3F1OA

Crystal structure of the high affinity heterodimer of hif2 alpha and arnt c-terminal pas domains, with an internally-bound artificial ligand
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
114
structure length
109
Chain Sequence
FKGLDSKTFLSEHSMDMKFTYCDDRITELIGYHPEELLGRSAYEFYHALDSENMTKSHQNLCTKGQVVSGQYRMLAKHGGYVWLETQGTVIYNPQCIMCVNYVLSEIEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords Endothelial PAS domain-containing protein 1
publication title Artificial ligand binding within the HIF2alpha PAS-B domain of the HIF2 transcription factor.
pubmed doi rcsb
source organism Homo sapiens
total genus 30
structure length 109
sequence length 114
ec nomenclature
pdb deposition date 2008-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08447 PAS_3 PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3f1oA00
2EA9A 1T1CA 1T18A 5AVFA 2K7SA 2JHEA 1KOUA 4EERA 3E4PA 3MFXA 4KQDA 4LRZE 1G28A 3D72A 2V0WA 1DRMA 3RH8B 2PYPA 1UWNX 1P97A 3NOUC 5F68A 4HH3A 1UGUA 3UB8A 2V9AA 2L4RA 1XFQA 2V1BA 4F3LB 4L9EA 4I39A 2QWSA 1S4SA 3E4OA 3CWFA 3P7NA 4HIAA 1OT6A 1XJ3A 3B33A 2WKPA 1OJGA 3HJIA 2PR6A 3H7WA 4GS9B 3HJKA 4WUJA 1LSWA 4KUOA 3H9WA 2W0NA 4WLAA 1LT0A 3ICYA 4KUKA 3BWLA 1OJ5A 5A8BA 4K08A 2OWJA 1XFNA 2PD8A 3A0VA 4EESA 3LI8A 3MXQA 1GSVA 4NXBA 3BY9A 5IU1A 4DJ2A 4NXEA 2V1AA 5KIZA 4HHDA 1P0ZA 3F1OB 3NJAA 4JGPA 5F69A 2VV6A 3LUQA 4HJ4A 1D06A 5HDCA 4HH2A 1X0OA 4HJ3A 2D02A 3LIEA 3LIBA 2A24B 4H6JA 2ZBBA 1DP9A 5HWVA 1DP6A 1OTIA 4NXGA 4R38A 4WF0A 2WKQA 2I9VA 3UMDA 3IS2B 2QJ7A 4RQ9A 4L9GA 3MQOA 3C2WA 1XJ4A 2H28A 3UB6A 1LSVA 3EWKA 5J3WA 1MZUA 2ZOHA 3T50A 2YKFA 4GW9A 5TBMA 5HDDA 3UB9A 3E4QA 1N9OA 1GSXA 2W27A 4GHIA 1VB6A 3ULFA 1F98A 2OOLA 4PKYA 2VV8A 3H82A 1TS0A 1XJ6A 3PYPA 3MR0A 4WN5A 3NHQA 4EEPA 1T1AA 2B02A 1XJ2A 1NWZA 5DKKA 4JGRA 4HOIA 3UE6A 1OTAA 1T1BA 4JGQA 2Z6DA 2PDRA 1S4RA 1WA9A 1TS8A 2PR5A 3PHYA 3VE3A 4I3AA 3K3DA 1V9YA 3F1NB 2M1CA 1OTEA 4L9FA 2BASA 3UMEA 4NXFA 1GSWA 4GS9A 3FG8A 3F1PA 1OT9A 4WL9A 1T19A 1TS6A 4HP9A 3LIDA 3GDIA 3VOLA 5HD3A 1JNUA 3LIAA 4EEUA 1UWPX 4LPZA 4MN6A 4EQ1A 4XT2B 1S1ZA 2V0UA 4LLOB 4BBVA 3F1OA 4MN5A 2GJ3A 5F5YA 5DKLA 3C8CA 1Y28A 3OLOA 3ZQ5A 2P7JA 5IS1A 3UB7A 1S67L 5EFWA 5J7EA 2PHYA 2QKPA 4PKYG 5HD5A 4LRXC 1LSXA 4BBTA 4E04A 3EEHA 5TBMB 4I38A 4R6LA 5I5LA 4JGOA 4GHIB 2INWA 2Z6CA 2PYRA 2JN7A 1DP8A 3LICA 3H82B 1F9IA 1N9LA 4R3AA 2L1MA 3IS2A 4HP4A 2OWHA 2WKRA 1OTBA 5G4YA 4YWZA 3CAXA 3H7WB 1TS7A 2KDKA 4BBUA 2CMNA 1OTDA 3IBRA 5DJUA 4HI4A 3LYXA 2KX6A 3SW1A 5HDSA 2D01A 1ODVA 1BYWA 4I5SA 3RTYA 4F3LA 5J4EA 1V9ZA 3F1PB 1S1YA 4R70A 3A0SA 5DJTA 3MQQA 3MJQA 3LIFA 4HNBA 1LL8A 3KX0X 4HQAA 4EETB 3NOPC 2YKHA 4HJ6A 2QHKA 3F1NA 4I3IA 3FC7A 3G6OA 5F6AA 2QJ5A 2R78A 1EW0A 4H6JB 4EXOA 2L0WA 3LI9A 3GECA 2VLGA 4LRYC 1N9NA 3BY8A 5HWTA 5HWWA 4EW7A 3A0RA 4HY8A 4DJ3A 2ZOIA 3K3CA 1D7EA 5HSQA 3VE4A 2VV7A 4GCZA 5AVEA 3NOTC 2VEAA 3CLOA 1S66L 2HV1A 5HZHA 2J80A 2A24A 2PD7A 4M4XA 5G4ZA 4B9OA 4XT2A 4I3JA
chains in the Genus database with same CATH superfamily
4OQ0A 5EOEA 4KG5A 1T18A 2W3DA 2JHEA 4X1MA 4EERA 1QMFA 4M3KA 3MFXA 1SKFA 2G2UA 1G28A 3PAEA 2V0WA 3SS4A 2XA7S 4Q0HA 1FILA 1UWNX 1LL5A 3NOUC 4UEYA 1CEFA 2JKTI 4HH3A 4E6WA 4B93A 4NK3A 2Y2QA 4PM5A 4G3KA 2P04A 3WRTA 1O7EA 2EWVA 2OLUA 2QWSA 3C4OA 3P7NA 1FCMA 2ZJ9A 1OT6A 1TVFA 3B33A 1YLYA 5E2EA 3T4JA 4GDNA 3DTEA 3E98A 1LSWA 2W1TA 5CEBA 3H9WA 2W0NA 1N9BA 3ICYA 4JPMA 3FV7A 5A8BA 1PIOA 4Y13A 4MBHA 4GD8A 1G5UA 1NZOA 2IWDA 4ETZA 1I2SA 3LI8A 1PW8A 4MCWA 1GSVA 2ZM8A 1TEMA 4WZ5A 1M40A 4II7A 4B4ZA 3MQ0A 5EM0A 3ZG7B 4HHDA 1P0ZA 2Q9NA 3HVFA 1IKIA 1D06A 4Y2FA 4C6YA 3SOIA 5EOOA 5HDCA 1X0OA 4LV2A 2V2FF 2D02A 2WGWA 3LIEA 2P74A 4IUHA 2E8JA 3LIBA 5GLDA 4H6JA 3ZVWA 1YAXA 4MMNA 2ZMVA 3HUMA 1HD8A 5FI2A 2UWXA 5HWVA 4OPRA 1OTIA 4YFMA 1TF1A 2Y2GA 4WF0A 2HDUA 2I9VA 4G3WA 2ZQ7A 2Y2NA 2QJ7A 1FCOA 1E4DA 3HLDA 1HLUP 1XJ4A 3MF0A 2XD5A 3MKFA 2LB5A 3CG5A 4QY6A 3DAVA 1MZUA 2ZOHA 3T4KA 4Y5FA 3IWIA 5TBMA 1GHPA 3UB9A 2VZWA 3E4QA 4GLQA 2Y55A 1J3WA 2DNSA 4DF6A 3BFEA 1BLHA 1DY6A 1XX2A 3MKEA 3LY4A 4DKIA 3O87A 3MR0A 2VX8A 3C30A 4S2JA 2O99A 2J9PA 5AQ9A 2JKGA 3MSHA 2JKFA 4HOIA 3ZNTA 1YSQA 1YMXA 3A3IA 4R0QA 4R3BA 3VSKA 1PI5A 3DTKA 2Z6DA 4KQQA 1S4RA 1YLTA 2ZQCA 2PR5A 3WS0A 4I3AA 4EBLA 5HPFA 3F1NB 2V20A 3VV4A 4IBXA 2ZQAA 3HCYA 2Y79A 4L9FA 3UDXA 1YM1A 1KGEA 3UMEA 2DRWA 4GS9A 3FG8A 1IEMA 4ZJ2A 4WL9A 5HFOA 3C7VA 1TS6A 3LR0A 3LIDA 5CX7A 3OBFA 1MKIA 4ID4A 2VA0A 4YINA 5HD3A 1JWZA 4BJPA 3VFFA 3BM6A 1IYQA 1UWPX 4X25A 2Y8HA 3UPPA 4JKTA 1L2SA 1YPRA 4XT2B 1S1ZA 2V0UA 3ZCZA 4BBVA 3FPWA 3S7NA 3VMAA 3OCNA 4MN5A 3BFCA 5DKLA 1Y28A 4HEFA 5C5KA 3C4PA 1GA9A 3UY6A 2EWWA 2FH5A 3UB7A 4DMZA 1S67L 1Q2QA 3G2ZA 1ERQA 2PHYA 4PKYG 1XXMA 1IYSA 3BFFA 3BRMA 1ONHA 5FL3A 1PFLA 4E04A 1YLZA 2P08A 3IXDA 3B42A 5FQIA 5HAIA 1MC0A 1YLJA 2XLNA 5HAQA 4FCFA 1BTLA 1ZTUA 4OLDA 5I5LA 3MFDA 2INWA 5F83A 2J3TD 1BLSA 1N9LA 4Y0OA 1BT5A 2Y2HA 3CAXA 5EVID 3CPTB 1FR1A 2HJ9C 2HDRA 2VKSA 2W1TB 2ZC5B 2WKHA 5L2FA 3TRCA 3O88A 5HDSA 4DDYA 1YLWA 1C3BA 3HLCA 1NJ4A 3SS5A 1VEUB 3KYEA 4KZ7A 2LB9A 3CITA 3F1PB 1S1YA 5DJTA 3AGEA 2ZD8A 2PBYA 4HQAA 3S7QA 1K38A 3HLWA 3UDFA 3KSIA 3ZG0A 3IHBA 2VGLS 4HJ6A 3ZFZA 1BUEA 2K2NA 4PPRA 3EEAA 3OPHA 4X68A 3KYQA 3R7WB 2WGWB 3FC7A 4H6JB 1XKZA 2L0WA 3DWZA 5FDSA 3CJMA 5HWTA 3SH8A 4MLLA 3V3RA 3O86A 1W8QA 3K3CA 5HSQA 3BECA 1K57C 3UE1A 4GCZA 5CHJA 1ACFA 3NOTC 3CLOA 2UV0E 1MKMA 4S2LA 4GZBA 1ES4A 2Q0OA 1XA7A 2J80A 2PD7A 4DXBA 2V8FA 5DTTA 5GLBA 1GHMA 3CMZA 1ES5A 2ZM0A 5CEDA 4DXCA 2FFFB 5A92A 4BMWA 1T1CA 5AVFA 2WUQA 2K7SA 3UDIA 3QP1A 1K0KA 2RCXA 3GTCA 4KQDA 3D72A 2M7UA 1CF0A 4BLMA 4XXRA 2PYPA 4E3LA 4LV1A 2QYBA 2Y2OA 4GDBA 3NY4A 3PTEA 2X71A 4PAUA 1FCNA 2L4RA 2HDSA 3VOZA 1XFQA 5AQAA 4O8GA 1STZA 1YSPA 2V1BA 4L9EA 1S4SA 3M6BA 4Y3IA 2WK0A 4HIAA 2Y91A 4OOYA 2J7VA 4E3OA 1EI5A 4WM9A 1OJGA 3HJIA 1SDNA 2HP5A 1L0FA 4GS9B 1E3UD 5AQBA 3PXPA 1LT0A 3Q07A 3BFDA 2JKRM 4Z9QA 1OJ5A 5FI6A 2ZL1B 3FWLA 4QWOA 4WEKA 2Z2LB 4K0XA 4EESA 4LCLA 4NXBA 2RL3A 3VP4A 3BY9A 3NCKA 5IU1A 4D60A 3ZG9B 5FA7A 3NJAA 4JGPA 5F69A 1F5MA 1PI4A 4KG2A 2VJWA 2GZAA 4PM7A 1VM1A 2ZQDA 4C3QA 3A3FA 4QD4A 3T4QA 3LR3A 3IWQA 4K0WA 2B18A 2Q9MA 1HZOA 2IA2A 4HJ3A 4ZRRA 1GA0A 4PM6A 1FIKA 1PZPA 1DP9A 4XUXA 5E2FA 2XDMA 3C5AA 4R4RA 3N4IA 5CGWA 4UQIM 1DP6A 3S1YA 4A5RA 2P9VB 3LEQA 1OPXA 1K57A 4OPYA 1WYCA 4LV0A 4OQHA 2O0YA 3RFBA 5DFXA 5EM1A 1IYOA 3S22A 4JXGA 3UB6A 1LSVA 5J3WA 1SCWA 3DTIA 4IJGA 3FKVA 1E25A 1GHIA 4IVIA 4O7DA 1AXBA 5CERA 1BZAA 3IT9A 3NECA 1LI0A 2JCHA 4FUWA 3T12B 2W27A 2EFUA 3VOYA 1WE4A 4LGWA 4QJGA 1L0DA 2XA7M 2Y2KA 4JF6A 3EGXC 1XJ6A 2ACGA 4MEZA 1BLPA 2B02A 2JE5A 1XJ2A 5HAPA 5DKKA 5LBRA 1OTAA 2XRNA 5F82A 1T1BA 3CPTA 1ONGA 5EPHA 4R1GA 1L0GA 4EQIA 4ESPA 4KQOA 4E6XA 2XROA 2PDRA 5KSCA 5E43A 2XD1A 3VE3A 2J3WA 1KE4A 1PZOA 4ARZA 2OSUA 3ZNYA 3T4TA 5CECA 3QP6A 4EUZA 2PBDP 3MXRA 1VEUA 4ZBEA 3B47A 1GSWA 3NI9A 3F1PA 1OT9A 1T19A 4GOGA 5GL9A 4MDZA 1NYMA 4HP9A 3QP5A 4LCMA 3LO7A 5KSHA 1N4OA 3GDIA 1SDEA 3V3SA 4R4SA 1XA1A 3V67A 3VOLA 4PHTA 3T1XA 5FDHA 1Z6FA 1JNUA 3R7WA 2BTFP 1XGJA 4KZ5A 3IF5A 2JKRI 1IOUA 1W63Q 2W3FA 3EOIA 5JYOA 5EV0A 4WMCA 4P85A 5F5YA 4K91A 4BD1A 2P7JA 5IS1A 1MPLA 4NETA 4OKPA 5J7EA 5HD5A 4JXVA 4QPRA 3W4QA 2OAP1 3EEHA 2V1ZA 3UPNA 5F1FA 1ES2A 4JGOA 4GHIB 2ZMAA 3T1RA 1FOFA 1K55C 5CXWA 3LICA 2L1MA 3IS2A 3DW0A 4HP4A 2WKRA 5I94A 1OTBA 2K31A 1FR6A 4ZJ1A 3CHWP 3GRJA 2IWBA 1ZG6A 1TS7A 2KDKA 3DBAA 4BBUA 3V50A 2CMNA 3PBTA 4CLCD 1XP4A 2MJ6A 4U3TA 2GX5A 1FQGA 2X02A 3MZFA 3LYXA 2KX6A 1K4FA 4OVDA 3IX3A 5CRFA 2D01A 3IH9A 1ODVA 1BYWA 4Q8IA 3Q82A 1KE3A 1EROA 3NC8A 5EUAA 5J4EA 2XQZA 5EE8A 3UE0A 4OP8A 3A0SA 3AGDA 2W3GA 5CGXA 3BLSA 4X1LA 3N8LA 4N1HA 4ME4A 1KDWA 3IWOA 2H0TA 3JYIA 3BFGA 5A91A 2YKHA 3GVBA 2ZL1A 1VETA 2EX6A 3HREA 2G2WA 4GD6A 5F6AA 4BL2A 2QJ5A 1EW0A 3LCEA 3T4SA 3BJNA 3WWXA 1L3LA 2VLGA 1NRFA 4OQIA 4GJ4A 3UB5P 5IT5A 1D1JA 4P6ZS 2ZM2A 3A0RA 4HY8A 3ISGA 4JF4A 5GLCA 4HBUA 5G18A 4DJ3A 2ZOIA 4ETXA 3WS4A 3VE4A 2VV7A 4Q0JA 1Z09A 4LV3A 4M4XA 1F2KA 3C38A 3M6HA 1TD5A 4B9OA 2O9BA 4O0PA 5EVIB 1IKGA 2GNXA 4FH4A 2CC1A 2P9VA 4RYEA 1H8YA 2PU2A 3OZHA 1ES3A 1JVJA 3Q1FA 4PM9A 2X01A 4CLCC 1DRMA 2HF6A 2XK1A 5AJGA 5TJJA 3HUNA 4UA7A 2WGIA 2I72A 2EX2A 2FZ0A 4UA6A 1DJBA 3G30A 3UB8A 1G68A 1KE0A 1K55A 5HX9A 5L8MA 3G31A 1YLPA 1YQSA 2V9AA 1PWDA 3HLGA 5M18A 2JC7A 3O3VA 1CK3A 4F3LB 4I39A 3PBRA 2EFXA 3E4OA 3ZVTA 3CWFA 4ARZB 1K54C 3LGOA 1SKOB 3MS6A 1ESIA 3Q81A 2WKPA 2IWCA 2ZC4B 4QU3A 2WKEA 3HJKA 1K56D 4E3JA 4G3VA 4KUOA 5JYPA 4U0XA 4N9LA 4WLAA 1P9WA 4KUKA 5D3OA 1S6RA 3BWLA 4EUVA 1IELA 2PD8A 4FH2A 3A0VA 4CQHA 4IBRA 2EX9A 3AGFA 1KGGA 3PBQA 2VK3A 4DJ2A 4KQRA 2V1AA 5KIZA 1K25A 2VGJA 4KZ9A 2VV6A 4B4XA 1NZUA 2VGLM 3W2ZA 4FOFA 2XR0A 4HH2A 4E3MA 2C5WB 2R9WA 2XEPA 2A24B 2OV5A 1S0WA 2VGKA 1BSGA 2J3TC 4RA7A 3V39A 1J9MA 1BLCA 1RP5A 4NXGA 3B3XA 2JKTM 4R38A 3U2AA 3P01A 3RJUA 3O5YA 5EVIC 3IS2B 2C6WB 4RQ9A 4L9GA 3S7OA 4MNRA 3LY3A 2H28A 4BWIA 4ZJ3A 5FEFA 3KSGA 3T4OA 3G4PA 3EWKA 3QP2A 3WS5A 3NIAA 2FFYA 4OPQA 4KENB 3T50A 1H5XA 4JF5A 3IX4A 4GW9A 3ZDJA 5HDDA 1K6SA 4ZAMA 1N9OA 4GHIA 2G7UA 4P0MA 2VV8A 4KZAA 5J8XA 2WGVA 4IHQA 5TR7A 4DE0A 3NHQA 4O01A 1T1AA 4OQGA 4MBKA 1U60A 2H10A 3UE6A 2QMIA 4QHCA 3SZTA 3TW8A 1NY0A 1WA9A 4FSFA 2E8IA 2XFTA 4P87A 1TS8A 3NDGA 1ZC2A 1H8ZA 1K4EA 1V9YA 1VETB 3GQZA 5DTSA 1OTEA 2Z2MB 4KZ6A 3TSGA 4IVKA 4FTXA 3IF6C 3IXHA 1KDSA 4EBPA 3U4LP 4RX3A 4S2NC 3IQAA 3KYZA 4S2OA 1P9RA 3UE3A 3TG9A 4JXWA 3N7WA 1H8MA 4ZDXA 2PU4A 2WZXA 4P6BA 1PYYA 4OOLA 5CGSA 3BQAA 5BOHA 3CI6A 3BLMA 2AVXA 3MZEA 3F1OA 3PAGA 1LI9A 5M19A 5CTNA 2ZLYA 3ZQ5A 2XH9A 4R3JA 4WYYA 5CHMA 5GHZA 4BQMA 3KSFA 3A3JA 3PBNA 5EFWA 4NEED 3HLFA 3PBOA 5HL1A 4LRXC 1I2WA 1ZG4A 4KZ3A 3BEBA 4LENA 4E3IA 4KZ4A 4UAAA 4I38A 1DJCA 2BLSA 4R6LA 5K5BA 3TOIA 1NXYA 3LEZA 3IBJA 5EVIA 3M2KA 4RVAA 2JN7A 3BQ8A 5M1AA 3H82B 1F9IA 4R3AA 3W4OA 3UPOA 5FQKA 1KVMA 2A3UA 4EU0A 1LLBA 3A3EA 4F94A 2W3HA 2O9CA 2HZ5A 3VFHA 5G4YA 4YWZA 5DF9A 4HBTA 2WAFA 3BYDA 3M2JA 3OPRA 3HUOA 4YNRA 1OTDA 1LL9A 4S2MA 1TDLA 5DJUA 4E3KA 3G2YA 4HI4A 3RXWA 1G6AA 2BG1A 3SW1A 5KMWA 1K56A 3WS1A 2V8CA 3RTYA 4F3LA 4OOMA 5FQ9A 3NBLA 5HARA 1IYPA 1PWCA 1V9ZA 5L10A 3W4PA 1SKOA 2HJEA 4R70A 1O07A 3HLEA 3MJQA 4HNBA 3QNBA 2KLIA 3ZGAB 2WAEA 2Y4AA 4GNUA 3PBSA 4N1XA 4S2PA 1JTGA 4ZTKA 5FAQA 4Y17A 3G6OA 5FQMA 3IF6A 2WKIA 5FATA 3LI9A 3GECA 1MWSA 3G35A 3QP8A 3V5MA 4X69A 3OCLA 4S2NA 4R23A 5U47A 3LFVA 3IXBA 4S2KA 4EBNA 3W8KA 4EWFA 2KOIA 2HP6A 3S7PA 1YMSA 3CZDA 5GHXA 2XGNA 2HV1A 2ZQ9A 2A24A 3WRZA 2HDQA 3OPLA 5FSRA 3EQUA 4OLGA 2EA9A 3I7JA 3VP2A 1NLYA 4NG2A 5L07A 1IFQA 1KOUA 5A90A 3E4PA 2H0YA 3D4FA 4CLCB 2QPNA 3NULA 4LRZE 1ALQA 3RH8B 3HBRA 3ZG5A 3TJZC 4X55A 3ZYTA 1JWVA 2PAVP 1P97A 2W1RA 4Q0IA 5F68A 1YT4A 1UGUA 2W3EA 1CJFA 4IEDA 4YOFA 1AWIA 2M7VA 4PM8A 4RX2A 4FD8A 3UNWA 3IH8A 3IHAA 4BD0A 4D2OA 1E3UA 4WEJA 2R9XA 3NDEA 3UO9A 5MC7A 1XJ3A 2PR6A 3H7WA 4AFIA 5DVAA 1PWGA 4WELA 4WUJA 1ZHHB 4UA9A 3RXXA 5HPIA 2WZZA 5HW3A 3GMWA 3G32A 1Y54A 1W7FA 4KZBA 1L0EA 4K08A 2OWJA 1XFNA 1W8YA 1CI8A 3MXQA 1RGZA 4DE1A 2Y2IA 3Q7VA 2XFSA 5E2GA 4NXEA 1ZKJA 3F1OB 1MWUA 5FAOA 2Y2LA 4H8RA 3LUQA 1CEGA 5DF7A 4HJ4A 3WS2A 1Q2PA 3SS3A 3MXSA 1WYBA 5GLAA 3G34A 4CLCE 3ZG8B 1YKDA 1H0MA 2ZC3B 1MWRA 5DTKA 2Y2MA 4S2IA 4X6TA 2ZBBA 1JTDA 4P6ZM 2PRFA 3C7UA 5DFYA 1QMEA 4DDSA 5FQJA 2WKQA 4Y0TA 3E2LA 5E2HA 3OPPA 4CJNA 1A0KA 3S4XA 1I5QA 3UMDA 3MQOA 3C2WA 3GR2A 1W63M 3DWKA 4Y15A 4Z1WA 3JVUA 5CHUA 2A49A 2EXBA 4OP5A 5GHYA 2Y59A 1EWZA 2YKFA 2A2LA 2DCFA 4JBFA 3UN7A 4XUZA 4NKPA 1H3QA 1GSXA 1VB6A 3ULFA 1F98A 2OOLA 4IUKA 3LR5A 2Y2JA 3P98A 4PKYA 5EECA 5TFQA 3H82A 4GKUA 4CPKA 1TS0A 1OMEA 4DE3A 3PYPA 1MXOA 1ESUA 3MBZA 3SH9A 4DN0A 4WN5A 4C75A 2B5RA 4EEPA 3D9YA 1XPBA 1NWZA 4JGRA 3L7HA 3EGDC 4N92A 3KSHA 2XSSA 4JGQA 2ZQ8A 1DJAA 3N6IA 1VHMA 3JVVA 4OPZA 4Y0UA 2HPBA 3LR4A 3PHYA 3K3DA 2M1CA 1W5DA 1PNEA 4X53A 5EVEA 2BASA 3IF6B 1BULA 4KZ8A 1FSWA 4NXFA 3CUEC 5AQ7A 4BENA 3QHYA 3N8SA 1NLZA 3E2KA 1TDGA 3IX8A 3QP4A 4WZ4A 3E0YA 4LFUA 3Q7ZA 3MMHA 3FZCA 4QB8A 3QNCA 1ERMA 4MBFA 3LIAA 2HGVA 3OC2A 4EEUA 1MBLA 1KGFA 3DTMA 4LPZA 4MN6A 1K6RA 5F1GA 4EQ1A 1NYYA 4LLOB 1W79A 1Y4OA 2WADA 4WBGA 3BW6A 1PW1A 2GJ3A 2B95A 3C8CA 3OLOA 4HESA 4DRTA 2ZC7A 2J8YA 1FSYA 5EVLA 1CQAA 1RCJA 2QKPA 4UHUA 4WMCD 3T4LA 5IHVA 1SZVA 1LSXA 4BBTA 4B88A 3KO6A 4U0TA 1MY8A 3ITBA 5TBMB 3N8RA 2JBFA 3K2NA 2EX8A 2OLVA 2Z6CA 2PYRA 2NUTC 3ITAA 1DP8A 3TE8A 3GSGA 2J9OA 1XGIA 2HP9A 4CLCA 2OWHA 1LHYA 2DMWA 3FYZA 3FKWA 2XF3A 3H7WB 1HTZA 5FAPA 5A93A 5CTMA 1VQQA 1CI9A 3IBRA 5FI7A 2EXAA 5FQQA 1JWPA 3T1SA 4QY5A 3PR6A 1NRJA 2OAQ1 3HLBA 4I5SA 3JPUA 1G6OA 1M6KA 1K54A 1KVLA 4JLFA 3VP1A 2GDNA 5DF8A 4BL3A 3P09A 1SHVA 4E3NA 3HL9A 5TGFA 1HVBA 3Q7VB 5HL6A 3MQQA 3D3OA 3LIFA 1LL8A 4WZ5C 3KX0X 4GN2A 3A3DA 4EETB 2Y2PA 3NOPC 4JXSA 3EQVA 2O9AA 3FPVA 2QHKA 3F1NA 4L0LA 4I3IA 3CUEA 3T1QB 3SH7A 4Y7PA 1PRQA 5FEGA 2R78A 4EV4A 4N9KA 4EXOA 2ZMFA 3VSLA 4OH0A 3IXGA 4LRYC 1N9NA 3BY8A 4KG6A 3VP0A 5KZHA 3VP3A 5HWWA 3L9KA 4EW7A 3GV9A 2WYXA 4UQIS 3MZDA 4DE2A 1D7EA 2QZ6A 4PMAA 3R4KA 3OOVA 5AVEA 4GB7A 4OONA 1GCEA 5L09A 2VEAA 1S66L 2PT7A 5HZHA 3ZHHA 2NUPC 1MWTA 5G4ZA 2H5SA 2ZC6B 4X56A 5FASA 1RGYA 4MN7A 4XT2A 4I3JA
chains in the Genus database with same CATH topology
2EA9A 4BMWA 1T1CA 1T18A 2W3DA 5AVFA 1NLYA 2GNXA 2K7SA 2JHEA 1IFQA 1KOUA 4EERA 3E4PA 3MFXA 4CLCB 4KQDA 4LRZE 1G28A 3D72A 2V0WA 2M7UA 4CLCC 1DRMA 3RH8B 2PYPA 2HF6A 2XA7S 3TJZC 3ZYTA 4Q0HA 5AJGA 5TJJA 1UWNX 2QYBA 1P97A 2W1RA 3NOUC 4UEYA 4Q0IA 5F68A 2JKTI 2FZ0A 4HH3A 1UGUA 2W3EA 3UB8A 4B93A 4PAUA 4YOFA 5L8MA 2M7VA 2V9AA 2L4RA 1XFQA 4O8GA 1STZA 1YSPA 2V1BA 2P04A 4G3KA 4F3LB 2EWVA 4L9EA 4I39A 2QWSA 1S4SA 3PBRA 4WEJA 4Y3IA 3E4OA 3CWFA 4ARZB 3P7NA 4HIAA 1OT6A 5MC7A 1XJ3A 3B33A 2WKPA 1OJGA 3T4JA 3HJIA 2PR6A 3H7WA 4AFIA 3E98A 4GS9B 3HJKA 4WELA 4WUJA 1ZHHB 1LSWA 2W1TA 4G3VA 4KUOA 3PXPA 3H9WA 2W0NA 5HPIA 4WLAA 1LT0A 1P9WA 3ICYA 4KUKA 2JKRM 3BWLA 1OJ5A 4EUVA 5A8BA 4K08A 4WEKA 2OWJA 1XFNA 2PD8A 3A0VA 4ETZA 4CQHA 4EESA 3LI8A 4MCWA 3MXQA 1GSVA 4NXBA 3BY9A 4II7A 3PBQA 5IU1A 3MQ0A 4DJ2A 4NXEA 2V1AA 5KIZA 4HHDA 1P0ZA 3F1OB 3NJAA 4JGPA 5F69A 1F5MA 2VV6A 3LUQA 2VGLM 2VJWA 4HJ4A 2GZAA 1D06A 3W2ZA 4Y2FA 3T4QA 4FOFA 4CLCE 3LR3A 5HDCA 4HH2A 2B18A 1YKDA 1X0OA 2IA2A 4HJ3A 2D02A 4ZRRA 3LIEA 4IUHA 3LIBA 2A24B 4H6JA 2ZBBA 1YAXA 4P6ZM 4MMNA 1DP9A 2J3TC 2ZMVA 4UQIM 5HWVA 1DP6A 5DFYA 1OTIA 4NXGA 1TF1A 2JKTM 4R38A 4WF0A 1OPXA 2WKQA 3U2AA 3P01A 2I9VA 4G3WA 2O0YA 3O5YA 3IS2B 2QJ7A 4RQ9A 3UMDA 4L9GA 3MQOA 3RFBA 3C2WA 5DFXA 3S7OA 1XJ4A 2H28A 3MF0A 4BWIA 1W63M 3UB6A 3KSGA 3T4OA 2LB5A 4Z1WA 3JVUA 1LSVA 3EWKA 5J3WA 1MZUA 4IJGA 2ZOHA 3T4KA 3T50A 4Y5FA 2YKFA 4GW9A 2A2LA 5TBMA 5HDDA 4NKPA 1H3QA 3UB9A 2VZWA 3E4QA 4GLQA 1N9OA 1GSXA 2W27A 4GHIA 1VB6A 2G7UA 3ULFA 1F98A 2OOLA 4IUKA 3LR5A 4PKYA 2VV8A 2XA7M 3H82A 1TS0A 3EGXC 1XJ6A 3PYPA 3MR0A 4IHQA 4DN0A 2VX8A 3C30A 4WN5A 2O99A 3NHQA 4O01A 4EEPA 1T1AA 2B02A 1XJ2A 1NWZA 5DKKA 4JGRA 4HOIA 3UE6A 1YSQA 5LBRA 1OTAA 2XRNA 3EGDC 1T1BA 3KSHA 3TW8A 2XSSA 4JGQA 4KQOA 2Z6DA 2XROA 2PDRA 1S4RA 1WA9A 4FSFA 1TS8A 1VHMA 3JVVA 3LR4A 2PR5A 3PHYA 3VE3A 2J3WA 4I3AA 5HPFA 3K3DA 1V9YA 3F1NB 4ARZA 2M1CA 3VV4A 1OTEA 3T4TA 3HCYA 2Y79A 4L9FA 2BASA 3UMEA 3B47A 4NXFA 3CUEC 1GSWA 4GS9A 3FG8A 3F1PA 1OT9A 4WL9A 1T19A 1TS6A 3LR0A 4MDZA 1NLZA 4HP9A 3LIDA 5CX7A 3KYZA 3E0YA 3OBFA 5KSHA 3MMHA 3GDIA 1P9RA 3UE3A 3V67A 3VOLA 4PHTA 2VA0A 1H8MA 5HD3A 4BJPA 1JNUA 3LIAA 3R7WA 2HGVA 3OC2A 4EEUA 4OOLA 1UWPX 2Y8HA 3BQAA 2JKRI 1IOUA 4LPZA 4MN6A 3CI6A 4EQ1A 1W63Q 2W3FA 3EOIA 4XT2B 1S1ZA 2V0UA 4LLOB 4BBVA 3FPWA 3F1OA 3S7NA 3OCNA 4MN5A 3BW6A 2GJ3A 5F5YA 5DKLA 3C8CA 1Y28A 3OLOA 3ZQ5A 2P7JA 5C5KA 5IS1A 2EWWA 2FH5A 3UB7A 4DMZA 1S67L 3KSFA 5EFWA 3PBNA 4NEED 5J7EA 2PHYA 2QKPA 4PKYG 5HD5A 3PBOA 4LRXC 3T4LA 4QPRA 1LSXA 4BBTA 5FL3A 4E04A 2OAP1 3EEHA 2P08A 3KO6A 3B42A 5TBMB 4I38A 1MC0A 3K2NA 4R6LA 1ZTUA 5I5LA 5K5BA 4JGOA 4GHIB 2INWA 2Z6CA 3IBJA 2PYRA 2NUTC 2J3TD 2JN7A 1DP8A 3BQ8A 3LICA 3H82B 1F9IA 1N9LA 4R3AA 3TE8A 2L1MA 3IS2A 4HP4A 4EU0A 4CLCA 2OWHA 2W3HA 2O9CA 2WKRA 2DMWA 1OTBA 2K31A 5G4YA 4YWZA 3CAXA 5DF9A 3H7WB 1TS7A 2KDKA 3DBAA 4BBUA 2CMNA 3PBTA 4CLCD 2HJ9C 2VKSA 2W1TB 4YNRA 1OTDA 3IBRA 2MJ6A 2GX5A 5DJUA 4HI4A 3LYXA 2KX6A 3TRCA 3SW1A 3PR6A 1NRJA 2OAQ1 5HDSA 2D01A 1ODVA 1BYWA 4I5SA 1G6OA 3RTYA 4F3LA 4OOMA 5J4EA 2LB9A 1V9ZA 3CITA 3F1PB 1S1YA 2HJEA 4R70A 3A0SA 5DJTA 2W3GA 5HL6A 3MQQA 3MJQA 3D3OA 3LIFA 4HNBA 1LL8A 3KX0X 4HQAA 3S7QA 4EETB 4ME4A 2KLIA 3NOPC 3KSIA 2YKHA 3PBSA 3EQVA 2O9AA 3FPVA 2VGLS 4HJ6A 2K2NA 2QHKA 3F1NA 3EEAA 4L0LA 3R7WB 3KYQA 4I3IA 3CUEA 3FC7A 3G6OA 5F6AA 2QJ5A 2R78A 1EW0A 4H6JB 4EXOA 2L0WA 2ZMFA 3T4SA 3LI9A 3BJNA 3GECA 2VLGA 4LRYC 1N9NA 3BY8A 4GJ4A 5HWTA 5IT5A 3OCLA 5HWWA 4P6ZS 3LFVA 4EW7A 3A0RA 4HY8A 4UQIS 4DJ3A 2ZOIA 4ETXA 3K3CA 1D7EA 5HSQA 2KOIA 2VV7A 3R4KA 3VE4A 3OOVA 4GCZA 5AVEA 3S7PA 3NOTC 2VEAA 3CLOA 4Q0JA 1MKMA 1S66L 2HV1A 2PT7A 5HZHA 2NUPC 2J80A 2A24A 2PD7A 4M4XA 5G4ZA 3C38A 1TD5A 4B9OA 4MN7A 3EQUA 2O9BA 4XT2A 4O0PA 4I3JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EA9 A;  1T1C A;  1T18 A;  5AVF A;  2K7S A;  2JHE A;  1KOU A;  4EER A;  3E4P A;  3MFX A;  4KQD A;  4LRZ E;  1G28 A;  3D72 A;  2V0W A;  1DRM A;  3RH8 B;  2PYP A;  1UWN X;  1P97 A;  3NOU C;  5F68 A;  4HH3 A;  1UGU A;  3UB8 A;  2V9A A;  2L4R A;  1XFQ A;  2V1B A;  4F3L B;  4L9E A;  4I39 A;  2QWS A;  1S4S A;  3E4O A;  3CWF A;  3P7N A;  4HIA A;  1OT6 A;  1XJ3 A;  3B33 A;  2WKP A;  1OJG A;  3HJI A;  2PR6 A;  3H7W A;  4GS9 B;  3HJK A;  4WUJ A;  1LSW A;  4KUO A;  3H9W A;  2W0N A;  4WLA A;  1LT0 A;  3ICY A;  4KUK A;  3BWL A;  1OJ5 A;  5A8B A;  4K08 A;  2OWJ A;  1XFN A;  2PD8 A;  3A0V A;  4EES A;  3LI8 A;  3MXQ A;  1GSV A;  4NXB A;  3BY9 A;  5IU1 A;  4DJ2 A;  4NXE A;  2V1A A;  5KIZ A;  4HHD A;  1P0Z A;  3F1O B;  3NJA A;  4JGP A;  5F69 A;  2VV6 A;  3LUQ A;  4HJ4 A;  1D06 A;  5HDC A;  4HH2 A;  1X0O A;  4HJ3 A;  2D02 A;  3LIE A;  3LIB A;  2A24 B;  4H6J A;  2ZBB A;  1DP9 A;  5HWV A;  1DP6 A;  1OTI A;  4NXG A;  4R38 A;  4WF0 A;  2WKQ A;  2I9V A;  3UMD A;  3IS2 B;  2QJ7 A;  4RQ9 A;  4L9G A;  3MQO A;  3C2W A;  1XJ4 A;  2H28 A;  3UB6 A;  1LSV A;  3EWK A;  5J3W A;  1MZU A;  2ZOH A;  3T50 A;  2YKF A;  4GW9 A;  5TBM A;  5HDD A;  3UB9 A;  3E4Q A;  1N9O A;  1GSX A;  2W27 A;  4GHI A;  1VB6 A;  3ULF A;  1F98 A;  2OOL A;  4PKY A;  2VV8 A;  3H82 A;  1TS0 A;  1XJ6 A;  3PYP A;  3MR0 A;  4WN5 A;  3NHQ A;  4EEP A;  1T1A A;  2B02 A;  1XJ2 A;  1NWZ A;  5DKK A;  4JGR A;  4HOI A;  3UE6 A;  1OTA A;  1T1B A;  4JGQ A;  2Z6D A;  2PDR A;  1S4R A;  1WA9 A;  1TS8 A;  2PR5 A;  3PHY A;  3VE3 A;  4I3A A;  3K3D A;  1V9Y A;  3F1N B;  2M1C A;  1OTE A;  4L9F A;  2BAS A;  3UME A;  4NXF A;  1GSW A;  4GS9 A;  3FG8 A;  3F1P A;  1OT9 A;  4WL9 A;  1T19 A;  1TS6 A;  4HP9 A;  3LID A;  3GDI A;  3VOL A;  5HD3 A;  1JNU A;  3LIA A;  4EEU A;  1UWP X;  4LPZ A;  4MN6 A;  4EQ1 A;  4XT2 B;  1S1Z A;  2V0U A;  4LLO B;  4BBV A;  3F1O A;  4MN5 A;  2GJ3 A;  5F5Y A;  5DKL A;  3C8C A;  1Y28 A;  3OLO A;  3ZQ5 A;  2P7J A;  5IS1 A;  3UB7 A;  1S67 L;  5EFW A;  5J7E A;  2PHY A;  2QKP A;  4PKY G;  5HD5 A;  4LRX C;  1LSX A;  4BBT A;  4E04 A;  3EEH A;  5TBM B;  4I38 A;  4R6L A;  5I5L A;  4JGO A;  4GHI B;  2INW A;  2Z6C A;  2PYR A;  2JN7 A;  1DP8 A;  3LIC A;  3H82 B;  1F9I A;  1N9L A;  4R3A A;  2L1M A;  3IS2 A;  4HP4 A;  2OWH A;  2WKR A;  1OTB A;  5G4Y A;  4YWZ A;  3CAX A;  3H7W B;  1TS7 A;  2KDK A;  4BBU A;  2CMN A;  1OTD A;  3IBR A;  5DJU A;  4HI4 A;  3LYX A;  2KX6 A;  3SW1 A;  5HDS A;  2D01 A;  1ODV A;  1BYW A;  4I5S A;  3RTY A;  4F3L A;  5J4E A;  1V9Z A;  3F1P B;  1S1Y A;  4R70 A;  3A0S A;  5DJT A;  3MQQ A;  3MJQ A;  3LIF A;  4HNB A;  1LL8 A;  3KX0 X;  4HQA A;  4EET B;  3NOP C;  2YKH A;  4HJ6 A;  2QHK A;  3F1N A;  4I3I A;  3FC7 A;  3G6O A;  5F6A A;  2QJ5 A;  2R78 A;  1EW0 A;  4H6J B;  4EXO A;  2L0W A;  3LI9 A;  3GEC A;  2VLG A;  4LRY C;  1N9N A;  3BY8 A;  5HWT A;  5HWW A;  4EW7 A;  3A0R A;  4HY8 A;  4DJ3 A;  2ZOI A;  3K3C A;  1D7E A;  5HSQ A;  3VE4 A;  2VV7 A;  4GCZ A;  5AVE A;  3NOT C;  2VEA A;  3CLO A;  1S66 L;  2HV1 A;  5HZH A;  2J80 A;  2A24 A;  2PD7 A;  4M4X A;  5G4Z A;  4B9O A;  4XT2 A;  4I3J A; 
#chains in the Genus database with same CATH topology
 4OQ0 A;  5EOE A;  4KG5 A;  1T18 A;  2W3D A;  2JHE A;  4X1M A;  4EER A;  1QMF A;  4M3K A;  3MFX A;  1SKF A;  2G2U A;  1G28 A;  3PAE A;  2V0W A;  3SS4 A;  2XA7 S;  4Q0H A;  1FIL A;  1UWN X;  1LL5 A;  3NOU C;  4UEY A;  1CEF A;  2JKT I;  4HH3 A;  4E6W A;  4B93 A;  4NK3 A;  2Y2Q A;  4PM5 A;  4G3K A;  2P04 A;  3WRT A;  1O7E A;  2EWV A;  2OLU A;  2QWS A;  3C4O A;  3P7N A;  1FCM A;  2ZJ9 A;  1OT6 A;  1TVF A;  3B33 A;  1YLY A;  5E2E A;  3T4J A;  4GDN A;  3DTE A;  3E98 A;  1LSW A;  2W1T A;  5CEB A;  3H9W A;  2W0N A;  1N9B A;  3ICY A;  4JPM A;  3FV7 A;  5A8B A;  1PIO A;  4Y13 A;  4MBH A;  4GD8 A;  1G5U A;  1NZO A;  2IWD A;  4ETZ A;  1I2S A;  3LI8 A;  1PW8 A;  4MCW A;  1GSV A;  2ZM8 A;  1TEM A;  4WZ5 A;  1M40 A;  4II7 A;  4B4Z A;  3MQ0 A;  5EM0 A;  3ZG7 B;  4HHD A;  1P0Z A;  2Q9N A;  3HVF A;  1IKI A;  1D06 A;  4Y2F A;  4C6Y A;  3SOI A;  5EOO A;  5HDC A;  1X0O A;  4LV2 A;  2V2F F;  2D02 A;  2WGW A;  3LIE A;  2P74 A;  4IUH A;  2E8J A;  3LIB A;  5GLD A;  4H6J A;  3ZVW A;  1YAX A;  4MMN A;  2ZMV A;  3HUM A;  1HD8 A;  5FI2 A;  2UWX A;  5HWV A;  4OPR A;  1OTI A;  4YFM A;  1TF1 A;  2Y2G A;  4WF0 A;  2HDU A;  2I9V A;  4G3W A;  2ZQ7 A;  2Y2N A;  2QJ7 A;  1FCO A;  1E4D A;  3HLD A;  1HLU P;  1XJ4 A;  3MF0 A;  2XD5 A;  3MKF A;  2LB5 A;  3CG5 A;  4QY6 A;  3DAV A;  1MZU A;  2ZOH A;  3T4K A;  4Y5F A;  3IWI A;  5TBM A;  1GHP A;  3UB9 A;  2VZW A;  3E4Q A;  4GLQ A;  2Y55 A;  1J3W A;  2DNS A;  4DF6 A;  3BFE A;  1BLH A;  1DY6 A;  1XX2 A;  3MKE A;  3LY4 A;  4DKI A;  3O87 A;  3MR0 A;  2VX8 A;  3C30 A;  4S2J A;  2O99 A;  2J9P A;  5AQ9 A;  2JKG A;  3MSH A;  2JKF A;  4HOI A;  3ZNT A;  1YSQ A;  1YMX A;  3A3I A;  4R0Q A;  4R3B A;  3VSK A;  1PI5 A;  3DTK A;  2Z6D A;  4KQQ A;  1S4R A;  1YLT A;  2ZQC A;  2PR5 A;  3WS0 A;  4I3A A;  4EBL A;  5HPF A;  3F1N B;  2V20 A;  3VV4 A;  4IBX A;  2ZQA A;  3HCY A;  2Y79 A;  4L9F A;  3UDX A;  1YM1 A;  1KGE A;  3UME A;  2DRW A;  4GS9 A;  3FG8 A;  1IEM A;  4ZJ2 A;  4WL9 A;  5HFO A;  3C7V A;  1TS6 A;  3LR0 A;  3LID A;  5CX7 A;  3OBF A;  1MKI A;  4ID4 A;  2VA0 A;  4YIN A;  5HD3 A;  1JWZ A;  4BJP A;  3VFF A;  3BM6 A;  1IYQ A;  1UWP X;  4X25 A;  2Y8H A;  3UPP A;  4JKT A;  1L2S A;  1YPR A;  4XT2 B;  1S1Z A;  2V0U A;  3ZCZ A;  4BBV A;  3FPW A;  3S7N A;  3VMA A;  3OCN A;  4MN5 A;  3BFC A;  5DKL A;  1Y28 A;  4HEF A;  5C5K A;  3C4P A;  1GA9 A;  3UY6 A;  2EWW A;  2FH5 A;  3UB7 A;  4DMZ A;  1S67 L;  1Q2Q A;  3G2Z A;  1ERQ A;  2PHY A;  4PKY G;  1XXM A;  1IYS A;  3BFF A;  3BRM A;  1ONH A;  5FL3 A;  1PFL A;  4E04 A;  1YLZ A;  2P08 A;  3IXD A;  3B42 A;  5FQI A;  5HAI A;  1MC0 A;  1YLJ A;  2XLN A;  5HAQ A;  4FCF A;  1BTL A;  1ZTU A;  4OLD A;  5I5L A;  3MFD A;  2INW A;  5F83 A;  2J3T D;  1BLS A;  1N9L A;  4Y0O A;  1BT5 A;  2Y2H A;  3CAX A;  5EVI D;  3CPT B;  1FR1 A;  2HJ9 C;  2HDR A;  2VKS A;  2W1T B;  2ZC5 B;  2WKH A;  5L2F A;  3TRC A;  3O88 A;  5HDS A;  4DDY A;  1YLW A;  1C3B A;  3HLC A;  1NJ4 A;  3SS5 A;  1VEU B;  3KYE A;  4KZ7 A;  2LB9 A;  3CIT A;  3F1P B;  1S1Y A;  5DJT A;  3AGE A;  2ZD8 A;  2PBY A;  4HQA A;  3S7Q A;  1K38 A;  3HLW A;  3UDF A;  3KSI A;  3ZG0 A;  3IHB A;  2VGL S;  4HJ6 A;  3ZFZ A;  1BUE A;  2K2N A;  4PPR A;  3EEA A;  3OPH A;  4X68 A;  3KYQ A;  3R7W B;  2WGW B;  3FC7 A;  4H6J B;  1XKZ A;  2L0W A;  3DWZ A;  5FDS A;  3CJM A;  5HWT A;  3SH8 A;  4MLL A;  3V3R A;  3O86 A;  1W8Q A;  3K3C A;  5HSQ A;  3BEC A;  1K57 C;  3UE1 A;  4GCZ A;  5CHJ A;  1ACF A;  3NOT C;  3CLO A;  2UV0 E;  1MKM A;  4S2L A;  4GZB A;  1ES4 A;  2Q0O A;  1XA7 A;  2J80 A;  2PD7 A;  4DXB A;  2V8F A;  5DTT A;  5GLB A;  1GHM A;  3CMZ A;  1ES5 A;  2ZM0 A;  5CED A;  4DXC A;  2FFF B;  5A92 A;  4BMW A;  1T1C A;  5AVF A;  2WUQ A;  2K7S A;  3UDI A;  3QP1 A;  1K0K A;  2RCX A;  3GTC A;  4KQD A;  3D72 A;  2M7U A;  1CF0 A;  4BLM A;  4XXR A;  2PYP A;  4E3L A;  4LV1 A;  2QYB A;  2Y2O A;  4GDB A;  3NY4 A;  3PTE A;  2X71 A;  4PAU A;  1FCN A;  2L4R A;  2HDS A;  3VOZ A;  1XFQ A;  5AQA A;  4O8G A;  1STZ A;  1YSP A;  2V1B A;  4L9E A;  1S4S A;  3M6B A;  4Y3I A;  2WK0 A;  4HIA A;  2Y91 A;  4OOY A;  2J7V A;  4E3O A;  1EI5 A;  4WM9 A;  1OJG A;  3HJI A;  1SDN A;  2HP5 A;  1L0F A;  4GS9 B;  1E3U D;  5AQB A;  3PXP A;  1LT0 A;  3Q07 A;  3BFD A;  2JKR M;  4Z9Q A;  1OJ5 A;  5FI6 A;  2ZL1 B;  3FWL A;  4QWO A;  4WEK A;  2Z2L B;  4K0X A;  4EES A;  4LCL A;  4NXB A;  2RL3 A;  3VP4 A;  3BY9 A;  3NCK A;  5IU1 A;  4D60 A;  3ZG9 B;  5FA7 A;  3NJA A;  4JGP A;  5F69 A;  1F5M A;  1PI4 A;  4KG2 A;  2VJW A;  2GZA A;  4PM7 A;  1VM1 A;  2ZQD A;  4C3Q A;  3A3F A;  4QD4 A;  3T4Q A;  3LR3 A;  3IWQ A;  4K0W A;  2B18 A;  2Q9M A;  1HZO A;  2IA2 A;  4HJ3 A;  4ZRR A;  1GA0 A;  4PM6 A;  1FIK A;  1PZP A;  1DP9 A;  4XUX A;  5E2F A;  2XDM A;  3C5A A;  4R4R A;  3N4I A;  5CGW A;  4UQI M;  1DP6 A;  3S1Y A;  4A5R A;  2P9V B;  3LEQ A;  1OPX A;  1K57 A;  4OPY A;  1WYC A;  4LV0 A;  4OQH A;  2O0Y A;  3RFB A;  5DFX A;  5EM1 A;  1IYO A;  3S22 A;  4JXG A;  3UB6 A;  1LSV A;  5J3W A;  1SCW A;  3DTI A;  4IJG A;  3FKV A;  1E25 A;  1GHI A;  4IVI A;  4O7D A;  1AXB A;  5CER A;  1BZA A;  3IT9 A;  3NEC A;  1LI0 A;  2JCH A;  4FUW A;  3T12 B;  2W27 A;  2EFU A;  3VOY A;  1WE4 A;  4LGW A;  4QJG A;  1L0D A;  2XA7 M;  2Y2K A;  4JF6 A;  3EGX C;  1XJ6 A;  2ACG A;  4MEZ A;  1BLP A;  2B02 A;  2JE5 A;  1XJ2 A;  5HAP A;  5DKK A;  5LBR A;  1OTA A;  2XRN A;  5F82 A;  1T1B A;  3CPT A;  1ONG A;  5EPH A;  4R1G A;  1L0G A;  4EQI A;  4ESP A;  4KQO A;  4E6X A;  2XRO A;  2PDR A;  5KSC A;  5E43 A;  2XD1 A;  3VE3 A;  2J3W A;  1KE4 A;  1PZO A;  4ARZ A;  2OSU A;  3ZNY A;  3T4T A;  5CEC A;  3QP6 A;  4EUZ A;  2PBD P;  3MXR A;  1VEU A;  4ZBE A;  3B47 A;  1GSW A;  3NI9 A;  3F1P A;  1OT9 A;  1T19 A;  4GOG A;  5GL9 A;  4MDZ A;  1NYM A;  4HP9 A;  3QP5 A;  4LCM A;  3LO7 A;  5KSH A;  1N4O A;  3GDI A;  1SDE A;  3V3S A;  4R4S A;  1XA1 A;  3V67 A;  3VOL A;  4PHT A;  3T1X A;  5FDH A;  1Z6F A;  1JNU A;  3R7W A;  2BTF P;  1XGJ A;  4KZ5 A;  3IF5 A;  2JKR I;  1IOU A;  1W63 Q;  2W3F A;  3EOI A;  5JYO A;  5EV0 A;  4WMC A;  4P85 A;  5F5Y A;  4K91 A;  4BD1 A;  2P7J A;  5IS1 A;  1MPL A;  4NET A;  4OKP A;  5J7E A;  5HD5 A;  4JXV A;  4QPR A;  3W4Q A;  2OAP 1;  3EEH A;  2V1Z A;  3UPN A;  5F1F A;  1ES2 A;  4JGO A;  4GHI B;  2ZMA A;  3T1R A;  1FOF A;  1K55 C;  5CXW A;  3LIC A;  2L1M A;  3IS2 A;  3DW0 A;  4HP4 A;  2WKR A;  5I94 A;  1OTB A;  2K31 A;  1FR6 A;  4ZJ1 A;  3CHW P;  3GRJ A;  2IWB A;  1ZG6 A;  1TS7 A;  2KDK A;  3DBA A;  4BBU A;  3V50 A;  2CMN A;  3PBT A;  4CLC D;  1XP4 A;  2MJ6 A;  4U3T A;  2GX5 A;  1FQG A;  2X02 A;  3MZF A;  3LYX A;  2KX6 A;  1K4F A;  4OVD A;  3IX3 A;  5CRF A;  2D01 A;  3IH9 A;  1ODV A;  1BYW A;  4Q8I A;  3Q82 A;  1KE3 A;  1ERO A;  3NC8 A;  5EUA A;  5J4E A;  2XQZ A;  5EE8 A;  3UE0 A;  4OP8 A;  3A0S A;  3AGD A;  2W3G A;  5CGX A;  3BLS A;  4X1L A;  3N8L A;  4N1H A;  4ME4 A;  1KDW A;  3IWO A;  2H0T A;  3JYI A;  3BFG A;  5A91 A;  2YKH A;  3GVB A;  2ZL1 A;  1VET A;  2EX6 A;  3HRE A;  2G2W A;  4GD6 A;  5F6A A;  4BL2 A;  2QJ5 A;  1EW0 A;  3LCE A;  3T4S A;  3BJN A;  3WWX A;  1L3L A;  2VLG A;  1NRF A;  4OQI A;  4GJ4 A;  3UB5 P;  5IT5 A;  1D1J A;  4P6Z S;  2ZM2 A;  3A0R A;  4HY8 A;  3ISG A;  4JF4 A;  5GLC A;  4HBU A;  5G18 A;  4DJ3 A;  2ZOI A;  4ETX A;  3WS4 A;  3VE4 A;  2VV7 A;  4Q0J A;  1Z09 A;  4LV3 A;  4M4X A;  1F2K A;  3C38 A;  3M6H A;  1TD5 A;  4B9O A;  2O9B A;  4O0P A;  5EVI B;  1IKG A;  2GNX A;  4FH4 A;  2CC1 A;  2P9V A;  4RYE A;  1H8Y A;  2PU2 A;  3OZH A;  1ES3 A;  1JVJ A;  3Q1F A;  4PM9 A;  2X01 A;  4CLC C;  1DRM A;  2HF6 A;  2XK1 A;  5AJG A;  5TJJ A;  3HUN A;  4UA7 A;  2WGI A;  2I72 A;  2EX2 A;  2FZ0 A;  4UA6 A;  1DJB A;  3G30 A;  3UB8 A;  1G68 A;  1KE0 A;  1K55 A;  5HX9 A;  5L8M A;  3G31 A;  1YLP A;  1YQS A;  2V9A A;  1PWD A;  3HLG A;  5M18 A;  2JC7 A;  3O3V A;  1CK3 A;  4F3L B;  4I39 A;  3PBR A;  2EFX A;  3E4O A;  3ZVT A;  3CWF A;  4ARZ B;  1K54 C;  3LGO A;  1SKO B;  3MS6 A;  1ESI A;  3Q81 A;  2WKP A;  2IWC A;  2ZC4 B;  4QU3 A;  2WKE A;  3HJK A;  1K56 D;  4E3J A;  4G3V A;  4KUO A;  5JYP A;  4U0X A;  4N9L A;  4WLA A;  1P9W A;  4KUK A;  5D3O A;  1S6R A;  3BWL A;  4EUV A;  1IEL A;  2PD8 A;  4FH2 A;  3A0V A;  4CQH A;  4IBR A;  2EX9 A;  3AGF A;  1KGG A;  3PBQ A;  2VK3 A;  4DJ2 A;  4KQR A;  2V1A A;  5KIZ A;  1K25 A;  2VGJ A;  4KZ9 A;  2VV6 A;  4B4X A;  1NZU A;  2VGL M;  3W2Z A;  4FOF A;  2XR0 A;  4HH2 A;  4E3M A;  2C5W B;  2R9W A;  2XEP A;  2A24 B;  2OV5 A;  1S0W A;  2VGK A;  1BSG A;  2J3T C;  4RA7 A;  3V39 A;  1J9M A;  1BLC A;  1RP5 A;  4NXG A;  3B3X A;  2JKT M;  4R38 A;  3U2A A;  3P01 A;  3RJU A;  3O5Y A;  5EVI C;  3IS2 B;  2C6W B;  4RQ9 A;  4L9G A;  3S7O A;  4MNR A;  3LY3 A;  2H28 A;  4BWI A;  4ZJ3 A;  5FEF A;  3KSG A;  3T4O A;  3G4P A;  3EWK A;  3QP2 A;  3WS5 A;  3NIA A;  2FFY A;  4OPQ A;  4KEN B;  3T50 A;  1H5X A;  4JF5 A;  3IX4 A;  4GW9 A;  3ZDJ A;  5HDD A;  1K6S A;  4ZAM A;  1N9O A;  4GHI A;  2G7U A;  4P0M A;  2VV8 A;  4KZA A;  5J8X A;  2WGV A;  4IHQ A;  5TR7 A;  4DE0 A;  3NHQ A;  4O01 A;  1T1A A;  4OQG A;  4MBK A;  1U60 A;  2H10 A;  3UE6 A;  2QMI A;  4QHC A;  3SZT A;  3TW8 A;  1NY0 A;  1WA9 A;  4FSF A;  2E8I A;  2XFT A;  4P87 A;  1TS8 A;  3NDG A;  1ZC2 A;  1H8Z A;  1K4E A;  1V9Y A;  1VET B;  3GQZ A;  5DTS A;  1OTE A;  2Z2M B;  4KZ6 A;  3TSG A;  4IVK A;  4FTX A;  3IF6 C;  3IXH A;  1KDS A;  4EBP A;  3U4L P;  4RX3 A;  4S2N C;  3IQA A;  3KYZ A;  4S2O A;  1P9R A;  3UE3 A;  3TG9 A;  4JXW A;  3N7W A;  1H8M A;  4ZDX A;  2PU4 A;  2WZX A;  4P6B A;  1PYY A;  4OOL A;  5CGS A;  3BQA A;  5BOH A;  3CI6 A;  3BLM A;  2AVX A;  3MZE A;  3F1O A;  3PAG A;  1LI9 A;  5M19 A;  5CTN A;  2ZLY A;  3ZQ5 A;  2XH9 A;  4R3J A;  4WYY A;  5CHM A;  5GHZ A;  4BQM A;  3KSF A;  3A3J A;  3PBN A;  5EFW A;  4NEE D;  3HLF A;  3PBO A;  5HL1 A;  4LRX C;  1I2W A;  1ZG4 A;  4KZ3 A;  3BEB A;  4LEN A;  4E3I A;  4KZ4 A;  4UAA A;  4I38 A;  1DJC A;  2BLS A;  4R6L A;  5K5B A;  3TOI A;  1NXY A;  3LEZ A;  3IBJ A;  5EVI A;  3M2K A;  4RVA A;  2JN7 A;  3BQ8 A;  5M1A A;  3H82 B;  1F9I A;  4R3A A;  3W4O A;  3UPO A;  5FQK A;  1KVM A;  2A3U A;  4EU0 A;  1LLB A;  3A3E A;  4F94 A;  2W3H A;  2O9C A;  2HZ5 A;  3VFH A;  5G4Y A;  4YWZ A;  5DF9 A;  4HBT A;  2WAF A;  3BYD A;  3M2J A;  3OPR A;  3HUO A;  4YNR A;  1OTD A;  1LL9 A;  4S2M A;  1TDL A;  5DJU A;  4E3K A;  3G2Y A;  4HI4 A;  3RXW A;  1G6A A;  2BG1 A;  3SW1 A;  5KMW A;  1K56 A;  3WS1 A;  2V8C A;  3RTY A;  4F3L A;  4OOM A;  5FQ9 A;  3NBL A;  5HAR A;  1IYP A;  1PWC A;  1V9Z A;  5L10 A;  3W4P A;  1SKO A;  2HJE A;  4R70 A;  1O07 A;  3HLE A;  3MJQ A;  4HNB A;  3QNB A;  2KLI A;  3ZGA B;  2WAE A;  2Y4A A;  4GNU A;  3PBS A;  4N1X A;  4S2P A;  1JTG A;  4ZTK A;  5FAQ A;  4Y17 A;  3G6O A;  5FQM A;  3IF6 A;  2WKI A;  5FAT A;  3LI9 A;  3GEC A;  1MWS A;  3G35 A;  3QP8 A;  3V5M A;  4X69 A;  3OCL A;  4S2N A;  4R23 A;  5U47 A;  3LFV A;  3IXB A;  4S2K A;  4EBN A;  3W8K A;  4EWF A;  2KOI A;  2HP6 A;  3S7P A;  1YMS A;  3CZD A;  5GHX A;  2XGN A;  2HV1 A;  2ZQ9 A;  2A24 A;  3WRZ A;  2HDQ A;  3OPL A;  5FSR A;  3EQU A;  4OLG A;  2EA9 A;  3I7J A;  3VP2 A;  1NLY A;  4NG2 A;  5L07 A;  1IFQ A;  1KOU A;  5A90 A;  3E4P A;  2H0Y A;  3D4F A;  4CLC B;  2QPN A;  3NUL A;  4LRZ E;  1ALQ A;  3RH8 B;  3HBR A;  3ZG5 A;  3TJZ C;  4X55 A;  3ZYT A;  1JWV A;  2PAV P;  1P97 A;  2W1R A;  4Q0I A;  5F68 A;  1YT4 A;  1UGU A;  2W3E A;  1CJF A;  4IED A;  4YOF A;  1AWI A;  2M7V A;  4PM8 A;  4RX2 A;  4FD8 A;  3UNW A;  3IH8 A;  3IHA A;  4BD0 A;  4D2O A;  1E3U A;  4WEJ A;  2R9X A;  3NDE A;  3UO9 A;  5MC7 A;  1XJ3 A;  2PR6 A;  3H7W A;  4AFI A;  5DVA A;  1PWG A;  4WEL A;  4WUJ A;  1ZHH B;  4UA9 A;  3RXX A;  5HPI A;  2WZZ A;  5HW3 A;  3GMW A;  3G32 A;  1Y54 A;  1W7F A;  4KZB A;  1L0E A;  4K08 A;  2OWJ A;  1XFN A;  1W8Y A;  1CI8 A;  3MXQ A;  1RGZ A;  4DE1 A;  2Y2I A;  3Q7V A;  2XFS A;  5E2G A;  4NXE A;  1ZKJ A;  3F1O B;  1MWU A;  5FAO A;  2Y2L A;  4H8R A;  3LUQ A;  1CEG A;  5DF7 A;  4HJ4 A;  3WS2 A;  1Q2P A;  3SS3 A;  3MXS A;  1WYB A;  5GLA A;  3G34 A;  4CLC E;  3ZG8 B;  1YKD A;  1H0M A;  2ZC3 B;  1MWR A;  5DTK A;  2Y2M A;  4S2I A;  4X6T A;  2ZBB A;  1JTD A;  4P6Z M;  2PRF A;  3C7U A;  5DFY A;  1QME A;  4DDS A;  5FQJ A;  2WKQ A;  4Y0T A;  3E2L A;  5E2H A;  3OPP A;  4CJN A;  1A0K A;  3S4X A;  1I5Q A;  3UMD A;  3MQO A;  3C2W A;  3GR2 A;  1W63 M;  3DWK A;  4Y15 A;  4Z1W A;  3JVU A;  5CHU A;  2A49 A;  2EXB A;  4OP5 A;  5GHY A;  2Y59 A;  1EWZ A;  2YKF A;  2A2L A;  2DCF A;  4JBF A;  3UN7 A;  4XUZ A;  4NKP A;  1H3Q A;  1GSX A;  1VB6 A;  3ULF A;  1F98 A;  2OOL A;  4IUK A;  3LR5 A;  2Y2J A;  3P98 A;  4PKY A;  5EEC A;  5TFQ A;  3H82 A;  4GKU A;  4CPK A;  1TS0 A;  1OME A;  4DE3 A;  3PYP A;  1MXO A;  1ESU A;  3MBZ A;  3SH9 A;  4DN0 A;  4WN5 A;  4C75 A;  2B5R A;  4EEP A;  3D9Y A;  1XPB A;  1NWZ A;  4JGR A;  3L7H A;  3EGD C;  4N92 A;  3KSH A;  2XSS A;  4JGQ A;  2ZQ8 A;  1DJA A;  3N6I A;  1VHM A;  3JVV A;  4OPZ A;  4Y0U A;  2HPB A;  3LR4 A;  3PHY A;  3K3D A;  2M1C A;  1W5D A;  1PNE A;  4X53 A;  5EVE A;  2BAS A;  3IF6 B;  1BUL A;  4KZ8 A;  1FSW A;  4NXF A;  3CUE C;  5AQ7 A;  4BEN A;  3QHY A;  3N8S A;  1NLZ A;  3E2K A;  1TDG A;  3IX8 A;  3QP4 A;  4WZ4 A;  3E0Y A;  4LFU A;  3Q7Z A;  3MMH A;  3FZC A;  4QB8 A;  3QNC A;  1ERM A;  4MBF A;  3LIA A;  2HGV A;  3OC2 A;  4EEU A;  1MBL A;  1KGF A;  3DTM A;  4LPZ A;  4MN6 A;  1K6R A;  5F1G A;  4EQ1 A;  1NYY A;  4LLO B;  1W79 A;  1Y4O A;  2WAD A;  4WBG A;  3BW6 A;  1PW1 A;  2GJ3 A;  2B95 A;  3C8C A;  3OLO A;  4HES A;  4DRT A;  2ZC7 A;  2J8Y A;  1FSY A;  5EVL A;  1CQA A;  1RCJ A;  2QKP A;  4UHU A;  4WMC D;  3T4L A;  5IHV A;  1SZV A;  1LSX A;  4BBT A;  4B88 A;  3KO6 A;  4U0T A;  1MY8 A;  3ITB A;  5TBM B;  3N8R A;  2JBF A;  3K2N A;  2EX8 A;  2OLV A;  2Z6C A;  2PYR A;  2NUT C;  3ITA A;  1DP8 A;  3TE8 A;  3GSG A;  2J9O A;  1XGI A;  2HP9 A;  4CLC A;  2OWH A;  1LHY A;  2DMW A;  3FYZ A;  3FKW A;  2XF3 A;  3H7W B;  1HTZ A;  5FAP A;  5A93 A;  5CTM A;  1VQQ A;  1CI9 A;  3IBR A;  5FI7 A;  2EXA A;  5FQQ A;  1JWP A;  3T1S A;  4QY5 A;  3PR6 A;  1NRJ A;  2OAQ 1;  3HLB A;  4I5S A;  3JPU A;  1G6O A;  1M6K A;  1K54 A;  1KVL A;  4JLF A;  3VP1 A;  2GDN A;  5DF8 A;  4BL3 A;  3P09 A;  1SHV A;  4E3N A;  3HL9 A;  5TGF A;  1HVB A;  3Q7V B;  5HL6 A;  3MQQ A;  3D3O A;  3LIF A;  1LL8 A;  4WZ5 C;  3KX0 X;  4GN2 A;  3A3D A;  4EET B;  2Y2P A;  3NOP C;  4JXS A;  3EQV A;  2O9A A;  3FPV A;  2QHK A;  3F1N A;  4L0L A;  4I3I A;  3CUE A;  3T1Q B;  3SH7 A;  4Y7P A;  1PRQ A;  5FEG A;  2R78 A;  4EV4 A;  4N9K A;  4EXO A;  2ZMF A;  3VSL A;  4OH0 A;  3IXG A;  4LRY C;  1N9N A;  3BY8 A;  4KG6 A;  3VP0 A;  5KZH A;  3VP3 A;  5HWW A;  3L9K A;  4EW7 A;  3GV9 A;  2WYX A;  4UQI S;  3MZD A;  4DE2 A;  1D7E A;  2QZ6 A;  4PMA A;  3R4K A;  3OOV A;  5AVE A;  4GB7 A;  4OON A;  1GCE A;  5L09 A;  2VEA A;  1S66 L;  2PT7 A;  5HZH A;  3ZHH A;  2NUP C;  1MWT A;  5G4Z A;  2H5S A;  2ZC6 B;  4X56 A;  5FAS A;  1RGY A;  4MN7 A;  4XT2 A;  4I3J A; 
#chains in the Genus database with same CATH homology
 2EA9 A;  4BMW A;  1T1C A;  1T18 A;  2W3D A;  5AVF A;  1NLY A;  2GNX A;  2K7S A;  2JHE A;  1IFQ A;  1KOU A;  4EER A;  3E4P A;  3MFX A;  4CLC B;  4KQD A;  4LRZ E;  1G28 A;  3D72 A;  2V0W A;  2M7U A;  4CLC C;  1DRM A;  3RH8 B;  2PYP A;  2HF6 A;  2XA7 S;  3TJZ C;  3ZYT A;  4Q0H A;  5AJG A;  5TJJ A;  1UWN X;  2QYB A;  1P97 A;  2W1R A;  3NOU C;  4UEY A;  4Q0I A;  5F68 A;  2JKT I;  2FZ0 A;  4HH3 A;  1UGU A;  2W3E A;  3UB8 A;  4B93 A;  4PAU A;  4YOF A;  5L8M A;  2M7V A;  2V9A A;  2L4R A;  1XFQ A;  4O8G A;  1STZ A;  1YSP A;  2V1B A;  2P04 A;  4G3K A;  4F3L B;  2EWV A;  4L9E A;  4I39 A;  2QWS A;  1S4S A;  3PBR A;  4WEJ A;  4Y3I A;  3E4O A;  3CWF A;  4ARZ B;  3P7N A;  4HIA A;  1OT6 A;  5MC7 A;  1XJ3 A;  3B33 A;  2WKP A;  1OJG A;  3T4J A;  3HJI A;  2PR6 A;  3H7W A;  4AFI A;  3E98 A;  4GS9 B;  3HJK A;  4WEL A;  4WUJ A;  1ZHH B;  1LSW A;  2W1T A;  4G3V A;  4KUO A;  3PXP A;  3H9W A;  2W0N A;  5HPI A;  4WLA A;  1LT0 A;  1P9W A;  3ICY A;  4KUK A;  2JKR M;  3BWL A;  1OJ5 A;  4EUV A;  5A8B A;  4K08 A;  4WEK A;  2OWJ A;  1XFN A;  2PD8 A;  3A0V A;  4ETZ A;  4CQH A;  4EES A;  3LI8 A;  4MCW A;  3MXQ A;  1GSV A;  4NXB A;  3BY9 A;  4II7 A;  3PBQ A;  5IU1 A;  3MQ0 A;  4DJ2 A;  4NXE A;  2V1A A;  5KIZ A;  4HHD A;  1P0Z A;  3F1O B;  3NJA A;  4JGP A;  5F69 A;  1F5M A;  2VV6 A;  3LUQ A;  2VGL M;  2VJW A;  4HJ4 A;  2GZA A;  1D06 A;  3W2Z A;  4Y2F A;  3T4Q A;  4FOF A;  4CLC E;  3LR3 A;  5HDC A;  4HH2 A;  2B18 A;  1YKD A;  1X0O A;  2IA2 A;  4HJ3 A;  2D02 A;  4ZRR A;  3LIE A;  4IUH A;  3LIB A;  2A24 B;  4H6J A;  2ZBB A;  1YAX A;  4P6Z M;  4MMN A;  1DP9 A;  2J3T C;  2ZMV A;  4UQI M;  5HWV A;  1DP6 A;  5DFY A;  1OTI A;  4NXG A;  1TF1 A;  2JKT M;  4R38 A;  4WF0 A;  1OPX A;  2WKQ A;  3U2A A;  3P01 A;  2I9V A;  4G3W A;  2O0Y A;  3O5Y A;  3IS2 B;  2QJ7 A;  4RQ9 A;  3UMD A;  4L9G A;  3MQO A;  3RFB A;  3C2W A;  5DFX A;  3S7O A;  1XJ4 A;  2H28 A;  3MF0 A;  4BWI A;  1W63 M;  3UB6 A;  3KSG A;  3T4O A;  2LB5 A;  4Z1W A;  3JVU A;  1LSV A;  3EWK A;  5J3W A;  1MZU A;  4IJG A;  2ZOH A;  3T4K A;  3T50 A;  4Y5F A;  2YKF A;  4GW9 A;  2A2L A;  5TBM A;  5HDD A;  4NKP A;  1H3Q A;  3UB9 A;  2VZW A;  3E4Q A;  4GLQ A;  1N9O A;  1GSX A;  2W27 A;  4GHI A;  1VB6 A;  2G7U A;  3ULF A;  1F98 A;  2OOL A;  4IUK A;  3LR5 A;  4PKY A;  2VV8 A;  2XA7 M;  3H82 A;  1TS0 A;  3EGX C;  1XJ6 A;  3PYP A;  3MR0 A;  4IHQ A;  4DN0 A;  2VX8 A;  3C30 A;  4WN5 A;  2O99 A;  3NHQ A;  4O01 A;  4EEP A;  1T1A A;  2B02 A;  1XJ2 A;  1NWZ A;  5DKK A;  4JGR A;  4HOI A;  3UE6 A;  1YSQ A;  5LBR A;  1OTA A;  2XRN A;  3EGD C;  1T1B A;  3KSH A;  3TW8 A;  2XSS A;  4JGQ A;  4KQO A;  2Z6D A;  2XRO A;  2PDR A;  1S4R A;  1WA9 A;  4FSF A;  1TS8 A;  1VHM A;  3JVV A;  3LR4 A;  2PR5 A;  3PHY A;  3VE3 A;  2J3W A;  4I3A A;  5HPF A;  3K3D A;  1V9Y A;  3F1N B;  4ARZ A;  2M1C A;  3VV4 A;  1OTE A;  3T4T A;  3HCY A;  2Y79 A;  4L9F A;  2BAS A;  3UME A;  3B47 A;  4NXF A;  3CUE C;  1GSW A;  4GS9 A;  3FG8 A;  3F1P A;  1OT9 A;  4WL9 A;  1T19 A;  1TS6 A;  3LR0 A;  4MDZ A;  1NLZ A;  4HP9 A;  3LID A;  5CX7 A;  3KYZ A;  3E0Y A;  3OBF A;  5KSH A;  3MMH A;  3GDI A;  1P9R A;  3UE3 A;  3V67 A;  3VOL A;  4PHT A;  2VA0 A;  1H8M A;  5HD3 A;  4BJP A;  1JNU A;  3LIA A;  3R7W A;  2HGV A;  3OC2 A;  4EEU A;  4OOL A;  1UWP X;  2Y8H A;  3BQA A;  2JKR I;  1IOU A;  4LPZ A;  4MN6 A;  3CI6 A;  4EQ1 A;  1W63 Q;  2W3F A;  3EOI A;  4XT2 B;  1S1Z A;  2V0U A;  4LLO B;  4BBV A;  3FPW A;  3F1O A;  3S7N A;  3OCN A;  4MN5 A;  3BW6 A;  2GJ3 A;  5F5Y A;  5DKL A;  3C8C A;  1Y28 A;  3OLO A;  3ZQ5 A;  2P7J A;  5C5K A;  5IS1 A;  2EWW A;  2FH5 A;  3UB7 A;  4DMZ A;  1S67 L;  3KSF A;  5EFW A;  3PBN A;  4NEE D;  5J7E A;  2PHY A;  2QKP A;  4PKY G;  5HD5 A;  3PBO A;  4LRX C;  3T4L A;  4QPR A;  1LSX A;  4BBT A;  5FL3 A;  4E04 A;  2OAP 1;  3EEH A;  2P08 A;  3KO6 A;  3B42 A;  5TBM B;  4I38 A;  1MC0 A;  3K2N A;  4R6L A;  1ZTU A;  5I5L A;  5K5B A;  4JGO A;  4GHI B;  2INW A;  2Z6C A;  3IBJ A;  2PYR A;  2NUT C;  2J3T D;  2JN7 A;  1DP8 A;  3BQ8 A;  3LIC A;  3H82 B;  1F9I A;  1N9L A;  4R3A A;  3TE8 A;  2L1M A;  3IS2 A;  4HP4 A;  4EU0 A;  4CLC A;  2OWH A;  2W3H A;  2O9C A;  2WKR A;  2DMW A;  1OTB A;  2K31 A;  5G4Y A;  4YWZ A;  3CAX A;  5DF9 A;  3H7W B;  1TS7 A;  2KDK A;  3DBA A;  4BBU A;  2CMN A;  3PBT A;  4CLC D;  2HJ9 C;  2VKS A;  2W1T B;  4YNR A;  1OTD A;  3IBR A;  2MJ6 A;  2GX5 A;  5DJU A;  4HI4 A;  3LYX A;  2KX6 A;  3TRC A;  3SW1 A;  3PR6 A;  1NRJ A;  2OAQ 1;  5HDS A;  2D01 A;  1ODV A;  1BYW A;  4I5S A;  1G6O A;  3RTY A;  4F3L A;  4OOM A;  5J4E A;  2LB9 A;  1V9Z A;  3CIT A;  3F1P B;  1S1Y A;  2HJE A;  4R70 A;  3A0S A;  5DJT A;  2W3G A;  5HL6 A;  3MQQ A;  3MJQ A;  3D3O A;  3LIF A;  4HNB A;  1LL8 A;  3KX0 X;  4HQA A;  3S7Q A;  4EET B;  4ME4 A;  2KLI A;  3NOP C;  3KSI A;  2YKH A;  3PBS A;  3EQV A;  2O9A A;  3FPV A;  2VGL S;  4HJ6 A;  2K2N A;  2QHK A;  3F1N A;  3EEA A;  4L0L A;  3R7W B;  3KYQ A;  4I3I A;  3CUE A;  3FC7 A;  3G6O A;  5F6A A;  2QJ5 A;  2R78 A;  1EW0 A;  4H6J B;  4EXO A;  2L0W A;  2ZMF A;  3T4S A;  3LI9 A;  3BJN A;  3GEC A;  2VLG A;  4LRY C;  1N9N A;  3BY8 A;  4GJ4 A;  5HWT A;  5IT5 A;  3OCL A;  5HWW A;  4P6Z S;  3LFV A;  4EW7 A;  3A0R A;  4HY8 A;  4UQI S;  4DJ3 A;  2ZOI A;  4ETX A;  3K3C A;  1D7E A;  5HSQ A;  2KOI A;  2VV7 A;  3R4K A;  3VE4 A;  3OOV A;  4GCZ A;  5AVE A;  3S7P A;  3NOT C;  2VEA A;  3CLO A;  4Q0J A;  1MKM A;  1S66 L;  2HV1 A;  2PT7 A;  5HZH A;  2NUP C;  2J80 A;  2A24 A;  2PD7 A;  4M4X A;  5G4Z A;  3C38 A;  1TD5 A;  4B9O A;  4MN7 A;  3EQU A;  2O9B A;  4XT2 A;  4O0P A;  4I3J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...