3F1OA

Crystal structure of the high affinity heterodimer of hif2 alpha and arnt c-terminal pas domains, with an internally-bound artificial ligand
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
114
structure length
109
Chain Sequence
FKGLDSKTFLSEHSMDMKFTYCDDRITELIGYHPEELLGRSAYEFYHALDSENMTKSHQNLCTKGQVVSGQYRMLAKHGGYVWLETQGTVIYNPQCIMCVNYVLSEIEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Endothelial PAS domain-containing protein 1
publication title Artificial ligand binding within the HIF2alpha PAS-B domain of the HIF2 transcription factor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 30
structure length 109
sequence length 114
ec nomenclature
pdb deposition date 2008-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08447 PAS_3 PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3f1oA00
2Z6CA 2J80A 1VB6A 3A0SA 3UB7A 4BBUA 1XFNA 2K7SA 4KUOA 3ICYA 1TS8A 5A8BA 4I3AA 4JGOA 2V9AA 3K3CA 4HJ4A 3FC7A 4NXFA 4PKYG 4EESA 2ZBBA 1MZUA 2OWJA 4WF0A 3LUQA 4LRZE 5DKLA 3B33A 4HNBA 1OTIA 1S66L 2V0UA 2WKRA 4XT2A 1GSVA 4HH2A 1DP9A 5I5LA 4GS9A 4I3JA 1V9ZA 1S1YA 3E4QA 3F1NA 2ZOHA 4B9OA 3LI9A 2INWA 4EXOA 4NXEA 3KX0X 3UMEA 4M4XA 3H7WA 3EEHA 3LYXA 4R70A 4LRXC 3RTYA 4PKYA 3MQQA 5AVEA 4H6JA 4EERA 1S4SA 2L4RA 3IS2B 5F69A 4E04A 3UMDA 4DJ3A 4R38A 4HQAA 4NXGA 2L1MA 1LL8A 3PYPA 5DJTA 1T1CA 2PDRA 1V9YA 2R78A 3HJKA 4LPZA 3GECA 3T50A 3UB8A 2PR5A 1UGUA 1S4RA 1OT6A 4EEPA 2QKPA 4L9EA 5F5YA 2L0WA 1OTEA 4F3LB 4KQDA 3LI8A 1DRMA 3H7WB 1KOUA 2PYRA 1LSXA 1T19A 4H6JB 1BYWA 4JGQA 1LSVA 1N9OA 1XFQA 4LRYC 3PHYA 1OJ5A 5HDCA 3GDIA 3UB6A 3BY8A 3IBRA 5HD3A 4EETB 1D7EA 2GJ3A 1TS0A 1NWZA 3A0VA 1S1ZA 1P97A 1ODVA 4KUKA 2JN7A 2VLGA 3CLOA 4I3IA 2BASA 3NOTC 2D02A 5G4ZA 3FG8A 3C2WA 3IS2A 4HOIA 4R3AA 4HJ3A 1DP6A 3A0RA 4RQ9A 3OLOA 3F1OA 2Z6DA 3VE3A 4BBTA 4L9FA 3LIBA 4EW7A 4F3LA 5J7EA 4HH3A 4HI4A 4NXBA 3P7NA 2PHYA 1EW0A 3RH8B 1TS7A 2VV6A 5HD5A 3F1PA 5G4YA 3MFXA 1WA9A 3VOLA 5J4EA 2CMNA 1XJ6A 1JNUA 3BWLA 2ZOIA 1N9NA 5HSQA 2YKHA 3VE4A 3MR0A 4HP9A 2VV7A 5HWWA 4WLAA 3G6OA 4LLOB 2YKFA 4GCZA 3F1OB 1F98A 4JGPA 5HZHA 4BBVA 2OWHA 2OOLA 4K08A 4WL9A 2QWSA 4WUJA 3UE6A 1OJGA 1T1AA 5EFWA 2QHKA 3F1PB 5F68A 2PD7A 1GSWA 2QJ5A 1OTBA 1DP8A 3NJAA 2WKQA 1T18A 3EWKA 1XJ4A 5IS1A 3SW1A 3HJIA 1OT9A 2HV1A 2V0WA 5TBMA 5J3WA 2PR6A 3E4OA 3BY9A 2P7JA 3ZQ5A 2D01A 3MXQA 5AVFA 1P0ZA 4R6LA 4I38A 5HWTA 4HJ6A 2WKPA 4MN5A 3H82A 3ULFA 3E4PA 3MJQA 4EEUA 1D06A 3LIDA 1F9IA 2V1AA 2H28A 1T1BA 5TBMB 4GHIA 4L9GA 3NOUC 1Y28A 4YWZA 2JHEA 3LIFA 2VV8A 2V1BA 1GSXA 4I5SA 2I9VA 4HHDA 2PD8A 1N9LA 1TS6A 1G28A 3CAXA 1LT0A 2PYPA 2VEAA 4GW9A 1XJ2A 2QJ7A 3LIAA 4HIAA 1LSWA 2A24A 3H82B 1S67L 4JGRA 2M1CA 3C8CA 1XJ3A 3NOPC 4GHIB 4HP4A 1X0OA 2KDKA 2B02A 5IU1A 4MN6A 2EA9A 2KX6A 4XT2B 3MQOA 4EQ1A 5HWVA 4DJ2A 1OTAA 4GS9B 5DJUA 5HDSA 2W27A 3F1NB 2A24B 3D72A 5KIZA 4WN5A 3LIEA 4I39A 5DKKA 3LICA 3K3DA 1UWPX 3H9WA 5F6AA 4HY8A 5HDDA 1OTDA 3CWFA 3NHQA 3UB9A 1UWNX 2W0NA
chains in the Genus database with same CATH superfamily
2Z6CA 3IF6B 3ZYTA 4KENB 2XFSA 1N4OA 2ZC3B 5DVAA 2ZL1B 1KGGA 1FSYA 4WBGA 4GN2A 3DBAA 4KUOA 2V9AA 2QYBA 4DMZA 3FC7A 1ZC2A 1VETB 1Q2PA 1LL9A 2ZBBA 2OWJA 3S7NA 3LUQA 5CTNA 1DJBA 5U47A 3QNCA 3W4QA 4OONA 1OTIA 1RGZA 2IA2A 4R3JA 4GD8A 2ZD8A 5CGWA 1DP9A 2HZ5A 2HPBA 4IVKA 1AWIA 4X68A 2XH9A 1V9ZA 3T4JA 3C7VA 3A3JA 2HDUA 3PAEA 2ZOHA 4B9OA 3UE1A 2Y8HA 3IXBA 3DW0A 2C6WB 2Q9NA 3NI9A 2Y59A 2VZWA 2ZQ7A 2XRNA 2WGWA 3EEHA 3IX4A 1XA1A 4LRXC 1YM1A 5AVEA 3OZHA 4UQIS 1IEMA 4PHTA 2ZM8A 4PMAA 1CJFA 3IF6A 4XUXA 3FPWA 2WGVA 2O9AA 4IHQA 5FAQA 4CLCC 3MXRA 2L1MA 1LL8A 2XEPA 4IBRA 3V67A 3KYZA 4HBUA 3T50A 3CMZA 3GECA 3OBFA 2VJWA 1ZTUA 1S4RA 3ZHHA 4KZ9A 2W3HA 4KQDA 4QY5A 3ZVTA 4S2OA 2ZQAA 4KG6A 2HJ9C 3W4OA 3BFCA 3ISGA 2XD5A 5L09A 4CQHA 2XA7M 3DWKA 3TSGA 1HLUP 3ZG0A 3OCNA 1T19A 3SS4A 1G68A 4FH2A 1IYOA 3OPHA 2W3GA 4LRYC 3C38A 3CPTB 3ZNYA 3VOZA 4KZ7A 1YLWA 4QPRA 1VEUB 2HJEA 4P87A 4B4XA 5EVIC 2J3WA 3QHYA 1NJ4A 1J9MA 4IVIA 4KUKA 3LEZA 2FZ0A 2BASA 3NOTC 5CGSA 3C2WA 3M2KA 3G31A 2UV0E 5EOOA 3A0RA 4BQMA 2A3UA 1NYYA 3W8KA 4E3IA 1W79A 3OLOA 3UDIA 4HESA 4EW7A 1SCWA 1W7FA 3DAVA 4HI4A 4NXBA 2ZM0A 4O0PA 1TS7A 5HD5A 2M7VA 4DE1A 1NRFA 4KZ6A 5AQ7A 2PRFA 4DE2A 2ZMVA 2UWXA 1JNUA 1YLZA 3EOIA 3CUEC 1N9NA 5HL6A 3GVBA 1YMSA 1JTDA 1W63M 3M6HA 4HP9A 3CPTA 1FIKA 5FQQA 3DWZA 5M1AA 2EX9A 2WK0A 3D9YA 4LV0A 2ZM2A 3F1OB 3N8RA 1K57A 1YLJA 5HZHA 2OOLA 3OPPA 1OJGA 4Q0JA 1T1AA 1HZOA 2J3TC 2QHKA 5AQ9A 2EX2A 3FPVA 2WZXA 4QB8A 5F68A 2FH5A 3BQ8A 2QJ5A 5EM1A 4EWFA 4Y0TA 4Q0HA 2W3EA 3N6IA 3M6BA 4WYYA 3ZNTA 4IUKA 4Q0IA 4Y5FA 2HV1A 2V0WA 3LR3A 2WAEA 1CK3A 1MWRA 4Y0OA 2Y2LA 2Y2KA 2P7JA 3PBOA 3WS1A 4ME4A 3MS6A 2PT7A 2XSSA 4FUWA 1KVLA 3E2KA 3C4OA 3T4SA 1S6RA 1RGYA 1GHIA 1VHMA 1XA7A 4OP5A 1K56A 2PU4A 1CI8A 1YT4A 4DN0A 1D06A 3PBNA 5L10A 1PZOA 2O9BA 5TBMB 1H3QA 5FQ9A 3HLWA 2JHEA 2ZC6B 4EV4A 2Y2JA 2V1BA 3HLFA 1ALQA 3UPOA 4L0LA 2ZMFA 2PD8A 3QP1A 5D3OA 5DF8A 5IHVA 4C6YA 3PBTA 1TEMA 3IXHA 2WGIA 1IELA 2J9PA 1FOFA 3VFFA 3O88A 1ESIA 2WKHA 2E8JA 2O99A 3VOYA 1S67L 2HDQA 4BWIA 5CHMA 5FL3A 1NRJA 4RYEA 5FI7A 1CEGA 4OPRA 3VSLA 3BFDA 2EXBA 3IWQA 4ARZB 4HBTA 3ITAA 4EQ1A 4DJ2A 1TF1A 5DTTA 4DXCA 1XX2A 4KQQA 5A93A 5CHJA 4E3OA 3BRMA 5M19A 5EPHA 2Q9MA 4U0XA 4WN5A 1ES2A 5FI2A 2XLNA 1GHMA 3P98A 1JWVA 2B95A 2C5WB 4YNRA 2B18A 1MXOA 1JWPA 3CWFA 3NHQA 1N9BA 3FZCA 4Y17A 3WS2A 3E98A 2J80A 3G35A 2ZMAA 5HL1A 3LY3A 4WZ5C 1VB6A 2PAVP 4JXSA 4ETZA 4E3KA 4G3WA 1ACFA 3UB7A 1CEFA 2Y2GA 1K38A 3T1SA 2GZAA 2Y91A 1K55C 1FCMA 4DXBA 4M3KA 1MWSA 4FTXA 4CLCD 5TFQA 5DKLA 4ZDXA 3EGXC 5FI6A 3IX8A 1BZAA 1MKMA 3KYEA 2DMWA 1YKDA 1SDEA 3MQ0A 1F5MA 1FR6A 4OOMA 2WUQA 4JF5A 3QP2A 2IWBA 1GSVA 5CECA 5FSRA 4DKIA 3PXPA 3E0YA 2XQZA 3LI9A 3LR4A 2INWA 1Y4OA 4EXOA 4NXEA 3KX0X 5F82A 3FYZA 3UMEA 3H7WA 3LYXA 3FWLA 3RTYA 4IEDA 3MQQA 4BJPA 2L4RA 5EVID 5F69A 4E04A 5GLDA 1ZKJA 4HQAA 3B3XA 3ZG7B 3IF6C 4NXGA 4KZBA 1T1CA 2PDRA 2Y2IA 4OQIA 2DNSA 3Q82A 4LV1A 4OP8A 5F83A 5F5YA 3PBSA 1OTEA 5HAIA 5CXWA 3QP6A 4RX2A 4KG5A 4ZJ2A 1XGJA 1DRMA 5EM0A 2Y55A 1D1JA 2FFYA 3IHBA 4RA7A 1GCEA 2MJ6A 2PYRA 4E3NA 1EWZA 2X71A 4JGQA 3PAGA 1N9OA 4EUZA 5F1GA 3PHYA 2G2UA 1OJ5A 3PBQA 1W8YA 1KGFA 5HD3A 1K54C 3GTCA 2QZ6A 5E2EA 3JYIA 1D7EA 1I2WA 3HREA 1BT5A 3CITA 4RX3A 1IKIA 4LCLA 3A0VA 3S7PA 1P97A 5HX9A 5KSCA 4D2OA 1L0FA 2WAFA 4I3IA 1IFQA 2D02A 3GV9A 3FG8A 1G6OA 2H5SA 3LO7A 4B93A 3C4PA 1SKOB 2EX6A 1E3UD 5FQMA 2B5RA 4BBTA 4L9FA 1KVMA 2ZC5B 4UEYA 3P7NA 3ZGAB 1EW0A 4PM9A 5C5KA 2JKRM 4C3QA 1WA9A 4R1GA 4N1XA 5J8XA 3HUNA 2OSUA 1OMEA 3V3SA 3HLGA 4PAUA 3NECA 2V2FF 3BYDA 3VP4A 2JKRI 4XXRA 5AQBA 3MZEA 1ONHA 2YKHA 4OLDA 4Q8IA 3MR0A 5E2FA 2VV7A 4WLAA 3G6OA 4D60A 3Q1FA 3ZG8B 4LLOB 2YKFA 4KZ4A 4GCZA 3T1QB 2K31A 1F98A 2WADA 4PPRA 4B4ZA 2ZQCA 1YLTA 3IWIA 4WUJA 3BQAA 1E25A 2NUTC 1Y54A 3IH8A 5EFWA 4E6XA 3Q81A 4JXWA 2PD7A 4BLMA 3SOIA 3KYQA 1DP8A 1HTZA 5CRFA 2WKQA 3EGDC 1T18A 3IQAA 4LV3A 1TDLA 3HJIA 1OT9A 4MLLA 1SKOA 4QWOA 4OLGA 4DF6A 1YAXA 4Y13A 1FSWA 5GL9A 3E4OA 3LR5A 3BY9A 3ZQ5A 4XUZA 2D01A 4P6ZS 4X1LA 1CQAA 4CLCB 4S2LA 4GZBA 5AVFA 3PR6A 4R6LA 1A0KA 5CX7A 5HWTA 3P09A 1W63Q 1MC0A 1SKFA 4HJ6A 4N9KA 4II7A 4CJNA 1FR1A 2ZQDA 4MN5A 3KO6A 2XD1A 2HP9A 2Y2PA 4GLQA 1S0WA 2DRWA 2ZC7A 4OPZA 3SH7A 4WEKA 3LIDA 5EOEA 3WWXA 1ES3A 4MDZA 1LHYA 2V1AA 4KZAA 5FA7A 4ZRRA 1T1BA 2XFTA 1DJCA 1OPXA 2V8CA 4LV2A 4GHIA 3MFDA 1Y28A 2JKTM 3AGEA 3BFFA 4YINA 1M6KA 1GSXA 3QP5A 3I7JA 3NDGA 3CAXA 1LT0A 2JKTI 4WZ4A 2QJ7A 2V20A 4P85A 5EVIB 4KZ8A 3LIAA 4EBLA 4GDBA 5A92A 1LSWA 2IWDA 2G7UA 4GNUA 1NLYA 5CERA 1H8YA 3C8CA 5DTSA 4YOFA 5EE8A 4K0XA 3RXXA 5EVLA 4Y3IA 1XPBA 1L0GA 2VGLM 4Y15A 3PBRA 3U2AA 4OOLA 1X0OA 4CLCA 2KDKA 4MBFA 1LI9A 4KQRA 3BFGA 5IU1A 5I94A 2EA9A 3MQOA 3EQUA 3O5YA 5HWVA 3CJMA 2KLIA 1Z6FA 3VP0A 3FKVA 2W1RA 3OPRA 2W27A 3F1NB 5HPFA 5G18A 2JCHA 4I39A 5DKKA 1PW8A 5GHYA 5F6AA 4IBXA 4RVAA 2EX8A 2ZC4B 3L7HA 1OTDA 4NKPA 3B42A 4F94A 1UWNX 2W0NA 1U60A 2KOIA 2RCXA 4NK3A 4FOFA 4S2NC 1H8MA 5EVIA 1I5QA 2W3FA 3Q07A 1XFNA 3JVVA 2R9WA 3ICYA 1PWDA 3HL9A 4U3TA 2Z2LB 3UE3A 3G34A 4JGOA 4N9LA 4JBFA 1GA9A 3MBZA 4PKYG 3OC2A 4FH4A 4EESA 4G3KA 4NETA 2P04A 1MZUA 2ZLYA 1YPRA 3C7UA 3N8LA 4LRZE 3B33A 4X25A 4HNBA 2I72A 1ZG4A 5CEBA 3O87A 2WKRA 4BENA 3PTEA 1I2SA 3HCYA 1PI5A 3WS5A 2HF6A 4HH2A 3T4LA 3A3DA 4I3JA 1S1YA 3BLSA 1H5XA 3F1NA 4JXGA 3LEQA 3HVFA 3W2ZA 4M4XA 1KE0A 3UPNA 1G6AA 5M18A 4R70A 1ERMA 4PKYA 3CUEA 4A5RA 2VA0A 2HDRA 2WKEA 4H6JA 5KZHA 4EERA 2EXAA 5HPIA 1TVFA 3UDXA 3VSKA 3O86A 3UMDA 2ZQ9A 4KQOA 4DJ3A 2XA7S 2QPNA 4LCMA 2VGJA 2LB5A 1PYYA 3IX3A 3PYPA 5DJTA 5GHZA 2R78A 4LPZA 4Y7PA 3UB8A 1FCNA 2PR5A 1UGUA 1OT6A 4EEPA 2QKPA 4L9EA 3TJZC 2GNXA 4GB7A 3LFVA 4F3LB 1E3UA 4O01A 3VP3A 4ZJ3A 3WRZA 4OH0A 2XK1A 3LI8A 3HBRA 4UQIM 3H7WB 5FDHA 3U4LP 2HGVA 1LL5A 1LSXA 4P0MA 2WZZA 2Z2MB 1BLCA 4ESPA 1LSVA 4EUVA 1VM1A 4ETXA 1BULA 5DTKA 1H0MA 5KMWA 5HDCA 3GDIA 3UB6A 2PBYA 3Q7VA 2W1TB 1YSPA 3ZCZA 5HW3A 3S22A 1ERQA 3KSHA 1KE4A 4KG2A 4ZJ1A 1NWZA 2FFFB 4R0QA 4MNRA 4E3MA 2JN7A 3FKWA 4K0WA 1O07A 4E3JA 3L9KA 5G4ZA 3DTKA 4AFIA 1NZOA 1HVBA 1IYPA 3LCEA 4HJ3A 4DDSA 3VV4A 1DP6A 4B88A 3TW8A 4K91A 3KSIA 2JC7A 4RQ9A 2H0YA 3IT9A 3M2JA 4FSFA 1CF0A 3VE3A 3G4PA 2XGNA 3B47A 1BLHA 4F3LA 4QY6A 2OLVA 4HH3A 1P9WA 2P08A 2PHYA 1MKIA 2EWVA 2VV6A 1CI9A 3F1PA 3CI6A 3GSGA 3TE8A 3R4KA 2EFXA 3VP2A 4G3VA 3RFBA 5FQIA 4OQHA 5EUAA 5HSQA 3NCKA 4X6TA 1BUEA 2Y4AA 3IBJA 4QD4A 1BTLA 2P9VA 3UPPA 2V8FA 2GX5A 3CG5A 3MZFA 3TRCA 2W1TA 3UDFA 1MWUA 1NYMA 2PBDP 2JE5A 4BBVA 2OWHA 3OCLA 1DY6A 4UA9A 4K08A 2QWSA 3UE6A 3BFEA 5HARA 4O7DA 3V5MA 2A49A 1YMXA 4WMCA 3VMAA 1TD5A 1GSWA 2Y2MA 5CEDA 1PWGA 4EU0A 1QMEA 3C30A 1ESUA 1KGEA 4QJGA 4Y0UA 3NIAA 4UHUA 5J3WA 4DE0A 4JPMA 3ZFZA 4PM6A 2PU2A 4MCWA 1FQGA 2V1ZA 3LY4A 3MXQA 3AGFA 1LLBA 4WZ5A 3T4TA 1PW1A 1KDWA 3G30A 4I38A 5IT5A 1K55A 4N1HA 1YQSA 3H82A 2CC1A 3ULFA 2O9CA 3E4PA 4R3BA 4HEFA 3UY6A 1F9IA 2H10A 2H28A 3QP8A 2J3TD 4OQGA 4JF6A 3NOUC 4X1MA 1PIOA 3HLEA 2I9VA 5E2GA 4HHDA 4E3LA 1N9LA 1TDGA 1TS6A 4X69A 1G28A 1PRQA 1L0EA 2W3DA 5E2HA 2VEAA 2J8YA 5MC7A 5FASA 3G32A 1NZUA 2JBFA 4S2IA 4EBPA 2A24A 1AXBA 3S1YA 5EV0A 2M7UA 5FAOA 1ES4A 3EEAA 2EWWA 2Y2OA 3A3EA 3N4IA 4JF4A 1K6RA 2Y2NA 2AVXA 4MMNA 1EI5A 3NOPC 4QU3A 3SZTA 4GHIB 5FAPA 1L3LA 3R7WB 3MXSA 1WYBA 3Q7ZA 2RL3A 2B02A 2ZJ9A 1FILA 4R4RA 1K57C 4PM8A 2KX6A 4JLFA 2ZL1A 4XT2B 4R23A 4JXVA 1YLYA 4WEJA 4Z1WA 1C3BA 1OTAA 1ES5A 3NULA 5FDSA 4GS9B 4EQIA 3D3OA 4GD6A 5HDSA 3VFHA 4P6BA 3CHWP 3D72A 4BMWA 2JKGA 3T4QA 1VETA 3LIEA 2BG1A 4HY8A 5HDDA 4N92A 2ZQ8A 1E4DA 4KZ3A 3GQZA 4CLCE 4X56A 2Y2HA 4ZBEA 3NBLA 2LB9A 4MN7A 1K54A 3IF5A 4GOGA 3A0SA 1XXMA 5DFXA 4Y2FA 4BBUA 5A90A 2K7SA 5AJGA 3LR0A 3WRTA 4MBKA 1JVJA 1TS8A 5FEFA 5A8BA 4I3AA 3K3CA 4HJ4A 4NXFA 3C5AA 5L07A 3SS5A 3BM6A 4WF0A 5GHXA 1PNEA 3G2YA 3R7WA 5L8MA 2EFUA 4WMCD 4IUHA 5TJJA 3HUMA 1S66L 1GA0A 2V0UA 3GMWA 5JYPA 4XT2A 4S2KA 4NEED 3RJUA 3QP4A 4OVDA 1J3WA 3EQVA 1BSGA 3P01A 5LBRA 5I5LA 1BLSA 4GS9A 4LGWA 3S7QA 3E4QA 1XGIA 5CHUA 1SHVA 4X55A 2HP5A 1F2KA 3MSHA 1DJAA 1NLZA 3O3VA 3OPLA 5BOHA 4S2JA 1L0DA 2OAP1 1XP4A 4BD0A 3SH8A 3NY4A 1IYQA 4H8RA 2VKSA 1NY0A 3UE0A 1S4SA 1K4EA 4BD1A 4E6WA 3IS2B 3TG9A 5HFOA 4DRTA 4UAAA 4WELA 4R38A 3A3IA 3T12B 3GRJA 3N7WA 1WE4A 5CTMA 1VEUA 1V9YA 3HJKA 5CGXA 3IWOA 1YLPA 2Y2QA 3MMHA 4EBNA 4WM9A 1BLPA 2L0WA 2GDNA 3T4KA 2XROA 4FD8A 3BLMA 4CPKA 3BECA 1PI4A 2OLUA 5GLCA 4BL2A 3HLDA 5GLAA 2JKFA 3MZDA 3DTIA 1MBLA 2XF3A 1MY8A 5FQJA 2A2LA 4DDYA 3LGOA 1KOUA 2G2WA 2O0YA 1VQQA 5EVEA 4H6JB 1BYWA 3S4XA 1RP5A 3RXWA 3BW6A 3T1RA 3QNBA 1XFQA 4S2PA 5FEGA 3UN7A 2Q0OA 1QMFA 5F1FA 3BY8A 3IBRA 4EETB 1G5UA 2GJ3A 4LENA 1TS0A 1JTGA 3HLCA 1S1ZA 2HP6A 2XR0A 1ODVA 4ID4A 1STZA 1LI0A 1PWCA 3NDEA 5DF7A 2VLGA 3CLOA 2OV5A 2J7VA 4X53A 3E2LA 4OPQA 3W4PA 3IXGA 3IS2A 4HOIA 3S7OA 4R3AA 2Y79A 3A3FA 1M40A 1Q2QA 1W5DA 3T4OA 3KSFA 4YFMA 1MPLA 5DFYA 3F1OA 2Z6DA 3Q7VB 3CZDA 3OOVA 2ACGA 3LIBA 4BL3A 4ZTKA 5JYOA 5J7EA 2NUPC 3V39A 1SZVA 3RH8B 5G4YA 2OAQ1 3MFXA 4LFUA 4PM5A 1SDNA 3VOLA 4FCFA 1NXYA 1KDSA 4GKUA 2XDMA 5J4EA 2CMNA 4MEZA 1XJ6A 4NG2A 3BWLA 2HDSA 2ZOIA 1EROA 5AQAA 3VE4A 3BJNA 5L2FA 3ZG9B 5HWWA 1K4FA 4KZ5A 1O7EA 1ZHHB 4S2MA 3N8SA 4IJGA 1XKZA 4JGPA 2DCFA 1WYCA 3ZVWA 4WL9A 4ZAMA 5TGFA 3F1PB 1IKGA 2BLSA 1PZPA 1OTBA 2WYXA 3V3RA 3NJAA 4OPYA 3EWKA 1XJ4A 3ZG5A 5FQKA 2H0TA 5IS1A 3SW1A 5DF9A 3NC8A 5TBMA 3IH9A 2PR6A 3WS4A 2VX8A 3UB5P 2P9VB 4OOYA 3MF0A 5A91A 4O8GA 3AGDA 2WKIA 3K2NA 4PM7A 1ZG6A 1L2SA 4OKPA 4S2NA 4UA7A 4UA6A 1P0ZA 4GDNA 4GJ4A 2WKPA 4QHCA 2QMIA 3GR2A 3D4FA 1W8QA 2BTFP 3SH9A 1K0KA 1PFLA 3MJQA 4EEUA 3FV7A 1GHPA 5GLBA 3MKFA 5KSHA 5FATA 4P6ZM 1MWTA 3IXDA 4Z9QA 4L9GA 4YWZA 4MBHA 1RCJA 3LIFA 2VV8A 3WS0A 3KSGA 4I5SA 2X01A 4ARZA 2VGLS 4OQ0A 2PYPA 3TOIA 1JWZA 3UO9A 4GW9A 1XJ2A 4HIAA 3H82B 1K6SA 2R9XA 2VK3A 4JGRA 2M1CA 3HUOA 3BEBA 1H8ZA 3JPUA 1XJ3A 4C75A 1P9RA 3VP1A 2IWCA 4U0TA 5EECA 5E43A 4HP4A 3V50A 1HD8A 5HAPA 1K56D 4MN6A 5TR7A 1Z09A 1IYSA 2VGKA 3SS3A 3G2ZA 2E8IA 2J9OA 4JKTA 5DJUA 5K5BA 2A24B 1FCOA 1YSQA 5KIZA 3T1XA 3ZDJA 3LICA 3K3DA 1UWPX 3MKEA 2K2NA 3H9WA 1K25A 3DTEA 2X02A 2WGWB 3IHAA 3JVUA 1ONGA 3HLBA 1IOUA 2P74A 3DTMA 3ITBA 5HAQA 1KE3A 4R4SA 3UB9A 4DE3A 3UNWA
chains in the Genus database with same CATH topology
2Z6CA 2J80A 3E98A 2KOIA 3ZYTA 2LB9A 4FOFA 4MN7A 1VB6A 4ETZA 3A0SA 1H8MA 4G3WA 3UB7A 5DFXA 4Y2FA 2W3FA 4BBUA 1XFNA 3DBAA 2GZAA 3JVVA 2K7SA 5AJGA 4KUOA 3ICYA 3LR0A 1TS8A 5A8BA 4I3AA 3UE3A 4JGOA 2V9AA 2QYBA 3K3CA 4DMZA 4HJ4A 3FC7A 4NXFA 4PKYG 3OC2A 4EESA 4G3KA 2ZBBA 4CLCD 2P04A 1MZUA 2OWJA 3S7NA 4WF0A 3LUQA 4LRZE 5DKLA 3EGXC 3R7WA 5L8MA 3B33A 4HNBA 1MKMA 4IUHA 5TJJA 1OTIA 2DMWA 2IA2A 1S66L 2V0UA 1YKDA 2WKRA 3MQ0A 4XT2A 1F5MA 4NEED 3HCYA 4OOMA 1GSVA 2HF6A 4HH2A 1DP9A 3EQVA 3P01A 5LBRA 5I5LA 3T4LA 4GS9A 4I3JA 1V9ZA 3T4JA 1S1YA 3S7QA 3E4QA 3PXPA 3F1NA 3E0YA 2ZOHA 4B9OA 2Y8HA 3LI9A 3LR4A 2INWA 4EXOA 4NXEA 3KX0X 3W2ZA 3UMEA 4M4XA 1NLZA 2VZWA 2XRNA 3H7WA 3EEHA 3LYXA 4R70A 2OAP1 4LRXC 3RTYA 4PKYA 3CUEA 2VA0A 3MQQA 5AVEA 4H6JA 4BJPA 2VKSA 4EERA 4UQIS 1S4SA 5HPIA 2L4RA 4PHTA 3IS2B 5F69A 4E04A 3UMDA 4KQOA 4DJ3A 3FPWA 4WELA 4R38A 2O9AA 2XA7S 4HQAA 4IHQA 4CLCC 2LB5A 4NXGA 2L1MA 1LL8A 3PYPA 5DJTA 3V67A 1T1CA 3KYZA 2PDRA 1V9YA 2R78A 3HJKA 4LPZA 3GECA 3T50A 3UB8A 3OBFA 2VJWA 2PR5A 1ZTUA 1UGUA 1S4RA 1OT6A 3MMHA 4EEPA 2QKPA 4L9EA 3PBSA 5F5YA 2L0WA 3T4KA 3TJZC 2XROA 1OTEA 2GNXA 3LFVA 4F3LB 4O01A 2W3HA 4KQDA 3LI8A 1DRMA 4UQIM 2HJ9C 3H7WB 2A2LA 1KOUA 4CQHA 2MJ6A 2O0YA 2PYRA 2HGVA 2XA7M 3OCNA 1LSXA 1T19A 4H6JB 1BYWA 4JGQA 1LSVA 4EUVA 4ETXA 3BW6A 1N9OA 2W3GA 1XFQA 4LRYC 3PHYA 3C38A 1OJ5A 3PBQA 5HDCA 3GDIA 3UB6A 4QPRA 3BY8A 3IBRA 5HD3A 4EETB 2HJEA 2W1TB 1YSPA 1D7EA 2J3WA 3CITA 2GJ3A 3KSHA 1TS0A 1NWZA 3A0VA 1S1ZA 3S7PA 1P97A 1ODVA 1STZA 4KUKA 2JN7A 2VLGA 3CLOA 4I3IA 2FZ0A 2BASA 3NOTC 1IFQA 2D02A 5G4ZA 3FG8A 1G6OA 3C2WA 3IS2A 4HOIA 3S7OA 4R3AA 4AFIA 2Y79A 4B93A 4HJ3A 3VV4A 1DP6A 3TW8A 3A0RA 3KSIA 3T4OA 3KSFA 4RQ9A 3OLOA 4FSFA 5DFYA 3F1OA 2Z6DA 3VE3A 4BBTA 4L9FA 3OOVA 3LIBA 4EW7A 3B47A 4F3LA 4UEYA 5J7EA 4HH3A 4HI4A 4NXBA 1P9WA 2P08A 3P7NA 2PHYA 2NUPC 1EW0A 4O0PA 2EWVA 5C5KA 2VV6A 1TS7A 2JKRM 5HD5A 3RH8B 3F1PA 5G4YA 2OAQ1 3CI6A 3MFXA 2M7VA 1WA9A 3TE8A 3VOLA 3R4KA 5J4EA 2CMNA 4PAUA 1XJ6A 2ZMVA 4G3VA 3RFBA 1JNUA 3BWLA 3EOIA 3CUEC 2ZOIA 1N9NA 2JKRI 5HL6A 5HSQA 2YKHA 1W63M 3VE4A 3BJNA 3MR0A 3IBJA 4HP9A 2VV7A 5HWWA 4WLAA 3G6OA 2GX5A 4LLOB 1ZHHB 3TRCA 2YKFA 2W1TA 4GCZA 4IJGA 3F1OB 2K31A 1F98A 4JGPA 5HZHA 4BBVA 2OWHA 3OCLA 2OOLA 4K08A 4WL9A 2QWSA 4WUJA 3UE6A 3BQAA 2NUTC 1OJGA 4Q0JA 1T1AA 2J3TC 5EFWA 2QHKA 3F1PB 3FPVA 5F68A 2PD7A 1TD5A 2FH5A 1GSWA 3BQ8A 2QJ5A 1OTBA 3KYQA 1DP8A 3NJAA 2WKQA 3EGDC 1T18A 4Q0HA 4EU0A 3EWKA 1XJ4A 2W3EA 5IS1A 3SW1A 3C30A 3HJIA 1OT9A 4IUKA 4Q0IA 5DF9A 4Y5FA 2HV1A 2V0WA 3LR3A 5TBMA 1YAXA 5J3WA 2PR6A 2VX8A 3E4OA 3LR5A 3MF0A 3BY9A 4MCWA 2P7JA 3ZQ5A 3PBOA 2D01A 4P6ZS 4ME4A 3MXQA 2PT7A 4O8GA 3K2NA 3T4TA 4CLCB 2XSSA 5AVFA 1P0ZA 3PR6A 4R6LA 4I38A 3T4SA 4GJ4A 5CX7A 5HWTA 5IT5A 1W63Q 1MC0A 4HJ6A 4II7A 2WKPA 1VHMA 4MN5A 3KO6A 3H82A 3ULFA 4GLQA 2O9CA 3E4PA 3MJQA 4EEUA 4DN0A 1D06A 4WEKA 3LIDA 1F9IA 4MDZA 5KSHA 2V1AA 3PBNA 2H28A 4ZRRA 1T1BA 4P6ZM 1OPXA 2J3TD 2O9BA 5TBMB 4GHIA 4L9GA 1H3QA 3NOUC 1Y28A 4YWZA 2JHEA 3LIFA 2VV8A 2JKTM 3KSGA 2V1BA 1GSXA 4I5SA 4L0LA 2ZMFA 2I9VA 4HHDA 4ARZA 2PD8A 2VGLS 1N9LA 1TS6A 1G28A 3CAXA 1LT0A 2PYPA 2W3DA 2JKTI 2VEAA 3PBTA 4GW9A 1XJ2A 2QJ7A 5MC7A 3LIAA 4HIAA 1LSWA 2O99A 2G7UA 2A24A 3H82B 1NLYA 1S67L 2M7UA 4BWIA 3EEAA 2EWWA 4JGRA 2M1CA 3C8CA 5FL3A 1NRJA 1XJ3A 4MMNA 4YOFA 1P9RA 3NOPC 4GHIB 4Y3IA 2VGLM 3R7WB 3PBRA 3U2AA 4OOLA 4HP4A 1X0OA 4CLCA 2KDKA 2B02A 5IU1A 4MN6A 2EA9A 2KX6A 4ARZB 4XT2B 3MQOA 4EQ1A 3EQUA 3O5YA 4WEJA 5HWVA 4DJ2A 4Z1WA 1TF1A 1OTAA 2KLIA 4GS9B 3D3OA 5DJUA 5HDSA 5K5BA 2W1RA 2W27A 3F1NB 5HPFA 2A24B 3D72A 4BMWA 1YSQA 3T4QA 5KIZA 4WN5A 3LIEA 4I39A 5DKKA 3LICA 3K3DA 1UWPX 2K2NA 3H9WA 5F6AA 4HY8A 3JVUA 4YNRA 5HDDA 2B18A 1IOUA 1OTDA 4NKPA 3CWFA 3NHQA 3B42A 3UB9A 1UWNX 4CLCE 2W0NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z6C A;  2J80 A;  1VB6 A;  3A0S A;  3UB7 A;  4BBU A;  1XFN A;  2K7S A;  4KUO A;  3ICY A;  1TS8 A;  5A8B A;  4I3A A;  4JGO A;  2V9A A;  3K3C A;  4HJ4 A;  3FC7 A;  4NXF A;  4PKY G;  4EES A;  2ZBB A;  1MZU A;  2OWJ A;  4WF0 A;  3LUQ A;  4LRZ E;  5DKL A;  3B33 A;  4HNB A;  1OTI A;  1S66 L;  2V0U A;  2WKR A;  4XT2 A;  1GSV A;  4HH2 A;  1DP9 A;  5I5L A;  4GS9 A;  4I3J A;  1V9Z A;  1S1Y A;  3E4Q A;  3F1N A;  2ZOH A;  4B9O A;  3LI9 A;  2INW A;  4EXO A;  4NXE A;  3KX0 X;  3UME A;  4M4X A;  3H7W A;  3EEH A;  3LYX A;  4R70 A;  4LRX C;  3RTY A;  4PKY A;  3MQQ A;  5AVE A;  4H6J A;  4EER A;  1S4S A;  2L4R A;  3IS2 B;  5F69 A;  4E04 A;  3UMD A;  4DJ3 A;  4R38 A;  4HQA A;  4NXG A;  2L1M A;  1LL8 A;  3PYP A;  5DJT A;  1T1C A;  2PDR A;  1V9Y A;  2R78 A;  3HJK A;  4LPZ A;  3GEC A;  3T50 A;  3UB8 A;  2PR5 A;  1UGU A;  1S4R A;  1OT6 A;  4EEP A;  2QKP A;  4L9E A;  5F5Y A;  2L0W A;  1OTE A;  4F3L B;  4KQD A;  3LI8 A;  1DRM A;  3H7W B;  1KOU A;  2PYR A;  1LSX A;  1T19 A;  4H6J B;  1BYW A;  4JGQ A;  1LSV A;  1N9O A;  1XFQ A;  4LRY C;  3PHY A;  1OJ5 A;  5HDC A;  3GDI A;  3UB6 A;  3BY8 A;  3IBR A;  5HD3 A;  4EET B;  1D7E A;  2GJ3 A;  1TS0 A;  1NWZ A;  3A0V A;  1S1Z A;  1P97 A;  1ODV A;  4KUK A;  2JN7 A;  2VLG A;  3CLO A;  4I3I A;  2BAS A;  3NOT C;  2D02 A;  5G4Z A;  3FG8 A;  3C2W A;  3IS2 A;  4HOI A;  4R3A A;  4HJ3 A;  1DP6 A;  3A0R A;  4RQ9 A;  3OLO A;  3F1O A;  2Z6D A;  3VE3 A;  4BBT A;  4L9F A;  3LIB A;  4EW7 A;  4F3L A;  5J7E A;  4HH3 A;  4HI4 A;  4NXB A;  3P7N A;  2PHY A;  1EW0 A;  3RH8 B;  1TS7 A;  2VV6 A;  5HD5 A;  3F1P A;  5G4Y A;  3MFX A;  1WA9 A;  3VOL A;  5J4E A;  2CMN A;  1XJ6 A;  1JNU A;  3BWL A;  2ZOI A;  1N9N A;  5HSQ A;  2YKH A;  3VE4 A;  3MR0 A;  4HP9 A;  2VV7 A;  5HWW A;  4WLA A;  3G6O A;  4LLO B;  2YKF A;  4GCZ A;  3F1O B;  1F98 A;  4JGP A;  5HZH A;  4BBV A;  2OWH A;  2OOL A;  4K08 A;  4WL9 A;  2QWS A;  4WUJ A;  3UE6 A;  1OJG A;  1T1A A;  5EFW A;  2QHK A;  3F1P B;  5F68 A;  2PD7 A;  1GSW A;  2QJ5 A;  1OTB A;  1DP8 A;  3NJA A;  2WKQ A;  1T18 A;  3EWK A;  1XJ4 A;  5IS1 A;  3SW1 A;  3HJI A;  1OT9 A;  2HV1 A;  2V0W A;  5TBM A;  5J3W A;  2PR6 A;  3E4O A;  3BY9 A;  2P7J A;  3ZQ5 A;  2D01 A;  3MXQ A;  5AVF A;  1P0Z A;  4R6L A;  4I38 A;  5HWT A;  4HJ6 A;  2WKP A;  4MN5 A;  3H82 A;  3ULF A;  3E4P A;  3MJQ A;  4EEU A;  1D06 A;  3LID A;  1F9I A;  2V1A A;  2H28 A;  1T1B A;  5TBM B;  4GHI A;  4L9G A;  3NOU C;  1Y28 A;  4YWZ A;  2JHE A;  3LIF A;  2VV8 A;  2V1B A;  1GSX A;  4I5S A;  2I9V A;  4HHD A;  2PD8 A;  1N9L A;  1TS6 A;  1G28 A;  3CAX A;  1LT0 A;  2PYP A;  2VEA A;  4GW9 A;  1XJ2 A;  2QJ7 A;  3LIA A;  4HIA A;  1LSW A;  2A24 A;  3H82 B;  1S67 L;  4JGR A;  2M1C A;  3C8C A;  1XJ3 A;  3NOP C;  4GHI B;  4HP4 A;  1X0O A;  2KDK A;  2B02 A;  5IU1 A;  4MN6 A;  2EA9 A;  2KX6 A;  4XT2 B;  3MQO A;  4EQ1 A;  5HWV A;  4DJ2 A;  1OTA A;  4GS9 B;  5DJU A;  5HDS A;  2W27 A;  3F1N B;  2A24 B;  3D72 A;  5KIZ A;  4WN5 A;  3LIE A;  4I39 A;  5DKK A;  3LIC A;  3K3D A;  1UWP X;  3H9W A;  5F6A A;  4HY8 A;  5HDD A;  1OTD A;  3CWF A;  3NHQ A;  3UB9 A;  1UWN X;  2W0N A; 
#chains in the Genus database with same CATH topology
 2Z6C A;  3IF6 B;  3ZYT A;  4KEN B;  2XFS A;  1N4O A;  2ZC3 B;  5DVA A;  2ZL1 B;  1KGG A;  1FSY A;  4WBG A;  4GN2 A;  3DBA A;  4KUO A;  2V9A A;  2QYB A;  4DMZ A;  3FC7 A;  1ZC2 A;  1VET B;  1Q2P A;  1LL9 A;  2ZBB A;  2OWJ A;  3S7N A;  3LUQ A;  5CTN A;  1DJB A;  5U47 A;  3QNC A;  3W4Q A;  4OON A;  1OTI A;  1RGZ A;  2IA2 A;  4R3J A;  4GD8 A;  2ZD8 A;  5CGW A;  1DP9 A;  2HZ5 A;  2HPB A;  4IVK A;  1AWI A;  4X68 A;  2XH9 A;  1V9Z A;  3T4J A;  3C7V A;  3A3J A;  2HDU A;  3PAE A;  2ZOH A;  4B9O A;  3UE1 A;  2Y8H A;  3IXB A;  3DW0 A;  2C6W B;  2Q9N A;  3NI9 A;  2Y59 A;  2VZW A;  2ZQ7 A;  2XRN A;  2WGW A;  3EEH A;  3IX4 A;  1XA1 A;  4LRX C;  1YM1 A;  5AVE A;  3OZH A;  4UQI S;  1IEM A;  4PHT A;  2ZM8 A;  4PMA A;  1CJF A;  3IF6 A;  4XUX A;  3FPW A;  2WGV A;  2O9A A;  4IHQ A;  5FAQ A;  4CLC C;  3MXR A;  2L1M A;  1LL8 A;  2XEP A;  4IBR A;  3V67 A;  3KYZ A;  4HBU A;  3T50 A;  3CMZ A;  3GEC A;  3OBF A;  2VJW A;  1ZTU A;  1S4R A;  3ZHH A;  4KZ9 A;  2W3H A;  4KQD A;  4QY5 A;  3ZVT A;  4S2O A;  2ZQA A;  4KG6 A;  2HJ9 C;  3W4O A;  3BFC A;  3ISG A;  2XD5 A;  5L09 A;  4CQH A;  2XA7 M;  3DWK A;  3TSG A;  1HLU P;  3ZG0 A;  3OCN A;  1T19 A;  3SS4 A;  1G68 A;  4FH2 A;  1IYO A;  3OPH A;  2W3G A;  4LRY C;  3C38 A;  3CPT B;  3ZNY A;  3VOZ A;  4KZ7 A;  1YLW A;  4QPR A;  1VEU B;  2HJE A;  4P87 A;  4B4X A;  5EVI C;  2J3W A;  3QHY A;  1NJ4 A;  1J9M A;  4IVI A;  4KUK A;  3LEZ A;  2FZ0 A;  2BAS A;  3NOT C;  5CGS A;  3C2W A;  3M2K A;  3G31 A;  2UV0 E;  5EOO A;  3A0R A;  4BQM A;  2A3U A;  1NYY A;  3W8K A;  4E3I A;  1W79 A;  3OLO A;  3UDI A;  4HES A;  4EW7 A;  1SCW A;  1W7F A;  3DAV A;  4HI4 A;  4NXB A;  2ZM0 A;  4O0P A;  1TS7 A;  5HD5 A;  2M7V A;  4DE1 A;  1NRF A;  4KZ6 A;  5AQ7 A;  2PRF A;  4DE2 A;  2ZMV A;  2UWX A;  1JNU A;  1YLZ A;  3EOI A;  3CUE C;  1N9N A;  5HL6 A;  3GVB A;  1YMS A;  1JTD A;  1W63 M;  3M6H A;  4HP9 A;  3CPT A;  1FIK A;  5FQQ A;  3DWZ A;  5M1A A;  2EX9 A;  2WK0 A;  3D9Y A;  4LV0 A;  2ZM2 A;  3F1O B;  3N8R A;  1K57 A;  1YLJ A;  5HZH A;  2OOL A;  3OPP A;  1OJG A;  4Q0J A;  1T1A A;  1HZO A;  2J3T C;  2QHK A;  5AQ9 A;  2EX2 A;  3FPV A;  2WZX A;  4QB8 A;  5F68 A;  2FH5 A;  3BQ8 A;  2QJ5 A;  5EM1 A;  4EWF A;  4Y0T A;  4Q0H A;  2W3E A;  3N6I A;  3M6B A;  4WYY A;  3ZNT A;  4IUK A;  4Q0I A;  4Y5F A;  2HV1 A;  2V0W A;  3LR3 A;  2WAE A;  1CK3 A;  1MWR A;  4Y0O A;  2Y2L A;  2Y2K A;  2P7J A;  3PBO A;  3WS1 A;  4ME4 A;  3MS6 A;  2PT7 A;  2XSS A;  4FUW A;  1KVL A;  3E2K A;  3C4O A;  3T4S A;  1S6R A;  1RGY A;  1GHI A;  1VHM A;  1XA7 A;  4OP5 A;  1K56 A;  2PU4 A;  1CI8 A;  1YT4 A;  4DN0 A;  1D06 A;  3PBN A;  5L10 A;  1PZO A;  2O9B A;  5TBM B;  1H3Q A;  5FQ9 A;  3HLW A;  2JHE A;  2ZC6 B;  4EV4 A;  2Y2J A;  2V1B A;  3HLF A;  1ALQ A;  3UPO A;  4L0L A;  2ZMF A;  2PD8 A;  3QP1 A;  5D3O A;  5DF8 A;  5IHV A;  4C6Y A;  3PBT A;  1TEM A;  3IXH A;  2WGI A;  1IEL A;  2J9P A;  1FOF A;  3VFF A;  3O88 A;  1ESI A;  2WKH A;  2E8J A;  2O99 A;  3VOY A;  1S67 L;  2HDQ A;  4BWI A;  5CHM A;  5FL3 A;  1NRJ A;  4RYE A;  5FI7 A;  1CEG A;  4OPR A;  3VSL A;  3BFD A;  2EXB A;  3IWQ A;  4ARZ B;  4HBT A;  3ITA A;  4EQ1 A;  4DJ2 A;  1TF1 A;  5DTT A;  4DXC A;  1XX2 A;  4KQQ A;  5A93 A;  5CHJ A;  4E3O A;  3BRM A;  5M19 A;  5EPH A;  2Q9M A;  4U0X A;  4WN5 A;  1ES2 A;  5FI2 A;  2XLN A;  1GHM A;  3P98 A;  1JWV A;  2B95 A;  2C5W B;  4YNR A;  2B18 A;  1MXO A;  1JWP A;  3CWF A;  3NHQ A;  1N9B A;  3FZC A;  4Y17 A;  3WS2 A;  3E98 A;  2J80 A;  3G35 A;  2ZMA A;  5HL1 A;  3LY3 A;  4WZ5 C;  1VB6 A;  2PAV P;  4JXS A;  4ETZ A;  4E3K A;  4G3W A;  1ACF A;  3UB7 A;  1CEF A;  2Y2G A;  1K38 A;  3T1S A;  2GZA A;  2Y91 A;  1K55 C;  1FCM A;  4DXB A;  4M3K A;  1MWS A;  4FTX A;  4CLC D;  5TFQ A;  5DKL A;  4ZDX A;  3EGX C;  5FI6 A;  3IX8 A;  1BZA A;  1MKM A;  3KYE A;  2DMW A;  1YKD A;  1SDE A;  3MQ0 A;  1F5M A;  1FR6 A;  4OOM A;  2WUQ A;  4JF5 A;  3QP2 A;  2IWB A;  1GSV A;  5CEC A;  5FSR A;  4DKI A;  3PXP A;  3E0Y A;  2XQZ A;  3LI9 A;  3LR4 A;  2INW A;  1Y4O A;  4EXO A;  4NXE A;  3KX0 X;  5F82 A;  3FYZ A;  3UME A;  3H7W A;  3LYX A;  3FWL A;  3RTY A;  4IED A;  3MQQ A;  4BJP A;  2L4R A;  5EVI D;  5F69 A;  4E04 A;  5GLD A;  1ZKJ A;  4HQA A;  3B3X A;  3ZG7 B;  3IF6 C;  4NXG A;  4KZB A;  1T1C A;  2PDR A;  2Y2I A;  4OQI A;  2DNS A;  3Q82 A;  4LV1 A;  4OP8 A;  5F83 A;  5F5Y A;  3PBS A;  1OTE A;  5HAI A;  5CXW A;  3QP6 A;  4RX2 A;  4KG5 A;  4ZJ2 A;  1XGJ A;  1DRM A;  5EM0 A;  2Y55 A;  1D1J A;  2FFY A;  3IHB A;  4RA7 A;  1GCE A;  2MJ6 A;  2PYR A;  4E3N A;  1EWZ A;  2X71 A;  4JGQ A;  3PAG A;  1N9O A;  4EUZ A;  5F1G A;  3PHY A;  2G2U A;  1OJ5 A;  3PBQ A;  1W8Y A;  1KGF A;  5HD3 A;  1K54 C;  3GTC A;  2QZ6 A;  5E2E A;  3JYI A;  1D7E A;  1I2W A;  3HRE A;  1BT5 A;  3CIT A;  4RX3 A;  1IKI A;  4LCL A;  3A0V A;  3S7P A;  1P97 A;  5HX9 A;  5KSC A;  4D2O A;  1L0F A;  2WAF A;  4I3I A;  1IFQ A;  2D02 A;  3GV9 A;  3FG8 A;  1G6O A;  2H5S A;  3LO7 A;  4B93 A;  3C4P A;  1SKO B;  2EX6 A;  1E3U D;  5FQM A;  2B5R A;  4BBT A;  4L9F A;  1KVM A;  2ZC5 B;  4UEY A;  3P7N A;  3ZGA B;  1EW0 A;  4PM9 A;  5C5K A;  2JKR M;  4C3Q A;  1WA9 A;  4R1G A;  4N1X A;  5J8X A;  3HUN A;  2OSU A;  1OME A;  3V3S A;  3HLG A;  4PAU A;  3NEC A;  2V2F F;  3BYD A;  3VP4 A;  2JKR I;  4XXR A;  5AQB A;  3MZE A;  1ONH A;  2YKH A;  4OLD A;  4Q8I A;  3MR0 A;  5E2F A;  2VV7 A;  4WLA A;  3G6O A;  4D60 A;  3Q1F A;  3ZG8 B;  4LLO B;  2YKF A;  4KZ4 A;  4GCZ A;  3T1Q B;  2K31 A;  1F98 A;  2WAD A;  4PPR A;  4B4Z A;  2ZQC A;  1YLT A;  3IWI A;  4WUJ A;  3BQA A;  1E25 A;  2NUT C;  1Y54 A;  3IH8 A;  5EFW A;  4E6X A;  3Q81 A;  4JXW A;  2PD7 A;  4BLM A;  3SOI A;  3KYQ A;  1DP8 A;  1HTZ A;  5CRF A;  2WKQ A;  3EGD C;  1T18 A;  3IQA A;  4LV3 A;  1TDL A;  3HJI A;  1OT9 A;  4MLL A;  1SKO A;  4QWO A;  4OLG A;  4DF6 A;  1YAX A;  4Y13 A;  1FSW A;  5GL9 A;  3E4O A;  3LR5 A;  3BY9 A;  3ZQ5 A;  4XUZ A;  2D01 A;  4P6Z S;  4X1L A;  1CQA A;  4CLC B;  4S2L A;  4GZB A;  5AVF A;  3PR6 A;  4R6L A;  1A0K A;  5CX7 A;  5HWT A;  3P09 A;  1W63 Q;  1MC0 A;  1SKF A;  4HJ6 A;  4N9K A;  4II7 A;  4CJN A;  1FR1 A;  2ZQD A;  4MN5 A;  3KO6 A;  2XD1 A;  2HP9 A;  2Y2P A;  4GLQ A;  1S0W A;  2DRW A;  2ZC7 A;  4OPZ A;  3SH7 A;  4WEK A;  3LID A;  5EOE A;  3WWX A;  1ES3 A;  4MDZ A;  1LHY A;  2V1A A;  4KZA A;  5FA7 A;  4ZRR A;  1T1B A;  2XFT A;  1DJC A;  1OPX A;  2V8C A;  4LV2 A;  4GHI A;  3MFD A;  1Y28 A;  2JKT M;  3AGE A;  3BFF A;  4YIN A;  1M6K A;  1GSX A;  3QP5 A;  3I7J A;  3NDG A;  3CAX A;  1LT0 A;  2JKT I;  4WZ4 A;  2QJ7 A;  2V20 A;  4P85 A;  5EVI B;  4KZ8 A;  3LIA A;  4EBL A;  4GDB A;  5A92 A;  1LSW A;  2IWD A;  2G7U A;  4GNU A;  1NLY A;  5CER A;  1H8Y A;  3C8C A;  5DTS A;  4YOF A;  5EE8 A;  4K0X A;  3RXX A;  5EVL A;  4Y3I A;  1XPB A;  1L0G A;  2VGL M;  4Y15 A;  3PBR A;  3U2A A;  4OOL A;  1X0O A;  4CLC A;  2KDK A;  4MBF A;  1LI9 A;  4KQR A;  3BFG A;  5IU1 A;  5I94 A;  2EA9 A;  3MQO A;  3EQU A;  3O5Y A;  5HWV A;  3CJM A;  2KLI A;  1Z6F A;  3VP0 A;  3FKV A;  2W1R A;  3OPR A;  2W27 A;  3F1N B;  5HPF A;  5G18 A;  2JCH A;  4I39 A;  5DKK A;  1PW8 A;  5GHY A;  5F6A A;  4IBX A;  4RVA A;  2EX8 A;  2ZC4 B;  3L7H A;  1OTD A;  4NKP A;  3B42 A;  4F94 A;  1UWN X;  2W0N A;  1U60 A;  2KOI A;  2RCX A;  4NK3 A;  4FOF A;  4S2N C;  1H8M A;  5EVI A;  1I5Q A;  2W3F A;  3Q07 A;  1XFN A;  3JVV A;  2R9W A;  3ICY A;  1PWD A;  3HL9 A;  4U3T A;  2Z2L B;  3UE3 A;  3G34 A;  4JGO A;  4N9L A;  4JBF A;  1GA9 A;  3MBZ A;  4PKY G;  3OC2 A;  4FH4 A;  4EES A;  4G3K A;  4NET A;  2P04 A;  1MZU A;  2ZLY A;  1YPR A;  3C7U A;  3N8L A;  4LRZ E;  3B33 A;  4X25 A;  4HNB A;  2I72 A;  1ZG4 A;  5CEB A;  3O87 A;  2WKR A;  4BEN A;  3PTE A;  1I2S A;  3HCY A;  1PI5 A;  3WS5 A;  2HF6 A;  4HH2 A;  3T4L A;  3A3D A;  4I3J A;  1S1Y A;  3BLS A;  1H5X A;  3F1N A;  4JXG A;  3LEQ A;  3HVF A;  3W2Z A;  4M4X A;  1KE0 A;  3UPN A;  1G6A A;  5M18 A;  4R70 A;  1ERM A;  4PKY A;  3CUE A;  4A5R A;  2VA0 A;  2HDR A;  2WKE A;  4H6J A;  5KZH A;  4EER A;  2EXA A;  5HPI A;  1TVF A;  3UDX A;  3VSK A;  3O86 A;  3UMD A;  2ZQ9 A;  4KQO A;  4DJ3 A;  2XA7 S;  2QPN A;  4LCM A;  2VGJ A;  2LB5 A;  1PYY A;  3IX3 A;  3PYP A;  5DJT A;  5GHZ A;  2R78 A;  4LPZ A;  4Y7P A;  3UB8 A;  1FCN A;  2PR5 A;  1UGU A;  1OT6 A;  4EEP A;  2QKP A;  4L9E A;  3TJZ C;  2GNX A;  4GB7 A;  3LFV A;  4F3L B;  1E3U A;  4O01 A;  3VP3 A;  4ZJ3 A;  3WRZ A;  4OH0 A;  2XK1 A;  3LI8 A;  3HBR A;  4UQI M;  3H7W B;  5FDH A;  3U4L P;  2HGV A;  1LL5 A;  1LSX A;  4P0M A;  2WZZ A;  2Z2M B;  1BLC A;  4ESP A;  1LSV A;  4EUV A;  1VM1 A;  4ETX A;  1BUL A;  5DTK A;  1H0M A;  5KMW A;  5HDC A;  3GDI A;  3UB6 A;  2PBY A;  3Q7V A;  2W1T B;  1YSP A;  3ZCZ A;  5HW3 A;  3S22 A;  1ERQ A;  3KSH A;  1KE4 A;  4KG2 A;  4ZJ1 A;  1NWZ A;  2FFF B;  4R0Q A;  4MNR A;  4E3M A;  2JN7 A;  3FKW A;  4K0W A;  1O07 A;  4E3J A;  3L9K A;  5G4Z A;  3DTK A;  4AFI A;  1NZO A;  1HVB A;  1IYP A;  3LCE A;  4HJ3 A;  4DDS A;  3VV4 A;  1DP6 A;  4B88 A;  3TW8 A;  4K91 A;  3KSI A;  2JC7 A;  4RQ9 A;  2H0Y A;  3IT9 A;  3M2J A;  4FSF A;  1CF0 A;  3VE3 A;  3G4P A;  2XGN A;  3B47 A;  1BLH A;  4F3L A;  4QY6 A;  2OLV A;  4HH3 A;  1P9W A;  2P08 A;  2PHY A;  1MKI A;  2EWV A;  2VV6 A;  1CI9 A;  3F1P A;  3CI6 A;  3GSG A;  3TE8 A;  3R4K A;  2EFX A;  3VP2 A;  4G3V A;  3RFB A;  5FQI A;  4OQH A;  5EUA A;  5HSQ A;  3NCK A;  4X6T A;  1BUE A;  2Y4A A;  3IBJ A;  4QD4 A;  1BTL A;  2P9V A;  3UPP A;  2V8F A;  2GX5 A;  3CG5 A;  3MZF A;  3TRC A;  2W1T A;  3UDF A;  1MWU A;  1NYM A;  2PBD P;  2JE5 A;  4BBV A;  2OWH A;  3OCL A;  1DY6 A;  4UA9 A;  4K08 A;  2QWS A;  3UE6 A;  3BFE A;  5HAR A;  4O7D A;  3V5M A;  2A49 A;  1YMX A;  4WMC A;  3VMA A;  1TD5 A;  1GSW A;  2Y2M A;  5CED A;  1PWG A;  4EU0 A;  1QME A;  3C30 A;  1ESU A;  1KGE A;  4QJG A;  4Y0U A;  3NIA A;  4UHU A;  5J3W A;  4DE0 A;  4JPM A;  3ZFZ A;  4PM6 A;  2PU2 A;  4MCW A;  1FQG A;  2V1Z A;  3LY4 A;  3MXQ A;  3AGF A;  1LLB A;  4WZ5 A;  3T4T A;  1PW1 A;  1KDW A;  3G30 A;  4I38 A;  5IT5 A;  1K55 A;  4N1H A;  1YQS A;  3H82 A;  2CC1 A;  3ULF A;  2O9C A;  3E4P A;  4R3B A;  4HEF A;  3UY6 A;  1F9I A;  2H10 A;  2H28 A;  3QP8 A;  2J3T D;  4OQG A;  4JF6 A;  3NOU C;  4X1M A;  1PIO A;  3HLE A;  2I9V A;  5E2G A;  4HHD A;  4E3L A;  1N9L A;  1TDG A;  1TS6 A;  4X69 A;  1G28 A;  1PRQ A;  1L0E A;  2W3D A;  5E2H A;  2VEA A;  2J8Y A;  5MC7 A;  5FAS A;  3G32 A;  1NZU A;  2JBF A;  4S2I A;  4EBP A;  2A24 A;  1AXB A;  3S1Y A;  5EV0 A;  2M7U A;  5FAO A;  1ES4 A;  3EEA A;  2EWW A;  2Y2O A;  3A3E A;  3N4I A;  4JF4 A;  1K6R A;  2Y2N A;  2AVX A;  4MMN A;  1EI5 A;  3NOP C;  4QU3 A;  3SZT A;  4GHI B;  5FAP A;  1L3L A;  3R7W B;  3MXS A;  1WYB A;  3Q7Z A;  2RL3 A;  2B02 A;  2ZJ9 A;  1FIL A;  4R4R A;  1K57 C;  4PM8 A;  2KX6 A;  4JLF A;  2ZL1 A;  4XT2 B;  4R23 A;  4JXV A;  1YLY A;  4WEJ A;  4Z1W A;  1C3B A;  1OTA A;  1ES5 A;  3NUL A;  5FDS A;  4GS9 B;  4EQI A;  3D3O A;  4GD6 A;  5HDS A;  3VFH A;  4P6B A;  3CHW P;  3D72 A;  4BMW A;  2JKG A;  3T4Q A;  1VET A;  3LIE A;  2BG1 A;  4HY8 A;  5HDD A;  4N92 A;  2ZQ8 A;  1E4D A;  4KZ3 A;  3GQZ A;  4CLC E;  4X56 A;  2Y2H A;  4ZBE A;  3NBL A;  2LB9 A;  4MN7 A;  1K54 A;  3IF5 A;  4GOG A;  3A0S A;  1XXM A;  5DFX A;  4Y2F A;  4BBU A;  5A90 A;  2K7S A;  5AJG A;  3LR0 A;  3WRT A;  4MBK A;  1JVJ A;  1TS8 A;  5FEF A;  5A8B A;  4I3A A;  3K3C A;  4HJ4 A;  4NXF A;  3C5A A;  5L07 A;  3SS5 A;  3BM6 A;  4WF0 A;  5GHX A;  1PNE A;  3G2Y A;  3R7W A;  5L8M A;  2EFU A;  4WMC D;  4IUH A;  5TJJ A;  3HUM A;  1S66 L;  1GA0 A;  2V0U A;  3GMW A;  5JYP A;  4XT2 A;  4S2K A;  4NEE D;  3RJU A;  3QP4 A;  4OVD A;  1J3W A;  3EQV A;  1BSG A;  3P01 A;  5LBR A;  5I5L A;  1BLS A;  4GS9 A;  4LGW A;  3S7Q A;  3E4Q A;  1XGI A;  5CHU A;  1SHV A;  4X55 A;  2HP5 A;  1F2K A;  3MSH A;  1DJA A;  1NLZ A;  3O3V A;  3OPL A;  5BOH A;  4S2J A;  1L0D A;  2OAP 1;  1XP4 A;  4BD0 A;  3SH8 A;  3NY4 A;  1IYQ A;  4H8R A;  2VKS A;  1NY0 A;  3UE0 A;  1S4S A;  1K4E A;  4BD1 A;  4E6W A;  3IS2 B;  3TG9 A;  5HFO A;  4DRT A;  4UAA A;  4WEL A;  4R38 A;  3A3I A;  3T12 B;  3GRJ A;  3N7W A;  1WE4 A;  5CTM A;  1VEU A;  1V9Y A;  3HJK A;  5CGX A;  3IWO A;  1YLP A;  2Y2Q A;  3MMH A;  4EBN A;  4WM9 A;  1BLP A;  2L0W A;  2GDN A;  3T4K A;  2XRO A;  4FD8 A;  3BLM A;  4CPK A;  3BEC A;  1PI4 A;  2OLU A;  5GLC A;  4BL2 A;  3HLD A;  5GLA A;  2JKF A;  3MZD A;  3DTI A;  1MBL A;  2XF3 A;  1MY8 A;  5FQJ A;  2A2L A;  4DDY A;  3LGO A;  1KOU A;  2G2W A;  2O0Y A;  1VQQ A;  5EVE A;  4H6J B;  1BYW A;  3S4X A;  1RP5 A;  3RXW A;  3BW6 A;  3T1R A;  3QNB A;  1XFQ A;  4S2P A;  5FEG A;  3UN7 A;  2Q0O A;  1QMF A;  5F1F A;  3BY8 A;  3IBR A;  4EET B;  1G5U A;  2GJ3 A;  4LEN A;  1TS0 A;  1JTG A;  3HLC A;  1S1Z A;  2HP6 A;  2XR0 A;  1ODV A;  4ID4 A;  1STZ A;  1LI0 A;  1PWC A;  3NDE A;  5DF7 A;  2VLG A;  3CLO A;  2OV5 A;  2J7V A;  4X53 A;  3E2L A;  4OPQ A;  3W4P A;  3IXG A;  3IS2 A;  4HOI A;  3S7O A;  4R3A A;  2Y79 A;  3A3F A;  1M40 A;  1Q2Q A;  1W5D A;  3T4O A;  3KSF A;  4YFM A;  1MPL A;  5DFY A;  3F1O A;  2Z6D A;  3Q7V B;  3CZD A;  3OOV A;  2ACG A;  3LIB A;  4BL3 A;  4ZTK A;  5JYO A;  5J7E A;  2NUP C;  3V39 A;  1SZV A;  3RH8 B;  5G4Y A;  2OAQ 1;  3MFX A;  4LFU A;  4PM5 A;  1SDN A;  3VOL A;  4FCF A;  1NXY A;  1KDS A;  4GKU A;  2XDM A;  5J4E A;  2CMN A;  4MEZ A;  1XJ6 A;  4NG2 A;  3BWL A;  2HDS A;  2ZOI A;  1ERO A;  5AQA A;  3VE4 A;  3BJN A;  5L2F A;  3ZG9 B;  5HWW A;  1K4F A;  4KZ5 A;  1O7E A;  1ZHH B;  4S2M A;  3N8S A;  4IJG A;  1XKZ A;  4JGP A;  2DCF A;  1WYC A;  3ZVW A;  4WL9 A;  4ZAM A;  5TGF A;  3F1P B;  1IKG A;  2BLS A;  1PZP A;  1OTB A;  2WYX A;  3V3R A;  3NJA A;  4OPY A;  3EWK A;  1XJ4 A;  3ZG5 A;  5FQK A;  2H0T A;  5IS1 A;  3SW1 A;  5DF9 A;  3NC8 A;  5TBM A;  3IH9 A;  2PR6 A;  3WS4 A;  2VX8 A;  3UB5 P;  2P9V B;  4OOY A;  3MF0 A;  5A91 A;  4O8G A;  3AGD A;  2WKI A;  3K2N A;  4PM7 A;  1ZG6 A;  1L2S A;  4OKP A;  4S2N A;  4UA7 A;  4UA6 A;  1P0Z A;  4GDN A;  4GJ4 A;  2WKP A;  4QHC A;  2QMI A;  3GR2 A;  3D4F A;  1W8Q A;  2BTF P;  3SH9 A;  1K0K A;  1PFL A;  3MJQ A;  4EEU A;  3FV7 A;  1GHP A;  5GLB A;  3MKF A;  5KSH A;  5FAT A;  4P6Z M;  1MWT A;  3IXD A;  4Z9Q A;  4L9G A;  4YWZ A;  4MBH A;  1RCJ A;  3LIF A;  2VV8 A;  3WS0 A;  3KSG A;  4I5S A;  2X01 A;  4ARZ A;  2VGL S;  4OQ0 A;  2PYP A;  3TOI A;  1JWZ A;  3UO9 A;  4GW9 A;  1XJ2 A;  4HIA A;  3H82 B;  1K6S A;  2R9X A;  2VK3 A;  4JGR A;  2M1C A;  3HUO A;  3BEB A;  1H8Z A;  3JPU A;  1XJ3 A;  4C75 A;  1P9R A;  3VP1 A;  2IWC A;  4U0T A;  5EEC A;  5E43 A;  4HP4 A;  3V50 A;  1HD8 A;  5HAP A;  1K56 D;  4MN6 A;  5TR7 A;  1Z09 A;  1IYS A;  2VGK A;  3SS3 A;  3G2Z A;  2E8I A;  2J9O A;  4JKT A;  5DJU A;  5K5B A;  2A24 B;  1FCO A;  1YSQ A;  5KIZ A;  3T1X A;  3ZDJ A;  3LIC A;  3K3D A;  1UWP X;  3MKE A;  2K2N A;  3H9W A;  1K25 A;  3DTE A;  2X02 A;  2WGW B;  3IHA A;  3JVU A;  1ONG A;  3HLB A;  1IOU A;  2P74 A;  3DTM A;  3ITB A;  5HAQ A;  1KE3 A;  4R4S A;  3UB9 A;  4DE3 A;  3UNW A; 
#chains in the Genus database with same CATH homology
 2Z6C A;  2J80 A;  3E98 A;  2KOI A;  3ZYT A;  2LB9 A;  4FOF A;  4MN7 A;  1VB6 A;  4ETZ A;  3A0S A;  1H8M A;  4G3W A;  3UB7 A;  5DFX A;  4Y2F A;  2W3F A;  4BBU A;  1XFN A;  3DBA A;  2GZA A;  3JVV A;  2K7S A;  5AJG A;  4KUO A;  3ICY A;  3LR0 A;  1TS8 A;  5A8B A;  4I3A A;  3UE3 A;  4JGO A;  2V9A A;  2QYB A;  3K3C A;  4DMZ A;  4HJ4 A;  3FC7 A;  4NXF A;  4PKY G;  3OC2 A;  4EES A;  4G3K A;  2ZBB A;  4CLC D;  2P04 A;  1MZU A;  2OWJ A;  3S7N A;  4WF0 A;  3LUQ A;  4LRZ E;  5DKL A;  3EGX C;  3R7W A;  5L8M A;  3B33 A;  4HNB A;  1MKM A;  4IUH A;  5TJJ A;  1OTI A;  2DMW A;  2IA2 A;  1S66 L;  2V0U A;  1YKD A;  2WKR A;  3MQ0 A;  4XT2 A;  1F5M A;  4NEE D;  3HCY A;  4OOM A;  1GSV A;  2HF6 A;  4HH2 A;  1DP9 A;  3EQV A;  3P01 A;  5LBR A;  5I5L A;  3T4L A;  4GS9 A;  4I3J A;  1V9Z A;  3T4J A;  1S1Y A;  3S7Q A;  3E4Q A;  3PXP A;  3F1N A;  3E0Y A;  2ZOH A;  4B9O A;  2Y8H A;  3LI9 A;  3LR4 A;  2INW A;  4EXO A;  4NXE A;  3KX0 X;  3W2Z A;  3UME A;  4M4X A;  1NLZ A;  2VZW A;  2XRN A;  3H7W A;  3EEH A;  3LYX A;  4R70 A;  2OAP 1;  4LRX C;  3RTY A;  4PKY A;  3CUE A;  2VA0 A;  3MQQ A;  5AVE A;  4H6J A;  4BJP A;  2VKS A;  4EER A;  4UQI S;  1S4S A;  5HPI A;  2L4R A;  4PHT A;  3IS2 B;  5F69 A;  4E04 A;  3UMD A;  4KQO A;  4DJ3 A;  3FPW A;  4WEL A;  4R38 A;  2O9A A;  2XA7 S;  4HQA A;  4IHQ A;  4CLC C;  2LB5 A;  4NXG A;  2L1M A;  1LL8 A;  3PYP A;  5DJT A;  3V67 A;  1T1C A;  3KYZ A;  2PDR A;  1V9Y A;  2R78 A;  3HJK A;  4LPZ A;  3GEC A;  3T50 A;  3UB8 A;  3OBF A;  2VJW A;  2PR5 A;  1ZTU A;  1UGU A;  1S4R A;  1OT6 A;  3MMH A;  4EEP A;  2QKP A;  4L9E A;  3PBS A;  5F5Y A;  2L0W A;  3T4K A;  3TJZ C;  2XRO A;  1OTE A;  2GNX A;  3LFV A;  4F3L B;  4O01 A;  2W3H A;  4KQD A;  3LI8 A;  1DRM A;  4UQI M;  2HJ9 C;  3H7W B;  2A2L A;  1KOU A;  4CQH A;  2MJ6 A;  2O0Y A;  2PYR A;  2HGV A;  2XA7 M;  3OCN A;  1LSX A;  1T19 A;  4H6J B;  1BYW A;  4JGQ A;  1LSV A;  4EUV A;  4ETX A;  3BW6 A;  1N9O A;  2W3G A;  1XFQ A;  4LRY C;  3PHY A;  3C38 A;  1OJ5 A;  3PBQ A;  5HDC A;  3GDI A;  3UB6 A;  4QPR A;  3BY8 A;  3IBR A;  5HD3 A;  4EET B;  2HJE A;  2W1T B;  1YSP A;  1D7E A;  2J3W A;  3CIT A;  2GJ3 A;  3KSH A;  1TS0 A;  1NWZ A;  3A0V A;  1S1Z A;  3S7P A;  1P97 A;  1ODV A;  1STZ A;  4KUK A;  2JN7 A;  2VLG A;  3CLO A;  4I3I A;  2FZ0 A;  2BAS A;  3NOT C;  1IFQ A;  2D02 A;  5G4Z A;  3FG8 A;  1G6O A;  3C2W A;  3IS2 A;  4HOI A;  3S7O A;  4R3A A;  4AFI A;  2Y79 A;  4B93 A;  4HJ3 A;  3VV4 A;  1DP6 A;  3TW8 A;  3A0R A;  3KSI A;  3T4O A;  3KSF A;  4RQ9 A;  3OLO A;  4FSF A;  5DFY A;  3F1O A;  2Z6D A;  3VE3 A;  4BBT A;  4L9F A;  3OOV A;  3LIB A;  4EW7 A;  3B47 A;  4F3L A;  4UEY A;  5J7E A;  4HH3 A;  4HI4 A;  4NXB A;  1P9W A;  2P08 A;  3P7N A;  2PHY A;  2NUP C;  1EW0 A;  4O0P A;  2EWV A;  5C5K A;  2VV6 A;  1TS7 A;  2JKR M;  5HD5 A;  3RH8 B;  3F1P A;  5G4Y A;  2OAQ 1;  3CI6 A;  3MFX A;  2M7V A;  1WA9 A;  3TE8 A;  3VOL A;  3R4K A;  5J4E A;  2CMN A;  4PAU A;  1XJ6 A;  2ZMV A;  4G3V A;  3RFB A;  1JNU A;  3BWL A;  3EOI A;  3CUE C;  2ZOI A;  1N9N A;  2JKR I;  5HL6 A;  5HSQ A;  2YKH A;  1W63 M;  3VE4 A;  3BJN A;  3MR0 A;  3IBJ A;  4HP9 A;  2VV7 A;  5HWW A;  4WLA A;  3G6O A;  2GX5 A;  4LLO B;  1ZHH B;  3TRC A;  2YKF A;  2W1T A;  4GCZ A;  4IJG A;  3F1O B;  2K31 A;  1F98 A;  4JGP A;  5HZH A;  4BBV A;  2OWH A;  3OCL A;  2OOL A;  4K08 A;  4WL9 A;  2QWS A;  4WUJ A;  3UE6 A;  3BQA A;  2NUT C;  1OJG A;  4Q0J A;  1T1A A;  2J3T C;  5EFW A;  2QHK A;  3F1P B;  3FPV A;  5F68 A;  2PD7 A;  1TD5 A;  2FH5 A;  1GSW A;  3BQ8 A;  2QJ5 A;  1OTB A;  3KYQ A;  1DP8 A;  3NJA A;  2WKQ A;  3EGD C;  1T18 A;  4Q0H A;  4EU0 A;  3EWK A;  1XJ4 A;  2W3E A;  5IS1 A;  3SW1 A;  3C30 A;  3HJI A;  1OT9 A;  4IUK A;  4Q0I A;  5DF9 A;  4Y5F A;  2HV1 A;  2V0W A;  3LR3 A;  5TBM A;  1YAX A;  5J3W A;  2PR6 A;  2VX8 A;  3E4O A;  3LR5 A;  3MF0 A;  3BY9 A;  4MCW A;  2P7J A;  3ZQ5 A;  3PBO A;  2D01 A;  4P6Z S;  4ME4 A;  3MXQ A;  2PT7 A;  4O8G A;  3K2N A;  3T4T A;  4CLC B;  2XSS A;  5AVF A;  1P0Z A;  3PR6 A;  4R6L A;  4I38 A;  3T4S A;  4GJ4 A;  5CX7 A;  5HWT A;  5IT5 A;  1W63 Q;  1MC0 A;  4HJ6 A;  4II7 A;  2WKP A;  1VHM A;  4MN5 A;  3KO6 A;  3H82 A;  3ULF A;  4GLQ A;  2O9C A;  3E4P A;  3MJQ A;  4EEU A;  4DN0 A;  1D06 A;  4WEK A;  3LID A;  1F9I A;  4MDZ A;  5KSH A;  2V1A A;  3PBN A;  2H28 A;  4ZRR A;  1T1B A;  4P6Z M;  1OPX A;  2J3T D;  2O9B A;  5TBM B;  4GHI A;  4L9G A;  1H3Q A;  3NOU C;  1Y28 A;  4YWZ A;  2JHE A;  3LIF A;  2VV8 A;  2JKT M;  3KSG A;  2V1B A;  1GSX A;  4I5S A;  4L0L A;  2ZMF A;  2I9V A;  4HHD A;  4ARZ A;  2PD8 A;  2VGL S;  1N9L A;  1TS6 A;  1G28 A;  3CAX A;  1LT0 A;  2PYP A;  2W3D A;  2JKT I;  2VEA A;  3PBT A;  4GW9 A;  1XJ2 A;  2QJ7 A;  5MC7 A;  3LIA A;  4HIA A;  1LSW A;  2O99 A;  2G7U A;  2A24 A;  3H82 B;  1NLY A;  1S67 L;  2M7U A;  4BWI A;  3EEA A;  2EWW A;  4JGR A;  2M1C A;  3C8C A;  5FL3 A;  1NRJ A;  1XJ3 A;  4MMN A;  4YOF A;  1P9R A;  3NOP C;  4GHI B;  4Y3I A;  2VGL M;  3R7W B;  3PBR A;  3U2A A;  4OOL A;  4HP4 A;  1X0O A;  4CLC A;  2KDK A;  2B02 A;  5IU1 A;  4MN6 A;  2EA9 A;  2KX6 A;  4ARZ B;  4XT2 B;  3MQO A;  4EQ1 A;  3EQU A;  3O5Y A;  4WEJ A;  5HWV A;  4DJ2 A;  4Z1W A;  1TF1 A;  1OTA A;  2KLI A;  4GS9 B;  3D3O A;  5DJU A;  5HDS A;  5K5B A;  2W1R A;  2W27 A;  3F1N B;  5HPF A;  2A24 B;  3D72 A;  4BMW A;  1YSQ A;  3T4Q A;  5KIZ A;  4WN5 A;  3LIE A;  4I39 A;  5DKK A;  3LIC A;  3K3D A;  1UWP X;  2K2N A;  3H9W A;  5F6A A;  4HY8 A;  3JVU A;  4YNR A;  5HDD A;  2B18 A;  1IOU A;  1OTD A;  4NKP A;  3CWF A;  3NHQ A;  3B42 A;  3UB9 A;  1UWN X;  4CLC E;  2W0N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...