3WRTA

Wild type beta-lactamase derived from chromohalobacter sp.560
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
357
structure length
357
Chain Sequence
QTREVLDPIVASLMEAQQIPGMAIALVRPEGTTISHYGAADRETGTPVDDDTLFEIGSLSKTLTATLASLAEVEGKLDFDAPVSRYLPELEGSAFDDISGLNLGTHTGGGLPLFVPDEVTDRASLMAWYREWQPTEPIGESRTYSNLGIGLLGLETAASLDGEFVPTMRAKVLAPLGMQDTWYDVPEARMADYAMGEDKDGQPTRVSPGVLDDEAYGIKTTAADLAKLVRANLHLADVDAELQQAIDATRQGHYRVGDMTQALIWEQYSLPVAPETLRAGNGYDMILEPNAAEALEPPQSPRDDVWVNKTGSTNGFGGYIVMLPGKHTGLVMLANKNYPNDARVEAAYRILSGLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Beta-lactamase
publication title Structure of a highly acidic beta-lactamase from the moderate halophile Chromohalobacter sp. 560 and the discovery of a Cs(+)-selective binding site
pubmed doi rcsb
source organism Chromohalobacter sp. 560
total genus 113
structure length 357
sequence length 357
chains with identical sequence B, C
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2014-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3wrtA00
3CZDA 2J8YA 3N8RA 2ZC6B 3M6BA 3MZEA 4N1XA 3A3DA 2EFUA 1DJBA 4OP8A 4R23A 3IQAA 4EV4A 2A3UA 4S2NC 3ZG5A 4IEDA 2WKEA 1YT4A 1K38A 2Y2NA 5KZHA 5AQ9A 3WS0A 1KE4A 2H0YA 4LV1A 1MWSA 1SDNA 2HPBA 4N9KA 2R9XA 4OQ0A 3UE0A 2EX8A 3V3RA 4ID4A 1BULA 5HW3A 4PM9A 4QD4A 3FWLA 2Z2LB 1GHPA 3DWKA 1MWTA 2OLUA 4OOLA 5TGFA 4BD0A 4UA9A 1QMEA 2WGVA 5DF8A 3Q7VB 3OPHA 3HLCA 3MBZA 5E2GA 1L0FA 5FAPA 1YLWA 2XD1A 3TOIA 5EPHA 3G32A 4OPQA 2ZQ9A 4ZJ1A 3VP3A 3UNWA 3VMAA 4ZJ2A 2OLVA 2E8IA 4RX3A 5EVIB 1KVMA 2V1ZA 3FV7A 5F1FA 4C75A 4DE0A 1LLBA 3BLSA 3PBQA 3QNBA 1QMFA 1KE0A 1GHIA 2ZQAA 1FQGA 1LI9A 4MEZA 2H10A 4GD6A 3ZG0A 2ZC3B 4OQGA 2XQZA 1K57A 5F1GA 3M6HA 4S2OA 1KGEA 4PMAA 4BD1A 4XUZA 4C3QA 3BEBA 4NETA 1N4OA 3BYDA 1SCWA 1Z6FA 5GHYA 2P9VB 4R1GA 1MWRA 3FYZA 2ZC5B 4BL2A 3WS1A 2R9WA 3SS4A 2V2FF 5JYPA 4CPKA 2ZQCA 4P85A 3ZDJA 5GLBA 4FH4A 4R3JA 3UE1A 1FCMA 2X01A 3BFFA 2JE5A 3G2ZA 2DCFA 2Y2MA 3IF5A 4L0LA 4BQMA 3MZFA 1E3UA 3IXGA 5EOOA 1G6AA 3BM6A 2WK0A 4EBLA 4JPMA 4P6BA 2Y2JA 2WAFA 3QNCA 1S0WA 5A90A 1FOFA 1SKFA 3ZVTA 2WAEA 3GRJA 4KZ9A 1CK3A 4GN2A 3RXWA 1ES3A 1E3UD 5DVAA 2FFFB 4GZBA 5E2EA 3G34A 5G18A 4Y0OA 4B4XA 4X68A 4OLDA 1JWVA 2PU2A 2ZD8A 3A3JA 3M2KA 3HREA 3V5MA 2C5WB 2IWBA 3JYIA 4GDNA 4ZAMA 4R4RA 5EVLA 4X6TA 3VOYA 5CEBA 2WADA 4KG2A 3HLEA 4RA7A 5FDHA 1GHMA 1XP4A 3Q7ZA 2WUQA 4WZ5A 5E2FA 3ZG9B 1FSWA 2A49A 2QPNA 4JLFA 4IBRA 1TEMA 4OKPA 1ES2A 5FQIA 2I72A 1K54A 4D2OA 3BFGA 4E3NA 4S2IA 1HVBA 1MXOA 4GNUA 1CEGA 5CHMA 3NY4A 4Q8IA 1IEMA 1YLJA 3C5AA 3IWQA 5FQMA 1ONHA 1IYPA 2PU4A 4WZ4A 1IYSA 4E3JA 4KG6A 3ZGAB 5FAOA 4EWFA 3E2LA 4Y0UA 1ERMA 5CTMA 4BJPA 3IF6B 3IWIA 4S2PA 3I7JA 3GVBA 2OSUA 4LV2A 1EI5A 4RVAA 4XUXA 2Y2KA 1M6KA 1YQSA 4DDYA 4P87A 3NBLA 3PBSA 4KQQA 1TDLA 4JKTA 4S2JA 3BECA 4S2MA 2Q9NA 1KDSA 3RJUA 1XA7A 4YINA 2Y55A 3Q07A 4LV3A 1NYYA 1FSYA 4ZJ3A 1JWZA 3TG9A 3NI9A 1ONGA 1L0EA 1W8YA 2XEPA 1K6SA 3G30A 1I2WA 1K56D 3LCEA 2EFXA 3OPRA 3UDIA 3UPOA 3NDEA 3IWOA 5F83A 4M3KA 4DXBA 4OONA 4Y0TA 4PPRA 3VP4A 3OZHA 1H5XA 4DKIA 3N7WA 1HZOA 3S1YA 1IELA 4F94A 3CMZA 3V50A 3LO7A 2WKHA 4QY6A 3IF6C 2Y2IA 1LL5A 3ZG7B 2ZM0A 4OQHA 5EE8A 3HBRA 3UE3A 4ZTKA 3GMWA 1I5QA 5JYOA 3C4PA 4KZAA 2C6WB 5KMWA 3P09A 4PM5A 1PI4A 2H0TA 1MWUA 3HUOA 4GD8A 5CGXA 4LCLA 5FQ9A 2EX2A 1Y54A 5DTKA 1BSGA 2QMIA 3BFEA 4ZDXA 5A92A 3N6IA 5FI2A 2XFTA 2XD5A 1JWPA 1JVJA 1PI5A 4FD8A 4KZ4A 5CXWA 3C7VA 3ZFZA 1SDEA 1TVFA 4MBKA 4N9LA 1W8QA 3AGEA 3Q81A 3VP2A 1CI9A 1ES4A 4GKUA 2XF3A 4UHUA 5TFQA 1W5DA 3HLBA 4EUZA 3B3XA 1GA0A 2EXBA 2B5RA 3ZNYA 1G68A 4X69A 3WRTA 1PIOA 2IWCA 1VQQA 1H8YA 2XLNA 3SH9A 5M18A 4U0XA 5CGWA 5A93A 1IKIA 4EQIA 1W79A 2G2UA 2JC7A 1PW1A 4UA7A 1ALQA 3OC2A 4WM9A 4S2NA 1BUEA 5CEDA 3FKWA 5CHUA 1K4EA 3BFCA 3PBRA 3HLDA 2EXAA 3PBNA 1K55C 1SHVA 5CERA 3NC8A 3RXXA 3HUNA 4HESA 5EVIC 5M1AA 2WGWA 2HDRA 1I2SA 4JBFA 2XGNA 3VFHA 4QY5A 1LHYA 3MXSA 3A3EA 1XGIA 1YLZA 1XGJA 2ZLYA 4OQIA 4X55A 4KZ8A 4WBGA 5FQQA 4GB7A 3ISGA 2J9PA 1KGFA 4K91A 2P74A 5GHXA 3DW0A 1H8ZA 4WYYA 5DF7A 2ZJ9A 1CEFA 5L2FA 1PWDA 1RP5A 4B88A 3NDGA 3O87A 5EECA 4BLMA 2FFYA 3IHAA 3ITAA 5GLAA 4R4SA 4JXWA 4OVDA 1IYOA 3N8SA 3PAEA 5FA7A 3BRMA 5FQJA 3SS5A 1N9BA 1MKIA 5CECA 4U0TA 4IVKA 4DRTA 1NJ4A 3WWXA 1W7FA 5D3OA 3OPPA 4IBXA 1NY0A 1XX2A 2ZC7A 3VP0A 1BLSA 3G31A 3G35A 3GTCA 1KE3A 2ZM8A 3Q1FA 2WZXA 4HBUA 3C4OA 4S2KA 4KZ6A 5GL9A 3UPNA 2WZZA 3W4PA 1K4FA 1XA1A 3GR2A 2HDQA 3PBTA 3Q7VA 4NK3A 3V3SA 3WRZA 1FCOA 4E3LA 2HP9A 2H5SA 3P98A 4OPYA 5E2HA 2HP5A 1L0GA 4RYEA 1IKGA 5E43A 1XKZA 3M2JA 5CGSA 2DRWA 3FZCA 1YLPA 1O7EA 4JXVA 4DE3A 5EOEA 4MNRA 1PZOA 5HAIA 4A5RA 1BLCA 3VSLA 4JXSA 4QU3A 5HL1A 4E3KA 4FCFA 1BLPA 4MBHA 1ESIA 2J9OA 3FKVA 1E4DA 3HLFA 1Q2PA 3CG5A 3G4PA 3MXRA 3A3IA 1PZPA 4N1HA 4R3BA 4X56A 1GCEA 5FASA 1M40A 2Y59A 3BFDA 1YMSA 3O86A 3UY6A 4JF5A 2P9VA 2WGWB 3O3VA 1ZKJA 2G2WA 1NZOA 5AQAA 4LCMA 2UWXA 3MKFA 4WEKA 5HAQA 5FI6A 3TSGA 3LY4A 3V39A 4EBNA 3S22A 4PM6A 1LI0A 2Y91A 3W4OA 2ZQ7A 2ZM2A 3IXHA 1K57C 4LENA 2Y2LA 5A91A 3SS3A 3LY3A 2V20A 4JF4A 4K0XA 1KVLA 3HVFA 3IXDA 1L0DA 4S2LA 1BLHA 4KZBA 1E25A 3ZNTA 2DNSA 4YFMA 1CI8A 1YLTA 4OPRA 5M19A 1HTZA 1RGZA 1ZC2A 2HDUA 5BOHA 1FCNA 4KQOA 2Q9MA 3D4FA 4B4ZA 1XXMA 4QB8A 2JCHA 1JTGA 2Y2GA 4K0WA 3UO9A 5IHVA 4JXGA 4E3IA 5DTTA 1NYMA 1BZAA 1L2SA 1OMEA 2XH9A 3NIAA 3EQVA 3OCNA 4UA6A 2QZ6A 3ITBA 5DTSA 3ZCZA 1ESUA 1AXBA 1PW8A 4Z9QA 4CJNA 1ZG6A 2HDSA 1K25A 2XK1A 2ZQDA 5TR7A 2OV5A 3AGFA 2ZQ8A 1U60A 2WGIA 4BL3A 1JTDA 1MBLA 2Z2MB 4C6YA 1FR1A 4JF6A 4OPZA 1PYYA 5FATA 1ERQA 3IT9A 2EX9A 3PAGA 4GDBA 4PM8A 4R0QA 5GHZA 5HX9A 3GV9A 3O88A 2PBYA 3IH8A 4XXRA 2Y2HA 5F82A 4WELA 1NZUA 4BENA 4FSFA 4MLLA 5FI7A 1EWZA 4OH0A 3PTEA 4OP5A 4WZ5C 2BLSA 3VP1A 3PBOA 1Q2QA 3IH9A 4LV0A 2X02A 1RCJA 3IF6A 3Q82A 1PWCA 5CRFA 4E6XA 4PM7A 4P0MA 1S6RA 1K54C 1KDWA 2CC1A 1XPBA 3VOZA 5CHJA 4N92A 4DDSA 3UPPA 1HD8A 1NXYA 3HUMA 2RCXA 3UDXA 3N8LA 3HLWA 4KENB 5KSCA 2HP6A 3SOIA 1EROA 4WMCA 2EX6A 5FSRA 3WS4A 4HBTA 4DF6A 2XDMA 1K6RA 3IHBA 1YLYA 3LEZA 4GOGA 3HL9A 4KZ3A 4KZ7A 1O07A 3DTMA 3GQZA 3W4QA 4EBPA 2VGKA 3E2KA 3GSGA 4WMCD 3VFFA 4DE2A 1FR6A 1NRFA 3UDFA 2JBFA 2XR0A 1ES5A 4FH2A 4DE1A 5CTNA 4ZBEA 4OLGA 3DWZA 3N4IA 4RX2A 4KQRA 4UAAA 3ZG8B 1WYBA 2XFSA 2WYXA 2Y2PA 5HARA 3BLMA 1RGYA 3WS5A 2Y2OA 2BG1A 5AQ7A 3MKEA 5DF9A 2IWDA 5KSHA 4H8RA 3VSKA 1IYQA 1LL9A 4E3MA 4OOYA 4O7DA 5J8XA 1BTLA 3MZDA 1KGGA 3A3FA 3UN7A 1BT5A 3ZHHA 5HFOA 2GDNA 3EQUA 4DXCA 2ZC4B 4U3TA 3C7UA 5FAQA 3SH8A 5FQKA 3MFDA 4KG5A 1K55A 3S4XA 2X71A 2Y2QA 5GLCA 2Y4AA 5EVIA 3SH7A 1DJCA 4X53A 4E6WA 4Y7PA 4E3OA 5GLDA 3OPLA 4KZ5A 1VM1A 5AQBA 3NCKA 3WS2A 1GA9A 1YM1A 4MBFA 2J7VA 5EVID 4WEJA 3HLGA 1J9MA 2VGJA 3W8KA 4QJGA 1YMXA 1PWGA 4HEFA 1MPLA 3IXBA 4QHCA 4OOMA 5EUAA 3OCLA 1TDGA 2RL3A 3G2YA 3ZVWA 1K56A 3AGDA 1WE4A 3QHYA 1DY6A 5I94A 1WYCA 2WKIA 1DJAA 1MY8A 3CJMA 2ZMAA 1ZG4A 5U47A 5HAPA 4IVIA 1C3BA
chains in the Genus database with same CATH superfamily
3CZDA 2FZ0A 4HI4A 1DJBA 4UQIS 2PR6A 3A0SA 4IEDA 1YT4A 3WS0A 5HL6A 2Z6CA 4LV1A 3T50A 4WL9A 2R9XA 4OQ0A 2EX8A 3E0YA 4MDZA 4ID4A 3FWLA 2Z2LB 1GHPA 2XSSA 3DWKA 5DF8A 3MBZA 2ZMFA 3LUQA 1YLWA 3QP5A 4EERA 5DKKA 3CAXA 3G32A 2ZQ9A 4ZJ1A 1UWPX 2OLVA 5MC7A 1LI9A 4MEZA 2H10A 4CLCB 3ZG0A 1OTDA 3LGOA 4OQGA 1K57A 4S2OA 4PMAA 5L10A 1SKOA 5GHYA 2P9VB 4BL2A 1TS7A 3WS1A 3SS4A 3SZTA 1DP9A 4P85A 4EEUA 5GLBA 2X01A 5CX7A 1XFNA 1S4SA 5EOOA 5HZHA 3BM6A 1N9OA 1T1AA 3HJKA 1SKFA 3GRJA 4GN2A 5F69A 3RXWA 3TRCA 4CLCE 2ZL1A 5G18A 1OTBA 4LPZA 4OLDA 3A3JA 1H8MA 2WUQA 1FSWA 4JLFA 4H6JA 4IBRA 2WKPA 1TEMA 1ES2A 2PBDP 2I72A 3BFGA 4DJ2A 5CHMA 3NY4A 1YLJA 3C5AA 5FQMA 3E2LA 2V8FA 3S7QA 4BJPA 3IWIA 3I7JA 1YPRA 4FOFA 4RVAA 4XUXA 2PYPA 4CLCD 1VETA 4AFIA 4P87A 2M7UA 3NBLA 3PBSA 4S2MA 3TJZC 2J80A 2ZMVA 3UDIA 2KLIA 4Y0TA 2EWVA 4PPRA 4MN7A 3VE4A 3V50A 3LO7A 1LL5A 2VV6A 3ZG7B 4QPRA 4OQHA 1TS0A 3UE3A 3GMWA 1I5QA 3JVVA 1NLZA 5KMWA 4L9GA 3BQAA 3CPTB 4LCLA 2EX2A 4UQIM 4EU0A 2PHYA 1H3QA 4FD8A 1SDEA 4MBKA 2AVXA 1CI9A 2XF3A 3MQ0A 1GA0A 4K08A 1G68A 1H8YA 3W2ZA 3R4KA 2VGLS 4Y15A 1ALQA 3OC2A 4S2NA 1BUEA 5CHUA 1K4EA 3BFCA 3HLDA 3H9WA 3PBNA 1K55C 1TF1A 4NXBA 4ETXA 3LR0A 5M1AA 5EFWA 2XGNA 3VFHA 1Y28A 2NUTC 1YLZA 4HP4A 4CLCC 2G7UA 4KZ8A 3HCYA 4K91A 2VA0A 5GHXA 5DFXA 5L2FA 3ITAA 5GLAA 4R4SA 3BRMA 4WN5A 4IVKA 5HDCA 1XJ2A 2PAVP 1XX2A 4KUOA 1BLSA 2PD8A 3C4OA 3IX3A 2XROA 2XRNA 2M7VA 3TW8A 3GR2A 1XA1A 3PBTA 3W4PA 2QJ5A 3WRZA 1W63Q 2W3FA 2HP9A 5HWVA 3P98A 4ME4A 5E2HA 1L0GA 4LRYC 1XKZA 5CGSA 4JXVA 5EOEA 1BLCA 3VSLA 4E3KA 3NJAA 3A0VA 1ESIA 2J9OA 2ZBBA 2JHEA 1E4DA 4ARZB 3T4TA 2K31A 1L3LA 2P9VA 1ZKJA 2G2WA 1GSXA 3P7NA 3V39A 3LY4A 4EBNA 4DMZA 4PM6A 2YKHA 3T4QA 3SS3A 2KX6A 4LENA 3HVFA 3K3CA 3VOLA 2PT7A 1YLTA 2INWA 3LI8A 2B18A 4P6ZS 4F3LB 2JCHA 3T1SA 5IHVA 4E3IA 5DTTA 1NYMA 1BZAA 1OMEA 3EQVA 4UA6A 2QZ6A 1ESUA 3B47A 3S7NA 2OWHA 3B33A 3RFBA 5TR7A 4BL3A 4JGQA 4OPZA 1ERQA 1DP8A 4GDBA 4PM8A 3PYPA 3IH8A 5F68A 2Y2HA 2VV8A 4WF0A 4FSFA 4WZ5C 3PBOA 1Q2QA 1PFLA 4LV0A 5CRFA 3D9YA 4PM7A 3U4LP 1K54C 1KDWA 4HH2A 1XPBA 3VOZA 2VGLM 4HQAA 3T4LA 4DDSA 1NXYA 4JGOA 3HLWA 2OAP1 4IHQA 5FSRA 1YSQA 3WS4A 4DF6A 2XDMA 1K6RA 3IHBA 1YLYA 3LEZA 1Y4OA 4GOGA 3DTMA 4EBPA 2VGKA 2PYRA 3C30A 1MKMA 4FH2A 3UB5P 4OLGA 4CQHA 1XJ4A 2Y2OA 1XJ3A 3CPTA 1OTAA 4E3MA 3UN7A 1WA9A 2GDNA 3EQUA 1D7EA 3MFDA 4KG5A 1OPXA 2X71A 1F98A 1T1BA 4E6WA 3CI6A 3WS2A 1YM1A 3IX8A 4MBFA 2VGJA 4OOMA 3OCLA 4EETB 2MJ6A 1NRJA 3C2WA 4PKYG 2WKIA 1DJAA 3T4OA 5FAOA 2ZC6B 4N1XA 4EV4A 3IQAA 4I3JA 4Y13A 2ZOHA 2WKEA 2Y2NA 5AQ9A 2H0YA 2K2NA 3V3RA 2JN7A 3UB9A 5HW3A 4Y5FA 2IA2A 4IUHA 2OLUA 5HWWA 4UA9A 1QMEA 2WGVA 4P6ZM 3A0RA 3HLCA 1L0FA 2VJWA 4NXEA 3TOIA 4OPQA 3VP3A 3UNWA 3VMAA 3IBRA 1XJ6A 2E8IA 5EVIB 2V1ZA 3FV7A 4DE0A 2W3DA 1LLBA 3QNBA 2W1RA 5F1GA 1KGEA 1T1CA 3LICA 4G3VA 4XUZA 4C3QA 1N4OA 3BYDA 1Z6FA 4R1GA 1MWRA 3CUEC 3EEAA 4CPKA 4GHIB 2ZQCA 2L1MA 2O9CA 4FH4A 1FCMA 3BFFA 3G2ZA 4NG2A 4BQMA 3IF5A 4ARZA 4MN5A 5HDDA 2Y2JA 1S0WA 5A90A 4HP9A 1H0MA 5E2EA 3G34A 4KQDA 4Y0OA 5EVEA 3NULA 2ZD8A 2IWBA 1XP4A 4F3LA 3Q7ZA 3KSIA 3ZG9B 2JKTI 2QPNA 2V1BA 4OKPA 4HH3A 1CEGA 1G28A 1IEMA 1ONHA 2PU4A 4WZ4A 1IYSA 4E3JA 5DJUA 1ERMA 5CTMA 3NHQA 2OSUA 5KIZA 2V9AA 3D3OA 1YQSA 3BECA 2Q9NA 1KDSA 1XA7A 2VLGA 3NOUC 4ZJ3A 1FSYA 1JWZA 3TG9A 3NI9A 1L0EA 1W8YA 1K56D 3LCEA 2EFXA 3OPRA 3IWOA 1FILA 4M3KA 4OONA 3OZHA 3S1YA 3SW1A 2V0WA 3CMZA 4EXOA 5IU1A 1DRMA 2ZM0A 3LYXA 3HUOA 2PDRA 4LRXC 2QMIA 4QWOA 1ZHHB 5A92A 5FI2A 2XFTA 1JVJA 5CXWA 3C7VA 2O99A 5AJGA 4N9LA 3T1QB 3Q81A 4Q0HA 5TFQA 1OTEA 3B3XA 2B5RA 1N9NA 3LI9A 4X69A 1PIOA 1OTIA 1VQQA 5M18A 4M4XA 5CGWA 5A93A 1IKIA 5EM0A 2G2UA 2VKSA 1PW1A 3LIDA 1OJGA 1S1YA 4I3IA 3FKWA 4PHTA 2GNXA 5CERA 4I39A 5EVIC 2WGWA 1DP6A 4QY5A 3KO6A 1OJ5A 2B95A 4OQIA 3FC7A 1XGJA 4X55A 4WBGA 4WUJA 4NKPA 5G4YA 5FQQA 2J9PA 1KGFA 1H8ZA 1T18A 3UE6A 3LR4A 1YSPA 3H7WB 4B88A 2D01A 4L9EA 5EECA 4X1MA 1STZA 4OVDA 3N8SA 3KSHA 1MKIA 5CECA 4U0TA 2W1TB 4PAUA 5D3OA 2A24B 1NY0A 1TS8A 3VP0A 3G31A 3G35A 3GTCA 1KE3A 2WZXA 4I38A 2WZZA 4NK3A 5K5BA 5LBRA 1FCOA 5HDSA 4YNRA 2H5SA 3G6OA 2HP5A 1IKGA 5E43A 1IOUA 4LRZE 3M2JA 2DRWA 3FZCA 5C5KA 3QP6A 2J3WA 4MNRA 4QU3A 5HL1A 3IS2B 1BLPA 3F1OA 1YKDA 3FKVA 3HLFA 3CG5A 3A3IA 1PZPA 4N1HA 4X56A 2Y59A 1YMSA 4X1LA 2PD7A 4LCMA 3MKFA 4WEKA 4GHIA 3TSGA 2QWSA 3H82B 1GSWA 4L9FA 2Y91A 2ZM2A 3IXHA 2Y2LA 3LY3A 4JF4A 1KVLA 3DTIA 1BLHA 4YFMA 4BWIA 1NLYA 4B4ZA 2QJ7A 3UO9A 3S7OA 3UB7A 1L2SA 3OCNA 3ZCZA 3ITBA 2Y8HA 2XK1A 3AGFA 2ZQ8A 1JTDA 4JF6A 1PYYA 2EX9A 3PAGA 4R0QA 3PHYA 3VV4A 3GV9A 1CF0A 5F82A 4WELA 4BENA 5L09A 4OH0A 2BLSA 3VP1A 4X25A 1VB6A 4KUKA 4E6XA 2QHKA 3EGXC 2HJ9C 5A8BA 2J3TD 3UPPA 2HF6A 3UDXA 3N8LA 5KSCA 4I3AA 2HP6A 2W3HA 2EX6A 4HBTA 4KZ3A 3HL9A 2P7JA 4KZ7A 2JKRM 4O01A 5FDSA 3E2KA 3GSGA 2H28A 3T12B 2XR0A 4DE1A 2OAQ1 2VZWA 3DWZA 4RX2A 4UAAA 3ZG8B 1WYBA 2XFSA 5HARA 5TBMB 1RGYA 2BG1A 3MKEA 2IWDA 5KSHA 1IYQA 4O7DA 5J8XA 3T1XA 3MZDA 3ZHHA 5HFOA 2ZC4B 5FAQA 2W3GA 3C7UA 3SH8A 1W63M 1K55A 2Y2QA 3V67A 4GS9B 3MS6A 2FH5A 4CLCA 3LEQA 5EV0A 1S66L 4QJGA 4DN0A 1MPLA 4QHCA 1TDGA 1VEUB 4GJ4A 3RTYA 3DTKA 3AGDA 1WE4A 3S7PA 1MY8A 3CJMA 3MQOA 2ZMAA 5U47A 4IVIA 1C3BA 2EA9A 2J8YA 3N8RA 3M6BA 3A3DA 2EFUA 4OP8A 4EQ1A 2UV0E 4GLQA 3ZG5A 1K38A 1KE4A 3H7WA 4YWZA 4QD4A 3K2NA 4OOLA 5TGFA 3JPUA 3OPHA 5E2GA 2W1TA 5FAPA 2A24A 5EPHA 4IJGA 4ZJ2A 4RX3A 1KVMA 3F1PB 5F1FA 4C75A 3BLSA 2VK3A 1QMFA 1KE0A 1GHIA 2ZQAA 4EEPA 1FQGA 1OT9A 4GD6A 4IUKA 2ZC3B 3BW6A 1S1ZA 2B02A 3E98A 3C38A 1SCWA 3FYZA 3QP1A 5JYPA 3IS2A 2L0WA 3ZDJA 4R3JA 3OLOA 3UE1A 2JE5A 1MC0A 1ZTUA 2M1CA 4L0LA 2HV1A 3MFXA 3MZFA 1A0KA 1E3UA 5J3WA 3LIEA 2WK0A 4EBLA 4JPMA 4P6BA 3EOIA 2QKPA 2WAEA 1CK3A 1ES3A 2Z6DA 3CITA 4GZBA 1JWVA 2PU2A 3M2KA 3V5MA 1LT0A 4GDNA 4ZAMA 5EVLA 4R4RA 5CEBA 4BMWA 2WADA 4KG2A 3HLEA 1GHMA 5F5YA 4MN6A 4WZ5A 5E2FA 5I5LA 3E4QA 1K54A 4D2OA 1MXOA 4GNUA 2VEAA 4Q8IA 3KYQA 4G3WA 4KG6A 3GVBA 4LV2A 4JGRA 2Y2KA 1LSXA 1M6KA 4DDYA 4KQQA 3RJUA 2Y55A 4LV3A 3T1RA 1ONGA 5AVFA 3G30A 1EW0A 4GCZA 3UPOA 4DXBA 1ODVA 3N7WA 1HZOA 4F94A 4QY6A 3IF6C 2Y2IA 5EE8A 3HBRA 4ZTKA 3C4PA 2ZL1B 3MSHA 4BBUA 3P09A 1D1JA 4PM5A 1PI4A 1P0ZA 4R70A 4GD8A 5FQ9A 3L7HA 4Q0JA 1P97A 5DTKA 1BSGA 1G5UA 3BFEA 2XD5A 1PI5A 2P04A 3DBAA 5FL3A 4R6LA 1SZVA 3AGEA 3VP2A 1ES4A 4GKUA 3MXQA 4WLAA 1PNEA 1W5DA 5EM1A 3KSFA 2W0NA 3NOPC 3WRTA 3DAVA 2XLNA 4U0XA 1FIKA 4EQIA 2EWWA 4GS9A 2JC7A 4UA7A 2PR5A 2LB5A 5HPIA 2EXAA 1SHVA 3RXXA 3F1NB 3L9KA 1VEUA 1I2SA 4GW9A 4JBFA 1LHYA 3MXSA 3A3EA 3HJIA 1J3WA 3MMHA 4MMNA 2P74A 3DW0A 3RH8B 5HWTA 1CEFA 1PWDA 1RP5A 3IHAA 5TJJA 3BJNA 3PAEA 5FQJA 3MQQA 1N9BA 4XT2B 5HD5A 1S4RA 4DRTA 4HHDA 1NJ4A 3WWXA 1NWZA 2A2LA 3OPPA 3U2AA 2ZC7A 4HBUA 4JGPA 3Q1FA 5GL9A 1LSVA 3UPNA 3CUEA 1K4FA 4HY8A 2HDQA 5F6AA 3T4KA 1VHMA 5L07A 3O5YA 4RYEA 3KX0X 4NXGA 4DE3A 1PZOA 4A5RA 4JXSA 4FCFA 2ACGA 1GSVA 3MXRA 2DMWA 4R3BA 5FASA 1GCEA 1M40A 4JF5A 2JKTM 3O3VA 5AQAA 3UB8A 1HLUP 2UWXA 3ULFA 3S22A 2ZQ7A 1K57C 3CWFA 2JKGA 4S2LA 4LFUA 3QP2A 2DNSA 1CI8A 2Q0OA 5M19A 1HTZA 3VE3A 2HDUA 5BOHA 4KQOA 2Q9MA 3KSGA 1XXMA 3LIFA 1JTGA 4EESA 4JXGA 3BY8A 4Q0IA 3NIAA 2XH9A 5DTSA 1AXBA 4CJNA 1K25A 2OV5A 1U60A 1ACFA 3FG8A 2GX5A 1K0KA 5FATA 3IT9A 4HJ6A 5HX9A 5GHZA 2PBYA 3K3DA 4OP5A 1TS6A 3IH9A 3BQ8A 1S6RA 2CC1A 3P01A 4HJ4A 4N92A 1HD8A 3HUMA 4Y2FA 2RCXA 5FEGA 4KENB 3SOIA 1EROA 4WMCA 3CLOA 4Y3IA 1O07A 3GQZA 3W4QA 3C8CA 2KOIA 4O0PA 3VFFA 4DE2A 1NRFA 2OWJA 2JBFA 1ES5A 5CTNA 5HD3A 4KQRA 2QYBA 2Y2PA 2V0UA 5AQ7A 3NOTC 5J4EA 3VSKA 2CMNA 1KGGA 3A3FA 3OOVA 4DXCA 5FQKA 3S4XA 1UWNX 5EVIA 3SH7A 2BTFP 4Y7PA 5GLDA 4KZ5A 1VM1A 3PR6A 1F9IA 1YMXA 1PWGA 3IXBA 2OOLA 5EUAA 2RL3A 3G2YA 5L8MA 3ZVWA 1K56A 2O0YA 3EEHA 4BBVA 3PXPA 1DY6A 5I94A 1WYCA 3UMEA 2XA7S 4Y17A 1CJFA 3F1NA 3MZEA 4R23A 5J7EA 2A3UA 4S2NC 2ZOIA 1S67L 5KZHA 2JKFA 3GECA 1MWSA 1SDNA 2HPBA 4N9KA 3UE0A 1LL8A 1N9LA 3MJQA 3ICYA 1BULA 4PM9A 1MWTA 4BD0A 3Q7VB 2Y79A 4XT2A 4NEED 3DTEA 2XD1A 2W3EA 2NUPC 5FEFA 1UGUA 3PBQA 2JKRI 2XQZA 3M6HA 4BD1A 3BEBA 4NETA 3TE8A 2ZC5B 2R9WA 2V2FF 4B9OA 2GJ3A 2DCFA 2Y2MA 1PRQA 4Z1WA 3IXGA 1G6AA 3JVUA 3KYEA 2WAFA 3QNCA 3QP4A 4E04A 1FOFA 3ZVTA 4KZ9A 4R3AA 1E3UD 5G4ZA 5DVAA 2FFFB 3R7WB 4B4XA 4X68A 3CHWP 3HREA 1JNUA 2C5WB 3JYIA 3VOYA 4X6TA 3BWLA 4RA7A 5FDHA 4EW7A 4I5SA 4LGWA 5DJTA 2A49A 2VV7A 4PKYA 5FQIA 4E3NA 4S2IA 4ETZA 1HVBA 3UMDA 3IWQA 1IYPA 4HNBA 1YAXA 3ZGAB 4EWFA 4Y0UA 3IF6B 4S2PA 3QP8A 1EI5A 3GDIA 4S2JA 1TDLA 4JKTA 4YINA 3Q07A 5HPFA 1NYYA 1XFQA 2XEPA 1K6SA 4II7A 2W27A 1I2WA 1X0OA 3LIBA 3NDEA 1KOUA 2KDKA 5F83A 3VP4A 1H5XA 3EWKA 4DKIA 1IELA 2J3TC 2XA7M 2WKHA 2BASA 5JYOA 4KZAA 2C6WB 1V9ZA 2H0TA 1MWUA 5CGXA 1P9RA 1Y54A 4ZDXA 3N6IA 1JWPA 4KZ4A 3ZFZA 1TVFA 2D02A 1W8QA 1F5MA 4UHUA 4ZRRA 3HLBA 4EUZA 3E4OA 4BBTA 2EXBA 1G6OA 1F2KA 3ZNYA 3B42A 2IWCA 3ZQ5A 1IFQA 2V1AA 1W79A 4DJ3A 2HJEA 4WM9A 4R38A 5CEDA 3PBRA 3NC8A 3HUNA 4HESA 2HDRA 2I9VA 3ZYTA 3BY9A 1XGIA 3H82A 2ZLYA 3KYZA 4GB7A 5IT5A 3ISGA 4WYYA 5DF7A 2ZJ9A 4HOIA 2LB9A 3NDGA 3O87A 4BLMA 2FFYA 4JXWA 1IYOA 5FA7A 2HZ5A 3SS5A 3T4SA 1W7FA 4IBXA 4S2KA 2ZM8A 4KZ6A 5DFYA 3Q7VA 3V3SA 4G3KA 3FPWA 3LR3A 4E3LA 4OPYA 4HJ3A 1SKOB 2P08A 1YLPA 1O7EA 2K7SA 5HAIA 4MBHA 3SH9A 1Q2PA 3G4PA 3UY6A 3BFDA 3O86A 4YOFA 2WGWB 2WKQA 1NZOA 5HAQA 5FI6A 4RQ9A 1LI0A 1MZUA 3W4OA 5A91A 4FTXA 3IX4A 2V20A 4K0XA 3IXDA 1L0DA 2VX8A 4KZBA 1E25A 3ZNTA 4OPRA 4NXFA 1RGZA 1ZC2A 1FCNA 3D4FA 5TBMA 4QB8A 1P9WA 5HSQA 3R7WA 2Y2GA 4K0WA 2WKRA 3LFVA 4H6JB 4EUVA 3NECA 3LR5A 1PW8A 4Z9QA 1ZG6A 2HDSA 2ZQDA 1BYWA 3MR0A 2WGIA 1MBLA 2Z2MB 3MF0A 1FR1A 4C6YA 3UB6A 3O88A 1VETB 4XXRA 1NZUA 4MLLA 5FI7A 1EWZA 3PTEA 5AVEA 2X02A 1RCJA 3IF6A 3Q82A 1PWCA 1T19A 4P0MA 3F1OB 2PRFA 4LLOB 5CHJA 3FPVA 3LIAA 3IBJA 2R78A 4D60A 4UEYA 4MCWA 4WMCD 1FR6A 2V8CA 3D72A 3UDFA 2YKFA 4B93A 2L4RA 4ZBEA 1CQAA 3N4IA 2WYXA 3BLMA 3WS5A 2GZAA 5DF9A 4H8RA 3E4PA 1LL9A 4OOYA 5IS1A 1BTLA 1BT5A 4U3TA 1LSWA 4FUWA 4O8GA 1V9YA 5GLCA 2Y4AA 1DJCA 3F1PA 4X53A 4E3OA 3OPLA 2O9AA 5AQBA 3NCKA 5DKLA 1Z09A 1GA9A 2HGVA 2J7VA 4HIAA 5EVID 4ESPA 4WEJA 1OT6A 3HLGA 2E8JA 1J9MA 3W8KA 4HEFA 2O9BA 3EGDC 1TD5A 1D06A 3OBFA 3T4JA 3QHYA 1AWIA 1ZG4A 5HAPA
chains in the Genus database with same CATH topology
3CZDA 2J8YA 3N8RA 2ZC6B 3M6BA 3MZEA 4N1XA 3A3DA 2EFUA 1DJBA 4OP8A 4R23A 3IQAA 4EV4A 2A3UA 4S2NC 3ZG5A 4IEDA 2WKEA 1YT4A 1K38A 2Y2NA 5KZHA 5AQ9A 3WS0A 1KE4A 2H0YA 4LV1A 1MWSA 1SDNA 2HPBA 4N9KA 2R9XA 4OQ0A 3UE0A 2EX8A 3V3RA 4ID4A 1BULA 5HW3A 4PM9A 4QD4A 3FWLA 2Z2LB 1GHPA 3DWKA 1MWTA 2OLUA 4OOLA 5TGFA 4BD0A 4UA9A 1QMEA 2WGVA 5DF8A 3Q7VB 3OPHA 3HLCA 3MBZA 5E2GA 1L0FA 5FAPA 1YLWA 2XD1A 3TOIA 5EPHA 3G32A 4OPQA 2ZQ9A 4ZJ1A 3VP3A 3UNWA 3VMAA 4ZJ2A 2OLVA 2E8IA 4RX3A 5EVIB 1KVMA 2V1ZA 3FV7A 5F1FA 4C75A 4DE0A 1LLBA 3BLSA 3PBQA 3QNBA 1QMFA 1KE0A 1GHIA 2ZQAA 1FQGA 1LI9A 4MEZA 2H10A 4GD6A 3ZG0A 2ZC3B 4OQGA 2XQZA 1K57A 5F1GA 3M6HA 4S2OA 1KGEA 4PMAA 4BD1A 4XUZA 4C3QA 3BEBA 4NETA 1N4OA 3BYDA 1SCWA 1Z6FA 5GHYA 2P9VB 4R1GA 1MWRA 3FYZA 2ZC5B 4BL2A 3WS1A 2R9WA 3SS4A 2V2FF 5JYPA 4CPKA 2ZQCA 4P85A 3ZDJA 5GLBA 4FH4A 4R3JA 3UE1A 1FCMA 2X01A 3BFFA 2JE5A 3G2ZA 2DCFA 2Y2MA 3IF5A 4L0LA 4BQMA 3MZFA 1E3UA 3IXGA 5EOOA 1G6AA 3BM6A 2WK0A 4EBLA 4JPMA 4P6BA 2Y2JA 2WAFA 3QNCA 1S0WA 5A90A 1FOFA 1SKFA 3ZVTA 2WAEA 3GRJA 4KZ9A 1CK3A 4GN2A 3RXWA 1ES3A 1E3UD 5DVAA 2FFFB 4GZBA 5E2EA 3G34A 5G18A 4Y0OA 4B4XA 4X68A 4OLDA 1JWVA 2PU2A 2ZD8A 3A3JA 3M2KA 3HREA 3V5MA 2C5WB 2IWBA 3JYIA 4GDNA 4ZAMA 4R4RA 5EVLA 4X6TA 3VOYA 5CEBA 2WADA 4KG2A 3HLEA 4RA7A 5FDHA 1GHMA 1XP4A 3Q7ZA 2WUQA 4WZ5A 5E2FA 3ZG9B 1FSWA 2A49A 2QPNA 4JLFA 4IBRA 1TEMA 4OKPA 1ES2A 5FQIA 2I72A 1K54A 4D2OA 3BFGA 4E3NA 4S2IA 1HVBA 1MXOA 4GNUA 1CEGA 5CHMA 3NY4A 4Q8IA 1IEMA 1YLJA 3C5AA 3IWQA 5FQMA 1ONHA 1IYPA 2PU4A 4WZ4A 1IYSA 4E3JA 4KG6A 3ZGAB 5FAOA 4EWFA 3E2LA 4Y0UA 1ERMA 5CTMA 4BJPA 3IF6B 3IWIA 4S2PA 3I7JA 3GVBA 2OSUA 4LV2A 1EI5A 4RVAA 4XUXA 2Y2KA 1M6KA 1YQSA 4DDYA 4P87A 3NBLA 3PBSA 4KQQA 1TDLA 4JKTA 4S2JA 3BECA 4S2MA 2Q9NA 1KDSA 3RJUA 1XA7A 4YINA 2Y55A 3Q07A 4LV3A 1NYYA 1FSYA 4ZJ3A 1JWZA 3TG9A 3NI9A 1ONGA 1L0EA 1W8YA 2XEPA 1K6SA 3G30A 1I2WA 1K56D 3LCEA 2EFXA 3OPRA 3UDIA 3UPOA 3NDEA 3IWOA 5F83A 4M3KA 4DXBA 4OONA 4Y0TA 4PPRA 3VP4A 3OZHA 1H5XA 4DKIA 3N7WA 1HZOA 3S1YA 1IELA 4F94A 3CMZA 3V50A 3LO7A 2WKHA 4QY6A 3IF6C 2Y2IA 1LL5A 3ZG7B 2ZM0A 4OQHA 5EE8A 3HBRA 3UE3A 4ZTKA 3GMWA 1I5QA 5JYOA 3C4PA 4KZAA 2C6WB 5KMWA 3P09A 4PM5A 1PI4A 2H0TA 1MWUA 3HUOA 4GD8A 5CGXA 4LCLA 5FQ9A 2EX2A 1Y54A 5DTKA 1BSGA 2QMIA 3BFEA 4ZDXA 5A92A 3N6IA 5FI2A 2XFTA 2XD5A 1JWPA 1JVJA 1PI5A 4FD8A 4KZ4A 5CXWA 3C7VA 3ZFZA 1SDEA 1TVFA 4MBKA 4N9LA 1W8QA 3AGEA 3Q81A 3VP2A 1CI9A 1ES4A 4GKUA 2XF3A 4UHUA 5TFQA 1W5DA 3HLBA 4EUZA 3B3XA 1GA0A 2EXBA 2B5RA 3ZNYA 1G68A 4X69A 3WRTA 1PIOA 2IWCA 1VQQA 1H8YA 2XLNA 3SH9A 5M18A 4U0XA 5CGWA 5A93A 1IKIA 4EQIA 1W79A 2G2UA 2JC7A 1PW1A 4UA7A 1ALQA 3OC2A 4WM9A 4S2NA 1BUEA 5CEDA 3FKWA 5CHUA 1K4EA 3BFCA 3PBRA 3HLDA 2EXAA 3PBNA 1K55C 1SHVA 5CERA 3NC8A 3RXXA 3HUNA 4HESA 5EVIC 5M1AA 2WGWA 2HDRA 1I2SA 4JBFA 2XGNA 3VFHA 4QY5A 1LHYA 3MXSA 3A3EA 1XGIA 1YLZA 1XGJA 2ZLYA 4OQIA 4X55A 4KZ8A 4WBGA 5FQQA 4GB7A 3ISGA 2J9PA 1KGFA 4K91A 2P74A 5GHXA 3DW0A 1H8ZA 4WYYA 5DF7A 2ZJ9A 1CEFA 5L2FA 1PWDA 1RP5A 4B88A 3NDGA 3O87A 5EECA 4BLMA 2FFYA 3IHAA 3ITAA 5GLAA 4R4SA 4JXWA 4OVDA 1IYOA 3N8SA 3PAEA 5FA7A 3BRMA 5FQJA 3SS5A 1N9BA 1MKIA 5CECA 4U0TA 4IVKA 4DRTA 1NJ4A 3WWXA 1W7FA 5D3OA 3OPPA 4IBXA 1NY0A 1XX2A 2ZC7A 3VP0A 1BLSA 3G31A 3G35A 3GTCA 1KE3A 2ZM8A 3Q1FA 2WZXA 4HBUA 3C4OA 4S2KA 4KZ6A 5GL9A 3UPNA 2WZZA 3W4PA 1K4FA 1XA1A 3GR2A 2HDQA 3PBTA 3Q7VA 4NK3A 3V3SA 3WRZA 1FCOA 4E3LA 2HP9A 2H5SA 3P98A 4OPYA 5E2HA 2HP5A 1L0GA 4RYEA 1IKGA 5E43A 1XKZA 3M2JA 5CGSA 2DRWA 3FZCA 1YLPA 1O7EA 4JXVA 4DE3A 5EOEA 4MNRA 1PZOA 5HAIA 4A5RA 1BLCA 3VSLA 4JXSA 4QU3A 5HL1A 4E3KA 4FCFA 1BLPA 4MBHA 1ESIA 2J9OA 3FKVA 1E4DA 3HLFA 1Q2PA 3CG5A 3G4PA 3MXRA 3A3IA 1PZPA 4N1HA 4R3BA 4X56A 1GCEA 5FASA 1M40A 2Y59A 3BFDA 1YMSA 3O86A 3UY6A 4JF5A 2P9VA 2WGWB 3O3VA 1ZKJA 2G2WA 1NZOA 5AQAA 4LCMA 2UWXA 3MKFA 4WEKA 5HAQA 5FI6A 3TSGA 3LY4A 3V39A 4EBNA 3S22A 4PM6A 1LI0A 2Y91A 3W4OA 2ZQ7A 2ZM2A 3IXHA 1K57C 4LENA 2Y2LA 5A91A 3SS3A 3LY3A 2V20A 4JF4A 4K0XA 1KVLA 3HVFA 3IXDA 1L0DA 4S2LA 1BLHA 4KZBA 1E25A 3ZNTA 2DNSA 4YFMA 1CI8A 1YLTA 4OPRA 5M19A 1HTZA 1RGZA 1ZC2A 2HDUA 5BOHA 1FCNA 4KQOA 2Q9MA 3D4FA 4B4ZA 1XXMA 4QB8A 2JCHA 1JTGA 2Y2GA 4K0WA 3UO9A 5IHVA 4JXGA 4E3IA 5DTTA 1NYMA 1BZAA 1L2SA 1OMEA 2XH9A 3NIAA 3EQVA 3OCNA 4UA6A 2QZ6A 3ITBA 5DTSA 3ZCZA 1ESUA 1AXBA 1PW8A 4Z9QA 4CJNA 1ZG6A 2HDSA 1K25A 2XK1A 2ZQDA 5TR7A 2OV5A 3AGFA 2ZQ8A 1U60A 2WGIA 4BL3A 1JTDA 1MBLA 2Z2MB 4C6YA 1FR1A 4JF6A 4OPZA 1PYYA 5FATA 1ERQA 3IT9A 2EX9A 3PAGA 4GDBA 4PM8A 4R0QA 5GHZA 5HX9A 3GV9A 3O88A 2PBYA 3IH8A 4XXRA 2Y2HA 5F82A 4WELA 1NZUA 4BENA 4FSFA 4MLLA 5FI7A 1EWZA 4OH0A 3PTEA 4OP5A 4WZ5C 2BLSA 3VP1A 3PBOA 1Q2QA 3IH9A 4LV0A 2X02A 1RCJA 3IF6A 3Q82A 1PWCA 5CRFA 4E6XA 4PM7A 4P0MA 1S6RA 1K54C 1KDWA 2CC1A 1XPBA 3VOZA 5CHJA 4N92A 4DDSA 3UPPA 1HD8A 1NXYA 3HUMA 2RCXA 3UDXA 3N8LA 3HLWA 4KENB 5KSCA 2HP6A 3SOIA 1EROA 4WMCA 2EX6A 5FSRA 3WS4A 4HBTA 4DF6A 2XDMA 1K6RA 3IHBA 1YLYA 3LEZA 4GOGA 3HL9A 4KZ3A 4KZ7A 1O07A 3DTMA 3GQZA 3W4QA 4EBPA 2VGKA 3E2KA 3GSGA 4WMCD 3VFFA 4DE2A 1FR6A 1NRFA 3UDFA 2JBFA 2XR0A 1ES5A 4FH2A 4DE1A 5CTNA 4ZBEA 4OLGA 3DWZA 3N4IA 4RX2A 4KQRA 4UAAA 3ZG8B 1WYBA 2XFSA 2WYXA 2Y2PA 5HARA 3BLMA 1RGYA 3WS5A 2Y2OA 2BG1A 5AQ7A 3MKEA 5DF9A 2IWDA 5KSHA 4H8RA 3VSKA 1IYQA 1LL9A 4E3MA 4OOYA 4O7DA 5J8XA 1BTLA 3MZDA 1KGGA 3A3FA 3UN7A 1BT5A 3ZHHA 5HFOA 2GDNA 3EQUA 4DXCA 2ZC4B 4U3TA 3C7UA 5FAQA 3SH8A 5FQKA 3MFDA 4KG5A 1K55A 3S4XA 2X71A 2Y2QA 5GLCA 2Y4AA 5EVIA 3SH7A 1DJCA 4X53A 4E6WA 4Y7PA 4E3OA 5GLDA 3OPLA 4KZ5A 1VM1A 5AQBA 3NCKA 3WS2A 1GA9A 1YM1A 4MBFA 2J7VA 5EVID 4WEJA 3HLGA 1J9MA 2VGJA 3W8KA 4QJGA 1YMXA 1PWGA 4HEFA 1MPLA 3IXBA 4QHCA 4OOMA 5EUAA 3OCLA 1TDGA 2RL3A 3G2YA 3ZVWA 1K56A 3AGDA 1WE4A 3QHYA 1DY6A 5I94A 1WYCA 2WKIA 1DJAA 1MY8A 3CJMA 2ZMAA 1ZG4A 5U47A 5HAPA 4IVIA 1C3BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CZD A;  2J8Y A;  3N8R A;  2ZC6 B;  3M6B A;  3MZE A;  4N1X A;  3A3D A;  2EFU A;  1DJB A;  4OP8 A;  4R23 A;  3IQA A;  4EV4 A;  2A3U A;  4S2N C;  3ZG5 A;  4IED A;  2WKE A;  1YT4 A;  1K38 A;  2Y2N A;  5KZH A;  5AQ9 A;  3WS0 A;  1KE4 A;  2H0Y A;  4LV1 A;  1MWS A;  1SDN A;  2HPB A;  4N9K A;  2R9X A;  4OQ0 A;  3UE0 A;  2EX8 A;  3V3R A;  4ID4 A;  1BUL A;  5HW3 A;  4PM9 A;  4QD4 A;  3FWL A;  2Z2L B;  1GHP A;  3DWK A;  1MWT A;  2OLU A;  4OOL A;  5TGF A;  4BD0 A;  4UA9 A;  1QME A;  2WGV A;  5DF8 A;  3Q7V B;  3OPH A;  3HLC A;  3MBZ A;  5E2G A;  1L0F A;  5FAP A;  1YLW A;  2XD1 A;  3TOI A;  5EPH A;  3G32 A;  4OPQ A;  2ZQ9 A;  4ZJ1 A;  3VP3 A;  3UNW A;  3VMA A;  4ZJ2 A;  2OLV A;  2E8I A;  4RX3 A;  5EVI B;  1KVM A;  2V1Z A;  3FV7 A;  5F1F A;  4C75 A;  4DE0 A;  1LLB A;  3BLS A;  3PBQ A;  3QNB A;  1QMF A;  1KE0 A;  1GHI A;  2ZQA A;  1FQG A;  1LI9 A;  4MEZ A;  2H10 A;  4GD6 A;  3ZG0 A;  2ZC3 B;  4OQG A;  2XQZ A;  1K57 A;  5F1G A;  3M6H A;  4S2O A;  1KGE A;  4PMA A;  4BD1 A;  4XUZ A;  4C3Q A;  3BEB A;  4NET A;  1N4O A;  3BYD A;  1SCW A;  1Z6F A;  5GHY A;  2P9V B;  4R1G A;  1MWR A;  3FYZ A;  2ZC5 B;  4BL2 A;  3WS1 A;  2R9W A;  3SS4 A;  2V2F F;  5JYP A;  4CPK A;  2ZQC A;  4P85 A;  3ZDJ A;  5GLB A;  4FH4 A;  4R3J A;  3UE1 A;  1FCM A;  2X01 A;  3BFF A;  2JE5 A;  3G2Z A;  2DCF A;  2Y2M A;  3IF5 A;  4L0L A;  4BQM A;  3MZF A;  1E3U A;  3IXG A;  5EOO A;  1G6A A;  3BM6 A;  2WK0 A;  4EBL A;  4JPM A;  4P6B A;  2Y2J A;  2WAF A;  3QNC A;  1S0W A;  5A90 A;  1FOF A;  1SKF A;  3ZVT A;  2WAE A;  3GRJ A;  4KZ9 A;  1CK3 A;  4GN2 A;  3RXW A;  1ES3 A;  1E3U D;  5DVA A;  2FFF B;  4GZB A;  5E2E A;  3G34 A;  5G18 A;  4Y0O A;  4B4X A;  4X68 A;  4OLD A;  1JWV A;  2PU2 A;  2ZD8 A;  3A3J A;  3M2K A;  3HRE A;  3V5M A;  2C5W B;  2IWB A;  3JYI A;  4GDN A;  4ZAM A;  4R4R A;  5EVL A;  4X6T A;  3VOY A;  5CEB A;  2WAD A;  4KG2 A;  3HLE A;  4RA7 A;  5FDH A;  1GHM A;  1XP4 A;  3Q7Z A;  2WUQ A;  4WZ5 A;  5E2F A;  3ZG9 B;  1FSW A;  2A49 A;  2QPN A;  4JLF A;  4IBR A;  1TEM A;  4OKP A;  1ES2 A;  5FQI A;  2I72 A;  1K54 A;  4D2O A;  3BFG A;  4E3N A;  4S2I A;  1HVB A;  1MXO A;  4GNU A;  1CEG A;  5CHM A;  3NY4 A;  4Q8I A;  1IEM A;  1YLJ A;  3C5A A;  3IWQ A;  5FQM A;  1ONH A;  1IYP A;  2PU4 A;  4WZ4 A;  1IYS A;  4E3J A;  4KG6 A;  3ZGA B;  5FAO A;  4EWF A;  3E2L A;  4Y0U A;  1ERM A;  5CTM A;  4BJP A;  3IF6 B;  3IWI A;  4S2P A;  3I7J A;  3GVB A;  2OSU A;  4LV2 A;  1EI5 A;  4RVA A;  4XUX A;  2Y2K A;  1M6K A;  1YQS A;  4DDY A;  4P87 A;  3NBL A;  3PBS A;  4KQQ A;  1TDL A;  4JKT A;  4S2J A;  3BEC A;  4S2M A;  2Q9N A;  1KDS A;  3RJU A;  1XA7 A;  4YIN A;  2Y55 A;  3Q07 A;  4LV3 A;  1NYY A;  1FSY A;  4ZJ3 A;  1JWZ A;  3TG9 A;  3NI9 A;  1ONG A;  1L0E A;  1W8Y A;  2XEP A;  1K6S A;  3G30 A;  1I2W A;  1K56 D;  3LCE A;  2EFX A;  3OPR A;  3UDI A;  3UPO A;  3NDE A;  3IWO A;  5F83 A;  4M3K A;  4DXB A;  4OON A;  4Y0T A;  4PPR A;  3VP4 A;  3OZH A;  1H5X A;  4DKI A;  3N7W A;  1HZO A;  3S1Y A;  1IEL A;  4F94 A;  3CMZ A;  3V50 A;  3LO7 A;  2WKH A;  4QY6 A;  3IF6 C;  2Y2I A;  1LL5 A;  3ZG7 B;  2ZM0 A;  4OQH A;  5EE8 A;  3HBR A;  3UE3 A;  4ZTK A;  3GMW A;  1I5Q A;  5JYO A;  3C4P A;  4KZA A;  2C6W B;  5KMW A;  3P09 A;  4PM5 A;  1PI4 A;  2H0T A;  1MWU A;  3HUO A;  4GD8 A;  5CGX A;  4LCL A;  5FQ9 A;  2EX2 A;  1Y54 A;  5DTK A;  1BSG A;  2QMI A;  3BFE A;  4ZDX A;  5A92 A;  3N6I A;  5FI2 A;  2XFT A;  2XD5 A;  1JWP A;  1JVJ A;  1PI5 A;  4FD8 A;  4KZ4 A;  5CXW A;  3C7V A;  3ZFZ A;  1SDE A;  1TVF A;  4MBK A;  4N9L A;  1W8Q A;  3AGE A;  3Q81 A;  3VP2 A;  1CI9 A;  1ES4 A;  4GKU A;  2XF3 A;  4UHU A;  5TFQ A;  1W5D A;  3HLB A;  4EUZ A;  3B3X A;  1GA0 A;  2EXB A;  2B5R A;  3ZNY A;  1G68 A;  4X69 A;  3WRT A;  1PIO A;  2IWC A;  1VQQ A;  1H8Y A;  2XLN A;  3SH9 A;  5M18 A;  4U0X A;  5CGW A;  5A93 A;  1IKI A;  4EQI A;  1W79 A;  2G2U A;  2JC7 A;  1PW1 A;  4UA7 A;  1ALQ A;  3OC2 A;  4WM9 A;  4S2N A;  1BUE A;  5CED A;  3FKW A;  5CHU A;  1K4E A;  3BFC A;  3PBR A;  3HLD A;  2EXA A;  3PBN A;  1K55 C;  1SHV A;  5CER A;  3NC8 A;  3RXX A;  3HUN A;  4HES A;  5EVI C;  5M1A A;  2WGW A;  2HDR A;  1I2S A;  4JBF A;  2XGN A;  3VFH A;  4QY5 A;  1LHY A;  3MXS A;  3A3E A;  1XGI A;  1YLZ A;  1XGJ A;  2ZLY A;  4OQI A;  4X55 A;  4KZ8 A;  4WBG A;  5FQQ A;  4GB7 A;  3ISG A;  2J9P A;  1KGF A;  4K91 A;  2P74 A;  5GHX A;  3DW0 A;  1H8Z A;  4WYY A;  5DF7 A;  2ZJ9 A;  1CEF A;  5L2F A;  1PWD A;  1RP5 A;  4B88 A;  3NDG A;  3O87 A;  5EEC A;  4BLM A;  2FFY A;  3IHA A;  3ITA A;  5GLA A;  4R4S A;  4JXW A;  4OVD A;  1IYO A;  3N8S A;  3PAE A;  5FA7 A;  3BRM A;  5FQJ A;  3SS5 A;  1N9B A;  1MKI A;  5CEC A;  4U0T A;  4IVK A;  4DRT A;  1NJ4 A;  3WWX A;  1W7F A;  5D3O A;  3OPP A;  4IBX A;  1NY0 A;  1XX2 A;  2ZC7 A;  3VP0 A;  1BLS A;  3G31 A;  3G35 A;  3GTC A;  1KE3 A;  2ZM8 A;  3Q1F A;  2WZX A;  4HBU A;  3C4O A;  4S2K A;  4KZ6 A;  5GL9 A;  3UPN A;  2WZZ A;  3W4P A;  1K4F A;  1XA1 A;  3GR2 A;  2HDQ A;  3PBT A;  3Q7V A;  4NK3 A;  3V3S A;  3WRZ A;  1FCO A;  4E3L A;  2HP9 A;  2H5S A;  3P98 A;  4OPY A;  5E2H A;  2HP5 A;  1L0G A;  4RYE A;  1IKG A;  5E43 A;  1XKZ A;  3M2J A;  5CGS A;  2DRW A;  3FZC A;  1YLP A;  1O7E A;  4JXV A;  4DE3 A;  5EOE A;  4MNR A;  1PZO A;  5HAI A;  4A5R A;  1BLC A;  3VSL A;  4JXS A;  4QU3 A;  5HL1 A;  4E3K A;  4FCF A;  1BLP A;  4MBH A;  1ESI A;  2J9O A;  3FKV A;  1E4D A;  3HLF A;  1Q2P A;  3CG5 A;  3G4P A;  3MXR A;  3A3I A;  1PZP A;  4N1H A;  4R3B A;  4X56 A;  1GCE A;  5FAS A;  1M40 A;  2Y59 A;  3BFD A;  1YMS A;  3O86 A;  3UY6 A;  4JF5 A;  2P9V A;  2WGW B;  3O3V A;  1ZKJ A;  2G2W A;  1NZO A;  5AQA A;  4LCM A;  2UWX A;  3MKF A;  4WEK A;  5HAQ A;  5FI6 A;  3TSG A;  3LY4 A;  3V39 A;  4EBN A;  3S22 A;  4PM6 A;  1LI0 A;  2Y91 A;  3W4O A;  2ZQ7 A;  2ZM2 A;  3IXH A;  1K57 C;  4LEN A;  2Y2L A;  5A91 A;  3SS3 A;  3LY3 A;  2V20 A;  4JF4 A;  4K0X A;  1KVL A;  3HVF A;  3IXD A;  1L0D A;  4S2L A;  1BLH A;  4KZB A;  1E25 A;  3ZNT A;  2DNS A;  4YFM A;  1CI8 A;  1YLT A;  4OPR A;  5M19 A;  1HTZ A;  1RGZ A;  1ZC2 A;  2HDU A;  5BOH A;  1FCN A;  4KQO A;  2Q9M A;  3D4F A;  4B4Z A;  1XXM A;  4QB8 A;  2JCH A;  1JTG A;  2Y2G A;  4K0W A;  3UO9 A;  5IHV A;  4JXG A;  4E3I A;  5DTT A;  1NYM A;  1BZA A;  1L2S A;  1OME A;  2XH9 A;  3NIA A;  3EQV A;  3OCN A;  4UA6 A;  2QZ6 A;  3ITB A;  5DTS A;  3ZCZ A;  1ESU A;  1AXB A;  1PW8 A;  4Z9Q A;  4CJN A;  1ZG6 A;  2HDS A;  1K25 A;  2XK1 A;  2ZQD A;  5TR7 A;  2OV5 A;  3AGF A;  2ZQ8 A;  1U60 A;  2WGI A;  4BL3 A;  1JTD A;  1MBL A;  2Z2M B;  4C6Y A;  1FR1 A;  4JF6 A;  4OPZ A;  1PYY A;  5FAT A;  1ERQ A;  3IT9 A;  2EX9 A;  3PAG A;  4GDB A;  4PM8 A;  4R0Q A;  5GHZ A;  5HX9 A;  3GV9 A;  3O88 A;  2PBY A;  3IH8 A;  4XXR A;  2Y2H A;  5F82 A;  4WEL A;  1NZU A;  4BEN A;  4FSF A;  4MLL A;  5FI7 A;  1EWZ A;  4OH0 A;  3PTE A;  4OP5 A;  4WZ5 C;  2BLS A;  3VP1 A;  3PBO A;  1Q2Q A;  3IH9 A;  4LV0 A;  2X02 A;  1RCJ A;  3IF6 A;  3Q82 A;  1PWC A;  5CRF A;  4E6X A;  4PM7 A;  4P0M A;  1S6R A;  1K54 C;  1KDW A;  2CC1 A;  1XPB A;  3VOZ A;  5CHJ A;  4N92 A;  4DDS A;  3UPP A;  1HD8 A;  1NXY A;  3HUM A;  2RCX A;  3UDX A;  3N8L A;  3HLW A;  4KEN B;  5KSC A;  2HP6 A;  3SOI A;  1ERO A;  4WMC A;  2EX6 A;  5FSR A;  3WS4 A;  4HBT A;  4DF6 A;  2XDM A;  1K6R A;  3IHB A;  1YLY A;  3LEZ A;  4GOG A;  3HL9 A;  4KZ3 A;  4KZ7 A;  1O07 A;  3DTM A;  3GQZ A;  3W4Q A;  4EBP A;  2VGK A;  3E2K A;  3GSG A;  4WMC D;  3VFF A;  4DE2 A;  1FR6 A;  1NRF A;  3UDF A;  2JBF A;  2XR0 A;  1ES5 A;  4FH2 A;  4DE1 A;  5CTN A;  4ZBE A;  4OLG A;  3DWZ A;  3N4I A;  4RX2 A;  4KQR A;  4UAA A;  3ZG8 B;  1WYB A;  2XFS A;  2WYX A;  2Y2P A;  5HAR A;  3BLM A;  1RGY A;  3WS5 A;  2Y2O A;  2BG1 A;  5AQ7 A;  3MKE A;  5DF9 A;  2IWD A;  5KSH A;  4H8R A;  3VSK A;  1IYQ A;  1LL9 A;  4E3M A;  4OOY A;  4O7D A;  5J8X A;  1BTL A;  3MZD A;  1KGG A;  3A3F A;  3UN7 A;  1BT5 A;  3ZHH A;  5HFO A;  2GDN A;  3EQU A;  4DXC A;  2ZC4 B;  4U3T A;  3C7U A;  5FAQ A;  3SH8 A;  5FQK A;  3MFD A;  4KG5 A;  1K55 A;  3S4X A;  2X71 A;  2Y2Q A;  5GLC A;  2Y4A A;  5EVI A;  3SH7 A;  1DJC A;  4X53 A;  4E6W A;  4Y7P A;  4E3O A;  5GLD A;  3OPL A;  4KZ5 A;  1VM1 A;  5AQB A;  3NCK A;  3WS2 A;  1GA9 A;  1YM1 A;  4MBF A;  2J7V A;  5EVI D;  4WEJ A;  3HLG A;  1J9M A;  2VGJ A;  3W8K A;  4QJG A;  1YMX A;  1PWG A;  4HEF A;  1MPL A;  3IXB A;  4QHC A;  4OOM A;  5EUA A;  3OCL A;  1TDG A;  2RL3 A;  3G2Y A;  3ZVW A;  1K56 A;  3AGD A;  1WE4 A;  3QHY A;  1DY6 A;  5I94 A;  1WYC A;  2WKI A;  1DJA A;  1MY8 A;  3CJM A;  2ZMA A;  1ZG4 A;  5U47 A;  5HAP A;  4IVI A;  1C3B A; 
#chains in the Genus database with same CATH topology
 3CZD A;  2FZ0 A;  4HI4 A;  1DJB A;  4UQI S;  2PR6 A;  3A0S A;  4IED A;  1YT4 A;  3WS0 A;  5HL6 A;  2Z6C A;  4LV1 A;  3T50 A;  4WL9 A;  2R9X A;  4OQ0 A;  2EX8 A;  3E0Y A;  4MDZ A;  4ID4 A;  3FWL A;  2Z2L B;  1GHP A;  2XSS A;  3DWK A;  5DF8 A;  3MBZ A;  2ZMF A;  3LUQ A;  1YLW A;  3QP5 A;  4EER A;  5DKK A;  3CAX A;  3G32 A;  2ZQ9 A;  4ZJ1 A;  1UWP X;  2OLV A;  5MC7 A;  1LI9 A;  4MEZ A;  2H10 A;  4CLC B;  3ZG0 A;  1OTD A;  3LGO A;  4OQG A;  1K57 A;  4S2O A;  4PMA A;  5L10 A;  1SKO A;  5GHY A;  2P9V B;  4BL2 A;  1TS7 A;  3WS1 A;  3SS4 A;  3SZT A;  1DP9 A;  4P85 A;  4EEU A;  5GLB A;  2X01 A;  5CX7 A;  1XFN A;  1S4S A;  5EOO A;  5HZH A;  3BM6 A;  1N9O A;  1T1A A;  3HJK A;  1SKF A;  3GRJ A;  4GN2 A;  5F69 A;  3RXW A;  3TRC A;  4CLC E;  2ZL1 A;  5G18 A;  1OTB A;  4LPZ A;  4OLD A;  3A3J A;  1H8M A;  2WUQ A;  1FSW A;  4JLF A;  4H6J A;  4IBR A;  2WKP A;  1TEM A;  1ES2 A;  2PBD P;  2I72 A;  3BFG A;  4DJ2 A;  5CHM A;  3NY4 A;  1YLJ A;  3C5A A;  5FQM A;  3E2L A;  2V8F A;  3S7Q A;  4BJP A;  3IWI A;  3I7J A;  1YPR A;  4FOF A;  4RVA A;  4XUX A;  2PYP A;  4CLC D;  1VET A;  4AFI A;  4P87 A;  2M7U A;  3NBL A;  3PBS A;  4S2M A;  3TJZ C;  2J80 A;  2ZMV A;  3UDI A;  2KLI A;  4Y0T A;  2EWV A;  4PPR A;  4MN7 A;  3VE4 A;  3V50 A;  3LO7 A;  1LL5 A;  2VV6 A;  3ZG7 B;  4QPR A;  4OQH A;  1TS0 A;  3UE3 A;  3GMW A;  1I5Q A;  3JVV A;  1NLZ A;  5KMW A;  4L9G A;  3BQA A;  3CPT B;  4LCL A;  2EX2 A;  4UQI M;  4EU0 A;  2PHY A;  1H3Q A;  4FD8 A;  1SDE A;  4MBK A;  2AVX A;  1CI9 A;  2XF3 A;  3MQ0 A;  1GA0 A;  4K08 A;  1G68 A;  1H8Y A;  3W2Z A;  3R4K A;  2VGL S;  4Y15 A;  1ALQ A;  3OC2 A;  4S2N A;  1BUE A;  5CHU A;  1K4E A;  3BFC A;  3HLD A;  3H9W A;  3PBN A;  1K55 C;  1TF1 A;  4NXB A;  4ETX A;  3LR0 A;  5M1A A;  5EFW A;  2XGN A;  3VFH A;  1Y28 A;  2NUT C;  1YLZ A;  4HP4 A;  4CLC C;  2G7U A;  4KZ8 A;  3HCY A;  4K91 A;  2VA0 A;  5GHX A;  5DFX A;  5L2F A;  3ITA A;  5GLA A;  4R4S A;  3BRM A;  4WN5 A;  4IVK A;  5HDC A;  1XJ2 A;  2PAV P;  1XX2 A;  4KUO A;  1BLS A;  2PD8 A;  3C4O A;  3IX3 A;  2XRO A;  2XRN A;  2M7V A;  3TW8 A;  3GR2 A;  1XA1 A;  3PBT A;  3W4P A;  2QJ5 A;  3WRZ A;  1W63 Q;  2W3F A;  2HP9 A;  5HWV A;  3P98 A;  4ME4 A;  5E2H A;  1L0G A;  4LRY C;  1XKZ A;  5CGS A;  4JXV A;  5EOE A;  1BLC A;  3VSL A;  4E3K A;  3NJA A;  3A0V A;  1ESI A;  2J9O A;  2ZBB A;  2JHE A;  1E4D A;  4ARZ B;  3T4T A;  2K31 A;  1L3L A;  2P9V A;  1ZKJ A;  2G2W A;  1GSX A;  3P7N A;  3V39 A;  3LY4 A;  4EBN A;  4DMZ A;  4PM6 A;  2YKH A;  3T4Q A;  3SS3 A;  2KX6 A;  4LEN A;  3HVF A;  3K3C A;  3VOL A;  2PT7 A;  1YLT A;  2INW A;  3LI8 A;  2B18 A;  4P6Z S;  4F3L B;  2JCH A;  3T1S A;  5IHV A;  4E3I A;  5DTT A;  1NYM A;  1BZA A;  1OME A;  3EQV A;  4UA6 A;  2QZ6 A;  1ESU A;  3B47 A;  3S7N A;  2OWH A;  3B33 A;  3RFB A;  5TR7 A;  4BL3 A;  4JGQ A;  4OPZ A;  1ERQ A;  1DP8 A;  4GDB A;  4PM8 A;  3PYP A;  3IH8 A;  5F68 A;  2Y2H A;  2VV8 A;  4WF0 A;  4FSF A;  4WZ5 C;  3PBO A;  1Q2Q A;  1PFL A;  4LV0 A;  5CRF A;  3D9Y A;  4PM7 A;  3U4L P;  1K54 C;  1KDW A;  4HH2 A;  1XPB A;  3VOZ A;  2VGL M;  4HQA A;  3T4L A;  4DDS A;  1NXY A;  4JGO A;  3HLW A;  2OAP 1;  4IHQ A;  5FSR A;  1YSQ A;  3WS4 A;  4DF6 A;  2XDM A;  1K6R A;  3IHB A;  1YLY A;  3LEZ A;  1Y4O A;  4GOG A;  3DTM A;  4EBP A;  2VGK A;  2PYR A;  3C30 A;  1MKM A;  4FH2 A;  3UB5 P;  4OLG A;  4CQH A;  1XJ4 A;  2Y2O A;  1XJ3 A;  3CPT A;  1OTA A;  4E3M A;  3UN7 A;  1WA9 A;  2GDN A;  3EQU A;  1D7E A;  3MFD A;  4KG5 A;  1OPX A;  2X71 A;  1F98 A;  1T1B A;  4E6W A;  3CI6 A;  3WS2 A;  1YM1 A;  3IX8 A;  4MBF A;  2VGJ A;  4OOM A;  3OCL A;  4EET B;  2MJ6 A;  1NRJ A;  3C2W A;  4PKY G;  2WKI A;  1DJA A;  3T4O A;  5FAO A;  2ZC6 B;  4N1X A;  4EV4 A;  3IQA A;  4I3J A;  4Y13 A;  2ZOH A;  2WKE A;  2Y2N A;  5AQ9 A;  2H0Y A;  2K2N A;  3V3R A;  2JN7 A;  3UB9 A;  5HW3 A;  4Y5F A;  2IA2 A;  4IUH A;  2OLU A;  5HWW A;  4UA9 A;  1QME A;  2WGV A;  4P6Z M;  3A0R A;  3HLC A;  1L0F A;  2VJW A;  4NXE A;  3TOI A;  4OPQ A;  3VP3 A;  3UNW A;  3VMA A;  3IBR A;  1XJ6 A;  2E8I A;  5EVI B;  2V1Z A;  3FV7 A;  4DE0 A;  2W3D A;  1LLB A;  3QNB A;  2W1R A;  5F1G A;  1KGE A;  1T1C A;  3LIC A;  4G3V A;  4XUZ A;  4C3Q A;  1N4O A;  3BYD A;  1Z6F A;  4R1G A;  1MWR A;  3CUE C;  3EEA A;  4CPK A;  4GHI B;  2ZQC A;  2L1M A;  2O9C A;  4FH4 A;  1FCM A;  3BFF A;  3G2Z A;  4NG2 A;  4BQM A;  3IF5 A;  4ARZ A;  4MN5 A;  5HDD A;  2Y2J A;  1S0W A;  5A90 A;  4HP9 A;  1H0M A;  5E2E A;  3G34 A;  4KQD A;  4Y0O A;  5EVE A;  3NUL A;  2ZD8 A;  2IWB A;  1XP4 A;  4F3L A;  3Q7Z A;  3KSI A;  3ZG9 B;  2JKT I;  2QPN A;  2V1B A;  4OKP A;  4HH3 A;  1CEG A;  1G28 A;  1IEM A;  1ONH A;  2PU4 A;  4WZ4 A;  1IYS A;  4E3J A;  5DJU A;  1ERM A;  5CTM A;  3NHQ A;  2OSU A;  5KIZ A;  2V9A A;  3D3O A;  1YQS A;  3BEC A;  2Q9N A;  1KDS A;  1XA7 A;  2VLG A;  3NOU C;  4ZJ3 A;  1FSY A;  1JWZ A;  3TG9 A;  3NI9 A;  1L0E A;  1W8Y A;  1K56 D;  3LCE A;  2EFX A;  3OPR A;  3IWO A;  1FIL A;  4M3K A;  4OON A;  3OZH A;  3S1Y A;  3SW1 A;  2V0W A;  3CMZ A;  4EXO A;  5IU1 A;  1DRM A;  2ZM0 A;  3LYX A;  3HUO A;  2PDR A;  4LRX C;  2QMI A;  4QWO A;  1ZHH B;  5A92 A;  5FI2 A;  2XFT A;  1JVJ A;  5CXW A;  3C7V A;  2O99 A;  5AJG A;  4N9L A;  3T1Q B;  3Q81 A;  4Q0H A;  5TFQ A;  1OTE A;  3B3X A;  2B5R A;  1N9N A;  3LI9 A;  4X69 A;  1PIO A;  1OTI A;  1VQQ A;  5M18 A;  4M4X A;  5CGW A;  5A93 A;  1IKI A;  5EM0 A;  2G2U A;  2VKS A;  1PW1 A;  3LID A;  1OJG A;  1S1Y A;  4I3I A;  3FKW A;  4PHT A;  2GNX A;  5CER A;  4I39 A;  5EVI C;  2WGW A;  1DP6 A;  4QY5 A;  3KO6 A;  1OJ5 A;  2B95 A;  4OQI A;  3FC7 A;  1XGJ A;  4X55 A;  4WBG A;  4WUJ A;  4NKP A;  5G4Y A;  5FQQ A;  2J9P A;  1KGF A;  1H8Z A;  1T18 A;  3UE6 A;  3LR4 A;  1YSP A;  3H7W B;  4B88 A;  2D01 A;  4L9E A;  5EEC A;  4X1M A;  1STZ A;  4OVD A;  3N8S A;  3KSH A;  1MKI A;  5CEC A;  4U0T A;  2W1T B;  4PAU A;  5D3O A;  2A24 B;  1NY0 A;  1TS8 A;  3VP0 A;  3G31 A;  3G35 A;  3GTC A;  1KE3 A;  2WZX A;  4I38 A;  2WZZ A;  4NK3 A;  5K5B A;  5LBR A;  1FCO A;  5HDS A;  4YNR A;  2H5S A;  3G6O A;  2HP5 A;  1IKG A;  5E43 A;  1IOU A;  4LRZ E;  3M2J A;  2DRW A;  3FZC A;  5C5K A;  3QP6 A;  2J3W A;  4MNR A;  4QU3 A;  5HL1 A;  3IS2 B;  1BLP A;  3F1O A;  1YKD A;  3FKV A;  3HLF A;  3CG5 A;  3A3I A;  1PZP A;  4N1H A;  4X56 A;  2Y59 A;  1YMS A;  4X1L A;  2PD7 A;  4LCM A;  3MKF A;  4WEK A;  4GHI A;  3TSG A;  2QWS A;  3H82 B;  1GSW A;  4L9F A;  2Y91 A;  2ZM2 A;  3IXH A;  2Y2L A;  3LY3 A;  4JF4 A;  1KVL A;  3DTI A;  1BLH A;  4YFM A;  4BWI A;  1NLY A;  4B4Z A;  2QJ7 A;  3UO9 A;  3S7O A;  3UB7 A;  1L2S A;  3OCN A;  3ZCZ A;  3ITB A;  2Y8H A;  2XK1 A;  3AGF A;  2ZQ8 A;  1JTD A;  4JF6 A;  1PYY A;  2EX9 A;  3PAG A;  4R0Q A;  3PHY A;  3VV4 A;  3GV9 A;  1CF0 A;  5F82 A;  4WEL A;  4BEN A;  5L09 A;  4OH0 A;  2BLS A;  3VP1 A;  4X25 A;  1VB6 A;  4KUK A;  4E6X A;  2QHK A;  3EGX C;  2HJ9 C;  5A8B A;  2J3T D;  3UPP A;  2HF6 A;  3UDX A;  3N8L A;  5KSC A;  4I3A A;  2HP6 A;  2W3H A;  2EX6 A;  4HBT A;  4KZ3 A;  3HL9 A;  2P7J A;  4KZ7 A;  2JKR M;  4O01 A;  5FDS A;  3E2K A;  3GSG A;  2H28 A;  3T12 B;  2XR0 A;  4DE1 A;  2OAQ 1;  2VZW A;  3DWZ A;  4RX2 A;  4UAA A;  3ZG8 B;  1WYB A;  2XFS A;  5HAR A;  5TBM B;  1RGY A;  2BG1 A;  3MKE A;  2IWD A;  5KSH A;  1IYQ A;  4O7D A;  5J8X A;  3T1X A;  3MZD A;  3ZHH A;  5HFO A;  2ZC4 B;  5FAQ A;  2W3G A;  3C7U A;  3SH8 A;  1W63 M;  1K55 A;  2Y2Q A;  3V67 A;  4GS9 B;  3MS6 A;  2FH5 A;  4CLC A;  3LEQ A;  5EV0 A;  1S66 L;  4QJG A;  4DN0 A;  1MPL A;  4QHC A;  1TDG A;  1VEU B;  4GJ4 A;  3RTY A;  3DTK A;  3AGD A;  1WE4 A;  3S7P A;  1MY8 A;  3CJM A;  3MQO A;  2ZMA A;  5U47 A;  4IVI A;  1C3B A;  2EA9 A;  2J8Y A;  3N8R A;  3M6B A;  3A3D A;  2EFU A;  4OP8 A;  4EQ1 A;  2UV0 E;  4GLQ A;  3ZG5 A;  1K38 A;  1KE4 A;  3H7W A;  4YWZ A;  4QD4 A;  3K2N A;  4OOL A;  5TGF A;  3JPU A;  3OPH A;  5E2G A;  2W1T A;  5FAP A;  2A24 A;  5EPH A;  4IJG A;  4ZJ2 A;  4RX3 A;  1KVM A;  3F1P B;  5F1F A;  4C75 A;  3BLS A;  2VK3 A;  1QMF A;  1KE0 A;  1GHI A;  2ZQA A;  4EEP A;  1FQG A;  1OT9 A;  4GD6 A;  4IUK A;  2ZC3 B;  3BW6 A;  1S1Z A;  2B02 A;  3E98 A;  3C38 A;  1SCW A;  3FYZ A;  3QP1 A;  5JYP A;  3IS2 A;  2L0W A;  3ZDJ A;  4R3J A;  3OLO A;  3UE1 A;  2JE5 A;  1MC0 A;  1ZTU A;  2M1C A;  4L0L A;  2HV1 A;  3MFX A;  3MZF A;  1A0K A;  1E3U A;  5J3W A;  3LIE A;  2WK0 A;  4EBL A;  4JPM A;  4P6B A;  3EOI A;  2QKP A;  2WAE A;  1CK3 A;  1ES3 A;  2Z6D A;  3CIT A;  4GZB A;  1JWV A;  2PU2 A;  3M2K A;  3V5M A;  1LT0 A;  4GDN A;  4ZAM A;  5EVL A;  4R4R A;  5CEB A;  4BMW A;  2WAD A;  4KG2 A;  3HLE A;  1GHM A;  5F5Y A;  4MN6 A;  4WZ5 A;  5E2F A;  5I5L A;  3E4Q A;  1K54 A;  4D2O A;  1MXO A;  4GNU A;  2VEA A;  4Q8I A;  3KYQ A;  4G3W A;  4KG6 A;  3GVB A;  4LV2 A;  4JGR A;  2Y2K A;  1LSX A;  1M6K A;  4DDY A;  4KQQ A;  3RJU A;  2Y55 A;  4LV3 A;  3T1R A;  1ONG A;  5AVF A;  3G30 A;  1EW0 A;  4GCZ A;  3UPO A;  4DXB A;  1ODV A;  3N7W A;  1HZO A;  4F94 A;  4QY6 A;  3IF6 C;  2Y2I A;  5EE8 A;  3HBR A;  4ZTK A;  3C4P A;  2ZL1 B;  3MSH A;  4BBU A;  3P09 A;  1D1J A;  4PM5 A;  1PI4 A;  1P0Z A;  4R70 A;  4GD8 A;  5FQ9 A;  3L7H A;  4Q0J A;  1P97 A;  5DTK A;  1BSG A;  1G5U A;  3BFE A;  2XD5 A;  1PI5 A;  2P04 A;  3DBA A;  5FL3 A;  4R6L A;  1SZV A;  3AGE A;  3VP2 A;  1ES4 A;  4GKU A;  3MXQ A;  4WLA A;  1PNE A;  1W5D A;  5EM1 A;  3KSF A;  2W0N A;  3NOP C;  3WRT A;  3DAV A;  2XLN A;  4U0X A;  1FIK A;  4EQI A;  2EWW A;  4GS9 A;  2JC7 A;  4UA7 A;  2PR5 A;  2LB5 A;  5HPI A;  2EXA A;  1SHV A;  3RXX A;  3F1N B;  3L9K A;  1VEU A;  1I2S A;  4GW9 A;  4JBF A;  1LHY A;  3MXS A;  3A3E A;  3HJI A;  1J3W A;  3MMH A;  4MMN A;  2P74 A;  3DW0 A;  3RH8 B;  5HWT A;  1CEF A;  1PWD A;  1RP5 A;  3IHA A;  5TJJ A;  3BJN A;  3PAE A;  5FQJ A;  3MQQ A;  1N9B A;  4XT2 B;  5HD5 A;  1S4R A;  4DRT A;  4HHD A;  1NJ4 A;  3WWX A;  1NWZ A;  2A2L A;  3OPP A;  3U2A A;  2ZC7 A;  4HBU A;  4JGP A;  3Q1F A;  5GL9 A;  1LSV A;  3UPN A;  3CUE A;  1K4F A;  4HY8 A;  2HDQ A;  5F6A A;  3T4K A;  1VHM A;  5L07 A;  3O5Y A;  4RYE A;  3KX0 X;  4NXG A;  4DE3 A;  1PZO A;  4A5R A;  4JXS A;  4FCF A;  2ACG A;  1GSV A;  3MXR A;  2DMW A;  4R3B A;  5FAS A;  1GCE A;  1M40 A;  4JF5 A;  2JKT M;  3O3V A;  5AQA A;  3UB8 A;  1HLU P;  2UWX A;  3ULF A;  3S22 A;  2ZQ7 A;  1K57 C;  3CWF A;  2JKG A;  4S2L A;  4LFU A;  3QP2 A;  2DNS A;  1CI8 A;  2Q0O A;  5M19 A;  1HTZ A;  3VE3 A;  2HDU A;  5BOH A;  4KQO A;  2Q9M A;  3KSG A;  1XXM A;  3LIF A;  1JTG A;  4EES A;  4JXG A;  3BY8 A;  4Q0I A;  3NIA A;  2XH9 A;  5DTS A;  1AXB A;  4CJN A;  1K25 A;  2OV5 A;  1U60 A;  1ACF A;  3FG8 A;  2GX5 A;  1K0K A;  5FAT A;  3IT9 A;  4HJ6 A;  5HX9 A;  5GHZ A;  2PBY A;  3K3D A;  4OP5 A;  1TS6 A;  3IH9 A;  3BQ8 A;  1S6R A;  2CC1 A;  3P01 A;  4HJ4 A;  4N92 A;  1HD8 A;  3HUM A;  4Y2F A;  2RCX A;  5FEG A;  4KEN B;  3SOI A;  1ERO A;  4WMC A;  3CLO A;  4Y3I A;  1O07 A;  3GQZ A;  3W4Q A;  3C8C A;  2KOI A;  4O0P A;  3VFF A;  4DE2 A;  1NRF A;  2OWJ A;  2JBF A;  1ES5 A;  5CTN A;  5HD3 A;  4KQR A;  2QYB A;  2Y2P A;  2V0U A;  5AQ7 A;  3NOT C;  5J4E A;  3VSK A;  2CMN A;  1KGG A;  3A3F A;  3OOV A;  4DXC A;  5FQK A;  3S4X A;  1UWN X;  5EVI A;  3SH7 A;  2BTF P;  4Y7P A;  5GLD A;  4KZ5 A;  1VM1 A;  3PR6 A;  1F9I A;  1YMX A;  1PWG A;  3IXB A;  2OOL A;  5EUA A;  2RL3 A;  3G2Y A;  5L8M A;  3ZVW A;  1K56 A;  2O0Y A;  3EEH A;  4BBV A;  3PXP A;  1DY6 A;  5I94 A;  1WYC A;  3UME A;  2XA7 S;  4Y17 A;  1CJF A;  3F1N A;  3MZE A;  4R23 A;  5J7E A;  2A3U A;  4S2N C;  2ZOI A;  1S67 L;  5KZH A;  2JKF A;  3GEC A;  1MWS A;  1SDN A;  2HPB A;  4N9K A;  3UE0 A;  1LL8 A;  1N9L A;  3MJQ A;  3ICY A;  1BUL A;  4PM9 A;  1MWT A;  4BD0 A;  3Q7V B;  2Y79 A;  4XT2 A;  4NEE D;  3DTE A;  2XD1 A;  2W3E A;  2NUP C;  5FEF A;  1UGU A;  3PBQ A;  2JKR I;  2XQZ A;  3M6H A;  4BD1 A;  3BEB A;  4NET A;  3TE8 A;  2ZC5 B;  2R9W A;  2V2F F;  4B9O A;  2GJ3 A;  2DCF A;  2Y2M A;  1PRQ A;  4Z1W A;  3IXG A;  1G6A A;  3JVU A;  3KYE A;  2WAF A;  3QNC A;  3QP4 A;  4E04 A;  1FOF A;  3ZVT A;  4KZ9 A;  4R3A A;  1E3U D;  5G4Z A;  5DVA A;  2FFF B;  3R7W B;  4B4X A;  4X68 A;  3CHW P;  3HRE A;  1JNU A;  2C5W B;  3JYI A;  3VOY A;  4X6T A;  3BWL A;  4RA7 A;  5FDH A;  4EW7 A;  4I5S A;  4LGW A;  5DJT A;  2A49 A;  2VV7 A;  4PKY A;  5FQI A;  4E3N A;  4S2I A;  4ETZ A;  1HVB A;  3UMD A;  3IWQ A;  1IYP A;  4HNB A;  1YAX A;  3ZGA B;  4EWF A;  4Y0U A;  3IF6 B;  4S2P A;  3QP8 A;  1EI5 A;  3GDI A;  4S2J A;  1TDL A;  4JKT A;  4YIN A;  3Q07 A;  5HPF A;  1NYY A;  1XFQ A;  2XEP A;  1K6S A;  4II7 A;  2W27 A;  1I2W A;  1X0O A;  3LIB A;  3NDE A;  1KOU A;  2KDK A;  5F83 A;  3VP4 A;  1H5X A;  3EWK A;  4DKI A;  1IEL A;  2J3T C;  2XA7 M;  2WKH A;  2BAS A;  5JYO A;  4KZA A;  2C6W B;  1V9Z A;  2H0T A;  1MWU A;  5CGX A;  1P9R A;  1Y54 A;  4ZDX A;  3N6I A;  1JWP A;  4KZ4 A;  3ZFZ A;  1TVF A;  2D02 A;  1W8Q A;  1F5M A;  4UHU A;  4ZRR A;  3HLB A;  4EUZ A;  3E4O A;  4BBT A;  2EXB A;  1G6O A;  1F2K A;  3ZNY A;  3B42 A;  2IWC A;  3ZQ5 A;  1IFQ A;  2V1A A;  1W79 A;  4DJ3 A;  2HJE A;  4WM9 A;  4R38 A;  5CED A;  3PBR A;  3NC8 A;  3HUN A;  4HES A;  2HDR A;  2I9V A;  3ZYT A;  3BY9 A;  1XGI A;  3H82 A;  2ZLY A;  3KYZ A;  4GB7 A;  5IT5 A;  3ISG A;  4WYY A;  5DF7 A;  2ZJ9 A;  4HOI A;  2LB9 A;  3NDG A;  3O87 A;  4BLM A;  2FFY A;  4JXW A;  1IYO A;  5FA7 A;  2HZ5 A;  3SS5 A;  3T4S A;  1W7F A;  4IBX A;  4S2K A;  2ZM8 A;  4KZ6 A;  5DFY A;  3Q7V A;  3V3S A;  4G3K A;  3FPW A;  3LR3 A;  4E3L A;  4OPY A;  4HJ3 A;  1SKO B;  2P08 A;  1YLP A;  1O7E A;  2K7S A;  5HAI A;  4MBH A;  3SH9 A;  1Q2P A;  3G4P A;  3UY6 A;  3BFD A;  3O86 A;  4YOF A;  2WGW B;  2WKQ A;  1NZO A;  5HAQ A;  5FI6 A;  4RQ9 A;  1LI0 A;  1MZU A;  3W4O A;  5A91 A;  4FTX A;  3IX4 A;  2V20 A;  4K0X A;  3IXD A;  1L0D A;  2VX8 A;  4KZB A;  1E25 A;  3ZNT A;  4OPR A;  4NXF A;  1RGZ A;  1ZC2 A;  1FCN A;  3D4F A;  5TBM A;  4QB8 A;  1P9W A;  5HSQ A;  3R7W A;  2Y2G A;  4K0W A;  2WKR A;  3LFV A;  4H6J B;  4EUV A;  3NEC A;  3LR5 A;  1PW8 A;  4Z9Q A;  1ZG6 A;  2HDS A;  2ZQD A;  1BYW A;  3MR0 A;  2WGI A;  1MBL A;  2Z2M B;  3MF0 A;  1FR1 A;  4C6Y A;  3UB6 A;  3O88 A;  1VET B;  4XXR A;  1NZU A;  4MLL A;  5FI7 A;  1EWZ A;  3PTE A;  5AVE A;  2X02 A;  1RCJ A;  3IF6 A;  3Q82 A;  1PWC A;  1T19 A;  4P0M A;  3F1O B;  2PRF A;  4LLO B;  5CHJ A;  3FPV A;  3LIA A;  3IBJ A;  2R78 A;  4D60 A;  4UEY A;  4MCW A;  4WMC D;  1FR6 A;  2V8C A;  3D72 A;  3UDF A;  2YKF A;  4B93 A;  2L4R A;  4ZBE A;  1CQA A;  3N4I A;  2WYX A;  3BLM A;  3WS5 A;  2GZA A;  5DF9 A;  4H8R A;  3E4P A;  1LL9 A;  4OOY A;  5IS1 A;  1BTL A;  1BT5 A;  4U3T A;  1LSW A;  4FUW A;  4O8G A;  1V9Y A;  5GLC A;  2Y4A A;  1DJC A;  3F1P A;  4X53 A;  4E3O A;  3OPL A;  2O9A A;  5AQB A;  3NCK A;  5DKL A;  1Z09 A;  1GA9 A;  2HGV A;  2J7V A;  4HIA A;  5EVI D;  4ESP A;  4WEJ A;  1OT6 A;  3HLG A;  2E8J A;  1J9M A;  3W8K A;  4HEF A;  2O9B A;  3EGD C;  1TD5 A;  1D06 A;  3OBF A;  3T4J A;  3QHY A;  1AWI A;  1ZG4 A;  5HAP A; 
#chains in the Genus database with same CATH homology
 3CZD A;  2J8Y A;  3N8R A;  2ZC6 B;  3M6B A;  3MZE A;  4N1X A;  3A3D A;  2EFU A;  1DJB A;  4OP8 A;  4R23 A;  3IQA A;  4EV4 A;  2A3U A;  4S2N C;  3ZG5 A;  4IED A;  2WKE A;  1YT4 A;  1K38 A;  2Y2N A;  5KZH A;  5AQ9 A;  3WS0 A;  1KE4 A;  2H0Y A;  4LV1 A;  1MWS A;  1SDN A;  2HPB A;  4N9K A;  2R9X A;  4OQ0 A;  3UE0 A;  2EX8 A;  3V3R A;  4ID4 A;  1BUL A;  5HW3 A;  4PM9 A;  4QD4 A;  3FWL A;  2Z2L B;  1GHP A;  3DWK A;  1MWT A;  2OLU A;  4OOL A;  5TGF A;  4BD0 A;  4UA9 A;  1QME A;  2WGV A;  5DF8 A;  3Q7V B;  3OPH A;  3HLC A;  3MBZ A;  5E2G A;  1L0F A;  5FAP A;  1YLW A;  2XD1 A;  3TOI A;  5EPH A;  3G32 A;  4OPQ A;  2ZQ9 A;  4ZJ1 A;  3VP3 A;  3UNW A;  3VMA A;  4ZJ2 A;  2OLV A;  2E8I A;  4RX3 A;  5EVI B;  1KVM A;  2V1Z A;  3FV7 A;  5F1F A;  4C75 A;  4DE0 A;  1LLB A;  3BLS A;  3PBQ A;  3QNB A;  1QMF A;  1KE0 A;  1GHI A;  2ZQA A;  1FQG A;  1LI9 A;  4MEZ A;  2H10 A;  4GD6 A;  3ZG0 A;  2ZC3 B;  4OQG A;  2XQZ A;  1K57 A;  5F1G A;  3M6H A;  4S2O A;  1KGE A;  4PMA A;  4BD1 A;  4XUZ A;  4C3Q A;  3BEB A;  4NET A;  1N4O A;  3BYD A;  1SCW A;  1Z6F A;  5GHY A;  2P9V B;  4R1G A;  1MWR A;  3FYZ A;  2ZC5 B;  4BL2 A;  3WS1 A;  2R9W A;  3SS4 A;  2V2F F;  5JYP A;  4CPK A;  2ZQC A;  4P85 A;  3ZDJ A;  5GLB A;  4FH4 A;  4R3J A;  3UE1 A;  1FCM A;  2X01 A;  3BFF A;  2JE5 A;  3G2Z A;  2DCF A;  2Y2M A;  3IF5 A;  4L0L A;  4BQM A;  3MZF A;  1E3U A;  3IXG A;  5EOO A;  1G6A A;  3BM6 A;  2WK0 A;  4EBL A;  4JPM A;  4P6B A;  2Y2J A;  2WAF A;  3QNC A;  1S0W A;  5A90 A;  1FOF A;  1SKF A;  3ZVT A;  2WAE A;  3GRJ A;  4KZ9 A;  1CK3 A;  4GN2 A;  3RXW A;  1ES3 A;  1E3U D;  5DVA A;  2FFF B;  4GZB A;  5E2E A;  3G34 A;  5G18 A;  4Y0O A;  4B4X A;  4X68 A;  4OLD A;  1JWV A;  2PU2 A;  2ZD8 A;  3A3J A;  3M2K A;  3HRE A;  3V5M A;  2C5W B;  2IWB A;  3JYI A;  4GDN A;  4ZAM A;  4R4R A;  5EVL A;  4X6T A;  3VOY A;  5CEB A;  2WAD A;  4KG2 A;  3HLE A;  4RA7 A;  5FDH A;  1GHM A;  1XP4 A;  3Q7Z A;  2WUQ A;  4WZ5 A;  5E2F A;  3ZG9 B;  1FSW A;  2A49 A;  2QPN A;  4JLF A;  4IBR A;  1TEM A;  4OKP A;  1ES2 A;  5FQI A;  2I72 A;  1K54 A;  4D2O A;  3BFG A;  4E3N A;  4S2I A;  1HVB A;  1MXO A;  4GNU A;  1CEG A;  5CHM A;  3NY4 A;  4Q8I A;  1IEM A;  1YLJ A;  3C5A A;  3IWQ A;  5FQM A;  1ONH A;  1IYP A;  2PU4 A;  4WZ4 A;  1IYS A;  4E3J A;  4KG6 A;  3ZGA B;  5FAO A;  4EWF A;  3E2L A;  4Y0U A;  1ERM A;  5CTM A;  4BJP A;  3IF6 B;  3IWI A;  4S2P A;  3I7J A;  3GVB A;  2OSU A;  4LV2 A;  1EI5 A;  4RVA A;  4XUX A;  2Y2K A;  1M6K A;  1YQS A;  4DDY A;  4P87 A;  3NBL A;  3PBS A;  4KQQ A;  1TDL A;  4JKT A;  4S2J A;  3BEC A;  4S2M A;  2Q9N A;  1KDS A;  3RJU A;  1XA7 A;  4YIN A;  2Y55 A;  3Q07 A;  4LV3 A;  1NYY A;  1FSY A;  4ZJ3 A;  1JWZ A;  3TG9 A;  3NI9 A;  1ONG A;  1L0E A;  1W8Y A;  2XEP A;  1K6S A;  3G30 A;  1I2W A;  1K56 D;  3LCE A;  2EFX A;  3OPR A;  3UDI A;  3UPO A;  3NDE A;  3IWO A;  5F83 A;  4M3K A;  4DXB A;  4OON A;  4Y0T A;  4PPR A;  3VP4 A;  3OZH A;  1H5X A;  4DKI A;  3N7W A;  1HZO A;  3S1Y A;  1IEL A;  4F94 A;  3CMZ A;  3V50 A;  3LO7 A;  2WKH A;  4QY6 A;  3IF6 C;  2Y2I A;  1LL5 A;  3ZG7 B;  2ZM0 A;  4OQH A;  5EE8 A;  3HBR A;  3UE3 A;  4ZTK A;  3GMW A;  1I5Q A;  5JYO A;  3C4P A;  4KZA A;  2C6W B;  5KMW A;  3P09 A;  4PM5 A;  1PI4 A;  2H0T A;  1MWU A;  3HUO A;  4GD8 A;  5CGX A;  4LCL A;  5FQ9 A;  2EX2 A;  1Y54 A;  5DTK A;  1BSG A;  2QMI A;  3BFE A;  4ZDX A;  5A92 A;  3N6I A;  5FI2 A;  2XFT A;  2XD5 A;  1JWP A;  1JVJ A;  1PI5 A;  4FD8 A;  4KZ4 A;  5CXW A;  3C7V A;  3ZFZ A;  1SDE A;  1TVF A;  4MBK A;  4N9L A;  1W8Q A;  3AGE A;  3Q81 A;  3VP2 A;  1CI9 A;  1ES4 A;  4GKU A;  2XF3 A;  4UHU A;  5TFQ A;  1W5D A;  3HLB A;  4EUZ A;  3B3X A;  1GA0 A;  2EXB A;  2B5R A;  3ZNY A;  1G68 A;  4X69 A;  3WRT A;  1PIO A;  2IWC A;  1VQQ A;  1H8Y A;  2XLN A;  3SH9 A;  5M18 A;  4U0X A;  5CGW A;  5A93 A;  1IKI A;  4EQI A;  1W79 A;  2G2U A;  2JC7 A;  1PW1 A;  4UA7 A;  1ALQ A;  3OC2 A;  4WM9 A;  4S2N A;  1BUE A;  5CED A;  3FKW A;  5CHU A;  1K4E A;  3BFC A;  3PBR A;  3HLD A;  2EXA A;  3PBN A;  1K55 C;  1SHV A;  5CER A;  3NC8 A;  3RXX A;  3HUN A;  4HES A;  5EVI C;  5M1A A;  2WGW A;  2HDR A;  1I2S A;  4JBF A;  2XGN A;  3VFH A;  4QY5 A;  1LHY A;  3MXS A;  3A3E A;  1XGI A;  1YLZ A;  1XGJ A;  2ZLY A;  4OQI A;  4X55 A;  4KZ8 A;  4WBG A;  5FQQ A;  4GB7 A;  3ISG A;  2J9P A;  1KGF A;  4K91 A;  2P74 A;  5GHX A;  3DW0 A;  1H8Z A;  4WYY A;  5DF7 A;  2ZJ9 A;  1CEF A;  5L2F A;  1PWD A;  1RP5 A;  4B88 A;  3NDG A;  3O87 A;  5EEC A;  4BLM A;  2FFY A;  3IHA A;  3ITA A;  5GLA A;  4R4S A;  4JXW A;  4OVD A;  1IYO A;  3N8S A;  3PAE A;  5FA7 A;  3BRM A;  5FQJ A;  3SS5 A;  1N9B A;  1MKI A;  5CEC A;  4U0T A;  4IVK A;  4DRT A;  1NJ4 A;  3WWX A;  1W7F A;  5D3O A;  3OPP A;  4IBX A;  1NY0 A;  1XX2 A;  2ZC7 A;  3VP0 A;  1BLS A;  3G31 A;  3G35 A;  3GTC A;  1KE3 A;  2ZM8 A;  3Q1F A;  2WZX A;  4HBU A;  3C4O A;  4S2K A;  4KZ6 A;  5GL9 A;  3UPN A;  2WZZ A;  3W4P A;  1K4F A;  1XA1 A;  3GR2 A;  2HDQ A;  3PBT A;  3Q7V A;  4NK3 A;  3V3S A;  3WRZ A;  1FCO A;  4E3L A;  2HP9 A;  2H5S A;  3P98 A;  4OPY A;  5E2H A;  2HP5 A;  1L0G A;  4RYE A;  1IKG A;  5E43 A;  1XKZ A;  3M2J A;  5CGS A;  2DRW A;  3FZC A;  1YLP A;  1O7E A;  4JXV A;  4DE3 A;  5EOE A;  4MNR A;  1PZO A;  5HAI A;  4A5R A;  1BLC A;  3VSL A;  4JXS A;  4QU3 A;  5HL1 A;  4E3K A;  4FCF A;  1BLP A;  4MBH A;  1ESI A;  2J9O A;  3FKV A;  1E4D A;  3HLF A;  1Q2P A;  3CG5 A;  3G4P A;  3MXR A;  3A3I A;  1PZP A;  4N1H A;  4R3B A;  4X56 A;  1GCE A;  5FAS A;  1M40 A;  2Y59 A;  3BFD A;  1YMS A;  3O86 A;  3UY6 A;  4JF5 A;  2P9V A;  2WGW B;  3O3V A;  1ZKJ A;  2G2W A;  1NZO A;  5AQA A;  4LCM A;  2UWX A;  3MKF A;  4WEK A;  5HAQ A;  5FI6 A;  3TSG A;  3LY4 A;  3V39 A;  4EBN A;  3S22 A;  4PM6 A;  1LI0 A;  2Y91 A;  3W4O A;  2ZQ7 A;  2ZM2 A;  3IXH A;  1K57 C;  4LEN A;  2Y2L A;  5A91 A;  3SS3 A;  3LY3 A;  2V20 A;  4JF4 A;  4K0X A;  1KVL A;  3HVF A;  3IXD A;  1L0D A;  4S2L A;  1BLH A;  4KZB A;  1E25 A;  3ZNT A;  2DNS A;  4YFM A;  1CI8 A;  1YLT A;  4OPR A;  5M19 A;  1HTZ A;  1RGZ A;  1ZC2 A;  2HDU A;  5BOH A;  1FCN A;  4KQO A;  2Q9M A;  3D4F A;  4B4Z A;  1XXM A;  4QB8 A;  2JCH A;  1JTG A;  2Y2G A;  4K0W A;  3UO9 A;  5IHV A;  4JXG A;  4E3I A;  5DTT A;  1NYM A;  1BZA A;  1L2S A;  1OME A;  2XH9 A;  3NIA A;  3EQV A;  3OCN A;  4UA6 A;  2QZ6 A;  3ITB A;  5DTS A;  3ZCZ A;  1ESU A;  1AXB A;  1PW8 A;  4Z9Q A;  4CJN A;  1ZG6 A;  2HDS A;  1K25 A;  2XK1 A;  2ZQD A;  5TR7 A;  2OV5 A;  3AGF A;  2ZQ8 A;  1U60 A;  2WGI A;  4BL3 A;  1JTD A;  1MBL A;  2Z2M B;  4C6Y A;  1FR1 A;  4JF6 A;  4OPZ A;  1PYY A;  5FAT A;  1ERQ A;  3IT9 A;  2EX9 A;  3PAG A;  4GDB A;  4PM8 A;  4R0Q A;  5GHZ A;  5HX9 A;  3GV9 A;  3O88 A;  2PBY A;  3IH8 A;  4XXR A;  2Y2H A;  5F82 A;  4WEL A;  1NZU A;  4BEN A;  4FSF A;  4MLL A;  5FI7 A;  1EWZ A;  4OH0 A;  3PTE A;  4OP5 A;  4WZ5 C;  2BLS A;  3VP1 A;  3PBO A;  1Q2Q A;  3IH9 A;  4LV0 A;  2X02 A;  1RCJ A;  3IF6 A;  3Q82 A;  1PWC A;  5CRF A;  4E6X A;  4PM7 A;  4P0M A;  1S6R A;  1K54 C;  1KDW A;  2CC1 A;  1XPB A;  3VOZ A;  5CHJ A;  4N92 A;  4DDS A;  3UPP A;  1HD8 A;  1NXY A;  3HUM A;  2RCX A;  3UDX A;  3N8L A;  3HLW A;  4KEN B;  5KSC A;  2HP6 A;  3SOI A;  1ERO A;  4WMC A;  2EX6 A;  5FSR A;  3WS4 A;  4HBT A;  4DF6 A;  2XDM A;  1K6R A;  3IHB A;  1YLY A;  3LEZ A;  4GOG A;  3HL9 A;  4KZ3 A;  4KZ7 A;  1O07 A;  3DTM A;  3GQZ A;  3W4Q A;  4EBP A;  2VGK A;  3E2K A;  3GSG A;  4WMC D;  3VFF A;  4DE2 A;  1FR6 A;  1NRF A;  3UDF A;  2JBF A;  2XR0 A;  1ES5 A;  4FH2 A;  4DE1 A;  5CTN A;  4ZBE A;  4OLG A;  3DWZ A;  3N4I A;  4RX2 A;  4KQR A;  4UAA A;  3ZG8 B;  1WYB A;  2XFS A;  2WYX A;  2Y2P A;  5HAR A;  3BLM A;  1RGY A;  3WS5 A;  2Y2O A;  2BG1 A;  5AQ7 A;  3MKE A;  5DF9 A;  2IWD A;  5KSH A;  4H8R A;  3VSK A;  1IYQ A;  1LL9 A;  4E3M A;  4OOY A;  4O7D A;  5J8X A;  1BTL A;  3MZD A;  1KGG A;  3A3F A;  3UN7 A;  1BT5 A;  3ZHH A;  5HFO A;  2GDN A;  3EQU A;  4DXC A;  2ZC4 B;  4U3T A;  3C7U A;  5FAQ A;  3SH8 A;  5FQK A;  3MFD A;  4KG5 A;  1K55 A;  3S4X A;  2X71 A;  2Y2Q A;  5GLC A;  2Y4A A;  5EVI A;  3SH7 A;  1DJC A;  4X53 A;  4E6W A;  4Y7P A;  4E3O A;  5GLD A;  3OPL A;  4KZ5 A;  1VM1 A;  5AQB A;  3NCK A;  3WS2 A;  1GA9 A;  1YM1 A;  4MBF A;  2J7V A;  5EVI D;  4WEJ A;  3HLG A;  1J9M A;  2VGJ A;  3W8K A;  4QJG A;  1YMX A;  1PWG A;  4HEF A;  1MPL A;  3IXB A;  4QHC A;  4OOM A;  5EUA A;  3OCL A;  1TDG A;  2RL3 A;  3G2Y A;  3ZVW A;  1K56 A;  3AGD A;  1WE4 A;  3QHY A;  1DY6 A;  5I94 A;  1WYC A;  2WKI A;  1DJA A;  1MY8 A;  3CJM A;  2ZMA A;  1ZG4 A;  5U47 A;  5HAP A;  4IVI A;  1C3B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...