3WRTA

Wild type beta-lactamase derived from chromohalobacter sp.560
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
357
structure length
357
Chain Sequence
QTREVLDPIVASLMEAQQIPGMAIALVRPEGTTISHYGAADRETGTPVDDDTLFEIGSLSKTLTATLASLAEVEGKLDFDAPVSRYLPELEGSAFDDISGLNLGTHTGGGLPLFVPDEVTDRASLMAWYREWQPTEPIGESRTYSNLGIGLLGLETAASLDGEFVPTMRAKVLAPLGMQDTWYDVPEARMADYAMGEDKDGQPTRVSPGVLDDEAYGIKTTAADLAKLVRANLHLADVDAELQQAIDATRQGHYRVGDMTQALIWEQYSLPVAPETLRAGNGYDMILEPNAAEALEPPQSPRDDVWVNKTGSTNGFGGYIVMLPGKHTGLVMLANKNYPNDARVEAAYRILSGLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase
publication title Structure of a highly acidic beta-lactamase from the moderate halophile Chromohalobacter sp. 560 and the discovery of a Cs(+)-selective binding site
pubmed doi rcsb
source organism Chromohalobacter sp. 560
molecule tags Hydrolase
total genus 113
structure length 357
sequence length 357
chains with identical sequence B, C
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2014-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3wrtA00
5DTSA 1I5QA 3FYZA 4S2IA 1E3UD 1WE4A 1NZOA 5E43A 4OONA 3O88A 4OPZA 4DE2A 3HUMA 1BLPA 2EFXA 4L0LA 4E3IA 5EVLA 5FAPA 1L2SA 3G32A 4P85A 5M18A 1M40A 5EUAA 3VSKA 1NZUA 1XX2A 4RX2A 4UA6A 1ERQA 1HVBA 2XGNA 2C6WB 4IEDA 3UE0A 5M19A 4B4XA 3IXHA 2Z2LB 3HUOA 2Y59A 3PAGA 5HX9A 4OPRA 3AGDA 5TFQA 5FQQA 5L2FA 3NI9A 1RGZA 3ZGAB 3C7VA 4OH0A 5A90A 1JVJA 4KZAA 2XR0A 2ZC6B 4KZ6A 4ZAMA 2H0TA 3NY4A 3SH7A 5FQIA 2ZLYA 4PM6A 4WEJA 5IHVA 3IF6A 3HLCA 1KE0A 4KG5A 2Y2LA 2BLSA 2EXBA 4S2LA 3GVBA 1ALQA 4WZ4A 5AQ7A 3MZFA 4U3TA 4JKTA 2HDQA 1ES2A 3OCLA 4IVIA 4QU3A 3LEZA 4F94A 5E2GA 5GHYA 1FCOA 3VFFA 3PBSA 5F83A 3N6IA 2Y91A 1PW8A 4JF4A 4BENA 3C4PA 2HP6A 4E6XA 3OZHA 4E3MA 5CRFA 1YLZA 2OLUA 2PU4A 5E2EA 3P98A 4EV4A 3W4OA 2ZMAA 4UHUA 4RVAA 5KMWA 4WMCA 3M6HA 1CI9A 3WRZA 4JBFA 2QPNA 3BM6A 2WGWB 3ITAA 3W8KA 2Y4AA 4JXSA 1VQQA 1K25A 1YLWA 3FKWA 4IVKA 1BUEA 5FQMA 4OQIA 4ZJ2A 3V5MA 2Y2PA 2ZQ8A 4CJNA 5BOHA 5CTNA 1MY8A 5JYPA 5HARA 3ZG7B 1SCWA 3ZG5A 4EBNA 5FA7A 4KQOA 1EROA 4OLGA 4E3JA 4KZ3A 1BZAA 2IWDA 5DVAA 5GHZA 3UE1A 2WKIA 1ERMA 3D4FA 3PBNA 4E6WA 4GB7A 4KENB 2P9VA 3HL9A 3M2KA 3EQUA 3MBZA 5A91A 2FFFB 4C6YA 1TDLA 3WWXA 1GCEA 1EI5A 1MXOA 1JWPA 2J9PA 3OPRA 3N7WA 3CMZA 1JTGA 4RX3A 3FZCA 4PM7A 5A93A 4P87A 1ZG4A 2XD5A 4DXBA 3MXSA 3LO7A 1ZC2A 3Q07A 4B88A 1NYMA 4OOYA 3WS4A 3OCNA 1K6RA 4N1XA 1YLPA 3V3RA 4GD8A 1L0EA 3BFGA 4KG6A 1Q2PA 3N8SA 1QMEA 4MLLA 4C75A 4LV3A 2HDSA 1W79A 4QHCA 5M1AA 1HZOA 1LL5A 2WUQA 2ZQCA 3JYIA 2P74A 3Q7VB 3HLGA 1XP4A 2XFTA 3BEBA 3CJMA 4QB8A 3UNWA 1K56A 1NY0A 1K4EA 1KGGA 2Y2IA 1CI8A 2J9OA 5FI6A 4EUZA 1PI4A 2Y2NA 3CZDA 3SH9A 3MZDA 2ZQ9A 2IWCA 4KZ9A 3MFDA 4N1HA 1E3UA 3DWZA 5CGSA 1XKZA 1GA9A 2WAEA 4MNRA 2X02A 4HESA 4X55A 5AQBA 4ID4A 1Z6FA 1SHVA 2WZZA 3UPOA 3UE3A 1N4OA 4CPKA 1YLTA 5FATA 4WBGA 5J8XA 2V2FF 3IXGA 3QHYA 1ES5A 1WYCA 3ZVTA 1YMSA 3GQZA 3DW0A 3Q1FA 2XF3A 4S2NC 4WEKA 5FQJA 4X53A 2X71A 1KDWA 2DCFA 2XQZA 3NBLA 1K55C 3GV9A 5DF7A 4EBLA 4DKIA 5CHUA 1RCJA 3C4OA 4DE1A 3FV7A 4RA7A 1PW1A 3BFCA 1CEGA 3O87A 5FAQA 5TR7A 1BLSA 1ZG6A 3GR2A 3LCEA 5HAIA 1L0DA 2JCHA 3PBTA 3WS5A 1PYYA 2H10A 4X69A 4Y7PA 1DJAA 3PBQA 4MBHA 4GN2A 5EECA 4OQGA 2C5WB 2XD1A 4K91A 5HL1A 3V50A 4JPMA 5CEDA 2A49A 3HLBA 2Y2MA 4BD1A 4KZ4A 1PWDA 5F1FA 1L0GA 2Z2MB 5F1GA 3HREA 5CERA 2WGWA 3WS0A 3ITBA 4YFMA 3ZVWA 1LI0A 5HFOA 3V39A 5GLDA 2UWXA 2X01A 3WRTA 2A3UA 3A3FA 4JXVA 4PM5A 2WADA 1VM1A 4E3NA 5CTMA 3B3XA 2DRWA 1NJ4A 1PIOA 1XGJA 2EX6A 4FCFA 4OQ0A 3ISGA 2R9WA 4X6TA 4DDYA 5AQ9A 3LY4A 3VMAA 4JF6A 2WKEA 2Q9MA 2HP9A 1IELA 2XLNA 4QY5A 1JTDA 3C5AA 3ZG0A 4IBRA 2CC1A 3EQVA 5HAPA 1FQGA 1JWVA 3I7JA 4X56A 1MKIA 3ZG9B 2ZQ7A 5DF9A 4A5RA 4LV1A 1W8YA 3IWQA 5D3OA 3OPLA 4WZ5C 4MEZA 3FWLA 5F82A 3G35A 4EQIA 2HDUA 1I2WA 2R9XA 4FH4A 1IYQA 4R0QA 3O3VA 4WYYA 3S4XA 1E4DA 3UN7A 1MBLA 1G68A 3VSLA 1Y54A 2XFSA 5CGXA 4WM9A 1ONGA 3NDEA 4XUXA 4QY6A 3IXDA 2ZQDA 4PPRA 5GLAA 1PWCA 4KZBA 1MPLA 2FFYA 3NCKA 1L0FA 3G34A 1YMXA 3BYDA 3UPPA 3LY3A 4RYEA 1ZKJA 4E3OA 3MKFA 1QMFA 3UDXA 4BJPA 1ONHA 3Q7VA 1FCNA 4OPYA 2ZJ9A 5EOOA 5EVIC 3SS3A 4PM9A 1WYBA 1JWZA 1K4FA 3BFFA 3ZFZA 3SOIA 1YM1A 3E2KA 4LCMA 4MBKA 2Y2OA 1GHMA 5U47A 2VGKA 2XK1A 5DF8A 1MWTA 3GSGA 4K0WA 1FSWA 5CXWA 1XXMA 2Y2GA 3IT9A 4LENA 1MWUA 5TGFA 4NETA 4E3LA 4DF6A 1IYPA 2HDRA 2QZ6A 4KG2A 4S2JA 1FR1A 4OVDA 3S22A 2WAFA 5EVID 5EVIB 4S2KA 3HLFA 3A3EA 3RXWA 4DE0A 2H5SA 3DTMA 1NRFA 1LLBA 1PZPA 3W4QA 3P09A 1H5XA 4S2OA 3UDIA 3VOZA 3N4IA 5KZHA 4Z9QA 3IH9A 3BLSA 3UO9A 1MWSA 5HW3A 3PBOA 2ZM8A 4OLDA 3N8LA 1KGFA 3OC2A 3TOIA 4D2OA 3HUNA 3PBRA 3IXBA 2WKHA 5KSHA 4KZ8A 3IH8A 4S2NA 4R4RA 4H8RA 2ZC5B 3G31A 1LL9A 1Q2QA 1J9MA 2HPBA 3MKEA 3PAEA 4K0XA 1CEFA 4P6BA 4BL3A 2B5RA 1K55A 4R4SA 5CECA 5HAQA 3Q81A 3SS5A 3ZG8B 3Q7ZA 1N9BA 1LHYA 3TSGA 3VP4A 1IYSA 4QJGA 1BULA 2JBFA 5FASA 1BLCA 1ES3A 4EBPA 4GD6A 5A92A 4N9KA 3UDFA 1PWGA 3OPPA 2I72A 2ZM0A 3HLEA 2EX9A 1EWZA 4KQQA 1XGIA 2QMIA 3M2JA 4M3KA 1KGEA 1W7FA 2XH9A 5CGWA 4UA9A 3WS1A 1DY6A 4PMAA 2Y2QA 4FD8A 4LV2A 3VP0A 5CHMA 5FI2A 1TVFA 5DTTA 3NC8A 1YLJA 1C3BA 2V1ZA 1FOFA 1G6AA 2GDNA 2RCXA 1K57C 5FDHA 2JC7A 5GHXA 1XPBA 1YLYA 5FSRA 3SH8A 3ZNTA 1KE4A 3MXRA 4OOMA 3SS4A 1HTZA 2ZC4B 2E8IA 2WK0A 4U0XA 4U0TA 2Y2HA 3Q82A 4R23A 1KE3A 3VP3A 3IWIA 2WYXA 1K6SA 3QNBA 4Y0UA 1BT5A 3WS2A 3BFDA 3DWKA 3ZNYA 4OKPA 4Y0TA 3GTCA 1O07A 1RP5A 1E25A 4R3BA 4Q8IA 3CG5A 5FQKA 4E3KA 4OPQA 4WZ5A 2IWBA 3C7UA 4BQMA 2JE5A 1IKGA 2ZM2A 1K54A 4Y0OA 1SDEA 5GL9A 3IWOA 4S2PA 3IF6C 4GOGA 1K54C 3E2LA 4LCLA 3W4PA 4BLMA 2EXAA 2ZC3B 4XUZA 3BLMA 4XXRA 1YQSA 4GKUA 5DTKA 5EOEA 4JXWA 3G30A 3GMWA 4ZDXA 4IBXA 2EFUA 3AGFA 4UAAA 1W5DA 1GHPA 1H8YA 1TDGA 4B4ZA 4ZBEA 1CK3A 4P0MA 3A3JA 4X68A 2RL3A 4BD0A 5AQAA 2BG1A 5FQ9A 1YT4A 5CEBA 2VGJA 4NK3A 5EVIA 3IHAA 1ESUA 2OSUA 4ZJ3A 4FH2A 4HBUA 4ZTKA 4OP8A 1BSGA 3IF6B 5EE8A 1KVLA 3OPHA 1H8ZA 1O7EA 3ZDJA 2PU2A 5CHJA 4C3QA 3HLDA 4EWFA 2PBYA 2Y2KA 3IF5A 2HP5A 1SDNA 3NDGA 4JF5A 2OLVA 3G2YA 4KQRA 4DE3A 2EX8A 4YINA 2Q9NA 5EPHA 3G4PA 1S6RA 4OOLA 3IHBA 3GRJA 3FKVA 1W8QA 1DJCA 1GA0A 1IEMA 2H0YA 4HBTA 1OMEA 2WGIA 3ZHHA 4N92A 4WMCD 2Y55A 1NYYA 2ZC7A 1PI5A 3UPNA 1ES4A 1AXBA 2G2UA 2ZD8A 4S2MA 4GZBA 2WZXA 4JXGA 4WELA 1KDSA 3HLWA 3RXXA 5FAOA 3VP1A 3O86A 5FI7A 4DXCA 4R3JA 1MWRA 1I2SA 4KZ7A 4OP5A 1FR6A 3HBRA 1XA1A 2V20A 1NXYA 3NIAA 3PTEA 1DJBA 4GDBA 4JLFA 4KZ5A 4LV0A 5JYOA 4FSFA 3MZEA 1PZOA 1K38A 1IYOA 1KVMA 3VFHA 2P9VB 2WGVA 3VOYA 4GDNA 1ESIA 1SKFA 1BLHA 5GLCA 3G2ZA 1IKIA 3BECA 3N8RA 3S1YA 3A3IA 3V3SA 1XA7A 3A3DA 3BRMA 5GLBA 2ZQAA 5KSCA 4R1GA 4GNUA 4DRTA 1HD8A 1S0WA 4O7DA 1U60A 1GHIA 2XDMA 2G2WA 2Y2JA 1RGYA 4DDSA 3AGEA 2XEPA 3VP2A 3BFEA 4MBFA 1TEMA 1M6KA 2EX2A 3M6BA 2J8YA 4QD4A 3RJUA 4OQHA 3UY6A 3TG9A 4UA7A 1BTLA 4PM8A 4BL2A 2J7VA 1FCMA 3HVFA 5G18A 1LI9A 5I94A 5E2HA 3IQAA 2DNSA 3QNCA 4HEFA 5E2FA 2OV5A 3ZCZA 1K56D 4ZJ1A 4N9LA 1K57A 1FSYA
chains in the Genus database with same CATH superfamily
2A2LA 2LB9A 1E3UD 2H28A 4OONA 4AFIA 4DE2A 3NOUC 3MQOA 1BLPA 2EFXA 5EVLA 5FAPA 1L2SA 1AWIA 5M18A 5EUAA 3PR6A 4PKYA 1XX2A 4UA6A 3EOIA 2C6WB 3UE0A 5M19A 3HUOA 4M4XA 3ZGAB 1CQAA 3IX4A 2H0TA 3OOVA 2M7VA 2EXBA 5AQ7A 3TW8A 3MZFA 1FIKA 2HDQA 1ES2A 4IVIA 4F94A 4QU3A 3IBRA 3N6IA 5G4ZA 4KUOA 2K2NA 1YLZA 4MN7A 3UB8A 3OLOA 4UHUA 4RVAA 5KMWA 2ACGA 2XRNA 5JYOA 1BUEA 4OQIA 1MY8A 5JYPA 5HARA 1SCWA 3ZG5A 5FA7A 5DVAA 3OBFA 5J7EA 1ERMA 2CMNA 4GB7A 4KENB 3HL9A 3M2KA 4G3KA 3RFBA 2K31A 4RX3A 4PM7A 5A93A 4CLCB 2XD5A 4X1MA 2JKRM 5F6AA 3WS4A 3G6OA 1K6RA 4GD8A 4KG6A 4BBVA 1QMEA 1W79A 4QHCA 3JYIA 1XP4A 4QB8A 3U4LP 1NY0A 1KGGA 2J9OA 4O0PA 3CZDA 2OWJA 2ZQ9A 4KZ9A 3MFDA 4IHQA 3DWZA 5AVFA 4NXGA 4MNRA 3DBAA 4ID4A 2FZ0A 3LGOA 3F1OA 5J8XA 3IXGA 1YMSA 3T4JA 4S2NC 2XA7S 3BQAA 4GCZA 3KYEA 3C4OA 1CEGA 2L4RA 5TR7A 1BLSA 1DRMA 3LIFA 1YPRA 1L0DA 3PBTA 4I5SA 2C5WB 3B47A 2QKPA 4JPMA 3T4LA 5CEDA 5F1FA 1PNEA 1H3QA 2VV6A 3K2NA 4YFMA 5HDSA 3CI6A 2WADA 1VM1A 3S7OA 4DJ3A 1NJ4A 3IX3A 3SZTA 4OQ0A 3B33A 3VMAA 4JF6A 2WKEA 2HP9A 4NEED 3S7PA 3C5AA 4Y15A 4IBRA 4GHIA 2VKSA 4A5RA 1MZUA 3FWLA 1Y28A 4R0QA 4HJ3A 3VSLA 4L9GA 3IXDA 2ZQDA 4I39A 4LPZA 1F5MA 3BYDA 3LY3A 1ZKJA 3UDXA 4BJPA 4EETB 3Q7VA 5HZHA 3VV4A 5EVIC 4Y3IA 4UQIM 1PFLA 1K4FA 3BFFA 3F1PA 1UGUA 3T50A 1GSVA 4K0WA 4LFUA 1FSWA 3RTYA 4ESPA 3IT9A 5TGFA 4NETA 4G3WA 2W3GA 5EVID 1JNUA 4XT2B 4DE0A 1PZPA 3W4QA 1H5XA 4S2OA 3LIBA 2PYPA 3VOLA 2B18A 3HUNA 3PBRA 1MKMA 4O01A 3G31A 3QP1A 4BL3A 4ARZA 5HSQA 1CEFA 5CECA 1BULA 5FASA 2W1TB 3HLEA 1T18A 1EWZA 5FDSA 4KQQA 2QMIA 3M2JA 1W7FA 2HGVA 4UA9A 2PD7A 1DY6A 4WL9A 2GX5A 3VP0A 5FI2A 4Z1WA 3NC8A 1C3BA 1K57C 4GW9A 3ZNTA 3SS4A 1HTZA 3MSHA 4U0XA 4U0TA 3Q82A 3QP8A 3IWIA 4JGRA 4Y0UA 1BT5A 3BFDA 3GTCA 1RP5A 3KSIA 4Q8IA 1FILA 2JHEA 2ZL1B 4OPQA 4WZ5A 5J4EA 3K3DA 5GL9A 2V1BA 4GOGA 1K54C 3E2LA 3W4PA 4BLMA 2ZC3B 4GLQA 4XXRA 4GKUA 5DJUA 1J3WA 2Z6DA 1IOUA 4ZDXA 3DAVA 1W5DA 2O9CA 3D72A 4X68A 4PKYG 2HJ9C 5CEBA 2XROA 4NK3A 3IHAA 4ZJ3A 1CJFA 4ZTKA 4OP8A 1H8ZA 4EWFA 5CHJA 4C3QA 3HLDA 2Y2KA 4KQRA 4DE3A 4YINA 4G3VA 1S6RA 3IHBA 3FKVA 1W8QA 2P04A 1DJCA 1IEMA 3UB9A 1N9OA 2VZWA 2WGIA 4N92A 1PI5A 3CPTA 4I3AA 3R7WA 2G2UA 2ZD8A 4JXGA 2EA9A 3VP1A 4L9FA 5F69A 1SKOA 1FR6A 3HBRA 3PTEA 2NUPC 4MDZA 2P08A 1IKIA 3C8CA 2B02A 3A3IA 1XA7A 4Y13A 5KSCA 5L10A 2JKTI 1T1AA 1V9YA 5HDDA 1U60A 1UWNX 2XDMA 1RGYA 2BASA 4Y2FA 3VP2A 4ZRRA 4MBFA 2OOLA 2J8YA 1MC0A 3HJKA 1BTLA 3FPWA 5E2FA 2V1AA 5EM1A 3NULA 1FSYA 2QJ5A 3QP6A 4S2IA 1WE4A 3O88A 3LI8A 3HUMA 3F1OB 4P85A 2A24A 2R78A 4E04A 4IEDA 1S4SA 3IXHA 5HX9A 1OTEA 2JKFA 5FQQA 5L2FA 5FEGA 5A90A 4KZAA 4KZ6A 3SH7A 4WEJA 3IF6A 4KG5A 2BLSA 1ALQA 1KOUA 1XFQA 3CWFA 2VGLM 5E2GA 5GHYA 1FCOA 3VFFA 2EWWA 5KIZA 3C4PA 2HP6A 2OLUA 5HDCA 4EV4A 3W4OA 2ZMAA 4QPRA 4WMCA 4HOIA 3WRZA 4EW7A 3E98A 3ITAA 4JXSA 5FQMA 3FKWA 3V5MA 2ZQ8A 5C5KA 3MMHA 4CLCC 1EROA 3D9YA 4E3JA 1BZAA 5GHZA 3UE1A 3NOPC 2WKIA 1X0OA 2P9VA 2QJ7A 4GHIB 1TDLA 1EI5A 3CMZA 1JTGA 3FZCA 3MR0A 4HJ4A 4P87A 4DXBA 3JVVA 3MXSA 3Q07A 4B88A 5EM0A 4L9EA 5IU1A 3V3RA 3CUEA 1Q2PA 2D01A 4MLLA 4C75A 2HDSA 1LT0A 3O5YA 1LL5A 3DTEA 3Q7VB 4WUJA 4GS9A 2V8CA 4Q0IA 3A0SA 5FI6A 2Y2NA 5CGSA 1GA9A 3F1PB 2X02A 3T4OA 1SHVA 1TS0A 1N4OA 1YLTA 4WBGA 1OTIA 3T1SA 1ES5A 1WYCA 3GQZA 3DW0A 2VK3A 1KDWA 2DCFA 5EVEA 2O9BA 3NBLA 4EBLA 1PRQA 2W3FA 5CHUA 1RCJA 4DE1A 4RA7A 1PW1A 3O87A 1ZG6A 3WS5A 4X69A 4GN2A 4OQGA 5F68A 4K91A 5HL1A 4ARZB 1PWDA 2HF6A 1L0GA 2Z2MB 5CERA 3HREA 3H7WA 3T1RA 3V39A 5HFOA 2UWXA 2X01A 3A3FA 4JXVA 2V9AA 1ACFA 3B3XA 2DRWA 5HWTA 4X6TA 4DDYA 5AQ9A 2W27A 2Q9MA 1IELA 2M1CA 4QY5A 1JTDA 4DN0A 3I7JA 1MKIA 2ZQ7A 2WKPA 2O9AA 3OPLA 4CLCE 4MEZA 3G35A 2JKGA 2R9XA 3FG8A 1VB6A 3UN7A 3ICYA 1MBLA 4XUXA 4PPRA 5GLAA 1NRJA 2FFYA 3NCKA 1XJ4A 3UMDA 1QMFA 2GNXA 1ONHA 4MCWA 3C2WA 4PM9A 3ZFZA 3SOIA 4MBKA 1UWPX 1VHMA 1GHMA 5DF8A 2W3EA 1MWUA 4DF6A 2HDRA 3KSFA 4S2JA 2QYBA 1FR1A 3S22A 2WAFA 1GSWA 2Y79A 1YAXA 4UEYA 3RXWA 2H5SA 4LGWA 5KZHA 1W63Q 3P09A 4UQIS 4Z9QA 5CX7A 3UO9A 1MWSA 3MQQA 2ZM8A 2W3DA 1KGFA 2MJ6A 4DJ2A 2VV7A 4JGQA 4LLOB 3ULFA 5KSHA 3F1NB 4KZ8A 4HNBA 2ZC5B 1LL9A 2HPBA 3PAEA 1K55A 3Q81A 3CPTB 1LHYA 1D7EA 1WA9A 3KO6A 1ES3A 1SKOB 4EBPA 4GD6A 3UDFA 1DP8A 4K08A 2EX9A 3FC7A 5CGWA 3WS1A 3A0VA 1F9IA 2V1ZA 2GDNA 4LRXC 1T1CA 5GHXA 3DTIA 5FSRA 3MXRA 4IJGA 2WK0A 4R23A 2WYXA 1K6SA 1S1YA 4EEPA 4HJ6A 4F3LA 3WS2A 1F98A 4CQHA 1E25A 3P7NA 4E3KA 4GJ4A 1IKGA 2ZM2A 1K54A 1SDEA 4LCLA 2EXAA 3BLMA 4ETXA 1YQSA 4LRYC 5DTKA 2A24B 2INWA 4JXWA 3GMWA 2K7SA 2VV8A 3VE4A 2EFUA 3AGFA 1H8YA 1TDGA 4ZBEA 5FQ9A 1YT4A 2VGJA 1ESUA 2OSUA 3KYQA 4FH2A 3KYZA 1BSGA 1OTAA 3IF6B 5L07A 2PBYA 2HP5A 4I38A 4JF5A 2OLVA 3G2YA 2EX8A 2Q9NA 4OOLA 2JN7A 3IX8A 4BBTA 1GA0A 2H0YA 1V9ZA 3ZHHA 2PYRA 2ZC7A 1ES4A 4S2MA 4WF0A 4GZBA 2PBDP 3RXXA 3LR4A 1MWRA 3C38A 1XJ6A 1I2SA 1XA1A 2V20A 3MZEA 1PZOA 1KVMA 2P9VB 4R3AA 3H9WA 5GLCA 3V3SA 3GDIA 3A3DA 1S4RA 2V8FA 4ME4A 4HI4A 2DMWA 3MF0A 1GHIA 2J3TD 2G2WA 2Y2JA 3S7QA 3LFVA 3BFEA 5MC7A 2ZOIA 4HP4A 4QD4A 3IBJA 3UY6A 3TG9A 4BL2A 2J7VA 1FCMA 5G18A 1LI9A 3QNCA 1XJ3A 4GS9B 4N9LA 1I5QA 3LUQA 3FYZA 1ZHHB 4HY8A 4B93A 4L0LA 4E3IA 3S7NA 1NZUA 2HJEA 3EEHA 2Q0OA 3NJAA 4B4XA 2Z2LB 3PAGA 2YKFA 3AGDA 3NI9A 1RGZA 4OH0A 2XR0A 2ZC6B 3NY4A 5FQIA 3HLCA 4S2LA 5EFWA 2ZMVA 4U3TA 4NKPA 4JKTA 3OCLA 1NLZA 3E4PA 3PBSA 5F83A 2Y91A 1PW8A 4BENA 4EUVA 1LSVA 4E6XA 5CRFA 3P98A 2JKRI 3M6HA 1CI9A 3ZQ5A 4JBFA 1YKDA 3H7WB 3BM6A 3W8KA 1K25A 1YLWA 4ZJ2A 2Y2PA 4CJNA 5BOHA 3ZG7B 4Y5FA 4EBNA 4KQOA 2VGLS 4KZ3A 2IWDA 3D4FA 4E6WA 3EQUA 2FFFB 1TF1A 1GCEA 1MXOA 3L7HA 3OPRA 4X1LA 3H82A 2UV0E 1ZG4A 3T12B 4OOYA 1YLPA 1L0EA 3BFGA 5G4YA 2E8JA 4EERA 1LSWA 3N8SA 3MJQA 2I9VA 1HZOA 2L0WA 2P74A 2V0UA 3CJMA 2XFTA 1K56A 1CI8A 1PI4A 1YSPA 4N1HA 1E3UA 1XKZA 2WAEA 4EQ1A 4HESA 5AQBA 4X55A 4B9OA 1Z6FA 2QHKA 2WZZA 3UE3A 4CPKA 5FATA 3QHYA 5DKLA 4X25A 3ZVTA 2HZ5A 3Q1FA 4X53A 1TD5A 2XQZA 3GV9A 5HWVA 5DF7A 4DKIA 5L09A 1G28A 1Y4OA 3BFCA 3GR2A 4YWZA 2JCHA 2ZOHA 1PYYA 3UB6A 1DJAA 4MBHA 3C30A 2OWHA 4EESA 4YNRA 5TBMA 2A49A 5F1GA 5HWWA 2WGWA 3ITBA 3ZVWA 1LI0A 5GLDA 1S66L 2A3UA 4PM5A 5CTMA 3LIEA 5AVEA 1HLUP 1PIOA 2EX6A 4FCFA 3LY4A 1TS6A 4I3IA 3UB7A 2CC1A 3EQVA 5FL3A 5HAPA 1FQGA 4LV1A 1W8YA 5D3OA 4WZ5C 3BY8A 3SW1A 4EQIA 1ZTUA 4WYYA 4FH4A 1IYQA 3CAXA 4MMNA 1G68A 1Y54A 4WM9A 2KX6A 3NDEA 4BMWA 4QY6A 2NUTC 1PWCA 4F3LB 1MPLA 3UPPA 3K3CA 4E3OA 3MKFA 4MN6A 5IS1A 2ZJ9A 5EOOA 1OT6A 1CF0A 1WYBA 2PD8A 1JWZA 1YSQA 2Y2OA 5U47A 2VGKA 5HPFA 5CXWA 1XXMA 4LENA 4E3LA 2J80A 4KG2A 3T1QB 3HLFA 3A3EA 3RH8B 1NRFA 1LLBA 2V0WA 3UDIA 3IH9A 4BWIA 1NLYA 3BLSA 5HW3A 1IFQA 3N8LA 3OC2A 4D2OA 3IXBA 3IH8A 4S2NA 3MS6A 3CLOA 3LICA 4R4RA 3UB5P 4EXOA 1Q2QA 1J9MA 3MKEA 4K0XA 4P6BA 1D06A 5HAQA 3SS5A 3ZG8B 3TSGA 1IYSA 2JBFA 1BLCA 4NXFA 2PR6A 5A92A 3NECA 2Z6CA 1PWGA 3OPPA 1VEUA 3VE3A 4M3KA 2KDKA 1KGEA 5L8MA 4PHTA 4R38A 3LR5A 4FD8A 4LV2A 5CHMA 4WLAA 1YLJA 1FOFA 2RCXA 4YOFA 1XPBA 1YLYA 2ZMFA 1KE4A 4OOMA 3T4QA 2ZC4B 2Y2HA 3PHYA 3A0RA 3QNBA 3UE6A 3DWKA 3LR0A 2FH5A 3ZNYA 3FPVA 3CG5A 4LRZE 3EWKA 1W63M 2JE5A 2PHYA 4Y0OA 2IA2A 4S2PA 3IF6C 1H0MA 5HL6A 2QWSA 3T1XA 1LL8A 2B95A 3G30A 4IBXA 4B4ZA 3HCYA 3A3JA 1L3LA 2RL3A 3JPUA 2BG1A 5EVIA 4P6ZM 5FEFA 1OTDA 5EE8A 5J3WA 1KVLA 1O7EA 3ZDJA 1SDNA 4NXEA 3TJZC 4NXBA 3G4PA 3LEQA 4HBTA 2OAQ1 4WMCD 1NYYA 1TS7A 3MFXA 1K0KA 3UPNA 2WKQA 4BBUA 1EW0A 3DTKA 4PAUA 4WELA 4FOFA 3HLWA 3LYXA 5FAOA 5FI7A 3EGXC 4KZ7A 4OP5A 2O0YA 4GDBA 1NXYA 3NIAA 1DJBA 4KZ5A 4FSFA 1IYOA 3CUEC 4Q0HA 3VOYA 4GDNA 1ESIA 4Y17A 1BLHA 2VX8A 3BRMA 1XJ2A 4GNUA 3R7WB 3H82B 4DRTA 1HD8A 1S0WA 4DDSA 3CHWP 3AGEA 5DFYA 1A0KA 1TEMA 4HQAA 2EX2A 3M6BA 3RJUA 4OQHA 3CITA 4UA7A 3HVFA 4DMZA 3D3OA 5E2HA 2DNSA 2OV5A 2BTFP 1P9RA 1DP6A 4QWOA 1K57A 5DTSA 1NZOA 5E43A 2JKTM 4OPZA 3G32A 1M40A 2KLIA 3VSKA 4RX2A 1ERQA 1HVBA 2XGNA 1F2KA 3W2ZA 2Y59A 4OPRA 5TFQA 3C7VA 4H6JA 5HPIA 1JVJA 4ZAMA 2ZLYA 4PM6A 5IHVA 1KE0A 2Y2LA 4WZ4A 3GVBA 1S1ZA 1BYWA 3LEZA 4JF4A 1G6OA 1VETA 3OZHA 5TBMB 4E3MA 5E2EA 2PU4A 3P01A 4FTXA 2QPNA 2WGWB 2Y4AA 1VQQA 3KX0X 4IVKA 4BQMA 3PXPA 1H8MA 1ODVA 5CTNA 4OLGA 2GJ3A 1T1BA 3PBNA 1N9LA 2W1RA 3MBZA 1SZVA 5A91A 2OAP1 4C6YA 3WWXA 1JWPA 2J9PA 3N7WA 3LO7A 1ZC2A 2J3TC 1NYMA 4HH3A 3OCNA 5HD5A 3U2AA 4N1XA 4RQ9A 5F5YA 4HIAA 3NHQA 4LV3A 2XA7M 5M1AA 2WUQA 2ZQCA 2G7UA 3KSHA 3HLGA 3BEBA 3IS2A 3UNWA 1K4EA 4EUZA 2Y2IA 3SH9A 3MZDA 2IWCA 2PAVP 3T4TA 2PR5A 4IUHA 3UPOA 4KQDA 2V2FF 2XF3A 5FQJA 4WEKA 2X71A 3UMEA 1K55C 3EEAA 3FV7A 5FAQA 2O99A 3LCEA 5HAIA 2H10A 4Y7PA 3PBQA 5EECA 5A8BA 2XD1A 3E4OA 4EU0A 3V50A 3BWLA 3HLBA 2Y2MA 4BD1A 4KZ4A 3QP4A 3HJIA 3T4SA 1Z09A 3WS0A 1NWZA 4HP9A 3WRTA 4E3NA 1VEUB 1XGJA 3ISGA 2R9WA 4EEUA 1P0ZA 2XLNA 3BY9A 3ZG0A 1JWVA 4X56A 3ZG9B 5DF9A 3IWQA 3R4KA 1P97A 1T19A 5F82A 2HDUA 4CLCA 1I2WA 3O3VA 3S4XA 1E4DA 3EGDC 3GECA 2XFSA 5CGXA 1ONGA 2KOIA 5IT5A 4KZBA 1G5UA 1L0FA 3G34A 1YMXA 3KSGA 4RYEA 2M7UA 1FCNA 2HV1A 4OPYA 3SS3A 3QP2A 2VJWA 1YM1A 3E2KA 4LCMA 2PDRA 2XK1A 1MWTA 3GSGA 2Y2GA 3F1NA 1OJ5A 2W3HA 1IYPA 2QZ6A 2VA0A 4OVDA 4HHDA 5EVIB 4S2KA 1OPXA 3DTMA 3VOZA 3N4IA 3PBOA 4JGOA 4OLDA 5LBRA 3TOIA 3LI9A 2XSSA 2WKHA 5I5LA 1TS8A 4H8RA 3V67A 2B5RA 4R4SA 3BQ8A 4D60A 3Q7ZA 1N9BA 3TE8A 3VP4A 5DKKA 4MN5A 4QJGA 4N9KA 3T4KA 2I72A 2ZM0A 5DJTA 1XGIA 3QP5A 2XH9A 1GSXA 4PMAA 2Y2QA 1TVFA 5DTTA 1G6AA 5FDHA 2JC7A 2EWVA 3SH8A 2P7JA 2E8IA 1D1JA 1KE3A 2W0NA 2PRFA 3VP3A 4WN5A 1STZA 4FUWA 2GZAA 4OKPA 4Y0TA 1O07A 1OTBA 4R3BA 5FQKA 3JVUA 5HD3A 2IWBA 3C7UA 3LIDA 4R70A 3IWOA 4XUZA 3LR3A 4ETZA 4KUKA 3LIAA 2PT7A 5EOEA 5EV0A 1OJGA 4UAAA 1GHPA 3ZYTA 2Y8HA 1CK3A 1LSXA 4JGPA 4P0MA 4BD0A 4H6JB 5AQAA 4O8GA 4HH2A 4XT2A 4HBUA 1XFNA 1S67L 3MQ0A 3OPHA 2PU2A 3BW6A 3IF5A 3NDGA 5DFXA 3BJNA 5EPHA 2ZBBA 3GRJA 1VETB 2L1MA 4I3JA 1OMEA 5K5BA 2Y55A 2AVXA 4P6ZS 2VEAA 1AXBA 2VLGA 3L9KA 4CLCD 3E4QA 1DP9A 2WZXA 1KDSA 4DXCA 3O86A 4R3JA 2LB5A 2W1TA 3NOTC 1N9NA 4JLFA 4LV0A 2J3WA 1K38A 3VFHA 2WGVA 3MXQA 1SKFA 3G2ZA 3BECA 3N8RA 3S1YA 3B42A 5GLBA 2ZQAA 5TJJA 4R1GA 3PYPA 4O7DA 3E0YA 4R6LA 2XEPA 2D02A 1P9WA 1M6KA 4Q0JA 4NG2A 5AJGA 4PM8A 4IUKA 2YKHA 3TRCA 4II7A 5I94A 1OT9A 3IQAA 4HEFA 3ZCZA 3IS2B 1K56D 2ZL1A 4ZJ1A 2WKRA
chains in the Genus database with same CATH topology
5DTSA 1I5QA 3FYZA 4S2IA 1E3UD 1WE4A 1NZOA 5E43A 4OONA 3O88A 4OPZA 4DE2A 3HUMA 1BLPA 2EFXA 4L0LA 4E3IA 5EVLA 5FAPA 1L2SA 3G32A 4P85A 5M18A 1M40A 5EUAA 3VSKA 1NZUA 1XX2A 4RX2A 4UA6A 1ERQA 1HVBA 2XGNA 2C6WB 4IEDA 3UE0A 5M19A 4B4XA 3IXHA 2Z2LB 3HUOA 2Y59A 3PAGA 5HX9A 4OPRA 3AGDA 5TFQA 5FQQA 5L2FA 3NI9A 1RGZA 3ZGAB 3C7VA 4OH0A 5A90A 1JVJA 4KZAA 2XR0A 2ZC6B 4KZ6A 4ZAMA 2H0TA 3NY4A 3SH7A 5FQIA 2ZLYA 4PM6A 4WEJA 5IHVA 3IF6A 3HLCA 1KE0A 4KG5A 2Y2LA 2BLSA 2EXBA 4S2LA 3GVBA 1ALQA 4WZ4A 5AQ7A 3MZFA 4U3TA 4JKTA 2HDQA 1ES2A 3OCLA 4IVIA 4QU3A 3LEZA 4F94A 5E2GA 5GHYA 1FCOA 3VFFA 3PBSA 5F83A 3N6IA 2Y91A 1PW8A 4JF4A 4BENA 3C4PA 2HP6A 4E6XA 3OZHA 4E3MA 5CRFA 1YLZA 2OLUA 2PU4A 5E2EA 3P98A 4EV4A 3W4OA 2ZMAA 4UHUA 4RVAA 5KMWA 4WMCA 3M6HA 1CI9A 3WRZA 4JBFA 2QPNA 3BM6A 2WGWB 3ITAA 3W8KA 2Y4AA 4JXSA 1VQQA 1K25A 1YLWA 3FKWA 4IVKA 1BUEA 5FQMA 4OQIA 4ZJ2A 3V5MA 2Y2PA 2ZQ8A 4CJNA 5BOHA 5CTNA 1MY8A 5JYPA 5HARA 3ZG7B 1SCWA 3ZG5A 4EBNA 5FA7A 4KQOA 1EROA 4OLGA 4E3JA 4KZ3A 1BZAA 2IWDA 5DVAA 5GHZA 3UE1A 2WKIA 1ERMA 3D4FA 3PBNA 4E6WA 4GB7A 4KENB 2P9VA 3HL9A 3M2KA 3EQUA 3MBZA 5A91A 2FFFB 4C6YA 1TDLA 3WWXA 1GCEA 1EI5A 1MXOA 1JWPA 2J9PA 3OPRA 3N7WA 3CMZA 1JTGA 4RX3A 3FZCA 4PM7A 5A93A 4P87A 1ZG4A 2XD5A 4DXBA 3MXSA 3LO7A 1ZC2A 3Q07A 4B88A 1NYMA 4OOYA 3WS4A 3OCNA 1K6RA 4N1XA 1YLPA 3V3RA 4GD8A 1L0EA 3BFGA 4KG6A 1Q2PA 3N8SA 1QMEA 4MLLA 4C75A 4LV3A 2HDSA 1W79A 4QHCA 5M1AA 1HZOA 1LL5A 2WUQA 2ZQCA 3JYIA 2P74A 3Q7VB 3HLGA 1XP4A 2XFTA 3BEBA 3CJMA 4QB8A 3UNWA 1K56A 1NY0A 1K4EA 1KGGA 2Y2IA 1CI8A 2J9OA 5FI6A 4EUZA 1PI4A 2Y2NA 3CZDA 3SH9A 3MZDA 2ZQ9A 2IWCA 4KZ9A 3MFDA 4N1HA 1E3UA 3DWZA 5CGSA 1XKZA 1GA9A 2WAEA 4MNRA 2X02A 4HESA 4X55A 5AQBA 4ID4A 1Z6FA 1SHVA 2WZZA 3UPOA 3UE3A 1N4OA 4CPKA 1YLTA 5FATA 4WBGA 5J8XA 2V2FF 3IXGA 3QHYA 1ES5A 1WYCA 3ZVTA 1YMSA 3GQZA 3DW0A 3Q1FA 2XF3A 4S2NC 4WEKA 5FQJA 4X53A 2X71A 1KDWA 2DCFA 2XQZA 3NBLA 1K55C 3GV9A 5DF7A 4EBLA 4DKIA 5CHUA 1RCJA 3C4OA 4DE1A 3FV7A 4RA7A 1PW1A 3BFCA 1CEGA 3O87A 5FAQA 5TR7A 1BLSA 1ZG6A 3GR2A 3LCEA 5HAIA 1L0DA 2JCHA 3PBTA 3WS5A 1PYYA 2H10A 4X69A 4Y7PA 1DJAA 3PBQA 4MBHA 4GN2A 5EECA 4OQGA 2C5WB 2XD1A 4K91A 5HL1A 3V50A 4JPMA 5CEDA 2A49A 3HLBA 2Y2MA 4BD1A 4KZ4A 1PWDA 5F1FA 1L0GA 2Z2MB 5F1GA 3HREA 5CERA 2WGWA 3WS0A 3ITBA 4YFMA 3ZVWA 1LI0A 5HFOA 3V39A 5GLDA 2UWXA 2X01A 3WRTA 2A3UA 3A3FA 4JXVA 4PM5A 2WADA 1VM1A 4E3NA 5CTMA 3B3XA 2DRWA 1NJ4A 1PIOA 1XGJA 2EX6A 4FCFA 4OQ0A 3ISGA 2R9WA 4X6TA 4DDYA 5AQ9A 3LY4A 3VMAA 4JF6A 2WKEA 2Q9MA 2HP9A 1IELA 2XLNA 4QY5A 1JTDA 3C5AA 3ZG0A 4IBRA 2CC1A 3EQVA 5HAPA 1FQGA 1JWVA 3I7JA 4X56A 1MKIA 3ZG9B 2ZQ7A 5DF9A 4A5RA 4LV1A 1W8YA 3IWQA 5D3OA 3OPLA 4WZ5C 4MEZA 3FWLA 5F82A 3G35A 4EQIA 2HDUA 1I2WA 2R9XA 4FH4A 1IYQA 4R0QA 3O3VA 4WYYA 3S4XA 1E4DA 3UN7A 1MBLA 1G68A 3VSLA 1Y54A 2XFSA 5CGXA 4WM9A 1ONGA 3NDEA 4XUXA 4QY6A 3IXDA 2ZQDA 4PPRA 5GLAA 1PWCA 4KZBA 1MPLA 2FFYA 3NCKA 1L0FA 3G34A 1YMXA 3BYDA 3UPPA 3LY3A 4RYEA 1ZKJA 4E3OA 3MKFA 1QMFA 3UDXA 4BJPA 1ONHA 3Q7VA 1FCNA 4OPYA 2ZJ9A 5EOOA 5EVIC 3SS3A 4PM9A 1WYBA 1JWZA 1K4FA 3BFFA 3ZFZA 3SOIA 1YM1A 3E2KA 4LCMA 4MBKA 2Y2OA 1GHMA 5U47A 2VGKA 2XK1A 5DF8A 1MWTA 3GSGA 4K0WA 1FSWA 5CXWA 1XXMA 2Y2GA 3IT9A 4LENA 1MWUA 5TGFA 4NETA 4E3LA 4DF6A 1IYPA 2HDRA 2QZ6A 4KG2A 4S2JA 1FR1A 4OVDA 3S22A 2WAFA 5EVID 5EVIB 4S2KA 3HLFA 3A3EA 3RXWA 4DE0A 2H5SA 3DTMA 1NRFA 1LLBA 1PZPA 3W4QA 3P09A 1H5XA 4S2OA 3UDIA 3VOZA 3N4IA 5KZHA 4Z9QA 3IH9A 3BLSA 3UO9A 1MWSA 5HW3A 3PBOA 2ZM8A 4OLDA 3N8LA 1KGFA 3OC2A 3TOIA 4D2OA 3HUNA 3PBRA 3IXBA 2WKHA 5KSHA 4KZ8A 3IH8A 4S2NA 4R4RA 4H8RA 2ZC5B 3G31A 1LL9A 1Q2QA 1J9MA 2HPBA 3MKEA 3PAEA 4K0XA 1CEFA 4P6BA 4BL3A 2B5RA 1K55A 4R4SA 5CECA 5HAQA 3Q81A 3SS5A 3ZG8B 3Q7ZA 1N9BA 1LHYA 3TSGA 3VP4A 1IYSA 4QJGA 1BULA 2JBFA 5FASA 1BLCA 1ES3A 4EBPA 4GD6A 5A92A 4N9KA 3UDFA 1PWGA 3OPPA 2I72A 2ZM0A 3HLEA 2EX9A 1EWZA 4KQQA 1XGIA 2QMIA 3M2JA 4M3KA 1KGEA 1W7FA 2XH9A 5CGWA 4UA9A 3WS1A 1DY6A 4PMAA 2Y2QA 4FD8A 4LV2A 3VP0A 5CHMA 5FI2A 1TVFA 5DTTA 3NC8A 1YLJA 1C3BA 2V1ZA 1FOFA 1G6AA 2GDNA 2RCXA 1K57C 5FDHA 2JC7A 5GHXA 1XPBA 1YLYA 5FSRA 3SH8A 3ZNTA 1KE4A 3MXRA 4OOMA 3SS4A 1HTZA 2ZC4B 2E8IA 2WK0A 4U0XA 4U0TA 2Y2HA 3Q82A 4R23A 1KE3A 3VP3A 3IWIA 2WYXA 1K6SA 3QNBA 4Y0UA 1BT5A 3WS2A 3BFDA 3DWKA 3ZNYA 4OKPA 4Y0TA 3GTCA 1O07A 1RP5A 1E25A 4R3BA 4Q8IA 3CG5A 5FQKA 4E3KA 4OPQA 4WZ5A 2IWBA 3C7UA 4BQMA 2JE5A 1IKGA 2ZM2A 1K54A 4Y0OA 1SDEA 5GL9A 3IWOA 4S2PA 3IF6C 4GOGA 1K54C 3E2LA 4LCLA 3W4PA 4BLMA 2EXAA 2ZC3B 4XUZA 3BLMA 4XXRA 1YQSA 4GKUA 5DTKA 5EOEA 4JXWA 3G30A 3GMWA 4ZDXA 4IBXA 2EFUA 3AGFA 4UAAA 1W5DA 1GHPA 1H8YA 1TDGA 4B4ZA 4ZBEA 1CK3A 4P0MA 3A3JA 4X68A 2RL3A 4BD0A 5AQAA 2BG1A 5FQ9A 1YT4A 5CEBA 2VGJA 4NK3A 5EVIA 3IHAA 1ESUA 2OSUA 4ZJ3A 4FH2A 4HBUA 4ZTKA 4OP8A 1BSGA 3IF6B 5EE8A 1KVLA 3OPHA 1H8ZA 1O7EA 3ZDJA 2PU2A 5CHJA 4C3QA 3HLDA 4EWFA 2PBYA 2Y2KA 3IF5A 2HP5A 1SDNA 3NDGA 4JF5A 2OLVA 3G2YA 4KQRA 4DE3A 2EX8A 4YINA 2Q9NA 5EPHA 3G4PA 1S6RA 4OOLA 3IHBA 3GRJA 3FKVA 1W8QA 1DJCA 1GA0A 1IEMA 2H0YA 4HBTA 1OMEA 2WGIA 3ZHHA 4N92A 4WMCD 2Y55A 1NYYA 2ZC7A 1PI5A 3UPNA 1ES4A 1AXBA 2G2UA 2ZD8A 4S2MA 4GZBA 2WZXA 4JXGA 4WELA 1KDSA 3HLWA 3RXXA 5FAOA 3VP1A 3O86A 5FI7A 4DXCA 4R3JA 1MWRA 1I2SA 4KZ7A 4OP5A 1FR6A 3HBRA 1XA1A 2V20A 1NXYA 3NIAA 3PTEA 1DJBA 4GDBA 4JLFA 4KZ5A 4LV0A 5JYOA 4FSFA 3MZEA 1PZOA 1K38A 1IYOA 1KVMA 3VFHA 2P9VB 2WGVA 3VOYA 4GDNA 1ESIA 1SKFA 1BLHA 5GLCA 3G2ZA 1IKIA 3BECA 3N8RA 3S1YA 3A3IA 3V3SA 1XA7A 3A3DA 3BRMA 5GLBA 2ZQAA 5KSCA 4R1GA 4GNUA 4DRTA 1HD8A 1S0WA 4O7DA 1U60A 1GHIA 2XDMA 2G2WA 2Y2JA 1RGYA 4DDSA 3AGEA 2XEPA 3VP2A 3BFEA 4MBFA 1TEMA 1M6KA 2EX2A 3M6BA 2J8YA 4QD4A 3RJUA 4OQHA 3UY6A 3TG9A 4UA7A 1BTLA 4PM8A 4BL2A 2J7VA 1FCMA 3HVFA 5G18A 1LI9A 5I94A 5E2HA 3IQAA 2DNSA 3QNCA 4HEFA 5E2FA 2OV5A 3ZCZA 1K56D 4ZJ1A 4N9LA 1K57A 1FSYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DTS A;  1I5Q A;  3FYZ A;  4S2I A;  1E3U D;  1WE4 A;  1NZO A;  5E43 A;  4OON A;  3O88 A;  4OPZ A;  4DE2 A;  3HUM A;  1BLP A;  2EFX A;  4L0L A;  4E3I A;  5EVL A;  5FAP A;  1L2S A;  3G32 A;  4P85 A;  5M18 A;  1M40 A;  5EUA A;  3VSK A;  1NZU A;  1XX2 A;  4RX2 A;  4UA6 A;  1ERQ A;  1HVB A;  2XGN A;  2C6W B;  4IED A;  3UE0 A;  5M19 A;  4B4X A;  3IXH A;  2Z2L B;  3HUO A;  2Y59 A;  3PAG A;  5HX9 A;  4OPR A;  3AGD A;  5TFQ A;  5FQQ A;  5L2F A;  3NI9 A;  1RGZ A;  3ZGA B;  3C7V A;  4OH0 A;  5A90 A;  1JVJ A;  4KZA A;  2XR0 A;  2ZC6 B;  4KZ6 A;  4ZAM A;  2H0T A;  3NY4 A;  3SH7 A;  5FQI A;  2ZLY A;  4PM6 A;  4WEJ A;  5IHV A;  3IF6 A;  3HLC A;  1KE0 A;  4KG5 A;  2Y2L A;  2BLS A;  2EXB A;  4S2L A;  3GVB A;  1ALQ A;  4WZ4 A;  5AQ7 A;  3MZF A;  4U3T A;  4JKT A;  2HDQ A;  1ES2 A;  3OCL A;  4IVI A;  4QU3 A;  3LEZ A;  4F94 A;  5E2G A;  5GHY A;  1FCO A;  3VFF A;  3PBS A;  5F83 A;  3N6I A;  2Y91 A;  1PW8 A;  4JF4 A;  4BEN A;  3C4P A;  2HP6 A;  4E6X A;  3OZH A;  4E3M A;  5CRF A;  1YLZ A;  2OLU A;  2PU4 A;  5E2E A;  3P98 A;  4EV4 A;  3W4O A;  2ZMA A;  4UHU A;  4RVA A;  5KMW A;  4WMC A;  3M6H A;  1CI9 A;  3WRZ A;  4JBF A;  2QPN A;  3BM6 A;  2WGW B;  3ITA A;  3W8K A;  2Y4A A;  4JXS A;  1VQQ A;  1K25 A;  1YLW A;  3FKW A;  4IVK A;  1BUE A;  5FQM A;  4OQI A;  4ZJ2 A;  3V5M A;  2Y2P A;  2ZQ8 A;  4CJN A;  5BOH A;  5CTN A;  1MY8 A;  5JYP A;  5HAR A;  3ZG7 B;  1SCW A;  3ZG5 A;  4EBN A;  5FA7 A;  4KQO A;  1ERO A;  4OLG A;  4E3J A;  4KZ3 A;  1BZA A;  2IWD A;  5DVA A;  5GHZ A;  3UE1 A;  2WKI A;  1ERM A;  3D4F A;  3PBN A;  4E6W A;  4GB7 A;  4KEN B;  2P9V A;  3HL9 A;  3M2K A;  3EQU A;  3MBZ A;  5A91 A;  2FFF B;  4C6Y A;  1TDL A;  3WWX A;  1GCE A;  1EI5 A;  1MXO A;  1JWP A;  2J9P A;  3OPR A;  3N7W A;  3CMZ A;  1JTG A;  4RX3 A;  3FZC A;  4PM7 A;  5A93 A;  4P87 A;  1ZG4 A;  2XD5 A;  4DXB A;  3MXS A;  3LO7 A;  1ZC2 A;  3Q07 A;  4B88 A;  1NYM A;  4OOY A;  3WS4 A;  3OCN A;  1K6R A;  4N1X A;  1YLP A;  3V3R A;  4GD8 A;  1L0E A;  3BFG A;  4KG6 A;  1Q2P A;  3N8S A;  1QME A;  4MLL A;  4C75 A;  4LV3 A;  2HDS A;  1W79 A;  4QHC A;  5M1A A;  1HZO A;  1LL5 A;  2WUQ A;  2ZQC A;  3JYI A;  2P74 A;  3Q7V B;  3HLG A;  1XP4 A;  2XFT A;  3BEB A;  3CJM A;  4QB8 A;  3UNW A;  1K56 A;  1NY0 A;  1K4E A;  1KGG A;  2Y2I A;  1CI8 A;  2J9O A;  5FI6 A;  4EUZ A;  1PI4 A;  2Y2N A;  3CZD A;  3SH9 A;  3MZD A;  2ZQ9 A;  2IWC A;  4KZ9 A;  3MFD A;  4N1H A;  1E3U A;  3DWZ A;  5CGS A;  1XKZ A;  1GA9 A;  2WAE A;  4MNR A;  2X02 A;  4HES A;  4X55 A;  5AQB A;  4ID4 A;  1Z6F A;  1SHV A;  2WZZ A;  3UPO A;  3UE3 A;  1N4O A;  4CPK A;  1YLT A;  5FAT A;  4WBG A;  5J8X A;  2V2F F;  3IXG A;  3QHY A;  1ES5 A;  1WYC A;  3ZVT A;  1YMS A;  3GQZ A;  3DW0 A;  3Q1F A;  2XF3 A;  4S2N C;  4WEK A;  5FQJ A;  4X53 A;  2X71 A;  1KDW A;  2DCF A;  2XQZ A;  3NBL A;  1K55 C;  3GV9 A;  5DF7 A;  4EBL A;  4DKI A;  5CHU A;  1RCJ A;  3C4O A;  4DE1 A;  3FV7 A;  4RA7 A;  1PW1 A;  3BFC A;  1CEG A;  3O87 A;  5FAQ A;  5TR7 A;  1BLS A;  1ZG6 A;  3GR2 A;  3LCE A;  5HAI A;  1L0D A;  2JCH A;  3PBT A;  3WS5 A;  1PYY A;  2H10 A;  4X69 A;  4Y7P A;  1DJA A;  3PBQ A;  4MBH A;  4GN2 A;  5EEC A;  4OQG A;  2C5W B;  2XD1 A;  4K91 A;  5HL1 A;  3V50 A;  4JPM A;  5CED A;  2A49 A;  3HLB A;  2Y2M A;  4BD1 A;  4KZ4 A;  1PWD A;  5F1F A;  1L0G A;  2Z2M B;  5F1G A;  3HRE A;  5CER A;  2WGW A;  3WS0 A;  3ITB A;  4YFM A;  3ZVW A;  1LI0 A;  5HFO A;  3V39 A;  5GLD A;  2UWX A;  2X01 A;  3WRT A;  2A3U A;  3A3F A;  4JXV A;  4PM5 A;  2WAD A;  1VM1 A;  4E3N A;  5CTM A;  3B3X A;  2DRW A;  1NJ4 A;  1PIO A;  1XGJ A;  2EX6 A;  4FCF A;  4OQ0 A;  3ISG A;  2R9W A;  4X6T A;  4DDY A;  5AQ9 A;  3LY4 A;  3VMA A;  4JF6 A;  2WKE A;  2Q9M A;  2HP9 A;  1IEL A;  2XLN A;  4QY5 A;  1JTD A;  3C5A A;  3ZG0 A;  4IBR A;  2CC1 A;  3EQV A;  5HAP A;  1FQG A;  1JWV A;  3I7J A;  4X56 A;  1MKI A;  3ZG9 B;  2ZQ7 A;  5DF9 A;  4A5R A;  4LV1 A;  1W8Y A;  3IWQ A;  5D3O A;  3OPL A;  4WZ5 C;  4MEZ A;  3FWL A;  5F82 A;  3G35 A;  4EQI A;  2HDU A;  1I2W A;  2R9X A;  4FH4 A;  1IYQ A;  4R0Q A;  3O3V A;  4WYY A;  3S4X A;  1E4D A;  3UN7 A;  1MBL A;  1G68 A;  3VSL A;  1Y54 A;  2XFS A;  5CGX A;  4WM9 A;  1ONG A;  3NDE A;  4XUX A;  4QY6 A;  3IXD A;  2ZQD A;  4PPR A;  5GLA A;  1PWC A;  4KZB A;  1MPL A;  2FFY A;  3NCK A;  1L0F A;  3G34 A;  1YMX A;  3BYD A;  3UPP A;  3LY3 A;  4RYE A;  1ZKJ A;  4E3O A;  3MKF A;  1QMF A;  3UDX A;  4BJP A;  1ONH A;  3Q7V A;  1FCN A;  4OPY A;  2ZJ9 A;  5EOO A;  5EVI C;  3SS3 A;  4PM9 A;  1WYB A;  1JWZ A;  1K4F A;  3BFF A;  3ZFZ A;  3SOI A;  1YM1 A;  3E2K A;  4LCM A;  4MBK A;  2Y2O A;  1GHM A;  5U47 A;  2VGK A;  2XK1 A;  5DF8 A;  1MWT A;  3GSG A;  4K0W A;  1FSW A;  5CXW A;  1XXM A;  2Y2G A;  3IT9 A;  4LEN A;  1MWU A;  5TGF A;  4NET A;  4E3L A;  4DF6 A;  1IYP A;  2HDR A;  2QZ6 A;  4KG2 A;  4S2J A;  1FR1 A;  4OVD A;  3S22 A;  2WAF A;  5EVI D;  5EVI B;  4S2K A;  3HLF A;  3A3E A;  3RXW A;  4DE0 A;  2H5S A;  3DTM A;  1NRF A;  1LLB A;  1PZP A;  3W4Q A;  3P09 A;  1H5X A;  4S2O A;  3UDI A;  3VOZ A;  3N4I A;  5KZH A;  4Z9Q A;  3IH9 A;  3BLS A;  3UO9 A;  1MWS A;  5HW3 A;  3PBO A;  2ZM8 A;  4OLD A;  3N8L A;  1KGF A;  3OC2 A;  3TOI A;  4D2O A;  3HUN A;  3PBR A;  3IXB A;  2WKH A;  5KSH A;  4KZ8 A;  3IH8 A;  4S2N A;  4R4R A;  4H8R A;  2ZC5 B;  3G31 A;  1LL9 A;  1Q2Q A;  1J9M A;  2HPB A;  3MKE A;  3PAE A;  4K0X A;  1CEF A;  4P6B A;  4BL3 A;  2B5R A;  1K55 A;  4R4S A;  5CEC A;  5HAQ A;  3Q81 A;  3SS5 A;  3ZG8 B;  3Q7Z A;  1N9B A;  1LHY A;  3TSG A;  3VP4 A;  1IYS A;  4QJG A;  1BUL A;  2JBF A;  5FAS A;  1BLC A;  1ES3 A;  4EBP A;  4GD6 A;  5A92 A;  4N9K A;  3UDF A;  1PWG A;  3OPP A;  2I72 A;  2ZM0 A;  3HLE A;  2EX9 A;  1EWZ A;  4KQQ A;  1XGI A;  2QMI A;  3M2J A;  4M3K A;  1KGE A;  1W7F A;  2XH9 A;  5CGW A;  4UA9 A;  3WS1 A;  1DY6 A;  4PMA A;  2Y2Q A;  4FD8 A;  4LV2 A;  3VP0 A;  5CHM A;  5FI2 A;  1TVF A;  5DTT A;  3NC8 A;  1YLJ A;  1C3B A;  2V1Z A;  1FOF A;  1G6A A;  2GDN A;  2RCX A;  1K57 C;  5FDH A;  2JC7 A;  5GHX A;  1XPB A;  1YLY A;  5FSR A;  3SH8 A;  3ZNT A;  1KE4 A;  3MXR A;  4OOM A;  3SS4 A;  1HTZ A;  2ZC4 B;  2E8I A;  2WK0 A;  4U0X A;  4U0T A;  2Y2H A;  3Q82 A;  4R23 A;  1KE3 A;  3VP3 A;  3IWI A;  2WYX A;  1K6S A;  3QNB A;  4Y0U A;  1BT5 A;  3WS2 A;  3BFD A;  3DWK A;  3ZNY A;  4OKP A;  4Y0T A;  3GTC A;  1O07 A;  1RP5 A;  1E25 A;  4R3B A;  4Q8I A;  3CG5 A;  5FQK A;  4E3K A;  4OPQ A;  4WZ5 A;  2IWB A;  3C7U A;  4BQM A;  2JE5 A;  1IKG A;  2ZM2 A;  1K54 A;  4Y0O A;  1SDE A;  5GL9 A;  3IWO A;  4S2P A;  3IF6 C;  4GOG A;  1K54 C;  3E2L A;  4LCL A;  3W4P A;  4BLM A;  2EXA A;  2ZC3 B;  4XUZ A;  3BLM A;  4XXR A;  1YQS A;  4GKU A;  5DTK A;  5EOE A;  4JXW A;  3G30 A;  3GMW A;  4ZDX A;  4IBX A;  2EFU A;  3AGF A;  4UAA A;  1W5D A;  1GHP A;  1H8Y A;  1TDG A;  4B4Z A;  4ZBE A;  1CK3 A;  4P0M A;  3A3J A;  4X68 A;  2RL3 A;  4BD0 A;  5AQA A;  2BG1 A;  5FQ9 A;  1YT4 A;  5CEB A;  2VGJ A;  4NK3 A;  5EVI A;  3IHA A;  1ESU A;  2OSU A;  4ZJ3 A;  4FH2 A;  4HBU A;  4ZTK A;  4OP8 A;  1BSG A;  3IF6 B;  5EE8 A;  1KVL A;  3OPH A;  1H8Z A;  1O7E A;  3ZDJ A;  2PU2 A;  5CHJ A;  4C3Q A;  3HLD A;  4EWF A;  2PBY A;  2Y2K A;  3IF5 A;  2HP5 A;  1SDN A;  3NDG A;  4JF5 A;  2OLV A;  3G2Y A;  4KQR A;  4DE3 A;  2EX8 A;  4YIN A;  2Q9N A;  5EPH A;  3G4P A;  1S6R A;  4OOL A;  3IHB A;  3GRJ A;  3FKV A;  1W8Q A;  1DJC A;  1GA0 A;  1IEM A;  2H0Y A;  4HBT A;  1OME A;  2WGI A;  3ZHH A;  4N92 A;  4WMC D;  2Y55 A;  1NYY A;  2ZC7 A;  1PI5 A;  3UPN A;  1ES4 A;  1AXB A;  2G2U A;  2ZD8 A;  4S2M A;  4GZB A;  2WZX A;  4JXG A;  4WEL A;  1KDS A;  3HLW A;  3RXX A;  5FAO A;  3VP1 A;  3O86 A;  5FI7 A;  4DXC A;  4R3J A;  1MWR A;  1I2S A;  4KZ7 A;  4OP5 A;  1FR6 A;  3HBR A;  1XA1 A;  2V20 A;  1NXY A;  3NIA A;  3PTE A;  1DJB A;  4GDB A;  4JLF A;  4KZ5 A;  4LV0 A;  5JYO A;  4FSF A;  3MZE A;  1PZO A;  1K38 A;  1IYO A;  1KVM A;  3VFH A;  2P9V B;  2WGV A;  3VOY A;  4GDN A;  1ESI A;  1SKF A;  1BLH A;  5GLC A;  3G2Z A;  1IKI A;  3BEC A;  3N8R A;  3S1Y A;  3A3I A;  3V3S A;  1XA7 A;  3A3D A;  3BRM A;  5GLB A;  2ZQA A;  5KSC A;  4R1G A;  4GNU A;  4DRT A;  1HD8 A;  1S0W A;  4O7D A;  1U60 A;  1GHI A;  2XDM A;  2G2W A;  2Y2J A;  1RGY A;  4DDS A;  3AGE A;  2XEP A;  3VP2 A;  3BFE A;  4MBF A;  1TEM A;  1M6K A;  2EX2 A;  3M6B A;  2J8Y A;  4QD4 A;  3RJU A;  4OQH A;  3UY6 A;  3TG9 A;  4UA7 A;  1BTL A;  4PM8 A;  4BL2 A;  2J7V A;  1FCM A;  3HVF A;  5G18 A;  1LI9 A;  5I94 A;  5E2H A;  3IQA A;  2DNS A;  3QNC A;  4HEF A;  5E2F A;  2OV5 A;  3ZCZ A;  1K56 D;  4ZJ1 A;  4N9L A;  1K57 A;  1FSY A; 
#chains in the Genus database with same CATH topology
 2A2L A;  2LB9 A;  1E3U D;  2H28 A;  4OON A;  4AFI A;  4DE2 A;  3NOU C;  3MQO A;  1BLP A;  2EFX A;  5EVL A;  5FAP A;  1L2S A;  1AWI A;  5M18 A;  5EUA A;  3PR6 A;  4PKY A;  1XX2 A;  4UA6 A;  3EOI A;  2C6W B;  3UE0 A;  5M19 A;  3HUO A;  4M4X A;  3ZGA B;  1CQA A;  3IX4 A;  2H0T A;  3OOV A;  2M7V A;  2EXB A;  5AQ7 A;  3TW8 A;  3MZF A;  1FIK A;  2HDQ A;  1ES2 A;  4IVI A;  4F94 A;  4QU3 A;  3IBR A;  3N6I A;  5G4Z A;  4KUO A;  2K2N A;  1YLZ A;  4MN7 A;  3UB8 A;  3OLO A;  4UHU A;  4RVA A;  5KMW A;  2ACG A;  2XRN A;  5JYO A;  1BUE A;  4OQI A;  1MY8 A;  5JYP A;  5HAR A;  1SCW A;  3ZG5 A;  5FA7 A;  5DVA A;  3OBF A;  5J7E A;  1ERM A;  2CMN A;  4GB7 A;  4KEN B;  3HL9 A;  3M2K A;  4G3K A;  3RFB A;  2K31 A;  4RX3 A;  4PM7 A;  5A93 A;  4CLC B;  2XD5 A;  4X1M A;  2JKR M;  5F6A A;  3WS4 A;  3G6O A;  1K6R A;  4GD8 A;  4KG6 A;  4BBV A;  1QME A;  1W79 A;  4QHC A;  3JYI A;  1XP4 A;  4QB8 A;  3U4L P;  1NY0 A;  1KGG A;  2J9O A;  4O0P A;  3CZD A;  2OWJ A;  2ZQ9 A;  4KZ9 A;  3MFD A;  4IHQ A;  3DWZ A;  5AVF A;  4NXG A;  4MNR A;  3DBA A;  4ID4 A;  2FZ0 A;  3LGO A;  3F1O A;  5J8X A;  3IXG A;  1YMS A;  3T4J A;  4S2N C;  2XA7 S;  3BQA A;  4GCZ A;  3KYE A;  3C4O A;  1CEG A;  2L4R A;  5TR7 A;  1BLS A;  1DRM A;  3LIF A;  1YPR A;  1L0D A;  3PBT A;  4I5S A;  2C5W B;  3B47 A;  2QKP A;  4JPM A;  3T4L A;  5CED A;  5F1F A;  1PNE A;  1H3Q A;  2VV6 A;  3K2N A;  4YFM A;  5HDS A;  3CI6 A;  2WAD A;  1VM1 A;  3S7O A;  4DJ3 A;  1NJ4 A;  3IX3 A;  3SZT A;  4OQ0 A;  3B33 A;  3VMA A;  4JF6 A;  2WKE A;  2HP9 A;  4NEE D;  3S7P A;  3C5A A;  4Y15 A;  4IBR A;  4GHI A;  2VKS A;  4A5R A;  1MZU A;  3FWL A;  1Y28 A;  4R0Q A;  4HJ3 A;  3VSL A;  4L9G A;  3IXD A;  2ZQD A;  4I39 A;  4LPZ A;  1F5M A;  3BYD A;  3LY3 A;  1ZKJ A;  3UDX A;  4BJP A;  4EET B;  3Q7V A;  5HZH A;  3VV4 A;  5EVI C;  4Y3I A;  4UQI M;  1PFL A;  1K4F A;  3BFF A;  3F1P A;  1UGU A;  3T50 A;  1GSV A;  4K0W A;  4LFU A;  1FSW A;  3RTY A;  4ESP A;  3IT9 A;  5TGF A;  4NET A;  4G3W A;  2W3G A;  5EVI D;  1JNU A;  4XT2 B;  4DE0 A;  1PZP A;  3W4Q A;  1H5X A;  4S2O A;  3LIB A;  2PYP A;  3VOL A;  2B18 A;  3HUN A;  3PBR A;  1MKM A;  4O01 A;  3G31 A;  3QP1 A;  4BL3 A;  4ARZ A;  5HSQ A;  1CEF A;  5CEC A;  1BUL A;  5FAS A;  2W1T B;  3HLE A;  1T18 A;  1EWZ A;  5FDS A;  4KQQ A;  2QMI A;  3M2J A;  1W7F A;  2HGV A;  4UA9 A;  2PD7 A;  1DY6 A;  4WL9 A;  2GX5 A;  3VP0 A;  5FI2 A;  4Z1W A;  3NC8 A;  1C3B A;  1K57 C;  4GW9 A;  3ZNT A;  3SS4 A;  1HTZ A;  3MSH A;  4U0X A;  4U0T A;  3Q82 A;  3QP8 A;  3IWI A;  4JGR A;  4Y0U A;  1BT5 A;  3BFD A;  3GTC A;  1RP5 A;  3KSI A;  4Q8I A;  1FIL A;  2JHE A;  2ZL1 B;  4OPQ A;  4WZ5 A;  5J4E A;  3K3D A;  5GL9 A;  2V1B A;  4GOG A;  1K54 C;  3E2L A;  3W4P A;  4BLM A;  2ZC3 B;  4GLQ A;  4XXR A;  4GKU A;  5DJU A;  1J3W A;  2Z6D A;  1IOU A;  4ZDX A;  3DAV A;  1W5D A;  2O9C A;  3D72 A;  4X68 A;  4PKY G;  2HJ9 C;  5CEB A;  2XRO A;  4NK3 A;  3IHA A;  4ZJ3 A;  1CJF A;  4ZTK A;  4OP8 A;  1H8Z A;  4EWF A;  5CHJ A;  4C3Q A;  3HLD A;  2Y2K A;  4KQR A;  4DE3 A;  4YIN A;  4G3V A;  1S6R A;  3IHB A;  3FKV A;  1W8Q A;  2P04 A;  1DJC A;  1IEM A;  3UB9 A;  1N9O A;  2VZW A;  2WGI A;  4N92 A;  1PI5 A;  3CPT A;  4I3A A;  3R7W A;  2G2U A;  2ZD8 A;  4JXG A;  2EA9 A;  3VP1 A;  4L9F A;  5F69 A;  1SKO A;  1FR6 A;  3HBR A;  3PTE A;  2NUP C;  4MDZ A;  2P08 A;  1IKI A;  3C8C A;  2B02 A;  3A3I A;  1XA7 A;  4Y13 A;  5KSC A;  5L10 A;  2JKT I;  1T1A A;  1V9Y A;  5HDD A;  1U60 A;  1UWN X;  2XDM A;  1RGY A;  2BAS A;  4Y2F A;  3VP2 A;  4ZRR A;  4MBF A;  2OOL A;  2J8Y A;  1MC0 A;  3HJK A;  1BTL A;  3FPW A;  5E2F A;  2V1A A;  5EM1 A;  3NUL A;  1FSY A;  2QJ5 A;  3QP6 A;  4S2I A;  1WE4 A;  3O88 A;  3LI8 A;  3HUM A;  3F1O B;  4P85 A;  2A24 A;  2R78 A;  4E04 A;  4IED A;  1S4S A;  3IXH A;  5HX9 A;  1OTE A;  2JKF A;  5FQQ A;  5L2F A;  5FEG A;  5A90 A;  4KZA A;  4KZ6 A;  3SH7 A;  4WEJ A;  3IF6 A;  4KG5 A;  2BLS A;  1ALQ A;  1KOU A;  1XFQ A;  3CWF A;  2VGL M;  5E2G A;  5GHY A;  1FCO A;  3VFF A;  2EWW A;  5KIZ A;  3C4P A;  2HP6 A;  2OLU A;  5HDC A;  4EV4 A;  3W4O A;  2ZMA A;  4QPR A;  4WMC A;  4HOI A;  3WRZ A;  4EW7 A;  3E98 A;  3ITA A;  4JXS A;  5FQM A;  3FKW A;  3V5M A;  2ZQ8 A;  5C5K A;  3MMH A;  4CLC C;  1ERO A;  3D9Y A;  4E3J A;  1BZA A;  5GHZ A;  3UE1 A;  3NOP C;  2WKI A;  1X0O A;  2P9V A;  2QJ7 A;  4GHI B;  1TDL A;  1EI5 A;  3CMZ A;  1JTG A;  3FZC A;  3MR0 A;  4HJ4 A;  4P87 A;  4DXB A;  3JVV A;  3MXS A;  3Q07 A;  4B88 A;  5EM0 A;  4L9E A;  5IU1 A;  3V3R A;  3CUE A;  1Q2P A;  2D01 A;  4MLL A;  4C75 A;  2HDS A;  1LT0 A;  3O5Y A;  1LL5 A;  3DTE A;  3Q7V B;  4WUJ A;  4GS9 A;  2V8C A;  4Q0I A;  3A0S A;  5FI6 A;  2Y2N A;  5CGS A;  1GA9 A;  3F1P B;  2X02 A;  3T4O A;  1SHV A;  1TS0 A;  1N4O A;  1YLT A;  4WBG A;  1OTI A;  3T1S A;  1ES5 A;  1WYC A;  3GQZ A;  3DW0 A;  2VK3 A;  1KDW A;  2DCF A;  5EVE A;  2O9B A;  3NBL A;  4EBL A;  1PRQ A;  2W3F A;  5CHU A;  1RCJ A;  4DE1 A;  4RA7 A;  1PW1 A;  3O87 A;  1ZG6 A;  3WS5 A;  4X69 A;  4GN2 A;  4OQG A;  5F68 A;  4K91 A;  5HL1 A;  4ARZ B;  1PWD A;  2HF6 A;  1L0G A;  2Z2M B;  5CER A;  3HRE A;  3H7W A;  3T1R A;  3V39 A;  5HFO A;  2UWX A;  2X01 A;  3A3F A;  4JXV A;  2V9A A;  1ACF A;  3B3X A;  2DRW A;  5HWT A;  4X6T A;  4DDY A;  5AQ9 A;  2W27 A;  2Q9M A;  1IEL A;  2M1C A;  4QY5 A;  1JTD A;  4DN0 A;  3I7J A;  1MKI A;  2ZQ7 A;  2WKP A;  2O9A A;  3OPL A;  4CLC E;  4MEZ A;  3G35 A;  2JKG A;  2R9X A;  3FG8 A;  1VB6 A;  3UN7 A;  3ICY A;  1MBL A;  4XUX A;  4PPR A;  5GLA A;  1NRJ A;  2FFY A;  3NCK A;  1XJ4 A;  3UMD A;  1QMF A;  2GNX A;  1ONH A;  4MCW A;  3C2W A;  4PM9 A;  3ZFZ A;  3SOI A;  4MBK A;  1UWP X;  1VHM A;  1GHM A;  5DF8 A;  2W3E A;  1MWU A;  4DF6 A;  2HDR A;  3KSF A;  4S2J A;  2QYB A;  1FR1 A;  3S22 A;  2WAF A;  1GSW A;  2Y79 A;  1YAX A;  4UEY A;  3RXW A;  2H5S A;  4LGW A;  5KZH A;  1W63 Q;  3P09 A;  4UQI S;  4Z9Q A;  5CX7 A;  3UO9 A;  1MWS A;  3MQQ A;  2ZM8 A;  2W3D A;  1KGF A;  2MJ6 A;  4DJ2 A;  2VV7 A;  4JGQ A;  4LLO B;  3ULF A;  5KSH A;  3F1N B;  4KZ8 A;  4HNB A;  2ZC5 B;  1LL9 A;  2HPB A;  3PAE A;  1K55 A;  3Q81 A;  3CPT B;  1LHY A;  1D7E A;  1WA9 A;  3KO6 A;  1ES3 A;  1SKO B;  4EBP A;  4GD6 A;  3UDF A;  1DP8 A;  4K08 A;  2EX9 A;  3FC7 A;  5CGW A;  3WS1 A;  3A0V A;  1F9I A;  2V1Z A;  2GDN A;  4LRX C;  1T1C A;  5GHX A;  3DTI A;  5FSR A;  3MXR A;  4IJG A;  2WK0 A;  4R23 A;  2WYX A;  1K6S A;  1S1Y A;  4EEP A;  4HJ6 A;  4F3L A;  3WS2 A;  1F98 A;  4CQH A;  1E25 A;  3P7N A;  4E3K A;  4GJ4 A;  1IKG A;  2ZM2 A;  1K54 A;  1SDE A;  4LCL A;  2EXA A;  3BLM A;  4ETX A;  1YQS A;  4LRY C;  5DTK A;  2A24 B;  2INW A;  4JXW A;  3GMW A;  2K7S A;  2VV8 A;  3VE4 A;  2EFU A;  3AGF A;  1H8Y A;  1TDG A;  4ZBE A;  5FQ9 A;  1YT4 A;  2VGJ A;  1ESU A;  2OSU A;  3KYQ A;  4FH2 A;  3KYZ A;  1BSG A;  1OTA A;  3IF6 B;  5L07 A;  2PBY A;  2HP5 A;  4I38 A;  4JF5 A;  2OLV A;  3G2Y A;  2EX8 A;  2Q9N A;  4OOL A;  2JN7 A;  3IX8 A;  4BBT A;  1GA0 A;  2H0Y A;  1V9Z A;  3ZHH A;  2PYR A;  2ZC7 A;  1ES4 A;  4S2M A;  4WF0 A;  4GZB A;  2PBD P;  3RXX A;  3LR4 A;  1MWR A;  3C38 A;  1XJ6 A;  1I2S A;  1XA1 A;  2V20 A;  3MZE A;  1PZO A;  1KVM A;  2P9V B;  4R3A A;  3H9W A;  5GLC A;  3V3S A;  3GDI A;  3A3D A;  1S4R A;  2V8F A;  4ME4 A;  4HI4 A;  2DMW A;  3MF0 A;  1GHI A;  2J3T D;  2G2W A;  2Y2J A;  3S7Q A;  3LFV A;  3BFE A;  5MC7 A;  2ZOI A;  4HP4 A;  4QD4 A;  3IBJ A;  3UY6 A;  3TG9 A;  4BL2 A;  2J7V A;  1FCM A;  5G18 A;  1LI9 A;  3QNC A;  1XJ3 A;  4GS9 B;  4N9L A;  1I5Q A;  3LUQ A;  3FYZ A;  1ZHH B;  4HY8 A;  4B93 A;  4L0L A;  4E3I A;  3S7N A;  1NZU A;  2HJE A;  3EEH A;  2Q0O A;  3NJA A;  4B4X A;  2Z2L B;  3PAG A;  2YKF A;  3AGD A;  3NI9 A;  1RGZ A;  4OH0 A;  2XR0 A;  2ZC6 B;  3NY4 A;  5FQI A;  3HLC A;  4S2L A;  5EFW A;  2ZMV A;  4U3T A;  4NKP A;  4JKT A;  3OCL A;  1NLZ A;  3E4P A;  3PBS A;  5F83 A;  2Y91 A;  1PW8 A;  4BEN A;  4EUV A;  1LSV A;  4E6X A;  5CRF A;  3P98 A;  2JKR I;  3M6H A;  1CI9 A;  3ZQ5 A;  4JBF A;  1YKD A;  3H7W B;  3BM6 A;  3W8K A;  1K25 A;  1YLW A;  4ZJ2 A;  2Y2P A;  4CJN A;  5BOH A;  3ZG7 B;  4Y5F A;  4EBN A;  4KQO A;  2VGL S;  4KZ3 A;  2IWD A;  3D4F A;  4E6W A;  3EQU A;  2FFF B;  1TF1 A;  1GCE A;  1MXO A;  3L7H A;  3OPR A;  4X1L A;  3H82 A;  2UV0 E;  1ZG4 A;  3T12 B;  4OOY A;  1YLP A;  1L0E A;  3BFG A;  5G4Y A;  2E8J A;  4EER A;  1LSW A;  3N8S A;  3MJQ A;  2I9V A;  1HZO A;  2L0W A;  2P74 A;  2V0U A;  3CJM A;  2XFT A;  1K56 A;  1CI8 A;  1PI4 A;  1YSP A;  4N1H A;  1E3U A;  1XKZ A;  2WAE A;  4EQ1 A;  4HES A;  5AQB A;  4X55 A;  4B9O A;  1Z6F A;  2QHK A;  2WZZ A;  3UE3 A;  4CPK A;  5FAT A;  3QHY A;  5DKL A;  4X25 A;  3ZVT A;  2HZ5 A;  3Q1F A;  4X53 A;  1TD5 A;  2XQZ A;  3GV9 A;  5HWV A;  5DF7 A;  4DKI A;  5L09 A;  1G28 A;  1Y4O A;  3BFC A;  3GR2 A;  4YWZ A;  2JCH A;  2ZOH A;  1PYY A;  3UB6 A;  1DJA A;  4MBH A;  3C30 A;  2OWH A;  4EES A;  4YNR A;  5TBM A;  2A49 A;  5F1G A;  5HWW A;  2WGW A;  3ITB A;  3ZVW A;  1LI0 A;  5GLD A;  1S66 L;  2A3U A;  4PM5 A;  5CTM A;  3LIE A;  5AVE A;  1HLU P;  1PIO A;  2EX6 A;  4FCF A;  3LY4 A;  1TS6 A;  4I3I A;  3UB7 A;  2CC1 A;  3EQV A;  5FL3 A;  5HAP A;  1FQG A;  4LV1 A;  1W8Y A;  5D3O A;  4WZ5 C;  3BY8 A;  3SW1 A;  4EQI A;  1ZTU A;  4WYY A;  4FH4 A;  1IYQ A;  3CAX A;  4MMN A;  1G68 A;  1Y54 A;  4WM9 A;  2KX6 A;  3NDE A;  4BMW A;  4QY6 A;  2NUT C;  1PWC A;  4F3L B;  1MPL A;  3UPP A;  3K3C A;  4E3O A;  3MKF A;  4MN6 A;  5IS1 A;  2ZJ9 A;  5EOO A;  1OT6 A;  1CF0 A;  1WYB A;  2PD8 A;  1JWZ A;  1YSQ A;  2Y2O A;  5U47 A;  2VGK A;  5HPF A;  5CXW A;  1XXM A;  4LEN A;  4E3L A;  2J80 A;  4KG2 A;  3T1Q B;  3HLF A;  3A3E A;  3RH8 B;  1NRF A;  1LLB A;  2V0W A;  3UDI A;  3IH9 A;  4BWI A;  1NLY A;  3BLS A;  5HW3 A;  1IFQ A;  3N8L A;  3OC2 A;  4D2O A;  3IXB A;  3IH8 A;  4S2N A;  3MS6 A;  3CLO A;  3LIC A;  4R4R A;  3UB5 P;  4EXO A;  1Q2Q A;  1J9M A;  3MKE A;  4K0X A;  4P6B A;  1D06 A;  5HAQ A;  3SS5 A;  3ZG8 B;  3TSG A;  1IYS A;  2JBF A;  1BLC A;  4NXF A;  2PR6 A;  5A92 A;  3NEC A;  2Z6C A;  1PWG A;  3OPP A;  1VEU A;  3VE3 A;  4M3K A;  2KDK A;  1KGE A;  5L8M A;  4PHT A;  4R38 A;  3LR5 A;  4FD8 A;  4LV2 A;  5CHM A;  4WLA A;  1YLJ A;  1FOF A;  2RCX A;  4YOF A;  1XPB A;  1YLY A;  2ZMF A;  1KE4 A;  4OOM A;  3T4Q A;  2ZC4 B;  2Y2H A;  3PHY A;  3A0R A;  3QNB A;  3UE6 A;  3DWK A;  3LR0 A;  2FH5 A;  3ZNY A;  3FPV A;  3CG5 A;  4LRZ E;  3EWK A;  1W63 M;  2JE5 A;  2PHY A;  4Y0O A;  2IA2 A;  4S2P A;  3IF6 C;  1H0M A;  5HL6 A;  2QWS A;  3T1X A;  1LL8 A;  2B95 A;  3G30 A;  4IBX A;  4B4Z A;  3HCY A;  3A3J A;  1L3L A;  2RL3 A;  3JPU A;  2BG1 A;  5EVI A;  4P6Z M;  5FEF A;  1OTD A;  5EE8 A;  5J3W A;  1KVL A;  1O7E A;  3ZDJ A;  1SDN A;  4NXE A;  3TJZ C;  4NXB A;  3G4P A;  3LEQ A;  4HBT A;  2OAQ 1;  4WMC D;  1NYY A;  1TS7 A;  3MFX A;  1K0K A;  3UPN A;  2WKQ A;  4BBU A;  1EW0 A;  3DTK A;  4PAU A;  4WEL A;  4FOF A;  3HLW A;  3LYX A;  5FAO A;  5FI7 A;  3EGX C;  4KZ7 A;  4OP5 A;  2O0Y A;  4GDB A;  1NXY A;  3NIA A;  1DJB A;  4KZ5 A;  4FSF A;  1IYO A;  3CUE C;  4Q0H A;  3VOY A;  4GDN A;  1ESI A;  4Y17 A;  1BLH A;  2VX8 A;  3BRM A;  1XJ2 A;  4GNU A;  3R7W B;  3H82 B;  4DRT A;  1HD8 A;  1S0W A;  4DDS A;  3CHW P;  3AGE A;  5DFY A;  1A0K A;  1TEM A;  4HQA A;  2EX2 A;  3M6B A;  3RJU A;  4OQH A;  3CIT A;  4UA7 A;  3HVF A;  4DMZ A;  3D3O A;  5E2H A;  2DNS A;  2OV5 A;  2BTF P;  1P9R A;  1DP6 A;  4QWO A;  1K57 A;  5DTS A;  1NZO A;  5E43 A;  2JKT M;  4OPZ A;  3G32 A;  1M40 A;  2KLI A;  3VSK A;  4RX2 A;  1ERQ A;  1HVB A;  2XGN A;  1F2K A;  3W2Z A;  2Y59 A;  4OPR A;  5TFQ A;  3C7V A;  4H6J A;  5HPI A;  1JVJ A;  4ZAM A;  2ZLY A;  4PM6 A;  5IHV A;  1KE0 A;  2Y2L A;  4WZ4 A;  3GVB A;  1S1Z A;  1BYW A;  3LEZ A;  4JF4 A;  1G6O A;  1VET A;  3OZH A;  5TBM B;  4E3M A;  5E2E A;  2PU4 A;  3P01 A;  4FTX A;  2QPN A;  2WGW B;  2Y4A A;  1VQQ A;  3KX0 X;  4IVK A;  4BQM A;  3PXP A;  1H8M A;  1ODV A;  5CTN A;  4OLG A;  2GJ3 A;  1T1B A;  3PBN A;  1N9L A;  2W1R A;  3MBZ A;  1SZV A;  5A91 A;  2OAP 1;  4C6Y A;  3WWX A;  1JWP A;  2J9P A;  3N7W A;  3LO7 A;  1ZC2 A;  2J3T C;  1NYM A;  4HH3 A;  3OCN A;  5HD5 A;  3U2A A;  4N1X A;  4RQ9 A;  5F5Y A;  4HIA A;  3NHQ A;  4LV3 A;  2XA7 M;  5M1A A;  2WUQ A;  2ZQC A;  2G7U A;  3KSH A;  3HLG A;  3BEB A;  3IS2 A;  3UNW A;  1K4E A;  4EUZ A;  2Y2I A;  3SH9 A;  3MZD A;  2IWC A;  2PAV P;  3T4T A;  2PR5 A;  4IUH A;  3UPO A;  4KQD A;  2V2F F;  2XF3 A;  5FQJ A;  4WEK A;  2X71 A;  3UME A;  1K55 C;  3EEA A;  3FV7 A;  5FAQ A;  2O99 A;  3LCE A;  5HAI A;  2H10 A;  4Y7P A;  3PBQ A;  5EEC A;  5A8B A;  2XD1 A;  3E4O A;  4EU0 A;  3V50 A;  3BWL A;  3HLB A;  2Y2M A;  4BD1 A;  4KZ4 A;  3QP4 A;  3HJI A;  3T4S A;  1Z09 A;  3WS0 A;  1NWZ A;  4HP9 A;  3WRT A;  4E3N A;  1VEU B;  1XGJ A;  3ISG A;  2R9W A;  4EEU A;  1P0Z A;  2XLN A;  3BY9 A;  3ZG0 A;  1JWV A;  4X56 A;  3ZG9 B;  5DF9 A;  3IWQ A;  3R4K A;  1P97 A;  1T19 A;  5F82 A;  2HDU A;  4CLC A;  1I2W A;  3O3V A;  3S4X A;  1E4D A;  3EGD C;  3GEC A;  2XFS A;  5CGX A;  1ONG A;  2KOI A;  5IT5 A;  4KZB A;  1G5U A;  1L0F A;  3G34 A;  1YMX A;  3KSG A;  4RYE A;  2M7U A;  1FCN A;  2HV1 A;  4OPY A;  3SS3 A;  3QP2 A;  2VJW A;  1YM1 A;  3E2K A;  4LCM A;  2PDR A;  2XK1 A;  1MWT A;  3GSG A;  2Y2G A;  3F1N A;  1OJ5 A;  2W3H A;  1IYP A;  2QZ6 A;  2VA0 A;  4OVD A;  4HHD A;  5EVI B;  4S2K A;  1OPX A;  3DTM A;  3VOZ A;  3N4I A;  3PBO A;  4JGO A;  4OLD A;  5LBR A;  3TOI A;  3LI9 A;  2XSS A;  2WKH A;  5I5L A;  1TS8 A;  4H8R A;  3V67 A;  2B5R A;  4R4S A;  3BQ8 A;  4D60 A;  3Q7Z A;  1N9B A;  3TE8 A;  3VP4 A;  5DKK A;  4MN5 A;  4QJG A;  4N9K A;  3T4K A;  2I72 A;  2ZM0 A;  5DJT A;  1XGI A;  3QP5 A;  2XH9 A;  1GSX A;  4PMA A;  2Y2Q A;  1TVF A;  5DTT A;  1G6A A;  5FDH A;  2JC7 A;  2EWV A;  3SH8 A;  2P7J A;  2E8I A;  1D1J A;  1KE3 A;  2W0N A;  2PRF A;  3VP3 A;  4WN5 A;  1STZ A;  4FUW A;  2GZA A;  4OKP A;  4Y0T A;  1O07 A;  1OTB A;  4R3B A;  5FQK A;  3JVU A;  5HD3 A;  2IWB A;  3C7U A;  3LID A;  4R70 A;  3IWO A;  4XUZ A;  3LR3 A;  4ETZ A;  4KUK A;  3LIA A;  2PT7 A;  5EOE A;  5EV0 A;  1OJG A;  4UAA A;  1GHP A;  3ZYT A;  2Y8H A;  1CK3 A;  1LSX A;  4JGP A;  4P0M A;  4BD0 A;  4H6J B;  5AQA A;  4O8G A;  4HH2 A;  4XT2 A;  4HBU A;  1XFN A;  1S67 L;  3MQ0 A;  3OPH A;  2PU2 A;  3BW6 A;  3IF5 A;  3NDG A;  5DFX A;  3BJN A;  5EPH A;  2ZBB A;  3GRJ A;  1VET B;  2L1M A;  4I3J A;  1OME A;  5K5B A;  2Y55 A;  2AVX A;  4P6Z S;  2VEA A;  1AXB A;  2VLG A;  3L9K A;  4CLC D;  3E4Q A;  1DP9 A;  2WZX A;  1KDS A;  4DXC A;  3O86 A;  4R3J A;  2LB5 A;  2W1T A;  3NOT C;  1N9N A;  4JLF A;  4LV0 A;  2J3W A;  1K38 A;  3VFH A;  2WGV A;  3MXQ A;  1SKF A;  3G2Z A;  3BEC A;  3N8R A;  3S1Y A;  3B42 A;  5GLB A;  2ZQA A;  5TJJ A;  4R1G A;  3PYP A;  4O7D A;  3E0Y A;  4R6L A;  2XEP A;  2D02 A;  1P9W A;  1M6K A;  4Q0J A;  4NG2 A;  5AJG A;  4PM8 A;  4IUK A;  2YKH A;  3TRC A;  4II7 A;  5I94 A;  1OT9 A;  3IQA A;  4HEF A;  3ZCZ A;  3IS2 B;  1K56 D;  2ZL1 A;  4ZJ1 A;  2WKR A; 
#chains in the Genus database with same CATH homology
 5DTS A;  1I5Q A;  3FYZ A;  4S2I A;  1E3U D;  1WE4 A;  1NZO A;  5E43 A;  4OON A;  3O88 A;  4OPZ A;  4DE2 A;  3HUM A;  1BLP A;  2EFX A;  4L0L A;  4E3I A;  5EVL A;  5FAP A;  1L2S A;  3G32 A;  4P85 A;  5M18 A;  1M40 A;  5EUA A;  3VSK A;  1NZU A;  1XX2 A;  4RX2 A;  4UA6 A;  1ERQ A;  1HVB A;  2XGN A;  2C6W B;  4IED A;  3UE0 A;  5M19 A;  4B4X A;  3IXH A;  2Z2L B;  3HUO A;  2Y59 A;  3PAG A;  5HX9 A;  4OPR A;  3AGD A;  5TFQ A;  5FQQ A;  5L2F A;  3NI9 A;  1RGZ A;  3ZGA B;  3C7V A;  4OH0 A;  5A90 A;  1JVJ A;  4KZA A;  2XR0 A;  2ZC6 B;  4KZ6 A;  4ZAM A;  2H0T A;  3NY4 A;  3SH7 A;  5FQI A;  2ZLY A;  4PM6 A;  4WEJ A;  5IHV A;  3IF6 A;  3HLC A;  1KE0 A;  4KG5 A;  2Y2L A;  2BLS A;  2EXB A;  4S2L A;  3GVB A;  1ALQ A;  4WZ4 A;  5AQ7 A;  3MZF A;  4U3T A;  4JKT A;  2HDQ A;  1ES2 A;  3OCL A;  4IVI A;  4QU3 A;  3LEZ A;  4F94 A;  5E2G A;  5GHY A;  1FCO A;  3VFF A;  3PBS A;  5F83 A;  3N6I A;  2Y91 A;  1PW8 A;  4JF4 A;  4BEN A;  3C4P A;  2HP6 A;  4E6X A;  3OZH A;  4E3M A;  5CRF A;  1YLZ A;  2OLU A;  2PU4 A;  5E2E A;  3P98 A;  4EV4 A;  3W4O A;  2ZMA A;  4UHU A;  4RVA A;  5KMW A;  4WMC A;  3M6H A;  1CI9 A;  3WRZ A;  4JBF A;  2QPN A;  3BM6 A;  2WGW B;  3ITA A;  3W8K A;  2Y4A A;  4JXS A;  1VQQ A;  1K25 A;  1YLW A;  3FKW A;  4IVK A;  1BUE A;  5FQM A;  4OQI A;  4ZJ2 A;  3V5M A;  2Y2P A;  2ZQ8 A;  4CJN A;  5BOH A;  5CTN A;  1MY8 A;  5JYP A;  5HAR A;  3ZG7 B;  1SCW A;  3ZG5 A;  4EBN A;  5FA7 A;  4KQO A;  1ERO A;  4OLG A;  4E3J A;  4KZ3 A;  1BZA A;  2IWD A;  5DVA A;  5GHZ A;  3UE1 A;  2WKI A;  1ERM A;  3D4F A;  3PBN A;  4E6W A;  4GB7 A;  4KEN B;  2P9V A;  3HL9 A;  3M2K A;  3EQU A;  3MBZ A;  5A91 A;  2FFF B;  4C6Y A;  1TDL A;  3WWX A;  1GCE A;  1EI5 A;  1MXO A;  1JWP A;  2J9P A;  3OPR A;  3N7W A;  3CMZ A;  1JTG A;  4RX3 A;  3FZC A;  4PM7 A;  5A93 A;  4P87 A;  1ZG4 A;  2XD5 A;  4DXB A;  3MXS A;  3LO7 A;  1ZC2 A;  3Q07 A;  4B88 A;  1NYM A;  4OOY A;  3WS4 A;  3OCN A;  1K6R A;  4N1X A;  1YLP A;  3V3R A;  4GD8 A;  1L0E A;  3BFG A;  4KG6 A;  1Q2P A;  3N8S A;  1QME A;  4MLL A;  4C75 A;  4LV3 A;  2HDS A;  1W79 A;  4QHC A;  5M1A A;  1HZO A;  1LL5 A;  2WUQ A;  2ZQC A;  3JYI A;  2P74 A;  3Q7V B;  3HLG A;  1XP4 A;  2XFT A;  3BEB A;  3CJM A;  4QB8 A;  3UNW A;  1K56 A;  1NY0 A;  1K4E A;  1KGG A;  2Y2I A;  1CI8 A;  2J9O A;  5FI6 A;  4EUZ A;  1PI4 A;  2Y2N A;  3CZD A;  3SH9 A;  3MZD A;  2ZQ9 A;  2IWC A;  4KZ9 A;  3MFD A;  4N1H A;  1E3U A;  3DWZ A;  5CGS A;  1XKZ A;  1GA9 A;  2WAE A;  4MNR A;  2X02 A;  4HES A;  4X55 A;  5AQB A;  4ID4 A;  1Z6F A;  1SHV A;  2WZZ A;  3UPO A;  3UE3 A;  1N4O A;  4CPK A;  1YLT A;  5FAT A;  4WBG A;  5J8X A;  2V2F F;  3IXG A;  3QHY A;  1ES5 A;  1WYC A;  3ZVT A;  1YMS A;  3GQZ A;  3DW0 A;  3Q1F A;  2XF3 A;  4S2N C;  4WEK A;  5FQJ A;  4X53 A;  2X71 A;  1KDW A;  2DCF A;  2XQZ A;  3NBL A;  1K55 C;  3GV9 A;  5DF7 A;  4EBL A;  4DKI A;  5CHU A;  1RCJ A;  3C4O A;  4DE1 A;  3FV7 A;  4RA7 A;  1PW1 A;  3BFC A;  1CEG A;  3O87 A;  5FAQ A;  5TR7 A;  1BLS A;  1ZG6 A;  3GR2 A;  3LCE A;  5HAI A;  1L0D A;  2JCH A;  3PBT A;  3WS5 A;  1PYY A;  2H10 A;  4X69 A;  4Y7P A;  1DJA A;  3PBQ A;  4MBH A;  4GN2 A;  5EEC A;  4OQG A;  2C5W B;  2XD1 A;  4K91 A;  5HL1 A;  3V50 A;  4JPM A;  5CED A;  2A49 A;  3HLB A;  2Y2M A;  4BD1 A;  4KZ4 A;  1PWD A;  5F1F A;  1L0G A;  2Z2M B;  5F1G A;  3HRE A;  5CER A;  2WGW A;  3WS0 A;  3ITB A;  4YFM A;  3ZVW A;  1LI0 A;  5HFO A;  3V39 A;  5GLD A;  2UWX A;  2X01 A;  3WRT A;  2A3U A;  3A3F A;  4JXV A;  4PM5 A;  2WAD A;  1VM1 A;  4E3N A;  5CTM A;  3B3X A;  2DRW A;  1NJ4 A;  1PIO A;  1XGJ A;  2EX6 A;  4FCF A;  4OQ0 A;  3ISG A;  2R9W A;  4X6T A;  4DDY A;  5AQ9 A;  3LY4 A;  3VMA A;  4JF6 A;  2WKE A;  2Q9M A;  2HP9 A;  1IEL A;  2XLN A;  4QY5 A;  1JTD A;  3C5A A;  3ZG0 A;  4IBR A;  2CC1 A;  3EQV A;  5HAP A;  1FQG A;  1JWV A;  3I7J A;  4X56 A;  1MKI A;  3ZG9 B;  2ZQ7 A;  5DF9 A;  4A5R A;  4LV1 A;  1W8Y A;  3IWQ A;  5D3O A;  3OPL A;  4WZ5 C;  4MEZ A;  3FWL A;  5F82 A;  3G35 A;  4EQI A;  2HDU A;  1I2W A;  2R9X A;  4FH4 A;  1IYQ A;  4R0Q A;  3O3V A;  4WYY A;  3S4X A;  1E4D A;  3UN7 A;  1MBL A;  1G68 A;  3VSL A;  1Y54 A;  2XFS A;  5CGX A;  4WM9 A;  1ONG A;  3NDE A;  4XUX A;  4QY6 A;  3IXD A;  2ZQD A;  4PPR A;  5GLA A;  1PWC A;  4KZB A;  1MPL A;  2FFY A;  3NCK A;  1L0F A;  3G34 A;  1YMX A;  3BYD A;  3UPP A;  3LY3 A;  4RYE A;  1ZKJ A;  4E3O A;  3MKF A;  1QMF A;  3UDX A;  4BJP A;  1ONH A;  3Q7V A;  1FCN A;  4OPY A;  2ZJ9 A;  5EOO A;  5EVI C;  3SS3 A;  4PM9 A;  1WYB A;  1JWZ A;  1K4F A;  3BFF A;  3ZFZ A;  3SOI A;  1YM1 A;  3E2K A;  4LCM A;  4MBK A;  2Y2O A;  1GHM A;  5U47 A;  2VGK A;  2XK1 A;  5DF8 A;  1MWT A;  3GSG A;  4K0W A;  1FSW A;  5CXW A;  1XXM A;  2Y2G A;  3IT9 A;  4LEN A;  1MWU A;  5TGF A;  4NET A;  4E3L A;  4DF6 A;  1IYP A;  2HDR A;  2QZ6 A;  4KG2 A;  4S2J A;  1FR1 A;  4OVD A;  3S22 A;  2WAF A;  5EVI D;  5EVI B;  4S2K A;  3HLF A;  3A3E A;  3RXW A;  4DE0 A;  2H5S A;  3DTM A;  1NRF A;  1LLB A;  1PZP A;  3W4Q A;  3P09 A;  1H5X A;  4S2O A;  3UDI A;  3VOZ A;  3N4I A;  5KZH A;  4Z9Q A;  3IH9 A;  3BLS A;  3UO9 A;  1MWS A;  5HW3 A;  3PBO A;  2ZM8 A;  4OLD A;  3N8L A;  1KGF A;  3OC2 A;  3TOI A;  4D2O A;  3HUN A;  3PBR A;  3IXB A;  2WKH A;  5KSH A;  4KZ8 A;  3IH8 A;  4S2N A;  4R4R A;  4H8R A;  2ZC5 B;  3G31 A;  1LL9 A;  1Q2Q A;  1J9M A;  2HPB A;  3MKE A;  3PAE A;  4K0X A;  1CEF A;  4P6B A;  4BL3 A;  2B5R A;  1K55 A;  4R4S A;  5CEC A;  5HAQ A;  3Q81 A;  3SS5 A;  3ZG8 B;  3Q7Z A;  1N9B A;  1LHY A;  3TSG A;  3VP4 A;  1IYS A;  4QJG A;  1BUL A;  2JBF A;  5FAS A;  1BLC A;  1ES3 A;  4EBP A;  4GD6 A;  5A92 A;  4N9K A;  3UDF A;  1PWG A;  3OPP A;  2I72 A;  2ZM0 A;  3HLE A;  2EX9 A;  1EWZ A;  4KQQ A;  1XGI A;  2QMI A;  3M2J A;  4M3K A;  1KGE A;  1W7F A;  2XH9 A;  5CGW A;  4UA9 A;  3WS1 A;  1DY6 A;  4PMA A;  2Y2Q A;  4FD8 A;  4LV2 A;  3VP0 A;  5CHM A;  5FI2 A;  1TVF A;  5DTT A;  3NC8 A;  1YLJ A;  1C3B A;  2V1Z A;  1FOF A;  1G6A A;  2GDN A;  2RCX A;  1K57 C;  5FDH A;  2JC7 A;  5GHX A;  1XPB A;  1YLY A;  5FSR A;  3SH8 A;  3ZNT A;  1KE4 A;  3MXR A;  4OOM A;  3SS4 A;  1HTZ A;  2ZC4 B;  2E8I A;  2WK0 A;  4U0X A;  4U0T A;  2Y2H A;  3Q82 A;  4R23 A;  1KE3 A;  3VP3 A;  3IWI A;  2WYX A;  1K6S A;  3QNB A;  4Y0U A;  1BT5 A;  3WS2 A;  3BFD A;  3DWK A;  3ZNY A;  4OKP A;  4Y0T A;  3GTC A;  1O07 A;  1RP5 A;  1E25 A;  4R3B A;  4Q8I A;  3CG5 A;  5FQK A;  4E3K A;  4OPQ A;  4WZ5 A;  2IWB A;  3C7U A;  4BQM A;  2JE5 A;  1IKG A;  2ZM2 A;  1K54 A;  4Y0O A;  1SDE A;  5GL9 A;  3IWO A;  4S2P A;  3IF6 C;  4GOG A;  1K54 C;  3E2L A;  4LCL A;  3W4P A;  4BLM A;  2EXA A;  2ZC3 B;  4XUZ A;  3BLM A;  4XXR A;  1YQS A;  4GKU A;  5DTK A;  5EOE A;  4JXW A;  3G30 A;  3GMW A;  4ZDX A;  4IBX A;  2EFU A;  3AGF A;  4UAA A;  1W5D A;  1GHP A;  1H8Y A;  1TDG A;  4B4Z A;  4ZBE A;  1CK3 A;  4P0M A;  3A3J A;  4X68 A;  2RL3 A;  4BD0 A;  5AQA A;  2BG1 A;  5FQ9 A;  1YT4 A;  5CEB A;  2VGJ A;  4NK3 A;  5EVI A;  3IHA A;  1ESU A;  2OSU A;  4ZJ3 A;  4FH2 A;  4HBU A;  4ZTK A;  4OP8 A;  1BSG A;  3IF6 B;  5EE8 A;  1KVL A;  3OPH A;  1H8Z A;  1O7E A;  3ZDJ A;  2PU2 A;  5CHJ A;  4C3Q A;  3HLD A;  4EWF A;  2PBY A;  2Y2K A;  3IF5 A;  2HP5 A;  1SDN A;  3NDG A;  4JF5 A;  2OLV A;  3G2Y A;  4KQR A;  4DE3 A;  2EX8 A;  4YIN A;  2Q9N A;  5EPH A;  3G4P A;  1S6R A;  4OOL A;  3IHB A;  3GRJ A;  3FKV A;  1W8Q A;  1DJC A;  1GA0 A;  1IEM A;  2H0Y A;  4HBT A;  1OME A;  2WGI A;  3ZHH A;  4N92 A;  4WMC D;  2Y55 A;  1NYY A;  2ZC7 A;  1PI5 A;  3UPN A;  1ES4 A;  1AXB A;  2G2U A;  2ZD8 A;  4S2M A;  4GZB A;  2WZX A;  4JXG A;  4WEL A;  1KDS A;  3HLW A;  3RXX A;  5FAO A;  3VP1 A;  3O86 A;  5FI7 A;  4DXC A;  4R3J A;  1MWR A;  1I2S A;  4KZ7 A;  4OP5 A;  1FR6 A;  3HBR A;  1XA1 A;  2V20 A;  1NXY A;  3NIA A;  3PTE A;  1DJB A;  4GDB A;  4JLF A;  4KZ5 A;  4LV0 A;  5JYO A;  4FSF A;  3MZE A;  1PZO A;  1K38 A;  1IYO A;  1KVM A;  3VFH A;  2P9V B;  2WGV A;  3VOY A;  4GDN A;  1ESI A;  1SKF A;  1BLH A;  5GLC A;  3G2Z A;  1IKI A;  3BEC A;  3N8R A;  3S1Y A;  3A3I A;  3V3S A;  1XA7 A;  3A3D A;  3BRM A;  5GLB A;  2ZQA A;  5KSC A;  4R1G A;  4GNU A;  4DRT A;  1HD8 A;  1S0W A;  4O7D A;  1U60 A;  1GHI A;  2XDM A;  2G2W A;  2Y2J A;  1RGY A;  4DDS A;  3AGE A;  2XEP A;  3VP2 A;  3BFE A;  4MBF A;  1TEM A;  1M6K A;  2EX2 A;  3M6B A;  2J8Y A;  4QD4 A;  3RJU A;  4OQH A;  3UY6 A;  3TG9 A;  4UA7 A;  1BTL A;  4PM8 A;  4BL2 A;  2J7V A;  1FCM A;  3HVF A;  5G18 A;  1LI9 A;  5I94 A;  5E2H A;  3IQA A;  2DNS A;  3QNC A;  4HEF A;  5E2F A;  2OV5 A;  3ZCZ A;  1K56 D;  4ZJ1 A;  4N9L A;  1K57 A;  1FSY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...