4HY8A

Structures of pr1 and pr2 intermediates from time-resolved laue crystallography
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
125
structure length
125
Chain Sequence
b'MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photoactive yellow protein
publication title Volume-conserving trans-cis isomerization pathways in photoactive yellow protein visualized by picosecond X-ray crystallography
pubmed doi rcsb
source organism Halorhodospira halophila
molecule tags Luminescent protein
total genus 41
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2012-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4hy8A00
2D02A 1OT9A 1T1CA 4HOIA 3F1PB 4WLAA 2V0UA 3E4OA 4I3JA 4LRXC 4PKYA 3A0SA 3CWFA 2VV8A 4I38A 4HJ3A 2GJ3A 1T19A 3A0VA 4BBVA 3B33A 1S66L 4YWZA 4E04A 1F98A 1WA9A 1OTIA 3CAXA 1T1AA 2PD7A 4EXOA 2A24B 2QHKA 4HJ4A 2P7JA 3CLOA 4M4XA 4I5SA 2H28A 1DP9A 4LPZA 1N9NA 3GDIA 1S67L 3MR0A 5J7EA 3BY9A 1OJ5A 4EERA 4R6LA 3F1OA 3E4PA 4JGQA 2ZOHA 2PHYA 3LI8A 4HI4A 1S1YA 5IS1A 3ZQ5A 2KDKA 1DP6A 1XJ6A 2PR5A 3MXQA 3GECA 4HNBA 3UB7A 5DJTA 4B9OA 2ZOIA 2VLGA 3NJAA 1XFQA 3IS2A 3MJQA 2VV6A 3PYPA 1G28A 3HJKA 2ZBBA 3C2WA 3H82A 1GSXA 1UGUA 4BBUA 3K3CA 4LRYC 4WL9A 1P0ZA 2QKPA 5I5LA 2M1CA 3F1OB 1P97A 1OTAA 3G6OA 2D01A 3D72A 4HH2A 4WN5A 2BASA 5HDCA 4GCZA 1F9IA 3OLOA 3IS2B 2L0WA 4NXBA 3H82B 2L1MA 2INWA 4GS9A 5G4YA 5HDSA 4R38A 5F68A 5J3WA 4EW7A 5A8BA 4NXGA 4HY8A 3LIFA 5HWVA 5G4ZA 1KOUA 2JHEA 1UWNX 2W0NA 3H9WA 3LI9A 3LIEA 2HV1A 4L9EA 4EEUA 4MN5A 3LICA 3LUQA 1TS0A 4I39A 2W27A 2VEAA 4HHDA 5F6AA 4GS9B 3BY8A 5J4EA 2V1BA 2WKRA 2YKFA 3EWKA 1BYWA 4LLOB 4XT2A 2KX6A 5AVEA 3LYXA 2PYPA 2QJ5A 1S1ZA 3ICYA 3UMEA 1LSVA 2WKQA 3F1NA 4R70A 1N9OA 3VE4A 1XFNA 1V9YA 3NHQA 4K08A 4WUJA 3MFXA 2V1AA 5HD5A 2EA9A 4JGPA 5TBMA 3NOPC 4GHIA 1DRMA 4RQ9A 1GSVA 3C8CA 3EEHA 4I3IA 3RTYA 1N9LA 2PDRA 1LL8A 3PHYA 4XT2B 5F69A 5DKLA 4PKYG 2JN7A 3ULFA 2PR6A 5EFWA 1LSXA 4I3AA 3LIAA 4DJ3A 3F1NB 1XJ4A 4F3LA 2J80A 2K7SA 4EQ1A 5HWTA 4L9GA 4KUOA 4HP9A 2CMNA 3A0RA 2Z6CA 4MN6A 5TBMB 4GHIB 1S4SA 1GSWA 3UB9A 1TS8A 1JNUA 1S4RA 4H6JA 5KIZA 3FG8A 5HD3A 3VE3A 1LSWA 3UE6A 3P7NA 3NOUC 2I9VA 1V9ZA 1TS7A 5IU1A 5F5YA 5HSQA 1EW0A 3NOTC 5DKKA 2OWJA 4EETB 4F3LB 1OT6A 1MZUA 4KUKA 4HQAA 2OOLA 4HP4A 3VOLA 3SW1A 3UB8A 4R3AA 2L4RA 3KX0X 1XJ3A 2OWHA 1T18A 4WF0A 4EESA 1X0OA 4DJ2A 4H6JB 2YKHA 1T1BA 3H7WA 2B02A 4KQDA 5DJUA 1NWZA 2QWSA 4NXEA 5HZHA 3E4QA 1D7EA 4EEPA 2Z6DA 1TS6A 3K3DA 4NXFA 1DP8A 4BBTA 2VV7A 3T50A 3F1PA 2PYRA 3IBRA 1D06A 3UMDA 1OJGA 2WKPA 3FC7A 1XJ2A 3RH8B 4HH3A 4JGRA 1UWPX 1LT0A 3UB6A 1ODVA 5AVFA 3MQQA 5HDDA 4LRZE 2PD8A 3LIBA 4GW9A 4HIAA 2V9AA 2A24A 3BWLA 1VB6A 2V0WA 1Y28A 1OTDA 4JGOA 4HJ6A 3H7WB 4L9FA 1OTEA 2QJ7A 3LIDA 3HJIA 1OTBA 5HWWA 2R78A 3MQOA
chains in the Genus database with same CATH superfamily
3EGDC 3HLFA 4MEZA 3T12B 3F1PB 1F5MA 5TFQA 4WMCD 1PZOA 4PKYA 1P9WA 4KQOA 3A0SA 1S6RA 3CWFA 2VV8A 1ACFA 4S2MA 1M40A 4I38A 4KQRA 2GJ3A 1T19A 1FCOA 1S66L 4QPRA 3W8KA 2VZWA 4E04A 2WGWA 3CAXA 5HPFA 4JXWA 2O9CA 3EGXC 5M1AA 5FQKA 2W3HA 2DRWA 2QHKA 2P7JA 2JKGA 4F94A 4GLQA 4KENB 2X01A 2ZQ7A 1DP9A 4LPZA 1W8QA 2OLUA 4Y5FA 3UNWA 3HUOA 2ZD8A 2EWVA 3MR0A 3LO7A 1XPBA 1KE3A 3LR3A 1K56A 4UA9A 5DFYA 2JKRM 3CI6A 1DJCA 3ZQ5A 3W2ZA 3UPOA 1SKFA 1HZOA 5FEFA 5HL1A 3AGFA 1PW8A 3MXQA 2ZQ8A 3UB7A 3EOIA 3BFGA 5JYPA 2ZOIA 1E25A 4K91A 2ZL1B 4PHTA 1K25A 1G28A 2CC1A 5E2EA 3T4SA 1G6AA 3H82A 5TGFA 1GSXA 5A90A 2NUPC 3IQAA 5DTSA 2JKTM 1TDGA 3NY4A 2M1CA 1YQSA 1K57A 1P97A 3BQ8A 1NLZA 2HDUA 4BD0A 2D01A 2VGLM 3D72A 3DTIA 4AFIA 4DE0A 3S1YA 4KZ5A 2V2FF 3FKWA 2BLSA 1K4EA 1SCWA 4X1LA 2ZMVA 1XA1A 4OPZA 2LB5A 2O99A 4QU3A 1HVBA 5CGWA 4WMCA 2H0TA 2ZM2A 3QP2A 3R7WA 4BQMA 4C75A 5TJJA 4GJ4A 2K2NA 4IVKA 5KZHA 3CUEA 4JF5A 3G2ZA 4Q0HA 2G7UA 1WYCA 4EQIA 1NRJA 5EVLA 3GQZA 4JBFA 1WYBA 3VMAA 3LIFA 5HWVA 5FQ9A 3WS2A 4MCWA 2A2LA 4P6ZM 2EXBA 4WM9A 4FD8A 3BFDA 2Y59A 3LI9A 4OP5A 3RXXA 1HD8A 4MMNA 1NYMA 3ITBA 2HV1A 2VGLS 3LICA 1ES4A 4I39A 4N9LA 1IYPA 5GLCA 2QZ6A 4Z1WA 4ZDXA 5J4EA 1PZPA 4N92A 1K55C 1VEUA 5IT5A 2ACGA 2V20A 3QP1A 1H8YA 3SH8A 2FH5A 1RP5A 3IT9A 1ES5A 5CHUA 4WZ5A 4X53A 1JWPA 2KX6A 3WRZA 2O0YA 1NRFA 3WS4A 1YT4A 1HTZA 5E2HA 3LYXA 2X02A 1KE0A 3JVUA 2XFSA 3UMEA 2NUTC 4PMAA 4CLCD 4Y17A 3LY3A 1XFNA 3NHQA 3C30A 2Y2IA 3IH9A 1K6RA 1XGJA 2Q9MA 3M2KA 1KGGA 3OZHA 1W63Q 1DRMA 3GR2A 1GSVA 4FH4A 3HLEA 1WE4A 3PTEA 4II7A 4OPQA 3PR6A 4P6ZS 2IA2A 1CJFA 3M2JA 4XT2B 5F69A 5DKLA 1PRQA 4PKYG 3NECA 1AXBA 3C38A 5EFWA 3VOZA 2C6WB 2H0YA 2UV0E 3IF6C 2P08A 4C3QA 5FATA 4O7DA 1MPLA 1YSQA 1HLUP 2GZAA 3IXGA 4JXSA 2CMNA 3MBZA 4RA7A 3TRCA 4E3IA 1Q2PA 4UHUA 5DFXA 3GRJA 3HBRA 3QNCA 4GHIB 3W4OA 1GSWA 3A3DA 4E3JA 2Y2MA 3M6BA 4GD8A 1JNUA 5DF7A 3Q7VA 5DTTA 2HP9A 1H5XA 4M3KA 4U0XA 4DXBA 4BLMA 3DTEA 2JE5A 1L2SA 1TS7A 3S7OA 3DAVA 5IU1A 5AQ9A 3NOTC 1NYYA 2W3EA 5E43A 5GHYA 3PAGA 4NG2A 3MZEA 3HLWA 4KUKA 4HQAA 2Y2JA 3HCYA 5F1FA 3SZTA 3BJNA 2L4RA 4WBGA 4OH0A 4WF0A 2ZQCA 4GDBA 3ITAA 2O9BA 1X0OA 5F82A 2W1RA 5L07A 3HUNA 1O07A 2YKHA 1CI8A 1GCEA 4KQDA 5DJUA 5HX9A 3PBSA 4CLCA 3IXHA 3E4QA 4LV3A 2LB9A 3UE3A 1TS6A 5EVIB 2E8JA 4NXFA 3UE1A 3T50A 3V50A 5LBRA 3S7PA 3F1PA 1MKMA 3VSLA 2W1TB 3UMDA 3HLBA 1OJGA 4A5RA 2DNSA 3D4FA 1UWPX 1LT0A 1ZKJA 2HDRA 4R4SA 4N1XA 3OPRA 3NULA 1Y4OA 4RYEA 4KZ3A 3DWZA 1EROA 4D2OA 4C6YA 4LCLA 3BWLA 1VB6A 1CK3A 1YLZA 3V39A 1FIKA 4GN2A 4HJ6A 1ERMA 3M6HA 2J9PA 1YAXA 3Q1FA 4P0MA 5TR7A 5J8XA 1ZG6A 3VV4A 3IH8A 3MQOA 4B88A 1N4OA 4FTXA 1OT9A 4HOIA 3V3RA 4WLAA 5AJGA 3E4OA 1TVFA 4X6TA 1CF0A 1H3QA 1E3UD 4RVAA 3G32A 1BTLA 2HF6A 1OTIA 1WA9A 3MQ0A 1T1AA 2IWCA 2PD7A 2WYXA 4ETZA 3OBFA 1RCJA 1O7EA 1STZA 2A24B 4OQHA 4QB8A 1VQQA 3N7WA 5EOEA 2Y2NA 2ZL1A 5A93A 3G4PA 4I5SA 2H28A 3JPUA 3CHWP 2HP6A 3GDIA 1XXMA 3T1RA 3EEAA 4S2IA 4EBPA 2XROA 1TEMA 5EVEA 3LFVA 2Y2OA 3C7UA 1KVLA 4S2LA 5HW3A 5E2GA 2AVXA 3HREA 4S2NA 2WGIA 3FKVA 4HI4A 1FILA 4RX2A 1S1YA 2Q0OA 1DP6A 3O87A 2ZLYA 3D3OA 2Y2KA 4P87A 3GECA 4GZBA 4WYYA 4R23A 2VLGA 3U4LP 1XFQA 1H8ZA 1GA9A 2GX5A 3MJQA 1FQGA 1C3BA 1YLPA 3HJKA 4E6XA 3UDXA 2WZZA 4PM7A 3N8LA 3C2WA 3FWLA 4G3VA 4KG2A 3Q07A 2PRFA 3G30A 3TG9A 1PWGA 3F1OB 2XLNA 3UDFA 4MLLA 3IWIA 2JC7A 4DDSA 4ESPA 3PBTA 3QP6A 3O86A 2BASA 3IF5A 2M7VA 4B4XA 2VKSA 4QWOA 4K0XA 2MJ6A 1KDWA 1W5DA 1L0FA 1FOFA 3PXPA 4EUVA 3O5YA 4NXBA 3PBNA 4DDYA 3T4TA 1E3UA 1KVMA 4PAUA 2WADA 4Z9QA 5HDSA 3ZNTA 4R38A 2ZC3B 4LGWA 3IHAA 2ZQDA 3A3EA 4EW7A 4O8GA 4RX3A 4EU0A 3C4PA 5A91A 4DMZA 2EX9A 3MXSA 3SS5A 4BWIA 1ESUA 1K54A 4HY8A 3KO6A 1KOUA 2JHEA 2Y2HA 3Q81A 4ZRRA 4ETXA 2H5SA 1UWNX 3H9WA 5EVID 3RJUA 4S2JA 1CI9A 5HL6A 1G68A 3N6IA 4MN5A 5FEGA 1S0WA 3DW0A 3LUQA 3BYDA 4HHDA 1QMEA 2WAEA 3BFFA 5F6AA 4GS9B 2VK3A 4B93A 1IEMA 3T4KA 1IYQA 3IWOA 2Y4AA 3EWKA 1L3LA 4LLOB 1MWRA 3QNBA 4XT2A 2Y2PA 2KLIA 5EUAA 4ZJ2A 4KZ9A 5HAPA 3V3SA 3ZG0A 3E2KA 5FQQA 3ICYA 1LSVA 2J9OA 1N9OA 3VE4A 2R9XA 3VP1A 2ZC7A 4GOGA 3TOIA 4K08A 4BENA 1PNEA 1FR6A 2PBDP 3MFXA 1PWDA 3BFCA 2ZC4B 2XD1A 3TE8A 4E3OA 1NY0A 2EA9A 2J3TC 4GHIA 4OVDA 3R4KA 3UB5P 4NEED 2XSSA 2K31A 2Q9NA 5CXWA 5CEDA 4UA7A 1YMSA 5DVAA 1N9LA 4E3LA 2Y2LA 4NK3A 2JN7A 1IYOA 2WUQA 5AQ7A 4HBTA 5FI6A 5F1GA 3OOVA 1YMXA 5GHXA 4I3AA 4MBFA 2P9VB 1FSYA 4IEDA 2G2WA 3A3FA 2OAQ1 4X56A 5HWTA 4L9GA 1MXOA 3WWXA 3KYEA 3TW8A 1SDEA 1S4SA 5MC7A 4PM9A 1JVJA 4IBXA 3CMZA 1K0KA 4L0LA 4EBLA 2Y55A 3VE3A 1K57C 4R3JA 2XEPA 4CJNA 5EVIA 3A3JA 3ZNYA 2FFYA 2I72A 2OLVA 1EW0A 3N4IA 4EETB 4S2PA 1W79A 3IXDA 4FSFA 4DN0A 1ES3A 2W1TA 1MZUA 5L8MA 2OOLA 4UQIM 3MSHA 1GHMA 4IHQA 4H8RA 4KZ4A 3BECA 3KX0X 5K5BA 4KZBA 4Y0OA 4JKTA 4EESA 4JF6A 3LR0A 4ZAMA 1G5UA 4X1MA 3CUEC 3O3VA 4JXVA 4H6JB 4WZ4A 1NWZA 5HZHA 4HESA 2WKHA 3WRTA 2RCXA 5EECA 3I7JA 2VV7A 3E98A 2H10A 4QY5A 2A3UA 1D06A 3L7HA 3FC7A 4HH3A 3LGOA 3UB6A 3LCEA 2EX8A 2HDQA 4BJPA 4LRZE 2EXAA 4GW9A 3LIBA 2EWWA 3BW6A 2XH9A 2A24A 3T1SA 4O0PA 5KMWA 2FZ0A 4JGOA 5GHZA 5BOHA 4MDZA 1TDLA 2HPBA 1OTEA 4UQIS 4WZ5C 2XR0A 4E3KA 4CQHA 4WELA 1YLJA 2VX8A 1OTBA 2M7UA 5EM0A 5HWWA 4Y0UA 2WK0A 1TF1A 2D02A 4YINA 3N8SA 1MWUA 2V0UA 1IELA 3HL9A 4Q8IA 4BD1A 4ZJ3A 3UPPA 5CGXA 4U0TA 4OKPA 3B33A 1JTGA 1CEFA 4YWZA 3VOYA 3W4QA 3KYQA 3HUMA 2J3WA 4JPMA 4FOFA 3ISGA 3NI9A 4HJ4A 4M4XA 3GTCA 4U3TA 3OPPA 4GD6A 1ES2A 2P74A 1N9NA 4XUXA 1S67L 3CG5A 3SOIA 3ZDJA 1P9RA 3ZVTA 3UO9A 5J7EA 4JXGA 2J8YA 1D1JA 2VA0A 3MKEA 3KSIA 4R0QA 3OC2A 1ALQA 1JTDA 1OJ5A 3F1OA 3CJMA 5FAOA 4JGQA 3HLCA 4S2KA 2EFXA 2IWDA 2PHYA 4O01A 5A92A 4B4ZA 5IS1A 3N8RA 1TD5A 4PPRA 1XJ6A 1K6SA 4ZJ1A 4MBHA 2PR5A 3SS3A 4HNBA 5DJTA 4Y13A 5I94A 2JKRI 3NJAA 1VHMA 5D3OA 4EBNA 3JYIA 1MWSA 2ZBBA 3IBJA 3G2YA 3NDGA 1UGUA 4BBUA 1BLHA 3K3CA 1SHVA 1NZOA 2JKFA 4LRYC 3ZCZA 1P0ZA 5I5LA 5JYOA 1BLPA 3P09A 2OAP1 4XUZA 3G6OA 1PIOA 4HH2A 4Q0JA 3EQVA 3IF6B 4CLCE 1Z6FA 1I5QA 4GCZA 1F9IA 3B47A 4WEKA 3CPTB 1L0DA 2ZMFA 3IS2B 3VSKA 1BT5A 1YLYA 2L0WA 4CLCC 4KZ7A 3SS4A 3KSGA 4Y15A 3WS5A 2L1MA 3Q82A 4ME4A 5CTNA 4GS9A 1BULA 5G4YA 1FR1A 3NDEA 3GV9A 1KDSA 5AQBA 3BQAA 2A49A 5AQAA 2IWBA 2PBYA 4PM8A 2PU2A 3ZYTA 2GDNA 3C4OA 1I2WA 4NXGA 3DWKA 5G4ZA 3IX8A 1L0EA 2V8FA 3UY6A 2W3DA 3G35A 1EWZA 1SDNA 3PBOA 4LV0A 4L9EA 4EEUA 2WAFA 3VP3A 4P85A 2W27A 3W4PA 2BTFP 3B3XA 3IX4A 4IUKA 2V1BA 4OOYA 3P98A 3C5AA 2B5RA 2ZM0A 2YKFA 1GA0A 1Q2QA 5AVEA 3MXRA 3BLSA 3UPNA 4E3NA 2PYPA 2HJEA 2VJWA 2P9VA 2WKQA 3GSGA 3QHYA 4N1HA 1V9YA 3BLMA 1M6KA 1CEGA 3GMWA 1N9BA 1W8YA 2V1AA 4JGPA 4JLFA 4D60A 5FSRA 3S4XA 4RQ9A 3C8CA 3EEHA 4I3IA 4QY6A 5GLDA 5FQJA 1RGZA 4KG6A 4S2NC 3GVBA 1ZG4A 3T1QB 1LL8A 1E4DA 3C7VA 5FI2A 1H0MA 3T4QA 4UA6A 3IWQA 1Z09A 1IYSA 4BMWA 3HVFA 3PBQA 4EWFA 1LSXA 2X71A 3LIAA 4DJ3A 3F1NB 2W3GA 4ID4A 1XJ4A 2J80A 2QPNA 5KSCA 1MKIA 4EQ1A 1EI5A 3A0RA 5CECA 2Z6CA 5FI7A 1ZHHB 4MN6A 5TBMB 1PWCA 3Q7ZA 4MN7A 1W7FA 3WS0A 3S7QA 5EM1A 1LLBA 1TS8A 2O9AA 1BLSA 3NCKA 4H6JA 3S7NA 4DRTA 2FFFB 1DJAA 2P04A 5HPIA 5HD3A 1VETB 1MC0A 3LEQA 2KOIA 3OCLA 4IJGA 1LSWA 2I9VA 1BSGA 5F5YA 2OWJA 4F3LB 5GLAA 1IFQA 1GHPA 2RL3A 2WZXA 4DE2A 1PFLA 4X25A 4HP4A 3BRMA 1ERQA 4MBKA 3P01A 2XGNA 4HEFA 2OWHA 1T18A 2Z2LB 2OV5A 5CHJA 3QP4A 2G2UA 3VP4A 1BLCA 3VFFA 5CEBA 5FQMA 1LI0A 4OP8A 3SH7A 4NXEA 5CRFA 4X55A 5HAIA 4EEPA 5CTMA 4ARZB 1DP8A 3IHBA 1K54C 3CZDA 4LV2A 5M19A 4FUWA 3G34A 5DF9A 3ZG9B 1XJ2A 3RH8B 4JGRA 3BM6A 4LFUA 4R1GA 1SKOB 1ODVA 5AVFA 4FH2A 2HJ9C 1LL5A 2V9AA 3MFDA 1BZAA 3HLGA 1ZC2A 1LL9A 4BL3A 1OTDA 3T1XA 3H7WB 4LCMA 1MY8A 3LIDA 5CX7A 1JWVA 1QMFA 2ZC5B 2Y79A 2W3FA 2B95A 1FCMA 1DJBA 2QYBA 3IXBA 4KZ6A 3FPVA 1T1CA 1K55A 1PI4A 1Y54A 4EV4A 5CGSA 4I3JA 4LRXC 1F2KA 4OLGA 4UEYA 3PBRA 2HGVA 4KZ8A 4HJ3A 1I2SA 3A0VA 4BBVA 1YLWA 5L10A 1MWTA 1VM1A 1F98A 1NLYA 1H8MA 3LR4A 4EXOA 2XK1A 3ZFZA 1IKGA 3CLOA 3TJZC 5FAQA 3V5MA 5U47A 4OPRA 2HDSA 3CITA 4Y2FA 1DY6A 1KGEA 1OMEA 3VP2A 2WGVA 3NIAA 4GDNA 4Y3IA 2XRNA 3BY9A 3VFHA 2Y8HA 4EERA 4R6LA 5GLBA 1GHIA 3U2AA 3ZG5A 4QHCA 3E4PA 2ZOHA 3LI8A 2KDKA 4YNRA 3RFBA 3G31A 4CPKA 3DTKA 5E2FA 3IF6A 1XKZA 1RGYA 2WGWB 2XF3A 4B9OA 3D9YA 3CPTA 3IS2A 3WS1A 1YKDA 1KE4A 2VV6A 3KSFA 3PYPA 1U60A 5EE8A 4KG5A 3O88A 2ZM8A 5EVIC 2C5WB 3MKFA 4WL9A 2QKPA 5DF8A 5CERA 4OQIA 1IOUA 2Y2GA 4DKIA 3MF0A 3FV7A 4IVIA 4DE3A 4E6WA 2XA7M 4OQ0A 1OTAA 1XP4A 4YFMA 4WN5A 1PYYA 5HFOA 3QP5A 5HDCA 3ZG7B 4EUZA 3OLOA 4OOMA 4K0WA 4R3BA 4DXCA 4Y7PA 2ZC6B 1G6OA 4UAAA 5C5KA 1ONGA 3H82B 5HAQA 4NETA 2INWA 3OPLA 3NBLA 1K38A 2ZJ9A 2Z2MB 2XFTA 5F68A 5J3WA 4GNUA 4PM6A 4LENA 5FQIA 4G3KA 4HBUA 2DCFA 1LI9A 1XGIA 4DE1A 5A8BA 3ZHHA 1YSPA 3BFEA 2R9WA 2OSUA 1L0GA 5KSHA 2E8IA 1NJ4A 4OOLA 2W0NA 4JF4A 2XA7S 4PM5A 1JWZA 3LIEA 3OPHA 3R7WB 1YLTA 1TS0A 2VEAA 5EOOA 3IX3A 1ZTUA 3BY8A 2HZ5A 3BEBA 2WKRA 1A0KA 2EX2A 1BYWA 1FCNA 4G3WA 2WKIA 1NZUA 4Y0TA 2QJ5A 1S1ZA 3DTMA 1MBLA 1NXYA 3TSGA 1PI5A 3EQUA 3F1NA 3KYZA 4R70A 4DF6A 2XDMA 3RXWA 2UWXA 2V8CA 4WUJA 3MMHA 4OLDA 5HD5A 1YPRA 5TBMA 2JCHA 3NOPC 2PT7A 4KQQA 3ZG8B 5L09A 1BUEA 5G18A 2BG1A 3FYZA 4GB7A 3E2LA 4E3MA 4BL2A 2V1ZA 4LV1A 1VEUB 2WKEA 3AGDA 2DMWA 2ZQAA 1CQAA 3NC8A 3RTYA 2JKTI 2PDRA 1VETA 5EV0A 5FAPA 5FASA 3PHYA 2XD5A 1AWIA 5FL3A 3UN7A 5F83A 3DBAA 4ZTKA 3ULFA 2PR6A 2ZQ9A 1IKIA 3UE0A 4X68A 3ZGAB 1W63M 4OPYA 3SH9A 3MZFA 4F3LA 1XX2A 2K7SA 5HARA 3T4OA 5GL9A 2Y2QA 2VGJA 3PAEA 4R4RA 2QMIA 3V67A 2EX6A 3OCNA 4OONA 4KUOA 3B42A 4HP9A 3T4LA 1LHYA 3FZCA 4IBRA 3KSHA 4NKPA 3UB9A 1K4FA 2PU4A 1S4RA 2B18A 5KIZA 3FG8A 4IUHA 2XQZA 3HLDA 3K2NA 3P7NA 3UE6A 3NOUC 4ARZA 1XA7A 4WEJA 3LEZA 1KGFA 3MZDA 1V9ZA 2J7VA 5IHVA 5HSQA 5DKKA 3S22A 4KZAA 4P6BA 1OT6A 2J3TD 4ZBEA 1PW1A 3VOLA 1YM1A 3E0YA 3UB8A 3SW1A 1SKOA 4R3AA 5CHMA 2HP5A 3QP8A 2ZMAA 5FA7A 5L2FA 1XJ3A 1K56D 3UDIA 4XXRA 4Q0IA 4DJ2A 4S2OA 3Q7VB 4GKUA 3FPWA 1T1BA 3H7WA 2B02A 1J9MA 2GNXA 2QWSA 1D7EA 5M18A 2PAVP 2Z6DA 3K3DA 2Y91A 4BBTA 3L9KA 4OQGA 1OPXA 5FDHA 3LY4A 2VGKA 2PYRA 3IBRA 2WKPA 3AGEA 4MNRA 4QJGA 3VP0A 3MQQA 4FCFA 5HDDA 5FDSA 2PD8A 4HIAA 3MS6A 5DTKA 4QD4A 1SZVA 3ZVWA 4N9KA 1ONHA 1FSWA 2V0WA 1Y28A 3JVVA 5EPHA 4YOFA 4L9FA 4CLCB 2QJ7A 2EFUA 3A3IA 4X69A 3HJIA 3LR5A 2JBFA 3T4JA 1ESIA 2R78A 1J3WA
chains in the Genus database with same CATH topology
2D02A 3EGDC 2QYBA 1OT9A 3FPVA 1T1CA 4HOIA 3F1PB 4WLAA 1F5MA 2V0UA 5AJGA 3E4OA 4I3JA 4LRXC 4PKYA 1P9WA 4KQOA 3A0SA 1H3QA 3CWFA 4UEYA 3PBRA 2HGVA 2VV8A 4I38A 4HJ3A 2GJ3A 1T19A 3A0VA 4BBVA 3B33A 1S66L 4QPRA 2VZWA 2HF6A 4YWZA 4E04A 1F98A 1OTIA 1NLYA 1WA9A 1H8MA 1T1AA 2PD7A 3CAXA 3KYQA 3MQ0A 2J3WA 3LR4A 3OBFA 4ETZA 4FOFA 1STZA 2A24B 4EXOA 2O9CA 3EGXC 2W3HA 2QHKA 4HJ4A 2P7JA 3CLOA 4M4XA 3TJZC 4GLQA 4I5SA 2H28A 3CITA 4Y2FA 1DP9A 4LPZA 1N9NA 3GDIA 1S67L 3EEAA 2XROA 4Y5FA 1P9RA 3LFVA 3MR0A 2EWVA 5J7EA 4Y3IA 2XRNA 2VA0A 3BY9A 3KSIA 2Y8HA 3OC2A 3LR3A 1OJ5A 4EERA 4R6LA 3F1OA 3U2AA 5DFYA 2JKRM 3E4PA 4JGQA 2ZOHA 3CI6A 2PHYA 3LI8A 4HI4A 4O01A 1S1YA 5IS1A 3ZQ5A 2KDKA 4YNRA 3W2ZA 1DP6A 1TD5A 3RFBA 1XJ6A 3D3OA 2PR5A 3MXQA 3GECA 4HNBA 3UB7A 3EOIA 5DJTA 4B9OA 2ZOIA 2VLGA 2JKRI 3NJAA 1XFQA 3IS2A 4PHTA 1VHMA 1YKDA 2GX5A 3MJQA 2VV6A 3KSFA 3PYPA 1G28A 3HJKA 3T4SA 2ZBBA 3IBJA 3C2WA 3H82A 1GSXA 2NUPC 1UGUA 4BBUA 4G3VA 3K3CA 4LRYC 2JKTM 4WL9A 1P0ZA 2QKPA 5I5LA 1IOUA 2M1CA 2OAP1 3F1OB 3MF0A 2XA7M 1P97A 3BQ8A 1NLZA 1OTAA 3G6OA 2D01A 2VGLM 3D72A 4HH2A 4Q0JA 3PBTA 3EQVA 4WN5A 4AFIA 4CLCE 2BASA 2M7VA 5HDCA 4GCZA 1F9IA 2VKSA 2ZMVA 3B47A 3OLOA 4OOMA 4WEKA 5HPFA 2MJ6A 2ZMFA 2LB5A 2O99A 3IS2B 2L0WA 1G6OA 4CLCC 3PXPA 4EUVA 3O5YA 4NXBA 3KSGA 3PBNA 5C5KA 3R7WA 3T4TA 3H82B 2L1MA 2INWA 4ME4A 5TJJA 4GJ4A 2K2NA 4GS9A 3CUEA 5G4YA 4PAUA 4Q0HA 5HDSA 2G7UA 4R38A 5F68A 3BQAA 5J3WA 4EW7A 4O8GA 4G3KA 4EU0A 1NRJA 4DMZA 3ZYTA 5A8BA 4BWIA 1YSPA 4NXGA 4HY8A 3LIFA 5HWVA 3KO6A 5G4ZA 5KSHA 4MCWA 1KOUA 2JHEA 2A2LA 4OOLA 4ZRRA 4P6ZM 4ETXA 1UWNX 2W0NA 3H9WA 2XA7S 3LI9A 2W3DA 3LIEA 4MMNA 3PBOA 5HL6A 2HV1A 4L9EA 2VGLS 4EEUA 4MN5A 3LICA 3R7WB 3LUQA 1TS0A 4I39A 2W27A 2VEAA 4HHDA 1ZTUA 5F6AA 4Z1WA 4GS9B 3BY8A 4B93A 5J4EA 4IUKA 2V1BA 5IT5A 3T4KA 2FH5A 2WKRA 2YKFA 3EWKA 1BYWA 4LLOB 4XT2A 2KX6A 5AVEA 2KLIA 4G3WA 2O0YA 3LYXA 3JVUA 2PYPA 2HJEA 2QJ5A 1S1ZA 2VJWA 3ICYA 3UMEA 3EQUA 1LSVA 2WKQA 3F1NA 3KYZA 4R70A 2NUTC 4CLCD 1N9OA 3VE4A 1XFNA 1V9YA 3NHQA 4K08A 3C30A 4WUJA 3MFXA 3MMHA 2V1AA 3TE8A 5HD5A 2EA9A 4JGPA 5TBMA 1W63Q 2J3TC 3NOPC 2PT7A 4GHIA 3R4KA 1DRMA 4RQ9A 1GSVA 3C8CA 3EEHA 4I3IA 4NEED 2XSSA 2K31A 4II7A 3PR6A 4P6ZS 2DMWA 2IA2A 3RTYA 2JKTI 1N9LA 2PDRA 1LL8A 3PHYA 4XT2B 5FL3A 5F69A 5DKLA 4PKYG 3T4QA 3DBAA 2JN7A 3ULFA 4BMWA 2PR6A 3C38A 5EFWA 3OOVA 3PBQA 1LSXA 4I3AA 2P08A 1W63M 3LIAA 4DJ3A 3F1NB 2W3GA 1XJ4A 4F3LA 2J80A 2K7SA 3T4OA 2OAQ1 4EQ1A 5HWTA 4L9GA 3V67A 3OCNA 1YSQA 2GZAA 4KUOA 3B42A 4HP9A 2CMNA 3A0RA 2Z6CA 3T4LA 1ZHHB 3TRCA 4MN6A 5TBMB 3TW8A 5DFXA 3KSHA 4MN7A 4GHIB 1S4SA 4NKPA 3S7QA 1GSWA 5MC7A 3UB9A 1TS8A 1JNUA 2O9AA 1S4RA 2B18A 3S7NA 4H6JA 4L0LA 5KIZA 2P04A 5HPIA 3FG8A 4IUHA 5HD3A 3VE3A 1MC0A 2KOIA 3K2NA 3OCLA 4IJGA 1LSWA 3P7NA 3NOUC 3UE6A 4ARZA 4WEJA 2I9VA 1V9ZA 1TS7A 3S7OA 5IU1A 5F5YA 5HSQA 1EW0A 3NOTC 5DKKA 2OWJA 4EETB 2W3EA 4F3LB 1IFQA 4FSFA 4DN0A 2W1TA 1OT6A 1MZUA 4KUKA 2J3TD 5L8MA 4HQAA 3HCYA 2OOLA 4HP4A 4UQIM 3VOLA 3E0YA 4IHQA 3UB8A 3SW1A 3P01A 3BJNA 4R3AA 2L4RA 3KX0X 5K5BA 1XJ3A 2OWHA 1T18A 4WF0A 4EESA 3LR0A 2O9BA 1X0OA 4Q0IA 4DJ2A 2W1RA 3CUEC 3FPWA 4H6JB 2YKHA 1T1BA 3H7WA 2B02A 4KQDA 5DJUA 1NWZA 3PBSA 2GNXA 2QWSA 4CLCA 4NXEA 5HZHA 3E4QA 1D7EA 4EEPA 4ARZB 2LB9A 2Z6DA 3UE3A 1TS6A 3K3DA 4NXFA 1DP8A 4BBTA 2VV7A 3E98A 1OPXA 3T50A 5LBRA 3S7PA 3F1PA 2PYRA 5DF9A 1MKMA 3IBRA 1D06A 2W1TB 3UMDA 1OJGA 2WKPA 3FC7A 1XJ2A 3RH8B 4HH3A 4JGRA 1UWPX 1LT0A 3UB6A 1ODVA 5AVFA 3MQQA 5HDDA 4BJPA 4LRZE 2PD8A 3LIBA 4GW9A 4HIAA 2HJ9C 2EWWA 2V9AA 3BW6A 2A24A 3BWLA 1VB6A 4O0PA 2V0WA 1Y28A 1OTDA 3JVVA 2FZ0A 4JGOA 4HJ6A 3H7WB 4MDZA 4YOFA 1YAXA 4L9FA 4CLCB 1OTEA 2QJ7A 4UQIS 3LIDA 5CX7A 4CQHA 3HJIA 4WELA 3LR5A 2VX8A 1OTBA 2M7UA 3VV4A 2Y79A 5HWWA 3T4JA 2W3FA 2R78A 3MQOA 1TF1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D02 A;  1OT9 A;  1T1C A;  4HOI A;  3F1P B;  4WLA A;  2V0U A;  3E4O A;  4I3J A;  4LRX C;  4PKY A;  3A0S A;  3CWF A;  2VV8 A;  4I38 A;  4HJ3 A;  2GJ3 A;  1T19 A;  3A0V A;  4BBV A;  3B33 A;  1S66 L;  4YWZ A;  4E04 A;  1F98 A;  1WA9 A;  1OTI A;  3CAX A;  1T1A A;  2PD7 A;  4EXO A;  2A24 B;  2QHK A;  4HJ4 A;  2P7J A;  3CLO A;  4M4X A;  4I5S A;  2H28 A;  1DP9 A;  4LPZ A;  1N9N A;  3GDI A;  1S67 L;  3MR0 A;  5J7E A;  3BY9 A;  1OJ5 A;  4EER A;  4R6L A;  3F1O A;  3E4P A;  4JGQ A;  2ZOH A;  2PHY A;  3LI8 A;  4HI4 A;  1S1Y A;  5IS1 A;  3ZQ5 A;  2KDK A;  1DP6 A;  1XJ6 A;  2PR5 A;  3MXQ A;  3GEC A;  4HNB A;  3UB7 A;  5DJT A;  4B9O A;  2ZOI A;  2VLG A;  3NJA A;  1XFQ A;  3IS2 A;  3MJQ A;  2VV6 A;  3PYP A;  1G28 A;  3HJK A;  2ZBB A;  3C2W A;  3H82 A;  1GSX A;  1UGU A;  4BBU A;  3K3C A;  4LRY C;  4WL9 A;  1P0Z A;  2QKP A;  5I5L A;  2M1C A;  3F1O B;  1P97 A;  1OTA A;  3G6O A;  2D01 A;  3D72 A;  4HH2 A;  4WN5 A;  2BAS A;  5HDC A;  4GCZ A;  1F9I A;  3OLO A;  3IS2 B;  2L0W A;  4NXB A;  3H82 B;  2L1M A;  2INW A;  4GS9 A;  5G4Y A;  5HDS A;  4R38 A;  5F68 A;  5J3W A;  4EW7 A;  5A8B A;  4NXG A;  4HY8 A;  3LIF A;  5HWV A;  5G4Z A;  1KOU A;  2JHE A;  1UWN X;  2W0N A;  3H9W A;  3LI9 A;  3LIE A;  2HV1 A;  4L9E A;  4EEU A;  4MN5 A;  3LIC A;  3LUQ A;  1TS0 A;  4I39 A;  2W27 A;  2VEA A;  4HHD A;  5F6A A;  4GS9 B;  3BY8 A;  5J4E A;  2V1B A;  2WKR A;  2YKF A;  3EWK A;  1BYW A;  4LLO B;  4XT2 A;  2KX6 A;  5AVE A;  3LYX A;  2PYP A;  2QJ5 A;  1S1Z A;  3ICY A;  3UME A;  1LSV A;  2WKQ A;  3F1N A;  4R70 A;  1N9O A;  3VE4 A;  1XFN A;  1V9Y A;  3NHQ A;  4K08 A;  4WUJ A;  3MFX A;  2V1A A;  5HD5 A;  2EA9 A;  4JGP A;  5TBM A;  3NOP C;  4GHI A;  1DRM A;  4RQ9 A;  1GSV A;  3C8C A;  3EEH A;  4I3I A;  3RTY A;  1N9L A;  2PDR A;  1LL8 A;  3PHY A;  4XT2 B;  5F69 A;  5DKL A;  4PKY G;  2JN7 A;  3ULF A;  2PR6 A;  5EFW A;  1LSX A;  4I3A A;  3LIA A;  4DJ3 A;  3F1N B;  1XJ4 A;  4F3L A;  2J80 A;  2K7S A;  4EQ1 A;  5HWT A;  4L9G A;  4KUO A;  4HP9 A;  2CMN A;  3A0R A;  2Z6C A;  4MN6 A;  5TBM B;  4GHI B;  1S4S A;  1GSW A;  3UB9 A;  1TS8 A;  1JNU A;  1S4R A;  4H6J A;  5KIZ A;  3FG8 A;  5HD3 A;  3VE3 A;  1LSW A;  3UE6 A;  3P7N A;  3NOU C;  2I9V A;  1V9Z A;  1TS7 A;  5IU1 A;  5F5Y A;  5HSQ A;  1EW0 A;  3NOT C;  5DKK A;  2OWJ A;  4EET B;  4F3L B;  1OT6 A;  1MZU A;  4KUK A;  4HQA A;  2OOL A;  4HP4 A;  3VOL A;  3SW1 A;  3UB8 A;  4R3A A;  2L4R A;  3KX0 X;  1XJ3 A;  2OWH A;  1T18 A;  4WF0 A;  4EES A;  1X0O A;  4DJ2 A;  4H6J B;  2YKH A;  1T1B A;  3H7W A;  2B02 A;  4KQD A;  5DJU A;  1NWZ A;  2QWS A;  4NXE A;  5HZH A;  3E4Q A;  1D7E A;  4EEP A;  2Z6D A;  1TS6 A;  3K3D A;  4NXF A;  1DP8 A;  4BBT A;  2VV7 A;  3T50 A;  3F1P A;  2PYR A;  3IBR A;  1D06 A;  3UMD A;  1OJG A;  2WKP A;  3FC7 A;  1XJ2 A;  3RH8 B;  4HH3 A;  4JGR A;  1UWP X;  1LT0 A;  3UB6 A;  1ODV A;  5AVF A;  3MQQ A;  5HDD A;  4LRZ E;  2PD8 A;  3LIB A;  4GW9 A;  4HIA A;  2V9A A;  2A24 A;  3BWL A;  1VB6 A;  2V0W A;  1Y28 A;  1OTD A;  4JGO A;  4HJ6 A;  3H7W B;  4L9F A;  1OTE A;  2QJ7 A;  3LID A;  3HJI A;  1OTB A;  5HWW A;  2R78 A;  3MQO A; 
#chains in the Genus database with same CATH topology
 3EGD C;  3HLF A;  4MEZ A;  3T12 B;  3F1P B;  1F5M A;  5TFQ A;  4WMC D;  1PZO A;  4PKY A;  1P9W A;  4KQO A;  3A0S A;  1S6R A;  3CWF A;  2VV8 A;  1ACF A;  4S2M A;  1M40 A;  4I38 A;  4KQR A;  2GJ3 A;  1T19 A;  1FCO A;  1S66 L;  4QPR A;  3W8K A;  2VZW A;  4E04 A;  2WGW A;  3CAX A;  5HPF A;  4JXW A;  2O9C A;  3EGX C;  5M1A A;  5FQK A;  2W3H A;  2DRW A;  2QHK A;  2P7J A;  2JKG A;  4F94 A;  4GLQ A;  4KEN B;  2X01 A;  2ZQ7 A;  1DP9 A;  4LPZ A;  1W8Q A;  2OLU A;  4Y5F A;  3UNW A;  3HUO A;  2ZD8 A;  2EWV A;  3MR0 A;  3LO7 A;  1XPB A;  1KE3 A;  3LR3 A;  1K56 A;  4UA9 A;  5DFY A;  2JKR M;  3CI6 A;  1DJC A;  3ZQ5 A;  3W2Z A;  3UPO A;  1SKF A;  1HZO A;  5FEF A;  5HL1 A;  3AGF A;  1PW8 A;  3MXQ A;  2ZQ8 A;  3UB7 A;  3EOI A;  3BFG A;  5JYP A;  2ZOI A;  1E25 A;  4K91 A;  2ZL1 B;  4PHT A;  1K25 A;  1G28 A;  2CC1 A;  5E2E A;  3T4S A;  1G6A A;  3H82 A;  5TGF A;  1GSX A;  5A90 A;  2NUP C;  3IQA A;  5DTS A;  2JKT M;  1TDG A;  3NY4 A;  2M1C A;  1YQS A;  1K57 A;  1P97 A;  3BQ8 A;  1NLZ A;  2HDU A;  4BD0 A;  2D01 A;  2VGL M;  3D72 A;  3DTI A;  4AFI A;  4DE0 A;  3S1Y A;  4KZ5 A;  2V2F F;  3FKW A;  2BLS A;  1K4E A;  1SCW A;  4X1L A;  2ZMV A;  1XA1 A;  4OPZ A;  2LB5 A;  2O99 A;  4QU3 A;  1HVB A;  5CGW A;  4WMC A;  2H0T A;  2ZM2 A;  3QP2 A;  3R7W A;  4BQM A;  4C75 A;  5TJJ A;  4GJ4 A;  2K2N A;  4IVK A;  5KZH A;  3CUE A;  4JF5 A;  3G2Z A;  4Q0H A;  2G7U A;  1WYC A;  4EQI A;  1NRJ A;  5EVL A;  3GQZ A;  4JBF A;  1WYB A;  3VMA A;  3LIF A;  5HWV A;  5FQ9 A;  3WS2 A;  4MCW A;  2A2L A;  4P6Z M;  2EXB A;  4WM9 A;  4FD8 A;  3BFD A;  2Y59 A;  3LI9 A;  4OP5 A;  3RXX A;  1HD8 A;  4MMN A;  1NYM A;  3ITB A;  2HV1 A;  2VGL S;  3LIC A;  1ES4 A;  4I39 A;  4N9L A;  1IYP A;  5GLC A;  2QZ6 A;  4Z1W A;  4ZDX A;  5J4E A;  1PZP A;  4N92 A;  1K55 C;  1VEU A;  5IT5 A;  2ACG A;  2V20 A;  3QP1 A;  1H8Y A;  3SH8 A;  2FH5 A;  1RP5 A;  3IT9 A;  1ES5 A;  5CHU A;  4WZ5 A;  4X53 A;  1JWP A;  2KX6 A;  3WRZ A;  2O0Y A;  1NRF A;  3WS4 A;  1YT4 A;  1HTZ A;  5E2H A;  3LYX A;  2X02 A;  1KE0 A;  3JVU A;  2XFS A;  3UME A;  2NUT C;  4PMA A;  4CLC D;  4Y17 A;  3LY3 A;  1XFN A;  3NHQ A;  3C30 A;  2Y2I A;  3IH9 A;  1K6R A;  1XGJ A;  2Q9M A;  3M2K A;  1KGG A;  3OZH A;  1W63 Q;  1DRM A;  3GR2 A;  1GSV A;  4FH4 A;  3HLE A;  1WE4 A;  3PTE A;  4II7 A;  4OPQ A;  3PR6 A;  4P6Z S;  2IA2 A;  1CJF A;  3M2J A;  4XT2 B;  5F69 A;  5DKL A;  1PRQ A;  4PKY G;  3NEC A;  1AXB A;  3C38 A;  5EFW A;  3VOZ A;  2C6W B;  2H0Y A;  2UV0 E;  3IF6 C;  2P08 A;  4C3Q A;  5FAT A;  4O7D A;  1MPL A;  1YSQ A;  1HLU P;  2GZA A;  3IXG A;  4JXS A;  2CMN A;  3MBZ A;  4RA7 A;  3TRC A;  4E3I A;  1Q2P A;  4UHU A;  5DFX A;  3GRJ A;  3HBR A;  3QNC A;  4GHI B;  3W4O A;  1GSW A;  3A3D A;  4E3J A;  2Y2M A;  3M6B A;  4GD8 A;  1JNU A;  5DF7 A;  3Q7V A;  5DTT A;  2HP9 A;  1H5X A;  4M3K A;  4U0X A;  4DXB A;  4BLM A;  3DTE A;  2JE5 A;  1L2S A;  1TS7 A;  3S7O A;  3DAV A;  5IU1 A;  5AQ9 A;  3NOT C;  1NYY A;  2W3E A;  5E43 A;  5GHY A;  3PAG A;  4NG2 A;  3MZE A;  3HLW A;  4KUK A;  4HQA A;  2Y2J A;  3HCY A;  5F1F A;  3SZT A;  3BJN A;  2L4R A;  4WBG A;  4OH0 A;  4WF0 A;  2ZQC A;  4GDB A;  3ITA A;  2O9B A;  1X0O A;  5F82 A;  2W1R A;  5L07 A;  3HUN A;  1O07 A;  2YKH A;  1CI8 A;  1GCE A;  4KQD A;  5DJU A;  5HX9 A;  3PBS A;  4CLC A;  3IXH A;  3E4Q A;  4LV3 A;  2LB9 A;  3UE3 A;  1TS6 A;  5EVI B;  2E8J A;  4NXF A;  3UE1 A;  3T50 A;  3V50 A;  5LBR A;  3S7P A;  3F1P A;  1MKM A;  3VSL A;  2W1T B;  3UMD A;  3HLB A;  1OJG A;  4A5R A;  2DNS A;  3D4F A;  1UWP X;  1LT0 A;  1ZKJ A;  2HDR A;  4R4S A;  4N1X A;  3OPR A;  3NUL A;  1Y4O A;  4RYE A;  4KZ3 A;  3DWZ A;  1ERO A;  4D2O A;  4C6Y A;  4LCL A;  3BWL A;  1VB6 A;  1CK3 A;  1YLZ A;  3V39 A;  1FIK A;  4GN2 A;  4HJ6 A;  1ERM A;  3M6H A;  2J9P A;  1YAX A;  3Q1F A;  4P0M A;  5TR7 A;  5J8X A;  1ZG6 A;  3VV4 A;  3IH8 A;  3MQO A;  4B88 A;  1N4O A;  4FTX A;  1OT9 A;  4HOI A;  3V3R A;  4WLA A;  5AJG A;  3E4O A;  1TVF A;  4X6T A;  1CF0 A;  1H3Q A;  1E3U D;  4RVA A;  3G32 A;  1BTL A;  2HF6 A;  1OTI A;  1WA9 A;  3MQ0 A;  1T1A A;  2IWC A;  2PD7 A;  2WYX A;  4ETZ A;  3OBF A;  1RCJ A;  1O7E A;  1STZ A;  2A24 B;  4OQH A;  4QB8 A;  1VQQ A;  3N7W A;  5EOE A;  2Y2N A;  2ZL1 A;  5A93 A;  3G4P A;  4I5S A;  2H28 A;  3JPU A;  3CHW P;  2HP6 A;  3GDI A;  1XXM A;  3T1R A;  3EEA A;  4S2I A;  4EBP A;  2XRO A;  1TEM A;  5EVE A;  3LFV A;  2Y2O A;  3C7U A;  1KVL A;  4S2L A;  5HW3 A;  5E2G A;  2AVX A;  3HRE A;  4S2N A;  2WGI A;  3FKV A;  4HI4 A;  1FIL A;  4RX2 A;  1S1Y A;  2Q0O A;  1DP6 A;  3O87 A;  2ZLY A;  3D3O A;  2Y2K A;  4P87 A;  3GEC A;  4GZB A;  4WYY A;  4R23 A;  2VLG A;  3U4L P;  1XFQ A;  1H8Z A;  1GA9 A;  2GX5 A;  3MJQ A;  1FQG A;  1C3B A;  1YLP A;  3HJK A;  4E6X A;  3UDX A;  2WZZ A;  4PM7 A;  3N8L A;  3C2W A;  3FWL A;  4G3V A;  4KG2 A;  3Q07 A;  2PRF A;  3G30 A;  3TG9 A;  1PWG A;  3F1O B;  2XLN A;  3UDF A;  4MLL A;  3IWI A;  2JC7 A;  4DDS A;  4ESP A;  3PBT A;  3QP6 A;  3O86 A;  2BAS A;  3IF5 A;  2M7V A;  4B4X A;  2VKS A;  4QWO A;  4K0X A;  2MJ6 A;  1KDW A;  1W5D A;  1L0F A;  1FOF A;  3PXP A;  4EUV A;  3O5Y A;  4NXB A;  3PBN A;  4DDY A;  3T4T A;  1E3U A;  1KVM A;  4PAU A;  2WAD A;  4Z9Q A;  5HDS A;  3ZNT A;  4R38 A;  2ZC3 B;  4LGW A;  3IHA A;  2ZQD A;  3A3E A;  4EW7 A;  4O8G A;  4RX3 A;  4EU0 A;  3C4P A;  5A91 A;  4DMZ A;  2EX9 A;  3MXS A;  3SS5 A;  4BWI A;  1ESU A;  1K54 A;  4HY8 A;  3KO6 A;  1KOU A;  2JHE A;  2Y2H A;  3Q81 A;  4ZRR A;  4ETX A;  2H5S A;  1UWN X;  3H9W A;  5EVI D;  3RJU A;  4S2J A;  1CI9 A;  5HL6 A;  1G68 A;  3N6I A;  4MN5 A;  5FEG A;  1S0W A;  3DW0 A;  3LUQ A;  3BYD A;  4HHD A;  1QME A;  2WAE A;  3BFF A;  5F6A A;  4GS9 B;  2VK3 A;  4B93 A;  1IEM A;  3T4K A;  1IYQ A;  3IWO A;  2Y4A A;  3EWK A;  1L3L A;  4LLO B;  1MWR A;  3QNB A;  4XT2 A;  2Y2P A;  2KLI A;  5EUA A;  4ZJ2 A;  4KZ9 A;  5HAP A;  3V3S A;  3ZG0 A;  3E2K A;  5FQQ A;  3ICY A;  1LSV A;  2J9O A;  1N9O A;  3VE4 A;  2R9X A;  3VP1 A;  2ZC7 A;  4GOG A;  3TOI A;  4K08 A;  4BEN A;  1PNE A;  1FR6 A;  2PBD P;  3MFX A;  1PWD A;  3BFC A;  2ZC4 B;  2XD1 A;  3TE8 A;  4E3O A;  1NY0 A;  2EA9 A;  2J3T C;  4GHI A;  4OVD A;  3R4K A;  3UB5 P;  4NEE D;  2XSS A;  2K31 A;  2Q9N A;  5CXW A;  5CED A;  4UA7 A;  1YMS A;  5DVA A;  1N9L A;  4E3L A;  2Y2L A;  4NK3 A;  2JN7 A;  1IYO A;  2WUQ A;  5AQ7 A;  4HBT A;  5FI6 A;  5F1G A;  3OOV A;  1YMX A;  5GHX A;  4I3A A;  4MBF A;  2P9V B;  1FSY A;  4IED A;  2G2W A;  3A3F A;  2OAQ 1;  4X56 A;  5HWT A;  4L9G A;  1MXO A;  3WWX A;  3KYE A;  3TW8 A;  1SDE A;  1S4S A;  5MC7 A;  4PM9 A;  1JVJ A;  4IBX A;  3CMZ A;  1K0K A;  4L0L A;  4EBL A;  2Y55 A;  3VE3 A;  1K57 C;  4R3J A;  2XEP A;  4CJN A;  5EVI A;  3A3J A;  3ZNY A;  2FFY A;  2I72 A;  2OLV A;  1EW0 A;  3N4I A;  4EET B;  4S2P A;  1W79 A;  3IXD A;  4FSF A;  4DN0 A;  1ES3 A;  2W1T A;  1MZU A;  5L8M A;  2OOL A;  4UQI M;  3MSH A;  1GHM A;  4IHQ A;  4H8R A;  4KZ4 A;  3BEC A;  3KX0 X;  5K5B A;  4KZB A;  4Y0O A;  4JKT A;  4EES A;  4JF6 A;  3LR0 A;  4ZAM A;  1G5U A;  4X1M A;  3CUE C;  3O3V A;  4JXV A;  4H6J B;  4WZ4 A;  1NWZ A;  5HZH A;  4HES A;  2WKH A;  3WRT A;  2RCX A;  5EEC A;  3I7J A;  2VV7 A;  3E98 A;  2H10 A;  4QY5 A;  2A3U A;  1D06 A;  3L7H A;  3FC7 A;  4HH3 A;  3LGO A;  3UB6 A;  3LCE A;  2EX8 A;  2HDQ A;  4BJP A;  4LRZ E;  2EXA A;  4GW9 A;  3LIB A;  2EWW A;  3BW6 A;  2XH9 A;  2A24 A;  3T1S A;  4O0P A;  5KMW A;  2FZ0 A;  4JGO A;  5GHZ A;  5BOH A;  4MDZ A;  1TDL A;  2HPB A;  1OTE A;  4UQI S;  4WZ5 C;  2XR0 A;  4E3K A;  4CQH A;  4WEL A;  1YLJ A;  2VX8 A;  1OTB A;  2M7U A;  5EM0 A;  5HWW A;  4Y0U A;  2WK0 A;  1TF1 A;  2D02 A;  4YIN A;  3N8S A;  1MWU A;  2V0U A;  1IEL A;  3HL9 A;  4Q8I A;  4BD1 A;  4ZJ3 A;  3UPP A;  5CGX A;  4U0T A;  4OKP A;  3B33 A;  1JTG A;  1CEF A;  4YWZ A;  3VOY A;  3W4Q A;  3KYQ A;  3HUM A;  2J3W A;  4JPM A;  4FOF A;  3ISG A;  3NI9 A;  4HJ4 A;  4M4X A;  3GTC A;  4U3T A;  3OPP A;  4GD6 A;  1ES2 A;  2P74 A;  1N9N A;  4XUX A;  1S67 L;  3CG5 A;  3SOI A;  3ZDJ A;  1P9R A;  3ZVT A;  3UO9 A;  5J7E A;  4JXG A;  2J8Y A;  1D1J A;  2VA0 A;  3MKE A;  3KSI A;  4R0Q A;  3OC2 A;  1ALQ A;  1JTD A;  1OJ5 A;  3F1O A;  3CJM A;  5FAO A;  4JGQ A;  3HLC A;  4S2K A;  2EFX A;  2IWD A;  2PHY A;  4O01 A;  5A92 A;  4B4Z A;  5IS1 A;  3N8R A;  1TD5 A;  4PPR A;  1XJ6 A;  1K6S A;  4ZJ1 A;  4MBH A;  2PR5 A;  3SS3 A;  4HNB A;  5DJT A;  4Y13 A;  5I94 A;  2JKR I;  3NJA A;  1VHM A;  5D3O A;  4EBN A;  3JYI A;  1MWS A;  2ZBB A;  3IBJ A;  3G2Y A;  3NDG A;  1UGU A;  4BBU A;  1BLH A;  3K3C A;  1SHV A;  1NZO A;  2JKF A;  4LRY C;  3ZCZ A;  1P0Z A;  5I5L A;  5JYO A;  1BLP A;  3P09 A;  2OAP 1;  4XUZ A;  3G6O A;  1PIO A;  4HH2 A;  4Q0J A;  3EQV A;  3IF6 B;  4CLC E;  1Z6F A;  1I5Q A;  4GCZ A;  1F9I A;  3B47 A;  4WEK A;  3CPT B;  1L0D A;  2ZMF A;  3IS2 B;  3VSK A;  1BT5 A;  1YLY A;  2L0W A;  4CLC C;  4KZ7 A;  3SS4 A;  3KSG A;  4Y15 A;  3WS5 A;  2L1M A;  3Q82 A;  4ME4 A;  5CTN A;  4GS9 A;  1BUL A;  5G4Y A;  1FR1 A;  3NDE A;  3GV9 A;  1KDS A;  5AQB A;  3BQA A;  2A49 A;  5AQA A;  2IWB A;  2PBY A;  4PM8 A;  2PU2 A;  3ZYT A;  2GDN A;  3C4O A;  1I2W A;  4NXG A;  3DWK A;  5G4Z A;  3IX8 A;  1L0E A;  2V8F A;  3UY6 A;  2W3D A;  3G35 A;  1EWZ A;  1SDN A;  3PBO A;  4LV0 A;  4L9E A;  4EEU A;  2WAF A;  3VP3 A;  4P85 A;  2W27 A;  3W4P A;  2BTF P;  3B3X A;  3IX4 A;  4IUK A;  2V1B A;  4OOY A;  3P98 A;  3C5A A;  2B5R A;  2ZM0 A;  2YKF A;  1GA0 A;  1Q2Q A;  5AVE A;  3MXR A;  3BLS A;  3UPN A;  4E3N A;  2PYP A;  2HJE A;  2VJW A;  2P9V A;  2WKQ A;  3GSG A;  3QHY A;  4N1H A;  1V9Y A;  3BLM A;  1M6K A;  1CEG A;  3GMW A;  1N9B A;  1W8Y A;  2V1A A;  4JGP A;  4JLF A;  4D60 A;  5FSR A;  3S4X A;  4RQ9 A;  3C8C A;  3EEH A;  4I3I A;  4QY6 A;  5GLD A;  5FQJ A;  1RGZ A;  4KG6 A;  4S2N C;  3GVB A;  1ZG4 A;  3T1Q B;  1LL8 A;  1E4D A;  3C7V A;  5FI2 A;  1H0M A;  3T4Q A;  4UA6 A;  3IWQ A;  1Z09 A;  1IYS A;  4BMW A;  3HVF A;  3PBQ A;  4EWF A;  1LSX A;  2X71 A;  3LIA A;  4DJ3 A;  3F1N B;  2W3G A;  4ID4 A;  1XJ4 A;  2J80 A;  2QPN A;  5KSC A;  1MKI A;  4EQ1 A;  1EI5 A;  3A0R A;  5CEC A;  2Z6C A;  5FI7 A;  1ZHH B;  4MN6 A;  5TBM B;  1PWC A;  3Q7Z A;  4MN7 A;  1W7F A;  3WS0 A;  3S7Q A;  5EM1 A;  1LLB A;  1TS8 A;  2O9A A;  1BLS A;  3NCK A;  4H6J A;  3S7N A;  4DRT A;  2FFF B;  1DJA A;  2P04 A;  5HPI A;  5HD3 A;  1VET B;  1MC0 A;  3LEQ A;  2KOI A;  3OCL A;  4IJG A;  1LSW A;  2I9V A;  1BSG A;  5F5Y A;  2OWJ A;  4F3L B;  5GLA A;  1IFQ A;  1GHP A;  2RL3 A;  2WZX A;  4DE2 A;  1PFL A;  4X25 A;  4HP4 A;  3BRM A;  1ERQ A;  4MBK A;  3P01 A;  2XGN A;  4HEF A;  2OWH A;  1T18 A;  2Z2L B;  2OV5 A;  5CHJ A;  3QP4 A;  2G2U A;  3VP4 A;  1BLC A;  3VFF A;  5CEB A;  5FQM A;  1LI0 A;  4OP8 A;  3SH7 A;  4NXE A;  5CRF A;  4X55 A;  5HAI A;  4EEP A;  5CTM A;  4ARZ B;  1DP8 A;  3IHB A;  1K54 C;  3CZD A;  4LV2 A;  5M19 A;  4FUW A;  3G34 A;  5DF9 A;  3ZG9 B;  1XJ2 A;  3RH8 B;  4JGR A;  3BM6 A;  4LFU A;  4R1G A;  1SKO B;  1ODV A;  5AVF A;  4FH2 A;  2HJ9 C;  1LL5 A;  2V9A A;  3MFD A;  1BZA A;  3HLG A;  1ZC2 A;  1LL9 A;  4BL3 A;  1OTD A;  3T1X A;  3H7W B;  4LCM A;  1MY8 A;  3LID A;  5CX7 A;  1JWV A;  1QMF A;  2ZC5 B;  2Y79 A;  2W3F A;  2B95 A;  1FCM A;  1DJB A;  2QYB A;  3IXB A;  4KZ6 A;  3FPV A;  1T1C A;  1K55 A;  1PI4 A;  1Y54 A;  4EV4 A;  5CGS A;  4I3J A;  4LRX C;  1F2K A;  4OLG A;  4UEY A;  3PBR A;  2HGV A;  4KZ8 A;  4HJ3 A;  1I2S A;  3A0V A;  4BBV A;  1YLW A;  5L10 A;  1MWT A;  1VM1 A;  1F98 A;  1NLY A;  1H8M A;  3LR4 A;  4EXO A;  2XK1 A;  3ZFZ A;  1IKG A;  3CLO A;  3TJZ C;  5FAQ A;  3V5M A;  5U47 A;  4OPR A;  2HDS A;  3CIT A;  4Y2F A;  1DY6 A;  1KGE A;  1OME A;  3VP2 A;  2WGV A;  3NIA A;  4GDN A;  4Y3I A;  2XRN A;  3BY9 A;  3VFH A;  2Y8H A;  4EER A;  4R6L A;  5GLB A;  1GHI A;  3U2A A;  3ZG5 A;  4QHC A;  3E4P A;  2ZOH A;  3LI8 A;  2KDK A;  4YNR A;  3RFB A;  3G31 A;  4CPK A;  3DTK A;  5E2F A;  3IF6 A;  1XKZ A;  1RGY A;  2WGW B;  2XF3 A;  4B9O A;  3D9Y A;  3CPT A;  3IS2 A;  3WS1 A;  1YKD A;  1KE4 A;  2VV6 A;  3KSF A;  3PYP A;  1U60 A;  5EE8 A;  4KG5 A;  3O88 A;  2ZM8 A;  5EVI C;  2C5W B;  3MKF A;  4WL9 A;  2QKP A;  5DF8 A;  5CER A;  4OQI A;  1IOU A;  2Y2G A;  4DKI A;  3MF0 A;  3FV7 A;  4IVI A;  4DE3 A;  4E6W A;  2XA7 M;  4OQ0 A;  1OTA A;  1XP4 A;  4YFM A;  4WN5 A;  1PYY A;  5HFO A;  3QP5 A;  5HDC A;  3ZG7 B;  4EUZ A;  3OLO A;  4OOM A;  4K0W A;  4R3B A;  4DXC A;  4Y7P A;  2ZC6 B;  1G6O A;  4UAA A;  5C5K A;  1ONG A;  3H82 B;  5HAQ A;  4NET A;  2INW A;  3OPL A;  3NBL A;  1K38 A;  2ZJ9 A;  2Z2M B;  2XFT A;  5F68 A;  5J3W A;  4GNU A;  4PM6 A;  4LEN A;  5FQI A;  4G3K A;  4HBU A;  2DCF A;  1LI9 A;  1XGI A;  4DE1 A;  5A8B A;  3ZHH A;  1YSP A;  3BFE A;  2R9W A;  2OSU A;  1L0G A;  5KSH A;  2E8I A;  1NJ4 A;  4OOL A;  2W0N A;  4JF4 A;  2XA7 S;  4PM5 A;  1JWZ A;  3LIE A;  3OPH A;  3R7W B;  1YLT A;  1TS0 A;  2VEA A;  5EOO A;  3IX3 A;  1ZTU A;  3BY8 A;  2HZ5 A;  3BEB A;  2WKR A;  1A0K A;  2EX2 A;  1BYW A;  1FCN A;  4G3W A;  2WKI A;  1NZU A;  4Y0T A;  2QJ5 A;  1S1Z A;  3DTM A;  1MBL A;  1NXY A;  3TSG A;  1PI5 A;  3EQU A;  3F1N A;  3KYZ A;  4R70 A;  4DF6 A;  2XDM A;  3RXW A;  2UWX A;  2V8C A;  4WUJ A;  3MMH A;  4OLD A;  5HD5 A;  1YPR A;  5TBM A;  2JCH A;  3NOP C;  2PT7 A;  4KQQ A;  3ZG8 B;  5L09 A;  1BUE A;  5G18 A;  2BG1 A;  3FYZ A;  4GB7 A;  3E2L A;  4E3M A;  4BL2 A;  2V1Z A;  4LV1 A;  1VEU B;  2WKE A;  3AGD A;  2DMW A;  2ZQA A;  1CQA A;  3NC8 A;  3RTY A;  2JKT I;  2PDR A;  1VET A;  5EV0 A;  5FAP A;  5FAS A;  3PHY A;  2XD5 A;  1AWI A;  5FL3 A;  3UN7 A;  5F83 A;  3DBA A;  4ZTK A;  3ULF A;  2PR6 A;  2ZQ9 A;  1IKI A;  3UE0 A;  4X68 A;  3ZGA B;  1W63 M;  4OPY A;  3SH9 A;  3MZF A;  4F3L A;  1XX2 A;  2K7S A;  5HAR A;  3T4O A;  5GL9 A;  2Y2Q A;  2VGJ A;  3PAE A;  4R4R A;  2QMI A;  3V67 A;  2EX6 A;  3OCN A;  4OON A;  4KUO A;  3B42 A;  4HP9 A;  3T4L A;  1LHY A;  3FZC A;  4IBR A;  3KSH A;  4NKP A;  3UB9 A;  1K4F A;  2PU4 A;  1S4R A;  2B18 A;  5KIZ A;  3FG8 A;  4IUH A;  2XQZ A;  3HLD A;  3K2N A;  3P7N A;  3UE6 A;  3NOU C;  4ARZ A;  1XA7 A;  4WEJ A;  3LEZ A;  1KGF A;  3MZD A;  1V9Z A;  2J7V A;  5IHV A;  5HSQ A;  5DKK A;  3S22 A;  4KZA A;  4P6B A;  1OT6 A;  2J3T D;  4ZBE A;  1PW1 A;  3VOL A;  1YM1 A;  3E0Y A;  3UB8 A;  3SW1 A;  1SKO A;  4R3A A;  5CHM A;  2HP5 A;  3QP8 A;  2ZMA A;  5FA7 A;  5L2F A;  1XJ3 A;  1K56 D;  3UDI A;  4XXR A;  4Q0I A;  4DJ2 A;  4S2O A;  3Q7V B;  4GKU A;  3FPW A;  1T1B A;  3H7W A;  2B02 A;  1J9M A;  2GNX A;  2QWS A;  1D7E A;  5M18 A;  2PAV P;  2Z6D A;  3K3D A;  2Y91 A;  4BBT A;  3L9K A;  4OQG A;  1OPX A;  5FDH A;  3LY4 A;  2VGK A;  2PYR A;  3IBR A;  2WKP A;  3AGE A;  4MNR A;  4QJG A;  3VP0 A;  3MQQ A;  4FCF A;  5HDD A;  5FDS A;  2PD8 A;  4HIA A;  3MS6 A;  5DTK A;  4QD4 A;  1SZV A;  3ZVW A;  4N9K A;  1ONH A;  1FSW A;  2V0W A;  1Y28 A;  3JVV A;  5EPH A;  4YOF A;  4L9F A;  4CLC B;  2QJ7 A;  2EFU A;  3A3I A;  4X69 A;  3HJI A;  3LR5 A;  2JBF A;  3T4J A;  1ESI A;  2R78 A;  1J3W A; 
#chains in the Genus database with same CATH homology
 2D02 A;  3EGD C;  2QYB A;  1OT9 A;  3FPV A;  1T1C A;  4HOI A;  3F1P B;  4WLA A;  1F5M A;  2V0U A;  5AJG A;  3E4O A;  4I3J A;  4LRX C;  4PKY A;  1P9W A;  4KQO A;  3A0S A;  1H3Q A;  3CWF A;  4UEY A;  3PBR A;  2HGV A;  2VV8 A;  4I38 A;  4HJ3 A;  2GJ3 A;  1T19 A;  3A0V A;  4BBV A;  3B33 A;  1S66 L;  4QPR A;  2VZW A;  2HF6 A;  4YWZ A;  4E04 A;  1F98 A;  1OTI A;  1NLY A;  1WA9 A;  1H8M A;  1T1A A;  2PD7 A;  3CAX A;  3KYQ A;  3MQ0 A;  2J3W A;  3LR4 A;  3OBF A;  4ETZ A;  4FOF A;  1STZ A;  2A24 B;  4EXO A;  2O9C A;  3EGX C;  2W3H A;  2QHK A;  4HJ4 A;  2P7J A;  3CLO A;  4M4X A;  3TJZ C;  4GLQ A;  4I5S A;  2H28 A;  3CIT A;  4Y2F A;  1DP9 A;  4LPZ A;  1N9N A;  3GDI A;  1S67 L;  3EEA A;  2XRO A;  4Y5F A;  1P9R A;  3LFV A;  3MR0 A;  2EWV A;  5J7E A;  4Y3I A;  2XRN A;  2VA0 A;  3BY9 A;  3KSI A;  2Y8H A;  3OC2 A;  3LR3 A;  1OJ5 A;  4EER A;  4R6L A;  3F1O A;  3U2A A;  5DFY A;  2JKR M;  3E4P A;  4JGQ A;  2ZOH A;  3CI6 A;  2PHY A;  3LI8 A;  4HI4 A;  4O01 A;  1S1Y A;  5IS1 A;  3ZQ5 A;  2KDK A;  4YNR A;  3W2Z A;  1DP6 A;  1TD5 A;  3RFB A;  1XJ6 A;  3D3O A;  2PR5 A;  3MXQ A;  3GEC A;  4HNB A;  3UB7 A;  3EOI A;  5DJT A;  4B9O A;  2ZOI A;  2VLG A;  2JKR I;  3NJA A;  1XFQ A;  3IS2 A;  4PHT A;  1VHM A;  1YKD A;  2GX5 A;  3MJQ A;  2VV6 A;  3KSF A;  3PYP A;  1G28 A;  3HJK A;  3T4S A;  2ZBB A;  3IBJ A;  3C2W A;  3H82 A;  1GSX A;  2NUP C;  1UGU A;  4BBU A;  4G3V A;  3K3C A;  4LRY C;  2JKT M;  4WL9 A;  1P0Z A;  2QKP A;  5I5L A;  1IOU A;  2M1C A;  2OAP 1;  3F1O B;  3MF0 A;  2XA7 M;  1P97 A;  3BQ8 A;  1NLZ A;  1OTA A;  3G6O A;  2D01 A;  2VGL M;  3D72 A;  4HH2 A;  4Q0J A;  3PBT A;  3EQV A;  4WN5 A;  4AFI A;  4CLC E;  2BAS A;  2M7V A;  5HDC A;  4GCZ A;  1F9I A;  2VKS A;  2ZMV A;  3B47 A;  3OLO A;  4OOM A;  4WEK A;  5HPF A;  2MJ6 A;  2ZMF A;  2LB5 A;  2O99 A;  3IS2 B;  2L0W A;  1G6O A;  4CLC C;  3PXP A;  4EUV A;  3O5Y A;  4NXB A;  3KSG A;  3PBN A;  5C5K A;  3R7W A;  3T4T A;  3H82 B;  2L1M A;  2INW A;  4ME4 A;  5TJJ A;  4GJ4 A;  2K2N A;  4GS9 A;  3CUE A;  5G4Y A;  4PAU A;  4Q0H A;  5HDS A;  2G7U A;  4R38 A;  5F68 A;  3BQA A;  5J3W A;  4EW7 A;  4O8G A;  4G3K A;  4EU0 A;  1NRJ A;  4DMZ A;  3ZYT A;  5A8B A;  4BWI A;  1YSP A;  4NXG A;  4HY8 A;  3LIF A;  5HWV A;  3KO6 A;  5G4Z A;  5KSH A;  4MCW A;  1KOU A;  2JHE A;  2A2L A;  4OOL A;  4ZRR A;  4P6Z M;  4ETX A;  1UWN X;  2W0N A;  3H9W A;  2XA7 S;  3LI9 A;  2W3D A;  3LIE A;  4MMN A;  3PBO A;  5HL6 A;  2HV1 A;  4L9E A;  2VGL S;  4EEU A;  4MN5 A;  3LIC A;  3R7W B;  3LUQ A;  1TS0 A;  4I39 A;  2W27 A;  2VEA A;  4HHD A;  1ZTU A;  5F6A A;  4Z1W A;  4GS9 B;  3BY8 A;  4B93 A;  5J4E A;  4IUK A;  2V1B A;  5IT5 A;  3T4K A;  2FH5 A;  2WKR A;  2YKF A;  3EWK A;  1BYW A;  4LLO B;  4XT2 A;  2KX6 A;  5AVE A;  2KLI A;  4G3W A;  2O0Y A;  3LYX A;  3JVU A;  2PYP A;  2HJE A;  2QJ5 A;  1S1Z A;  2VJW A;  3ICY A;  3UME A;  3EQU A;  1LSV A;  2WKQ A;  3F1N A;  3KYZ A;  4R70 A;  2NUT C;  4CLC D;  1N9O A;  3VE4 A;  1XFN A;  1V9Y A;  3NHQ A;  4K08 A;  3C30 A;  4WUJ A;  3MFX A;  3MMH A;  2V1A A;  3TE8 A;  5HD5 A;  2EA9 A;  4JGP A;  5TBM A;  1W63 Q;  2J3T C;  3NOP C;  2PT7 A;  4GHI A;  3R4K A;  1DRM A;  4RQ9 A;  1GSV A;  3C8C A;  3EEH A;  4I3I A;  4NEE D;  2XSS A;  2K31 A;  4II7 A;  3PR6 A;  4P6Z S;  2DMW A;  2IA2 A;  3RTY A;  2JKT I;  1N9L A;  2PDR A;  1LL8 A;  3PHY A;  4XT2 B;  5FL3 A;  5F69 A;  5DKL A;  4PKY G;  3T4Q A;  3DBA A;  2JN7 A;  3ULF A;  4BMW A;  2PR6 A;  3C38 A;  5EFW A;  3OOV A;  3PBQ A;  1LSX A;  4I3A A;  2P08 A;  1W63 M;  3LIA A;  4DJ3 A;  3F1N B;  2W3G A;  1XJ4 A;  4F3L A;  2J80 A;  2K7S A;  3T4O A;  2OAQ 1;  4EQ1 A;  5HWT A;  4L9G A;  3V67 A;  3OCN A;  1YSQ A;  2GZA A;  4KUO A;  3B42 A;  4HP9 A;  2CMN A;  3A0R A;  2Z6C A;  3T4L A;  1ZHH B;  3TRC A;  4MN6 A;  5TBM B;  3TW8 A;  5DFX A;  3KSH A;  4MN7 A;  4GHI B;  1S4S A;  4NKP A;  3S7Q A;  1GSW A;  5MC7 A;  3UB9 A;  1TS8 A;  1JNU A;  2O9A A;  1S4R A;  2B18 A;  3S7N A;  4H6J A;  4L0L A;  5KIZ A;  2P04 A;  5HPI A;  3FG8 A;  4IUH A;  5HD3 A;  3VE3 A;  1MC0 A;  2KOI A;  3K2N A;  3OCL A;  4IJG A;  1LSW A;  3P7N A;  3NOU C;  3UE6 A;  4ARZ A;  4WEJ A;  2I9V A;  1V9Z A;  1TS7 A;  3S7O A;  5IU1 A;  5F5Y A;  5HSQ A;  1EW0 A;  3NOT C;  5DKK A;  2OWJ A;  4EET B;  2W3E A;  4F3L B;  1IFQ A;  4FSF A;  4DN0 A;  2W1T A;  1OT6 A;  1MZU A;  4KUK A;  2J3T D;  5L8M A;  4HQA A;  3HCY A;  2OOL A;  4HP4 A;  4UQI M;  3VOL A;  3E0Y A;  4IHQ A;  3UB8 A;  3SW1 A;  3P01 A;  3BJN A;  4R3A A;  2L4R A;  3KX0 X;  5K5B A;  1XJ3 A;  2OWH A;  1T18 A;  4WF0 A;  4EES A;  3LR0 A;  2O9B A;  1X0O A;  4Q0I A;  4DJ2 A;  2W1R A;  3CUE C;  3FPW A;  4H6J B;  2YKH A;  1T1B A;  3H7W A;  2B02 A;  4KQD A;  5DJU A;  1NWZ A;  3PBS A;  2GNX A;  2QWS A;  4CLC A;  4NXE A;  5HZH A;  3E4Q A;  1D7E A;  4EEP A;  4ARZ B;  2LB9 A;  2Z6D A;  3UE3 A;  1TS6 A;  3K3D A;  4NXF A;  1DP8 A;  4BBT A;  2VV7 A;  3E98 A;  1OPX A;  3T50 A;  5LBR A;  3S7P A;  3F1P A;  2PYR A;  5DF9 A;  1MKM A;  3IBR A;  1D06 A;  2W1T B;  3UMD A;  1OJG A;  2WKP A;  3FC7 A;  1XJ2 A;  3RH8 B;  4HH3 A;  4JGR A;  1UWP X;  1LT0 A;  3UB6 A;  1ODV A;  5AVF A;  3MQQ A;  5HDD A;  4BJP A;  4LRZ E;  2PD8 A;  3LIB A;  4GW9 A;  4HIA A;  2HJ9 C;  2EWW A;  2V9A A;  3BW6 A;  2A24 A;  3BWL A;  1VB6 A;  4O0P A;  2V0W A;  1Y28 A;  1OTD A;  3JVV A;  2FZ0 A;  4JGO A;  4HJ6 A;  3H7W B;  4MDZ A;  4YOF A;  1YAX A;  4L9F A;  4CLC B;  1OTE A;  2QJ7 A;  4UQI S;  3LID A;  5CX7 A;  4CQH A;  3HJI A;  4WEL A;  3LR5 A;  2VX8 A;  1OTB A;  2M7U A;  3VV4 A;  2Y79 A;  5HWW A;  3T4J A;  2W3F A;  2R78 A;  3MQO A;  1TF1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...