3WRTA

Wild type beta-lactamase derived from chromohalobacter sp.560
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
357
structure length
357
Chain Sequence
QTREVLDPIVASLMEAQQIPGMAIALVRPEGTTISHYGAADRETGTPVDDDTLFEIGSLSKTLTATLASLAEVEGKLDFDAPVSRYLPELEGSAFDDISGLNLGTHTGGGLPLFVPDEVTDRASLMAWYREWQPTEPIGESRTYSNLGIGLLGLETAASLDGEFVPTMRAKVLAPLGMQDTWYDVPEARMADYAMGEDKDGQPTRVSPGVLDDEAYGIKTTAADLAKLVRANLHLADVDAELQQAIDATRQGHYRVGDMTQALIWEQYSLPVAPETLRAGNGYDMILEPNAAEALEPPQSPRDDVWVNKTGSTNGFGGYIVMLPGKHTGLVMLANKNYPNDARVEAAYRILSGLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a highly acidic beta-lactamase from the moderate halophile Chromohalobacter sp. 560 and the discovery of a Cs(+)-selective binding site
pubmed doi rcsb
source organism Chromohalobacter sp. 560
molecule tags Hydrolase
molecule keywords Beta-lactamase
total genus 113
structure length 357
sequence length 357
chains with identical sequence B, C
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2014-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3wrtA00
5DF7A 3ZNYA 1W79A 5HX9A 3P98A 3GRJA 3AGDA 2B5RA 2A49A 3LEZA 3Q1FA 5CGSA 4CPKA 4BL2A 3HLFA 3SH9A 5A91A 1I2WA 1SCWA 3IWIA 2XGNA 1NXYA 2WAEA 4N1XA 1K6SA 4IBRA 4JXVA 1BLHA 1CK3A 3SS5A 4GD8A 2Y2LA 4BL3A 1JWZA 5CHJA 1K57A 3OPRA 4IVIA 4EWFA 4JPMA 3Q81A 4E6XA 3OCNA 5EVIB 1JWPA 2CC1A 3M6HA 1FSWA 2HDSA 2Y2KA 2ZMAA 3ZG8B 4OPYA 1IYQA 4B88A 1PWGA 4KENB 1H8ZA 1U60A 3OCLA 5TGFA 2H0YA 4S2MA 4WM9A 1YMXA 3WS1A 2OLVA 4B4ZA 3VP4A 2H0TA 2PBYA 2XK1A 5CXWA 2Z2MB 4QB8A 1O7EA 3UE3A 3O3VA 1YLZA 4LCMA 4RX2A 4JXWA 1XA1A 2XR0A 3OZHA 1LHYA 2P74A 4ZJ2A 4FH4A 3QHYA 2C6WB 3ZNTA 3GMWA 1CI8A 5AQAA 2DRWA 5G18A 2ZQ7A 3PBQA 4GDBA 2HP6A 2HPBA 2Y2GA 4L0LA 4MBFA 3AGFA 3VP1A 1DJBA 1KGEA 4S2PA 4D2OA 3N8LA 1QMEA 2ZC7A 3HL9A 4UHUA 5HFOA 1E25A 1KE3A 3W8KA 2XD1A 5E2FA 1IEMA 1VM1A 1XKZA 3CMZA 4FCFA 1PZPA 3NCKA 4P6BA 4WMCD 5DTKA 3N6IA 4BD1A 3GR2A 5E2GA 3DTMA 3B3XA 3O86A 1BLCA 3Q07A 1ZKJA 2DCFA 1KGGA 2DNSA 1O07A 1GHMA 2XFSA 1XXMA 4DXBA 5F1FA 4OOYA 5D3OA 1YLJA 4JKTA 5DTSA 2FFFB 5DF8A 4WMCA 4XXRA 5FQIA 3AGEA 1S6RA 5CGXA 3UDIA 2ZM0A 1G6AA 3ITBA 3UY6A 3M6BA 5BOHA 3HLDA 4KG2A 3ZFZA 3IT9A 4JBFA 4S2NA 4PM8A 3VSKA 4S2JA 3TOIA 3NY4A 4GKUA 4C75A 2JBFA 4BLMA 4EUZA 1NRFA 4N92A 4KZ5A 2P9VA 1RP5A 5FAPA 1FSYA 1OMEA 3VOZA 1LI9A 4Q8IA 2WGWA 4IEDA 2WUQA 4B4XA 1ERMA 4RYEA 3OPPA 1YMSA 2ZQ8A 4ZBEA 1HVBA 1Y54A 5U47A 4OQHA 1IKIA 4KG5A 2ZC5B 3IXGA 3IQAA 4GD6A 4JF6A 2VGKA 3LY4A 5EUAA 1DJAA 2ZM2A 2ZLYA 1ZC2A 4LENA 1RGYA 5FI6A 3UNWA 1K56D 5CTMA 3HREA 2ZJ9A 5EOOA 1KE0A 1MKIA 2XDMA 4FD8A 3SS4A 1NZOA 4OQ0A 4OQGA 2Y2PA 3IF5A 4WEJA 3WWXA 1ESUA 3A3FA 2X71A 4KZ9A 5A93A 2V2FF 2J7VA 1XA7A 2XFTA 1EI5A 1YQSA 4LV0A 1SHVA 3G31A 1K55C 4EBLA 4QU3A 1L0FA 4GB7A 3LO7A 3I7JA 3IHBA 5FAOA 1HD8A 3UN7A 4A5RA 1GCEA 4X69A 4OLDA 1FCMA 1IYPA 1XGJA 2WZZA 2VGJA 3HLBA 4MBHA 4OPQA 2RCXA 3FKVA 5M1AA 3CJMA 4R3BA 1HZOA 1K4EA 1EROA 1TEMA 3HLGA 4RVAA 3VP3A 4EBNA 1K6RA 3IXHA 3MKEA 3RXXA 3N8SA 2Y2MA 1YM1A 3UPOA 1PW1A 5CERA 1NZUA 3MZEA 4PPRA 4JXSA 5FAQA 4C6YA 3V3RA 1L0DA 3WS0A 1C3BA 1KVLA 3Q7ZA 3GTCA 4ZJ3A 1WYBA 4K0WA 4S2NC 4ID4A 4U0TA 4WELA 4WYYA 2EX2A 4LV1A 1W5DA 4X53A 5GLCA 3WS5A 4OPRA 1TVFA 4HEFA 4FSFA 5FQKA 1MXOA 2XLNA 4PM6A 4DXCA 4P0MA 1CEGA 2XD5A 4UA6A 2HDQA 2QMIA 3G2YA 5EVLA 2HP5A 5HAPA 3BEBA 2J9PA 4BENA 1BZAA 3D4FA 3A3DA 1MY8A 5FASA 5HAIA 1BULA 4KZ6A 3UDFA 1K56A 3UDXA 2ZC6B 4KQOA 4OQIA 2Z2LB 4X68A 3SOIA 3Q7VA 3GSGA 1K38A 1YLWA 4DF6A 1FCOA 2XEPA 1BLPA 5JYOA 2X01A 3WRZA 1E4DA 4XUXA 4XUZA 1YLPA 4ZAMA 2WKEA 2HDRA 4RX3A 4HESA 4S2OA 3WS4A 4RA7A 2QZ6A 2BLSA 3ITAA 4LCLA 1PWDA 1Z6FA 2HDUA 3BECA 3GV9A 1MWSA 2GDNA 5EE8A 5FQJA 5A92A 4DKIA 3OPHA 5A90A 3MXSA 4DE0A 1K55A 5HAQA 1Q2PA 2IWDA 2QPNA 2WKIA 3IF6A 3ZGAB 3LCEA 1AXBA 3QNBA 5CEDA 1W8YA 5J8XA 3G2ZA 4GZBA 4PM7A 2OLUA 5HW3A 3M2KA 3UO9A 4JLFA 3BFCA 1CEFA 3FKWA 2V20A 2IWBA 3BLSA 3V50A 3Q82A 3A3EA 1S0WA 4E3IA 4QY6A 3C7VA 1NJ4A 4NETA 4DE1A 1ERQA 1JTGA 3IF6B 4OONA 3SH8A 1FCNA 4O7DA 1K57C 2WZXA 3HUMA 2UWXA 2EXAA 4DE2A 2Q9MA 1K54C 3MBZA 3BFGA 1KDWA 4OH0A 3PBTA 4KZBA 1JWVA 3ZG0A 1K25A 1XP4A 1EWZA 1GHPA 1M40A 5GL9A 4JF5A 2Y2NA 5CHMA 1KDSA 4P87A 5FI2A 4PM9A 1YLYA 4R4RA 2J8YA 2V1ZA 4LV3A 1WYCA 4GN2A 3G4PA 3ZG9B 1PI4A 1XX2A 1NYYA 1FQGA 3E2LA 3P09A 3PAGA 1LL9A 2G2WA 2I72A 4PMAA 5AQ7A 4WZ5A 1L0GA 5IHVA 5GHZA 5CECA 4N9KA 4KZ8A 2RL3A 4R1GA 4IBXA 3BYDA 2J9OA 3RJUA 2JCHA 1GA0A 2EX8A 2JC7A 3IH9A 4JF4A 3FYZA 1N9BA 3E2KA 4OOLA 3BRMA 3S22A 3DW0A 1MWUA 1SDNA 4R4SA 3HUNA 4PM5A 1PZOA 2XQZA 4GDNA 4OPZA 1PYYA 1CI9A 4Y0TA 3OC2A 3IHAA 4BQMA 4P85A 3O88A 3VFFA 2PU2A 4OVDA 4MBKA 5DVAA 3UPNA 4K0XA 2Y2IA 3VP0A 1RCJA 2Y2OA 1I2SA 3HVFA 5KSHA 2XF3A 1W7FA 4N9LA 3NBLA 1GA9A 3MXRA 5AQBA 1PI5A 3LY3A 5FATA 4E3KA 1IYOA 1G68A 1PW8A 4WZ5C 5KMWA 5F1GA 2R9WA 1ZG4A 3CG5A 4LV2A 2ZQAA 1ES5A 2Y55A 5CHUA 5CRFA 3C4OA 2WKHA 4X56A 3O87A 1GHIA 5KSCA 3C4PA 3VP2A 3M2JA 3BFFA 1TDGA 1ES2A 4Y0OA 3ZVWA 4JXGA 5FQ9A 5AQ9A 2X02A 3HLWA 4YFMA 2PU4A 4MNRA 3V5MA 2EFUA 5M18A 3V3SA 2XH9A 3ZVTA 1W8QA 1FOFA 1HTZA 4DRTA 1PWCA 1WE4A 3N8RA 4QY5A 4X6TA 3G35A 4Z9QA 3BLMA 3IXBA 5I94A 4M3KA 2Y2QA 4ZTKA 1ES4A 1LL5A 2EXBA 3NDGA 1BTLA 4R3JA 4WBGA 3BM6A 2ZM8A 3NDEA 4X55A 4U0XA 1KVMA 4OLGA 4CJNA 5FQQA 1LLBA 5E2HA 4QJGA 4FH2A 3A3IA 3IWQA 4OKPA 3EQVA 5TR7A 1E3UD 3FZCA 3HUOA 3PAEA 3G30A 3BFEA 1J9MA 2Y91A 4MEZA 1K4FA 1Q2QA 2FFYA 4C3QA 5M19A 4R0QA 1L2SA 1YLTA 2WGWB 1M6KA 4Y0UA 4ZDXA 1KE4A 1MWTA 3TSGA 2Q9NA 1JTDA 2OSUA 1YT4A 2P9VB 2ZQDA 2WGIA 1SDEA 1TDLA 3FV7A 5JYPA 4WEKA 1FR1A 1N4OA 4U3TA 4BJPA 1MPLA 3VFHA 4EQIA 1ES3A 3HLCA 1MBLA 3UPPA 2ZD8A 2EFXA 4MLLA 4OP8A 1BLSA 3HLEA 3OPLA 3HBRA 4UA7A 1QMFA 3C5AA 4UA9A 3TG9A 3PBOA 4KQRA 4N1HA 3GQZA 3MFDA 1ALQA 3A3JA 3ZHHA 2H5SA 2C5WB 4KG6A 2Y59A 1IYSA 3ZG5A 4EV4A 4OOMA 3GVBA 3DWKA 5CTNA 3N4IA 2ZC3B 4KQQA 3W4OA 2HP9A 1ONGA 4K91A 5E43A 2WAFA 3PTEA 3W4PA 5FA7A 4E3OA 4E6WA 4OP5A 3SH7A 1ZG6A 3IWOA 3WRTA 3MZFA 5DTTA 5HL1A 4HBTA 4GOGA 5EVID 4R23A 1L0EA 1DY6A 3ZDJA 4KZ4A 3WS2A 4E3NA 5EPHA 5EVIC 5E2EA 3NC8A 4F94A 4S2KA 2H10A 3EQUA 1IKGA 1BUEA 3PBSA 5EOEA 1XPBA 5GHYA 4DDSA 2A3UA 4E3LA 3V39A 4BD0A 2Y4AA 5F83A 3VSLA 1XGIA 3MZDA 2E8IA 3FWLA 3G32A 4S2IA 4ZJ1A 4E3MA 1FR6A 5HARA 1ESIA 3VMAA 3CZDA 1K54A 3BFDA 4QD4A 4Y7PA 5FSRA 5TFQA 5F82A 3S4XA 4YINA 3S1YA 3MKFA 5FDHA 1BSGA 5GHXA 2OV5A 3IXDA 4DDYA 2G2UA 3VOYA 4EBPA 1MWRA 3SS3A 4IVKA 3Q7VB 3UE1A 5DF9A 5EECA 1ONHA 3ISGA 1NY0A 5FI7A 5EVIA 4HBUA 4UAAA 5GLDA 1H5XA 2Y2HA 4E3JA 2IWCA 2JE5A 3UE0A 5L2FA 1KGFA 3C7UA 4DE3A 5CGWA 3NI9A 1NYMA 5FQMA 2EX6A 5CEBA 3IH8A 5KZHA 3PBNA 1E3UA 2ZC4B 4WZ4A 2Y2JA 3JYIA 1I5QA 1LI0A 4S2LA 4KZAA 2WK0A 3NIAA 4H8RA 1DJCA 2ZQ9A 3N7WA 3RXWA 3DWZA 1BT5A 1IELA 3G34A 4QHCA 2WYXA 3PBRA 1JVJA 4NK3A 1SKFA 4GNUA 3ZG7B 3QNCA 1VQQA 1PIOA 1RGZA 2EX9A 3W4QA 3ZCZA 5GLBA 2R9XA 2WADA 2ZQCA 4KZ7A 1H8YA 2BG1A 2WGVA 5GLAA 4KZ3A 3IF6C
chains in the Genus database with same CATH superfamily
3P98A 3AGDA 2B5RA 4BL2A 2XSSA 3SH9A 1NWZA 4HP9A 3IWIA 1NXYA 4XT2A 4EEUA 3SS5A 4LFUA 1JWZA 5CHJA 4ETXA 3CHWP 4JPMA 2CC1A 2HDSA 2Y2KA 2ZMAA 3ZG8B 4OPYA 5G4YA 4B88A 1H8ZA 4YNRA 3VP4A 2INWA 2Z2MB 3UE3A 1YLZA 1F98A 1TF1A 2XR0A 2Z6CA 4ZJ2A 1X0OA 5AQAA 3QP4A 5G18A 2W3DA 3AGFA 3VP1A 1DJBA 3N8LA 3B33A 1XKZA 1IEMA 1VM1A 3CMZA 3GR2A 4JGRA 3Q07A 2PBDP 2XFSA 5FEGA 3V67A 4DXBA 5D3OA 5F6AA 2VKSA 2HJ9C 4XXRA 3VOLA 1L3LA 4EETB 3AGEA 1XJ3A 3UDIA 2ZM0A 4F3LB 1T1AA 3ZFZA 4S2NA 4JBFA 4BLMA 5FAPA 2WUQA 4B4XA 5U47A 4OQHA 4PKYA 1VEUB 1TS0A 1Y4OA 2E8JA 4JGQA 5EUAA 3IBJA 4Y2FA 5FI6A 2KLIA 2PYRA 1K56D 3HREA 1KE0A 1MKIA 3SS4A 4I5SA 2P04A 2VV8A 3LIDA 4OQGA 5A93A 4LV0A 5TBMB 4HY8A 4EBLA 4ME4A 2YKFA 4FUWA 4A5RA 1HD8A 4NXGA 4MCWA 3HLBA 4DJ2A 5M1AA 1HZOA 2LB5A 3A0SA 1P9WA 4RVAA 2PAVP 3MKEA 3BQAA 3UPOA 2ZL1B 4MN5A 4EW7A 5FAQA 1VB6A 5HSQA 3T4QA 4ID4A 3T1QB 4U0TA 2WKRA 4WYYA 1J3WA 3EWKA 5GLCA 3RFBA 1T19A 1MXOA 4DXCA 5IS1A 2XD5A 2QMIA 3CWFA 3G2YA 5HD5A 2HP5A 2V0UA 3D4FA 5FASA 5EFWA 3HJKA 3Q7VA 3GSGA 1K38A 1FCOA 5JYOA 4WL9A 3F1PB 2HDRA 2NUPC 2P08A 5DFXA 4LCLA 1PWDA 3BECA 5EE8A 2GDNA 4X1MA 3OPHA 3A0VA 3S7QA 3T12B 3IX8A 5HAQA 2WKIA 3ULFA 3IF6A 3LCEA 1W8YA 5J8XA 3G2ZA 1ACFA 3UB9A 3C2WA 3FKWA 2IWBA 3U4LP 1FCNA 2UWXA 3LIAA 3LFVA 3BFGA 3PBTA 4KZBA 1JWVA 3MQQA 3ZG0A 1XP4A 1ODVA 1WA9A 1KDSA 4P87A 1YLYA 2J8YA 4LV3A 2PT7A 4JGOA 4CQHA 5IU1A 1YPRA 3PAGA 1Z09A 5IHVA 3B42A 5CECA 1YSQA 3BYDA 2J9OA 3MF0A 2OWJA 3E2KA 4OOLA 3BRMA 4Q0IA 1MWUA 2DMWA 1CI9A 3MR0A 1OTEA 2ZOHA 4P85A 1OTAA 2HJEA 2LB9A 3LY3A 4E3KA 3IS2A 1SKOA 1G68A 2ZQAA 2AVXA 1ES5A 2Y55A 3C4OA 4X56A 5DFYA 2O99A 1F5MA 1GHIA 3C4PA 1HLUP 3BFFA 2XA7M 4Y0OA 3ZVWA 2X02A 3HLWA 4GS9A 4GS9B 2XH9A 1UWPX 3LIBA 3ZVTA 4QY5A 1YSPA 3BLMA 3QP1A 3KSHA 4O8GA 2ZM8A 3TW8A 2W0NA 1SKOB 2WKPA 4EUVA 1LLBA 4I3JA 3EQVA 3G30A 1VEUA 1J9MA 1K4FA 2EA9A 1Q2QA 2O9AA 5M19A 2WGWB 4Y0UA 2OSUA 2ZQDA 4LGWA 1TDLA 4EQIA 3VFHA 3O5YA 3H9WA 3OBFA 3HBRA 4UA9A 3TG9A 2EWVA 3MFDA 3ZHHA 2H5SA 3T1RA 4CLCE 4ESPA 3ZG5A 4KQQA 2WAFA 4R6LA 3E4QA 4E6WA 5FA7A 4HNBA 4KUOA 1ZG6A 3JPUA 5DTTA 4R23A 1L0EA 3ZDJA 4FTXA 5EPHA 5EVIC 5E2EA 3HJIA 4S2KA 1IKGA 3PBSA 5HWWA 2A3UA 4E3LA 1XGIA 4ZJ1A 2E8IA 3G32A 5HWTA 2GZAA 2M7UA 1K54A 3BFDA 3UB8A 3LICA 5F82A 1ZTUA 5FDHA 5GHXA 3IXDA 1P0ZA 4BBUA 4EERA 4IVKA 3Q7VB 3SW1A 1NY0A 5EVIA 4NG2A 4WF0A 2CMNA 2V1AA 2QJ7A 3P01A 1OJ5A 5EM1A 2JE5A 3UE0A 1DP6A 3NI9A 1OTDA 5FQMA 2EX6A 3FPVA 4XT2B 1E3UA 4LRXC 2ZC4B 2Y2JA 3JYIA 1I5QA 4HQAA 4MN7A 2WK0A 1DJCA 4CLCA 3G34A 1P9RA 2WYXA 1JVJA 5K5BA 1SKFA 4GNUA 3QNCA 1RGZA 5J4EA 3ZCZA 2R9XA 3IX3A 2ZQCA 5GLAA 1G28A 1K0KA 2L1MA 2O9BA 5DF7A 1GSWA 1W79A 2ZL1A 4E04A 3Q1FA 3LEZA 4GCZA 4UQIM 2XGNA 3NJAA 1K6SA 2VJWA 4JXVA 2QKPA 1K57A 3OPRA 3LR5A 3NHQA 3OCNA 5EVIB 3CLOA 4NKPA 1U60A 4EXOA 1YMXA 2QYBA 4LPZA 1YKDA 2H0TA 5CXWA 3T1XA 4RX2A 4LCMA 3G6OA 5DJUA 3GDIA 1TS6A 3QHYA 2DRWA 2KDKA 2BASA 1QMEA 4UHUA 3E4OA 5E2FA 4FCFA 3ZYTA 1PZPA 4P6BA 5DTKA 4JGPA 3B3XA 5LBRA 4WLAA 2IA2A 2DNSA 4QWOA 4I3AA 4OOYA 4JKTA 5DTSA 2FFFB 4YOFA 1S6RA 3GECA 5CGXA 3ITBA 3IT9A 4PM8A 3VSKA 4S2JA 3TOIA 5A8BA 3NY4A 4GKUA 2JBFA 3UMEA 4EUZA 1NRFA 4KZ5A 5L09A 4UQIS 1FSYA 3LYXA 1NLYA 2KX6A 3OPPA 1SZVA 1HVBA 1Y54A 4GD6A 3ZQ5A 3LY4A 5FEFA 2HZ5A 1NZOA 4OQ0A 4WEJA 2Y2PA 1ESUA 3A3FA 2V2FF 2J7VA 4GJ4A 2XFTA 1EI5A 5L07A 2V1BA 1S4SA 1L0FA 4GB7A 3I7JA 3IHBA 3UN7A 2JKRI 1XGJA 1S1ZA 4OPQA 2RCXA 3FKVA 1XJ6A 3CJMA 4R3BA 1K4EA 2UV0E 1TEMA 3VP3A 1K6RA 2XROA 3IXHA 1PW1A 5CERA 2A24B 4WN5A 4PPRA 1W63M 1L0DA 3Q7ZA 3EGXC 4NEED 4WELA 2EX2A 2J3TC 3LI9A 3NOPC 2MJ6A 4FSFA 5FQKA 4B9OA 5AJGA 3R4KA 5HAPA 1N9NA 3C38A 3UDXA 4KQOA 3SOIA 5HPIA 1YLWA 1UGUA 2PR5A 2X01A 3WRZA 2WKEA 2VV6A 2HDUA 3GV9A 4DKIA 3MXSA 4DE0A 1K55A 1Q2PA 3LR3A 1NRJA 1OT9A 3QNBA 5CEDA 4PM7A 5HW3A 2JN7A 3M2KA 3UO9A 2VV7A 3BLSA 3A3EA 4L9GA 3R7WA 3UE6A 4OONA 4BBVA 3HUMA 2EXAA 4NXFA 4OH0A 3F1NA 4KUKA 1KOUA 1OJGA 1GHPA 1M40A 4JF5A 1WYCA 5EV0A 1XX2A 1NYYA 1FQGA 3E2LA 3P09A 2I72A 2VLGA 4I3IA 3UB6A 2RL3A 4IBXA 2JCHA 4JF4A 1N9BA 3S22A 3EGDC 3VFFA 2PU2A 1RCJA 2Y2OA 3L9KA 1GA9A 4G3VA 2H28A 1PW8A 5KMWA 5F1GA 3CG5A 3MSHA 5CRFA 3VV4A 3O87A 3VP2A 3M2JA 1TDGA 5AQ9A 2PU4A 3V5MA 5I5LA 5M18A 3V3SA 2W3HA 1W8QA 4Y17A 1PWCA 3G35A 5I94A 3CI6A 3LIEA 4U0XA 1KVMA 4OLGA 3IS2B 2FH5A 1LSXA 2D02A 3IWQA 1E3UD 3P7NA 1H0MA 5L8MA 3LI8A 3RTYA 2V9AA 4MEZA 2D01A 1YLTA 3MMHA 1SDEA 3FV7A 4HP4A 1MPLA 3CITA 2ZMFA 4GHIA 1MBLA 3C30A 4MLLA 3D3OA 3HLEA 3PBOA 4KQRA 4N1HA 3E98A 2QWSA 3BY9A 4IUKA 1IYSA 5CTNA 5EVEA 4YWZA 3N4IA 2ZC3B 3C8CA 1ONGA 4K91A 3SH7A 4ARZB 4R38A 2PRFA 2PYPA 4HJ3A 4BMWA 2OAQ1 3WS2A 1VETA 5F5YA 3V39A 2Y4AA 5F83A 3MZDA 3FWLA 5HARA 3PXPA 1LSWA 3CZDA 4Y7PA 2OWHA 4Z1WA 4HJ6A 3MKFA 1BSGA 3A0RA 4DJ3A 4DDYA 2G2UA 2JKTM 3VOYA 5EECA 4NXEA 1H5XA 1TS8A 2J3WA 2IWCA 5L2FA 3IH8A 5KZHA 5AVFA 3S7PA 4KZAA 3NIAA 4H8RA 3H82A 2ZQ9A 4DN0A 1BT5A 1IELA 2VEAA 1VQQA 5GLBA 2WADA 1H8YA 2BG1A 2WGVA 3ZNYA 2A24A 3CUEC 4CPKA 2A49A 5CGSA 3T1SA 4QPRA 2WAEA 3KYZA 4N1XA 1BLHA 4GD8A 2Y2LA 5HDCA 2YKHA 2J80A 3NECA 1IYQA 4FOFA 5TBMA 3TJZC 1PWGA 3QP6A 2ZBBA 4BWIA 3OCLA 4S2MA 4WM9A 2OLVA 1V9ZA 2XK1A 1O7EA 3O3VA 4JXWA 1XA1A 1LHYA 1FILA 2P74A 1CF0A 3MQOA 3T4OA 3ZNTA 2ZQ7A 2HP6A 2Y2GA 4MBFA 3CAXA 4S2PA 2NUTC 2GX5A 2ZC7A 1CJFA 3HL9A 5HFOA 1E25A 3W8KA 4ARZA 3NCKA 3N6IA 5KIZA 5E2GA 2EWWA 1MZUA 4F3LA 3H7WA 3O86A 1BLCA 1S67L 1ZKJA 1KGGA 5FL3A 5F1FA 5DF8A 1PFLA 2HV1A 5FQIA 4CLCD 5BOHA 4P6ZS 3HLDA 2PDRA 4PHTA 3T4TA 4N92A 1RP5A 1V9YA 3VOZA 1LI9A 2WGWA 4IEDA 2B95A 4RYEA 2ZQ8A 4ZBEA 1IKIA 4KG5A 3IQAA 5TJJA 4JF6A 2VGKA 1DJAA 2ZM2A 3NOUC 1ZC2A 5J7EA 1RGYA 1LL8A 3IBRA 3TE8A 3IF5A 2OAP1 1N9LA 4KZ9A 2X71A 1XA7A 1YQSA 1SHVA 3JVUA 2W1TB 3G31A 1K55C 4QU3A 1BYWA 2V8CA 4X69A 4ETZA 1IYPA 2WZZA 2VGJA 3ICYA 4MBHA 2ZOIA 2HF6A 2Y79A 1G5UA 2L0WA 3CPTA 3N8SA 2Y2MA 1YM1A 3MZEA 2B02A 2W27A 1H8MA 1KVLA 3GTCA 4ZJ3A 5DJTA 4H6JB 4LV1A 1W5DA 5F69A 4X53A 3WS5A 3PR6A 4OPRA 3H82B 3LR0A 3NOTC 3FG8A 4HEFA 4O01A 3S7OA 2XLNA 1OTBA 4PM6A 1CEGA 3DBAA 4UA6A 2HDQA 5HPFA 5EVLA 3BY8A 2J9PA 1GSXA 1Y28A 5HAIA 4KZ6A 1K56A 2W3FA 2ZC6B 2Z2LB 1BLPA 3T4LA 1E4DA 4XUXA 4XUZA 1YLPA 4ZAMA 4CLCC 2QZ6A 1S66L 2BLSA 2XRNA 1Z6FA 3ITAA 5FQJA 3UPNA 1MWSA 5HZHA 4NXBA 5G4ZA 2QPNA 3R7WB 1AXBA 1VETB 4JLFA 3UB7A 3V50A 3Q82A 4MMNA 1S0WA 4QY6A 1NJ4A 2K7SA 1ERQA 1JTGA 3IF6B 3SH8A 4O7DA 1K57C 4DE2A 1K54C 1PNEA 3MBZA 1KDWA 3UB5P 2FZ0A 3L7HA 1EWZA 3PYPA 5GL9A 3KYQA 4R4RA 2V1ZA 4GN2A 3G4PA 3ZG9B 1PI4A 5AQ7A 4WZ5A 5GHZA 4N9KA 2JC7A 4HI4A 3OOVA 4MN6A 2V0WA 1PRQA 3DW0A 4PM5A 1PZOA 1PYYA 3RH8B 3OC2A 3IHAA 4I38A 4BQMA 4H6JA 3O88A 4GW9A 4MBKA 5DVAA 2Y2IA 3HVFA 1I2SA 5KSHA 4HHDA 5FATA 1W7FA 3NBLA 1IYOA 4WZ5C 3DAVA 3EOIA 3MFXA 2R9WA 1T1CA 5CHUA 2WKHA 3VE3A 5KSCA 2VGLM 4JXGA 2XA7S 1F9IA 4MNRA 2EFUA 3B47A 1HTZA 4DRTA 3BJNA 3KYEA 3N8RA 1LSVA 4HH2A 2ZMVA 4IJGA 5HWVA 1S4RA 1TD5A 1LL5A 4WBGA 4R3JA 3NDGA 1BTLA 2W3EA 4CJNA 5FQQA 4HH3A 5E2HA 4FH2A 5TR7A 3FZCA 3HUOA 3BQ8A 3BFEA 2FFYA 4C3QA 1L2SA 1M6KA 1MWTA 1IFQA 1MKMA 2PD7A 1EW0A 1N9OA 2QJ5A 1N4OA 1NLZA 4BBTA 3HLCA 3UPPA 1XFNA 1H3QA 2VX8A 1BLSA 2O9CA 3MS6A 4UA7A 1T18A 2ACGA 3GQZA 5EM0A 2C5WB 4KG6A 2Y59A 4EV4A 4OOMA 3W4OA 5E43A 3F1NB 4MDZA 4E3OA 4OP5A 3FPWA 3IWOA 3WRTA 3IX4A 4HBTA 4GOGA 5HL1A 1OTIA 1DY6A 4E3NA 2H10A 3LGOA 3EQUA 2W3GA 5GHYA 4E3MA 4S2IA 1D06A 1FR6A 1ESIA 3VMAA 4HJ4A 4QD4A 3EEAA 3S4XA 1DP8A 2OV5A 3PHYA 2P7JA 2PD8A 5DF9A 5F68A 3T4SA 4HBUA 5GLDA 4UAAA 4HIAA 4M4XA 1KGFA 3C7UA 4DE3A 5CGWA 1NYMA 2JHEA 4WZ4A 1LI0A 3RXWA 1A0KA 4QHCA 5DKLA 3EEHA 4GLQA 2BTFP 4S2OA 3IF6C 5HX9A 4CLCB 3GRJA 3CPTB 2V8FA 3HLFA 3DTIA 5A91A 1I2WA 1SCWA 1G6OA 3LIFA 1TS7A 4IBRA 1CK3A 4BL3A 4IVIA 4EWFA 1STZA 3Q81A 4E6XA 3W2ZA 1JWPA 3M6HA 3MXQA 1FSWA 2W1TA 3KSIA 4KENB 5TGFA 5MC7A 2H0YA 3WS1A 4EU0A 4B4ZA 2PBYA 4QB8A 1D7EA 5HL6A 4Q0HA 1AWIA 1MC0A 3OZHA 2Q0OA 3MQ0A 3DTKA 4FH4A 2M1CA 2C6WB 3GMWA 1CI8A 3PBQA 4GDBA 4L0LA 2HPBA 1KGEA 4D2OA 1KE3A 2XD1A 3MJQA 4K08A 4X25A 2I9VA 4WMCD 4BD1A 3DTMA 4D60A 3E4PA 3HCYA 2DCFA 1O07A 2K2NA 1GHMA 2OOLA 1XXMA 1YLJA 4WMCA 5FDSA 2HGVA 4WUJA 1G6AA 3FC7A 1S1YA 3UY6A 3M6BA 4KG2A 4PKYG 1VHMA 4C75A 4G3WA 2P9VA 2VGLS 2PR6A 1OMEA 1P97A 4Q8IA 1ERMA 1YMSA 4G3KA 3U2AA 2ZC5B 3IXGA 2K31A 2ZLYA 4LENA 3K3CA 3UNWA 5CTMA 2ZJ9A 5EOOA 2XDMA 4FD8A 3WWXA 5CX7A 3D72A 4RQ9A 2R78A 5IT5A 3KSFA 3LO7A 5FAOA 1GCEA 4OLDA 1FCMA 1XJ4A 4Y15A 3T4JA 2J3TD 1EROA 4B93A 4Y13A 2VK3A 3HLGA 4EBNA 3RXXA 4EESA 1NZUA 4JXSA 4C6YA 3V3RA 3WS0A 1C3BA 1WYBA 3LR4A 4K0WA 4S2NC 3UMDA 4ZRRA 5L10A 5HD3A 1TVFA 1F2KA 1XFQA 4P0MA 3KSGA 3BEBA 4LRYC 4BENA 2VA0A 1BZAA 3A3DA 1MY8A 1BULA 3UDFA 4OQIA 2VZWA 4X68A 4DF6A 4LLOB 2XEPA 4RX3A 4HESA 3WS4A 4RA7A 3OLOA 5A92A 5A90A 2IWDA 3ZGAB 1OT6A 3F1OB 4GZBA 2OLUA 4UEYA 1LT0A 3BFCA 1CEFA 2PHYA 2V20A 2L4RA 3KO6A 3LUQA 4E3IA 3C7VA 4NETA 3K2NA 4DE1A 1IOUA 2WZXA 2Q9MA 2JKTI 3BWLA 1K25A 3F1PA 1T1BA 2Y2NA 5CHMA 2GNXA 4PM9A 5FI2A 2Y8HA 1LL9A 2G2WA 4PMAA 4II7A 5J3WA 1L0GA 4HOIA 4KZ8A 4GHIB 4R1GA 3RJUA 1GA0A 2EX8A 3IH9A 3FYZA 1SDNA 4R4SA 3HUNA 2W1RA 2XQZA 4GDNA 4OPZA 3KX0X 4Y0TA 4OVDA 3VP0A 4AFIA 4K0XA 1OPXA 3QP2A 2XF3A 4LRZE 4PAUA 3CUEA 4N9LA 3MXRA 4IHQA 1PI5A 5AQBA 1ZG4A 4LV2A 4O0PA 3BW6A 3QP8A 1ES2A 5FQ9A 2M7VA 4YFMA 4EQ1A 1FOFA 1WE4A 4KQDA 4L9FA 4X6TA 4Z9QA 3IXBA 4M3KA 2Y2QA 4ZTKA 3JVVA 1ES4A 2EXBA 2JKRM 1FIKA 3BM6A 3NDEA 4X55A 4R70A 3T4KA 2Z6DA 1YAXA 4QJGA 3A3IA 4OKPA 3T50A 3E0YA 1JNUA 3PAEA 2Y91A 3D9YA 4R0QA 4ZDXA 1KE4A 3TSGA 2Q9NA 2B18A 1JTDA 1YT4A 1ZHHB 2P9VB 2WGIA 3NULA 4X1LA 5JYPA 4WEKA 1FR1A 4U3TA 4BJPA 1ES3A 1GSVA 2ZD8A 2EFXA 2JKGA 4I39A 4OP8A 1XJ2A 3OPLA 1QMFA 3C5AA 2O0YA 3QP5A 1DRMA 1ALQA 4Q0JA 3A3JA 5AVEA 3K3DA 1CQAA 4IUHA 2GJ3A 2JKFA 3S7NA 3GVBA 3DWKA 5C5KA 3H7WB 2HP9A 2G7UA 3PTEA 3W4PA 3TRCA 3MZFA 5EVID 4L9EA 4KZ4A 3NC8A 4F94A 1BUEA 5EOEA 1XPBA 4DDSA 2WKQA 4BD0A 4Y5FA 5HDSA 3F1OA 3VSLA 5FSRA 5HDDA 5TFQA 4YINA 3S1YA 1D1JA 4EBPA 1MWRA 3SS3A 3UE1A 1UWNX 1ONHA 4DMZA 3ISGA 5FI7A 2Y2HA 4E3JA 4P6ZM 1DP9A 4R3AA 5DKKA 5CEBA 4EEPA 3LEQA 3PBNA 2QHKA 3DTEA 3SZTA 3VE4A 4S2LA 4Y3IA 3N7WA 3DWZA 3PBRA 4NK3A 3ZG7B 1W63Q 2EX9A 1PIOA 3W4QA 2KOIA 4KZ7A 4KZ3A 2A2LA
chains in the Genus database with same CATH topology
5DF7A 3ZNYA 1W79A 5HX9A 3P98A 3GRJA 3AGDA 2B5RA 2A49A 3LEZA 3Q1FA 5CGSA 4CPKA 4BL2A 3HLFA 3SH9A 5A91A 1I2WA 1SCWA 3IWIA 2XGNA 1NXYA 2WAEA 4N1XA 1K6SA 4IBRA 4JXVA 1BLHA 1CK3A 3SS5A 4GD8A 2Y2LA 4BL3A 1JWZA 5CHJA 1K57A 3OPRA 4IVIA 4EWFA 4JPMA 3Q81A 4E6XA 3OCNA 5EVIB 1JWPA 2CC1A 3M6HA 1FSWA 2HDSA 2Y2KA 2ZMAA 3ZG8B 4OPYA 1IYQA 4B88A 1PWGA 4KENB 1H8ZA 1U60A 3OCLA 5TGFA 2H0YA 4S2MA 4WM9A 1YMXA 3WS1A 2OLVA 4B4ZA 3VP4A 2H0TA 2PBYA 2XK1A 5CXWA 2Z2MB 4QB8A 1O7EA 3UE3A 3O3VA 1YLZA 4LCMA 4RX2A 4JXWA 1XA1A 2XR0A 3OZHA 1LHYA 2P74A 4ZJ2A 4FH4A 3QHYA 2C6WB 3ZNTA 3GMWA 1CI8A 5AQAA 2DRWA 5G18A 2ZQ7A 3PBQA 4GDBA 2HP6A 2HPBA 2Y2GA 4L0LA 4MBFA 3AGFA 3VP1A 1DJBA 1KGEA 4S2PA 4D2OA 3N8LA 1QMEA 2ZC7A 3HL9A 4UHUA 5HFOA 1E25A 1KE3A 3W8KA 2XD1A 5E2FA 1IEMA 1VM1A 1XKZA 3CMZA 4FCFA 1PZPA 3NCKA 4P6BA 4WMCD 5DTKA 3N6IA 4BD1A 3GR2A 5E2GA 3DTMA 3B3XA 3O86A 1BLCA 3Q07A 1ZKJA 2DCFA 1KGGA 2DNSA 1O07A 1GHMA 2XFSA 1XXMA 4DXBA 5F1FA 4OOYA 5D3OA 1YLJA 4JKTA 5DTSA 2FFFB 5DF8A 4WMCA 4XXRA 5FQIA 3AGEA 1S6RA 5CGXA 3UDIA 2ZM0A 1G6AA 3ITBA 3UY6A 3M6BA 5BOHA 3HLDA 4KG2A 3ZFZA 3IT9A 4JBFA 4S2NA 4PM8A 3VSKA 4S2JA 3TOIA 3NY4A 4GKUA 4C75A 2JBFA 4BLMA 4EUZA 1NRFA 4N92A 4KZ5A 2P9VA 1RP5A 5FAPA 1FSYA 1OMEA 3VOZA 1LI9A 4Q8IA 2WGWA 4IEDA 2WUQA 4B4XA 1ERMA 4RYEA 3OPPA 1YMSA 2ZQ8A 4ZBEA 1HVBA 1Y54A 5U47A 4OQHA 1IKIA 4KG5A 2ZC5B 3IXGA 3IQAA 4GD6A 4JF6A 2VGKA 3LY4A 5EUAA 1DJAA 2ZM2A 2ZLYA 1ZC2A 4LENA 1RGYA 5FI6A 3UNWA 1K56D 5CTMA 3HREA 2ZJ9A 5EOOA 1KE0A 1MKIA 2XDMA 4FD8A 3SS4A 1NZOA 4OQ0A 4OQGA 2Y2PA 3IF5A 4WEJA 3WWXA 1ESUA 3A3FA 2X71A 4KZ9A 5A93A 2V2FF 2J7VA 1XA7A 2XFTA 1EI5A 1YQSA 4LV0A 1SHVA 3G31A 1K55C 4EBLA 4QU3A 1L0FA 4GB7A 3LO7A 3I7JA 3IHBA 5FAOA 1HD8A 3UN7A 4A5RA 1GCEA 4X69A 4OLDA 1FCMA 1IYPA 1XGJA 2WZZA 2VGJA 3HLBA 4MBHA 4OPQA 2RCXA 3FKVA 5M1AA 3CJMA 4R3BA 1HZOA 1K4EA 1EROA 1TEMA 3HLGA 4RVAA 3VP3A 4EBNA 1K6RA 3IXHA 3MKEA 3RXXA 3N8SA 2Y2MA 1YM1A 3UPOA 1PW1A 5CERA 1NZUA 3MZEA 4PPRA 4JXSA 5FAQA 4C6YA 3V3RA 1L0DA 3WS0A 1C3BA 1KVLA 3Q7ZA 3GTCA 4ZJ3A 1WYBA 4K0WA 4S2NC 4ID4A 4U0TA 4WELA 4WYYA 2EX2A 4LV1A 1W5DA 4X53A 5GLCA 3WS5A 4OPRA 1TVFA 4HEFA 4FSFA 5FQKA 1MXOA 2XLNA 4PM6A 4DXCA 4P0MA 1CEGA 2XD5A 4UA6A 2HDQA 2QMIA 3G2YA 5EVLA 2HP5A 5HAPA 3BEBA 2J9PA 4BENA 1BZAA 3D4FA 3A3DA 1MY8A 5FASA 5HAIA 1BULA 4KZ6A 3UDFA 1K56A 3UDXA 2ZC6B 4KQOA 4OQIA 2Z2LB 4X68A 3SOIA 3Q7VA 3GSGA 1K38A 1YLWA 4DF6A 1FCOA 2XEPA 1BLPA 5JYOA 2X01A 3WRZA 1E4DA 4XUXA 4XUZA 1YLPA 4ZAMA 2WKEA 2HDRA 4RX3A 4HESA 4S2OA 3WS4A 4RA7A 2QZ6A 2BLSA 3ITAA 4LCLA 1PWDA 1Z6FA 2HDUA 3BECA 3GV9A 1MWSA 2GDNA 5EE8A 5FQJA 5A92A 4DKIA 3OPHA 5A90A 3MXSA 4DE0A 1K55A 5HAQA 1Q2PA 2IWDA 2QPNA 2WKIA 3IF6A 3ZGAB 3LCEA 1AXBA 3QNBA 5CEDA 1W8YA 5J8XA 3G2ZA 4GZBA 4PM7A 2OLUA 5HW3A 3M2KA 3UO9A 4JLFA 3BFCA 1CEFA 3FKWA 2V20A 2IWBA 3BLSA 3V50A 3Q82A 3A3EA 1S0WA 4E3IA 4QY6A 3C7VA 1NJ4A 4NETA 4DE1A 1ERQA 1JTGA 3IF6B 4OONA 3SH8A 1FCNA 4O7DA 1K57C 2WZXA 3HUMA 2UWXA 2EXAA 4DE2A 2Q9MA 1K54C 3MBZA 3BFGA 1KDWA 4OH0A 3PBTA 4KZBA 1JWVA 3ZG0A 1K25A 1XP4A 1EWZA 1GHPA 1M40A 5GL9A 4JF5A 2Y2NA 5CHMA 1KDSA 4P87A 5FI2A 4PM9A 1YLYA 4R4RA 2J8YA 2V1ZA 4LV3A 1WYCA 4GN2A 3G4PA 3ZG9B 1PI4A 1XX2A 1NYYA 1FQGA 3E2LA 3P09A 3PAGA 1LL9A 2G2WA 2I72A 4PMAA 5AQ7A 4WZ5A 1L0GA 5IHVA 5GHZA 5CECA 4N9KA 4KZ8A 2RL3A 4R1GA 4IBXA 3BYDA 2J9OA 3RJUA 2JCHA 1GA0A 2EX8A 2JC7A 3IH9A 4JF4A 3FYZA 1N9BA 3E2KA 4OOLA 3BRMA 3S22A 3DW0A 1MWUA 1SDNA 4R4SA 3HUNA 4PM5A 1PZOA 2XQZA 4GDNA 4OPZA 1PYYA 1CI9A 4Y0TA 3OC2A 3IHAA 4BQMA 4P85A 3O88A 3VFFA 2PU2A 4OVDA 4MBKA 5DVAA 3UPNA 4K0XA 2Y2IA 3VP0A 1RCJA 2Y2OA 1I2SA 3HVFA 5KSHA 2XF3A 1W7FA 4N9LA 3NBLA 1GA9A 3MXRA 5AQBA 1PI5A 3LY3A 5FATA 4E3KA 1IYOA 1G68A 1PW8A 4WZ5C 5KMWA 5F1GA 2R9WA 1ZG4A 3CG5A 4LV2A 2ZQAA 1ES5A 2Y55A 5CHUA 5CRFA 3C4OA 2WKHA 4X56A 3O87A 1GHIA 5KSCA 3C4PA 3VP2A 3M2JA 3BFFA 1TDGA 1ES2A 4Y0OA 3ZVWA 4JXGA 5FQ9A 5AQ9A 2X02A 3HLWA 4YFMA 2PU4A 4MNRA 3V5MA 2EFUA 5M18A 3V3SA 2XH9A 3ZVTA 1W8QA 1FOFA 1HTZA 4DRTA 1PWCA 1WE4A 3N8RA 4QY5A 4X6TA 3G35A 4Z9QA 3BLMA 3IXBA 5I94A 4M3KA 2Y2QA 4ZTKA 1ES4A 1LL5A 2EXBA 3NDGA 1BTLA 4R3JA 4WBGA 3BM6A 2ZM8A 3NDEA 4X55A 4U0XA 1KVMA 4OLGA 4CJNA 5FQQA 1LLBA 5E2HA 4QJGA 4FH2A 3A3IA 3IWQA 4OKPA 3EQVA 5TR7A 1E3UD 3FZCA 3HUOA 3PAEA 3G30A 3BFEA 1J9MA 2Y91A 4MEZA 1K4FA 1Q2QA 2FFYA 4C3QA 5M19A 4R0QA 1L2SA 1YLTA 2WGWB 1M6KA 4Y0UA 4ZDXA 1KE4A 1MWTA 3TSGA 2Q9NA 1JTDA 2OSUA 1YT4A 2P9VB 2ZQDA 2WGIA 1SDEA 1TDLA 3FV7A 5JYPA 4WEKA 1FR1A 1N4OA 4U3TA 4BJPA 1MPLA 3VFHA 4EQIA 1ES3A 3HLCA 1MBLA 3UPPA 2ZD8A 2EFXA 4MLLA 4OP8A 1BLSA 3HLEA 3OPLA 3HBRA 4UA7A 1QMFA 3C5AA 4UA9A 3TG9A 3PBOA 4KQRA 4N1HA 3GQZA 3MFDA 1ALQA 3A3JA 3ZHHA 2H5SA 2C5WB 4KG6A 2Y59A 1IYSA 3ZG5A 4EV4A 4OOMA 3GVBA 3DWKA 5CTNA 3N4IA 2ZC3B 4KQQA 3W4OA 2HP9A 1ONGA 4K91A 5E43A 2WAFA 3PTEA 3W4PA 5FA7A 4E3OA 4E6WA 4OP5A 3SH7A 1ZG6A 3IWOA 3WRTA 3MZFA 5DTTA 5HL1A 4HBTA 4GOGA 5EVID 4R23A 1L0EA 1DY6A 3ZDJA 4KZ4A 3WS2A 4E3NA 5EPHA 5EVIC 5E2EA 3NC8A 4F94A 4S2KA 2H10A 3EQUA 1IKGA 1BUEA 3PBSA 5EOEA 1XPBA 5GHYA 4DDSA 2A3UA 4E3LA 3V39A 4BD0A 2Y4AA 5F83A 3VSLA 1XGIA 3MZDA 2E8IA 3FWLA 3G32A 4S2IA 4ZJ1A 4E3MA 1FR6A 5HARA 1ESIA 3VMAA 3CZDA 1K54A 3BFDA 4QD4A 4Y7PA 5FSRA 5TFQA 5F82A 3S4XA 4YINA 3S1YA 3MKFA 5FDHA 1BSGA 5GHXA 2OV5A 3IXDA 4DDYA 2G2UA 3VOYA 4EBPA 1MWRA 3SS3A 4IVKA 3Q7VB 3UE1A 5DF9A 5EECA 1ONHA 3ISGA 1NY0A 5FI7A 5EVIA 4HBUA 4UAAA 5GLDA 1H5XA 2Y2HA 4E3JA 2IWCA 2JE5A 3UE0A 5L2FA 1KGFA 3C7UA 4DE3A 5CGWA 3NI9A 1NYMA 5FQMA 2EX6A 5CEBA 3IH8A 5KZHA 3PBNA 1E3UA 2ZC4B 4WZ4A 2Y2JA 3JYIA 1I5QA 1LI0A 4S2LA 4KZAA 2WK0A 3NIAA 4H8RA 1DJCA 2ZQ9A 3N7WA 3RXWA 3DWZA 1BT5A 1IELA 3G34A 4QHCA 2WYXA 3PBRA 1JVJA 4NK3A 1SKFA 4GNUA 3ZG7B 3QNCA 1VQQA 1PIOA 1RGZA 2EX9A 3W4QA 3ZCZA 5GLBA 2R9XA 2WADA 2ZQCA 4KZ7A 1H8YA 2BG1A 2WGVA 5GLAA 4KZ3A 3IF6C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DF7 A;  3ZNY A;  1W79 A;  5HX9 A;  3P98 A;  3GRJ A;  3AGD A;  2B5R A;  2A49 A;  3LEZ A;  3Q1F A;  5CGS A;  4CPK A;  4BL2 A;  3HLF A;  3SH9 A;  5A91 A;  1I2W A;  1SCW A;  3IWI A;  2XGN A;  1NXY A;  2WAE A;  4N1X A;  1K6S A;  4IBR A;  4JXV A;  1BLH A;  1CK3 A;  3SS5 A;  4GD8 A;  2Y2L A;  4BL3 A;  1JWZ A;  5CHJ A;  1K57 A;  3OPR A;  4IVI A;  4EWF A;  4JPM A;  3Q81 A;  4E6X A;  3OCN A;  5EVI B;  1JWP A;  2CC1 A;  3M6H A;  1FSW A;  2HDS A;  2Y2K A;  2ZMA A;  3ZG8 B;  4OPY A;  1IYQ A;  4B88 A;  1PWG A;  4KEN B;  1H8Z A;  1U60 A;  3OCL A;  5TGF A;  2H0Y A;  4S2M A;  4WM9 A;  1YMX A;  3WS1 A;  2OLV A;  4B4Z A;  3VP4 A;  2H0T A;  2PBY A;  2XK1 A;  5CXW A;  2Z2M B;  4QB8 A;  1O7E A;  3UE3 A;  3O3V A;  1YLZ A;  4LCM A;  4RX2 A;  4JXW A;  1XA1 A;  2XR0 A;  3OZH A;  1LHY A;  2P74 A;  4ZJ2 A;  4FH4 A;  3QHY A;  2C6W B;  3ZNT A;  3GMW A;  1CI8 A;  5AQA A;  2DRW A;  5G18 A;  2ZQ7 A;  3PBQ A;  4GDB A;  2HP6 A;  2HPB A;  2Y2G A;  4L0L A;  4MBF A;  3AGF A;  3VP1 A;  1DJB A;  1KGE A;  4S2P A;  4D2O A;  3N8L A;  1QME A;  2ZC7 A;  3HL9 A;  4UHU A;  5HFO A;  1E25 A;  1KE3 A;  3W8K A;  2XD1 A;  5E2F A;  1IEM A;  1VM1 A;  1XKZ A;  3CMZ A;  4FCF A;  1PZP A;  3NCK A;  4P6B A;  4WMC D;  5DTK A;  3N6I A;  4BD1 A;  3GR2 A;  5E2G A;  3DTM A;  3B3X A;  3O86 A;  1BLC A;  3Q07 A;  1ZKJ A;  2DCF A;  1KGG A;  2DNS A;  1O07 A;  1GHM A;  2XFS A;  1XXM A;  4DXB A;  5F1F A;  4OOY A;  5D3O A;  1YLJ A;  4JKT A;  5DTS A;  2FFF B;  5DF8 A;  4WMC A;  4XXR A;  5FQI A;  3AGE A;  1S6R A;  5CGX A;  3UDI A;  2ZM0 A;  1G6A A;  3ITB A;  3UY6 A;  3M6B A;  5BOH A;  3HLD A;  4KG2 A;  3ZFZ A;  3IT9 A;  4JBF A;  4S2N A;  4PM8 A;  3VSK A;  4S2J A;  3TOI A;  3NY4 A;  4GKU A;  4C75 A;  2JBF A;  4BLM A;  4EUZ A;  1NRF A;  4N92 A;  4KZ5 A;  2P9V A;  1RP5 A;  5FAP A;  1FSY A;  1OME A;  3VOZ A;  1LI9 A;  4Q8I A;  2WGW A;  4IED A;  2WUQ A;  4B4X A;  1ERM A;  4RYE A;  3OPP A;  1YMS A;  2ZQ8 A;  4ZBE A;  1HVB A;  1Y54 A;  5U47 A;  4OQH A;  1IKI A;  4KG5 A;  2ZC5 B;  3IXG A;  3IQA A;  4GD6 A;  4JF6 A;  2VGK A;  3LY4 A;  5EUA A;  1DJA A;  2ZM2 A;  2ZLY A;  1ZC2 A;  4LEN A;  1RGY A;  5FI6 A;  3UNW A;  1K56 D;  5CTM A;  3HRE A;  2ZJ9 A;  5EOO A;  1KE0 A;  1MKI A;  2XDM A;  4FD8 A;  3SS4 A;  1NZO A;  4OQ0 A;  4OQG A;  2Y2P A;  3IF5 A;  4WEJ A;  3WWX A;  1ESU A;  3A3F A;  2X71 A;  4KZ9 A;  5A93 A;  2V2F F;  2J7V A;  1XA7 A;  2XFT A;  1EI5 A;  1YQS A;  4LV0 A;  1SHV A;  3G31 A;  1K55 C;  4EBL A;  4QU3 A;  1L0F A;  4GB7 A;  3LO7 A;  3I7J A;  3IHB A;  5FAO A;  1HD8 A;  3UN7 A;  4A5R A;  1GCE A;  4X69 A;  4OLD A;  1FCM A;  1IYP A;  1XGJ A;  2WZZ A;  2VGJ A;  3HLB A;  4MBH A;  4OPQ A;  2RCX A;  3FKV A;  5M1A A;  3CJM A;  4R3B A;  1HZO A;  1K4E A;  1ERO A;  1TEM A;  3HLG A;  4RVA A;  3VP3 A;  4EBN A;  1K6R A;  3IXH A;  3MKE A;  3RXX A;  3N8S A;  2Y2M A;  1YM1 A;  3UPO A;  1PW1 A;  5CER A;  1NZU A;  3MZE A;  4PPR A;  4JXS A;  5FAQ A;  4C6Y A;  3V3R A;  1L0D A;  3WS0 A;  1C3B A;  1KVL A;  3Q7Z A;  3GTC A;  4ZJ3 A;  1WYB A;  4K0W A;  4S2N C;  4ID4 A;  4U0T A;  4WEL A;  4WYY A;  2EX2 A;  4LV1 A;  1W5D A;  4X53 A;  5GLC A;  3WS5 A;  4OPR A;  1TVF A;  4HEF A;  4FSF A;  5FQK A;  1MXO A;  2XLN A;  4PM6 A;  4DXC A;  4P0M A;  1CEG A;  2XD5 A;  4UA6 A;  2HDQ A;  2QMI A;  3G2Y A;  5EVL A;  2HP5 A;  5HAP A;  3BEB A;  2J9P A;  4BEN A;  1BZA A;  3D4F A;  3A3D A;  1MY8 A;  5FAS A;  5HAI A;  1BUL A;  4KZ6 A;  3UDF A;  1K56 A;  3UDX A;  2ZC6 B;  4KQO A;  4OQI A;  2Z2L B;  4X68 A;  3SOI A;  3Q7V A;  3GSG A;  1K38 A;  1YLW A;  4DF6 A;  1FCO A;  2XEP A;  1BLP A;  5JYO A;  2X01 A;  3WRZ A;  1E4D A;  4XUX A;  4XUZ A;  1YLP A;  4ZAM A;  2WKE A;  2HDR A;  4RX3 A;  4HES A;  4S2O A;  3WS4 A;  4RA7 A;  2QZ6 A;  2BLS A;  3ITA A;  4LCL A;  1PWD A;  1Z6F A;  2HDU A;  3BEC A;  3GV9 A;  1MWS A;  2GDN A;  5EE8 A;  5FQJ A;  5A92 A;  4DKI A;  3OPH A;  5A90 A;  3MXS A;  4DE0 A;  1K55 A;  5HAQ A;  1Q2P A;  2IWD A;  2QPN A;  2WKI A;  3IF6 A;  3ZGA B;  3LCE A;  1AXB A;  3QNB A;  5CED A;  1W8Y A;  5J8X A;  3G2Z A;  4GZB A;  4PM7 A;  2OLU A;  5HW3 A;  3M2K A;  3UO9 A;  4JLF A;  3BFC A;  1CEF A;  3FKW A;  2V20 A;  2IWB A;  3BLS A;  3V50 A;  3Q82 A;  3A3E A;  1S0W A;  4E3I A;  4QY6 A;  3C7V A;  1NJ4 A;  4NET A;  4DE1 A;  1ERQ A;  1JTG A;  3IF6 B;  4OON A;  3SH8 A;  1FCN A;  4O7D A;  1K57 C;  2WZX A;  3HUM A;  2UWX A;  2EXA A;  4DE2 A;  2Q9M A;  1K54 C;  3MBZ A;  3BFG A;  1KDW A;  4OH0 A;  3PBT A;  4KZB A;  1JWV A;  3ZG0 A;  1K25 A;  1XP4 A;  1EWZ A;  1GHP A;  1M40 A;  5GL9 A;  4JF5 A;  2Y2N A;  5CHM A;  1KDS A;  4P87 A;  5FI2 A;  4PM9 A;  1YLY A;  4R4R A;  2J8Y A;  2V1Z A;  4LV3 A;  1WYC A;  4GN2 A;  3G4P A;  3ZG9 B;  1PI4 A;  1XX2 A;  1NYY A;  1FQG A;  3E2L A;  3P09 A;  3PAG A;  1LL9 A;  2G2W A;  2I72 A;  4PMA A;  5AQ7 A;  4WZ5 A;  1L0G A;  5IHV A;  5GHZ A;  5CEC A;  4N9K A;  4KZ8 A;  2RL3 A;  4R1G A;  4IBX A;  3BYD A;  2J9O A;  3RJU A;  2JCH A;  1GA0 A;  2EX8 A;  2JC7 A;  3IH9 A;  4JF4 A;  3FYZ A;  1N9B A;  3E2K A;  4OOL A;  3BRM A;  3S22 A;  3DW0 A;  1MWU A;  1SDN A;  4R4S A;  3HUN A;  4PM5 A;  1PZO A;  2XQZ A;  4GDN A;  4OPZ A;  1PYY A;  1CI9 A;  4Y0T A;  3OC2 A;  3IHA A;  4BQM A;  4P85 A;  3O88 A;  3VFF A;  2PU2 A;  4OVD A;  4MBK A;  5DVA A;  3UPN A;  4K0X A;  2Y2I A;  3VP0 A;  1RCJ A;  2Y2O A;  1I2S A;  3HVF A;  5KSH A;  2XF3 A;  1W7F A;  4N9L A;  3NBL A;  1GA9 A;  3MXR A;  5AQB A;  1PI5 A;  3LY3 A;  5FAT A;  4E3K A;  1IYO A;  1G68 A;  1PW8 A;  4WZ5 C;  5KMW A;  5F1G A;  2R9W A;  1ZG4 A;  3CG5 A;  4LV2 A;  2ZQA A;  1ES5 A;  2Y55 A;  5CHU A;  5CRF A;  3C4O A;  2WKH A;  4X56 A;  3O87 A;  1GHI A;  5KSC A;  3C4P A;  3VP2 A;  3M2J A;  3BFF A;  1TDG A;  1ES2 A;  4Y0O A;  3ZVW A;  4JXG A;  5FQ9 A;  5AQ9 A;  2X02 A;  3HLW A;  4YFM A;  2PU4 A;  4MNR A;  3V5M A;  2EFU A;  5M18 A;  3V3S A;  2XH9 A;  3ZVT A;  1W8Q A;  1FOF A;  1HTZ A;  4DRT A;  1PWC A;  1WE4 A;  3N8R A;  4QY5 A;  4X6T A;  3G35 A;  4Z9Q A;  3BLM A;  3IXB A;  5I94 A;  4M3K A;  2Y2Q A;  4ZTK A;  1ES4 A;  1LL5 A;  2EXB A;  3NDG A;  1BTL A;  4R3J A;  4WBG A;  3BM6 A;  2ZM8 A;  3NDE A;  4X55 A;  4U0X A;  1KVM A;  4OLG A;  4CJN A;  5FQQ A;  1LLB A;  5E2H A;  4QJG A;  4FH2 A;  3A3I A;  3IWQ A;  4OKP A;  3EQV A;  5TR7 A;  1E3U D;  3FZC A;  3HUO A;  3PAE A;  3G30 A;  3BFE A;  1J9M A;  2Y91 A;  4MEZ A;  1K4F A;  1Q2Q A;  2FFY A;  4C3Q A;  5M19 A;  4R0Q A;  1L2S A;  1YLT A;  2WGW B;  1M6K A;  4Y0U A;  4ZDX A;  1KE4 A;  1MWT A;  3TSG A;  2Q9N A;  1JTD A;  2OSU A;  1YT4 A;  2P9V B;  2ZQD A;  2WGI A;  1SDE A;  1TDL A;  3FV7 A;  5JYP A;  4WEK A;  1FR1 A;  1N4O A;  4U3T A;  4BJP A;  1MPL A;  3VFH A;  4EQI A;  1ES3 A;  3HLC A;  1MBL A;  3UPP A;  2ZD8 A;  2EFX A;  4MLL A;  4OP8 A;  1BLS A;  3HLE A;  3OPL A;  3HBR A;  4UA7 A;  1QMF A;  3C5A A;  4UA9 A;  3TG9 A;  3PBO A;  4KQR A;  4N1H A;  3GQZ A;  3MFD A;  1ALQ A;  3A3J A;  3ZHH A;  2H5S A;  2C5W B;  4KG6 A;  2Y59 A;  1IYS A;  3ZG5 A;  4EV4 A;  4OOM A;  3GVB A;  3DWK A;  5CTN A;  3N4I A;  2ZC3 B;  4KQQ A;  3W4O A;  2HP9 A;  1ONG A;  4K91 A;  5E43 A;  2WAF A;  3PTE A;  3W4P A;  5FA7 A;  4E3O A;  4E6W A;  4OP5 A;  3SH7 A;  1ZG6 A;  3IWO A;  3WRT A;  3MZF A;  5DTT A;  5HL1 A;  4HBT A;  4GOG A;  5EVI D;  4R23 A;  1L0E A;  1DY6 A;  3ZDJ A;  4KZ4 A;  3WS2 A;  4E3N A;  5EPH A;  5EVI C;  5E2E A;  3NC8 A;  4F94 A;  4S2K A;  2H10 A;  3EQU A;  1IKG A;  1BUE A;  3PBS A;  5EOE A;  1XPB A;  5GHY A;  4DDS A;  2A3U A;  4E3L A;  3V39 A;  4BD0 A;  2Y4A A;  5F83 A;  3VSL A;  1XGI A;  3MZD A;  2E8I A;  3FWL A;  3G32 A;  4S2I A;  4ZJ1 A;  4E3M A;  1FR6 A;  5HAR A;  1ESI A;  3VMA A;  3CZD A;  1K54 A;  3BFD A;  4QD4 A;  4Y7P A;  5FSR A;  5TFQ A;  5F82 A;  3S4X A;  4YIN A;  3S1Y A;  3MKF A;  5FDH A;  1BSG A;  5GHX A;  2OV5 A;  3IXD A;  4DDY A;  2G2U A;  3VOY A;  4EBP A;  1MWR A;  3SS3 A;  4IVK A;  3Q7V B;  3UE1 A;  5DF9 A;  5EEC A;  1ONH A;  3ISG A;  1NY0 A;  5FI7 A;  5EVI A;  4HBU A;  4UAA A;  5GLD A;  1H5X A;  2Y2H A;  4E3J A;  2IWC A;  2JE5 A;  3UE0 A;  5L2F A;  1KGF A;  3C7U A;  4DE3 A;  5CGW A;  3NI9 A;  1NYM A;  5FQM A;  2EX6 A;  5CEB A;  3IH8 A;  5KZH A;  3PBN A;  1E3U A;  2ZC4 B;  4WZ4 A;  2Y2J A;  3JYI A;  1I5Q A;  1LI0 A;  4S2L A;  4KZA A;  2WK0 A;  3NIA A;  4H8R A;  1DJC A;  2ZQ9 A;  3N7W A;  3RXW A;  3DWZ A;  1BT5 A;  1IEL A;  3G34 A;  4QHC A;  2WYX A;  3PBR A;  1JVJ A;  4NK3 A;  1SKF A;  4GNU A;  3ZG7 B;  3QNC A;  1VQQ A;  1PIO A;  1RGZ A;  2EX9 A;  3W4Q A;  3ZCZ A;  5GLB A;  2R9X A;  2WAD A;  2ZQC A;  4KZ7 A;  1H8Y A;  2BG1 A;  2WGV A;  5GLA A;  4KZ3 A;  3IF6 C; 
#chains in the Genus database with same CATH topology
 3P98 A;  3AGD A;  2B5R A;  4BL2 A;  2XSS A;  3SH9 A;  1NWZ A;  4HP9 A;  3IWI A;  1NXY A;  4XT2 A;  4EEU A;  3SS5 A;  4LFU A;  1JWZ A;  5CHJ A;  4ETX A;  3CHW P;  4JPM A;  2CC1 A;  2HDS A;  2Y2K A;  2ZMA A;  3ZG8 B;  4OPY A;  5G4Y A;  4B88 A;  1H8Z A;  4YNR A;  3VP4 A;  2INW A;  2Z2M B;  3UE3 A;  1YLZ A;  1F98 A;  1TF1 A;  2XR0 A;  2Z6C A;  4ZJ2 A;  1X0O A;  5AQA A;  3QP4 A;  5G18 A;  2W3D A;  3AGF A;  3VP1 A;  1DJB A;  3N8L A;  3B33 A;  1XKZ A;  1IEM A;  1VM1 A;  3CMZ A;  3GR2 A;  4JGR A;  3Q07 A;  2PBD P;  2XFS A;  5FEG A;  3V67 A;  4DXB A;  5D3O A;  5F6A A;  2VKS A;  2HJ9 C;  4XXR A;  3VOL A;  1L3L A;  4EET B;  3AGE A;  1XJ3 A;  3UDI A;  2ZM0 A;  4F3L B;  1T1A A;  3ZFZ A;  4S2N A;  4JBF A;  4BLM A;  5FAP A;  2WUQ A;  4B4X A;  5U47 A;  4OQH A;  4PKY A;  1VEU B;  1TS0 A;  1Y4O A;  2E8J A;  4JGQ A;  5EUA A;  3IBJ A;  4Y2F A;  5FI6 A;  2KLI A;  2PYR A;  1K56 D;  3HRE A;  1KE0 A;  1MKI A;  3SS4 A;  4I5S A;  2P04 A;  2VV8 A;  3LID A;  4OQG A;  5A93 A;  4LV0 A;  5TBM B;  4HY8 A;  4EBL A;  4ME4 A;  2YKF A;  4FUW A;  4A5R A;  1HD8 A;  4NXG A;  4MCW A;  3HLB A;  4DJ2 A;  5M1A A;  1HZO A;  2LB5 A;  3A0S A;  1P9W A;  4RVA A;  2PAV P;  3MKE A;  3BQA A;  3UPO A;  2ZL1 B;  4MN5 A;  4EW7 A;  5FAQ A;  1VB6 A;  5HSQ A;  3T4Q A;  4ID4 A;  3T1Q B;  4U0T A;  2WKR A;  4WYY A;  1J3W A;  3EWK A;  5GLC A;  3RFB A;  1T19 A;  1MXO A;  4DXC A;  5IS1 A;  2XD5 A;  2QMI A;  3CWF A;  3G2Y A;  5HD5 A;  2HP5 A;  2V0U A;  3D4F A;  5FAS A;  5EFW A;  3HJK A;  3Q7V A;  3GSG A;  1K38 A;  1FCO A;  5JYO A;  4WL9 A;  3F1P B;  2HDR A;  2NUP C;  2P08 A;  5DFX A;  4LCL A;  1PWD A;  3BEC A;  5EE8 A;  2GDN A;  4X1M A;  3OPH A;  3A0V A;  3S7Q A;  3T12 B;  3IX8 A;  5HAQ A;  2WKI A;  3ULF A;  3IF6 A;  3LCE A;  1W8Y A;  5J8X A;  3G2Z A;  1ACF A;  3UB9 A;  3C2W A;  3FKW A;  2IWB A;  3U4L P;  1FCN A;  2UWX A;  3LIA A;  3LFV A;  3BFG A;  3PBT A;  4KZB A;  1JWV A;  3MQQ A;  3ZG0 A;  1XP4 A;  1ODV A;  1WA9 A;  1KDS A;  4P87 A;  1YLY A;  2J8Y A;  4LV3 A;  2PT7 A;  4JGO A;  4CQH A;  5IU1 A;  1YPR A;  3PAG A;  1Z09 A;  5IHV A;  3B42 A;  5CEC A;  1YSQ A;  3BYD A;  2J9O A;  3MF0 A;  2OWJ A;  3E2K A;  4OOL A;  3BRM A;  4Q0I A;  1MWU A;  2DMW A;  1CI9 A;  3MR0 A;  1OTE A;  2ZOH A;  4P85 A;  1OTA A;  2HJE A;  2LB9 A;  3LY3 A;  4E3K A;  3IS2 A;  1SKO A;  1G68 A;  2ZQA A;  2AVX A;  1ES5 A;  2Y55 A;  3C4O A;  4X56 A;  5DFY A;  2O99 A;  1F5M A;  1GHI A;  3C4P A;  1HLU P;  3BFF A;  2XA7 M;  4Y0O A;  3ZVW A;  2X02 A;  3HLW A;  4GS9 A;  4GS9 B;  2XH9 A;  1UWP X;  3LIB A;  3ZVT A;  4QY5 A;  1YSP A;  3BLM A;  3QP1 A;  3KSH A;  4O8G A;  2ZM8 A;  3TW8 A;  2W0N A;  1SKO B;  2WKP A;  4EUV A;  1LLB A;  4I3J A;  3EQV A;  3G30 A;  1VEU A;  1J9M A;  1K4F A;  2EA9 A;  1Q2Q A;  2O9A A;  5M19 A;  2WGW B;  4Y0U A;  2OSU A;  2ZQD A;  4LGW A;  1TDL A;  4EQI A;  3VFH A;  3O5Y A;  3H9W A;  3OBF A;  3HBR A;  4UA9 A;  3TG9 A;  2EWV A;  3MFD A;  3ZHH A;  2H5S A;  3T1R A;  4CLC E;  4ESP A;  3ZG5 A;  4KQQ A;  2WAF A;  4R6L A;  3E4Q A;  4E6W A;  5FA7 A;  4HNB A;  4KUO A;  1ZG6 A;  3JPU A;  5DTT A;  4R23 A;  1L0E A;  3ZDJ A;  4FTX A;  5EPH A;  5EVI C;  5E2E A;  3HJI A;  4S2K A;  1IKG A;  3PBS A;  5HWW A;  2A3U A;  4E3L A;  1XGI A;  4ZJ1 A;  2E8I A;  3G32 A;  5HWT A;  2GZA A;  2M7U A;  1K54 A;  3BFD A;  3UB8 A;  3LIC A;  5F82 A;  1ZTU A;  5FDH A;  5GHX A;  3IXD A;  1P0Z A;  4BBU A;  4EER A;  4IVK A;  3Q7V B;  3SW1 A;  1NY0 A;  5EVI A;  4NG2 A;  4WF0 A;  2CMN A;  2V1A A;  2QJ7 A;  3P01 A;  1OJ5 A;  5EM1 A;  2JE5 A;  3UE0 A;  1DP6 A;  3NI9 A;  1OTD A;  5FQM A;  2EX6 A;  3FPV A;  4XT2 B;  1E3U A;  4LRX C;  2ZC4 B;  2Y2J A;  3JYI A;  1I5Q A;  4HQA A;  4MN7 A;  2WK0 A;  1DJC A;  4CLC A;  3G34 A;  1P9R A;  2WYX A;  1JVJ A;  5K5B A;  1SKF A;  4GNU A;  3QNC A;  1RGZ A;  5J4E A;  3ZCZ A;  2R9X A;  3IX3 A;  2ZQC A;  5GLA A;  1G28 A;  1K0K A;  2L1M A;  2O9B A;  5DF7 A;  1GSW A;  1W79 A;  2ZL1 A;  4E04 A;  3Q1F A;  3LEZ A;  4GCZ A;  4UQI M;  2XGN A;  3NJA A;  1K6S A;  2VJW A;  4JXV A;  2QKP A;  1K57 A;  3OPR A;  3LR5 A;  3NHQ A;  3OCN A;  5EVI B;  3CLO A;  4NKP A;  1U60 A;  4EXO A;  1YMX A;  2QYB A;  4LPZ A;  1YKD A;  2H0T A;  5CXW A;  3T1X A;  4RX2 A;  4LCM A;  3G6O A;  5DJU A;  3GDI A;  1TS6 A;  3QHY A;  2DRW A;  2KDK A;  2BAS A;  1QME A;  4UHU A;  3E4O A;  5E2F A;  4FCF A;  3ZYT A;  1PZP A;  4P6B A;  5DTK A;  4JGP A;  3B3X A;  5LBR A;  4WLA A;  2IA2 A;  2DNS A;  4QWO A;  4I3A A;  4OOY A;  4JKT A;  5DTS A;  2FFF B;  4YOF A;  1S6R A;  3GEC A;  5CGX A;  3ITB A;  3IT9 A;  4PM8 A;  3VSK A;  4S2J A;  3TOI A;  5A8B A;  3NY4 A;  4GKU A;  2JBF A;  3UME A;  4EUZ A;  1NRF A;  4KZ5 A;  5L09 A;  4UQI S;  1FSY A;  3LYX A;  1NLY A;  2KX6 A;  3OPP A;  1SZV A;  1HVB A;  1Y54 A;  4GD6 A;  3ZQ5 A;  3LY4 A;  5FEF A;  2HZ5 A;  1NZO A;  4OQ0 A;  4WEJ A;  2Y2P A;  1ESU A;  3A3F A;  2V2F F;  2J7V A;  4GJ4 A;  2XFT A;  1EI5 A;  5L07 A;  2V1B A;  1S4S A;  1L0F A;  4GB7 A;  3I7J A;  3IHB A;  3UN7 A;  2JKR I;  1XGJ A;  1S1Z A;  4OPQ A;  2RCX A;  3FKV A;  1XJ6 A;  3CJM A;  4R3B A;  1K4E A;  2UV0 E;  1TEM A;  3VP3 A;  1K6R A;  2XRO A;  3IXH A;  1PW1 A;  5CER A;  2A24 B;  4WN5 A;  4PPR A;  1W63 M;  1L0D A;  3Q7Z A;  3EGX C;  4NEE D;  4WEL A;  2EX2 A;  2J3T C;  3LI9 A;  3NOP C;  2MJ6 A;  4FSF A;  5FQK A;  4B9O A;  5AJG A;  3R4K A;  5HAP A;  1N9N A;  3C38 A;  3UDX A;  4KQO A;  3SOI A;  5HPI A;  1YLW A;  1UGU A;  2PR5 A;  2X01 A;  3WRZ A;  2WKE A;  2VV6 A;  2HDU A;  3GV9 A;  4DKI A;  3MXS A;  4DE0 A;  1K55 A;  1Q2P A;  3LR3 A;  1NRJ A;  1OT9 A;  3QNB A;  5CED A;  4PM7 A;  5HW3 A;  2JN7 A;  3M2K A;  3UO9 A;  2VV7 A;  3BLS A;  3A3E A;  4L9G A;  3R7W A;  3UE6 A;  4OON A;  4BBV A;  3HUM A;  2EXA A;  4NXF A;  4OH0 A;  3F1N A;  4KUK A;  1KOU A;  1OJG A;  1GHP A;  1M40 A;  4JF5 A;  1WYC A;  5EV0 A;  1XX2 A;  1NYY A;  1FQG A;  3E2L A;  3P09 A;  2I72 A;  2VLG A;  4I3I A;  3UB6 A;  2RL3 A;  4IBX A;  2JCH A;  4JF4 A;  1N9B A;  3S22 A;  3EGD C;  3VFF A;  2PU2 A;  1RCJ A;  2Y2O A;  3L9K A;  1GA9 A;  4G3V A;  2H28 A;  1PW8 A;  5KMW A;  5F1G A;  3CG5 A;  3MSH A;  5CRF A;  3VV4 A;  3O87 A;  3VP2 A;  3M2J A;  1TDG A;  5AQ9 A;  2PU4 A;  3V5M A;  5I5L A;  5M18 A;  3V3S A;  2W3H A;  1W8Q A;  4Y17 A;  1PWC A;  3G35 A;  5I94 A;  3CI6 A;  3LIE A;  4U0X A;  1KVM A;  4OLG A;  3IS2 B;  2FH5 A;  1LSX A;  2D02 A;  3IWQ A;  1E3U D;  3P7N A;  1H0M A;  5L8M A;  3LI8 A;  3RTY A;  2V9A A;  4MEZ A;  2D01 A;  1YLT A;  3MMH A;  1SDE A;  3FV7 A;  4HP4 A;  1MPL A;  3CIT A;  2ZMF A;  4GHI A;  1MBL A;  3C30 A;  4MLL A;  3D3O A;  3HLE A;  3PBO A;  4KQR A;  4N1H A;  3E98 A;  2QWS A;  3BY9 A;  4IUK A;  1IYS A;  5CTN A;  5EVE A;  4YWZ A;  3N4I A;  2ZC3 B;  3C8C A;  1ONG A;  4K91 A;  3SH7 A;  4ARZ B;  4R38 A;  2PRF A;  2PYP A;  4HJ3 A;  4BMW A;  2OAQ 1;  3WS2 A;  1VET A;  5F5Y A;  3V39 A;  2Y4A A;  5F83 A;  3MZD A;  3FWL A;  5HAR A;  3PXP A;  1LSW A;  3CZD A;  4Y7P A;  2OWH A;  4Z1W A;  4HJ6 A;  3MKF A;  1BSG A;  3A0R A;  4DJ3 A;  4DDY A;  2G2U A;  2JKT M;  3VOY A;  5EEC A;  4NXE A;  1H5X A;  1TS8 A;  2J3W A;  2IWC A;  5L2F A;  3IH8 A;  5KZH A;  5AVF A;  3S7P A;  4KZA A;  3NIA A;  4H8R A;  3H82 A;  2ZQ9 A;  4DN0 A;  1BT5 A;  1IEL A;  2VEA A;  1VQQ A;  5GLB A;  2WAD A;  1H8Y A;  2BG1 A;  2WGV A;  3ZNY A;  2A24 A;  3CUE C;  4CPK A;  2A49 A;  5CGS A;  3T1S A;  4QPR A;  2WAE A;  3KYZ A;  4N1X A;  1BLH A;  4GD8 A;  2Y2L A;  5HDC A;  2YKH A;  2J80 A;  3NEC A;  1IYQ A;  4FOF A;  5TBM A;  3TJZ C;  1PWG A;  3QP6 A;  2ZBB A;  4BWI A;  3OCL A;  4S2M A;  4WM9 A;  2OLV A;  1V9Z A;  2XK1 A;  1O7E A;  3O3V A;  4JXW A;  1XA1 A;  1LHY A;  1FIL A;  2P74 A;  1CF0 A;  3MQO A;  3T4O A;  3ZNT A;  2ZQ7 A;  2HP6 A;  2Y2G A;  4MBF A;  3CAX A;  4S2P A;  2NUT C;  2GX5 A;  2ZC7 A;  1CJF A;  3HL9 A;  5HFO A;  1E25 A;  3W8K A;  4ARZ A;  3NCK A;  3N6I A;  5KIZ A;  5E2G A;  2EWW A;  1MZU A;  4F3L A;  3H7W A;  3O86 A;  1BLC A;  1S67 L;  1ZKJ A;  1KGG A;  5FL3 A;  5F1F A;  5DF8 A;  1PFL A;  2HV1 A;  5FQI A;  4CLC D;  5BOH A;  4P6Z S;  3HLD A;  2PDR A;  4PHT A;  3T4T A;  4N92 A;  1RP5 A;  1V9Y A;  3VOZ A;  1LI9 A;  2WGW A;  4IED A;  2B95 A;  4RYE A;  2ZQ8 A;  4ZBE A;  1IKI A;  4KG5 A;  3IQA A;  5TJJ A;  4JF6 A;  2VGK A;  1DJA A;  2ZM2 A;  3NOU C;  1ZC2 A;  5J7E A;  1RGY A;  1LL8 A;  3IBR A;  3TE8 A;  3IF5 A;  2OAP 1;  1N9L A;  4KZ9 A;  2X71 A;  1XA7 A;  1YQS A;  1SHV A;  3JVU A;  2W1T B;  3G31 A;  1K55 C;  4QU3 A;  1BYW A;  2V8C A;  4X69 A;  4ETZ A;  1IYP A;  2WZZ A;  2VGJ A;  3ICY A;  4MBH A;  2ZOI A;  2HF6 A;  2Y79 A;  1G5U A;  2L0W A;  3CPT A;  3N8S A;  2Y2M A;  1YM1 A;  3MZE A;  2B02 A;  2W27 A;  1H8M A;  1KVL A;  3GTC A;  4ZJ3 A;  5DJT A;  4H6J B;  4LV1 A;  1W5D A;  5F69 A;  4X53 A;  3WS5 A;  3PR6 A;  4OPR A;  3H82 B;  3LR0 A;  3NOT C;  3FG8 A;  4HEF A;  4O01 A;  3S7O A;  2XLN A;  1OTB A;  4PM6 A;  1CEG A;  3DBA A;  4UA6 A;  2HDQ A;  5HPF A;  5EVL A;  3BY8 A;  2J9P A;  1GSX A;  1Y28 A;  5HAI A;  4KZ6 A;  1K56 A;  2W3F A;  2ZC6 B;  2Z2L B;  1BLP A;  3T4L A;  1E4D A;  4XUX A;  4XUZ A;  1YLP A;  4ZAM A;  4CLC C;  2QZ6 A;  1S66 L;  2BLS A;  2XRN A;  1Z6F A;  3ITA A;  5FQJ A;  3UPN A;  1MWS A;  5HZH A;  4NXB A;  5G4Z A;  2QPN A;  3R7W B;  1AXB A;  1VET B;  4JLF A;  3UB7 A;  3V50 A;  3Q82 A;  4MMN A;  1S0W A;  4QY6 A;  1NJ4 A;  2K7S A;  1ERQ A;  1JTG A;  3IF6 B;  3SH8 A;  4O7D A;  1K57 C;  4DE2 A;  1K54 C;  1PNE A;  3MBZ A;  1KDW A;  3UB5 P;  2FZ0 A;  3L7H A;  1EWZ A;  3PYP A;  5GL9 A;  3KYQ A;  4R4R A;  2V1Z A;  4GN2 A;  3G4P A;  3ZG9 B;  1PI4 A;  5AQ7 A;  4WZ5 A;  5GHZ A;  4N9K A;  2JC7 A;  4HI4 A;  3OOV A;  4MN6 A;  2V0W A;  1PRQ A;  3DW0 A;  4PM5 A;  1PZO A;  1PYY A;  3RH8 B;  3OC2 A;  3IHA A;  4I38 A;  4BQM A;  4H6J A;  3O88 A;  4GW9 A;  4MBK A;  5DVA A;  2Y2I A;  3HVF A;  1I2S A;  5KSH A;  4HHD A;  5FAT A;  1W7F A;  3NBL A;  1IYO A;  4WZ5 C;  3DAV A;  3EOI A;  3MFX A;  2R9W A;  1T1C A;  5CHU A;  2WKH A;  3VE3 A;  5KSC A;  2VGL M;  4JXG A;  2XA7 S;  1F9I A;  4MNR A;  2EFU A;  3B47 A;  1HTZ A;  4DRT A;  3BJN A;  3KYE A;  3N8R A;  1LSV A;  4HH2 A;  2ZMV A;  4IJG A;  5HWV A;  1S4R A;  1TD5 A;  1LL5 A;  4WBG A;  4R3J A;  3NDG A;  1BTL A;  2W3E A;  4CJN A;  5FQQ A;  4HH3 A;  5E2H A;  4FH2 A;  5TR7 A;  3FZC A;  3HUO A;  3BQ8 A;  3BFE A;  2FFY A;  4C3Q A;  1L2S A;  1M6K A;  1MWT A;  1IFQ A;  1MKM A;  2PD7 A;  1EW0 A;  1N9O A;  2QJ5 A;  1N4O A;  1NLZ A;  4BBT A;  3HLC A;  3UPP A;  1XFN A;  1H3Q A;  2VX8 A;  1BLS A;  2O9C A;  3MS6 A;  4UA7 A;  1T18 A;  2ACG A;  3GQZ A;  5EM0 A;  2C5W B;  4KG6 A;  2Y59 A;  4EV4 A;  4OOM A;  3W4O A;  5E43 A;  3F1N B;  4MDZ A;  4E3O A;  4OP5 A;  3FPW A;  3IWO A;  3WRT A;  3IX4 A;  4HBT A;  4GOG A;  5HL1 A;  1OTI A;  1DY6 A;  4E3N A;  2H10 A;  3LGO A;  3EQU A;  2W3G A;  5GHY A;  4E3M A;  4S2I A;  1D06 A;  1FR6 A;  1ESI A;  3VMA A;  4HJ4 A;  4QD4 A;  3EEA A;  3S4X A;  1DP8 A;  2OV5 A;  3PHY A;  2P7J A;  2PD8 A;  5DF9 A;  5F68 A;  3T4S A;  4HBU A;  5GLD A;  4UAA A;  4HIA A;  4M4X A;  1KGF A;  3C7U A;  4DE3 A;  5CGW A;  1NYM A;  2JHE A;  4WZ4 A;  1LI0 A;  3RXW A;  1A0K A;  4QHC A;  5DKL A;  3EEH A;  4GLQ A;  2BTF P;  4S2O A;  3IF6 C;  5HX9 A;  4CLC B;  3GRJ A;  3CPT B;  2V8F A;  3HLF A;  3DTI A;  5A91 A;  1I2W A;  1SCW A;  1G6O A;  3LIF A;  1TS7 A;  4IBR A;  1CK3 A;  4BL3 A;  4IVI A;  4EWF A;  1STZ A;  3Q81 A;  4E6X A;  3W2Z A;  1JWP A;  3M6H A;  3MXQ A;  1FSW A;  2W1T A;  3KSI A;  4KEN B;  5TGF A;  5MC7 A;  2H0Y A;  3WS1 A;  4EU0 A;  4B4Z A;  2PBY A;  4QB8 A;  1D7E A;  5HL6 A;  4Q0H A;  1AWI A;  1MC0 A;  3OZH A;  2Q0O A;  3MQ0 A;  3DTK A;  4FH4 A;  2M1C A;  2C6W B;  3GMW A;  1CI8 A;  3PBQ A;  4GDB A;  4L0L A;  2HPB A;  1KGE A;  4D2O A;  1KE3 A;  2XD1 A;  3MJQ A;  4K08 A;  4X25 A;  2I9V A;  4WMC D;  4BD1 A;  3DTM A;  4D60 A;  3E4P A;  3HCY A;  2DCF A;  1O07 A;  2K2N A;  1GHM A;  2OOL A;  1XXM A;  1YLJ A;  4WMC A;  5FDS A;  2HGV A;  4WUJ A;  1G6A A;  3FC7 A;  1S1Y A;  3UY6 A;  3M6B A;  4KG2 A;  4PKY G;  1VHM A;  4C75 A;  4G3W A;  2P9V A;  2VGL S;  2PR6 A;  1OME A;  1P97 A;  4Q8I A;  1ERM A;  1YMS A;  4G3K A;  3U2A A;  2ZC5 B;  3IXG A;  2K31 A;  2ZLY A;  4LEN A;  3K3C A;  3UNW A;  5CTM A;  2ZJ9 A;  5EOO A;  2XDM A;  4FD8 A;  3WWX A;  5CX7 A;  3D72 A;  4RQ9 A;  2R78 A;  5IT5 A;  3KSF A;  3LO7 A;  5FAO A;  1GCE A;  4OLD A;  1FCM A;  1XJ4 A;  4Y15 A;  3T4J A;  2J3T D;  1ERO A;  4B93 A;  4Y13 A;  2VK3 A;  3HLG A;  4EBN A;  3RXX A;  4EES A;  1NZU A;  4JXS A;  4C6Y A;  3V3R A;  3WS0 A;  1C3B A;  1WYB A;  3LR4 A;  4K0W A;  4S2N C;  3UMD A;  4ZRR A;  5L10 A;  5HD3 A;  1TVF A;  1F2K A;  1XFQ A;  4P0M A;  3KSG A;  3BEB A;  4LRY C;  4BEN A;  2VA0 A;  1BZA A;  3A3D A;  1MY8 A;  1BUL A;  3UDF A;  4OQI A;  2VZW A;  4X68 A;  4DF6 A;  4LLO B;  2XEP A;  4RX3 A;  4HES A;  3WS4 A;  4RA7 A;  3OLO A;  5A92 A;  5A90 A;  2IWD A;  3ZGA B;  1OT6 A;  3F1O B;  4GZB A;  2OLU A;  4UEY A;  1LT0 A;  3BFC A;  1CEF A;  2PHY A;  2V20 A;  2L4R A;  3KO6 A;  3LUQ A;  4E3I A;  3C7V A;  4NET A;  3K2N A;  4DE1 A;  1IOU A;  2WZX A;  2Q9M A;  2JKT I;  3BWL A;  1K25 A;  3F1P A;  1T1B A;  2Y2N A;  5CHM A;  2GNX A;  4PM9 A;  5FI2 A;  2Y8H A;  1LL9 A;  2G2W A;  4PMA A;  4II7 A;  5J3W A;  1L0G A;  4HOI A;  4KZ8 A;  4GHI B;  4R1G A;  3RJU A;  1GA0 A;  2EX8 A;  3IH9 A;  3FYZ A;  1SDN A;  4R4S A;  3HUN A;  2W1R A;  2XQZ A;  4GDN A;  4OPZ A;  3KX0 X;  4Y0T A;  4OVD A;  3VP0 A;  4AFI A;  4K0X A;  1OPX A;  3QP2 A;  2XF3 A;  4LRZ E;  4PAU A;  3CUE A;  4N9L A;  3MXR A;  4IHQ A;  1PI5 A;  5AQB A;  1ZG4 A;  4LV2 A;  4O0P A;  3BW6 A;  3QP8 A;  1ES2 A;  5FQ9 A;  2M7V A;  4YFM A;  4EQ1 A;  1FOF A;  1WE4 A;  4KQD A;  4L9F A;  4X6T A;  4Z9Q A;  3IXB A;  4M3K A;  2Y2Q A;  4ZTK A;  3JVV A;  1ES4 A;  2EXB A;  2JKR M;  1FIK A;  3BM6 A;  3NDE A;  4X55 A;  4R70 A;  3T4K A;  2Z6D A;  1YAX A;  4QJG A;  3A3I A;  4OKP A;  3T50 A;  3E0Y A;  1JNU A;  3PAE A;  2Y91 A;  3D9Y A;  4R0Q A;  4ZDX A;  1KE4 A;  3TSG A;  2Q9N A;  2B18 A;  1JTD A;  1YT4 A;  1ZHH B;  2P9V B;  2WGI A;  3NUL A;  4X1L A;  5JYP A;  4WEK A;  1FR1 A;  4U3T A;  4BJP A;  1ES3 A;  1GSV A;  2ZD8 A;  2EFX A;  2JKG A;  4I39 A;  4OP8 A;  1XJ2 A;  3OPL A;  1QMF A;  3C5A A;  2O0Y A;  3QP5 A;  1DRM A;  1ALQ A;  4Q0J A;  3A3J A;  5AVE A;  3K3D A;  1CQA A;  4IUH A;  2GJ3 A;  2JKF A;  3S7N A;  3GVB A;  3DWK A;  5C5K A;  3H7W B;  2HP9 A;  2G7U A;  3PTE A;  3W4P A;  3TRC A;  3MZF A;  5EVI D;  4L9E A;  4KZ4 A;  3NC8 A;  4F94 A;  1BUE A;  5EOE A;  1XPB A;  4DDS A;  2WKQ A;  4BD0 A;  4Y5F A;  5HDS A;  3F1O A;  3VSL A;  5FSR A;  5HDD A;  5TFQ A;  4YIN A;  3S1Y A;  1D1J A;  4EBP A;  1MWR A;  3SS3 A;  3UE1 A;  1UWN X;  1ONH A;  4DMZ A;  3ISG A;  5FI7 A;  2Y2H A;  4E3J A;  4P6Z M;  1DP9 A;  4R3A A;  5DKK A;  5CEB A;  4EEP A;  3LEQ A;  3PBN A;  2QHK A;  3DTE A;  3SZT A;  3VE4 A;  4S2L A;  4Y3I A;  3N7W A;  3DWZ A;  3PBR A;  4NK3 A;  3ZG7 B;  1W63 Q;  2EX9 A;  1PIO A;  3W4Q A;  2KOI A;  4KZ7 A;  4KZ3 A;  2A2L A; 
#chains in the Genus database with same CATH homology
 5DF7 A;  3ZNY A;  1W79 A;  5HX9 A;  3P98 A;  3GRJ A;  3AGD A;  2B5R A;  2A49 A;  3LEZ A;  3Q1F A;  5CGS A;  4CPK A;  4BL2 A;  3HLF A;  3SH9 A;  5A91 A;  1I2W A;  1SCW A;  3IWI A;  2XGN A;  1NXY A;  2WAE A;  4N1X A;  1K6S A;  4IBR A;  4JXV A;  1BLH A;  1CK3 A;  3SS5 A;  4GD8 A;  2Y2L A;  4BL3 A;  1JWZ A;  5CHJ A;  1K57 A;  3OPR A;  4IVI A;  4EWF A;  4JPM A;  3Q81 A;  4E6X A;  3OCN A;  5EVI B;  1JWP A;  2CC1 A;  3M6H A;  1FSW A;  2HDS A;  2Y2K A;  2ZMA A;  3ZG8 B;  4OPY A;  1IYQ A;  4B88 A;  1PWG A;  4KEN B;  1H8Z A;  1U60 A;  3OCL A;  5TGF A;  2H0Y A;  4S2M A;  4WM9 A;  1YMX A;  3WS1 A;  2OLV A;  4B4Z A;  3VP4 A;  2H0T A;  2PBY A;  2XK1 A;  5CXW A;  2Z2M B;  4QB8 A;  1O7E A;  3UE3 A;  3O3V A;  1YLZ A;  4LCM A;  4RX2 A;  4JXW A;  1XA1 A;  2XR0 A;  3OZH A;  1LHY A;  2P74 A;  4ZJ2 A;  4FH4 A;  3QHY A;  2C6W B;  3ZNT A;  3GMW A;  1CI8 A;  5AQA A;  2DRW A;  5G18 A;  2ZQ7 A;  3PBQ A;  4GDB A;  2HP6 A;  2HPB A;  2Y2G A;  4L0L A;  4MBF A;  3AGF A;  3VP1 A;  1DJB A;  1KGE A;  4S2P A;  4D2O A;  3N8L A;  1QME A;  2ZC7 A;  3HL9 A;  4UHU A;  5HFO A;  1E25 A;  1KE3 A;  3W8K A;  2XD1 A;  5E2F A;  1IEM A;  1VM1 A;  1XKZ A;  3CMZ A;  4FCF A;  1PZP A;  3NCK A;  4P6B A;  4WMC D;  5DTK A;  3N6I A;  4BD1 A;  3GR2 A;  5E2G A;  3DTM A;  3B3X A;  3O86 A;  1BLC A;  3Q07 A;  1ZKJ A;  2DCF A;  1KGG A;  2DNS A;  1O07 A;  1GHM A;  2XFS A;  1XXM A;  4DXB A;  5F1F A;  4OOY A;  5D3O A;  1YLJ A;  4JKT A;  5DTS A;  2FFF B;  5DF8 A;  4WMC A;  4XXR A;  5FQI A;  3AGE A;  1S6R A;  5CGX A;  3UDI A;  2ZM0 A;  1G6A A;  3ITB A;  3UY6 A;  3M6B A;  5BOH A;  3HLD A;  4KG2 A;  3ZFZ A;  3IT9 A;  4JBF A;  4S2N A;  4PM8 A;  3VSK A;  4S2J A;  3TOI A;  3NY4 A;  4GKU A;  4C75 A;  2JBF A;  4BLM A;  4EUZ A;  1NRF A;  4N92 A;  4KZ5 A;  2P9V A;  1RP5 A;  5FAP A;  1FSY A;  1OME A;  3VOZ A;  1LI9 A;  4Q8I A;  2WGW A;  4IED A;  2WUQ A;  4B4X A;  1ERM A;  4RYE A;  3OPP A;  1YMS A;  2ZQ8 A;  4ZBE A;  1HVB A;  1Y54 A;  5U47 A;  4OQH A;  1IKI A;  4KG5 A;  2ZC5 B;  3IXG A;  3IQA A;  4GD6 A;  4JF6 A;  2VGK A;  3LY4 A;  5EUA A;  1DJA A;  2ZM2 A;  2ZLY A;  1ZC2 A;  4LEN A;  1RGY A;  5FI6 A;  3UNW A;  1K56 D;  5CTM A;  3HRE A;  2ZJ9 A;  5EOO A;  1KE0 A;  1MKI A;  2XDM A;  4FD8 A;  3SS4 A;  1NZO A;  4OQ0 A;  4OQG A;  2Y2P A;  3IF5 A;  4WEJ A;  3WWX A;  1ESU A;  3A3F A;  2X71 A;  4KZ9 A;  5A93 A;  2V2F F;  2J7V A;  1XA7 A;  2XFT A;  1EI5 A;  1YQS A;  4LV0 A;  1SHV A;  3G31 A;  1K55 C;  4EBL A;  4QU3 A;  1L0F A;  4GB7 A;  3LO7 A;  3I7J A;  3IHB A;  5FAO A;  1HD8 A;  3UN7 A;  4A5R A;  1GCE A;  4X69 A;  4OLD A;  1FCM A;  1IYP A;  1XGJ A;  2WZZ A;  2VGJ A;  3HLB A;  4MBH A;  4OPQ A;  2RCX A;  3FKV A;  5M1A A;  3CJM A;  4R3B A;  1HZO A;  1K4E A;  1ERO A;  1TEM A;  3HLG A;  4RVA A;  3VP3 A;  4EBN A;  1K6R A;  3IXH A;  3MKE A;  3RXX A;  3N8S A;  2Y2M A;  1YM1 A;  3UPO A;  1PW1 A;  5CER A;  1NZU A;  3MZE A;  4PPR A;  4JXS A;  5FAQ A;  4C6Y A;  3V3R A;  1L0D A;  3WS0 A;  1C3B A;  1KVL A;  3Q7Z A;  3GTC A;  4ZJ3 A;  1WYB A;  4K0W A;  4S2N C;  4ID4 A;  4U0T A;  4WEL A;  4WYY A;  2EX2 A;  4LV1 A;  1W5D A;  4X53 A;  5GLC A;  3WS5 A;  4OPR A;  1TVF A;  4HEF A;  4FSF A;  5FQK A;  1MXO A;  2XLN A;  4PM6 A;  4DXC A;  4P0M A;  1CEG A;  2XD5 A;  4UA6 A;  2HDQ A;  2QMI A;  3G2Y A;  5EVL A;  2HP5 A;  5HAP A;  3BEB A;  2J9P A;  4BEN A;  1BZA A;  3D4F A;  3A3D A;  1MY8 A;  5FAS A;  5HAI A;  1BUL A;  4KZ6 A;  3UDF A;  1K56 A;  3UDX A;  2ZC6 B;  4KQO A;  4OQI A;  2Z2L B;  4X68 A;  3SOI A;  3Q7V A;  3GSG A;  1K38 A;  1YLW A;  4DF6 A;  1FCO A;  2XEP A;  1BLP A;  5JYO A;  2X01 A;  3WRZ A;  1E4D A;  4XUX A;  4XUZ A;  1YLP A;  4ZAM A;  2WKE A;  2HDR A;  4RX3 A;  4HES A;  4S2O A;  3WS4 A;  4RA7 A;  2QZ6 A;  2BLS A;  3ITA A;  4LCL A;  1PWD A;  1Z6F A;  2HDU A;  3BEC A;  3GV9 A;  1MWS A;  2GDN A;  5EE8 A;  5FQJ A;  5A92 A;  4DKI A;  3OPH A;  5A90 A;  3MXS A;  4DE0 A;  1K55 A;  5HAQ A;  1Q2P A;  2IWD A;  2QPN A;  2WKI A;  3IF6 A;  3ZGA B;  3LCE A;  1AXB A;  3QNB A;  5CED A;  1W8Y A;  5J8X A;  3G2Z A;  4GZB A;  4PM7 A;  2OLU A;  5HW3 A;  3M2K A;  3UO9 A;  4JLF A;  3BFC A;  1CEF A;  3FKW A;  2V20 A;  2IWB A;  3BLS A;  3V50 A;  3Q82 A;  3A3E A;  1S0W A;  4E3I A;  4QY6 A;  3C7V A;  1NJ4 A;  4NET A;  4DE1 A;  1ERQ A;  1JTG A;  3IF6 B;  4OON A;  3SH8 A;  1FCN A;  4O7D A;  1K57 C;  2WZX A;  3HUM A;  2UWX A;  2EXA A;  4DE2 A;  2Q9M A;  1K54 C;  3MBZ A;  3BFG A;  1KDW A;  4OH0 A;  3PBT A;  4KZB A;  1JWV A;  3ZG0 A;  1K25 A;  1XP4 A;  1EWZ A;  1GHP A;  1M40 A;  5GL9 A;  4JF5 A;  2Y2N A;  5CHM A;  1KDS A;  4P87 A;  5FI2 A;  4PM9 A;  1YLY A;  4R4R A;  2J8Y A;  2V1Z A;  4LV3 A;  1WYC A;  4GN2 A;  3G4P A;  3ZG9 B;  1PI4 A;  1XX2 A;  1NYY A;  1FQG A;  3E2L A;  3P09 A;  3PAG A;  1LL9 A;  2G2W A;  2I72 A;  4PMA A;  5AQ7 A;  4WZ5 A;  1L0G A;  5IHV A;  5GHZ A;  5CEC A;  4N9K A;  4KZ8 A;  2RL3 A;  4R1G A;  4IBX A;  3BYD A;  2J9O A;  3RJU A;  2JCH A;  1GA0 A;  2EX8 A;  2JC7 A;  3IH9 A;  4JF4 A;  3FYZ A;  1N9B A;  3E2K A;  4OOL A;  3BRM A;  3S22 A;  3DW0 A;  1MWU A;  1SDN A;  4R4S A;  3HUN A;  4PM5 A;  1PZO A;  2XQZ A;  4GDN A;  4OPZ A;  1PYY A;  1CI9 A;  4Y0T A;  3OC2 A;  3IHA A;  4BQM A;  4P85 A;  3O88 A;  3VFF A;  2PU2 A;  4OVD A;  4MBK A;  5DVA A;  3UPN A;  4K0X A;  2Y2I A;  3VP0 A;  1RCJ A;  2Y2O A;  1I2S A;  3HVF A;  5KSH A;  2XF3 A;  1W7F A;  4N9L A;  3NBL A;  1GA9 A;  3MXR A;  5AQB A;  1PI5 A;  3LY3 A;  5FAT A;  4E3K A;  1IYO A;  1G68 A;  1PW8 A;  4WZ5 C;  5KMW A;  5F1G A;  2R9W A;  1ZG4 A;  3CG5 A;  4LV2 A;  2ZQA A;  1ES5 A;  2Y55 A;  5CHU A;  5CRF A;  3C4O A;  2WKH A;  4X56 A;  3O87 A;  1GHI A;  5KSC A;  3C4P A;  3VP2 A;  3M2J A;  3BFF A;  1TDG A;  1ES2 A;  4Y0O A;  3ZVW A;  4JXG A;  5FQ9 A;  5AQ9 A;  2X02 A;  3HLW A;  4YFM A;  2PU4 A;  4MNR A;  3V5M A;  2EFU A;  5M18 A;  3V3S A;  2XH9 A;  3ZVT A;  1W8Q A;  1FOF A;  1HTZ A;  4DRT A;  1PWC A;  1WE4 A;  3N8R A;  4QY5 A;  4X6T A;  3G35 A;  4Z9Q A;  3BLM A;  3IXB A;  5I94 A;  4M3K A;  2Y2Q A;  4ZTK A;  1ES4 A;  1LL5 A;  2EXB A;  3NDG A;  1BTL A;  4R3J A;  4WBG A;  3BM6 A;  2ZM8 A;  3NDE A;  4X55 A;  4U0X A;  1KVM A;  4OLG A;  4CJN A;  5FQQ A;  1LLB A;  5E2H A;  4QJG A;  4FH2 A;  3A3I A;  3IWQ A;  4OKP A;  3EQV A;  5TR7 A;  1E3U D;  3FZC A;  3HUO A;  3PAE A;  3G30 A;  3BFE A;  1J9M A;  2Y91 A;  4MEZ A;  1K4F A;  1Q2Q A;  2FFY A;  4C3Q A;  5M19 A;  4R0Q A;  1L2S A;  1YLT A;  2WGW B;  1M6K A;  4Y0U A;  4ZDX A;  1KE4 A;  1MWT A;  3TSG A;  2Q9N A;  1JTD A;  2OSU A;  1YT4 A;  2P9V B;  2ZQD A;  2WGI A;  1SDE A;  1TDL A;  3FV7 A;  5JYP A;  4WEK A;  1FR1 A;  1N4O A;  4U3T A;  4BJP A;  1MPL A;  3VFH A;  4EQI A;  1ES3 A;  3HLC A;  1MBL A;  3UPP A;  2ZD8 A;  2EFX A;  4MLL A;  4OP8 A;  1BLS A;  3HLE A;  3OPL A;  3HBR A;  4UA7 A;  1QMF A;  3C5A A;  4UA9 A;  3TG9 A;  3PBO A;  4KQR A;  4N1H A;  3GQZ A;  3MFD A;  1ALQ A;  3A3J A;  3ZHH A;  2H5S A;  2C5W B;  4KG6 A;  2Y59 A;  1IYS A;  3ZG5 A;  4EV4 A;  4OOM A;  3GVB A;  3DWK A;  5CTN A;  3N4I A;  2ZC3 B;  4KQQ A;  3W4O A;  2HP9 A;  1ONG A;  4K91 A;  5E43 A;  2WAF A;  3PTE A;  3W4P A;  5FA7 A;  4E3O A;  4E6W A;  4OP5 A;  3SH7 A;  1ZG6 A;  3IWO A;  3WRT A;  3MZF A;  5DTT A;  5HL1 A;  4HBT A;  4GOG A;  5EVI D;  4R23 A;  1L0E A;  1DY6 A;  3ZDJ A;  4KZ4 A;  3WS2 A;  4E3N A;  5EPH A;  5EVI C;  5E2E A;  3NC8 A;  4F94 A;  4S2K A;  2H10 A;  3EQU A;  1IKG A;  1BUE A;  3PBS A;  5EOE A;  1XPB A;  5GHY A;  4DDS A;  2A3U A;  4E3L A;  3V39 A;  4BD0 A;  2Y4A A;  5F83 A;  3VSL A;  1XGI A;  3MZD A;  2E8I A;  3FWL A;  3G32 A;  4S2I A;  4ZJ1 A;  4E3M A;  1FR6 A;  5HAR A;  1ESI A;  3VMA A;  3CZD A;  1K54 A;  3BFD A;  4QD4 A;  4Y7P A;  5FSR A;  5TFQ A;  5F82 A;  3S4X A;  4YIN A;  3S1Y A;  3MKF A;  5FDH A;  1BSG A;  5GHX A;  2OV5 A;  3IXD A;  4DDY A;  2G2U A;  3VOY A;  4EBP A;  1MWR A;  3SS3 A;  4IVK A;  3Q7V B;  3UE1 A;  5DF9 A;  5EEC A;  1ONH A;  3ISG A;  1NY0 A;  5FI7 A;  5EVI A;  4HBU A;  4UAA A;  5GLD A;  1H5X A;  2Y2H A;  4E3J A;  2IWC A;  2JE5 A;  3UE0 A;  5L2F A;  1KGF A;  3C7U A;  4DE3 A;  5CGW A;  3NI9 A;  1NYM A;  5FQM A;  2EX6 A;  5CEB A;  3IH8 A;  5KZH A;  3PBN A;  1E3U A;  2ZC4 B;  4WZ4 A;  2Y2J A;  3JYI A;  1I5Q A;  1LI0 A;  4S2L A;  4KZA A;  2WK0 A;  3NIA A;  4H8R A;  1DJC A;  2ZQ9 A;  3N7W A;  3RXW A;  3DWZ A;  1BT5 A;  1IEL A;  3G34 A;  4QHC A;  2WYX A;  3PBR A;  1JVJ A;  4NK3 A;  1SKF A;  4GNU A;  3ZG7 B;  3QNC A;  1VQQ A;  1PIO A;  1RGZ A;  2EX9 A;  3W4Q A;  3ZCZ A;  5GLB A;  2R9X A;  2WAD A;  2ZQC A;  4KZ7 A;  1H8Y A;  2BG1 A;  2WGV A;  5GLA A;  4KZ3 A;  3IF6 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...