB 5SZKB 3GLIA 2EU8A 2XNDA 3MD0A 4M2LA 4EPYA 2BC9A 5JWOA 2H7VA 2YWEA 3U4QA 1XXHE 2FEOA 1VPLA 5A4JA 1G5TA 4M9ZA 1IXRC 2FU5C 2UZIR 2VL7A 4OQLA 2VP4A 2ZE5A 3OFND 5FBWB 3VMFA 3QXXA 5KOYA 1CBUA 4DDTA 2J45A 2IC5A 3BGWA 4XTRA 3L2OB 2RHDA 1P6XA 4AG5A 4DJTA 3QNUA 2O8CB 1XX6A 2V1XA 1E9FA 2R8RA 2C04A 4R2IA 2X2FA 2D7CA 2JLWA 2RGNC 5TV2A 3WNBA 5E4FA 2OT3B 3A6PC 3P20A 2IWRA 2BDTA 4QG7A 4ESHA 2DFKB 1W4RA 1GFIA 2QTVB 2VSXA 3A58B 1QBKC 3A4MA 3EARA 1G3RA 2GZHA 1Q20A 1OIXA 3ZVNA 3B6EA 3QVVA 3ZZUA 4IDNA 2BJWA 4CF7A 3VR5A 2ZUBA 4NZYA 2N46A 4TT3A 4CIDA 2XOKA 3DHWC 4PXAA 5G3YA 3SN6A 4HI0E 4X8MA 4NCHA 1F3OA 1R0XA 4OQMA 2BJVA 3F5FA 4ESVA 3Q5EA 2ERYA 4JLMA 1F48A 5FR1A 1ANKA 1UEJA 4G1UC 5CIQA 1SXJC 2A30A 4OQNA 2QU8A 5K8LA 3U7EB 1YRBA 4X8LA 4DLVA 2F7SA 4Q21A 2H16A 2W2XA 3OZXA 3VNUA 2G1JA 5EUMA 1ZD9A 3W3ZB 2QPAA 2YINC 4YDHB 5BN3A 5KDOA 3QEJA 2O8BA 1B0UA 4EPRA 2LWIA 3NXSA 2E87A 2IYXA 3KQLA 3WY9A 1KMQA 5J5CA 5J4VA 1U81A 4G5SA 3GLGA 3OIUA 1JI0A 2JLRA 2Q21A 2A5GA 1IN4A 1G3UA 2Q3MA 2AKAB 2ZAOA 2QT0A 4OI4A 1QHNA 1G21E 5JI2E 2ZRKA 3KKOA 2ZS8A 3AVUA 2Z4RA 2FSHA 4IXNA 3Q3JB 2ZE7A 3PG5A 2OO7A 1R5OA 4RZ2A 1Z22A 2ZREA 1YR8A 4D82A 3V4FA 3IHWA 4HLDA 2WSSA 5JLJA 1Q21A 4RKEA 1EWQA 3UWOA 4RD6A 4M9QA 5EE0A 2P0EA 1G3IA 2C03A 1TQ4A 5BXQC 1SULA 4PC6A 2GK7A 2IXEA 2GAOA 2P5SA 2ZJOA 4PPNA 4EPWA 5KNBA 1G19A 1B23P 821PA 1GM5A 5EXXA 5FPTA 2UZ3A 2EQBA 4KLZA 3BRWD 4WXPA 3WYFA 4URVR 2QT1A 2ZI3A 3OIVA 3ZDQA 4HYYA 2OG2A 4BLOA 1KJWA 2CL6X 2QY9A 3AVQA 2XZOA 3CRRA 2QAGA 4G5OA 5JCPA 1RVDA 2C99A 4PTLA 3WRYC 1GIAA 2QP3A 3PVSA 1JJ7A 3LVRE 3QF4A 4TQAA 4B76A 4V0NA 5JCZA 1OJLA 1OH6A 1XZPA 4E22A 5F9FA 2IT1A 4HDOB 3JVVA 2O8CA 3LLMA 1ODFA 4HAYA 4LDJA 3EPKA 5HKKA 3RWMB 2MSCB 1QG4A 3IQXA 1NLZA 4TMTA 1DOAA 3AF3A 5JS7A 4EDHA 4GMXA 5DISB 2BEJA 3QG1A 3AVVA 4MKFA 1NG1A 3BH0A 2J3EA 1U8AA 3D7MA 3GJ0A 4RD3A 4A0RA 4A0GA 1WDTA 4NYMR 3U2QA 3KQKA 4H1UA 3THXB 4P4SB 2O8FB 2IBMA 2G1KA 1UKVY 2AD5A 1GP2A 1E9CA 2WMOB 3HDTA 4TMKA 4E5UA 3VHXA 2FGKA 1CKEA 2GF9A 4ARZB 5LBIA 2Q9BA 1EWRA 2ZIAA 1NLYA 4AWXA 4XWOA 2I4IA 2IYRA 1OW3B 2C9OA 1X86B 3V00A 3QENA 1EK0A 1DTSA 4CYMA 1EFTA 3DDCA 4JLNA 2IYTA 1CEEA 2CE2X 4QBHA 4C0AC 5E7JA 1DELA 2VF7A 1E9EA 3WBKA 4RD1A 2YC2C 4IVRA 4XSGA 1BS1A 4QGHA 2P6RA 1HQYE 1ZU4A 3BC1A 3GD7A 4LYFA 4A0FA 3LW8A 1W0KD 4PAQA 3LO5A 1GRNA 1MKYA 4NE2A 3ZVLA 2GAAA 5FR2A 4YLGA 4RVCA 2JDID 3I32A 1P2SA 1MO3A 2O0KA 4MRRA 2AN9A 4M53A 1Z63A 4MRPA 3GFPA 3PFIA 1N2CE 2E9SA 1WQ1R 3WP1B 4FMCB 2OV2A 3UKDA 2R2AA 3KDSE 1S2MA 3DOFA 4TMZA 3AF4A 1SGWA 1HH4A 1ZAKA 1NSTA 3K9GA 1E2EA 1NMYA 5EJEA 3THOA 3NC1C 3L0IB 3TRFA 2Q9CA 4DSOA 3GLHB 1P4SA 3UPUA 3KJHA 2X19A 4G5QA 4HZIA 4HUTA 1M6NA 2CK3D 3DM5A 1R5BA 4UNQA 2J9RA 1KSFX 3OFNA 5DI9A 1P2UA 4Q9HA 3QE0A 2VRWA 2GJAA 5GJBA 2P2LA 5JZVA 4OI2A 3GLHE 2NIPA 2A5FA 4LV5B 3R8FA 3A1TA 2FPMA 2XTZA 4LCBA 1ZNZA 2GKSA 3MGCA 3RHFA 1XPUA 3EZ9A 2HJVA 3KZ1E 2O0JA 4AY2A 4XD7D 5JECA 5BQ5A 1NKSA 2LKDA 2BBOA 4LHZA 3DVLA 2Q0HA 4L9SA 1N0VC 1LF0A 2YZ2A 4MKGA 4MDEA 2CL0X 4JBWA 1JR6A 5LDDC 1GAJA 5B30A 4HZUB 1BKDR 1A7JA 3AF1A 5G53C 4WXRA 4IDOA 5AUNB 2EW1A 3QI2A 2CHGA 3SQWA 1H8HD 4BEJA 1QHHA 2WBLC 1ETUA 2FFQA 3MG9A 4PC3A 5C18A 2GTPA 4KODA 4IFEA 1ESNA 1PVOA 1KK3A 1T6NA 2VP9A 3U3MA 5HR5A 2VSFA 1AA9A 2V6JA 3DO6A 1HURA 1GKYA 4URXR 2WSMA 3H1TA 2NTYC 2WKRA 4JLPA 3ZS9A 1CR4A 1PUIA 1U90A 4US0R 4B33A 4RFVA 2JLVA 2J7KA 2REOA 1COWD 3SJAA 1A4RA 3B1WA 1QHXA 2ZRGA 1E9BA 3C7KA 3N5CA 1YZLA 5JI3E 4IDPA 4MRVA 1ZD8A 4QJ5A 2W58A 1XBTA 1ZIOA 4GP6A 3RRYA 3RYTC 1KAGA 2CCKA 3TR5A 4ASUD 3SDZA 1RKBA 3QPVA 3H86A 5E3HA 4FWTA 2VP2A 2QMOA 4TLDA 3EG5A 2XXAA 2OCYC 2CL7X 3AVXA 4M0LA 721PA 1IAQA 2CHQA 1YZQA 2VQSA 1OYYA 4HLCA 1XZQA 3B5JA 2PEZA 1D5CA 3H4MA 1W4AA 2CHVA 5HTKA 1E2JA 4LPSA 1L2TA 1OH5A 1S4QA 4JL5A 4JJZA 1N6KA 4RSGA 1DO2A 4Q9KA 5IRCD 2XGJA 3A36A 1NN1A 4JIMA 1IOZA 3TJZA 1MABA 2IUSA 4CEHA 2DBYA 1OHHD 1XFAA 2J46A 3IEVA 2ODEA 5J4YA 1S3GA 8OHMA 4TLBA 2RB4A 1E0KA 2IYYA 2GXUA 1F2UA 1Q44A 2YVUA 2C98A 1GL9B 3HYRA 3SBEA 3THYA 1T5IA 1T4GA 4Q7JB 1J7KA 1YR7A 4Q1FA 3O8BA 2GVDC 3ZIAD 2GJSA 4F4IA 4M1TA 4E07A 2ZE8A 4Q4HA 4KFUA 4WOPA 5FI0B 1KKLA 4DDWA 4NYIQ 4QNRA 1TUIA 2HF9A 1JPNA 4JVSB 4C0BA 5K8UA 3CX8A 5AJZA 4AYXA 4D0GA 4IXMA 1HE8B 2GHIA 4L8GA 5D3MB 5DI3B 3Q5DA 2BEKA 3ZJYA 2HUPA 5IHPA 4LBWA 1YZKA 4UNRA 2IL1A 2BIFA 3RRMA 1NIJA 3R8CA 5A0FA 2H1LA 1O87A 1XTSA 3D3QA 1YE8A 5IDVA 1VECA 5HCNA 2ZRAA 5KTYA 4LUCA 4LJ4A 4Q4AB 3KQNA 2CLDX 2FPLA 2R6FA 2PL3A 1KK1A 5E95A 2D2EA 1N5JA 1P73A 2ZRFA 1JAIA 1N6LA 2QNRA 5M04A 2J0QA 2Y8EA 1T9HA 2QM8A 2BMEA 1Q1ZA 2XNSA 3IILA 4HZUA 2FG5A 4P3YA 3TSWA 1E2QA 4A8JA 4Z54A 2PX0A 4F7WA 1OH8A 3C8UA 3UG7A 4YMSA 2VP5A 2XB2A 3T5GA 2VHQA 4V02A 4CEJA 2R65A 3TUZC 4KVAA 3FHCB 5FUWA 3RDPA 3T5DA 1NNEA 4BFZA 1ZUNB 1KO8A 4B3XA 1OFIA 4TL6A 1JJVA 4URYR 2ZJBA 2XEXA 2RHMA 3NG1A 3W6NA 3B9QA 3CRW1 1KDOA 3KB2A 4DB4A 3BFVA 2GCNA 2C95A 1N5IA 2GCPA 3T1TA 4P4TA 3X2SA 5L3QB 4DKXA 1MOZA 4Z1MD 2P67A 3VU9B 1BH2A 3CM0A 1ZYUA 2PX3A 3P26A 4HEJA 1GVNB 3LA6A 1SXJB 1CJUC 3CONA 4YC7A 3RC3A 4AKHA 2D74A 2QTFA 2AK2A 1EFCA 1DG1G 1E4YA 2QGNA 3KB1A 3TUJC 4B6FA 4JLDA 2VSOA 1SQ5A 1UPTA 3AF0A 4C3ZA 4DLZA 1XEWX 5B57C 3DPUA 1E1RD 3TUIC 5CM9C 2W0SA 1A1VA 5JWHA 5EZ6B 1NY5A 1SXJE 1W0KA 3FMPB 2NO6A 1CR1A 4QGFA 2LKCA 4TYPA 2OLJA 1S3SA 1N0WA 1YZTA 4LRWA 1E3MA 3VQTA 1N25A 3D6TB 1P2VA 2G0TA 5DE3A 3ZVMA 1QRAA 3OE7A 3CWZA 3EIQA 4C0JA 4POAA 4FWIB 1E4VA 4M22A 2OUKA 2WWIA 4ZO4A 1G7SA 1TUEA 5F98A 1E1QD 3K09A 3TR0A 3K0AB 2HYIC 1JR3E 2V54A 4KBGA 3IBGA 1KNQA 2DYKA 1QVRA 1VDZA 2AWOA 2CK3A 2ZTSA 1M74A 3JZAA 5J40A 5LD2B 1EX6A 5TY0A 1W2HA 5AJVB 4UKDA 1TQ2A 2ORWA 2XAUA 1R8QA 3PEWA 2CLSA 1GDDA 5TMPA 4WZ6A 3KFVA 1T8UA 1NL3A 1G8PA 4XD7A 2BHRA 3NDBB 3GLIB 2SHKA 1LY1A 2ZRIA 4M1SA 3WXMA 1N6IA 3SOPA 3U4QB 4TLEA 4IOKA 1EG7A 2EFHB 1FQJA 1J8MF 3AV0B 4OQFA 5D3MA 4B3FX 3NBFA 2VP0A 4GP7A 2B7CA 3UANA 2FFBA 4HDQB 3NH9A 4JLOA 3REGA 4DC9A 2IS2A 3IO5A 4FMBB 2ZU6A 3AKDA 1Z6TA 2IYQA 1H8HA 4Q4AA 1A2BA 4URWR 4B3GA 1HT2E 1W1WA 2GBLA 3HPRA 4TQUS 2GWHA 4RFSA 1W47A 1FFHA 4TZ0A 1E9DA 2D4HA 4JVMA 1XCPA 1ZC4A 1Z29A 3WRXC 1E9SA 5IK2D 2QRZA 2RGBA 5CJPA 1PV4A 2F1RA 4ACAA 2A5DA 2FH5B 3CPJB 3DZ8A 1E2PA 5KSZA 1EFRA 4A8JC 3K70B 1M34E 1COWA 3ND8A 3NEYA 4OK3A 1Z0IA 2QBYA 4ILEA 1SVLA 1YZNA 1UKZA 1VG8A 2B21A 4WAUA 3WHLA 4A4DA 1FP6A 2WIAA 1W36D 1AQYA 1Z07A 1HUQA 2BMDA 5CYOA 1R4AA 521PA 3J81k 3C5HA 1JQJC 3F0TA 2Q6TA 4ASUA 3B82A 5DN6D 3O8CA 4MGZR 3OEED 3TIFA 2BCJQ 1NG9A 3GEIA 3B13B 4GZLA 4F4CA 2C5LA 2RGAA 4JSYA 2YHSA 4TYNA 1AIPA 5UKDA 5L3QA 1YKSA 3LFUA 4JBYA 2VLIA 4M4SA 1NIPA 2R44A 3I1FA 3BFXA 4JLVA 1KSJA 5FPYA 2ZI4A 4BASA 3RLFA 3KQHA 2GEUA 4X8OA 1MO4A 3ZH9B 5FOTA 4D2IA 2VIIA 3VAAA 4B35A 1L8QA 4EFMA 1XU4A 1K5DA 1OHHA 3EIHA 2IEZA 5C4MA 3PUVA 2ODBA 2O8BB 5FBRB 1ZNYA 3PEUA 4KHZA 2GJ9A 2ZS9A 3DMNA 2ZI7A 1AS2A 2BOVA 3A8TA 1AQUA 4PO9A 4NHOA 3GLGB 3SR0A 5L3RA 2CLCX 3LD9A 4LYAA 2ORVA 4IOMA 3MWJA 2X77A 1XD9A 2J5XA 4N0EA 3SJZA 4BLQA 2OLKA 4JVNA 3GLFA 3ZIAA 4BLPA 2YNMA 3AGPA 5FTLA 4HLUA 3ZLJA 3GLGE 4B3DA 2FPKA 1AS0A 1RFLA 1UKEA 3ICEA 4GSYA 4MUAA 4CRWB 3DOEA 1GZSA 2ZUDA 1R0WA 1ZCBA 3D8BA 3ETLA 1ESMA 4KLNA 4QM6A 1H8ED 5TARA 5GADl 2ZRMA 3RS7A 1FL9A 1LB1B 5BWMA 1US8A 4R7ZA 1VYTA 4OKSA 1K6MA 4KJZA 1UJ2A 1R8SA 1G41A 2ANBA 3P4XA 4TYWA 2GJ8A 4JLAA 5G3ZA 3FTQA 2EYUA 5IF9A 2YKGA 1XF9A 1SVOA 3BB4A 3ECCA 1Z6GA 4KBFA 1X1RA 4M1OA 4DEXA 1CR0A 5JEEA 5JJKA 4XVRA 3C14C 3CR8A 4Q1EA 1OB2A 3LVQE 3Q72A 2QAGB 2ANCA 4D4KA 2X1VA 4YONB 4II7A 1PLLA 4TL7A 3U61B 4MGIR 1GL7A 3BH6A 4LBVA 5JHGB 3QF4B 3KQUA 2BKEA 5AUQA 2YOHA 3CZQA 2GBLC 1HT1E 3I72A 4MKIA 1LV7A 1LNZA 3UG6A 2F6RA 4QOSA 1NMXA 2A5JA 3I92A 1IXSB 1ZCAA 1DG3A 1S1CA 3GJ4A 5FBQB 1NVVQ 4IOJA 2F9MA 2ZRPA 4V0MA 4UQOA 4A0HA 2AXPA 3EASA 3BOSA 2FFHA 4EAQA 2O8EA 4XWKA 3F8TA 3UXMA 3RS4A 3ZQ6A 4Q18A 4Z1MA 2AWNA 4BPBA 3U3JA 1E32A 2ZI6A 2QUZA 3B8HA 4QHYA 1L4UA 3NBXX 3SFZA 4OBEA 4PSAA 1WXQA 5CITA 2O52A 2OFWA 4JL6A 4MGKR 1L4YA 4A1FA 2ZS7A 4C2TA 4G5GA 4C4PA 4TTQA 4GI7A 5EXTA 1E1RA 1KNXA 1S1MA 2GEVA 3QOFA 2ZSBA 5FI1B 2PZGA 4C30A 1DARA 2DPXA 4BUJA 1Q57A 2XTMA 4BQSA 5ELXA 1TADA 2CNWD 1HYQA 3RS2A 4PZYA 4JYCA 1KSGA 2CMKA 2CE7A 4W9MC 4MITA 3EWAA 2F55A 1XTJA 4LZZA 3VFDA 1XMSA 2IW3A 2IEYA 3K0SA 1YRAA 2IWHA 3SYKA 2NGRA 1JAHA 1E1QA 1VKJA 1QVAA 2RAPA 1CS4C 2AFHE 4LJYA 4X8HA 621PA 1CRQA 2NOAA 1OT3A 2QZ4A 3A4LA 2QSYA 3U44A 5CIWA 2OCAA 2WMNB 1T8TA 1ZM4A 2PH1A 1XMVA 3CO5A 3EC1A 4KO8A 3EZ2A 1ELOA 1C4OA 2JCSA 3BFKA 1AS3A 4QFMA 2QORA 2F3RA 1IQPA 4GPTA 4US2R 4IRUB 1NI3A 2VO1A 2WPDD 3BB3A 3CIOA 3PIRA 4KYIB 1MO6A 3L43A 2KSQA 3ND9A 4HLUC 1NSFA 3HYTA 4TQ9A 4LX0A 1EESA 2OZEA 1ZP6A 2FWRA 3EWSA 4LV6A 4EQ6A 5LD2C 5EE5B 5TDHA 1VG1A 2ZYUX 3RANA 1WB9A 4GRAA 2VHTA 4DXAA 4M1YA 3G5UA 1ZM2A 4O3MA 2FJUA 2OEPA 3PEVA 1FNMA 3EX7C 3FMFA 1E69A 4CW7A 3VKHA 2PZFA 3CPEA 2FGJA 4HDCA 4NCKA 4OHZA 1QHYA 1G16A 3QUSA 3T1VA 2NMVA 1N5LA 1W46A 3O8DA 1G8YA 1OLOA 1G18A 4PAMA 4Q66C 3FYHA 3FWYA 1RPZA 2GCOA 2NZJA 3QXCA 4DHEA 4UJ5A 5IK2A 3ZZ0A 1FNNA 4HB3A 3CX7A 1OXXK 4LPKA 2QSZA 3QBVA 4IW3B 1VHLA 4U00A 5C2JB 1ZC3A 1JECA 1II0A 2NPIA 3A4NA 3Q85A 1LVGA 1DAHA 1X3SA 4Y0VA 5EXPA 3TSZA 3AQ4A 1AK2A 4YMTA 1QHHB 3NDPA 2GA8A 1G20E 3WBJA 4ZI2A 1UDWA 1MRSA 3ASYA 3EA0A 3PUXA 3VHLB 1ZNXA 1HEIA 5DN6A 1J90A 2W83A 1LF5A 3OEEA 2IYUA 2OXCA 3WYAA 1Q1QA 4HB0A 4B43A 3K70C 4IDQA 1AN0A 1KSHA 5CDFA 4D4LA 1KMHA 4PC2A 2NQ2C 4QBIA 2PMKA 4XIGS 2AL7A 5KDDA 4DIDA 4PQRA 2NO7A 1KDTA 3UATA 4QBGB 3X1WA 2J0VA 2CVFA 2IXGA 5J47A 4AI6A 1J2JA 3SBDA 2AK3A 2F3TA 2GXSA 2RGGA 1DAEA 3FMIA 3OAAD 3RWOA 1VCIA 4JSTA 4LWZA 2O8DA 1KZ7B 2WAXA 2QA5A 2XXAB 4B2LA 2AD1A 5AR1A 2J87A 4KVGA 3HU2A 1ZVQA 2V6IA 4PANA 1NN3A 5HPYB 4DLYA 4LBYA 5FTNA 1G17A 3C15C 2QP4A 2W00A 2YJTD 1M8PA 2D2FA 3PJRA 2ZYVX 4ZIRA 2IHBA 1GKIA 2NO9A 3EIEA 3PR1A 4QL3A 4MA4A 3TAHA 5FH9A 4HB4A 4QRHA 2CEAA 2X2EA 2DFLA 1MABB 1VYUA 5LPNA 3CX6A 1W0JA 4YMUA 4CEHB 1W5SA 3T1QA 2F1JA 5B64A 2ZI5A 2PLFA 4PO8A 1F60A 2CBZA 3L0OA 4LJAA 4U02A 4M1KA 1H8EA 4HAXA 4Q1CA 1VIAA 4XVQA 1F2UB 4XTCS 2F43A 1BIFA 3EXAA 4P0TA 2RCNA 4TL9A 3OE7D 5JS8A 3THYB 2CDNA 4JKYA 4LC0A 2AXNA 1HQCA 2BBWA 4BFVA 4DLUA 1UBEA 1EXMA 1CF4A 1HTWA 1FMJA 4Q4HB 4BE7B 5H68A 1NN5A 4QC2A 5DH9A 3LBNA 5BN5A 1FTSA 2VH5R 2DWPA 2R9VA 4JBXA 4JL8A 3RSOA 2P6NA 4DSTA 4PSVA 1XEWY 1Y63A 2BCGY 1DAMA 3KX2A 5TB5A 2GRJA 1T3HA 3GEHA 3MWYW 4C7OA 4Q4LA 5FBLB 2VHUA 4YXWA 3BORA 4BLSA 4ITRC 2WWXA 1G3QA 2Z6VA 1S0UA 4EPXA 4EKDA 3G0HA 4NCIA 4UNSA 4DLTA 1J70A 2CCGA 4DT1A 2PT7A 1X8JA 2GJKA 3FKQA 2ZE6A 3FFBA 3KUDA 3EA5A 2FEMA 3SFVA 3CNOA 1K5GA 4S2EA 3FKSD
chains in the Genus database with same CATH superfamily
5FYDA 2XLCA 5EPHA 3LSYA 1A5TA 1TEXA 1SUWA 4LV0A 1D1PA 3ZTWA 3TG8A 1YK0A 1X1TA 3FNIA 3FCUB 1Z6XA 1YCHA 5EV0A 3MJHA 3KYDA 1ZR4A 1FLAA 4P31A 4DJJA 1XZFA 4GM4A 2WU1A 4LQDA 3EHEA 1Y1QA 4D1YA 1SZCA 3LRTA 4BRSA 1NQXA 4L15A 1IN6A 1PI3A 3MQ4A 4QARA 4ZAYA 3PQEA 4GS5A 2FOLA 3KTAA 4Z99A 2WDZA 4WCVA 3L0SA 2P08A 4G8CA 5HJ5A 2HSJA 4LRYC 4LI3X 3M2KA 1W2WB 2G9ZA 1Y1RA 3I76A 2R6JA 3KLPX 2WYUA 2H57A 4M0DA 1LFDB 4QUIA 4GW9A 3AVWA 3LS2A 4WKNA 4DIKA 3QM1A 1A8HA 1QUEA 2Q7DA 2EL9A 5DBFA 4MW9A 5KO2A 4CT0A 2X14A 2NZVG 1J99A 4EBPA 5EWJA 3CUYA 4UW9A 4WZAE 3MGKA 3BJMA 1U3TA 3FFAA 4AN1A 3A04A 5FQIA 5CLQA 1FQKA 3U81A 1H4SA 4O4JF 3TE6A 3U7GA 5DM0A 1FNCA 4JV5B 1Q0RA 2QMUA 1X39A 3B3GA 1C7IA 1BO6A 3HJAA 4PYKA 1VBMA 4Q3EA 5BYAA 1MX9A 4D3ZA 3O03A 1Q3HA 3RS0A 6REQA 2PS1A 3EXG2 1R2QA 5AM2A 1KDPA 2O7VA 3BKXA 1YB7A 1GLGA 5DK6A 4HBUA 1ZOPA 3HE3A 3NETA 1Y4SA 1E9RA 1BQ3A 2EG5A 2FZ4A 1X7WB 4GXRA 4CF7A 3BXXA 1SBIA 4D02A 3FVTA 1ESCA 5IW8A 4E09A 5BY2A 1FMLA 3WWEA 2KWIA 3FXAA 3QSYA 4EOGA 4OK5A 5LXTA 1IONA 3CZ4A 4LW8A 2GK4A 4GMFA 1VFPA 5JXHA 1M2KA 2VPQA 1XZGA 4RKRA 2QU7A 1P0IA 4ZI3A 3BRMA 4F3RA 1T1GA 1ZOOA 5JADA 5AJUA 1HA3A 4A6DA 4DA7A 1F5SA 4NL4H 1UADA 3ET5A 1QHSA 1UWVA 3EVZA 1JQ5A 3SYNA 1KJZA 1XDSA 3A6EA 4V38A 3CJRA 5I7EA 1QQ6A 3LSTA 1PK8A 1BXZA 1EP2B 2ZSUA 4EX7A 2R86A 2O2XA 2Q5HA 2PDRA 1MC8A 2WT4A 1RLUA 2REQB 3EXEA 1E79D 1C2TA 3AL3A 4J1TA 1TCUA 4HWKA 5EFOA 3AERB 4WL9A 1TNDA 2XXJA 1JILA 4DOMA 3IALA 5HOEA 1OT6A 3HU1A 4PY2A 4G3KA 4MW5A 3AIIA 5EP4A 2YY7A 1YS7A 5K99A 4OPQA 2MMGA 3I3OA 2AZMA 2ABWA 3HDVA 3HTXA 4YCCA 4OOEA 2EYQA 3W6UA 1ZSVA 2VP3A 4JJ4A 5ILGA 2MJLA 3UB5P 3HCRA 2OC9A 2BBSA 3OM8A 1TZBA 2NUTA 4ES6A 3FG8A 1L4HA 2ECQA 3JQAB 1UP7A 2X7XA 1THMA 1XZMA 2FE4A 3EWIA 2IUTA 1OLUA 1KYIA 3ZI0A 3SQOA 5HKOA 3PICA 3CS3A 5ARDA 5C4GB 3S2ZA 3T34A 2WUQA 4BV9A 1DTEA 5DNVA 4ZMRA 1WCIB 3RTBA 2QGZA 2QMEA 5D5PA 1KKUA 3T5BA 3PEYA 1NP6A 2OGSA 4ZWNA 3WMEA 1V8PA 3UPNA 2CB0A 3EF1A 1KORA 3DTNA 3ICQB 3ZQ4A 1STZA 1THGA 4GMDA 3BL6A 5GGXA 2X1HA 3STWA 2D2XA 4AIIA 3H8SA 4LSGA 1ADYA 3FNQA 4NQZA 2DOKA 4WH0A 1LSXA 1BSGA 5TQ2A 2XMZA 3FRHA 1SVNA 3UXHA 3MXSA 3CJTA 2D5IA 1E2KA 3DTVA 4QWMA 2JHAA 1B3RA 1UC9A 1B15A 2X5NA 2WM8A 4UASA 5ELLA 1JIQA 1EINA 1SN7A 4CDGA 4M36A 5FAQA 1M1XB 8GPBA 1SCWA 5JNTA 4RK7A 4L8LA 3TBKA 1UPXA 4BZPA 1WHSA 4Z9AA 1EK5A 3ETNA 3ZD8A 1SVSA 4OATA 7MDHA 1P29A 3UBTA 5EM1A 2BPOA 2ZVPX 5HA5A 4Z3OA 5EWLB 4KAJA 4OBXA 4XM1A 2XNJA 1M10A 2QJWA 2RHHA 3H0KA 5LOVF 2NO1A 1Z3CA 1CNFA 1AURA 3LP6A 1IOVA 1G7TA 4Q4JB 4PYJA 1AWIA 1Y9JA 1EBUA 4BO5A 1TU3A 1DBSA 3M2TA 4CG0A 4MK4A 4UVDA 1FU7A 2JKYA 4NS1A 5FPKA 3LDFA 2VAWA 4WK6A 4MLPA 3AFNA 3LPMA 2PSFA 5FWYB 1T91A 1H1LB 2VX8A 8LDHA 1QGDA 2JFYA 3PUWA 5ERGB 4ZGGA 3INRA 1TFUA 1Y34E 4RAQA 3W8RA 3GP8A 3KSGA 3A0RB 1ULSA 2BFOA 2R6HA 4S2JA 4XGKA 2ZR0A 3W1VA 1CR2A 3RNLA 1TEVA 4WLUA 5HQ3A 3FNHA 1SXJD 2ZL1A 3WIVA 3E9CA 1UBSB 2PRZA 4I50A 3P0RA 2FZVA 3DYIA 4HWOA 3AY3A 4QEKA 5P21A 4AG3A 4V0KA 1EDBA 1LXCA 3FN4A 1V0JA 3CR3C 2X7JA 4NG5A 3WFIA 3PRHA 1OA1A 2GD6A 1T5TA 3O31A 5CCBA 4QTTB 1QKJA 3NDRA 5EJ4A 1FUEA 4RIHA 2XNDD 1ZVMA 1ETHA 4OUDA 5FAXA 3AG6A 1C30A 1VHQA 2VEOA 2C7QA 1NJGA 4KLAA 2YFQA 5LZ4A 4P3XA 1CHNA 3M9WA 1CZLA 4XDGA 2PSHA 1Y98A 1BLHA 4BWVA 1RRCA 3W4QA 4TWRA 2HW8A 3S22A 3IT0A 5IDQA 4IFIA 5M3BA 1RS0A 1S6YA 3NVAA 4NYJQ 2A24A 4CCWA 4E2WA 3AVPA 1X7DA 4GLLA 5DO9A 2JDIA 3PUZA 2NSHA 1QDUA 5K03A 3U4CA 3PITA 4FNOA 1DFHA 1R6UA 1QMEA 3G9QA 2ZYHA 3ZDDA 2QN9A 2IQ5A 1IWBB 4YP5A 3NC4A 2O0MA 5A4FS 2B0CA 4UDNA 1VMDA 1JVBA 3Q3CA 3DKPA 1TX4B 5E6SA 5JNWA 2NV2B 3FLMA 4LECA 4BTVA 1WUIS 1OR8A 1HMPA 3HH8A 3DDWA 4N6GA 3QY0A 5EI5A 1S1ZA 1J2EA 4FFRA 5AVXA 1P6QA 5FI3A 4C1BA 1FLDA 5KX5A 2Q1XA 4GW3A 1PLJA 4I0WB 1OIVA 1WCXA 2ZJ9A 1N5DA 1IB0A 1ULTA 1V6SA 1TQDA 4BMWA 1N9ZA 1Z16A 5AHRA 4E3KA 2GN8A 3MNFA 2HJRA 4FEYA 1SVUA 3UXEA 2QXYA 2BGUA 3O3MB 3Q8XB 3W4KA 3VVMA 4QXAA 1WQ3A 4LTNA 3CMMA 1D6MA 5FCDA 4IINA 1CFJA 2JH8A 1R4NB 2AEFA 2OXRA 1BOOA 3K0AA 4BLTA 1OU4A 2PV0A 5HD3A 3LGXA 1AXBA 1P4HA 1NXVA 4LMRA 1X8KA 1PX0A 4HJ6A 4F6CA 4BKPA 2H7VA 4UMFA 1XXHE 3VBEA 2E2WA 4PX2A 5F1KA 3E8MA 5TE9A 1HNNA 5KOYA 4AF8A 3B7WA 3E15A 3BGWA 1UPUA 4F2WA 2B61A 1XX6A 5KQMA 1LSSA 1JLKA 2JEYA 2OVBA 2DLNA 3UK7A 5TV2A 3AIKA 3G79A 4X45A 2PL9A 3LNTA 1HZZA 3UWMA 1I6KA 4J75A 3GDIA 1GGKA 2GZHA 3L1JA 1GARA 3QVVA 1B0PA 4ND2A 1FP2A 3D64A 2AE2A 4X8MA 4UTOA 3GJSA 4OQMA 4LQLA 1IKGA 2EKZA 1JQBA 4G8BA 4G1UC 1WO8A 3FBWA 3U7EB 2P9YA 1OFGA 5I6DA 4I5IA 2ZULA 3CSDA 5JYOA 3JY6A 3DMPA 3DBHA 5TS3A 2O8BA 1AXGA 4MUFA 3WY9A 2AJ8A 5A2QA 2MOKA 5AXAA 3QE9Y 1SUFA 2ZAOA 3DVSX 3KKOA 4A1OA 1C1DB 2ZREA 3E2PA 2EX9A 5LNK1 2WSSA 5JLJA 5ALPA 2AVXA 3C43A 2GAOA 2EGGA 4J0JA 4I38A 1WUJS 1HM5A 1UZLA 3GUHA 4ZHQB 1BQ4A 5BR8B 2LPMA 4UCWA 3H3XA 3TTVA 2QN8A 2OP1A 4DMKA 4EK9A 5JCPA 1AGNA 3QF4A 5JY6A 4DLKA 5G4ZA 1NNI1 2IT1A 1DMRA 4YUXA 3FDFA 3IQXA 1MCZA 4GMXA 3M2JA 3AVVA 1S8OA 3HJUA 5CAEA 4RTQA 1L7EA 3BWXA 2Q8PA 4E5UA 4TMKA 4QY6A 4JBHA 4QPZA 3JR7A 4ILKA 3TOCA 1QZTA 3FUWA 2AFHA 3V8MA 4PONA 4WLOA 5KI6A 3QH4A 2XIJA 1QXSA 1MGOA 5FIUA 1C9NA 1V26A 2IPOA 4J0IA 1D2RA 1DNPA 1Q2UA 4U7FA 1U5BB 3EGIA 3NBUA 5FX2A 1VGQA 5EJEA 5B1DA 2C9MA 4YR9A 2QR5A 3MJTA 5EYPB 4F11A 5IT4A 2YIDA 2EV9A 5HPFA 1PG5A 3NBLA 3V1KA 1QIHA 4I1RA 2ZAGA 3Q4GA 2R11A 2BBOA 3IXLA 5FB3A 3DVLA 4UTVA 4FH4A 3QVJA 4L9SA 1NULA 3RFBA 4ZZ2A 2O48X 1NVTA 1DP6A 1QCYA 1Z75A 2EW1A 5AICA 3SQWA 4KODA 3ZVKA 1DPGA 5C3UA 4EB3A 3MOSA 1GXSB 3ZS9A 4DNFA 1BLPA 3SJAA 4PHCA 3C7KA 2VDNB 1ZD8A 4FCFA 4E2FA 3E5RA 3QPVA 2X0JA 2QMOA 2FSSA 1YZQA 2PMWB 3JS5A 4CIYA 2PEZA 5F3DA 5JBNA 5B3AA 1ZCFA 1WMBA 2HCFA 3B6IA 1NXOA 2BGMA 5J4YA 3T9CA 4R3JA 1CDDA 1L1QA 3O9MA 4NK3A 2I9KA 1Z8DA 2X40A 2GI4A 2JZOA 1I24A 1EAYA 3OMXA 1JPNA 4BEWA 3OKPA 2IPAB 4KNWA 1V5EA 5HCNA 5ISMA 3C6XA 4YMHA 1ECBA 1X1QA 2YASA 3TRJA 1B6TA 3ZWKA 3SGLA 3TUZC 3BGDA 3DTIA 4KQ1A 3CMZA 1E0DA 4RX3A 5CU7A 5L3QB 1T1BA 1G6Q1 2G7MC 4DA9A 3RARA 1CJUC 1NVKA 2HV1A 4JB0A 3PBNA 2JFXA 4LHEA 5JWHA 2YUTA 5EKTA 4CKBB 3BD6A 1N0WA 2C4HA 4WOJA 3CPTB 3PFKA 3TAXA 5AHXA 3O87A 4KO2S 4WLAA 3NVDA 3IH5A 3PC4A 1CCWA 1P1HA 3AEQB 3QOXA 3NHFA 5L40A 1ZK1A 1NL3A 4LX8A 3MBOA 4O5OA 3I6MA 1KTIA 3FPFA 4D46A 4TLEA 5E0KB 5HZMA 5E8RA 1CJSA 3CEAA 5F7XA 2IS2A 4Q9DA 3B70A 1G5UA 4OHKA 1Z2DA 4D9MA 1I7SB 1G66A 2IP4A 5KSZA 5G0TA 1KPHA 4BNFA 7REQA 1OTDA 5AVOA 1FRQA 2QNIA 1SXPA 3JYPA 3NI9A 4I4TF 3NTQA 2BCJQ 3PUJA 4TYNA 1X1AA 4Y2SA 3N2KA 1U80A 4WL0A 5FOTA 4EFMA 3GPCA 1EU1A 4I6EA 3LZ6A 3NCTA 1VMKA 3QK7A 4IOMA 3QE3A 2OBXA 3QMVA 4DABA 3H42B 4PLCA 3AGPA 3ZZNA 3GLGE 4M0PA 3LX4A 4X1IB 1RFLA 1ES3A 2PBFA 1SCIA 3ZHTA 1ZCBA 3ETLA 3RKRA 3RS7A 1V9CA 4YCLA 4B6PA 4BCBA 1U11A 5HFJA 2WLSA 1JWPA 1VQQA 4KH0A 1NFQA 5ALIA 1D0VA 3KAKA 4CR6A 5JEEA 3OCJA 3CW8X 3T9EA 1WLSA 4GS9B 4CCAA 5HRCA 3GECA 4A5SA 1DXOA 1L5HB 2ZATA 4X69A 2GBLC 5JXGA 1S1CA 3LFHA 3HV2A 1JR4A 2JI9A 1TZCA 1N2XA 1T9KA 3BOSA 2RK4A 3WL8A 5TBMB 5EHXA 2YZ7A 2I7VA 4HQFA 3S68A 3MN1A 4TM8A 3GA7A 3RV4A 2PRYA 1GG8A 1TVKB 3G6OA 4M7PA 2HU5A 1E92A 5B3LA 4M7RA 1QDLB 3FDZB 2NOAA 3U44A 1YBMA 3KBOA 2Z2YA 3OQOA 4W1PA 4REQB 1TW3A 3NAZA 2Q9NA 1T6YA 4N3CA 1EESA 3D3WB 3VKUA 1ADFA 1J2RA 1E1DA 2OV6A 4UM9B 1UIMA 2PZFA 1RBQA 5BNTA 4MUHA 1FNNA 5AKHA 1HDEA 2UWXA 5C2JB 2QJTA 1DAHA 2IHVA 4AY3A 2A1UB 3HJKA 2M2IA 1WZ2A 1HEIA 1OASA 4AWBA 1J90A 4HB0A 4D4LA 2EGUA 1XGIA 4WZ5C 1S6RA 4HH0A 1RWPA 1GN8A 3AONB 4JEIA 1Q0TA 3D0RA 1CRWG 1QC5A 3SM9A 5MFPA 4AVYA 4PANA 2J9GA 3U7JA 3KR0A 1G17A 1X7YB 4PQEA 2AXQA 5FH9A 2D2IA 4UUQA 4I7EA 3QBDA 3C24A 4N40A 3G1UA 4X97A 4O4IF 1YQDA 2F43A 1BIFA 1PJ3A 2VG8A 4Y7DA 4BWIA 4LC0A 4Q4HB 3I1IA 4BVGA 2Y0DA 4RM3A 2XMGA 3OT1A 1AGYA 1USWA 3HUEA 3LUJA 4HJ4A 5GTDA 2QDXA 2Z30A 3MQ0A 4BNTA 3DD1A 3DV0B 4QXMA 3EAQA 4R5HA 4DREA 3GZ4A 3I9V6 2OV5A 3H2SA 2XK1A 4P58A 1BJTA 5D6OA 3IP5A 2QZPA 3ZGNA 1JHXA 3BJNA 3OESA 1DY6A 4ZPXA 1EFRD 5AW4A 4MB0A 1GPUA 2ZRCA 1XJ6A 1U2DA 4IMIB 3DT8A 4OLHA 2B1IA 4DMFA 1F38A 5KNCD 5JAZA 1AHNA 3P9RA 3F73A 5CXQA 1U6JA 3FTDA 4R7TA 5FV4A 1YQ9A 2PSEA 5I5LA 2GAJA 2Z2ZA 3DLIA 4RJIA 1Z08A 3IHBA 1NUHA 2HLDA 2A9PA 1P81A 1II8A 1Z68A 2PMEA 4HNAA 1AZLA 1ZICA 1BZAA 1EP3B 1IYQA 5KNLA 3ZXSA 1XCBA 1V45E 4YP0A 1R9MA 4F8EA 4ETZA 5JU6A 1QNLA 3K53A 2O3QA 1Z0FA 1C9EA 4JQCA 4EG0A 2OZLA 2I4TA 1ZM3A 3JXEA 4K6GA 5AKZA 1ARZA 4LI0A 2CLMB 3ZTYA 1C9DB 3PFWO 1HLPA 2D5LA 4ANFA 3VPSA 3ESDA 3OAAA 1SWVA 2FPUA 3LP5A 3JQGA 2JKRI 4LLOB 1UDXA 5ALSA 4FP9A 1XA0A 4KACA 2XTJA 5M1AA 3SR3A 1VP3A 1K08A 2RHJA 3FYZA 3C3KA 2BZ1A 3DYVA 1XD2A 5FJIA 2W2TA 2V9PA 2AG6A 4OLGA 2VXCA 1ZLXA 1GT91 1V1MA 5KNDH 1QFJA 3NOQA 4Y13A 2YIVX 2VAMA 4KKVA 4H1HA 2G72A 5GVRA 1GNSA 4M8LA 2OV4A 1PBTA 3E3AA 4LWQA 4Y2TA 2EFYA 1MAUA 1YULA 1NNSA 2H0QA 1GU1A 3T7CA 3F5DA 2EFDB 3HBFA 1GYQA 3LUQA 3VZPA 3C7UA 5AW7A 3SM3A 3OQHA 2AMFA 2ZZNA 2BSAA 4A5OA 1PUXA 1XU7A 3TH5A 1K38A 3KG2A 1KBZA 4MN7A 1Q0QA 3IODA 4DPKA 4RXMA 3Q6NA 1V16A 4EITA 4LXYA 5AVKA 4NU0A 3DVAB 1X92A 3N70A 3HUNA 4PFKA 3VSDA 2VFAA 2ZQCA 1YQUA 2QF7A 2XXBA 1F2TA 4I55F 2L2QA 5HUQA 5C8XA 3PC3A 2PL1A 2RGWA 1W79A 5DBHX 4M9XA 1JEYA 3AHIA 4FQ8A 1OKKD 2OSBA 4MBKA 2WWRA 3GMSA 3INNA 1ZGJA 3EGDA 3VSEA 4QWWA 3H5VA 2W71A 3T41A 5EJ7A 1WMAA 1RKXA 3ZWAA 5BW8A 4NNPA 3HREA 2FZ5A 1J23A 4XM0A 4Y2GA 4BNZA 4Q8IA 4I4LA 1FFXB 5E4JA 1QORA 3OX3A 1LCIA 4E5MA 4EHNA 1TUBB 1JLMA 4Q1AA 3G2MA 1T0JB 2GCOB 1ZGHA 3R23A 3DBIA 4BFLA 4JXVA 1TKBA 1UC5B 2DF8A 5FA7A 1ZNQO 3GT0A 2H2DA 5B1EA 4HRVA 4IEEA 3UFXA 1HY3A 3RKSA 1DJNA 1JWVA 5TPZA 1D2NA 1DJPA 1S3FA 3OHPA 3VJMA 4MV1A 4R7GA 2R25B 2RH4A 4JYBA 2IYWA 3DE1X 1CUBA 1G8AA 3R3YA 3TCNA 5BSEA 4W7IA 2QYHA 5HEKA 1RI3A 1KEEB 1QS0A 1U2QA 1BE1A 4R41A 2FN3A 2VF5X 2E4YA 1PK9A 4Z0NA 1EVKA 1C1XB 4JXSA 1OXTA 1CY1A 5EG5A 2HDQA 2BVNA 3RAGA 4JT4A 1JDJA 4HRXA 1A9QA 4EA6A 1O94C 1UXHA 3B1VA 1IDOA 1FLVA 4MP3A 4BRWA 5G0WA 2VHCA 3K0FA 4WXMA 4ALMA 1KY2A 2E4WA 2FZWA 2HU7A 3LQYA 3MLEA 4J2HA 3AF5A 1KS2A 1VLHA 1C9MA 4WXEA 4EEZA 5HZGA 4XJXA 4DCCA 3IAUA 3CF0A 2A14A 3UPDA 5EUAA 4H0NA 5L51A 2YX1A 1FSZA 2V8FA 4OM7A 1W87A 3GEPA 4HHEA 2FMKA 2M32A 3OPVA 4FMPA 4QRDA 2FX2A 5IU6A 2Q41A 5EJGA 1RJ9B 1QF9A 1LJUA 3RF6A 5FUQA 3AUKA 1WTAA 3PFNA 1DOHA 3IPYA 2VQDA 3PJGA 5ADVA 4MRNA 1DRWA 3FPSA 3E22B 2G28A 2VNSA 1VRCA 4GWGA 2O1WA 6AT1A 1PTKA 3QBTA 3Q8WA 1NW7A 2WTBA 1YASA 3OM9A 1DAIA 1LQ2A 4X20B 1F06A 4OQZA 2VDKB 3F4LA 3IUYA 4I1IA 3KLOA 3T52A 5ETJA 1B4DA 2FY8A 3TKLA 4E3LA 4B82A 3RT9A 3BGIA 5HK8A 1D7OA 3H0CA 2J9FA 3HUTA 1I33A 1FZQA 3UMMA 3ZR4B 3R5XA 2AR9A 2YMLA 4DG5A 3HSKA 1A8PA 5DNWA 1PFQA 1T0HB 5FASA 4G25A 1E99A 2G3YA 1M1NB 5EVEA 4N8DA 3N5KA 2X2OA 2EFGA 3RREA 3OJOA 4AQ7A 2P65A 2ZU0C 2IYVA 1PR1A 2FRXA 2W6QA 2CFCA 2FCRA 4ZEVA 1AUVA 4RKFA 1YUMA 2JFHA 1UWCA 3ZXYA 3OZAA 1YMVA 4LJ7A 5G0UA 4CL0A 2ZIXA 2WAFA 4I4TB 4BUCA 2JH9A 1CK4A 3F98A 4WVFA 1ATZA 4LRXC 3KYEA 3UIEA 5AQ9A 1KIFA 2JJ1A 1F2KA 1F0KA 2XTNA 3OZDA 4YPFA 4O8CA 5DM60 1XJ4A 4LCLA 5C1PA 3HJGA 2M9MA 2J9XB 4UC0A 2JI8A 1R64A 4J90A 3VR4A 1GPAA 1IK6A 3NDJA 5A7FA 3C5EA 3GMIA 4YRIA 3RVMA 1L5SA 2LCFA 1I4EB 1D8AA 2QVBA 1H42A 1R18A 3LYHA 4LVNA 1CZRA 1M6VA 2QG4A 1WRBA 5EMKA 4BGVA 3LKDA 1E0AA 3DAFA 1IY2A 1EHCA 2H1CA 4RJKA 3DMDA 1L5WA 1SPBS 5A90A 3CRNA 3QYPA 3QLJA 4GBGA 4Q1DA 2CVPA 2XV1A 2PYZA 4X64B 4Z7JA 2OD7A 3LPCA 3A9WA 4GFDA 1XNHA 2KB0A 1CETA 1VMIA 1D9XA 1NUPA 1LLDA 4XQ9A 1KY3A 2PYRA 1U3UA 2Q50A 4O8GA 2CLOB 3RFCA 3I8SA 4OYHA 1GSHA 2BW0A 5EZYF 1Y28A 4BD0A 3QFRA 3DZHA 4EHHA 1Q3TA 4EWFA 2QTZA 1G3MA 2IUYA 3DAVA 2WYHA 1P2GA 3QLVA 3Q0IA 4FCWA 3TTSA 2E82A 1Y4DE 1AZSC 2NP6A 4E13A 1KO4A 4LV1A 2HK9A 1DEXA 3OECA 5B1YA 1NUAA 4ZVQA 2ETXA 3RU3A 4CEIB 1MHPA 1HE2A 2ZITA 2VF2A 5BUCA 3VTAA 3ZWYA 1E7YA 2AW5A 1EP9A 3BD9A 3ZZTA 5DYIA 3DE6X 1ZJ6A 3GJ8A 4NXMB 5SY6A 1CQPA 1JVSA 4INZA 1XTPA 3AM5A 5CRFA 2XGOA 3X1ZA 4UAUA 2OFOA 2P78A 1F5MA 3DTVD 1SZVA 3B1JA 4DUZB 2WJYA 2QYOA 4DYHA 3U0VA 1CB7A 2Y1KA 3GO4A 1ECLA 1JHRA 4FFSA 2BHLA 4RVGA 3PR3A 3W05A 1VJ5A 1O96A 4GEKA 1TUGA 3R0ZA 3UE6A 1PQPA 3DBAA 5REQA 3TJMA 2QWXA 3SQNA 2I2FA 1Y4ZA 3KX0X 1I5QA 1DINA 4L9AA 2JARA 3WAGA 4LY6A 3I30X 1O4WA 3UKOA 4O4IB 5JMOA 5IZ4A 5JANA 2QJOA 1V5IA 3HRIA 2IV3A 3FPCA 4ZTZB 1ORVA 3GZNB 4LOAA 4BFSA 5E4TA 1CUAA 3TAUA 3RXWA 5JWOA 2HHAA 2UUCB 2QTNA 3OFND 1DXYA 3WLMA 3OLOA 1YWGO 4QJIA 5CG1A 3NRJA 5D51S 1J8DA 1AU9A 1QCZA 4B0OA 1GV0A 3WWCA 2WADA 1M2EA 1E4EB 2P90A 4CLCC 1ISIA 3DCNA 3IELA 5I5GA 1LLBA 1Q16A 2O4UX 4EYQA 1ANKA 3DL2A 1VPTA 1A88A 2ZW9A 1RBZA 4G0QA 1RWWA 1IMOA 4ID3A 3WLRA 2A58A 1F9AA 4EJFA 1JI0A 2Q21A 2BZGA 3EOIA 5KIAA 1L8OA 2HMWA 3KPUA 2I71A 2Z4RA 4HBZA 3PG5A 5L4LA 4RKEA 5EJ6A 1G3IA 1ZA1A 1OTXA 5BXQC 2W6CX 1ZZGA 2ZJOA 1OWOA 2CNKA 1LPPA 3SQMA 3R5HA 1A72A 4WEJA 3KQPA 2ZB7A 1BFDA 2F9FA 2QAGA 5FATA 1H0HA 4NJEB 3LVRE 4I5EA 3OZIA 2O8CA 1J2UA 5HKKA 3GARA 4JXGA 5E6RB 5JS7A 3R6DA 4P08A 3I6BA 1WDTA 4Q93A 2BKXA 4H1UA 3L5OA 1W29A 3C3CA 3LOQA 4EZIA 5ALMA 2P9VB 3LG2A 2I4IA 5IZCC 2C8LA 3WRWA 4NZZA 3PDJA 4W1SA 2IYTA 1ZU4A 1CF9A 2ARKA 4EHIA 5A02A 3N8LA 2QX8A 1F51E 3JQFA 4ETXA 4WOCA 2JDID 1GAQA 1NW3A 4JR1A 2E85A 4JDPA 1X2BA 5C1IA 2D8MA 1ERMA 2PZLA 5JSQA 2ATCA 4FDLA 5IJWA 4EHDA 3L0IB 4HEQA 3GLHB 3FWHA 3MRXA 2Y1EA 2Q4RA 1AMOA 3PYPA 2J9RA 3IV6A 1OTHA 4OI2A 5CLHA 4E21A 3VDRA 1L0EA 3DR5A 4LCBA 2LVBA 4AY2A 3TLEA 1W581 2H5JA 3FY4A 4MKGA 1P0CA 4MDEA 2CL0X 5LDDC 2HR1A 3ZOKA 4WACA 3AF1A 1JDBB 3KL2A 4J49A 2OFPA 4IDOA 2QPLA 2CT8A 1D0IA 2GD0A 2V6JA 1L7DA 1GKYA 4URXR 4I55B 2J7KA 2YQ5A 2OHGA 3OT5A 4ND5A 4YNRA 4D3XA 5IARA 5LC1A 4N8SA 4YR7A 5E3HA 1FSSA 4TLDA 5KTRA 5TPWB 3R1IA 2L82A 5BVGA 4JL5A 4D41A 1N6KA 5D1NA 1MABA 4LNHA 1ZMBA 4L5JA 4EFDA 2XQFA 1BTLA 4JB3A 4ED9A 2C92A 4KFUA 3U48A 5AVYA 4Z4CA 1HE8B 4Y2XA 2R8BA 4ZHQF 4R3AA 3BAZA 3JWEA 2BEUB 2H1LA 2RBKA 4YALA 3EK2A 1RAFA 4PPRA 1O03A 4CKZA 3GLVA 5AT1A 2J0QA 1D2GA 2FG5A 4O4HF 5TT1A 3BMOB 4JYAB 2BSQA 1MUUA 4MW4A 4KVAA 1CUCA 5FUWA 4QUGA 4K0KB 1SPXA 1UXIA 2ZJBA 3P97A 2PUBA 4FBMA 2EKDA 5ALOA 1SXJB 1X0XA 2AK2A 3BIXA 3QHPA 3H3JA 1XEWX 4HDAA 2G08A 5EZ6B 4OB7A 2W90A 1GPYA 3S2UA 2YVKA 4AO6A 1F4PA 2POQX 1QRAA 5JZOA 3CWZA 1ISMA 1HGXA 1E4VA 1RXIA 1G7SA 4FHZA 3TR0A 1TAQA 7YASA 1VKHA 3FUVA 5GOTA 2CK3A 3AIMA 3PNSA 4GBJA 4Z0PA 3CG5A 3PEWA 3B9RA 4YUZA 1CYEA 1SUCA 1ADGA 2P7JA 1LY1A 3P2KA 4TXLA 3VE4A 1G2QA 5C5IA 1FSPA 5B12A 2GN6A 4FMBB 1Z6TA 4LWPA 4IHKA 4C7BA 2ZIWB 4Q82A 3S1SA 2NWQA 2Z1DA 1ESDA 1XO1A 1Q2QA 1Z25A 4H6JA 1XL0A 2CWWA 1DHRA 1U7XA 3CH7A 3BCRA 4WAUA 1VG8A 3LK7A 1ZGBA 1R4AA 3J81k 4ZGBA 1NRFA 5IKPA 2BFFA 2G5TA 1N4AA 3C87A 5DCUA 4U0TA 3BIOA 5AK4A 5JAHA 3D8HA 3FWZA 3NAQA 3OEWA 1LX6A 4DJFC 4YRQA 1H9BA 2NSLA 5L3RA 3AEYA 2J5XA 1KOJA 2W2PA 4JVNA 4EU0A 3ZIAA 4E2YA 5A3RA 1EGQA 4C4XA 4Y9UA 8ATCA 1AS0A 3ICEA 4RX2A 1MVLA 4XGQA 3P7NA 3O74A 2CJFA 4QM6A 1A9OA 4O63O 2BE9A 2DQKA 4UHCA 2I7DA 4B81A 1SK9A 1US8A 2X8LA 1OJ5A 5EIHA 5IF9A 1LPOA 3F9CA 4M1OA 1C8KA 3DEHA 3ZE0B 3OQPA 2X1VA 1YHYA 2PX2A 3KQUA 1H93A 3RTYA 1Z37A 2IHNA 3IF6C 1NMXA 1ZESA 1NVVQ 2BM8A 3A3KA 4IWNA 4PM6A 1YS4A 1L4UA 1Z4MA 4IIJA 5I9NA 5CITA 1DRUA 4MGKR 4LDZA 4CI0B 1T2NA 2GEVA 1TFRA 3QLUC 3R7NA 4KZ9A 5IEBA 4CM7A 3DDOA 3WX0A 3D3OA 4W9MC 4Q3NA 2B1QA 1A9ZA 1YO6A 1YRAA 1PJ2A 4KQXA 3PXDA 8ABPA 1CRQA 4B09A 2V5VA 2M7VA 4BJ6A 3MJDA 2WMNB 1ZM4A 1FDWA 2C4WA 2FVYA 1U3DA 4QFMA 2Y4NA 4CHTA 2GRAA 2ID8A 4CJXA 4R1LA 4FILA 4TQ9A 2OQ2A 3PP8A 3ODGA 2B25A 2GPTA 3LT0A 5SYMA 4GN2A 3RANA 1WB9A 2HPAA 2VPYA 4E6WA 4F71A 1J09A 3H9WA 3PBOA 1VHLA 4LXXA 4UUMA 3Q7VB 2NPIA 3TSZA 1AK2A 1RWKA 4JOCA 1U8EA 1YMQA 5HKLA 2HQBA 3PUXA 5AKKA 1LF5A 3BX1A 1HDYA 5AIBA 1LL5A 3EH1A 2W0NA 4PQRA 4FQ5A 2D0PB 3X1WA 2DRIA 4AXBA 4BQOA 3O0DA 5CT8A 1IRXA 3GNSA 3CLTD 1LJ8A 2MSNA 4KWHA 1Y6FA 4R23A 1I7PA 1GKIA 2QN2A 2LRHA 1PTJA 3IP1A 1CY6A 3CX6A 5B64A 5EZYB 1F2UB 2LCIA 1P77A 4K6KA 3S2IA 3VU1A 1Q0LA 1FMJA 4G9EA 4GE0A 3D9YA 1U1GA 3L7YA 3F1OB 3LBNA 1K55C 3C6MA 4UUNA 1DRJA 1ZY2A 1CWUA 4RTPA 3RRFA 1RAIA 2PSJA 1P5RA 1DT5A 2P3OA 3WBBA 2QRVB 1UK7A 4IS2A 3SSAA 2GHTA 3CZDA 4LMBA 4DV6B 3DOIA 3KUDA 3LBYA 5DB4A 1U60A 1YB4A 2GD2A 1SUBA 1BCRA 3C7TA 2NVWA 3DMTA 5CEBA 4LY0A 3B78A 4EFNA 5CCEA 1YXMA 1KYWA 1JALA 3CNNA 1MZPA 3SZRA 1CY7A 3R24A 3HVKA 3P0EA 3O84A 5MFZA 2XA7S 3UWKA 2Q1UA 4I99A 3QVOA 4IJ5A 4MYCA 2GNXA 3SI7A 1NHGA 5KSWB 4MW6A 3QMMA 4MAMA 5D00A 3NHLA 3QU5A 2B37A 3B1KA 4MQEB 2V55B 3T0GA 3BHIA 5MN5A 5L10A 3R4KA 1ALQA 1T5LA 2BTOA 3KWMA 2MIIA 1P1FA 2SKEA 1SVWA 4PAUA 4GL4A 3JCZA 3AJ9A 3JWJA 4D6XA 1U4NA 2ZC5B 2HU8A 4N7MA 1HDIA 3A4VA 1LBSA 4KIUA 3L4JA 3TW4A 2W93A 4TSFD 1NOKA 3SMQA 4QHSA 2K2QB 5TQ0B 4TZTA 3HKEA 5FUYA 1M7GA 2JLXA 1G68A 1P91A 1CE8A 1UJCA 3AR4A 2HHHB 1VEUB 1Y8RA 2EW2A 4IEIA 3TECE 3O8QA 1IEQA 2OWHA 3DZGA 1CZHA 1XA4A 2HA4A 3WS5A 3O1JC 5LUAA 2VDPB 3MINA 3H5NA 1O97C 2WZQA 4XFJA 5EQJB 3PZRA 4RDXA 5EOEA 3PAGA 5KAMA 1WF6A 5BNWA 4BQQA 4F2HA 3HSSA 4AK9A 3PYXA 5AVRA 4ARVA 2IOFA 4PSUA 2OCDA 2GDNA 1NVXQ 4JUIA 4XFKA 2WOJA 2DFNA 1NY0A 1UBCA 2Q07A 4ZAGA 2X5OA 1X8XA 2R1VB 1GKUB 1R0RE 3GLFB 1I5EA 3JQ8B 4B80A 3GJ7A 4FMCF 4HH4A 3SLRA 1LI9A 2ZT6A 2H28A 4QGAA 3OY7A 2JAXA 1VIYA 4C0LA 3BJEA 5IMBA 3VGPA 1GEEA 3IB6A 4DC1A 2NSDA 4XUXA 4KQEA 4S2MA 1TTHA 2AJBA 4RHEA 1WMDA 1KARA 1RAGA 5BOSA 5BYJA 2JAHA 3KHTA 1PR9A 2HHJA 4OHBA 1KU6A 1XCLA 3IB3A 4GL2A 3KL4A 1JEJA 2A33A 4QB8A 2ATIA 3NVMB 3AP3A 3S99A 4KXYA 5AH0A 4EJ0A 4L5IA 2J5KA 1XTUA 5HUJA 1Z33A 4R1GA 3C3DA 3RRXA 4LJKA 2PYPA 4TKVB 5GIOE 2OSUA 3I2HA 1KOUA 3IJRA 4D56A 2XT0A 3C74A 5GONF 1RYFA 1JHAA 5AKEA 1T9GR 4GGMX 2A9FA 4TROA 2JAUA 4RYEA 4EVQA 1L4MA 4MLDA 3EDRA 2ZCVA 1PGNA 1OB5A 5FDSA 1VI2A 2HRDA 1HE3A 2H63A 1LT0A 5EUCA 2EDCA 3D2BA 4UHDA 1TYAE 1Q92A 3VOSA 4XCXA 4H6VA 2H9YA 2QPNA 3M4YA 3KXLA 3MJRA 3Q40A 4RLQA 1N9NA 2WZBA 1ACJA 5FQQA 2YXEA 3HP7A 2ZG6A 3P9XA 3W8NA 2IS4A 2BEVB 3SSMA 2XB8A 3IEXA 1IQRA 5GM1A 1W8IA 2JNWA 2J7PA 2A0YA 1DX4A 2HDNB 4GPBA 3MCZA 2HRBA 3LUBA 1TMKA 1NQ5A 1A9XA 5FRDA 2CXRA 4LQCA 3LIBA 1ODKA 4TWBA 1THTA 4L95C 1MW9X 3EDYA 4TWJA 4KN5A 4BUZA 2REXB 4I1UA 2HM7A 1T36B 4PWYA 2VLBA 1ZN9A 1UR5A 4QQFA 4L5CA 1PNOA 3AGEA 5FDFA 4KXMA 2HLDD 1L4EA 3R0XA