3WRTA

Wild type beta-lactamase derived from chromohalobacter sp.560
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
357
structure length
357
Chain Sequence
QTREVLDPIVASLMEAQQIPGMAIALVRPEGTTISHYGAADRETGTPVDDDTLFEIGSLSKTLTATLASLAEVEGKLDFDAPVSRYLPELEGSAFDDISGLNLGTHTGGGLPLFVPDEVTDRASLMAWYREWQPTEPIGESRTYSNLGIGLLGLETAASLDGEFVPTMRAKVLAPLGMQDTWYDVPEARMADYAMGEDKDGQPTRVSPGVLDDEAYGIKTTAADLAKLVRANLHLADVDAELQQAIDATRQGHYRVGDMTQALIWEQYSLPVAPETLRAGNGYDMILEPNAAEALEPPQSPRDDVWVNKTGSTNGFGGYIVMLPGKHTGLVMLANKNYPNDARVEAAYRILSGLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a highly acidic beta-lactamase from the moderate halophile Chromohalobacter sp. 560 and the discovery of a Cs(+)-selective binding site
pubmed doi rcsb
source organism Chromohalobacter sp. 560
molecule tags Hydrolase
molecule keywords Beta-lactamase
total genus 113
structure length 357
sequence length 357
chains with identical sequence B, C
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2014-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3wrtA00
2EX8A 1EI5A 2PU2A 2XK1A 4A5RA 4GN2A 4HBUA 5FA7A 4BL3A 2I72A 4LCMA 1K56A 3GQZA 3PBSA 4GKUA 1ESUA 1QMFA 2G2WA 2X01A 4IVIA 1JVJA 4HBTA 2IWDA 3Q7ZA 2ZC4B 2HP9A 5FQJA 3EQVA 1BLCA 2Z2LB 3IXDA 3N4IA 5AQ9A 5EVIC 4S2LA 3IH9A 3SH9A 3ZG5A 4P0MA 1S6RA 3V5MA 2WGWB 5GHZA 1J9MA 1O07A 4OQIA 4PMAA 2E8IA 3TSGA 2QMIA 4KQRA 1YQSA 1BT5A 2WK0A 3VSLA 3GTCA 5HL1A 2ZLYA 3VFFA 4LENA 5E43A 1VM1A 4OQ0A 4DE1A 3A3FA 4RX3A 5DF7A 3UDIA 3AGEA 3IHBA 3QNBA 1KVLA 4KENB 2EFXA 1RGZA 1FCOA 1RP5A 2WZXA 1K54A 4X53A 1I5QA 3OPLA 1LL9A 2Y59A 4OOLA 4DRTA 2Y2NA 3SH7A 2XH9A 3UDFA 4DDYA 4GZBA 4S2OA 1DJAA 4OQGA 4L0LA 1JWZA 4K0XA 3C5AA 4HEFA 2XEPA 1FR6A 5GHXA 3HL9A 5F1GA 3HLFA 4RYEA 3OZHA 3M2KA 4IVKA 4ZJ1A 5D3OA 1PWGA 2C5WB 1PI4A 2XR0A 3TOIA 4RA7A 3CG5A 2ZMAA 5HARA 3HLCA 3Q82A 5DTTA 1TDLA 1IEMA 2WKHA 3W4OA 4OPRA 4D2OA 1CK3A 4RX2A 4JBFA 1K4FA 3DTMA 4OOYA 3NBLA 4JF6A 3BFDA 4JF5A 5GLDA 3UN7A 3IWQA 4KZ3A 1MPLA 3ZG8B 1JWPA 2HDSA 3HLGA 3WS1A 3HVFA 5DF9A 5KZHA 2Z2MB 4C75A 4DE2A 3ZVWA 1JTDA 4FCFA 1NYMA 1W8QA 5U47A 4GD8A 2Y2OA 3MZDA 1ZG6A 2BLSA 4K91A 5CGSA 5CTNA 2V1ZA 2ZQ9A 3RJUA 1Y54A 3BFEA 3IF6A 4IBXA 3O86A 4ID4A 4N9KA 5FI7A 4MBFA 2A3UA 1TDGA 2WGIA 2Y2LA 5CRFA 1ALQA 1KGFA 3Q7VA 3N8SA 1EROA 4IBRA 4Z9QA 2ZQDA 4RVAA 4OPYA 2XGNA 3ZNYA 2DRWA 4KQOA 4H8RA 4KG2A 1KE4A 3GMWA 1PYYA 5CEBA 3IXBA 1SCWA 3HLEA 3GR2A 1MWRA 1ES2A 1K6RA 4PPRA 4FH4A 3MZEA 5EVLA 3GV9A 3G2ZA 5CHJA 2ZM2A 3UO9A 5GLCA 4U0XA 1Q2QA 4Y0UA 1IKGA 5E2EA 5F83A 5AQAA 4WYYA 2ZD8A 4IEDA 2H0TA 1K57A 4DKIA 4N92A 4JF4A 3HREA 2ZC5B 1GA9A 4JKTA 3MXRA 4QU3A 5FQMA 1M6KA 4NETA 4GNUA 4F94A 5KSCA 1DJCA 4P87A 2OLVA 4DF6A 4OQHA 4OPZA 3M6HA 4M3KA 5M18A 5HX9A 3BYDA 2C6WB 1NY0A 3PBRA 4KZ4A 1WYCA 4N1HA 5FSRA 4HESA 4B88A 3G35A 2Y91A 4PM6A 3N8LA 3UPNA 1KDSA 1W5DA 3V39A 1K25A 1G68A 4X56A 1BLSA 2R9XA 3PTEA 2VGKA 4Y0OA 2V2FF 1ERMA 2Q9NA 3LY4A 1E4DA 2OLUA 3ZFZA 1EWZA 4WZ4A 3MXSA 4YFMA 3WS0A 1O7EA 3G2YA 3QNCA 5EVIB 3ZG7B 4QB8A 3LCEA 5L2FA 4Q8IA 3BECA 3MKEA 2Y4AA 3MFDA 5FDHA 1BULA 4QY5A 5DTKA 3UE3A 4DE0A 4ZTKA 3VP4A 3M6BA 3RXXA 3UPOA 3GRJA 4FSFA 2X02A 3DWZA 4XUZA 4XUXA 5CHMA 5GL9A 5FAPA 3WS5A 1ES4A 1L0EA 1GA0A 3GVBA 5GLAA 5A92A 4B4XA 2HDRA 1FSYA 3M2JA 2ZM8A 2UWXA 1MWTA 5CGXA 3SS3A 1ZKJA 1FSWA 1MWSA 1S0WA 5HAPA 1NYYA 1Q2PA 2ZC7A 3HUMA 3IH8A 3TG9A 1XA1A 4OOMA 1HTZA 5HAQA 4KZ5A 3S4XA 3CZDA 1FCNA 3LO7A 2H0YA 4MBHA 3VSKA 3PAEA 1XKZA 1IELA 3WWXA 1GCEA 1CI9A 1KE3A 1PWCA 3HUOA 4E3MA 1YMSA 1PW1A 1H8YA 1ESIA 1K54C 5A90A 3Q07A 2CC1A 1XXMA 5E2GA 3MBZA 3G30A 3MZFA 1BLPA 3NDGA 4X6TA 5CXWA 5HAIA 5M1AA 1Z6FA 1AXBA 1TVFA 1KGEA 3BFGA 1K55A 1LHYA 4WZ5A 4E3OA 4OLGA 1N4OA 5HFOA 4E6XA 4LV0A 1WYBA 4OLDA 1WE4A 1BZAA 1ES5A 1SHVA 3PBNA 3GSGA 4WBGA 3W4PA 2JC7A 3OC2A 4S2KA 4DXBA 1K57C 1K56D 1W8YA 3NC8A 4R3JA 4Y0TA 1SKFA 3IF6C 4KQQA 2B5RA 2XQZA 3IXGA 3MKFA 5JYOA 5M19A 1XP4A 4R0QA 3NDEA 1K38A 3VP3A 4BL2A 1XPBA 2XF3A 4WM9A 4P85A 3ZHHA 1XX2A 1IYSA 4S2NA 1LL5A 3G4PA 3OCNA 1PZPA 1YLZA 3IT9A 4UAAA 4ZDXA 1E3UA 3ITAA 4C3QA 3G31A 4K0WA 5EPHA 1YM1A 3BLMA 4LV2A 2V20A 3ZDJA 1GHPA 2R9WA 5FQQA 1MBLA 2ZM0A 5F82A 1L0FA 2JCHA 4QJGA 5CERA 5TR7A 1XA7A 4LV3A 5FI6A 2H10A 1BUEA 4UA7A 1ES3A 3ISGA 3UE0A 2WUQA 4Y7PA 2EX2A 5DTSA 5TFQA 4ZBEA 2FFYA 4P6BA 1U60A 2WAEA 4EV4A 1FOFA 1H8ZA 4FD8A 3UDXA 1C3BA 1NZUA 2XD5A 3JYIA 5AQ7A 2RL3A 1ERQA 4YINA 3S22A 1FQGA 3Q81A 2OV5A 5IHVA 2IWBA 3O87A 4DE3A 1YMXA 1KGGA 3VP0A 1SDEA 3IXHA 3N8RA 5CGWA 1G6AA 3IF5A 1HVBA 2JBFA 3C7VA 3O88A 2J7VA 2EFUA 5F1FA 1L2SA 4ZJ3A 3ZVTA 1I2WA 1IKIA 4E3IA 1PIOA 1MWUA 3NY4A 4KZ6A 4OONA 1QMEA 5EOOA 1L0GA 4B4ZA 4QY6A 2EXAA 1KDWA 2Y2PA 1IYQA 3DWKA 4GDNA 3LEZA 3FZCA 3OPRA 1XGIA 4S2IA 2XFSA 4UHUA 4OVDA 5FAOA 5CEDA 4FH2A 2P9VA 2WGVA 2Y2HA 3Q1FA 5FATA 2Q9MA 3A3DA 5I94A 2Y2IA 1BSGA 1BTLA 4JXSA 3N6IA 1TEMA 3IQAA 4DDSA 4KG6A 1W7FA 3NI9A 2FFFB 4KZBA 4E3JA 4QD4A 1K55C 2WKEA 1LI0A 1ZC2A 3NCKA 2ZQAA 3HLDA 4WMCA 3SOIA 5FQIA 3SS4A 4BD0A 1FCMA 3UPPA 4E3LA 4PM5A 4U3TA 4WEJA 4EBLA 1KVMA 1E3UD 2WAFA 1ONHA 2P9VB 3FWLA 4EBPA 1NXYA 1HZOA 2GDNA 3PAGA 4S2MA 5EVIA 2HP6A 3LY3A 4KZ9A 5KSHA 3OCLA 1LLBA 4OPQA 2ZC3B 5GHYA 2G2UA 3E2KA 3IWIA 5HW3A 2IWCA 1VQQA 3BEBA 3G34A 3BRMA 3SH8A 3FYZA 2J9OA 4JXWA 2Y2QA 4LCLA 4PM9A 3VMAA 2EX9A 2J8YA 1NRFA 4JXGA 3FKVA 3N7WA 5JYPA 1W79A 4KZ7A 4S2NC 4E3KA 2QZ6A 4KZAA 1BLHA 2JE5A 1KE0A 3C4OA 3O3VA 2VGJA 1IYOA 5EECA 2XLNA 4BLMA 4CPKA 4DXCA 3W4QA 5G18A 1HD8A 5A93A 2DCFA 1ZG4A 3VP2A 3P09A 4UA9A 2ZQ8A 3OPPA 4OH0A 4OP5A 5GLBA 1CEGA 1L0DA 2Y2MA 4X55A 3FKWA 5KMWA 3OPHA 4KG5A 3RXWA 1YT4A 4MNRA 4U0TA 4WZ5C 2OSUA 5E2HA 3QHYA 3VFHA 3HLWA 5TGFA 1JWVA 5DVAA 4JXVA 1CI8A 2WGWA 3G32A 3ZCZA 1MY8A 2ZJ9A 2EXBA 1OMEA 3EQUA 2ZQ7A 3IHAA 4JPMA 4PM7A 4QHCA 1PW8A 3BLSA 4BQMA 4GOGA 4N9LA 3E2LA 4BJPA 5CECA 3Q7VB 5E2FA 2H5SA 3BFCA 4GDBA 3B3XA 5A91A 3BFFA 3W8KA 4XXRA 1RGYA 3IF6B 2RCXA 3ZG0A 3V50A 2ZQCA 4R1GA 2HDUA 3ITBA 3PBQA 4GD6A 4WMCD 5CHUA 3V3RA 3ZGAB 1YLWA 3I7JA 4EQIA 4EWFA 5FAQA 2A49A 3PBTA 2HDQA 2P74A 1LI9A 1N9BA 4OKPA 3DW0A 1I2SA 4X69A 3C4PA 4R3BA 2QPNA 1YLPA 4MEZA 2WADA 4R23A 4JLFA 5BOHA 1NJ4A 2XDMA 5EVID 1YLJA 4WEKA 2Y2JA 5FASA 3ZNTA 1PWDA 2XD1A 3FV7A 4S2JA 3V3SA 5FI2A 4ZJ2A 5CTMA 3S1YA 5EOEA 4CJNA 2WYXA 1YLYA 1NZOA 3HLBA 3HUNA 5FQ9A 2EX6A 4WELA 1SDNA 1CEFA 4X68A 2HP5A 1FR1A 3CMZA 1K6SA 1MKIA 3D4FA 3BM6A 4BENA 1GHIA 4OP8A 3A3IA 5J8XA 4EBNA 2XFTA 4ZAMA 3A3EA 4GB7A 4BD1A 1MXOA 3IWOA 3WS2A 3P98A 3PBOA 3UNWA 3VP1A 4NK3A 1IYPA 1XGJA 1DJBA 1GHMA 1YLTA 4N1XA 3UY6A 4UA6A 3HBRA 3VOZA 1JTGA 2Y2KA 3CJMA 3AGDA 4EUZA 1PZOA 3WRTA 5AQBA 2J9PA 4KZ8A 1DY6A 2BG1A 4E3NA 3ZG9B 1K4EA 2Y55A 4LV1A 4PM8A 2X71A 5EUAA 3UE1A 4R4SA 4C6YA 3C7UA 2PBYA 1PI5A 5DF8A 2Y2GA 4E6WA 2DNSA 5FQKA 2WKIA 1RCJA 4O7DA 3A3JA 4S2PA 5EE8A 4R4RA 1H5XA 3SS5A 3AGFA 2HPBA 1M40A 1ONGA 2WZZA 3WRZA 4MLLA 2ZC6B 2PU4A 3VOYA 4MBKA 1E25A 3WS4A 3NIAA
chains in the Genus database with same CATH superfamily
4HH2A 5I5LA 4GN2A 2QYBA 5CX7A 4LPZA 2ZBBA 3JPUA 2B95A 3PBSA 2IWDA 3Q7ZA 2ZC4B 2HP9A 3C38A 4S2LA 3SH9A 3ZG5A 1HLUP 1J9MA 1DP8A 2QMIA 3OLOA 2WK0A 3GTCA 2PYRA 4WUJA 2CMNA 3UDIA 3IBJA 4KENB 1RGZA 2WZXA 4X53A 4Q0HA 1GSWA 3R4KA 3SH7A 3UDFA 2O9CA 1A0KA 1EW0A 4L0LA 4K0XA 3C5AA 4I5SA 4R70A 2HZ5A 2XEPA 4HY8A 5F1GA 2K31A 3CPTA 5D3OA 1VETB 1UGUA 4OPRA 2W3DA 3DTMA 4NXGA 4KZ3A 3ZG8B 2HDSA 5FEGA 5KZHA 3BW6A 1SKOB 2FH5A 3ZVWA 4FCFA 1W8QA 4GD8A 3MZDA 1ZG6A 5CTNA 2KOIA 1Y54A 3UMDA 4N9KA 3DTEA 3O86A 5HDCA 1TDGA 5CRFA 1ALQA 3N8SA 4NXFA 2WKQA 2KDKA 2OAP1 1KE4A 4ARZB 2BASA 5CEBA 1SCWA 3HLEA 2KLIA 3NOPC 3GR2A 1ES2A 1K6RA 2HGVA 4B9OA 5F5YA 3GV9A 3P01A 5EM1A 5J3WA 1P9WA 5GLCA 5G4YA 1IKGA 5E2EA 2R78A 5F83A 5AQAA 4WYYA 2ZD8A 4IEDA 4N92A 1OJGA 3HREA 2ZC5B 4I38A 1M6KA 4F94A 1DJCA 4GS9B 2B02A 2OLVA 4OPZA 4DF6A 2Y79A 4R3AA 1NY0A 3PBRA 1P0ZA 1X0OA 1LT0A 4N1HA 4B88A 2I9VA 3UPNA 4X56A 1BLSA 2R9XA 3UB6A 4MMNA 2VGKA 4MDZA 3ZYTA 4LGWA 5HL6A 1O7EA 3G2YA 2QKPA 5L2FA 1WA9A 2J3TD 4Y5FA 5FDHA 3E4QA 4ZTKA 1D06A 3UPOA 3DWZA 4XUZA 5CHMA 5FAPA 3CPTB 4ESPA 3LFVA 3W2ZA 4LLOB 4P6ZM 2UWXA 2VGLS 4MN6A 4UQIS 4AFIA 1FCNA 2H0YA 3WWXA 3LIDA 3S7PA 1VHMA 5F69A 1PW1A 1P97A 3JVUA 3A0VA 5E2GA 5HAIA 2BTFP 1BLPA 3MZFA 1Z6FA 1OTDA 4WZ5A 4NEED 5HFOA 4E6XA 4LV0A 1WE4A 2QHKA 4PKYA 4ZRRA 3PBNA 3W4PA 3NC8A 4Y0TA 1SKFA 3B47A 2A2LA 2L1MA 3VP3A 4WM9A 1XX2A 1IYSA 3OCNA 4KUOA 3IX4A 3IT9A 4UAAA 4ZDXA 1E3UA 3G31A 3EOIA 1GHPA 4Q0JA 1MBLA 4QJGA 1S4SA 2H10A 1ES3A 3ISGA 3LIAA 2FFYA 1U60A 2WAEA 4BBTA 1NZUA 4LRXC 3CUEC 3S22A 5IHVA 1KGGA 4R6LA 3EEHA 3VP0A 1G6AA 3IF5A 3T4SA 4LRZE 5F1FA 3ZVTA 2W3FA 4YOFA 5EOOA 1NRJA 4QY6A 3T1RA 1KDWA 2Y2PA 3CAXA 3DWKA 4S2IA 2XFSA 5CEDA 3Q1FA 1CQAA 4JXSA 2LB9A 3N6IA 1TEMA 4KG6A 5L09A 2B18A 3NCKA 2Q0OA 3HJKA 4WMCA 1P9RA 3UPPA 4BMWA 1OT9A 4U3TA 4EBLA 2OWHA 3FWLA 3LEQA 1NXYA 2GDNA 2XROA 1IFQA 1JNUA 1LLBA 1S1YA 4EXOA 3CWFA 2J9OA 1W79A 3FPWA 5HWWA 4S2NC 2P08A 4E3KA 1KE0A 2Z6DA 3C4OA 2XLNA 5DJUA 3W4QA 3T4QA 2J80A 3OPPA 4XT2B 3MSHA 3HJIA 1TS7A 3RXWA 2O99A 4MNRA 3QHYA 3VFHA 3HLWA 5TGFA 4JXVA 4PM7A 1MY8A 3LI9A 3S7QA 3BLSA 3LR5A 3GDIA 3VE4A 4EU0A 2K2NA 1NLZA 3B3XA 5A91A 3BFFA 3IF6B 3V50A 3V3RA 1YLWA 5FAQA 1DP9A 2A49A 2P74A 3PXPA 4OKPA 3DW0A 2QPNA 1NJ4A 1D7EA 4NXEA 4ZJ2A 1YLYA 5FQ9A 2O9BA 2VA0A 1CEFA 2HP5A 1FR1A 3CMZA 1K6SA 1XJ4A 4PAUA 3D4FA 3BM6A 1YPRA 5J4EA 1NLYA 4EBNA 2XFTA 4BD1A 3A3EA 4GB7A 5AVFA 2JHEA 3IWOA 2NUTC 3F1PB 3VP1A 1IYPA 1YLTA 3HBRA 3VOZA 1PZOA 4DN0A 2YKHA 1T1AA 3ZG9B 2Y55A 4PM8A 5HWTA 3UE1A 4M4XA 4E6WA 4R4RA 2DMWA 1F2KA 2HPBA 2WZZA 4IJGA 2ZOIA 5EV0A 3VOYA 3QP6A 1E25A 2HJEA 2EX8A 2XK1A 4BL3A 1VETA 1K56A 3GQZA 4IVIA 4IUKA 3EQVA 4GHIB 2Z2LB 2W1RA 2WGWB 4E04A 4BBUA 5HPFA 1BT5A 3VFFA 4LENA 2ZL1B 1H3QA 4OQ0A 5E43A 1KVLA 1RP5A 3OPLA 2Y59A 4DRTA 2XH9A 4DDYA 4NKPA 4OQGA 1JWZA 4HEFA 5GHXA 1VB6A 3OZHA 4ZJ1A 1PI4A 1LSVA 4RA7A 5HARA 3HLCA 3W4OA 1OJ5A 4D2OA 4RX2A 4OOYA 3NBLA 5GLDA 3UN7A 1IOUA 3IWQA 1MPLA 3BQAA 1OPXA 3HVFA 4DE2A 1JTDA 3OBFA 4K91A 2BLSA 4WN5A 1OTBA 3BFEA 4IBXA 2J3WA 2WGIA 1KGFA 4LRYC 4BBVA 1EROA 4Z9QA 2ZQDA 4H8RA 2M7UA 2QJ7A 3U4LP 1MWRA 4FH4A 3MZEA 2ZM2A 2PRFA 4Y0UA 4DKIA 1K57A 3KYZA 4JF4A 4JKTA 5KSCA 5L10A 4QU3A 5FQMA 4NETA 4GNUA 3QP2A 3M6HA 3BYDA 3H82A 4GW9A 2PR6A 3CUEA 1MC0A 3G35A 4QPRA 1UWPX 1W5DA 1DRMA 2PBDP 1K25A 3GECA 5F6AA 4Y0OA 3MXSA 4YFMA 3WS0A 3C2WA 2MJ6A 3LCEA 4Q8IA 1V9YA 3MFDA 4QY5A 4FSFA 3QP8A 3GVBA 3M2JA 3F1PA 1MWTA 3KSHA 3MR0A 3NHQA 3RTYA 1NYYA 2ZC7A 3HUMA 3TG9A 2HV1A 4OOMA 3T12B 5FDSA 4JGRA 4KZ5A 2ACGA 3PAEA 1IELA 1PWCA 3HUOA 3EGDC 5AJGA 4NXBA 3LUQA 1H8YA 3FPVA 5HDSA 3DBAA 3K3CA 3MBZA 3NDGA 4CQHA 4HJ3A 3ICYA 4G3KA 1TVFA 1KGEA 3UB9A 4OLGA 1N4OA 1WYBA 1BZAA 1SHVA 3GSGA 4PHTA 1W8YA 2XQZA 3IXGA 3MKFA 5JYOA 5M19A 1K38A 2VV7A 1XPBA 3G4PA 1PZPA 1OTIA 2P7JA 5EPHA 4LV2A 2V20A 3ZDJA 2W1TB 5F82A 2E8JA 1L0FA 1N9LA 5FI6A 4O0PA 4UA7A 3UE0A 5TFQA 5DTSA 2EX2A 2QJ5A 3BQ8A 3D9YA 1H8ZA 3UDXA 4FD8A 1C3BA 3KYQA 5FEFA 3MXQA 1ERQA 4GHIA 1FQGA 2OV5A 2WKPA 2J7VA 3MF0A 1I2WA 1PIOA 4KZ6A 4B4ZA 5IT5A 1CJFA 1SZVA 2EXAA 3T1SA 1IYQA 2ZMFA 3LEZA 4UHUA 1DP6A 2WGVA 3U2AA 5J7EA 5HDDA 5IU1A 3A3DA 1BSGA 1BTLA 3NI9A 4HHDA 4E3JA 4QD4A 1ZC2A 3SZTA 2ZQAA 1GSVA 3HLDA 3SOIA 5FQIA 4BD0A 4PM5A 3CHWP 1YKDA 4WEJA 4HOIA 1J3WA 1ONHA 2P9VB 2WAFA 1HZOA 3IS2A 2GX5A 4S2MA 5EVIA 3LY3A 4KZ9A 5KSHA 3OCLA 5HW3A 2IWCA 3BEBA 3G34A 3L9KA 3SH8A 4YWZA 2Y2QA 4PM9A 2EX9A 4JXGA 3FKVA 4KZ7A 3PR6A 2M1CA 3LI8A 2QZ6A 4KZAA 4DJ3A 1IYOA 3H9WA 4GJ4A 4BLMA 3P7NA 2JKFA 4CPKA 4MCWA 1HD8A 4ARZA 3P09A 4FOFA 4I39A 1T19A 3TRCA 2Y2MA 4X55A 3KSIA 5TJJA 1JWVA 3JVVA 5DVAA 1OMEA 3IHAA 4QHCA 2P04A 3QP1A 4BQMA 1SKOA 1YSPA 4BJPA 3E98A 3A0SA 4XXRA 1RGYA 3ZG0A 2HDUA 3PBQA 4GD6A 4HP4A 3PBTA 5EVEA 2HDQA 1N9BA 3MFXA 4HP9A 3LIFA 3HCYA 2VEAA 1YLJA 2Y2JA 5FI2A 3KSFA 5CTMA 5EOEA 1NZOA 3HLBA 3T4LA 4X68A 1MKIA 2VKSA 4Q0IA 1ODVA 4BENA 4HJ6A 2ZMVA 4Y15A 4QWOA 3DTKA 4R38A 5DJTA 4MN5A 1XGJA 1DJBA 1GHMA 4UA6A 1JTGA 3AGDA 4EUZA 1Z09A 2J9PA 2BG1A 1K4EA 5EUAA 5HD5A 2X71A 4C6YA 3C7UA 2PBYA 1PI5A 5DF8A 2Y2GA 5FQKA 1RCJA 1N9OA 3AGFA 4HIAA 4CLCE 2PU4A 4H6JB 4MBKA 3WS4A 1EI5A 4A5RA 4HBUA 5FA7A 3EWKA 2A24A 2G2WA 1QMFA 2X01A 3UE6A 2D01A 1UWNX 3N4IA 4G3WA 3KYEA 1VEUB 1S6RA 3V5MA 5GHZA 4OQIA 4PMAA 2E8IA 5HL1A 1V9ZA 3VSLA 2ZLYA 1VM1A 3AGEA 3D72A 3IHBA 3S7NA 3QNBA 1K54A 3SW1A 1I5QA 1LL9A 2VV8A 4OOLA 4GZBA 1DJAA 2GNXA 1FR6A 1YSQA 3HL9A 3CITA 3KSGA 4IVKA 4X1LA 3F1NB 2ZMAA 4EW7A 5DTTA 1TDLA 3VOLA 1IEMA 2INWA 2WKHA 4JBFA 1K4FA 4JF6A 4IUHA 4JF5A 3F1NA 3LGOA 3HLGA 3IBRA 3F1OA 5KIZA 4C75A 3T4KA 1NYMA 5U47A 2V8FA 2Y2OA 2W3HA 2V1ZA 3IF6A 5FI7A 4DMZA 4MBFA 2A3UA 1H0MA 3Q7VA 5DKLA 1Y28A 4RVAA 2XGNA 1T1CA 4KQOA 4KG2A 3KO6A 1PYYA 1PNEA 4EUVA 3IX8A 2JKRI 2W3GA 1FIKA 5EVLA 5CHJA 3G2ZA 1W63M 1K0KA 2VZWA 2ZL1A 4P87A 4OQHA 4M3KA 5HX9A 2C6WB 1WYCA 5FSRA 4HESA 4Y3IA 3NOUC 4PM6A 3N8LA 1KDSA 1G68A 4HJ4A 3PTEA 2Q9NA 3LY4A 1E4DA 2EWWA 1EWZA 4WZ4A 2WKRA 3QNCA 1TS0A 3ZG7B 4QB8A 4JGOA 5DFXA 3BECA 3MKEA 2Y4AA 1OTAA 3M6BA 3RXXA 4XUXA 3CLOA 5GL9A 1ES4A 1L0EA 1GA0A 2HDRA 2ZM8A 5CGXA 4LFUA 4IHQA 3SS3A 3RFBA 1FSWA 4CLCC 1MWSA 1S0WA 1Q2PA 1ZHHB 3IH8A 3S4XA 3D3OA 3VSKA 1XKZA 1GCEA 1CI9A 3MMHA 3MQQA 1OT6A 1LL8A 5A90A 2CC1A 3G30A 5CXWA 3PYPA 3BFGA 1LHYA 3BY9A 1ES5A 4DXBA 2JC7A 3OC2A 1K56D 3IF6C 2OAQ1 1XP4A 4R0QA 4BL2A 2XF3A 3LYXA 2PAVP 4Y17A 3ZHHA 3B42A 3E4OA 3FC7A 1LSWA 4O8GA 3ITAA 4C3QA 1F5MA 4B93A 2R9WA 5FQQA 2ZM0A 2JCHA 3MQOA 4ZBEA 4P6BA 1FOFA 3G6OA 3JYIA 1OTEA 4YINA 3Q81A 1YMXA 3R7WB 5TBMB 3IXHA 3C7VA 4L9GA 2EFUA 2PR5A 1L2SA 4ZJ3A 4E3IA 1IKIA 2K7SA 4OONA 4H6JA 1QMEA 1AWIA 3S7OA 3EEAA 4GDNA 1XGIA 5FAOA 4I3IA 3IQAA 4BWIA 4KZBA 1LI0A 2D02A 3SS4A 4P6ZS 3LR0A 3ZQ5A 3DAVA 1E3UD 2M7VA 2JKTM 3PAGA 2ZC3B 2G2UA 3E2KA 3IWIA 1MZUA 4K08A 4JXWA 3VMAA 1NWZA 1XFNA 1XJ2A 4F3LA 2V9AA 4FTXA 3LIBA 2VGJA 2O0YA 5G18A 2L0WA 5A93A 2DCFA 3VP2A 4GCZA 4UA9A 3T1QB 1MKMA 4OH0A 5GLBA 4G3VA 1CEGA 1L0DA 3FKWA 4EETB 3OPHA 5L8MA 4KG5A 3K2NA 3MS6A 3L7HA 5HZHA 4L9FA 1CI8A 4EEUA 3ZCZA 2ZJ9A 2EXBA 3EQUA 3UB8A 4JPMA 4GOGA 4N9LA 5HSQA 3Q7VB 2H5SA 4GDBA 4ME4A 2ZQCA 3IX3A 5CHUA 3ITBA 3ZGAB 4EWFA 2JN7A 3I7JA 2HF6A 1H8MA 1GSXA 4X69A 3F1OB 4R3BA 1YLPA 3OOVA 4MEZA 2WADA 4JLFA 4RQ9A 3E4PA 2NUPC 4JGPA 2XD1A 3FV7A 4S2JA 4GS9A 3BJNA 3HUNA 4WELA 4KQDA 1T1BA 4PKYG 3A3IA 4F3LB 5J8XA 4ZAMA 1G6OA 3P98A 3UNWA 4WLAA 2UV0E 2KX6A 4CLCB 1LSXA 2Y2KA 3WRTA 4KZ8A 1DY6A 3NULA 2EWVA 2DNSA 2W0NA 4O7DA 4S2PA 1H5XA 1PFLA 4WF0A 2ZOHA 1ONGA 3WRZA 4MLLA 3NECA 1S67L 2VV6A 4Y13A 5LBRA 1S66L 2PU2A 4ETXA 2JKGA 2PD8A 2I72A 4LCMA 2A24B 2XA7S 4GKUA 1ESUA 1JVJA 4HBTA 4L9EA 5FQJA 1BLCA 3IXDA 5AQ9A 5EVIC 3IH9A 2J3TC 4HI4A 1BYWA 4P0MA 2V1BA 2L4RA 3VE3A 1O07A 3TSGA 4KQRA 1YQSA 2W1TA 2VLGA 5AVEA 4DE1A 3A3FA 4RX3A 1CF0A 5DF7A 4I3AA 1G5UA 2EFXA 1FCOA 1XFQA 3R7WA 3IS2B 3T4JA 4NG2A 2Y2NA 4S2OA 3LIEA 3UMEA 5IS1A 2GZAA 3HLFA 4RYEA 3M2KA 1PWGA 2C5WB 2XR0A 3TW8A 5HWVA 3TOIA 3CG5A 3Q82A 1CK3A 3BY8A 3T1XA 1XJ6A 3BFDA 3DTIA 4UQIM 1JWPA 3CI6A 3WS1A 5DF9A 2Z2MB 3FG8A 5CGSA 3RJUA 2ZQ9A 4EERA 4ID4A 4GLQA 2PHYA 2Y2LA 2QWSA 4ETZA 4IBRA 4EQ1A 4OPYA 3ZNYA 2DRWA 2VX8A 4WL9A 3GMWA 1S1ZA 3IXBA 4Y2FA 4PPRA 3UO9A 4U0XA 1Q2QA 2H0TA 2XA7M 1GA9A 3MXRA 5M18A 3BWLA 4KZ4A 4FUWA 5EM0A 1VEUA 2Y91A 3V39A 5A8BA 2V2FF 1ERMA 3ZFZA 2OLUA 1ZTUA 4Z1WA 5EVIB 1F98A 1BULA 3UE3A 5DTKA 4DE0A 3VP4A 3GRJA 5HD3A 2X02A 3WS5A 3NJAA 5GLAA 5A92A 4B4XA 3A0RA 1FSYA 4YNRA 3V67A 1ZKJA 5HAPA 1XA1A 1HTZA 3H7WB 5HAQA 2PT7A 2VGLM 2Y8HA 3CZDA 3LO7A 4MBHA 4X1MA 4KUKA 1KE3A 4E3MA 2W27A 4XT2A 1YMSA 1W63Q 1ESIA 1K54C 4JGQA 1PRQA 3Q07A 2AVXA 1T18A 1XXMA 4X6TA 5M1AA 3H82B 3KX0X 2HJ9C 1AXBA 1K55A 4E3OA 2O9AA 4II7A 4OLDA 4WBGA 4S2KA 1TS6A 1K57C 4R3JA 3QP4A 4KQQA 2B5RA 1G28A 2VJWA 3NDEA 1D1JA 2PDRA 2OWJA 4O01A 4P85A 3O5YA 5DKKA 4S2NA 1LL5A 2H28A 2JKRM 1YLZA 2V0UA 4K0WA 1YM1A 3BLMA 2Z6CA 3MJQA 5CERA 2G7UA 5TR7A 1XA7A 4LV3A 1BUEA 3LICA 2WUQA 4Y7PA 2V0WA 4EV4A 3VV4A 1KOUA 3RH8B 2XD5A 1Y4OA 5AQ7A 4X25A 2RL3A 3PHYA 1YAXA 2IWBA 3O87A 5DFYA 4DE3A 2EA9A 2XRNA 2VK3A 1SDEA 5CGWA 3B33A 3N8RA 3NOTC 3C8CA 1HVBA 2JBFA 3O88A 3MQ0A 1MWUA 3NY4A 1L0GA 4DJ2A 2YKFA 4MN7A 5L07A 3FZCA 3OPRA 4OVDA 4FH2A 2P9VA 2Y2HA 5FATA 2Q9MA 5I94A 2Y2IA 3EGXC 2V1AA 4DDSA 1W7FA 2FFFB 2W3EA 4CLCA 1K55C 2WKEA 2IA2A 3TE8A 1FCMA 4E3LA 1KVMA 1L3LA 4EBPA 2HP6A 4OPQA 5GHYA 1VQQA 3BRMA 3FYZA 4LCLA 2J8YA 1NRFA 5FL3A 3N7WA 5JYPA 3T50A 5G4ZA 1BLHA 2JE5A 3O3VA 1F9IA 5EECA 4DXCA 3H7WA 2PD7A 1ZG4A 2ZQ8A 4OP5A 1ACFA 5C5KA 5KMWA 2LB5A 2GJ3A 1YT4A 4U0TA 4WZ5C 2OSUA 4HQAA 5E2HA 3E0YA 1XJ3A 2WGWA 1N9NA 3G32A 3UB7A 2ZQ7A 1PW8A 3E2LA 5CECA 5E2FA 3C30A 3BFCA 4CLCD 3W8KA 3T4OA 2RCXA 5F68A 4R1GA 4WMCD 4EQIA 3QP5A 2OOLA 1LI9A 1TD5A 2FZ0A 1I2SA 3C4PA 4R23A 5BOHA 5MC7A 2XDMA 5EVID 4WEKA 5FASA 3ZNTA 1PWDA 3ULFA 3V3SA 3S1YA 5EFWA 4CJNA 2WYXA 2EX6A 1SDNA 3UB5P 5TBMA 3LR3A 1GHIA 4OP8A 1FILA 1S4RA 3LR4A 4EEPA 1MXOA 3WS2A 3PBOA 4NK3A 4I3JA 3TJZC 1TS8A 4N1XA 3UY6A 3CJMA 3K3DA 5AQBA 4E3NA 2XSSA 1TF1A 4LV1A 4HNBA 3T4TA 4R4SA 4D60A 5K5BA 2JKTI 2WKIA 4HH3A 3A3JA 5EE8A 3SS5A 2PYPA 1M40A 2V8CA 5HPIA 2ZC6B 4EESA 4UEYA 1STZA 3NIAA
chains in the Genus database with same CATH topology
2EX8A 1EI5A 2PU2A 2XK1A 4A5RA 4GN2A 4HBUA 5FA7A 4BL3A 2I72A 4LCMA 1K56A 3GQZA 3PBSA 4GKUA 1ESUA 1QMFA 2G2WA 2X01A 4IVIA 1JVJA 4HBTA 2IWDA 3Q7ZA 2ZC4B 2HP9A 5FQJA 3EQVA 1BLCA 2Z2LB 3IXDA 3N4IA 5AQ9A 5EVIC 4S2LA 3IH9A 3SH9A 3ZG5A 4P0MA 1S6RA 3V5MA 2WGWB 5GHZA 1J9MA 1O07A 4OQIA 4PMAA 2E8IA 3TSGA 2QMIA 4KQRA 1YQSA 1BT5A 2WK0A 3VSLA 3GTCA 5HL1A 2ZLYA 3VFFA 4LENA 5E43A 1VM1A 4OQ0A 4DE1A 3A3FA 4RX3A 5DF7A 3UDIA 3AGEA 3IHBA 3QNBA 1KVLA 4KENB 2EFXA 1RGZA 1FCOA 1RP5A 2WZXA 1K54A 4X53A 1I5QA 3OPLA 1LL9A 2Y59A 4OOLA 4DRTA 2Y2NA 3SH7A 2XH9A 3UDFA 4DDYA 4GZBA 4S2OA 1DJAA 4OQGA 4L0LA 1JWZA 4K0XA 3C5AA 4HEFA 2XEPA 1FR6A 5GHXA 3HL9A 5F1GA 3HLFA 4RYEA 3OZHA 3M2KA 4IVKA 4ZJ1A 5D3OA 1PWGA 2C5WB 1PI4A 2XR0A 3TOIA 4RA7A 3CG5A 2ZMAA 5HARA 3HLCA 3Q82A 5DTTA 1TDLA 1IEMA 2WKHA 3W4OA 4OPRA 4D2OA 1CK3A 4RX2A 4JBFA 1K4FA 3DTMA 4OOYA 3NBLA 4JF6A 3BFDA 4JF5A 5GLDA 3UN7A 3IWQA 4KZ3A 1MPLA 3ZG8B 1JWPA 2HDSA 3HLGA 3WS1A 3HVFA 5DF9A 5KZHA 2Z2MB 4C75A 4DE2A 3ZVWA 1JTDA 4FCFA 1NYMA 1W8QA 5U47A 4GD8A 2Y2OA 3MZDA 1ZG6A 2BLSA 4K91A 5CGSA 5CTNA 2V1ZA 2ZQ9A 3RJUA 1Y54A 3BFEA 3IF6A 4IBXA 3O86A 4ID4A 4N9KA 5FI7A 4MBFA 2A3UA 1TDGA 2WGIA 2Y2LA 5CRFA 1ALQA 1KGFA 3Q7VA 3N8SA 1EROA 4IBRA 4Z9QA 2ZQDA 4RVAA 4OPYA 2XGNA 3ZNYA 2DRWA 4KQOA 4H8RA 4KG2A 1KE4A 3GMWA 1PYYA 5CEBA 3IXBA 1SCWA 3HLEA 3GR2A 1MWRA 1ES2A 1K6RA 4PPRA 4FH4A 3MZEA 5EVLA 3GV9A 3G2ZA 5CHJA 2ZM2A 3UO9A 5GLCA 4U0XA 1Q2QA 4Y0UA 1IKGA 5E2EA 5F83A 5AQAA 4WYYA 2ZD8A 4IEDA 2H0TA 1K57A 4DKIA 4N92A 4JF4A 3HREA 2ZC5B 1GA9A 4JKTA 3MXRA 4QU3A 5FQMA 1M6KA 4NETA 4GNUA 4F94A 5KSCA 1DJCA 4P87A 2OLVA 4DF6A 4OQHA 4OPZA 3M6HA 4M3KA 5M18A 5HX9A 3BYDA 2C6WB 1NY0A 3PBRA 4KZ4A 1WYCA 4N1HA 5FSRA 4HESA 4B88A 3G35A 2Y91A 4PM6A 3N8LA 3UPNA 1KDSA 1W5DA 3V39A 1K25A 1G68A 4X56A 1BLSA 2R9XA 3PTEA 2VGKA 4Y0OA 2V2FF 1ERMA 2Q9NA 3LY4A 1E4DA 2OLUA 3ZFZA 1EWZA 4WZ4A 3MXSA 4YFMA 3WS0A 1O7EA 3G2YA 3QNCA 5EVIB 3ZG7B 4QB8A 3LCEA 5L2FA 4Q8IA 3BECA 3MKEA 2Y4AA 3MFDA 5FDHA 1BULA 4QY5A 5DTKA 3UE3A 4DE0A 4ZTKA 3VP4A 3M6BA 3RXXA 3UPOA 3GRJA 4FSFA 2X02A 3DWZA 4XUZA 4XUXA 5CHMA 5GL9A 5FAPA 3WS5A 1ES4A 1L0EA 1GA0A 3GVBA 5GLAA 5A92A 4B4XA 2HDRA 1FSYA 3M2JA 2ZM8A 2UWXA 1MWTA 5CGXA 3SS3A 1ZKJA 1FSWA 1MWSA 1S0WA 5HAPA 1NYYA 1Q2PA 2ZC7A 3HUMA 3IH8A 3TG9A 1XA1A 4OOMA 1HTZA 5HAQA 4KZ5A 3S4XA 3CZDA 1FCNA 3LO7A 2H0YA 4MBHA 3VSKA 3PAEA 1XKZA 1IELA 3WWXA 1GCEA 1CI9A 1KE3A 1PWCA 3HUOA 4E3MA 1YMSA 1PW1A 1H8YA 1ESIA 1K54C 5A90A 3Q07A 2CC1A 1XXMA 5E2GA 3MBZA 3G30A 3MZFA 1BLPA 3NDGA 4X6TA 5CXWA 5HAIA 5M1AA 1Z6FA 1AXBA 1TVFA 1KGEA 3BFGA 1K55A 1LHYA 4WZ5A 4E3OA 4OLGA 1N4OA 5HFOA 4E6XA 4LV0A 1WYBA 4OLDA 1WE4A 1BZAA 1ES5A 1SHVA 3PBNA 3GSGA 4WBGA 3W4PA 2JC7A 3OC2A 4S2KA 4DXBA 1K57C 1K56D 1W8YA 3NC8A 4R3JA 4Y0TA 1SKFA 3IF6C 4KQQA 2B5RA 2XQZA 3IXGA 3MKFA 5JYOA 5M19A 1XP4A 4R0QA 3NDEA 1K38A 3VP3A 4BL2A 1XPBA 2XF3A 4WM9A 4P85A 3ZHHA 1XX2A 1IYSA 4S2NA 1LL5A 3G4PA 3OCNA 1PZPA 1YLZA 3IT9A 4UAAA 4ZDXA 1E3UA 3ITAA 4C3QA 3G31A 4K0WA 5EPHA 1YM1A 3BLMA 4LV2A 2V20A 3ZDJA 1GHPA 2R9WA 5FQQA 1MBLA 2ZM0A 5F82A 1L0FA 2JCHA 4QJGA 5CERA 5TR7A 1XA7A 4LV3A 5FI6A 2H10A 1BUEA 4UA7A 1ES3A 3ISGA 3UE0A 2WUQA 4Y7PA 2EX2A 5DTSA 5TFQA 4ZBEA 2FFYA 4P6BA 1U60A 2WAEA 4EV4A 1FOFA 1H8ZA 4FD8A 3UDXA 1C3BA 1NZUA 2XD5A 3JYIA 5AQ7A 2RL3A 1ERQA 4YINA 3S22A 1FQGA 3Q81A 2OV5A 5IHVA 2IWBA 3O87A 4DE3A 1YMXA 1KGGA 3VP0A 1SDEA 3IXHA 3N8RA 5CGWA 1G6AA 3IF5A 1HVBA 2JBFA 3C7VA 3O88A 2J7VA 2EFUA 5F1FA 1L2SA 4ZJ3A 3ZVTA 1I2WA 1IKIA 4E3IA 1PIOA 1MWUA 3NY4A 4KZ6A 4OONA 1QMEA 5EOOA 1L0GA 4B4ZA 4QY6A 2EXAA 1KDWA 2Y2PA 1IYQA 3DWKA 4GDNA 3LEZA 3FZCA 3OPRA 1XGIA 4S2IA 2XFSA 4UHUA 4OVDA 5FAOA 5CEDA 4FH2A 2P9VA 2WGVA 2Y2HA 3Q1FA 5FATA 2Q9MA 3A3DA 5I94A 2Y2IA 1BSGA 1BTLA 4JXSA 3N6IA 1TEMA 3IQAA 4DDSA 4KG6A 1W7FA 3NI9A 2FFFB 4KZBA 4E3JA 4QD4A 1K55C 2WKEA 1LI0A 1ZC2A 3NCKA 2ZQAA 3HLDA 4WMCA 3SOIA 5FQIA 3SS4A 4BD0A 1FCMA 3UPPA 4E3LA 4PM5A 4U3TA 4WEJA 4EBLA 1KVMA 1E3UD 2WAFA 1ONHA 2P9VB 3FWLA 4EBPA 1NXYA 1HZOA 2GDNA 3PAGA 4S2MA 5EVIA 2HP6A 3LY3A 4KZ9A 5KSHA 3OCLA 1LLBA 4OPQA 2ZC3B 5GHYA 2G2UA 3E2KA 3IWIA 5HW3A 2IWCA 1VQQA 3BEBA 3G34A 3BRMA 3SH8A 3FYZA 2J9OA 4JXWA 2Y2QA 4LCLA 4PM9A 3VMAA 2EX9A 2J8YA 1NRFA 4JXGA 3FKVA 3N7WA 5JYPA 1W79A 4KZ7A 4S2NC 4E3KA 2QZ6A 4KZAA 1BLHA 2JE5A 1KE0A 3C4OA 3O3VA 2VGJA 1IYOA 5EECA 2XLNA 4BLMA 4CPKA 4DXCA 3W4QA 5G18A 1HD8A 5A93A 2DCFA 1ZG4A 3VP2A 3P09A 4UA9A 2ZQ8A 3OPPA 4OH0A 4OP5A 5GLBA 1CEGA 1L0DA 2Y2MA 4X55A 3FKWA 5KMWA 3OPHA 4KG5A 3RXWA 1YT4A 4MNRA 4U0TA 4WZ5C 2OSUA 5E2HA 3QHYA 3VFHA 3HLWA 5TGFA 1JWVA 5DVAA 4JXVA 1CI8A 2WGWA 3G32A 3ZCZA 1MY8A 2ZJ9A 2EXBA 1OMEA 3EQUA 2ZQ7A 3IHAA 4JPMA 4PM7A 4QHCA 1PW8A 3BLSA 4BQMA 4GOGA 4N9LA 3E2LA 4BJPA 5CECA 3Q7VB 5E2FA 2H5SA 3BFCA 4GDBA 3B3XA 5A91A 3BFFA 3W8KA 4XXRA 1RGYA 3IF6B 2RCXA 3ZG0A 3V50A 2ZQCA 4R1GA 2HDUA 3ITBA 3PBQA 4GD6A 4WMCD 5CHUA 3V3RA 3ZGAB 1YLWA 3I7JA 4EQIA 4EWFA 5FAQA 2A49A 3PBTA 2HDQA 2P74A 1LI9A 1N9BA 4OKPA 3DW0A 1I2SA 4X69A 3C4PA 4R3BA 2QPNA 1YLPA 4MEZA 2WADA 4R23A 4JLFA 5BOHA 1NJ4A 2XDMA 5EVID 1YLJA 4WEKA 2Y2JA 5FASA 3ZNTA 1PWDA 2XD1A 3FV7A 4S2JA 3V3SA 5FI2A 4ZJ2A 5CTMA 3S1YA 5EOEA 4CJNA 2WYXA 1YLYA 1NZOA 3HLBA 3HUNA 5FQ9A 2EX6A 4WELA 1SDNA 1CEFA 4X68A 2HP5A 1FR1A 3CMZA 1K6SA 1MKIA 3D4FA 3BM6A 4BENA 1GHIA 4OP8A 3A3IA 5J8XA 4EBNA 2XFTA 4ZAMA 3A3EA 4GB7A 4BD1A 1MXOA 3IWOA 3WS2A 3P98A 3PBOA 3UNWA 3VP1A 4NK3A 1IYPA 1XGJA 1DJBA 1GHMA 1YLTA 4N1XA 3UY6A 4UA6A 3HBRA 3VOZA 1JTGA 2Y2KA 3CJMA 3AGDA 4EUZA 1PZOA 3WRTA 5AQBA 2J9PA 4KZ8A 1DY6A 2BG1A 4E3NA 3ZG9B 1K4EA 2Y55A 4LV1A 4PM8A 2X71A 5EUAA 3UE1A 4R4SA 4C6YA 3C7UA 2PBYA 1PI5A 5DF8A 2Y2GA 4E6WA 2DNSA 5FQKA 2WKIA 1RCJA 4O7DA 3A3JA 4S2PA 5EE8A 4R4RA 1H5XA 3SS5A 3AGFA 2HPBA 1M40A 1ONGA 2WZZA 3WRZA 4MLLA 2ZC6B 2PU4A 3VOYA 4MBKA 1E25A 3WS4A 3NIAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EX8 A;  1EI5 A;  2PU2 A;  2XK1 A;  4A5R A;  4GN2 A;  4HBU A;  5FA7 A;  4BL3 A;  2I72 A;  4LCM A;  1K56 A;  3GQZ A;  3PBS A;  4GKU A;  1ESU A;  1QMF A;  2G2W A;  2X01 A;  4IVI A;  1JVJ A;  4HBT A;  2IWD A;  3Q7Z A;  2ZC4 B;  2HP9 A;  5FQJ A;  3EQV A;  1BLC A;  2Z2L B;  3IXD A;  3N4I A;  5AQ9 A;  5EVI C;  4S2L A;  3IH9 A;  3SH9 A;  3ZG5 A;  4P0M A;  1S6R A;  3V5M A;  2WGW B;  5GHZ A;  1J9M A;  1O07 A;  4OQI A;  4PMA A;  2E8I A;  3TSG A;  2QMI A;  4KQR A;  1YQS A;  1BT5 A;  2WK0 A;  3VSL A;  3GTC A;  5HL1 A;  2ZLY A;  3VFF A;  4LEN A;  5E43 A;  1VM1 A;  4OQ0 A;  4DE1 A;  3A3F A;  4RX3 A;  5DF7 A;  3UDI A;  3AGE A;  3IHB A;  3QNB A;  1KVL A;  4KEN B;  2EFX A;  1RGZ A;  1FCO A;  1RP5 A;  2WZX A;  1K54 A;  4X53 A;  1I5Q A;  3OPL A;  1LL9 A;  2Y59 A;  4OOL A;  4DRT A;  2Y2N A;  3SH7 A;  2XH9 A;  3UDF A;  4DDY A;  4GZB A;  4S2O A;  1DJA A;  4OQG A;  4L0L A;  1JWZ A;  4K0X A;  3C5A A;  4HEF A;  2XEP A;  1FR6 A;  5GHX A;  3HL9 A;  5F1G A;  3HLF A;  4RYE A;  3OZH A;  3M2K A;  4IVK A;  4ZJ1 A;  5D3O A;  1PWG A;  2C5W B;  1PI4 A;  2XR0 A;  3TOI A;  4RA7 A;  3CG5 A;  2ZMA A;  5HAR A;  3HLC A;  3Q82 A;  5DTT A;  1TDL A;  1IEM A;  2WKH A;  3W4O A;  4OPR A;  4D2O A;  1CK3 A;  4RX2 A;  4JBF A;  1K4F A;  3DTM A;  4OOY A;  3NBL A;  4JF6 A;  3BFD A;  4JF5 A;  5GLD A;  3UN7 A;  3IWQ A;  4KZ3 A;  1MPL A;  3ZG8 B;  1JWP A;  2HDS A;  3HLG A;  3WS1 A;  3HVF A;  5DF9 A;  5KZH A;  2Z2M B;  4C75 A;  4DE2 A;  3ZVW A;  1JTD A;  4FCF A;  1NYM A;  1W8Q A;  5U47 A;  4GD8 A;  2Y2O A;  3MZD A;  1ZG6 A;  2BLS A;  4K91 A;  5CGS A;  5CTN A;  2V1Z A;  2ZQ9 A;  3RJU A;  1Y54 A;  3BFE A;  3IF6 A;  4IBX A;  3O86 A;  4ID4 A;  4N9K A;  5FI7 A;  4MBF A;  2A3U A;  1TDG A;  2WGI A;  2Y2L A;  5CRF A;  1ALQ A;  1KGF A;  3Q7V A;  3N8S A;  1ERO A;  4IBR A;  4Z9Q A;  2ZQD A;  4RVA A;  4OPY A;  2XGN A;  3ZNY A;  2DRW A;  4KQO A;  4H8R A;  4KG2 A;  1KE4 A;  3GMW A;  1PYY A;  5CEB A;  3IXB A;  1SCW A;  3HLE A;  3GR2 A;  1MWR A;  1ES2 A;  1K6R A;  4PPR A;  4FH4 A;  3MZE A;  5EVL A;  3GV9 A;  3G2Z A;  5CHJ A;  2ZM2 A;  3UO9 A;  5GLC A;  4U0X A;  1Q2Q A;  4Y0U A;  1IKG A;  5E2E A;  5F83 A;  5AQA A;  4WYY A;  2ZD8 A;  4IED A;  2H0T A;  1K57 A;  4DKI A;  4N92 A;  4JF4 A;  3HRE A;  2ZC5 B;  1GA9 A;  4JKT A;  3MXR A;  4QU3 A;  5FQM A;  1M6K A;  4NET A;  4GNU A;  4F94 A;  5KSC A;  1DJC A;  4P87 A;  2OLV A;  4DF6 A;  4OQH A;  4OPZ A;  3M6H A;  4M3K A;  5M18 A;  5HX9 A;  3BYD A;  2C6W B;  1NY0 A;  3PBR A;  4KZ4 A;  1WYC A;  4N1H A;  5FSR A;  4HES A;  4B88 A;  3G35 A;  2Y91 A;  4PM6 A;  3N8L A;  3UPN A;  1KDS A;  1W5D A;  3V39 A;  1K25 A;  1G68 A;  4X56 A;  1BLS A;  2R9X A;  3PTE A;  2VGK A;  4Y0O A;  2V2F F;  1ERM A;  2Q9N A;  3LY4 A;  1E4D A;  2OLU A;  3ZFZ A;  1EWZ A;  4WZ4 A;  3MXS A;  4YFM A;  3WS0 A;  1O7E A;  3G2Y A;  3QNC A;  5EVI B;  3ZG7 B;  4QB8 A;  3LCE A;  5L2F A;  4Q8I A;  3BEC A;  3MKE A;  2Y4A A;  3MFD A;  5FDH A;  1BUL A;  4QY5 A;  5DTK A;  3UE3 A;  4DE0 A;  4ZTK A;  3VP4 A;  3M6B A;  3RXX A;  3UPO A;  3GRJ A;  4FSF A;  2X02 A;  3DWZ A;  4XUZ A;  4XUX A;  5CHM A;  5GL9 A;  5FAP A;  3WS5 A;  1ES4 A;  1L0E A;  1GA0 A;  3GVB A;  5GLA A;  5A92 A;  4B4X A;  2HDR A;  1FSY A;  3M2J A;  2ZM8 A;  2UWX A;  1MWT A;  5CGX A;  3SS3 A;  1ZKJ A;  1FSW A;  1MWS A;  1S0W A;  5HAP A;  1NYY A;  1Q2P A;  2ZC7 A;  3HUM A;  3IH8 A;  3TG9 A;  1XA1 A;  4OOM A;  1HTZ A;  5HAQ A;  4KZ5 A;  3S4X A;  3CZD A;  1FCN A;  3LO7 A;  2H0Y A;  4MBH A;  3VSK A;  3PAE A;  1XKZ A;  1IEL A;  3WWX A;  1GCE A;  1CI9 A;  1KE3 A;  1PWC A;  3HUO A;  4E3M A;  1YMS A;  1PW1 A;  1H8Y A;  1ESI A;  1K54 C;  5A90 A;  3Q07 A;  2CC1 A;  1XXM A;  5E2G A;  3MBZ A;  3G30 A;  3MZF A;  1BLP A;  3NDG A;  4X6T A;  5CXW A;  5HAI A;  5M1A A;  1Z6F A;  1AXB A;  1TVF A;  1KGE A;  3BFG A;  1K55 A;  1LHY A;  4WZ5 A;  4E3O A;  4OLG A;  1N4O A;  5HFO A;  4E6X A;  4LV0 A;  1WYB A;  4OLD A;  1WE4 A;  1BZA A;  1ES5 A;  1SHV A;  3PBN A;  3GSG A;  4WBG A;  3W4P A;  2JC7 A;  3OC2 A;  4S2K A;  4DXB A;  1K57 C;  1K56 D;  1W8Y A;  3NC8 A;  4R3J A;  4Y0T A;  1SKF A;  3IF6 C;  4KQQ A;  2B5R A;  2XQZ A;  3IXG A;  3MKF A;  5JYO A;  5M19 A;  1XP4 A;  4R0Q A;  3NDE A;  1K38 A;  3VP3 A;  4BL2 A;  1XPB A;  2XF3 A;  4WM9 A;  4P85 A;  3ZHH A;  1XX2 A;  1IYS A;  4S2N A;  1LL5 A;  3G4P A;  3OCN A;  1PZP A;  1YLZ A;  3IT9 A;  4UAA A;  4ZDX A;  1E3U A;  3ITA A;  4C3Q A;  3G31 A;  4K0W A;  5EPH A;  1YM1 A;  3BLM A;  4LV2 A;  2V20 A;  3ZDJ A;  1GHP A;  2R9W A;  5FQQ A;  1MBL A;  2ZM0 A;  5F82 A;  1L0F A;  2JCH A;  4QJG A;  5CER A;  5TR7 A;  1XA7 A;  4LV3 A;  5FI6 A;  2H10 A;  1BUE A;  4UA7 A;  1ES3 A;  3ISG A;  3UE0 A;  2WUQ A;  4Y7P A;  2EX2 A;  5DTS A;  5TFQ A;  4ZBE A;  2FFY A;  4P6B A;  1U60 A;  2WAE A;  4EV4 A;  1FOF A;  1H8Z A;  4FD8 A;  3UDX A;  1C3B A;  1NZU A;  2XD5 A;  3JYI A;  5AQ7 A;  2RL3 A;  1ERQ A;  4YIN A;  3S22 A;  1FQG A;  3Q81 A;  2OV5 A;  5IHV A;  2IWB A;  3O87 A;  4DE3 A;  1YMX A;  1KGG A;  3VP0 A;  1SDE A;  3IXH A;  3N8R A;  5CGW A;  1G6A A;  3IF5 A;  1HVB A;  2JBF A;  3C7V A;  3O88 A;  2J7V A;  2EFU A;  5F1F A;  1L2S A;  4ZJ3 A;  3ZVT A;  1I2W A;  1IKI A;  4E3I A;  1PIO A;  1MWU A;  3NY4 A;  4KZ6 A;  4OON A;  1QME A;  5EOO A;  1L0G A;  4B4Z A;  4QY6 A;  2EXA A;  1KDW A;  2Y2P A;  1IYQ A;  3DWK A;  4GDN A;  3LEZ A;  3FZC A;  3OPR A;  1XGI A;  4S2I A;  2XFS A;  4UHU A;  4OVD A;  5FAO A;  5CED A;  4FH2 A;  2P9V A;  2WGV A;  2Y2H A;  3Q1F A;  5FAT A;  2Q9M A;  3A3D A;  5I94 A;  2Y2I A;  1BSG A;  1BTL A;  4JXS A;  3N6I A;  1TEM A;  3IQA A;  4DDS A;  4KG6 A;  1W7F A;  3NI9 A;  2FFF B;  4KZB A;  4E3J A;  4QD4 A;  1K55 C;  2WKE A;  1LI0 A;  1ZC2 A;  3NCK A;  2ZQA A;  3HLD A;  4WMC A;  3SOI A;  5FQI A;  3SS4 A;  4BD0 A;  1FCM A;  3UPP A;  4E3L A;  4PM5 A;  4U3T A;  4WEJ A;  4EBL A;  1KVM A;  1E3U D;  2WAF A;  1ONH A;  2P9V B;  3FWL A;  4EBP A;  1NXY A;  1HZO A;  2GDN A;  3PAG A;  4S2M A;  5EVI A;  2HP6 A;  3LY3 A;  4KZ9 A;  5KSH A;  3OCL A;  1LLB A;  4OPQ A;  2ZC3 B;  5GHY A;  2G2U A;  3E2K A;  3IWI A;  5HW3 A;  2IWC A;  1VQQ A;  3BEB A;  3G34 A;  3BRM A;  3SH8 A;  3FYZ A;  2J9O A;  4JXW A;  2Y2Q A;  4LCL A;  4PM9 A;  3VMA A;  2EX9 A;  2J8Y A;  1NRF A;  4JXG A;  3FKV A;  3N7W A;  5JYP A;  1W79 A;  4KZ7 A;  4S2N C;  4E3K A;  2QZ6 A;  4KZA A;  1BLH A;  2JE5 A;  1KE0 A;  3C4O A;  3O3V A;  2VGJ A;  1IYO A;  5EEC A;  2XLN A;  4BLM A;  4CPK A;  4DXC A;  3W4Q A;  5G18 A;  1HD8 A;  5A93 A;  2DCF A;  1ZG4 A;  3VP2 A;  3P09 A;  4UA9 A;  2ZQ8 A;  3OPP A;  4OH0 A;  4OP5 A;  5GLB A;  1CEG A;  1L0D A;  2Y2M A;  4X55 A;  3FKW A;  5KMW A;  3OPH A;  4KG5 A;  3RXW A;  1YT4 A;  4MNR A;  4U0T A;  4WZ5 C;  2OSU A;  5E2H A;  3QHY A;  3VFH A;  3HLW A;  5TGF A;  1JWV A;  5DVA A;  4JXV A;  1CI8 A;  2WGW A;  3G32 A;  3ZCZ A;  1MY8 A;  2ZJ9 A;  2EXB A;  1OME A;  3EQU A;  2ZQ7 A;  3IHA A;  4JPM A;  4PM7 A;  4QHC A;  1PW8 A;  3BLS A;  4BQM A;  4GOG A;  4N9L A;  3E2L A;  4BJP A;  5CEC A;  3Q7V B;  5E2F A;  2H5S A;  3BFC A;  4GDB A;  3B3X A;  5A91 A;  3BFF A;  3W8K A;  4XXR A;  1RGY A;  3IF6 B;  2RCX A;  3ZG0 A;  3V50 A;  2ZQC A;  4R1G A;  2HDU A;  3ITB A;  3PBQ A;  4GD6 A;  4WMC D;  5CHU A;  3V3R A;  3ZGA B;  1YLW A;  3I7J A;  4EQI A;  4EWF A;  5FAQ A;  2A49 A;  3PBT A;  2HDQ A;  2P74 A;  1LI9 A;  1N9B A;  4OKP A;  3DW0 A;  1I2S A;  4X69 A;  3C4P A;  4R3B A;  2QPN A;  1YLP A;  4MEZ A;  2WAD A;  4R23 A;  4JLF A;  5BOH A;  1NJ4 A;  2XDM A;  5EVI D;  1YLJ A;  4WEK A;  2Y2J A;  5FAS A;  3ZNT A;  1PWD A;  2XD1 A;  3FV7 A;  4S2J A;  3V3S A;  5FI2 A;  4ZJ2 A;  5CTM A;  3S1Y A;  5EOE A;  4CJN A;  2WYX A;  1YLY A;  1NZO A;  3HLB A;  3HUN A;  5FQ9 A;  2EX6 A;  4WEL A;  1SDN A;  1CEF A;  4X68 A;  2HP5 A;  1FR1 A;  3CMZ A;  1K6S A;  1MKI A;  3D4F A;  3BM6 A;  4BEN A;  1GHI A;  4OP8 A;  3A3I A;  5J8X A;  4EBN A;  2XFT A;  4ZAM A;  3A3E A;  4GB7 A;  4BD1 A;  1MXO A;  3IWO A;  3WS2 A;  3P98 A;  3PBO A;  3UNW A;  3VP1 A;  4NK3 A;  1IYP A;  1XGJ A;  1DJB A;  1GHM A;  1YLT A;  4N1X A;  3UY6 A;  4UA6 A;  3HBR A;  3VOZ A;  1JTG A;  2Y2K A;  3CJM A;  3AGD A;  4EUZ A;  1PZO A;  3WRT A;  5AQB A;  2J9P A;  4KZ8 A;  1DY6 A;  2BG1 A;  4E3N A;  3ZG9 B;  1K4E A;  2Y55 A;  4LV1 A;  4PM8 A;  2X71 A;  5EUA A;  3UE1 A;  4R4S A;  4C6Y A;  3C7U A;  2PBY A;  1PI5 A;  5DF8 A;  2Y2G A;  4E6W A;  2DNS A;  5FQK A;  2WKI A;  1RCJ A;  4O7D A;  3A3J A;  4S2P A;  5EE8 A;  4R4R A;  1H5X A;  3SS5 A;  3AGF A;  2HPB A;  1M40 A;  1ONG A;  2WZZ A;  3WRZ A;  4MLL A;  2ZC6 B;  2PU4 A;  3VOY A;  4MBK A;  1E25 A;  3WS4 A;  3NIA A; 
#chains in the Genus database with same CATH topology
 4HH2 A;  5I5L A;  4GN2 A;  2QYB A;  5CX7 A;  4LPZ A;  2ZBB A;  3JPU A;  2B95 A;  3PBS A;  2IWD A;  3Q7Z A;  2ZC4 B;  2HP9 A;  3C38 A;  4S2L A;  3SH9 A;  3ZG5 A;  1HLU P;  1J9M A;  1DP8 A;  2QMI A;  3OLO A;  2WK0 A;  3GTC A;  2PYR A;  4WUJ A;  2CMN A;  3UDI A;  3IBJ A;  4KEN B;  1RGZ A;  2WZX A;  4X53 A;  4Q0H A;  1GSW A;  3R4K A;  3SH7 A;  3UDF A;  2O9C A;  1A0K A;  1EW0 A;  4L0L A;  4K0X A;  3C5A A;  4I5S A;  4R70 A;  2HZ5 A;  2XEP A;  4HY8 A;  5F1G A;  2K31 A;  3CPT A;  5D3O A;  1VET B;  1UGU A;  4OPR A;  2W3D A;  3DTM A;  4NXG A;  4KZ3 A;  3ZG8 B;  2HDS A;  5FEG A;  5KZH A;  3BW6 A;  1SKO B;  2FH5 A;  3ZVW A;  4FCF A;  1W8Q A;  4GD8 A;  3MZD A;  1ZG6 A;  5CTN A;  2KOI A;  1Y54 A;  3UMD A;  4N9K A;  3DTE A;  3O86 A;  5HDC A;  1TDG A;  5CRF A;  1ALQ A;  3N8S A;  4NXF A;  2WKQ A;  2KDK A;  2OAP 1;  1KE4 A;  4ARZ B;  2BAS A;  5CEB A;  1SCW A;  3HLE A;  2KLI A;  3NOP C;  3GR2 A;  1ES2 A;  1K6R A;  2HGV A;  4B9O A;  5F5Y A;  3GV9 A;  3P01 A;  5EM1 A;  5J3W A;  1P9W A;  5GLC A;  5G4Y A;  1IKG A;  5E2E A;  2R78 A;  5F83 A;  5AQA A;  4WYY A;  2ZD8 A;  4IED A;  4N92 A;  1OJG A;  3HRE A;  2ZC5 B;  4I38 A;  1M6K A;  4F94 A;  1DJC A;  4GS9 B;  2B02 A;  2OLV A;  4OPZ A;  4DF6 A;  2Y79 A;  4R3A A;  1NY0 A;  3PBR A;  1P0Z A;  1X0O A;  1LT0 A;  4N1H A;  4B88 A;  2I9V A;  3UPN A;  4X56 A;  1BLS A;  2R9X A;  3UB6 A;  4MMN A;  2VGK A;  4MDZ A;  3ZYT A;  4LGW A;  5HL6 A;  1O7E A;  3G2Y A;  2QKP A;  5L2F A;  1WA9 A;  2J3T D;  4Y5F A;  5FDH A;  3E4Q A;  4ZTK A;  1D06 A;  3UPO A;  3DWZ A;  4XUZ A;  5CHM A;  5FAP A;  3CPT B;  4ESP A;  3LFV A;  3W2Z A;  4LLO B;  4P6Z M;  2UWX A;  2VGL S;  4MN6 A;  4UQI S;  4AFI A;  1FCN A;  2H0Y A;  3WWX A;  3LID A;  3S7P A;  1VHM A;  5F69 A;  1PW1 A;  1P97 A;  3JVU A;  3A0V A;  5E2G A;  5HAI A;  2BTF P;  1BLP A;  3MZF A;  1Z6F A;  1OTD A;  4WZ5 A;  4NEE D;  5HFO A;  4E6X A;  4LV0 A;  1WE4 A;  2QHK A;  4PKY A;  4ZRR A;  3PBN A;  3W4P A;  3NC8 A;  4Y0T A;  1SKF A;  3B47 A;  2A2L A;  2L1M A;  3VP3 A;  4WM9 A;  1XX2 A;  1IYS A;  3OCN A;  4KUO A;  3IX4 A;  3IT9 A;  4UAA A;  4ZDX A;  1E3U A;  3G31 A;  3EOI A;  1GHP A;  4Q0J A;  1MBL A;  4QJG A;  1S4S A;  2H10 A;  1ES3 A;  3ISG A;  3LIA A;  2FFY A;  1U60 A;  2WAE A;  4BBT A;  1NZU A;  4LRX C;  3CUE C;  3S22 A;  5IHV A;  1KGG A;  4R6L A;  3EEH A;  3VP0 A;  1G6A A;  3IF5 A;  3T4S A;  4LRZ E;  5F1F A;  3ZVT A;  2W3F A;  4YOF A;  5EOO A;  1NRJ A;  4QY6 A;  3T1R A;  1KDW A;  2Y2P A;  3CAX A;  3DWK A;  4S2I A;  2XFS A;  5CED A;  3Q1F A;  1CQA A;  4JXS A;  2LB9 A;  3N6I A;  1TEM A;  4KG6 A;  5L09 A;  2B18 A;  3NCK A;  2Q0O A;  3HJK A;  4WMC A;  1P9R A;  3UPP A;  4BMW A;  1OT9 A;  4U3T A;  4EBL A;  2OWH A;  3FWL A;  3LEQ A;  1NXY A;  2GDN A;  2XRO A;  1IFQ A;  1JNU A;  1LLB A;  1S1Y A;  4EXO A;  3CWF A;  2J9O A;  1W79 A;  3FPW A;  5HWW A;  4S2N C;  2P08 A;  4E3K A;  1KE0 A;  2Z6D A;  3C4O A;  2XLN A;  5DJU A;  3W4Q A;  3T4Q A;  2J80 A;  3OPP A;  4XT2 B;  3MSH A;  3HJI A;  1TS7 A;  3RXW A;  2O99 A;  4MNR A;  3QHY A;  3VFH A;  3HLW A;  5TGF A;  4JXV A;  4PM7 A;  1MY8 A;  3LI9 A;  3S7Q A;  3BLS A;  3LR5 A;  3GDI A;  3VE4 A;  4EU0 A;  2K2N A;  1NLZ A;  3B3X A;  5A91 A;  3BFF A;  3IF6 B;  3V50 A;  3V3R A;  1YLW A;  5FAQ A;  1DP9 A;  2A49 A;  2P74 A;  3PXP A;  4OKP A;  3DW0 A;  2QPN A;  1NJ4 A;  1D7E A;  4NXE A;  4ZJ2 A;  1YLY A;  5FQ9 A;  2O9B A;  2VA0 A;  1CEF A;  2HP5 A;  1FR1 A;  3CMZ A;  1K6S A;  1XJ4 A;  4PAU A;  3D4F A;  3BM6 A;  1YPR A;  5J4E A;  1NLY A;  4EBN A;  2XFT A;  4BD1 A;  3A3E A;  4GB7 A;  5AVF A;  2JHE A;  3IWO A;  2NUT C;  3F1P B;  3VP1 A;  1IYP A;  1YLT A;  3HBR A;  3VOZ A;  1PZO A;  4DN0 A;  2YKH A;  1T1A A;  3ZG9 B;  2Y55 A;  4PM8 A;  5HWT A;  3UE1 A;  4M4X A;  4E6W A;  4R4R A;  2DMW A;  1F2K A;  2HPB A;  2WZZ A;  4IJG A;  2ZOI A;  5EV0 A;  3VOY A;  3QP6 A;  1E25 A;  2HJE A;  2EX8 A;  2XK1 A;  4BL3 A;  1VET A;  1K56 A;  3GQZ A;  4IVI A;  4IUK A;  3EQV A;  4GHI B;  2Z2L B;  2W1R A;  2WGW B;  4E04 A;  4BBU A;  5HPF A;  1BT5 A;  3VFF A;  4LEN A;  2ZL1 B;  1H3Q A;  4OQ0 A;  5E43 A;  1KVL A;  1RP5 A;  3OPL A;  2Y59 A;  4DRT A;  2XH9 A;  4DDY A;  4NKP A;  4OQG A;  1JWZ A;  4HEF A;  5GHX A;  1VB6 A;  3OZH A;  4ZJ1 A;  1PI4 A;  1LSV A;  4RA7 A;  5HAR A;  3HLC A;  3W4O A;  1OJ5 A;  4D2O A;  4RX2 A;  4OOY A;  3NBL A;  5GLD A;  3UN7 A;  1IOU A;  3IWQ A;  1MPL A;  3BQA A;  1OPX A;  3HVF A;  4DE2 A;  1JTD A;  3OBF A;  4K91 A;  2BLS A;  4WN5 A;  1OTB A;  3BFE A;  4IBX A;  2J3W A;  2WGI A;  1KGF A;  4LRY C;  4BBV A;  1ERO A;  4Z9Q A;  2ZQD A;  4H8R A;  2M7U A;  2QJ7 A;  3U4L P;  1MWR A;  4FH4 A;  3MZE A;  2ZM2 A;  2PRF A;  4Y0U A;  4DKI A;  1K57 A;  3KYZ A;  4JF4 A;  4JKT A;  5KSC A;  5L10 A;  4QU3 A;  5FQM A;  4NET A;  4GNU A;  3QP2 A;  3M6H A;  3BYD A;  3H82 A;  4GW9 A;  2PR6 A;  3CUE A;  1MC0 A;  3G35 A;  4QPR A;  1UWP X;  1W5D A;  1DRM A;  2PBD P;  1K25 A;  3GEC A;  5F6A A;  4Y0O A;  3MXS A;  4YFM A;  3WS0 A;  3C2W A;  2MJ6 A;  3LCE A;  4Q8I A;  1V9Y A;  3MFD A;  4QY5 A;  4FSF A;  3QP8 A;  3GVB A;  3M2J A;  3F1P A;  1MWT A;  3KSH A;  3MR0 A;  3NHQ A;  3RTY A;  1NYY A;  2ZC7 A;  3HUM A;  3TG9 A;  2HV1 A;  4OOM A;  3T12 B;  5FDS A;  4JGR A;  4KZ5 A;  2ACG A;  3PAE A;  1IEL A;  1PWC A;  3HUO A;  3EGD C;  5AJG A;  4NXB A;  3LUQ A;  1H8Y A;  3FPV A;  5HDS A;  3DBA A;  3K3C A;  3MBZ A;  3NDG A;  4CQH A;  4HJ3 A;  3ICY A;  4G3K A;  1TVF A;  1KGE A;  3UB9 A;  4OLG A;  1N4O A;  1WYB A;  1BZA A;  1SHV A;  3GSG A;  4PHT A;  1W8Y A;  2XQZ A;  3IXG A;  3MKF A;  5JYO A;  5M19 A;  1K38 A;  2VV7 A;  1XPB A;  3G4P A;  1PZP A;  1OTI A;  2P7J A;  5EPH A;  4LV2 A;  2V20 A;  3ZDJ A;  2W1T B;  5F82 A;  2E8J A;  1L0F A;  1N9L A;  5FI6 A;  4O0P A;  4UA7 A;  3UE0 A;  5TFQ A;  5DTS A;  2EX2 A;  2QJ5 A;  3BQ8 A;  3D9Y A;  1H8Z A;  3UDX A;  4FD8 A;  1C3B A;  3KYQ A;  5FEF A;  3MXQ A;  1ERQ A;  4GHI A;  1FQG A;  2OV5 A;  2WKP A;  2J7V A;  3MF0 A;  1I2W A;  1PIO A;  4KZ6 A;  4B4Z A;  5IT5 A;  1CJF A;  1SZV A;  2EXA A;  3T1S A;  1IYQ A;  2ZMF A;  3LEZ A;  4UHU A;  1DP6 A;  2WGV A;  3U2A A;  5J7E A;  5HDD A;  5IU1 A;  3A3D A;  1BSG A;  1BTL A;  3NI9 A;  4HHD A;  4E3J A;  4QD4 A;  1ZC2 A;  3SZT A;  2ZQA A;  1GSV A;  3HLD A;  3SOI A;  5FQI A;  4BD0 A;  4PM5 A;  3CHW P;  1YKD A;  4WEJ A;  4HOI A;  1J3W A;  1ONH A;  2P9V B;  2WAF A;  1HZO A;  3IS2 A;  2GX5 A;  4S2M A;  5EVI A;  3LY3 A;  4KZ9 A;  5KSH A;  3OCL A;  5HW3 A;  2IWC A;  3BEB A;  3G34 A;  3L9K A;  3SH8 A;  4YWZ A;  2Y2Q A;  4PM9 A;  2EX9 A;  4JXG A;  3FKV A;  4KZ7 A;  3PR6 A;  2M1C A;  3LI8 A;  2QZ6 A;  4KZA A;  4DJ3 A;  1IYO A;  3H9W A;  4GJ4 A;  4BLM A;  3P7N A;  2JKF A;  4CPK A;  4MCW A;  1HD8 A;  4ARZ A;  3P09 A;  4FOF A;  4I39 A;  1T19 A;  3TRC A;  2Y2M A;  4X55 A;  3KSI A;  5TJJ A;  1JWV A;  3JVV A;  5DVA A;  1OME A;  3IHA A;  4QHC A;  2P04 A;  3QP1 A;  4BQM A;  1SKO A;  1YSP A;  4BJP A;  3E98 A;  3A0S A;  4XXR A;  1RGY A;  3ZG0 A;  2HDU A;  3PBQ A;  4GD6 A;  4HP4 A;  3PBT A;  5EVE A;  2HDQ A;  1N9B A;  3MFX A;  4HP9 A;  3LIF A;  3HCY A;  2VEA A;  1YLJ A;  2Y2J A;  5FI2 A;  3KSF A;  5CTM A;  5EOE A;  1NZO A;  3HLB A;  3T4L A;  4X68 A;  1MKI A;  2VKS A;  4Q0I A;  1ODV A;  4BEN A;  4HJ6 A;  2ZMV A;  4Y15 A;  4QWO A;  3DTK A;  4R38 A;  5DJT A;  4MN5 A;  1XGJ A;  1DJB A;  1GHM A;  4UA6 A;  1JTG A;  3AGD A;  4EUZ A;  1Z09 A;  2J9P A;  2BG1 A;  1K4E A;  5EUA A;  5HD5 A;  2X71 A;  4C6Y A;  3C7U A;  2PBY A;  1PI5 A;  5DF8 A;  2Y2G A;  5FQK A;  1RCJ A;  1N9O A;  3AGF A;  4HIA A;  4CLC E;  2PU4 A;  4H6J B;  4MBK A;  3WS4 A;  1EI5 A;  4A5R A;  4HBU A;  5FA7 A;  3EWK A;  2A24 A;  2G2W A;  1QMF A;  2X01 A;  3UE6 A;  2D01 A;  1UWN X;  3N4I A;  4G3W A;  3KYE A;  1VEU B;  1S6R A;  3V5M A;  5GHZ A;  4OQI A;  4PMA A;  2E8I A;  5HL1 A;  1V9Z A;  3VSL A;  2ZLY A;  1VM1 A;  3AGE A;  3D72 A;  3IHB A;  3S7N A;  3QNB A;  1K54 A;  3SW1 A;  1I5Q A;  1LL9 A;  2VV8 A;  4OOL A;  4GZB A;  1DJA A;  2GNX A;  1FR6 A;  1YSQ A;  3HL9 A;  3CIT A;  3KSG A;  4IVK A;  4X1L A;  3F1N B;  2ZMA A;  4EW7 A;  5DTT A;  1TDL A;  3VOL A;  1IEM A;  2INW A;  2WKH A;  4JBF A;  1K4F A;  4JF6 A;  4IUH A;  4JF5 A;  3F1N A;  3LGO A;  3HLG A;  3IBR A;  3F1O A;  5KIZ A;  4C75 A;  3T4K A;  1NYM A;  5U47 A;  2V8F A;  2Y2O A;  2W3H A;  2V1Z A;  3IF6 A;  5FI7 A;  4DMZ A;  4MBF A;  2A3U A;  1H0M A;  3Q7V A;  5DKL A;  1Y28 A;  4RVA A;  2XGN A;  1T1C A;  4KQO A;  4KG2 A;  3KO6 A;  1PYY A;  1PNE A;  4EUV A;  3IX8 A;  2JKR I;  2W3G A;  1FIK A;  5EVL A;  5CHJ A;  3G2Z A;  1W63 M;  1K0K A;  2VZW A;  2ZL1 A;  4P87 A;  4OQH A;  4M3K A;  5HX9 A;  2C6W B;  1WYC A;  5FSR A;  4HES A;  4Y3I A;  3NOU C;  4PM6 A;  3N8L A;  1KDS A;  1G68 A;  4HJ4 A;  3PTE A;  2Q9N A;  3LY4 A;  1E4D A;  2EWW A;  1EWZ A;  4WZ4 A;  2WKR A;  3QNC A;  1TS0 A;  3ZG7 B;  4QB8 A;  4JGO A;  5DFX A;  3BEC A;  3MKE A;  2Y4A A;  1OTA A;  3M6B A;  3RXX A;  4XUX A;  3CLO A;  5GL9 A;  1ES4 A;  1L0E A;  1GA0 A;  2HDR A;  2ZM8 A;  5CGX A;  4LFU A;  4IHQ A;  3SS3 A;  3RFB A;  1FSW A;  4CLC C;  1MWS A;  1S0W A;  1Q2P A;  1ZHH B;  3IH8 A;  3S4X A;  3D3O A;  3VSK A;  1XKZ A;  1GCE A;  1CI9 A;  3MMH A;  3MQQ A;  1OT6 A;  1LL8 A;  5A90 A;  2CC1 A;  3G30 A;  5CXW A;  3PYP A;  3BFG A;  1LHY A;  3BY9 A;  1ES5 A;  4DXB A;  2JC7 A;  3OC2 A;  1K56 D;  3IF6 C;  2OAQ 1;  1XP4 A;  4R0Q A;  4BL2 A;  2XF3 A;  3LYX A;  2PAV P;  4Y17 A;  3ZHH A;  3B42 A;  3E4O A;  3FC7 A;  1LSW A;  4O8G A;  3ITA A;  4C3Q A;  1F5M A;  4B93 A;  2R9W A;  5FQQ A;  2ZM0 A;  2JCH A;  3MQO A;  4ZBE A;  4P6B A;  1FOF A;  3G6O A;  3JYI A;  1OTE A;  4YIN A;  3Q81 A;  1YMX A;  3R7W B;  5TBM B;  3IXH A;  3C7V A;  4L9G A;  2EFU A;  2PR5 A;  1L2S A;  4ZJ3 A;  4E3I A;  1IKI A;  2K7S A;  4OON A;  4H6J A;  1QME A;  1AWI A;  3S7O A;  3EEA A;  4GDN A;  1XGI A;  5FAO A;  4I3I A;  3IQA A;  4BWI A;  4KZB A;  1LI0 A;  2D02 A;  3SS4 A;  4P6Z S;  3LR0 A;  3ZQ5 A;  3DAV A;  1E3U D;  2M7V A;  2JKT M;  3PAG A;  2ZC3 B;  2G2U A;  3E2K A;  3IWI A;  1MZU A;  4K08 A;  4JXW A;  3VMA A;  1NWZ A;  1XFN A;  1XJ2 A;  4F3L A;  2V9A A;  4FTX A;  3LIB A;  2VGJ A;  2O0Y A;  5G18 A;  2L0W A;  5A93 A;  2DCF A;  3VP2 A;  4GCZ A;  4UA9 A;  3T1Q B;  1MKM A;  4OH0 A;  5GLB A;  4G3V A;  1CEG A;  1L0D A;  3FKW A;  4EET B;  3OPH A;  5L8M A;  4KG5 A;  3K2N A;  3MS6 A;  3L7H A;  5HZH A;  4L9F A;  1CI8 A;  4EEU A;  3ZCZ A;  2ZJ9 A;  2EXB A;  3EQU A;  3UB8 A;  4JPM A;  4GOG A;  4N9L A;  5HSQ A;  3Q7V B;  2H5S A;  4GDB A;  4ME4 A;  2ZQC A;  3IX3 A;  5CHU A;  3ITB A;  3ZGA B;  4EWF A;  2JN7 A;  3I7J A;  2HF6 A;  1H8M A;  1GSX A;  4X69 A;  3F1O B;  4R3B A;  1YLP A;  3OOV A;  4MEZ A;  2WAD A;  4JLF A;  4RQ9 A;  3E4P A;  2NUP C;  4JGP A;  2XD1 A;  3FV7 A;  4S2J A;  4GS9 A;  3BJN A;  3HUN A;  4WEL A;  4KQD A;  1T1B A;  4PKY G;  3A3I A;  4F3L B;  5J8X A;  4ZAM A;  1G6O A;  3P98 A;  3UNW A;  4WLA A;  2UV0 E;  2KX6 A;  4CLC B;  1LSX A;  2Y2K A;  3WRT A;  4KZ8 A;  1DY6 A;  3NUL A;  2EWV A;  2DNS A;  2W0N A;  4O7D A;  4S2P A;  1H5X A;  1PFL A;  4WF0 A;  2ZOH A;  1ONG A;  3WRZ A;  4MLL A;  3NEC A;  1S67 L;  2VV6 A;  4Y13 A;  5LBR A;  1S66 L;  2PU2 A;  4ETX A;  2JKG A;  2PD8 A;  2I72 A;  4LCM A;  2A24 B;  2XA7 S;  4GKU A;  1ESU A;  1JVJ A;  4HBT A;  4L9E A;  5FQJ A;  1BLC A;  3IXD A;  5AQ9 A;  5EVI C;  3IH9 A;  2J3T C;  4HI4 A;  1BYW A;  4P0M A;  2V1B A;  2L4R A;  3VE3 A;  1O07 A;  3TSG A;  4KQR A;  1YQS A;  2W1T A;  2VLG A;  5AVE A;  4DE1 A;  3A3F A;  4RX3 A;  1CF0 A;  5DF7 A;  4I3A A;  1G5U A;  2EFX A;  1FCO A;  1XFQ A;  3R7W A;  3IS2 B;  3T4J A;  4NG2 A;  2Y2N A;  4S2O A;  3LIE A;  3UME A;  5IS1 A;  2GZA A;  3HLF A;  4RYE A;  3M2K A;  1PWG A;  2C5W B;  2XR0 A;  3TW8 A;  5HWV A;  3TOI A;  3CG5 A;  3Q82 A;  1CK3 A;  3BY8 A;  3T1X A;  1XJ6 A;  3BFD A;  3DTI A;  4UQI M;  1JWP A;  3CI6 A;  3WS1 A;  5DF9 A;  2Z2M B;  3FG8 A;  5CGS A;  3RJU A;  2ZQ9 A;  4EER A;  4ID4 A;  4GLQ A;  2PHY A;  2Y2L A;  2QWS A;  4ETZ A;  4IBR A;  4EQ1 A;  4OPY A;  3ZNY A;  2DRW A;  2VX8 A;  4WL9 A;  3GMW A;  1S1Z A;  3IXB A;  4Y2F A;  4PPR A;  3UO9 A;  4U0X A;  1Q2Q A;  2H0T A;  2XA7 M;  1GA9 A;  3MXR A;  5M18 A;  3BWL A;  4KZ4 A;  4FUW A;  5EM0 A;  1VEU A;  2Y91 A;  3V39 A;  5A8B A;  2V2F F;  1ERM A;  3ZFZ A;  2OLU A;  1ZTU A;  4Z1W A;  5EVI B;  1F98 A;  1BUL A;  3UE3 A;  5DTK A;  4DE0 A;  3VP4 A;  3GRJ A;  5HD3 A;  2X02 A;  3WS5 A;  3NJA A;  5GLA A;  5A92 A;  4B4X A;  3A0R A;  1FSY A;  4YNR A;  3V67 A;  1ZKJ A;  5HAP A;  1XA1 A;  1HTZ A;  3H7W B;  5HAQ A;  2PT7 A;  2VGL M;  2Y8H A;  3CZD A;  3LO7 A;  4MBH A;  4X1M A;  4KUK A;  1KE3 A;  4E3M A;  2W27 A;  4XT2 A;  1YMS A;  1W63 Q;  1ESI A;  1K54 C;  4JGQ A;  1PRQ A;  3Q07 A;  2AVX A;  1T18 A;  1XXM A;  4X6T A;  5M1A A;  3H82 B;  3KX0 X;  2HJ9 C;  1AXB A;  1K55 A;  4E3O A;  2O9A A;  4II7 A;  4OLD A;  4WBG A;  4S2K A;  1TS6 A;  1K57 C;  4R3J A;  3QP4 A;  4KQQ A;  2B5R A;  1G28 A;  2VJW A;  3NDE A;  1D1J A;  2PDR A;  2OWJ A;  4O01 A;  4P85 A;  3O5Y A;  5DKK A;  4S2N A;  1LL5 A;  2H28 A;  2JKR M;  1YLZ A;  2V0U A;  4K0W A;  1YM1 A;  3BLM A;  2Z6C A;  3MJQ A;  5CER A;  2G7U A;  5TR7 A;  1XA7 A;  4LV3 A;  1BUE A;  3LIC A;  2WUQ A;  4Y7P A;  2V0W A;  4EV4 A;  3VV4 A;  1KOU A;  3RH8 B;  2XD5 A;  1Y4O A;  5AQ7 A;  4X25 A;  2RL3 A;  3PHY A;  1YAX A;  2IWB A;  3O87 A;  5DFY A;  4DE3 A;  2EA9 A;  2XRN A;  2VK3 A;  1SDE A;  5CGW A;  3B33 A;  3N8R A;  3NOT C;  3C8C A;  1HVB A;  2JBF A;  3O88 A;  3MQ0 A;  1MWU A;  3NY4 A;  1L0G A;  4DJ2 A;  2YKF A;  4MN7 A;  5L07 A;  3FZC A;  3OPR A;  4OVD A;  4FH2 A;  2P9V A;  2Y2H A;  5FAT A;  2Q9M A;  5I94 A;  2Y2I A;  3EGX C;  2V1A A;  4DDS A;  1W7F A;  2FFF B;  2W3E A;  4CLC A;  1K55 C;  2WKE A;  2IA2 A;  3TE8 A;  1FCM A;  4E3L A;  1KVM A;  1L3L A;  4EBP A;  2HP6 A;  4OPQ A;  5GHY A;  1VQQ A;  3BRM A;  3FYZ A;  4LCL A;  2J8Y A;  1NRF A;  5FL3 A;  3N7W A;  5JYP A;  3T50 A;  5G4Z A;  1BLH A;  2JE5 A;  3O3V A;  1F9I A;  5EEC A;  4DXC A;  3H7W A;  2PD7 A;  1ZG4 A;  2ZQ8 A;  4OP5 A;  1ACF A;  5C5K A;  5KMW A;  2LB5 A;  2GJ3 A;  1YT4 A;  4U0T A;  4WZ5 C;  2OSU A;  4HQA A;  5E2H A;  3E0Y A;  1XJ3 A;  2WGW A;  1N9N A;  3G32 A;  3UB7 A;  2ZQ7 A;  1PW8 A;  3E2L A;  5CEC A;  5E2F A;  3C30 A;  3BFC A;  4CLC D;  3W8K A;  3T4O A;  2RCX A;  5F68 A;  4R1G A;  4WMC D;  4EQI A;  3QP5 A;  2OOL A;  1LI9 A;  1TD5 A;  2FZ0 A;  1I2S A;  3C4P A;  4R23 A;  5BOH A;  5MC7 A;  2XDM A;  5EVI D;  4WEK A;  5FAS A;  3ZNT A;  1PWD A;  3ULF A;  3V3S A;  3S1Y A;  5EFW A;  4CJN A;  2WYX A;  2EX6 A;  1SDN A;  3UB5 P;  5TBM A;  3LR3 A;  1GHI A;  4OP8 A;  1FIL A;  1S4R A;  3LR4 A;  4EEP A;  1MXO A;  3WS2 A;  3PBO A;  4NK3 A;  4I3J A;  3TJZ C;  1TS8 A;  4N1X A;  3UY6 A;  3CJM A;  3K3D A;  5AQB A;  4E3N A;  2XSS A;  1TF1 A;  4LV1 A;  4HNB A;  3T4T A;  4R4S A;  4D60 A;  5K5B A;  2JKT I;  2WKI A;  4HH3 A;  3A3J A;  5EE8 A;  3SS5 A;  2PYP A;  1M40 A;  2V8C A;  5HPI A;  2ZC6 B;  4EES A;  4UEY A;  1STZ A;  3NIA A; 
#chains in the Genus database with same CATH homology
 2EX8 A;  1EI5 A;  2PU2 A;  2XK1 A;  4A5R A;  4GN2 A;  4HBU A;  5FA7 A;  4BL3 A;  2I72 A;  4LCM A;  1K56 A;  3GQZ A;  3PBS A;  4GKU A;  1ESU A;  1QMF A;  2G2W A;  2X01 A;  4IVI A;  1JVJ A;  4HBT A;  2IWD A;  3Q7Z A;  2ZC4 B;  2HP9 A;  5FQJ A;  3EQV A;  1BLC A;  2Z2L B;  3IXD A;  3N4I A;  5AQ9 A;  5EVI C;  4S2L A;  3IH9 A;  3SH9 A;  3ZG5 A;  4P0M A;  1S6R A;  3V5M A;  2WGW B;  5GHZ A;  1J9M A;  1O07 A;  4OQI A;  4PMA A;  2E8I A;  3TSG A;  2QMI A;  4KQR A;  1YQS A;  1BT5 A;  2WK0 A;  3VSL A;  3GTC A;  5HL1 A;  2ZLY A;  3VFF A;  4LEN A;  5E43 A;  1VM1 A;  4OQ0 A;  4DE1 A;  3A3F A;  4RX3 A;  5DF7 A;  3UDI A;  3AGE A;  3IHB A;  3QNB A;  1KVL A;  4KEN B;  2EFX A;  1RGZ A;  1FCO A;  1RP5 A;  2WZX A;  1K54 A;  4X53 A;  1I5Q A;  3OPL A;  1LL9 A;  2Y59 A;  4OOL A;  4DRT A;  2Y2N A;  3SH7 A;  2XH9 A;  3UDF A;  4DDY A;  4GZB A;  4S2O A;  1DJA A;  4OQG A;  4L0L A;  1JWZ A;  4K0X A;  3C5A A;  4HEF A;  2XEP A;  1FR6 A;  5GHX A;  3HL9 A;  5F1G A;  3HLF A;  4RYE A;  3OZH A;  3M2K A;  4IVK A;  4ZJ1 A;  5D3O A;  1PWG A;  2C5W B;  1PI4 A;  2XR0 A;  3TOI A;  4RA7 A;  3CG5 A;  2ZMA A;  5HAR A;  3HLC A;  3Q82 A;  5DTT A;  1TDL A;  1IEM A;  2WKH A;  3W4O A;  4OPR A;  4D2O A;  1CK3 A;  4RX2 A;  4JBF A;  1K4F A;  3DTM A;  4OOY A;  3NBL A;  4JF6 A;  3BFD A;  4JF5 A;  5GLD A;  3UN7 A;  3IWQ A;  4KZ3 A;  1MPL A;  3ZG8 B;  1JWP A;  2HDS A;  3HLG A;  3WS1 A;  3HVF A;  5DF9 A;  5KZH A;  2Z2M B;  4C75 A;  4DE2 A;  3ZVW A;  1JTD A;  4FCF A;  1NYM A;  1W8Q A;  5U47 A;  4GD8 A;  2Y2O A;  3MZD A;  1ZG6 A;  2BLS A;  4K91 A;  5CGS A;  5CTN A;  2V1Z A;  2ZQ9 A;  3RJU A;  1Y54 A;  3BFE A;  3IF6 A;  4IBX A;  3O86 A;  4ID4 A;  4N9K A;  5FI7 A;  4MBF A;  2A3U A;  1TDG A;  2WGI A;  2Y2L A;  5CRF A;  1ALQ A;  1KGF A;  3Q7V A;  3N8S A;  1ERO A;  4IBR A;  4Z9Q A;  2ZQD A;  4RVA A;  4OPY A;  2XGN A;  3ZNY A;  2DRW A;  4KQO A;  4H8R A;  4KG2 A;  1KE4 A;  3GMW A;  1PYY A;  5CEB A;  3IXB A;  1SCW A;  3HLE A;  3GR2 A;  1MWR A;  1ES2 A;  1K6R A;  4PPR A;  4FH4 A;  3MZE A;  5EVL A;  3GV9 A;  3G2Z A;  5CHJ A;  2ZM2 A;  3UO9 A;  5GLC A;  4U0X A;  1Q2Q A;  4Y0U A;  1IKG A;  5E2E A;  5F83 A;  5AQA A;  4WYY A;  2ZD8 A;  4IED A;  2H0T A;  1K57 A;  4DKI A;  4N92 A;  4JF4 A;  3HRE A;  2ZC5 B;  1GA9 A;  4JKT A;  3MXR A;  4QU3 A;  5FQM A;  1M6K A;  4NET A;  4GNU A;  4F94 A;  5KSC A;  1DJC A;  4P87 A;  2OLV A;  4DF6 A;  4OQH A;  4OPZ A;  3M6H A;  4M3K A;  5M18 A;  5HX9 A;  3BYD A;  2C6W B;  1NY0 A;  3PBR A;  4KZ4 A;  1WYC A;  4N1H A;  5FSR A;  4HES A;  4B88 A;  3G35 A;  2Y91 A;  4PM6 A;  3N8L A;  3UPN A;  1KDS A;  1W5D A;  3V39 A;  1K25 A;  1G68 A;  4X56 A;  1BLS A;  2R9X A;  3PTE A;  2VGK A;  4Y0O A;  2V2F F;  1ERM A;  2Q9N A;  3LY4 A;  1E4D A;  2OLU A;  3ZFZ A;  1EWZ A;  4WZ4 A;  3MXS A;  4YFM A;  3WS0 A;  1O7E A;  3G2Y A;  3QNC A;  5EVI B;  3ZG7 B;  4QB8 A;  3LCE A;  5L2F A;  4Q8I A;  3BEC A;  3MKE A;  2Y4A A;  3MFD A;  5FDH A;  1BUL A;  4QY5 A;  5DTK A;  3UE3 A;  4DE0 A;  4ZTK A;  3VP4 A;  3M6B A;  3RXX A;  3UPO A;  3GRJ A;  4FSF A;  2X02 A;  3DWZ A;  4XUZ A;  4XUX A;  5CHM A;  5GL9 A;  5FAP A;  3WS5 A;  1ES4 A;  1L0E A;  1GA0 A;  3GVB A;  5GLA A;  5A92 A;  4B4X A;  2HDR A;  1FSY A;  3M2J A;  2ZM8 A;  2UWX A;  1MWT A;  5CGX A;  3SS3 A;  1ZKJ A;  1FSW A;  1MWS A;  1S0W A;  5HAP A;  1NYY A;  1Q2P A;  2ZC7 A;  3HUM A;  3IH8 A;  3TG9 A;  1XA1 A;  4OOM A;  1HTZ A;  5HAQ A;  4KZ5 A;  3S4X A;  3CZD A;  1FCN A;  3LO7 A;  2H0Y A;  4MBH A;  3VSK A;  3PAE A;  1XKZ A;  1IEL A;  3WWX A;  1GCE A;  1CI9 A;  1KE3 A;  1PWC A;  3HUO A;  4E3M A;  1YMS A;  1PW1 A;  1H8Y A;  1ESI A;  1K54 C;  5A90 A;  3Q07 A;  2CC1 A;  1XXM A;  5E2G A;  3MBZ A;  3G30 A;  3MZF A;  1BLP A;  3NDG A;  4X6T A;  5CXW A;  5HAI A;  5M1A A;  1Z6F A;  1AXB A;  1TVF A;  1KGE A;  3BFG A;  1K55 A;  1LHY A;  4WZ5 A;  4E3O A;  4OLG A;  1N4O A;  5HFO A;  4E6X A;  4LV0 A;  1WYB A;  4OLD A;  1WE4 A;  1BZA A;  1ES5 A;  1SHV A;  3PBN A;  3GSG A;  4WBG A;  3W4P A;  2JC7 A;  3OC2 A;  4S2K A;  4DXB A;  1K57 C;  1K56 D;  1W8Y A;  3NC8 A;  4R3J A;  4Y0T A;  1SKF A;  3IF6 C;  4KQQ A;  2B5R A;  2XQZ A;  3IXG A;  3MKF A;  5JYO A;  5M19 A;  1XP4 A;  4R0Q A;  3NDE A;  1K38 A;  3VP3 A;  4BL2 A;  1XPB A;  2XF3 A;  4WM9 A;  4P85 A;  3ZHH A;  1XX2 A;  1IYS A;  4S2N A;  1LL5 A;  3G4P A;  3OCN A;  1PZP A;  1YLZ A;  3IT9 A;  4UAA A;  4ZDX A;  1E3U A;  3ITA A;  4C3Q A;  3G31 A;  4K0W A;  5EPH A;  1YM1 A;  3BLM A;  4LV2 A;  2V20 A;  3ZDJ A;  1GHP A;  2R9W A;  5FQQ A;  1MBL A;  2ZM0 A;  5F82 A;  1L0F A;  2JCH A;  4QJG A;  5CER A;  5TR7 A;  1XA7 A;  4LV3 A;  5FI6 A;  2H10 A;  1BUE A;  4UA7 A;  1ES3 A;  3ISG A;  3UE0 A;  2WUQ A;  4Y7P A;  2EX2 A;  5DTS A;  5TFQ A;  4ZBE A;  2FFY A;  4P6B A;  1U60 A;  2WAE A;  4EV4 A;  1FOF A;  1H8Z A;  4FD8 A;  3UDX A;  1C3B A;  1NZU A;  2XD5 A;  3JYI A;  5AQ7 A;  2RL3 A;  1ERQ A;  4YIN A;  3S22 A;  1FQG A;  3Q81 A;  2OV5 A;  5IHV A;  2IWB A;  3O87 A;  4DE3 A;  1YMX A;  1KGG A;  3VP0 A;  1SDE A;  3IXH A;  3N8R A;  5CGW A;  1G6A A;  3IF5 A;  1HVB A;  2JBF A;  3C7V A;  3O88 A;  2J7V A;  2EFU A;  5F1F A;  1L2S A;  4ZJ3 A;  3ZVT A;  1I2W A;  1IKI A;  4E3I A;  1PIO A;  1MWU A;  3NY4 A;  4KZ6 A;  4OON A;  1QME A;  5EOO A;  1L0G A;  4B4Z A;  4QY6 A;  2EXA A;  1KDW A;  2Y2P A;  1IYQ A;  3DWK A;  4GDN A;  3LEZ A;  3FZC A;  3OPR A;  1XGI A;  4S2I A;  2XFS A;  4UHU A;  4OVD A;  5FAO A;  5CED A;  4FH2 A;  2P9V A;  2WGV A;  2Y2H A;  3Q1F A;  5FAT A;  2Q9M A;  3A3D A;  5I94 A;  2Y2I A;  1BSG A;  1BTL A;  4JXS A;  3N6I A;  1TEM A;  3IQA A;  4DDS A;  4KG6 A;  1W7F A;  3NI9 A;  2FFF B;  4KZB A;  4E3J A;  4QD4 A;  1K55 C;  2WKE A;  1LI0 A;  1ZC2 A;  3NCK A;  2ZQA A;  3HLD A;  4WMC A;  3SOI A;  5FQI A;  3SS4 A;  4BD0 A;  1FCM A;  3UPP A;  4E3L A;  4PM5 A;  4U3T A;  4WEJ A;  4EBL A;  1KVM A;  1E3U D;  2WAF A;  1ONH A;  2P9V B;  3FWL A;  4EBP A;  1NXY A;  1HZO A;  2GDN A;  3PAG A;  4S2M A;  5EVI A;  2HP6 A;  3LY3 A;  4KZ9 A;  5KSH A;  3OCL A;  1LLB A;  4OPQ A;  2ZC3 B;  5GHY A;  2G2U A;  3E2K A;  3IWI A;  5HW3 A;  2IWC A;  1VQQ A;  3BEB A;  3G34 A;  3BRM A;  3SH8 A;  3FYZ A;  2J9O A;  4JXW A;  2Y2Q A;  4LCL A;  4PM9 A;  3VMA A;  2EX9 A;  2J8Y A;  1NRF A;  4JXG A;  3FKV A;  3N7W A;  5JYP A;  1W79 A;  4KZ7 A;  4S2N C;  4E3K A;  2QZ6 A;  4KZA A;  1BLH A;  2JE5 A;  1KE0 A;  3C4O A;  3O3V A;  2VGJ A;  1IYO A;  5EEC A;  2XLN A;  4BLM A;  4CPK A;  4DXC A;  3W4Q A;  5G18 A;  1HD8 A;  5A93 A;  2DCF A;  1ZG4 A;  3VP2 A;  3P09 A;  4UA9 A;  2ZQ8 A;  3OPP A;  4OH0 A;  4OP5 A;  5GLB A;  1CEG A;  1L0D A;  2Y2M A;  4X55 A;  3FKW A;  5KMW A;  3OPH A;  4KG5 A;  3RXW A;  1YT4 A;  4MNR A;  4U0T A;  4WZ5 C;  2OSU A;  5E2H A;  3QHY A;  3VFH A;  3HLW A;  5TGF A;  1JWV A;  5DVA A;  4JXV A;  1CI8 A;  2WGW A;  3G32 A;  3ZCZ A;  1MY8 A;  2ZJ9 A;  2EXB A;  1OME A;  3EQU A;  2ZQ7 A;  3IHA A;  4JPM A;  4PM7 A;  4QHC A;  1PW8 A;  3BLS A;  4BQM A;  4GOG A;  4N9L A;  3E2L A;  4BJP A;  5CEC A;  3Q7V B;  5E2F A;  2H5S A;  3BFC A;  4GDB A;  3B3X A;  5A91 A;  3BFF A;  3W8K A;  4XXR A;  1RGY A;  3IF6 B;  2RCX A;  3ZG0 A;  3V50 A;  2ZQC A;  4R1G A;  2HDU A;  3ITB A;  3PBQ A;  4GD6 A;  4WMC D;  5CHU A;  3V3R A;  3ZGA B;  1YLW A;  3I7J A;  4EQI A;  4EWF A;  5FAQ A;  2A49 A;  3PBT A;  2HDQ A;  2P74 A;  1LI9 A;  1N9B A;  4OKP A;  3DW0 A;  1I2S A;  4X69 A;  3C4P A;  4R3B A;  2QPN A;  1YLP A;  4MEZ A;  2WAD A;  4R23 A;  4JLF A;  5BOH A;  1NJ4 A;  2XDM A;  5EVI D;  1YLJ A;  4WEK A;  2Y2J A;  5FAS A;  3ZNT A;  1PWD A;  2XD1 A;  3FV7 A;  4S2J A;  3V3S A;  5FI2 A;  4ZJ2 A;  5CTM A;  3S1Y A;  5EOE A;  4CJN A;  2WYX A;  1YLY A;  1NZO A;  3HLB A;  3HUN A;  5FQ9 A;  2EX6 A;  4WEL A;  1SDN A;  1CEF A;  4X68 A;  2HP5 A;  1FR1 A;  3CMZ A;  1K6S A;  1MKI A;  3D4F A;  3BM6 A;  4BEN A;  1GHI A;  4OP8 A;  3A3I A;  5J8X A;  4EBN A;  2XFT A;  4ZAM A;  3A3E A;  4GB7 A;  4BD1 A;  1MXO A;  3IWO A;  3WS2 A;  3P98 A;  3PBO A;  3UNW A;  3VP1 A;  4NK3 A;  1IYP A;  1XGJ A;  1DJB A;  1GHM A;  1YLT A;  4N1X A;  3UY6 A;  4UA6 A;  3HBR A;  3VOZ A;  1JTG A;  2Y2K A;  3CJM A;  3AGD A;  4EUZ A;  1PZO A;  3WRT A;  5AQB A;  2J9P A;  4KZ8 A;  1DY6 A;  2BG1 A;  4E3N A;  3ZG9 B;  1K4E A;  2Y55 A;  4LV1 A;  4PM8 A;  2X71 A;  5EUA A;  3UE1 A;  4R4S A;  4C6Y A;  3C7U A;  2PBY A;  1PI5 A;  5DF8 A;  2Y2G A;  4E6W A;  2DNS A;  5FQK A;  2WKI A;  1RCJ A;  4O7D A;  3A3J A;  4S2P A;  5EE8 A;  4R4R A;  1H5X A;  3SS5 A;  3AGF A;  2HPB A;  1M40 A;  1ONG A;  2WZZ A;  3WRZ A;  4MLL A;  2ZC6 B;  2PU4 A;  3VOY A;  4MBK A;  1E25 A;  3WS4 A;  3NIA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...