2EWWA

Crystal structure of the pilus retraction motor pilt and bound atp
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
350
structure length
343
Chain Sequence
b'ELKILEIIKEAIELGASDIHLTAGAPPAVRIDGYIKFLKDFPRLTPEDTQKLAYSVMSEKHRQKLEENGQVDFSFGVRGVGRFRANVFYQRGSVAAALRSLPAEIPEFKKLGLPDKVLELCHRKMGLILVTGPTGSGKSTTIASMIDYINQTKSYHIITIEDPIEYVFKHKKSIVNQREVGEDTKSFADALRAALREDPDVIFVGEMRDLETVETALRAAETGHLVFGTLHTNTAIDTIHRIVDIFPLNQQEQVRIVLSFILQGIISQRLLPKIGGGRVLAYELLIPNTAIRNLIRENKLQQVYSLMQMQTMNQTLYKLYKQGLITLEDAMEASPDPKELERM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords twitching motility protein PilT
publication title Crystal structures of the pilus retraction motor PilT suggest large domain movements and subunit cooperation drive motility.
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Protein transport
total genus 84
structure length 343
sequence length 350
ec nomenclature
pdb deposition date 2005-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00437 T2SSE Type II/IV secretion system protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.90 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2ewwA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2ewwA02
5FR2A 5DYIA 5C18A 3ZLJA 4G1UC 1OJLA 4HDCA 3T5GA 5K8IA 3AGQA 5EE5B 1XB2A 1YZLA 3LA6A 3CR7A 3PEUA 5KDOA 2ZXUA 2X19A 1WDTA 1AIPA 4ZO4A 4II7A 2W6ID 1WA5A 2W0MA 4MGZR 3TVTA 2CLCX 4Z8XA 1VYTA 4X8OA 5KHOC 3BD9A 4EJSA 1T3HA 2JAQA 4I1UA 4P0TA 4PAQA 4WAUA 2B8TA 3T61A 3U3MA 4RZXA 2PZGA 3WNDA 1D6JA 4EKDA 2XJ9A 5DNYB 1H8HA 3JZMA 4M1SA 5JJLA 5IDVA 4A8JA 3FFBA 1W0JD 1KI1A 2J0VA 2OBLA 3CZPA 2XB4A 3IQXA 4G5OA 3T1OA 3L0PA 2YYZA 4JLDA 721PA 4WXRA 3B78A 3C4JA 1S4QA 3PUXA 4IDQA 4EPWA 5C46F 5IRCD 5FI0B 4Q4HA 4HB0A 5J47A 3SQWA 2O8BB 3ZQ6A 3QNUA 3REFA 3SC3A 4V0MA 4KCGA 1TPZA 1Z22A 3IDQA 1CJTC 4NCNA 4I1OA 4Q1FA 1ZUHA 3CRMA 1A82A 2QM7A 1EWRA 1EWQA 4X8MA 1OB5A 3HU2A 1BMFA 5CM9C 3R9XA 3OAAD 1VG8A 1Z0DA 3K70C 2QY9A 1E9RA 3AF4A 1Z47A 2KJQA 2WKPA 1XX6A 2PCJA 5FTJA 1CR1A 2LCFA 2HUPA 2PH1A 4MYTA 1O87A 2QTVB 3QXSA 3EPLA 1VCMA 5JS7A 4F4IA 5AJWA 2C9CA 2A9KA 4XH9B 2P2LA 3TSWA 1Q0UA 1S3GA 1GKUB 3TAUA 3P32A 4PHHA 1I4LD 1X8KA 3GJXC 1BKDR 5EXXA 1RJ9B 3NHAA 521PA 4RD2A 3QE0A 3HR8A 2RCNA 3QSYA 3EC1A 2GA8A 2R62A 4TL7A 3BAFA 3PFIA 5GJBA 4UKDA 4KODA 3GLGE 3IPXA 2J0UB 4XTCS 2OCPA 4GPTA 1M7BA 3WMEA 4UNSA 3W6OA 2QMUA 4JLAA 5CIQA 1II9A 3V9PA 3LRPA 3P4YA 4XIGS 5AJXA 3CONA 2GILA 4Q4LA 3CIOA 4XVRA 4LJYA 1XD8A 5DH9A 3C5HA 3W3ZB 2IS1A 3ZGXA 3KQHA 1EFRD 2C77A 1E0SA 1E94E 1S1MA 3CM0A 2JJ8A 3AF3A 3EWSA 3HPQA 3I1FA 4MQBA 1IM2A 3EARA 1G6OA 1GL9B 3Q3JB 1M7GA 1NY6A 4KYIB 1DS6A 4XSGA 3KQUA 3OF5A 4D0GA 5SZIA 4EPTA 4LHYA 3IILA 4Z54A 4NYMR 3RSLA 1SKYE 2D62A 3X1ZA 1E9BA 2LWIA 4YDHB 1DADA 1OFIA 4RY2A 4IOMA 1G64A 3GLFA 4Q21A 2KI5A 1OH5A 4KVAA 1U98A 1W36D 1YJ5A 4OI1A 3QI2A 3FKSD 3R7WB 4LHZA 4Q9KA 5EZ6B 1Q44A 3RABA 4TQ9A 4JT4A 5IT5A 2Z6VA 4P4UA 4BFTA 2XOKD 2IXEA 3T1QA 3IQWA 2QN6A 3TRFA 5C2JB 1F5NA 1GOTA 2JA1A 3D8BA 3K0FB 3PUZA 2G1JA 1XTIA 1ESMA 4KFTA 1QG2A 1N5KA 1SXJC 1ZBDA 1HEIA 1KAOA 3T1TA 3B2EA 3ZZTA 2ZS9A 2DPXA 3MWYW 4JKYA 1S1CA 3RANA 3WY9A 1Y3AA 3I3SR 1VECA 4FMCF 1ONBA 1CKEA 4DEYA 4HAVA 1TAGA 2C95A 4LHXA 4C4PA 3I4LA 1FMLA 3A58B 1J90A 3TW4A 2XZPA 4M4SA 1ZNXA 3GFTA 3GEIA 4IDPA 4FW9A 1W4CA 4M1KA 5D3QA 4TLAA 2CE2X 1E9SA 3M6AA 2XNDA 1E2KA 4ZDIA 4NTZA 1E96A 2JJ1D 1LVGA 1KTVA 1P2SA 2OUKA 4KBGA 1ELOA 2BDTA 2FSIA 2RGEA 3V4RA 3A1UA 1KO8A 3CNOA 2JLWA 1T8TA 5HKKD 2VL7A 2OXRA 3CB4A 1YZQA 4M9ZA 1AS2A 2FZ4A 1ZM7A 4OKSA 1SGWA 2OEPA 1OFUX 4RFSB 1KMQA 4XD7A 2O8BA 3GJ6A 1UDWA 4LC0A 2XTZA 3SFZA 2ZUBA 4JSYA 2D74A 3FDIA 2CDNA 2QTFA 1ZMXA 5AJZA 4IJMA 4DEXA 4B48A 1SVIA 1SVOA 1YZKA 4B43A 4IFEA 2EFDB 1KMHB 2ANCA 4BLRA 1TQ4A 3TGPA 1OH7A 2YOHA 2NO1A 1D2MA 2F1HA 2YVUA 2W83A 1OF1A 1KI8A 1MV5A 2IC5A 2IHYA 4TL6A 3OIWA 1LY1A 4H1VA 2B21A 2PX0A 4PANA 3FKQA 2VLIA 3EAQA 1M34E 5JZVA 5FOWA 4UQOA 5DI9A 1LF5A 3QXCA 5J4VA 5L3QB 1I4DD 1YE8A 1FTSA 1R0WA 4N3NA 1JJVA 2VA8A 4MYCA 3B1VA 3MWJA 5FOXA 5KOYA 5J4KA 3KXLA 1PUJA 4OI2A 1RJ9A 3FHCB 4DUGD 2GCNA 1DG1G 1P2UA 4BLSA 4B2LA 4G3XA 2B6HA 2P3SA 2V55B 4RZ3A 2J0UA 4V02A 2GWHA 2JLYA 3THXB 1ZUIA 3SI7A 4AYXA 2QRNA 1ZM9A 5KNBA 4M1YA 1NVWQ 3VAAA 4NH0A 1MKYA 1AZTA 2VP4A 1NRJB 2GK6A 4MRVA 2OESA 4YMVA 1ZRHA 3U6KA 1Z6YA 2EW1A 3KZ1E 4GNKA 3RC3A 5G40A 2YC4C 1II0A 4Q66C 4QJ3A 2H1LA 4B32A 4E5UA 1Q1BA 4MYHA 3KFVA 1UKZA 2QENA 4DLUA 1CLUA 4QBGB 4Q4AB 4HLUC 1KSGA 3UG7A 3TUJC 1IXRC 4M2LA 3B13B 2IX3A 2P65A 1R8QA 4YXWD 1XTRA 5DISB 2AK2A 3SJZA 2UZ3A 2GETA 2J3EA 3DPUA 1CRPA 3O47A 3WP0A 5E7JA 2NPFA 3R7WA 3AV0B 4TSFA 2BEJA 1K5GA 3QBTA 2GTPA 2FPMA 4CGZA 3RC8A 2ZAOA 3VHXA 2XGJA 2ZSAA 3B1ZA 3A1VA 4AY2A 3CO5A 4JLPA 5KYKA 4DZZA 1J8YF 1NKSA 4TT3A 3K9LA 4LJ5A 2ZRDA 1VG0B 4QGGA 2DB3A 4R2HA 2RH5A 4LV6A 2J7PD 4P4SB 4XVQA 3K0FA 3G0HA 5BN3A 1XJQA 1MO5A 2A5YB 4NYJQ 4LCBA 4D25A 2JLSA 3IO5A 4BLQA 1SXJE 2ZU6A 2A5DA 3LNCA 3GPLA 3UMSA 1NN0A 1UPTA 1Z28A 3CPEA 1NMZA 2WAXA 4LYAA 1G5RA 4LYFA 2XXAB 1Z6XA 3HYTA 3R8FA 2QSYA 3NWJA 3QXHA 2W2TA 2UZIR 4HLUA 4RD6A 1RPZA 1NBME 2IYTA 4I1SA 4MKIA 5DE3A 2MSDB 3CNNA 4TMXA 2OBNA 2CCJA 5JFGA 1FZQA 3AEZA 1NG9A 2X8AA 1NBMD 3AVWA 2HDNB 4DIEA 1LS6A 1G4UR 2CCKA 3K1JA 3K9HA 4MUBA 2ZI4A 4NL4H 3I73A 1JR6A 1II8B 2ZIAA 4KU4A 4OQXA 3EIQA 3EZFA 4RFSA 1JPNA 4Z51A 2G0TA 4QC2A 1X1SA 1XD9A 1RFLA 4CEJB 1FW6A 1COWA 1NJFA 1IHUA 4Q00A 4YONB 2OAP1 1S2MA 3EWAA 2AD1A 2HJGA 3VFDA 1RW4A 3NHBA 2FU5C 1KMHA 3FOZA 4X8HA 5HE9A 4WXPA 4A2QA 2OZEA 1FNMA 2ZITA 4Q7JB 4ZI2A 2I1QA 1ZP6A 5H8WA 3RS4A 1DAHA 1IJEA 4AKGA 2BM0A 2ZI3A 2RGDA 1KSHA 1S96A 2VSFA 5L3QA 1JAIA 2X2EA 1AKEA 4TL9A 2L0XA 1B23P 3W6NA 1UAAA 4KAXA 2FJUA 2NO0A 1P62B 4W5HA 1CBUA 1J70A 2EU8A 3BE4A 4U00A 1OXTA 2GRJA 3QKTA 5DHFA 1CEEA 5E3HA 5KUTA 2Z83A 4V0OA 4ILEA 2WWYA 3H86A 5KTYA 1KI6B 1PUIA 3BB1A 3PITA 4BFXA 2YV5A 2NZJA 4DCNA 3DKPA 3UWOA 3LBNA 3THXA 3KKNA 3CH5A 4ARZA 4BQSA 1TF7A 3F8TA 4DT1B 621PA 3LQRA 1TQDA 1Z2CA 4KFUA 3JVVA 2OE2A 2ZE6A 5TB5A 4JS0A 3VR1A 1JXMA 1KI7A 1ZAKA 5KDLA 5BW8A 5LB2A 2ZSDA 4YMWA 1F48A 1P61B 1V43A 4U5XA 1AGPA 1G9XA 3IKJA 4DC9A 4BFSA 2DFTA 1VPLA 1W4AA 2LKDA 2N46A 1CR2A 4KJZA 1UKVY 2PT7A 1JR3E 3R8CA 3T15A 4JBWA 5E4FA 2F3RA 1AZSC 4LV5B 3W9YA 3KQLA 3SQXA 1XMIA 4Q4AA 4JVMA 4MKFA 4Q9HA 5EP1A 5G53C 1JR3D 4B34A 1IBRA 4ZKEA 1MO4A 2G3YA 5CIWA 5LD2C 2NPIA 1CF4A 4AIIA 4TLDA 4WW0A 4A0HA 2IXFA 1ESNA 5FL7A 3KKOA 4IDNA 3VHLB 1P72A 3EW9A 3ASYA 2BMEA 2P6NA 2BM1A 3LDAA 2AKAB 2ZRJA 3TE6A 4F4CA 5G41A 3CKLA 3IIKA 2HEIA 5BN4A 2Z43A 2PJZA 3X1YA 3EIEA 1AS3A 2D3WA 3IUYA 4HB2A 1W2GA 5H70A 4P4SA 2RGXA 2G9NA 3ZDQA 3SZRA 4HAUA 1X3SA 4A9AA 3KKMA 2IS6A 3X2SA 1OH8A 1N6PA 2REXB 1OPXA 3ADKA 1MR3F 4JLBA 5IK2A 3ND8A 4B2IA 3GLGB 1X8LA 4C7OB 1RYHA 5H1YA 3KKPA 2XZOA 4O0MA 4A15A 4A0GA 3H1TA 1WMSA 2BMJA 2FEMA 5EP3A 1N3BA 2DCUA 4DDUA 3GJ8A 3MGCA 4LGMA 2FF7A 1JECA 3DZDA 3FVQA 2ZJ8A 4G5GA 4NU0A 3R9IA 2XXAA 3AP1A 1XJCA 4B3GA 3TSZA 3OIVA 1DEKA 2ZSFA 1P6XA 4QBHA 4BECA 1E1RD 2WMOB 3RRMA 5LDDC 1XJ0A 2P0EA 4ZPXA 3FB4A 2ZRAA 2O8CB 1HTWA 1T4GA 1QHIA 2A5FA 4UNQA 1Q3TA 3AKYA 5JHGB 2ZR9A 4LRWA 2ZRNA 3BBPA 2QT1A 1G18A 3QPWA 5CYOA 3T1VA 4MRRA 3U4QB 3H2YA 4JSTA 2WSMA 5AJYA 4LZZA 4J0QA 1ZCAA 2OLJA 4EDHA 1II8A 4C0AC 1N0WA 1SKYB 2ZRPA 3GJ5A 4PTLA 4A6PA 1W36B 1AQUA 3GJ7A 1Z0KA 1JQLB 2DFLA 4CEJA 3REGA 3AKDA 1BYUA 1DAFA 3A4MA 2GF9A 3KXIA 1JEEA 5FI1B 3K53A 2RAPA 2ODNA 2JATA 1HT2E 2ZVQX 3B1WA 1E79A 2EYQA 3WYGA 4TLCA 3VTKA 1W7AA 1EFCA 1E69A 4IVQA 4IOKA 4QNRA 3RWOA 3TQCA 1KJYA 3CUEF 2N42A 2B7BA 4DJTA 5KSZA 4MRPA 1VIAA 1J8MF 4MGYR 1KO7A 1T0JB 1YVDA 2CEAA 4S35A 1IY0A 4DVGA 1WP9A 1NSFA 2VEDA 4DXAA 4EPRA 1Z83A 2D7CA 3CF6R 4EPYA 1D5CA 5L8VA 3U7FB 1SVKA 1AM4D 1P7CA 2ZI5A 4FWTA 1NL3A 3I62A 1L7VC 2O52A 3F0TA 4C0JA 2EWVA 2W6IA 2ORIA 3D6TB 1WXQA 4GFDA 1KI6A 3KB2A 2VHQA 3PVSA 4YC7A 4JLOA 5HE8A 5HZHA 5JRZA 3UXMA 1XBTA 4DT1A 4L5BA 2W2XA 5AR1A 2LKCA 4ACBA 1U81A 2VP9A 3Q9LA 3R20A 3AVVA 1W0JA 1F3OA 5F2EA 4YLGA 4B3BA 5FL3A 2ZJBA 1KNQA 1MRNA 1CU1A 4W5WA 2QMHA 4F4JA 2BMDA 3O8DA 5D3MB 3MUFA 4XWOA 5FH9A 5HTKA 3RHFA 1U8YA 1W0KA 1CRQA 2GJKA 1XMSA 4NCJA 1HUQA 2VPPA 3GJ3A 4HZIA 4NYJR 4R7ZA 5FPKA 2CMKA 4L9WA 3I8SA 5M04A 3LVQE 4HLDA 2Z4SA 1RKBA 4GT1A 3OAAA 3VR4A 1Z6AA 3W3AA 2ZQ5A 4Q1EA 2ZYWX 2ATXA 1E2GA 3OESA 4BRWA 1E4VA 2NO9A 1HY3A 3OIYA 3H0KA 4LDJA 3RLFA 4FMBB 1KO1A 4GOXA 4PX9A 1YHNA 3A1WA 1KNXA 3B7GA 3QJYA 2CLSA 2EWWA 3H84A 5C1BA 3LQQA 1Z2AA 2AK3A 4XWAA 1W36C 5DSZA 3IEUA 1XCGB 2A7QA 4LJ4A 4RD4A 4BFWA 4HATA 2WJHA 2IYLD 1QHXA 1WRBA 1RIFA 4IHQA 1E2IA 1UJ2A 2GXQA 3B60A 3AVUA 3QPUA 1GL6A 1M6NA 3O8RA 2W58A 1EK0A 2DHRA 3IPYA 3DOEA 2ZPTX 4CRWB 4ESHA 3OFND 1HV8A 1FTNA 1T5IA 3B1XA 4TMTA 5FTMA 4JZKA 2JIZD 5EJEA 5L3SB 3GLGA 2QI9C 2OFXA 3AF0A 1NJGA 4C7OA 3CX8A 4BFYA 2JDID 4ZCIA 1CR0A 2OCYC 2ZYTX 4NCKA 2PCLA 4MGKR 1NKTA 1W1WA 5EZ5A 3KQKA 2C9YA 3EA5A 2C96A 1T9HA 2OBMA 4V0LA 4U02A 2BCGY 1A2KC 3AVPA 2GDJA 2WVJA 1NI3A 3NEYA 3HWSA 1YRAA 2WWXA 4QGFA 3BFXA 2O8CA 2J7KA 3P27A 1GNRA 2ZREA 2O8EB 1E2FA 1LS1A 4AK9A 2OFOA 4K81B 1NLZA 3SFVA 4DCTA 3U4QA 1E2HA 3GEHA 2GF0A 1H8ED 4DSNA 3BXZA 3DOFA 2XZLA 3QKUA 1Q1QA 2OILA 2RB4A 4DDTA 1H65A 4JVLA 2VHCA 2IF0A 1TF5A 4HZUB 3TSOA 3ZS8A 4RJLA 1WF3A 4YMUA 3KJEA 2H92A 4LBYA 3LD9A 4TLEA 2F6RA 5DIFA 2Q6TA 1QDEA 2WWIA 2GJ8A 5EUMA 2XOKA 1XEWX 1TU3A 2ZRBA 3LH5A 4H9GA 2E1RA 1VG1A 1KK3A 4OHVA 3AKCA 3QF4B 2IBMA 2QAGB 2WJVA 1OIVA 4M1WA 1E98A 1EXMA 1TEVA 1WQ1R 3NG1A 5J40A 5KNDA 1UBFA 1OFTA 1MO6A 1XU4A 2FFAA 1SXJB 5SZHB 3A1SA 3WBKA 2YWFA 2ODBA 3JVUA 4Y0AA 1C1YA 221PA 3GJ4A 4IVPA 4LHVA 1KSFX 1N2CE 2WPDA 2QG6A 4PAMA 3EPHA 4GZMA 3BGWA 2QQ0A 5F3WB 3NDBB 2IF2A 1VTKA 2FMXA 2WIAA 4MKHA 4FMDB 1E2EA 1EFUA 4PPFA 1G1MA 4KLNA 4B3CA 4QG7A 2JLVA 3J81k 2WJIA 5AJVB 2H8KA 2CE7A 2JJ1A 5BXQC 1O3YA 4OQLA 1KZGB 3KX2A 3T06B 2WV9A 4QJ5A 4K8OA 3ZS9A 3SJBA 3WRYC 1KDRA 1XTSA 3PJRA 2VIIA 5D3MA 2AWNA 3BH7A 1WBBA 3U3RA 4RD1A 1TUEA 1GNQA 3ZQJA 4QM7A 1XCMA 2PLRA 4C0QC 5A4JA 5FTLA 3FPAA 4NYIR 1E0KA 1JJ7A 1C9KA 2AWOA 2EFGA 2Z5FA 4BPBA 4BFUA 4D82A 1G7RA 5KO2A 3BERA 1KI3A 5KSPA 3ZH9B 5J4LA 4I1VA 4ON9A 3TMKA 3U3OA 3KDSE 4ACAA 5FTNA 1N6KA 4OI0A 5FR1A 2YZ2A 4MA4A 4I81A 5CJ2A 5E7MA 1UKYA 3GMTA 2ZJ2A 1G17A 3AKEA 5TDHA 3SE0A 3VR6A 3K0EA 4FCVA 1QF9A 4KLZA 4TTPA 3Q7QA 4RZ2A 5GJCA 1IY2A 1OHHD 3PUVA 3N2EA 1GFIA 2WKRA 3QUSA 3D31A 2JLUA 4CT5A 1BOFA 2QE7D 4GI7A 4JLVA 3FHOA 1LW7A 1VCIA 3C41J 5TMPA 1NIJA 4KFRA 5EE9A 5JRJA 1XCPA 2WAYA 4ZDWA 4UXHA 1FQKA 1R5BA 2ASEA 2BVNA 4Q9IA 1CS4C 1DPFA 2H17A 3DKVA 2HCBA 2QORA 2WBLC 2YOGA 3K9GA 2CXXA 4B76A 5L3SA 3KQNA 3B85A 5BN5A 2QAGC 4FXPA 1Z6TA 4LK2A 4B47A 4IKEA 2GHIA 4AKIA 1N6LA 1X6VA 3QBVA 2CJWB 2ZSBA 4DDWA 4ZV4A 4CEHB 3RVBA 1G3MA 1JALA 2QMEA 2QNRA 5CM8B 3EXAA 3NH6A 4AYTA 1XTQA 1I4TD 1GILA 2C78A 3W8RA 1GTVA 2F3TA 2HYIC 2O8EA 4F38A 1H8HD 2ZJYA 4QOSA 1HQYE 1KI2A 3BOSA 1K6MA 2ZRLA 1NVUQ 1Z0FA 2ZRHA 5JCPA 5SZKB 5K8UA 2IL1A 4DKXA 4WZBE 5HZKA 4LJAA 3TQFA 3PR1A 3SS8A 2XTNA 1P9WA 4ASUA 4BLOA 4OJKA 4HLCA 4QHSA 3PEYA 3C14C 4HZUA 4BFVA 1N6IA 3BS4A 4AD8A 3VNUA 2ZJZA 3UK6A 2I1VB 4R98A 5JS8A 2Z4RA 2CCGA 2HJVA 4PR0A 5FPSA 1NSTA 1BMFD 4N1AA 4DDVA 4B6FA 1LFDB 4B33A 1A7JA 1A4RA 2J7PA 3N70A 5CDFE 4AI6A 1BO6A 3QF4A 1PLLA 3TUZC 2QAGA 3U7HB 1YU9A 2HT6A 1KJZA 3LW8A 2OXCA 1U0LA 5JMTA 2QM8A 3ADBA 2AFHE 3L0IB 4HUQB 1OIXA 3MWLA 2GJSA 4FI3C 1NF3A 1OXXK 4KV9A 4JKIA 4AG5A 1SXJA 3CH4B 3CPHA 3WXMA 4FWIB 1R5OA 1OKKD 1FQJA 2CL0X 2OCBA 1HT1E 1VMAA 5DHAA 1DAEA 1KJWA 5B30A 2D06A 3FWYA 2DWPA 4RSGA 2CBZA 2B92A 2J45A 2MMGA 3CWZA 3GJ0A 2KE5A 3K9NA 2XB2A 3AF1A 4IFBA 5HCIA 1NBMA 3UKDA 1DO2A 3AVYA 3ETLA 1JEDA 2ZE8A 4C0KA 3MJHA 3QG5A 1N0UA 4URXR 2ZS8A 4ESVA 3HU1A 1ZYUA 2J46A 1TMKA 1R5NA 4KBFA 1ZM2A 2HLDD 3PENA 4M21A 2WZQA 1HURA 4R71A 2GK7A 4A2WA 2IT1A 3L2OB 2VF7A 3VKHA 5SZJA 1MOZA 3VU9B 4XTRA 5CLLA 2ZI7A 4BUJA 2YWHA 2ZRMA 3I32A 3A4NA 3AB3A 1E9FA 1GUAA 3TKLA 4PQYA 3VR5A 3A4LA 4N0DA 4B73A 4OHYA 1ZD9A 1LV7A 4GZLA 3ICQB 2H57A 2Q21A 1R8SA 421PA 3SU8A 2QGNA 4Q7MB 4S2EA 2IYVA 3B9PA 4RKEA 4JJZA 2JJ2A 1M2OB 3A37A 1T5LA 2C98A 3AUYA 4TMWA 4BE7B 1Q1ZA 2QA5A 3C15C 2RGAA 4ZDJA 2GCOB 5AK0A 2EFEB 2VP2A 1ETUA 3SYNA 1G8GA 4CZ2A 5HCNA 4Q1CA 4O2LA 3CX6A 4PSKA 2WOOA 3KB1A 4ZCLA 1YQTA 2REOA 2J59A 2FOLA 3NXSA 4C3ZA 1RE0A 5TY0A 5TXGA 1OYWA 1R2QA 4B71A 2DFNA 2VHJA 3VR2A 5GVSA 3K0CC 1WBDA 3W6PA 4TYWA 1ZUNB 4FD2A 1XPOA 1I2DA 2CJWA 1JAHA 1N5JA 3PUYA 4CEHA 1FL9A 2GVDC 4BASA 2PEYA 3N2IA 1GKYA 2GXUA 3LBIA 3CRW1 5KU1A 2ZVPX 3TR5A 2FH5B 3QEJA 2QROA 4CDGA 3TBKA 1HE8B 4W5JA 5JJKA 3UANA 1JR3A 3RS0A 4C0LA 5DO9A 1XZQA 4RD3A 3VNVA 1OH6A 4JT2A 5CYPA 3CRQA 3SJCA 1U90A 1UKEA 1Z0AA 4D2IA 4KO8A 2NQ2C 2QEQA 2ZE7A 5EE3A 1XTKA 3HP1A 2EFCB 2FN4A 2A2ZA 3OEHA 1GNPA 5LD2B 4L16A 1G16A 1R4AA 2CK3A 5FOVA 3KJHA 4EFLA 1N6OA 3OEEA 1FOEB 3EA0A 3KKQA 4DSTA 3U3JA 3QKSB 1IN6A 4A0FA 2GZDA 3MRSA 1W49A 3LVRE 1VHTA 3EC2A 1HE1C 1G8HA 1X86B 3FTQA 3GLIE 3AP2A 4M1OA 3TR0A 4A4DA 2FA9A 3P4XA 1P9RA 3K0CA 2ZETA 3V00A 3RAPR 2GAAA 1R0ZA 4HUQA 4OHXA 2XITA 4YMTA 2GJAA 1W46A 2QAJA 4FINA 2VO1A 3F3YA 1VHLA 2BIFA 2C8VA 3L43A 3A1TA 2W6JD 4M9SA 1E9CA 2BC9A 5BWMA 2WJGA 2BMFA 1R10A 1BH2A 2GCPA 2P6UA 2R6AA 3B9QA 4QBIA 1E1RA 5L3VA 1EX7A 2R6DA 3S1AB 2ERXA 4A36A 4URVR 4LYHA 1YZGA 2ZRKA 4KFSA 5FFMA 4MUAA 2AD5A 4OQFA 2IYQA 3LV8A 2ATVA 3BB3A 1OV4A 1CTQA 3C7KA 4I4LA 4OK5A 1OT3A 4B3FX 4OK3A 4TN1A 4HYYA 3RRYA 4NPHA 3CZQA 4RZUA 4PPQA 1OSNA 2H5EA 2ZTSA 3CF2A 1N5LA 2R9VA 1GRQA 4FN5A 4FMCB 2QQEA 3DZ8A 1E2QA 4IVRA 1JBKA 3B1YA 3RSOA 5C4GB 1AA9A 4US0R 3ADDA 1M74A 4Q9JA 4PO1A 2A30A 2OAQ1 1Z07A 1XFAA 4IDHA 3CWQA 3VU9A 3SYKA 2Q3MA 4Q7KA 3I8XA 3TVDA 1TUIA 2FG5A 1G21E 1UM8A 2A5JA 1XEXB 4MKGA 3I5YA 4IDOA 1J99A 4UXJA 2BKUA 3LBHA 1UBCA 1XMJA 3NIBA 5TVKA 4GDFA 1W5SA 3FYHA 4AYWA 5GVRA 1TU4A 1RRCA 4D4LA 3BRWD 2F9LA 2VSOA 4GSYA 2GCOA 3SHFA 5EP4A 4V03A 4DCSA 1BS1A 2WICA 1BYIA 3WHKA 2HV8A 1RVDA 5FPTA 4PZYA 4KSBA 4Z8YA 3B5JA 4DLXA 4P4TA 3NC0C 5FPHA 1QVRA 3LY5A 3U61B 4BZXA 1IAQA 1T0HB 1J2JA 3E2IA 1T6NA 1UBGA 2YHSA 3MFYA 4LOAA 1DAKA 3NBZC 4A0RA 3GFOA 2HT1A 1RC8A 3EASA 2GKSA 2QTHA 3FMOB 2G77B 5B57C 4JBYA 3ZIAD 3KUCA 3KJIA 5FTKA 1NN1A 3P1JA 5B64A 2OV2A 1IQPA 4NDZA 3BK7A 4GP6A 2B8WA 3SDZA 2CNWD 2KWIA 2QRZA 1NN3A 4NKRA 2WJJA 4BEJA 3VR3A 2FSHA 1GDDA 3KFXA 1F60A 3B8HA 2Q9BA 2GNOA 4DB2A 2EFHB 4KI0A 1QG4A 4B74A 1E3MA 1YR9A 4BEBA 1K8RA 2ORWA 5FOTA 4TZ6A 1D2NA 3IGFA 1I2MA 4FCWA 2R6CA 1XWIA 2FFHA 3U2QA 1HQCA 4BLPA 3PEVA 4GL2A 4RD0A 3ICEA 2EQBA 5BQ5A 2R6FA 4HDQB 1IN8A 2ZYVX 1G3UA 4TMKA 821PA 1NVVQ 4IOLA 1KDOA 2WJYA 3BFKA 3LWNA 1NVXQ 4NE2A 3RNLA 3WYAA 3Q72A 1KI9A 1KZ7B 4GOJA 4B2PA 2FFBA 5KSYA 4LJ8A 3IHLA 1AN0A 2Q9CA 4Q7LA 2IWRA 2GESA 2FSGA 3D7MA 1N6RA 5DGXA 4PQFA 1Z08A 4LBZA 1P5ZB 3QXXA 1VIYA 3RWMB 2K5UA 4NYMQ 2JDIA 1AQYA 1N6HA 1UADA 4PC2A 1Q3HA 1FP7A 4YMSA 3TH5A 3FGNA 4HUTA 2IUSA 2OLKA 1Z8FA 4YDSA 1XDBA 4DBLC 1JPJA 4IRUB 4Q9LA 4YQFA 3EZ2A 1RZ3A 3HDTA 1U8ZA 3T34A 3S1AA 3AP3A 3AVTA 1JXOA 3E70C 4CIDA 2O0JA 3AF2A 121PA 1OXUA 4PC1A 5AUQA 2V54A 2UKDA 3DHWC 4M1TA 1H8EA 2QP4A 3FE2A 2Z0MA 1ZM3A 4LSGA 4GOKA 3ASZA 1EESA 4L9SA 1TX4B 1LTQA 3TK1A 3PCRB 3SN6A 1XEFA 4NHOA 1IXZA 1ZW6A 3QVUA 1LB1B 3G82C 1N6NA 1QHGA 4TWZA 3EPKA 1CP2A 2GAOA 3AUXA 1R6BX 1E9EA 4G01B 1Y63A 4EIWA 4QM6A 5F98A 4JLMA 4OK6A 1KK0A 1CR4A 3L8ZA 4P31A 5LB4A 3QENA 4UJ5A 4CVNA 1XD2B 1Z5ZA 2HF9A 5A0FA 3K8YA 1RYFA 3BORA 1XEXA 2FNAA 2ZU0C 1ZIPA 2ZJ5A 4Q1AA 4OQNA 1XXHE 2IYWA 2RGGA 3BFVA 3AVOA 3O8BA 2WOJA 4MITA 3EG5A 4URYR 2Q9AA 2W00A 3NH9A 5FPYA 2OM2A 1OFHA 2GEDA 1AGRA 4E03A 1NIPA 2V7QD 2NO6A 3GLHE 1JNYA 5JEEA 2FFQA 4LYJA 4G0NA 2ZROA 2FSFA 2MMCA 2ODEA 4PO8A 1VYVA 3GQBA 4IW3B 2Y8EA 5IK2D 2P67A 3I61A 3CRRA 1G5TA 1NLFA 3BC1A 2WKQA 1KY3A 1GL7A 2GZHA 1KAGA 2AX4A 3WNCA 4JJKA 3SEAA 4OBEA 3DMNA 2AKYA 1M1YE 3RDPA 2F1IA 4UNPA 3RS7A 1GSIA 4N0EA 2GVZC 2GEVA 2DWQA 2FWRA 2VP5A 5ANRB 4ZCMA 2J0QA 3D3QA 2V6IA 3V4FA 2IEYA 4RFVA 1N25A 2ECKA 4EJSC 4O3MA 3BJIC 4AKEA 1QZXA 1FUKA 3M0EA 1W5TA 2VP6A 1EFRA 2ZRGA 3LXRA 3PIRA 4M0LA 5TARA 4DLZA 4HLQB 4A6XA 4KVGA 1E2NA 5CITA 3HYRA 1P2TA 1XPRA 3KJGA 2ZRFA 3DVLA 3JZAA 3RS2A 3A8TA 3ECCA 2V9PA 1VDZA 4ZI3A 1OHHA 1UF9A 3GCGA 5FBRB 3X1WA 1AKYA 1E79D 1MRSA 1F2UB 2C03A 4C0HA 3R9WA 2QE7A 4WBSA 2IWHA 1YZUA 2XAUA 4C0SA 2A3RA 3Q8XB 1S0UA 4LJ6A 3A6PC 3FKSA 3FHTA 4F93B 3NBXX 2VHUA 2A78A 4K46A 4Z1MD 4XJXA 2YWEA 5HPYB 2O8DB 1T91A 5CLQA 1Z0JA 2J1LA 1DTSA 3I5XA 4WOPA 1OYYA 1UFQA 4AURA 2J41A 2QPAA 4PZZA 1D9XA 2G83A 2FDCA 4DRZA 1GIAA 4M9XA 1G7SA 2OG2A 4D6PA 2J9RA 4BWYA 4ZKDA 5DN6D 1SQ5A 2CL6X 2JLXA 4RVCA 5FBQB 5KDDA 1W4BA 3NBYC 5EP2A 2PBRA 1D8TA 1HH4A 1YKSA 4PO9A 2NMVA 2C04A 4Q1BA 3WNBA 2WMNB 4A82A 4EFMA 1E1QD 2ZJOA 4PFSA 4PPGA 1MABB 4QGHA 4JL6A 4QGAA 2G0NA 1NY5A 1W0KD 1ZC4A 1P9NA 2ODWA 1PZNA 2ZRIA 1CXZA 4QBFA 2AXPA 1EX6A 1G41A 3Q85A 4Q48A 2VF8A 4NBSA 5L3RA 4WIAA 3VKGA 4TYQA 3W34A 1NMXA 3PQCA 4KHZA 2DY1A 5HKKA 5DLQC 1CJKC 1X8JA 1XD2A 1P75A 1WB9A 3NBFA 4F91B 2KBFA 3C16C 2GZAA 4L4UA 3EZ7A 3QY0A 1GG2A 4LPSA 2BEKA 3ZVMA 2ANBA 2AN9A 3DMDA 1XMVA 4G5SA 3CBQA 4TZ0A 1AK2A 3T5DA 5JWOA 3GLIB 3ZD7A 5CDFA 2Q0HA 3I72A 4DCUA 4BGDA 4JLJA 4Q47A 3U60B 5IHPA 3IIJA 1P2VA 1QHHB 3IO3A 1PLJA 5GADl 3OE7D 4TYNA 3K09C 1OKKA 4LY6A 4OHWA 1BIFA 1ZVQA 1A2BA 2X1VA 1Z63A 3QXJA 4NP6A 1XNJA 3U7GA 2WSSD 5JJIA 3UG6A 1WCV1 2XSZD 3TNFA 4JVNA 1NP6A 3UPUA 3CX7A 3F5FA 4AWXA 5JHHB 4OHZA 3QPVA 4PXAA 3UMFA 3EZ9A 3SJAA 3X1XA 1NN5A 5UKDA 1Q57A 4PHFA 4F92B 4URUR 2V1XA 1ZJ6A 1GRRA 1NVVR 2QUZA 3LX5A 5H68A 1KK2A 4DUGA 1OW3B 1N5IA 2O8FB 3KTAB 3TUIC 1G3QA 3DM5A 4V0NA 1JQJC 2IYRA 1KSJA 2FPKA 3DEFA 2HLDA 4MDFA 4IEIA 2KB0A 3MSXA 4QL3A 1OIWA 1Z0IA 4XOIA 1TADA 1E2MA 4F7WA 2CHVA 2JLZA 1IY1A 2CVHA 3AGPA 1ZNWA 3QEOA 4DIDA 2R2AA 4PSAA 3CLVA 2QPTA 1W47A 2AHOA 1PLKA 1J7KA 4ERNA 2JLQA 1XRJA 4RCZA 1NMYA 4CF7A 4AKHA 1OE0A 4WZAE 2V6JA 1W48A 4LX0A 5ELXA 2EVWX 3K09A 1FX0B 3VMFA 1AJEA 1FPMA 4YXWA 2H16A 2J0SA 1D2EA 4IEEA 3UIEA 1F2UA 4V0ME 5FBWB 5J4YA 2F7SA 3VQTA 5BYKA 4R2IA 2NO7A 1T3SA 3DL0A 4HB4A 5GJWC 1E4YA 1DE0A 5GJVC 1E2LA 4JLNA 3IIMA 5KPJA 1L4UA 1P60A 2QZ4A 3THOA 2CLDX 1LNZA 1DARA 1M7HA 2O8DA 4QKQA 1F2TB 3U44B 3OHMA 1Q20A 5IF9A 3B6EA 1A1VA 3FMIA 3GFPA 1C4OA 2HXSA 2ZEJA 4FIDA 3ZVRA 3HU3A 4D81A 4HAZA 3UWKA 5G3YA 3BIFA 4E09A 1TL7C 5TV2A 1N0VC 3P26A 4B35A 2QT0A 4BFZA 2WPDD 3NVAA 4GMDA 2RKOA 2WM9B 1CIPA 1PV4A 2O0KA 1GKIA 1ZD8A 4URZR 1DOAA 1R0XA 2IUTA 4MH0R 3MWKA 1VG9B 2REBA 3TIFA 2WWGA 4TQUS 3SR0A 3PUWA 2ZAMA 4GBMA 3QF7A 3TW8B 4OYHA 1TF2A 4I99A 4W7SA 4CYMA 4NCHA 2R44A 1MABA 4D0NA 1T8UA 3C8UA 3GEEA 4M53A 1NLYA 1CJUC 2ZI9A 4EAQA 2KBEA 4B44A 2BBSA 4JBXA 3FFAA 4U7DA 1ZNYA 4E07A 4KXFB 5LBIA 1KOFA 2AXNA 2PZFA 4ZIRB 5JSZB 3N5CA 4QRHA 4TQAA 1XPUA 2XX3A 1TQ2A 1EFTA 2N1BA 2YJTD 2AFIE 2FGJA 1E32A 3BH6A 4HAYA 3THWB 3AH8A 2VTKA 1UBEA 4Q1DA 4V0KA 1Z29A 2BBWA 2DR3A 2JEOA 3WYFA 5JECA 5KNCA 3K70D 3DO6A 4ABYA 3GLIA 2P5TB 3GLFE 3EX7C 3T12A 2WWWA 2ZYUX 4HAXA 2QP3A 4JVSB 4DWJA 1QHHA 4MRNA 1SHZA 2W6JA 2WHXA 5EQTA 1KGDA 2F55A 5CK5A 5C4MA 2BOVA 5FUWA 2PZEA 3IHWA 4Y0VA 4IOJA 4QFMA 3B82A 2QU8A 2IUUA 4ARZB 4URWR 5CB8A 4ITRC 1QRAA 4Q4JB 5EXSA 1KDPA 2V8OA 4RCYA 5G3ZA 2VBCA 2BBTA 2O8FA 2JASA 3NDPA 4QJ4A 2D7DA 1ZC3A 3KTAA 2GEUA 2NZ8A 2X2FA 1E9DA 1YZNA 2H18A 3QKRB 1X1RA 2IEZA 2NIPA 5JEDA 3VX4A 2Q3FA 1ZNZA 4UXIA 2FEOA 4WA7A 4DLRA 3PXGA 2ORVA 3E1SA 2FGKA 2HCJB 2OO7A 4BZQA 4AG6A 1FNNA 4PC3A 1IN4A 1U9IC 4DLSA 3I92A 2QBYB 1G8FA 2GJ9A 4D4KA 4US2R 4TYPA 4JL5A 3THYB 1M8PA 4JL8A 1G3RA 1P4SA 2QP9X 2RHDA 3W5JA 3MG9A 4Q02A 5LPNA 3HJNA 4XWKA 3DM9B 1YR6A 2HXYA 4EPXA 2RGCA 1ZM4A 1KK1A 4ASUD 4C2UA 2VRWA 1RRGA 2XNDD 2CVFA 2PJRA 1F6BA 3WRXC 2ZM5A 3ZYCA 1DAIA 2IW3A 3ZVLA 1FX0A 1XXHB 2C2HA 3QVVA 3EZ6A 4QHTA 3LXXA 2YINC 4D80A 4B6EA 4H1UA 2BHRA 1U8AA 1W4RA 4G5RA 3L0OA 4PHTA 3IBYA 3CW2A 2V4ZA 3CF0A 2O0HA 4XD7D 5JCZA 5EXPA 1RRPA 3OZXA 1DELA 4IXMA 4PZLA 3GLHB 1P73A 3NKVA 1DVRA 2F1RA 2XEXA 2RHMA 3L82B 3M4YA 3Q5EA 1Z6GA 1F2TA 4C30A 3U44A 5FOSA 1SXJD 1E2JA 1TNDA 3ZIAA 5FBLB 1S9DA 3LAWA 4A92A 1U9IA 5CJPA 4D26A 1CJMA 2IXGA 2PLFA 3ZZUA 3RYTC 3MAAC 3O8CA 3U5ZB 2CNWA 3CR8A 4IXNA 3GP8A 1KKLA 1TTTA 1G5PA 1G20E 4P32A 2D2FA 4JYCA 1GITA 1GWNA 2G88A 3KL4A 1JI0A 2R65A 4KYUA 1L2TA 3MJRA 4M9QA 2BKEA 3QG1A 3WHLA 1RRFA 2PMDA 1SVSA 2BV3A 2ONKA 3BWDD 2IYYA 3MCAA 3NC1C 1FMJA 1ZU4A 2YOFA 1TQ6A 3RRZA 4TL8A 1KYIA 1T3LA 2RMKA 4L8GA 4CT4B 2CHQA 2W2VA 3Q7PA 5AUPB 5K8TA 2H7VA 4TTRA 2OHFA 2PMKA 3BB4A 1D9ZA 4GP7A 1OB2A 3G5UA 4HDOB 1IJFA 1V5WA 4ZIRA 5JSZA 3K0SA 1FUUA 2VH5R 3DDCA 5F9HA 5AUNB 4NZYA 4OJQA 5EXTA 3EIHA 1YRBA 4US1R 1XF9A 2WWHA 2W0SA 3P20A 4W9MC 1S3SA 1SHKA 4LHWA 3THWA 1U2RA 4WVFA 3ONWA 1R0YA 1SKQA 1QVAA 2QPOA 4PHGA 3ADCA 3RRNA 4DB4A 1G7CA 2JJ2D 1PJRA 2X77A 4M8NE 1G291 1GRNA 2NOAA 3SBDA 3VX3A 3LLMA 2PX3A 4D4MA 2IYUA 1OLOA 1HYQA 4UJ3A 3ND9A 5JLJA 4EFNA 2AL7A 1GZSA 4JIMA 4PC6A 5JI3E 2RGBA 2VHTA 3EPJA 4AC9A 1UEJA 2VP0A 4PC7A 4TSFD 3VKWA 2QL6A 4LJ7A 5DI3B 5B58C 1TEXA 3SHWA 4OQMA 4Q18A 4Q4JA 2IHBA 1UDXA 2JGNA 2NGRA 4TT3D 2V1UA 2F43B 2BWJA 5FUYA 3WMFA 5J4HA 4WZ6A 3SOPA 4O2RA 4QXAA 3ZZ0A 2XTMA 3QKRA 4TMZA 1ANKA 1G7TA 3PG5A 1KO5A 1VKJA 2YWGA 1EGAA 2WWFA 4NONA 5JWHA 4EUNA 3HPRA 4B75A 4JMPA 4PPNA 1E0AA 1DAGA 1EFHA 3ZVNA 2ZS7A 2FE4A 1Q22A 1US8B 4LI0A 4CEIB 3MD0A 3FMFA 2QBYA 2IYXA 3THYA 3CPJB 1SVLA 1G4AE 2BBOA 1L8QA 4M1MA 4JYBA 2MSCB 3IBGA 3OEHD 4TYYA 1B0UA 1E2PA 1MO3A 4LV8B 4MYUA 8OHMA 2TMKA 2SHKA 4MDEA 1K5DA 2CK3D 5CK4A 5AWFC 4XSHA 1KI4A 1IN7A 3OEED 4Q01A 2ZR7A 1XXHA 2G1KA 1Q21A 4D4JA 3W5IA 1VCOA 1Q12A 1SVMA 4DLTA 5JWRA 2YNMA 2E87A 2V7QA 3M1IA 5E95A 2XNSA 1CJVC 2J87A 3U6BA 2DWOA 1YZTA 4UNRA 3W8NA 5F9FA 3K0AB 1COWD 2F1JA 4B3DA 4BLTA 4DSOA 4NYIQ 3GLHA 1DO0A 1QHYA 4GMXA 1U0HC 3SYLA 1U99A 2I4IA 5KPDA 3QKSA 4FMDF 1OXVA 1YR8A 2ZANA 5CB6A 1S9HA 4G5QA 1U0JA 4RKFA 3RS5A 1G6HA 1W2HA 2JCSA 2QMOA 4DLVA 3MLEA 1FFHA 4DLWA 3OFNA 4BZPA 4EQ6B 3UMRA 3AM1A 1KO4A 2JIZA 3GD7A 1S8FA 1KKMA 3QIAA 1DAMA 5BYJA 1IXSB 2V3CC 2J5XA 2OT3B 2Q3HA 2NG1A 4LBVA 1E6CA 4HB3A 4ZDKA 3LX8A 1GP2A 2E9SA 1ODFA 4Q19A 5P21A 2VSXA 5EE0A 3E5HA 1VYUA 1LF0A 3L0SA 4LWZA 1P3JA 3U3KA 4EJSB 3QQ5A 1HA3A 1AS0A 2DBYA 4E22A 2R8RA 3SNHA 4MRSA 3BH0A 3PV0A 4A8JB 4LBWA 4JLKA 1XEWY 3KXKA 1ZIOA 2D4HA 4DLYA 1SULA 4LC1A 4KSCA 4Q03A 1G8PA 2YKGA 1E2DA 2IYSA 3LFUA 4DSUA 5FUVA 2VYFA 2R6GA 4B3XA 3KUDA 1KDTA 4Q4HB 1ZINA 1E9AA 1KY2A 3NTUA 1ZCBA 2ONJA 3X1DA 4LPKA 4UNNA 3Q5DA 2GXAA 4Z1MA 4PSVA 4C2TA 4XVUA 4OL0A 2HYDA 3U7EB 1G19A 1GAJA 2B7CA 2BCJQ 2FV8A 4DCVA 3L8YA 4TMVA 2P5SA 2ZSEA 2IS4A 5E7IA 4C0BA 1UEIA 2ZUDA 4HAWA 1G8YA 3CRVA 1WE2A 3LW7A 2C5LA 2AR7A 3ZD6A 3AQ4A 1PVOA 5FL7D 3FMPB 3QOFA 4GRAA 2ERYA 2FPLA 2RGNC 2WIBA 3H4MA 1YR7A 5DN6A 3TLXA 2BJVA 3HR7A 5DI3A 4NCIA 2YC2C 4R9UC 3UATA 1IONA 2DYKA 2FZLA 3OIUA 4HEJA 4BRUA 4P33A 4CW7A 2GBLC 2F43A 2FX3A 1VCNA 1E1QA 4EPVA 2ZI6A 3AVQA 4A2PA 3W90A 5EE1A 2IS2A 5FBVB 5JBQA 3PEWA 1KHTA 2IK8A 2G6BA 4LJ9A 1E0JA 3C5CA 4KITB 4QNMA 1Z3IX 3WP1B 2OFWA 2CHGA 2DFKB 2UVQA 1US8A 2O5VA 4NMMA 5J5CA 4CEIA 4X8LA 1DBSA 2QSZA 2ZJAA 2BJWA 1QHSA 1OXSC 2HF8A 1FP6A 1XP8A 5KSOA 4PAOA 1IOZA 5HR5A 2ZE5A 3AVXA 1ZU5A 3LO5A 1U94A 3IEVA 3TJZA 1SZPA 1G3IA 4TTQA 1MH1A 3ZJYA 4D0LB 3K70B 5K8LA 3WMGA 2F9MA 1EG7A 1GM5A 2MSEB 1IN5A 5EUQB 2CL7X 1JB1A 1R7RA 1ZD1A 2GXSA 2C9OA 2RGNA 1QBKC 1MT0A 2IA5A 1E99A 2JLRA 3NEJA 3OE7A 4PQRA 2WTUA 2P6RA 5AUOB 6Q21A 4OI4A 3GLFB 2PEZA 1L4YA 3WBJA 4L15A 2OCAA 2D2EA 4TLBA 4A8JC 2PT5A 1KIMA 2WSSA 5A5GA 5DYGA 2A5GA 4MGIR 2XSZA 4DHEA 3K0AA 3TAHA 5FOUA 1W44A 1NG1A 1XTJA 2GBLA 2EYUA 4HSEA 3T35A 3SBEA 2ZRCA 2QGZA 1CULC 1Z06A 1Q1EA 2NTYC 4POAA 4QHYA 1NNEA 4FCTA 2C99A 2ZR0A 5FUXA 4C9BA 3LLUA 2XJ4A 4M22A 1QHNA 3RS3A 5JI2E 3A36A 2KSQA 5B2ZA 2I3BA 3CNLA 1SVWA 1XZPA 2PL3A 4HI0E 4LUCA 1DG3A 4O25A 2IYZA 2OSBA 2ZUCA 3MMPA 4P3YA 1GVNB 4Q5IA 4A1FA 4EQ6A 2VQSA 1A5TA
chains in the Genus database with same CATH superfamily
4AECA 2JJQA 4D79A 1YZLA 5KDOA 2ZXUA 4FFRA 1VCHA 1V8ZA 2VNKA 3O3CA 1V8BA 3EBPA 3DMTC 4R5MA 4P2GA 5DNYB 5JJLA 1ZZGA 4IXTA 4Q8IA 2VC2B 4E3WA 3BK2A 3R4VA 2BI7A 3PNPA 3ROEA 4BU1A 2Y67A 1B8NA 2PZAA 2R6HA 4HCJA 5CM9C 3VR4D 2RHJA 3DC2A 1VG8A 3K70C 1QJ4A 1HTTA 2KJQA 3NHWA 1RKUA 3HCOA 4OQQA 4F4IA 1I7SB 2C9CA 2E0IA 3IRVA 4IBXA 3EC1A 2GAFA 3DMTA 3FVTA 4KODA 3KSIA 5ECGC 3IAEA 3CIOA 1J5XA 3H3XA 4RQAA 4LJYA 1Y8RB 3EGEA 4FR5A 1EFRD 3P19A 2QX7A 5I8PA 1E94E 3AF3A 4HDKB 4GLQA 3EARA 2X8BA 1H2ZA 1EK6A 3Q7RA 1K55A 1I51A 4IOMA 1DC4A 1YJ5A 1F0NA 4ZOBA 3AY3A 3L01A 4D9JA 3IQWA 5C2JB 2YVQA 1BHO1 2V03A 9LDTA 1I6LA 4ZANA 2Q5LA 1IJBA 4FMCF 1CUJA 5T7BA 3KAKA 1PWEA 3IV9A 2CE2X 4TLAA 5AKGA 2J0EA 4QDKA 5ALQA 3ISVA 1Z2EA 4UQIM 3WV5A 2FSIA 5TEVA 3AF5A 2PR2A 1TKBA 3JX9A 1DBVO 2MSKA 4C4SA 1D6MA 3ZY3A 3GGJA 5BW5A 3QU7A 5AJZA 1FFSA 4IJMA 1SVOA 3IDZA 4YT5A 1GPAA 4GSKA 2NO1A 5A90A 4CTKA 1OF1A 4WNCA 5B58T 2JCVA 2D0IA 4OMFG 3SWWA 3L6EA 4RADA 4Y8VA 5KOHB 3K0KA 1RJ9A 5IARA 3KPWA 4LF5B 2QXYA 4FC6A 2NU9A 3D2LA 3RWBA 4KH1A 2VPZA 1CVIA 3AR6A 1O57A 3NOQA 3KZ1E 4FSDA 4Q66C 1JDSA 3TPCA 3IOBA 4ICIA 1ABBA 4QREA 4PPRA 5DISB 5AHOA 5LYJA 2UZ3A 3QX3A 3R3WA 3HDHA 2FPMA 4UE3S 4PM7A 2ZB4A 2ZWVA 4TT3A 2Q2NA 3RD5A 1BN7A 1QS0B 5GIOE 2M1CA 3V39A 2HDRA 4D25A 2YH2A 1VLHA 4MV0A 3G6KA 4LYFA 3DP9A 1RP5A 4KO1S 2H4FA 4J0FA 4NHEA 1MC5A 3PQFA 4I1SA 2AQ8A 4ZT7A 3LM8A 2HJEA 1QYIA 3GT4A 1ZEJA 5C3MA 2GPWA 1L1RA 4JGRA 3AZQA 1U2QA 2XDWA 4CEJB 4CQJA 1I0LA 1S2MA 2R00A 2Y2QA 3FOZA 3MGAA 1UPUA 1ZP6A 5H8WA 4MGEA 1BN6A 1FRVA 2OA0A 1SC3A 2X2EA 1DBPA 1MOQA 1RDFA 3VZPA 1J70A 1PW5A 3JU3A 5G2OA 3JRWA 4IX9A 2ZL1B 4S2OA 3OFSA 1FFEA 3KVVA 2RI6A 4IH4A 3S27A 2YFYA 2DKOA 3NLLA 4AP6A 3F7OA 4YMWA 4WLVA 4CNQA 3PEFA 4BO0A 4AZ3A 1JR3E 3ETCA 4JUAA 5E4FA 4LV5B 2V7TA 3L02A 5CIWA 4NZOA 1NW9B 3CSSA 3U39A 4A0HA 1OV6A 4FKBA 4AUNA 2JAPA 1CUXA 3BFGA 2JH3A 2CY0A 4NY1A 1DQPA 4BV9A 5ILOA 1KU6A 1P4AA 5EVID 4FYVA 4PRYA 2GYWA 3G2JA 4A15A 4DDUA 3FVQA 4LXHA 2ZQCA 4IDEA 4GS5A 4HVLA 2HFKA 1I1NA 2ALJA 3HCCA 4ZYWA 2VQDA 4G5FA 4PWZA 1J8FA 3AKYA 3U4QB 4HS4A 1K5HA 2WSMA 3HYLA 1N0WA 4BNXA 2Z2MB 3AX6A 1KS2A 4HX2A 3AKDA 1NV9A 3HKEA 5FI1B 2PQMA 4UBOA 2ZVQX 2NSDA 4X41A 1UEXC 3K8QA 1YVDA 3ZH2A 3IHAA 2PWZA 3ZV5A 1WBJB 5KBYA 2WJAA 1SUBA 3GFGA 3FNBA 5THQA 3TSCA 3FYTA 5DNAA 2VP9A 1QTRA 2ZJBA 2AX3A 3O8DA 3RHFA 4X60A 1SBIA 1CS0A 2OENG 4R7ZA 1XPJA 4DE2A 5CRFA 3T5AA 4H2DA 5KTOA 3NTLA 3ZHQA 4GT1A 1NMEA 4LV1A 2C3UA 4HZGA 3RK1A 4LKOA 1SBNE 1Q16A 3PKIA 3A1WA 4CMAA 3LIBA 4NEGA 4UOEA 3H84A 4QO7A 4DTIA 3NOXA 2QMZA 3H5TA 2VF5X 4TMTA 1GAXA 1HNNA 1CQZA 1SVUA 2DFPA 3R40A 4PBSA 1Z68A 1T9HA 4JQSA 1GCIA 3H9QA 1U9YA 2H1OA 2GDJA 1VI5A 4R81A 2WWXA 4QGFA 1JZQA 4QD3A 3MBKA 1E2FA 4BU0A 4PIMA 1E2HA 4C5AA 3DV2A 2C2GA 4P7JA 1YDEA 2W8BB 3CITA 5I9IA 2HMAA 2HQOA 2D0DA 2H92A 4JP3A 3ZD8A 5DF9A 4Q12A 1Q2UA 5BWOA 4OHVA 3QF4B 4D99A 1GQYA 4DBLE 4RK0A 4DR6B 4ZJ2A 2X7HA 1RJDA 5KNDA 4MJXA 1GZ6A 2XCRB 3ZDBA 1NJSA 2DF8A 3F2IA 1KZGB 1B0AA 3KQPA 1ECBA 2Y8HA 1IQUA 5U47A 3PJRA 3GFQA 1WBBA 3UE6A 3E23A 2I2WA 3WMRA 5I9SA 4RTQA 3SEFA 2C00A 2I03A 1TEZA 4ZD6A 3AB8A 2WC1A 1J9EA 1E3WA 4DR7B 2JBFA 4X53A 5BWCA 4RW0A 1G4HA 2JLUA 3QH4A 1LVUA 2GHQA 1AA6A 5CA0B 2HZBA 5IH7A 4WCFC 3B85A 1JH9A 1SIUA 4S1OA 2ZSBA 4C3UA 4RKYA 1JALA 3NIWA 2VEAA 3BIJA 2VJBA 4AYTA 1GA9A 4WLOA 3WLAA 2OUIA 1SZDA 3GI1A 5G4ZA 5C5CA 4WX2B 2JHAA 4QHSA 3PEYA 4RZIA 5LZ7A 4AD8A 4LZJA 5JFOA 4LCMA 2I1VB 4QT0A 3V1LA 1YOBA 1BMFD 4B6FA 1RD4A 5CDFE 2VA9A 2MHCA 3AHCA 2FZ5A 1U31A 1H3FA 3WXMA 2ZLBA 4MYRA 4P86A 3EGIA 2D06A 3PNKA 3GJ0A 2FKAA 2F8MA 4MV4A 2O1EA 3QU9A 2QUIA 2XQJA 5BWNA 1A72A 4Z4GA 3LX6A 1JIVA 2J46A 1XK6A 1IOWA 1W9HA 2RH8A 1CX9B 1RWMA 3TIVA 1TLTA 4BWVA 4CR7A 4AF7A 5K51A 1NJ2A 1ZGHA 3TKLA 4B9OA 1ST2A 1SU6A 2ZQYA 4YRIA 2JJ2A 2II6A 3H6KA 4YA6A 3OZGA 1DJNA 2XGNA 2V1AA 5JSKA 3AERB 3KB1A 3ICPA 3FW1A 3LUHA 4MHTA 2K2NA 5LA6A 4XASA 4L9RA 4YP1A 3U2AA 1GKYA 5AVQA 1QANA 3LBIA 5F1OA 2CLIB 4ZYTA 1W75A 2V6BA 4V0QA 4ESEA 1MVOA 2RHCA 5EXDA 4EF5A 4EB3A 4HIAA 4D2IA 4MJLA 2ZE7A 5F68A 3HP1A 2EFCB 2ZWMA 2EJUA 2WEKA 5DLDA 2CK3A 1I2CA 3OEEA 5C31A 2E5WA 2GZDA 1SCDA 1W49A 3JAKB 3EC2A 3TQIA 2A9PA 1EVJA 1J9GA 4L95C 4DN0A 5JE8A 3P2JA 1P1KA 4DJ3A 4KUEA 2QYSA 1TZMA 1RBYA 2XWSA 4QBIA 5L3VA 4MLLA 2J9XB 4MUAA 3BXXA 4OK3A 3RRYA 2PHZA 3A0SA 1EJ6A 2L0WA 3H8WA 4O5OA 5H3LA 4F86A 3N58A 3TRIA 3GRVA 3OLCX 3GWGA 2H5SA 4GDFA 4HFNA 4WUJA 2OGSA 5GVRA 2Z6QA 5AM4A 2XMZA 4RGQA 3AIKA 3EAGA 4P3XA 5F64A 4M4XA 2O5CA 4Z8YA 1T6NA 8MHTA 4A0RA 3GFOA 1W85A 5J2UA 5B64A 4GP6A 3S2GA 5KNLA 3WOHA 3EN0A 3EWNA 1T3TA 3F1OB 3HN6A 2ORWA 2XHEA 4BLPA 1G3UA 1IB6A 4NQZA 2WT9A 2Z6AA 3OCLA 1RI5A 4PGMA 4G0UA 3O8LA 8ADHA 3RHTA 5D6OA 3PBOA 3GOHA 1U8TA 4PC2A 5IDWA 3C1TA 1MTOA 3RFFA 5E6UB 1ENOA 4WBNF 1Y8ZA 2HK7A 4ZAMA 3BUSA 1H8MA 3G5TA 4LGYA 2Z0MA 4L50A 3SN6A 3RTCA 4Y3IA 1MAUA 3S99A 1YSCA 4BVJA 1FFWA 4KR2A 4QAQA 4AB1A 4QM6A 1Y63A 2R0QC 4ARIA 5FV7A 2QX6A 4P31A 4UJ5A 4CVNA 4E5KA 1Z5ZA 5JT1A 3BORA 1XEXA 3G7UA 5GONB 3NBMA 3ZHHA 4OLDA 1JE1A 2IHJA 4UEWA 3KALA 1OFHA 4L5CA 1L5WA 2XF2A 2D1FA 1CF9A 2ZROA 4QDTA 3C6QA 2ZGVA 1QR6A 4UEOA 5BT9A 4EGCB 1DU4A 1M1YE 3G2PA 1ZHFA 4BQQA 1JKXA 3Q8MA 3HLBA 5CAEB 2G71A 1TTQB 1QZXA 5L53A 1VKHA 1W5TA 2CMDA 1P2TA 4DG9A 4LJLA 4B4KA 4CJXA 5KIAA 3SZMA 2J3JA 1QOZA 2JKVA 2WFLB 4WBSA 2Y4AA 4UFOA 3G34A 3EEBA 4KZ7A 2A3RA 2M6LA 2VK4A 1YLJA 4XJXA 1P7YA 3Q7VA 3MAJA 1DTSA 5BR1A 1UFQA 3G2YA 4ZICA 2GR9A 4QXPA 1G7SA 3V67A 3DPSA 1X7WB 1KMCA 4DZRA 2VWPA 2YXNA 1WVMA 2FLVA 4MR7B 1W8DA 4UHDA 3PHCA 2GA9A 5BOHA 4N0MA 3A3NA 3RPEA 2HJHA 4ND3A 4GB7A 3ORHA 2HC9A 1VLMA 1BH6A 4ALLA 3F6CA 4P83A 3E35A 3T1HB 1AV7A 2AG8A 1QH9A 3WGGA 4RPKA 3DLHA 3ESAA 3EYAA 1N5RA 3BJNA 1ADGA 5HKAA 2EBWA 1GG9A 2LXNA 5TGFA 3E05A 5M34A 1X7XA 3PLNA 1R9NA 3KTAB 4BNDB 1N5MA 5CD1A 3MTDA 1P1FA 1KEEA 1ZNWA 3ZWNA 2VJYA 3TLJA 3PF9A 1DP4A 4LX0A 4LDQA 4EDFA 2EVWX 3VZQA 4Z7QB 4MPDA 2X58A 3H6GA 5JMWA 3EGDC 1H1LB 4EA9A 1DXYA 1K9VF 2JHGA 4DMCA 1TO1E 5ICEA 5JJCA 2BTQA 3GFPA 3ED5A 2Y0BA 2IPLA 2X3YA 1TL7C 5AJGA 1XQXA 3PGLA 1L5YA 1N9LA 5CTJA 1ZGBA 1KY4A 4BFLA 5CDSA 4FGKA 1GTJ1 5AHWA 3DL4A 1TF2A 4UHJA 4KDEA 4RACA 1RKVA 4M53A 3W4IA 3D3KA 3EGDA 4G23A 4GOMD 1NLYA 4RXMA 4JBXA 3FFAA 4M0PA 2HF6A 2WHRA 1KOFA 5BUCA 4Q1VA 2PTGA 4L5AA 3HXLA 1O89A 1LCIA 2HJRA 3MMNA 4JXJA 1WLSA 1Z29A 5KNCA 5MGNA 3HDYA 2QP3A 3OZHA 1ORTA 2WYOA 1VBNA 3CTPA 2FPIA 2QPLA 3HSYA 1JLHA 2EBHX 3R24A 3LLVA 1KDPA 2EERA 3NDPA 2NZ8A 2X2FA 1YZNA 4XYEA 7ABPA 16PKA 4QBTA 1SXPA 2GH1A 3BQ9A 3PC4A 2QD3A 5IC4A 4EHLA 5ALSA 2HCJB 1CF2O 2BGKA 1IN4A 3EIWA 2QMIA 1M8PA 3AO0B 5LLSA 1VA5A 3IKLA 4W6QA 3OA2A 1RRGA 4OF4A 5BSEA 2QI9F 2I4MA 2PSDA 4KMOA 2C2HA 1RM4A 2H1SA 3F4LA 2GWRA 2WUWE 4IO1A 3KFLA 1DVRA 1QO0D 1C80A 5I3ZA 3QUAA 4IBOA 1EFPB 1QGUA 4ZYLA 2GSDA 3VA7A 5IPFA 3P7NA 3AW8A 4OQYA 1Y3IA 3WJ2A 5TS3A 1U1EA 1QQAA 2UYHA 2OQRA 4IV0A 5REQA 1G20E 1M1YB 3IUBA 5KOJB 1L2TA 2OV1A 2ZQDA 5LJIA 5JUWA 1V3TA 3UPDA 4TM8A 3T3GA 4L8GA 5JH7F 4UULA 4AN0A 3TLMA 2QU7A 1MQSA 2WD7B 2FW8A 4NZYA 3H9CA 2B5RA 2YRXA 4OFZA 4MI3A 2PH5A 3HFJA 2R5FA 3DAHA 3QBJA 5KJCA 3L9KA 3RRNA 4B3JA 2PX3A 3WDMA 2PU2A 1T13A 3ND9A 3B7PA 2OV6A 1VQQA 3F47A 2QRQA 2YHBA 4AC9A 4B1FA 3FVWA 2GASA 1ZI9A 4O2RA 1ANKA 1OAKA 4NONA 2P77A 4YJFA 3H17A 3S2IA 5LUBA 3JATA 4K86A 1OTHA 3LT1A 4XUXA 2BBOA 4QJGA 2PLWA 5AW7A 1EDEA 4R8MA 4ZQHA 4D4JA 2PQ0A 3EISA 4IUDS 3WG9A 1AGXA 2QTLA 3DXFA 2XNSA 3NIGB 5AVSA 3HGMA 4EP1A 4UC0A 2KM1A 3KD3A 1OXVA 2BLNA 3P2EA 2J9ZB 2X15A 1T2CA 1RXYA 2W1RA 3UMRA 3L7JA 4KLCA 4B93A 1IXSB 5I7FA 4FZVA 4L1KA 1LZLA 3EGCA 2A1UA 1V8DA 3C74A 5IT0A 4EX7A 2EP8A 2IIVA 1EGQA 3OQMA 4G1BA 2ZBDA 4KSCA 4B3XA 3AONB 1E9AA 1YC5A 5LP6C 4ARCA 4UNNA 1PS0A 3R5SA 1L5OA 2P5SA 1NT4A 4B80A 4O63O 3CEAA 4ZPJA 4DMFA 1XRNA 4I2NA 2VZ9A 3CVJA 4JOQA 1J2TA 3RF6A 1DFIA 2C2KA 4BWIA 4GSLA 4DF3A 1JG7A 4ZOAA 1KHTA 4LJ9A 5DXAA 4MVJH 2W93A 1Q1AA 5LP6A 3PBSA 2M32A 2YRFA 1R00A 2HD4A 3AVXA 5K8LA 4Y9DA 1L4GA 1OYOA 2ZAGA 3FGZA 3NEJA 1CDOA 1BYWA 4UDOA 4JR1A 1TI7A 2PT5A 2WSSA 3SBEA 1W0CA 1S7GA 2L82A 4I4TF 3GPDG 2NUBA 4O02B 2OC9A 5FQJA 2PL3A 3HO8A 2JPDA 2OSBA 4EQ6A 3VE4A 4ZEMA 3SEQA 3ZLJA 5A9TA 1MTZA 3A3EA 5JYEA 2GAJA 4YCNA 3FETA 4C6RA 3T61A 5TMBA 3IUJA 4RZXA 3QE3A 1MW9X 5DBOA 5IDVA 1P2BA 4MKXA 3DBLB 2R7LA 2YYZA 1FJXA 4HJ6A 1YS7A 3QTTA 3REFA 3SSOA 2I2XB 1MQ8B 1P7PA 4ETZA 5ADWA 1PNOA 3K2BA 1N77A 2PH1A 2JGFA 1GKUB 2QSUA 3OQIB 1XHFA 3GNTA 3EXIB 4BO9A 3I01M 1G20B 2H08A 3KDAA 1WE4A 1DQSA 5AM1A 4RDXA 3V9PA 4IJUA 3S28A 1O9HA 4FLEA 2XE7A 4HQOA 1ZCFA 3EWSA 2JJ8A 3ZQKA 1DBWA 2VXOA 1IEMA 1M7GA 4NYMR 4GPIB 5BPFA 1DADA 1PR9A 4XPIB 2X0JA 4OLAA 1QPGA 2GBCA 2QK4A 1CZHA 3A05A 1SKOB 4TQ9A 5IAGA 4CCWA 3COSA 4KR6A 1XGJA 3VC7A 3BL6A 4D3ZA 5K6AA 3E9DA 2P1DA 5JNSA 3ABQB 4M89A 4DEYA 4L3OA 2OCGA 4ABTA 5AD1A 1JDVA 4N8DA 1CUVA 4FDAA 5AP9A 3T9DA 3Q7SA 1E2KA 1JG3A 4LWOA 4Z7JA 1T8TA 2VK3A 2IWDA 3C4VA 1AS2A 1ZM7A 1SGWA 2OEPA 4GD3Q 5F4ZA 1IBKB 5JXWA 2O8BA 4LC0A 2Y59A 4LVNA 4BMDA 3E5NA 1OTIA 1PJBA 1KMHB 1H3NA 3F97A 4HGQA 2PX0A 4MQFA 3EAQA 3MA0A 4C89A 2WZXA 2QTVA 5L3QB 1JJVA 1KRHA 3TB4A 2BEUA 4H18A 2V9CA 1U7UA 3RV4A 3W2HA 3FHCB 3W0LB 1EM8A 2D1YA 4V02A 3WKBA 3SI7A 3ZG7B 2PZBA 4D3FA 3DEZA 2EKZA 1WYBA 3I2FA 3RC3A 3UMDA 5ITZA 2EKQA 5EZYB 1QNFA 1CUSA 3TUJC 3TRHA 5F52A 3K94A 4KGZA 4E88A 1FYWA 4WD3A 2GETA 3C3CA 3AV0B 2BEJA 1PUXA 2Z2JA 1WXXA 4EGQA 3IEPA 2OZVA 2JD0A 3R4KA 5AVRA 4LCBA 3IO5A 1O96B 3GCXA 2A5DA 1CY2A 1J24A 1Z28A 2Z2YA 1AF7A 3P2MA 1HE2A 3C8HA 1PU2A 2EZ4A 4UU7A 4R8LA 5DTMA 5D3OA 1Z2DA 1IYPA 3F3MA 3N2KA 2HDWA 4DYVA 3JYQA 3PGVA 1ULHA 5AVWA 4B4UA 4QC2A 2H4ZA 4Q00A 5WRFA 1Z4LA 3EWAA 3A6JA 3VFDA 1RW4A 1VPWA 3CUSA 2O2HA 4MWBA 1ZBQA 5I7WA 3O8QA 2DT5A 1QFZA 2FWNA 2WGWA 1XRRA 3H7WB 4JU9A 5KTYA 2C58A 3AFOA 3R23A 3LKZA 2QTNA 3DKPA 3F8TA 4A26A 1TQDA 5KDLA 4CMIB 4EW2A 4EG4A 1JA9A 1JA0A 3ZCRA 4DA4A 3I9MA 3HCYA 3FNRA 1NVAA 2A5LA 4FD3A 1KDSA 2R1TA 4TSRA 4U6NA 3CPTA 1A5AB 3I9JA 4PM8A 4D45A 4WA8A 1TM5E 4HHDA 4BD1A 1GZ4A 2PFKA 1SA0A 2Y1LA 3NV7A 2Q1UA 4PLTA 3D4LA 3X1YA 5LOVA 2WJ3A 5FO0A 4ZZIA 1BXGA 1TYAE 2NXCA 1AT1A 3U13A 3EOIA 4A9AA 3KKMA 1S4MA 4DPKA 2FEMA 4BJHB 5BY2A 5I8ZA 4G0YA 4RXUA 2GD6A 2PO7A 1QHIA 3BBPA 3QPWA 4LQCA 3KYBA 4IICA 5JDCA 2YCBA 5IBPA 2WWVD 1ECGA 1W36B 2O7NA 4AJKA 4RTJA 4GM0A 1Y28A 5M1AA 2EYQA 2XLNA 4IVQA 2W6MA 1G8JA 5T6MA 4MGYR 2OP0A 5KS2A 3CF6R 4OB8A 3RXXA 1X9HA 2J3TC 3IUNA 3LY8A 4LY3A 4YC7A 1NDHA 5JRZA 3FFWA 1V16B 3O9VA 1TXGA 4C1NA 3A11A 1CU1A 2QL9A 3CE6A 3QU5A 4L75A 2ZZNA 2P5YA 1X1QA 1T1JA 1HUQA 1LPNA 3QYAA 3JQAA 3FZCA 2NV6A 4MO9A 5E2IA 1I7NA 4WY2A 3BTOA 3KLNA 1XZIA 3CKYA 5FQ9A 1YDHA 3M2PA 4NK5A 1KNXA 5BMVF 5KHLB 4BFWA 4HATA 1Y9EA 4HRYA 5CG1A 3AVUA 5CNMA 4C22A 4JQYA 1PRQA 2CLKB 4N6NA 1T5IA 2YJ5A 5IUKC 3OF3A 4TXHA 2OCYC 2XCOA 3DW1X 3AKZA 1H23A 3L1VA 4OA5A 1FJHA 4ZZ0A 1QGOA 2XGGA 1N4OA 1VKZA 3E03A 2EATA 4IBRA 3GEHA 4M9CA 1KRXA 1NBOA 3ZS8A 2RJOA 4YMUA 1W94A 3OEWA 4BJ1A 3N7AA 5B6IA 4LZAA 1S66L 1IULA 1KP2A 5B53A 5AJUA 5TT1A 1Q7RA 3U3ZA 2WJVA 3WE7A 5E2HA 1EXMA 4LF9B 4GPD1 3H1EA 1N2CE 4WVLA 2FMXA 4MKHA 5AJVB 2RD2A 2CE7A 2UVPA 1C7FA 1O3YA 3IIIA 4IVIA 3ROKA 1QTIA 4K8OA 4QO8A 2R7NA 1PV1A 2DKNA 2D0OB 5LU9A 1FRQA 2PLRA 3WVNA 2EFGA 2ORYA 5CRIA 4FX2A 1G7RA 5EIBC 2ZJ1A 4MOWA 3JQ8B 2PR6A 1HORA 2Y2UA 4DR2B 5TGZA 3OT1B 3VR6A 2JLBA 1M34A 2YMMA 3IH9A 2X5OA 4OXNA 3FHOA 2QX4A 5JRJA 5IVPA 1CJBA 4NENB 1QRSA 4N54A 4JYAB 4X0EA 4QYIB 4RVAA 2GHTA 4ZN6A 3MXSA 3UUEA 3I5UA 3HP4A 1MPLA 4G5XA 4GBED 1GTVA 2O8EA 4O4LB 4D44A 3WK9A 1IXYA 4WZBE 2FW7A 4MVJM 1KVTA 4HRVA 3SS8A 1CQJA 4EJMA 4PZ0A 1P9WA 4OJKA 1ZVVA 2B2XA 4DDVA 2BGMA 2OD9A 4ARUA 3WRWA 2ZUFA 5FQIA 3WLLA 3OM8A 2VDMB 4LDAA 4MBKA 3T3NA 4J7XA 4L0MA 4EUKA 4IJ5A 4KV9A 2CL0X 2OCBA 5EQDA 3F1PA 4RTSA 4CMKA 3VDMA 2XB2A 1NBMA 4QTZA 5JS6A 2YJGA 3QG5A 5BV0A 2OQ2A 4PS0A 1MOZA 3NUZA 2ZRMA 3M1LA 1E9FA 1YB5A 2ZPAA 1ZD9A 2NVUA 1FFDA 2I7XA 5L9AA 3UO8B 3TOCA 4D8WA 1E6WA 3ELYA 3VV2A 4IIGA 3PA8A 1FCOA 2LTAA 1ERMA 2FOLA 2GPSA 3NXSA 3L1IA 3CVVA 4CI0B 1LGYA 1UKAA 3DE1X 1D1TA 3AJEA 3G49A 4MI9A 3ZE2B 2BASA 4KWIA 2BGGA 5FEUA 1TM4E 4IHKA 4JYMA 2QROA 2PO5A 5GOTA 1YK0A 2R5NA 5LKAA 5C53B 4OONA 1XZQA 3E9CA 1U90A 4RYDA 5THKA 2KX7A 4NPCA 2FN4A 3TX6A 3OEHA 1U3FA 4NICA 4OXRA 5FOVA 5IM5A 4DKIA 2AFRA 4MS1B 1NXOA 3F8WA 1XNRB 1L7NA 1YQDA 1IBLB 4WERA 4UOQA 3P9YA 4W5QA 2GAAA 1W46A 4EK9A 4F60A 1W581 2AQIA 3GG9A 5B1HA 4ZJ3A 4HFRA 1T9ZA 2CXQA 1HGXA 4O2BB 3VNSA 3MHPA 4MW1A 4U9IS 2WHPA 4B09A 4PKYG 1T4CB 1GPBA 2VJWA 3NYQA 5JANA 3ZDFA 2PDAA 3ZV3A 2Q3MA 4XD2A 2FG5A 4DMUB 4OCZA 2ZCVA 1QXSA 4IIUA 1M2OA 5KREA 2HBQA 5DBEX 3CUVA 4BAUA 2H9IA 1V9CA 2PHYA 3FYUB 4GH5A 1N2CB 4S2UA 4FZRA 5ES4B 3SXUA 5FI6A 3EASA 3LCMA 3ZVTA 3KJIA 5FTKA 1RYYA 3QFHA 3P1JA 2FH5A 3KFXA 3RBXA 4JGPA 2H2AA 2QZ6A 5T3UA 2B34A 4B74A 1I3KA 1K8RA 5FOTA 4WLFA 5IKMA 3S2FA 1HTZA 4YCJA 3U40A 1ZZEA 2WJYA 4PF1A 3MRTA 1T19A 1U28A 4LJ8A 4JENA 4L8YA 4Q7LA 1BE0A 2BMAA 5JISA 3MKFA 3AR9A 4YUXA 1USVA 3QXXA 3RWMB 1QCDA 3CG5A 1Z8FA 4BVEA 1JPJA 3H19A 4RVOA 1D04A 4KQMA 3EEFA 4QOFA 3SM3A 1YJXA 1QDLB 1OZGA 4FYYA 2V7GA 5DCWA 3FE2A 2JFOA 5ALYA 2AG1A 4RQUA 1IXZA 1LB1B 4WZBB 1RLUA 4GIBA 1CP2A 4MHSA 1IYOA 1R6BX 1QV6A 5HTOA 3M4ZA 1E18A 2W6QA 2FNAA 4XUCA 4NDNE 5U4XA 1M72A 1IN1A 3EVCA 2ADMA 2O6LA 4IILA 1GUFA 4OMUA 2F59A 2NO6A 1VL2A 1IHPA 5IAEA 4K9MA 2VT3A 2E7ZA 4KQ6A 1NUHA 2GZHA 1KAGA 3NOOA 3CZ5A 3C7UA 4XQEA 1DX4A 3DTIA 3L7MA 3IMFA 4ER7A 3FJ1A 3BJIC 3BZBA 1FUKA 5TARA 3IX8A 3CW8X 2J4DA 2Q9UA 3ECCA 1OHHA 1F6WA 2GLTA 4WY5A 3I04A 2OLVA 4G1CA 3WLMA 4NJEB 1KHHA 3SQLA 4NIMA 2IE8A 4PZZA 4RQ9A 3W77A 3GELA 3RAEC 3NQ41 4HN4B 2J9RA 2V7UA 1XPBA 5EP2A 2QX8A 1G1AA 4XYBA 2NMVA 4ZOLF 3RGGA 1MABB 3Q85A 3JS5A 2GFHA 3WL4A 1XUOA 1I0ZA 2QLNA 3Q8LA 2ANBA 1K55C 3ZD7A 4BGDA 1OGJA 4JLJA 4UQIS 3IIJA 2AFHA 3UT5B 2JFGA 1A2BA 3DT9A 1XNJA 4NP6A 3JPWA 3RU9A 3L8FA 3GGGA 1VEUB 1L0GA 1Q57A 5FJIA 2O8FB 1G3QA 3VU1A 2OTCA 2FPKA 3H6HA 3PWZA 2HDOA 2KB0A 1SD1A 3VYVA 5EOVA 1IY1A 5EWLA 1WOMA 4KAJA 4PSAA 1CJSA 1J7KA 3D7NA 5HQ3A 3I12A 1OE0A 4G1FA 3PS9A 2L18A 1HDCA 5LC1A 3B38A 2IV2X 1F2UA 5T64A 1RLIA 4C6YA 1T3SA 3MXOA 4RA9A 2G6TA 4D81A 3MT0A 3PGKA 2GARA 2R9XA 2ZUSA 3K73O 4V1CB 3V7YA 2CDAA 4JJAA 1Z15A 4MH0R 1NE7A 3MWKA 3ZV4A 5CHYA 5KINB 3NULA 4J90A 1PZPA 2ZKLA 3QF7A 4OYHA 2QLFA 3PR6A 1QIMA 4HNRA 4YCLA 1SB9A 5GZ1A 4P54A 3ZD9A 4PG4A 2JGRA 2AFVA 2IYEA 2H54A 3ZDXB 1EE1A 2FVYA 4DE0A 2AFIE 3H9UA 4P53A 1K7XB 3UTCA 1MHTA 5NULA 2FFFB 1VGRA 3WS1A 3WIUA 1VP9A 3G9TA 4BGVA 2C3OA 1UJBA 1RI3A 1BT5A 3K6RA 1NBHA 1OTBA 4GQIA 1OI2A 2JASA 3QKRB 3V8RA 4O29A 1MBLA 1EUZA 2SBTA 4DLSA 4KN9S 3THYB 4JL5A 2GN2A 4D9CA 4MWGA 2VRNA 3N05A 2WU8A 4LRXA 2A6PA 3ZVLA 5D6NA 3TFWA 5KJEA 4OJTA 3CF0A 2R00C 5K3OA 1KEUA 4QWWA 2P78A 4TV9A 1F2TA 4P6BA 4LNUA 4QDJA 1SXJD 2IDZA 2PX6A 3ZZUA 2NUTB 3GP8A 4M49A 2VGLS 1TTTA 2QT9A 4B4XA 3NHYA 2XB6A 3MS4A 4R3WA 1KVRA 3D1LA 3KR9A 3MJRA 2W11A 2JIOA 2BKEA 3QG1A 1OZAA 1JBQA 3MCAA 4OHPA 3AHEA 2H7VA 2L42A 2QAIA 2EG5A 1V5WA 2Q29A 4OM8A 3EIHA 1X92A 1N33B 3E6AA 2XYRA 1AG9A 3IVCA 4DB4A 4AZTA 4PRZA 2RI0A 2AEJA 4D4MA 2IYUA 2O2CA 4UJ3A 4PC6A 1OFGA 1Q11A 3HLCA 3ANSA 2ZJ3A 3O6VA 3W05A 1URPA 2NGRA 5DNUA 5U4QA 1O8CA 4RABA 4AJLA 4I46A 1PYYA 2WAAA 4R31A 1EDBA 3TOXA 4MEJA 4NCXA 4YR9A 3CPJB 2YVKA 1OUMA 1QWSA 3P9IA 2VGLM 5CK4A 4NK3A 3MSHA 1XXHA 2FHSA 4Y15A 3AFGA 1AC5A 3OBIA 3V46A 3GVPA 1A9XB 5JAOA 1QHYA 1U0HC 3CINA 3ZE7A 4FMDF 1WUYA 3W4PA 2WDZA 3EZNA 1KO4A 4IJKA 1KKMA 5BYJA 2V3CC 2Q3HA 1JNUA 5JPIA 2NG1A 3D4OA 4WLEA 4AW9A 2JFHA 2AMJA 5P21A 4LWZA 3OKFA 1SKUA 4FYMA 5AK6A 3PV0A 1XCJA 3D8SA 4A8JB 2DULA 3KTDA 1XEWY 1ZIOA 4RZSA 4JUBA 3Q9SA 3G5AA 3TJMA 3WKDA 3VDXA 2GXAA 2P2NA 4OL0A 3GA5A 1G19A 4EGSA 5HMMA 3WYDA 3R9XB 2DLNA 2MTBA 5EJ6A 4K03A 3O91A 5GLCA 3QOFA 5EKTA 4HEJA 1LSJA 5DCYA 3STYA 2XSSA 4A2PA 4M1ZA 5CLGA 4INZA 3PEWA 1W7FA 1Y5NA 4LCEA 4WI1A 2O5VA 4NMMA 4CEIA 5CEFA 2HF8A 4G81A 4LRUA 1IOZA 3DXZA 2TYSB 4F5YA 1ZU5A 2EZ9A 3BXPA 3IEVA 1G3IA 1CHDA 2AFIB 2QTAA 1OWPA 1V47A 4KG2A 3MEQA 5EE8A 1QBKC 4TRMA 4D9NA 1NBEA 1PT6A 4MGIR 2XSZA 3K0AA 3C2WA 2EYUA 1LJ8A 3ZE0B 5DVAA 2VSQA 1TJ5A 2Y1XA 2Y2PA 2DR0A 1XJ2A 5J9FA 5M5BA 3N8KA 3GEPA 3RUEA 1XFNA 4I9FA 3BZWA 4G1UC 1U65A 2Y0DA 4KO3S 3TZHA 1WDTA 5F5XA 1JDPA 1YT4A 2EEZA 4EJSA 3WNDA 2X23A 2EG9A 4QELA 2C2OA 4G5OA 3L0PA 4JLDA 1JHUA 5H59A 3T7AA 5FP0A 4O4IF 1U4NA 3WIBA 2BFFB 3UPPA 3V55A 1I4WA 3DOJA 1Z22A 3O88A 1D1JA 3ZWOA 2Y2JA 4ZT6A 1EWRA 1A7AA 3HWX1 2XDAA 3OG9A 2ZJ6A 3BEBA 4KXWA 3QXSA 2QOEA 1R8XA 3QE0A 5IMSA 4GW9A 2GA8A 5E3JA 3KDPA 3IPXA 3I2HA 2NO4A 5DCUA 4XIGS 3FZQA 5HAQA 3KLBA 3K9WA 5HIMA 3ZX5A 1KF0A 4PG5A 5KVVA 4HJXA 3E9ZA 3QYPA 3CE9A 4XDZA 5IWAB 1AXEA 1XSEA 3WKAA 3P0RA 1K1EA 5K6TA 1L4LA 1Y8QB 4EBNA 2VAXA 2FUNB 3DWGA 2WFLA 4X85A 3T0FA 4FDTA 2JFPA 4M0UA 5BN3B 5KMGA 3M89A 1ZA1A 1ZBDA 3DTMA 1J9MA 3GNLA 1Z5UA 3DEHA 4ETNA 4J7CA 1JEAA 5DWQA 3WGLA 1RPNA 2Y1CA 2G9UA 4M83A 3TW4A 4M4SA 4DJJA 1Y7LA 4DHWA 1XZAA 3HDVA 4H8RA 1DKNA 5IEBA 3A1UA 4MR7A 1QH0A 2TS1A 3TGWA 1YZQA 2YJ3A 4IQ4A 5B3KA 5IF3A 1BQEA 1N1EA 1ZMXA 3GGSA 4ZI5A 1ZKMA 2PWYA 2F1HA 3TIXB 2IC5A 5CHEA 3M9WA 3I6QA 2VLIA 3BA6A 3O90A 2DQ4A 3D3NA 4QPNA 4C7BA 4GF5A 1LF5A 4MYCA 1JEOA 2I5PO 5JU6A 2PBLA 3Q6NA 2KLBA 2B6HA 1KYXA 1QTQA 5KNBA 2FWPA 3VAAA 4E94A 5CBPA 3VOSA 4RTKA 3LYHA 4GNKA 2QYBA 3X2EA 1Z7EA 1D06A 3C3PA 1YS4A 4CLOB 3B48A 2RFLA 3DZCA 3DZBA 2BFCA 3HQ4O 1XXLA 2PMBA 2A88A 3TM5A 5EFWA 3VH3A 1EB8A 1YR3A 3HM2A 5KYKA 4GZ6A 1V39A 3HNOA 2WVGA 1NKSA 4XM1A 3ZU5A 3N74A 4LRZE 5EG5A 4IQFA 2C29D 1SU8A 3IAS6 4YCMA 3IWIA 2FPXA 5BVGB 3HHPA 4BLQA 3ZOZA 1L2SA 1WIWA 2WAXA 3WL3A 1EUCA 1USUA 2HA0A 5DE3A 3EQ8A 3N5KA 2IBSA 4G67A 4JX8A 1G4UR 4XWGA 1PI4A 2VZ0A 3P8ZA 4QJBA 4M7RA 4DDSA 1HZZC 1IHUA 4YP7A 3C6XA 2PUVA 4CLEA 1T1EA 3L1UA 4Y3UA 3VR5D 1KVUA 2XEDA 2HAEA 2RGDA 4LPZA 1YC2A 4OYLA 4TL9A 4S04A 1B23P 2F3SA 2IZZA 5A5DA 3QKTA 3LR5A 1PBTA 1QYVA 3I09A 5DHFA 3LQ2A 3H86A 3LBNA 4R0QA 4BJ5A 2Z2ZA 3HN2A 4BQSA 4X93A 4BWFB 2JC3A 1I94B 3JVVA 1ZAKA 1XGKA 2DGDA 2AW3A