3H82B

Crystal structure of the high affinity heterodimer of hif2 alpha and arnt c-terminal pas domains with the artificial ligand ths020
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
113
structure length
113
Chain Sequence
LNVCQPTRFISRHNIEGIFTFVDHRCVATVGYQPQELLGKNIVEFCHPEDQQLLRDSFQQVVKLKGQVLSVMFRFRSKNQEWLWMRTSSFTFQNPYSDEIEYIICTNTNVKNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Aryl hydrocarbon receptor nuclear translocator
publication title Principles of ligand binding within a completely buried cavity in HIF2alpha PAS-B
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 32
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 2009-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF14598 PAS_11 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3h82B01
1N9LA 1D06A 4EXOA 2Z6CA 4EW7A 3F1NB 4F3LA 3C2WA 3GDIA 1XFQA 2PD8A 1V9YA 1WA9A 4WF0A 1XJ2A 5HWTA 2L1MA 4I5SA 4B9OA 4LPZA 1OTIA 3F1NA 1T1BA 2Z6DA 1T1CA 1DP6A 3D72A 2ZOHA 4L9EA 4PKYG 5DJUA 3E4QA 4R6LA 1OJ5A 3NOUC 4DJ3A 2V1AA 5G4ZA 2M1CA 4LRZE 1TS6A 1G28A 5DKKA 4LLOB 4KUOA 4I38A 4GW9A 4BBUA 4R70A 1LSVA 3RH8B 1V9ZA 3K3DA 3IS2A 2R78A 1XFNA 3MJQA 5EFWA 1TS8A 1S1YA 3A0VA 4HJ6A 4WLAA 4EERA 4HY8A 3LIEA 2VV7A 2QWSA 3MQOA 3P7NA 2PYRA 4HH3A 1DP8A 2P7JA 4BBTA 4HP4A 4HP9A 2WKRA 4I3JA 5HWVA 4GCZA 4NXFA 4EEUA 4JGQA 1GSXA 4HNBA 1ODVA 5HWWA 1P0ZA 4I3AA 1XJ6A 3F1PB 4PKYA 2QJ7A 1GSWA 1LL8A 3LUQA 4MN5A 4I39A 4WL9A 3LIDA 3UB9A 2BASA 3F1PA 3K3CA 4MN6A 3FG8A 2KDKA 1F98A 2VV6A 3BY9A 3UE6A 2OWJA 4I3IA 3B33A 4EESA 2ZBBA 2VLGA 4KQDA 4L9FA 5AVEA 1T18A 1UWPX 3C8CA 3UB8A 4JGOA 2PYPA 1T1AA 4HI4A 3E4OA 2VV8A 3OLOA 3IS2B 1UGUA 3H82B 2J80A 2A24B 5TBMB 3NHQA 2V9AA 5F6AA 3UB7A 1JNUA 3FC7A 2YKHA 1OT6A 3NJAA 3BY8A 3H82A 4H6JB 2A24A 5TBMA 2WKPA 1OTAA 2JHEA 4L9GA 1OTEA 3NOPC 3EEHA 4RQ9A 4H6JA 3UMEA 3LICA 2PDRA 2V0WA 4LRYC 2HV1A 3UMDA 2V1BA 5HDSA 1DP9A 3ICYA 1N9OA 5HDDA 2L0WA 2K7SA 3NOTC 4HJ3A 3MQQA 3EWKA 4HH2A 2OOLA 1VB6A 3LIFA 1KOUA 1NWZA 4HIAA 2WKQA 4GS9B 2V0UA 3KX0X 4EEPA 1P97A 2QJ5A 5HD5A 5F5YA 4NXGA 1S66L 2L4RA 4GHIB 4GS9A 2KX6A 1OTDA 3E4PA 5IU1A 2I9VA 3T50A 2PHYA 1OJGA 2W0NA 1S4SA 3VOLA 3GECA 4GHIA 5I5LA 1S4RA 2OWHA 3VE3A 3HJKA 5J7EA 3CAXA 1X0OA 4HOIA 2QHKA 4KUKA 4R38A 2D02A 5F69A 1UWNX 4BBVA 1BYWA 4NXEA 4WN5A 4YWZA 1N9NA 5J3WA 4WUJA 2W27A 3HJIA 3PHYA 5HD3A 3LIAA 2JN7A 4EETB 3LYXA 5DKLA 1XJ4A 2B02A 1LT0A 5AVFA 3SW1A 3LI9A 5DJTA 4E04A 1D7EA 3A0SA 3ULFA 3LI8A 3F1OB 2GJ3A 1TS7A 5HZHA 5J4EA 3IBRA 3MXQA 5KIZA 3A0RA 1S67L 2ZOIA 3RTYA 3MFXA 1LSXA 4M4XA 3F1OA 4HJ4A 4HQAA 2D01A 4R3AA 5F68A 1S1ZA 1Y28A 3ZQ5A 5HSQA 3PYPA 4EQ1A 3CWFA 2PR5A 4JGPA 2PR6A 3UB6A 2H28A 4NXBA 3G6OA 1MZUA 1LSWA 1T19A 4XT2B 4DJ2A 3LIBA 3H7WB 1XJ3A 2PD7A 3CLOA 2VEAA 1TS0A 5G4YA 1F9IA 3BWLA 5IS1A 1OTBA 4XT2A 4JGRA 2INWA 1GSVA 4HHDA 3H7WA 5HDCA 2QKPA 1EW0A 2EA9A 2CMNA 3H9WA 4F3LB 2YKFA 3MR0A 4LRXC 5A8BA 1DRMA 1OT9A 3VE4A 4K08A
chains in the Genus database with same CATH superfamily
1MY8A 2HDSA 2Z6CA 4WZ5A 1NYMA 4UA6A 2EXBA 3F1NB 3O5YA 2O99A 4F3LA 4E3NA 4WF0A 2H10A 2PT7A 3EQVA 2HPBA 3ZG0A 1OTIA 1Z09A 3F1NA 1T1CA 1DP6A 3D72A 3ITAA 3ZFZA 1I2WA 2FH5A 3QP2A 2Y2GA 2ZM8A 2ZQ9A 4FH2A 1W5DA 3FV7A 2OLVA 4X69A 5FQIA 5FASA 3B47A 3S7OA 1G28A 2QPNA 3B42A 4KUOA 4MBKA 5FI2A 3T4TA 1NZOA 2ZC6B 3BEBA 3CI6A 2LB5A 2XGNA 1LSVA 3RH8B 2X02A 3VP1A 3IH8A 4UQIM 1IKGA 4C6YA 4FOFA 1S1YA 2ZQCA 5E2FA 2HP9A 2VV7A 5EVIB 3ZVWA 4IJGA 3O86A 3UDXA 1YSPA 3N8RA 4FUWA 4HEFA 4HP9A 1WE4A 2WUQA 1WYCA 4Y13A 2BTFP 1JTGA 2W3HA 3IX4A 3VP3A 4P85A 3P01A 3CG5A 2XR0A 1HD8A 4HNBA 5E2EA 3IHBA 4UA7A 3E2LA 1AXBA 4R4RA 2QJ7A 3LUQA 1PW8A 3WS5A 2XK1A 2CC1A 2UWXA 5FQMA 1H3QA 3BLMA 3DW0A 3K3CA 5FDSA 3FG8A 3C5AA 5EVID 4N9LA 3SS3A 4OQIA 2VGKA 2OV5A 1ERMA 3TE8A 1MXOA 3MBZA 1ESIA 2VKSA 4R3JA 4RA7A 5AVEA 3BQ8A 1G6AA 4OH0A 2VGLM 5L2FA 4Y3IA 1Y4OA 4KZBA 5EE8A 4R4SA 4JGOA 3MZFA 5A93A 2DMWA 1PNEA 4JXSA 5TBMB 1XKZA 2V9AA 4BD1A 3FC7A 3SH7A 1OT6A 3OPHA 3NJAA 4KG5A 1PI5A 3IF6C 3DBAA 5TBMA 2WKPA 3C38A 1E3UD 1H5XA 4E3KA 1F2KA 2QMIA 3M6HA 2G2WA 4GD8A 2PU2A 3C4PA 3IQAA 3VFFA 1FSWA 3EEHA 4RQ9A 3UMEA 2ZQ8A 3PAGA 3WS4A 1PZOA 1PRQA 2V0WA 3LR4A 4Q0HA 1IELA 4FTXA 3UMDA 3VV4A 1KVLA 3FPWA 3G2YA 4OOYA 2K7SA 3NOTC 1ESUA 5GLCA 3HBRA 4KQRA 1LI0A 4HH2A 5F83A 1I5QA 1VB6A 3HLGA 5EOOA 4S2JA 3ZG7B 4F94A 5HAPA 1K56A 4JXVA 5DFYA 1ZHHB 2R9XA 5GLAA 3HUMA 4OP8A 1K54C 1MKMA 3NY4A 4WMCA 4GHIB 4NEED 1L0FA 4GDNA 4DE0A 2ZC5B 2XH9A 3JPUA 4DE2A 2ZMFA 3E4PA 2I9VA 3T50A 2W0NA 5GLDA 4U0TA 4YFMA 1KGEA 3GECA 4GHIA 4RVAA 3HJKA 3G32A 2Y2HA 3NIAA 4HOIA 2QHKA 4R38A 1L2SA 2OAQ1 1NYYA 2O9BA 1BYWA 1G5UA 2HJEA 2WAEA 4QHCA 4YWZA 1QMEA 1N9NA 3N8LA 1E25A 2I72A 4DKIA 4ETZA 3GSGA 1H8YA 1JWPA 5CEDA 2W27A 3G2ZA 4O0PA 1L0GA 3HJIA 5HD3A 4WMCD 4JBFA 3UE0A 4YINA 3MZEA 1CI8A 2KLIA 4EETB 1DJBA 3LYXA 5DKLA 5L07A 2XROA 4CQHA 4MDZA 5L10A 5AQBA 4PPRA 2V20A 5DVAA 5EOEA 5DTTA 1IFQA 3LI9A 3DAVA 4E04A 2ZJ9A 3ULFA 3LFVA 3LI8A 3F1OB 5HX9A 5L8MA 1VETB 1CQAA 4IUHA 3P98A 3U2AA 3M6BA 1STZA 3IBRA 3BFGA 2WZXA 3MXQA 4X1LA 4ME4A 4IEDA 2ZQAA 3F1OA 1ES5A 3FKVA 3DWKA 5AQ9A 1VETA 5HSQA 1AWIA 3LGOA 1J9MA 3LCEA 3G34A 3LO7A 3PYPA 3CITA 3Q81A 4KZ4A 4JXWA 4ZJ1A 3A3JA 5EVIC 3C30A 3NBLA 1FQGA 3UDIA 4E3IA 2ZD8A 3PTEA 3OOVA 3QP1A 2WGIA 3HREA 3W4PA 5GL9A 1CF0A 4JLFA 3OCNA 1CEGA 1DY6A 2W3GA 2JC7A 3HLDA 1TEMA 4Y7PA 1ALQA 1LSWA 3LIBA 2JKFA 2PRFA 4KENB 3CLOA 5AJGA 1XXMA 4UA9A 2J7VA 1TS0A 4DN0A 3BWLA 4D2OA 2PU4A 2J3TD 3BFCA 2INWA 4N1HA 1GSVA 3JVVA 2E8JA 5HDCA 3TOIA 3CMZA 2QKPA 2XFSA 1SHVA 1PYYA 1ZG4A 4UEYA 1FOFA 1OT9A 3HVFA 4K08A 5EPHA 3HL9A 1D06A 2Y59A 3OPRA 4OLDA 2HDRA 3IWIA 1DJAA 2V8CA 4OPRA 1KGGA 2W3DA 5FEGA 1XFQA 2ACGA 1WA9A 4DMZA 2L1MA 3PBOA 4LPZA 4K0XA 5M18A 1YM1A 2Z6DA 4BENA 4PM7A 1BT5A 1FIKA 2Y2PA 2Y4AA 1K4EA 4R6LA 1OJ5A 3ZHHA 4G3KA 4IBXA 2M1CA 4LRZE 3EGXC 3IBJA 4LLOB 4WBGA 5E43A 4I38A 3QP6A 2O0YA 1EI5A 5L09A 3BM6A 2IA2A 2OLUA 3K3DA 3KYQA 4OPZA 3HLEA 3U4LP 3MJQA 5FSRA 5EFWA 1CEFA 4L0LA 1TS8A 1FCNA 3A0VA 1YPRA 4HJ6A 1PI4A 5DF8A 4QJGA 4HY8A 2WZZA 3VOYA 2QWSA 2DNSA 2W1TB 3MQOA 3ZGAB 3P7NA 3G30A 4HH3A 3OPLA 2J9OA 4E6WA 2JKRI 2P7JA 1M6KA 2W1TA 3BYDA 3Q82A 2WGVA 5KZHA 1ONGA 3DWZA 1YLTA 2O9CA 4M3KA 3UPNA 1TVFA 3Q1FA 4EEUA 1GSXA 2Y2KA 3JVUA 1JWVA 1ODVA 5HWWA 3T4SA 4I3AA 1XJ6A 3F1PB 1L0DA 3N4IA 4PKYA 1S6RA 1GSWA 4MN5A 4N1XA 2HDQA 4WL9A 2VGJA 1NZUA 1GA0A 3EGDC 3ZNTA 3UB9A 3E0YA 4A5RA 2GNXA 1SDEA 2ZM2A 3F1PA 4ARZB 4G3VA 4MN6A 4YOFA 2QZ6A 1L3LA 3HUNA 2XA7S 3LY4A 1FCOA 5E2GA 3BY9A 3WRZA 1SZVA 4ARZA 4I3IA 2M7UA 4FSFA 1YAXA 1K55C 2VLGA 4GN2A 4KQDA 3TG9A 4L9FA 1QMFA 4BMWA 5K5BA 1T18A 1UWPX 2QYBA 4WEKA 3UB8A 1M40A 5CERA 5TGFA 4BLMA 3G35A 5FA7A 4HI4A 4LV1A 3L9KA 3VSLA 3OLOA 1UGUA 2RL3A 2J80A 1K6RA 1LHYA 1HVBA 4OVDA 3UB7A 3AGFA 1GHPA 2YKHA 3T4LA 1H8ZA 3C7VA 3W2ZA 4FD8A 3BY8A 1YKDA 2OSUA 4H6JB 3MF0A 4Q0JA 2VK3A 1OTAA 4GNUA 1NRFA 2JHEA 1ES4A 3GTCA 5FAOA 3KSGA 2Y2MA 2XLNA 1JWZA 2ZC7A 2J3TC 1YT4A 4L9GA 3S22A 3UB5P 3NOPC 4D60A 4H6JA 3NECA 2Y91A 5GHYA 1KE0A 1BLCA 2HV1A 3FKWA 1ONHA 1XGJA 1FR1A 5HAIA 1FR6A 4B4ZA 1NJ4A 3ICYA 3MSHA 3BW6A 2L0WA 3EWKA 3WRTA 2OOLA 3GV9A 4JF4A 3W8KA 3LIFA 3MKEA 1KOUA 1NWZA 1XGIA 5FQQA 5FAPA 2W3EA 1IYSA 3NDGA 2Y2OA 4OKPA 1YLPA 1O07A 1VM1A 4JXGA 2QJ5A 5HD5A 3SS5A 5HPIA 5F5YA 3C7UA 3FWLA 2W3FA 1S66L 2A2LA 1OPXA 3OZHA 2GX5A 2G2UA 2P9VB 5FL3A 3D4FA 1OTDA 4JF5A 4K0WA 5IU1A 3HLCA 2ZL1B 4Q8IA 5I5LA 3VE3A 2P9VA 1NXYA 1C3BA 3BFDA 3T1XA 1U60A 2D02A 2HZ5A 3O3VA 2ZL1A 3Q7VA 1K6SA 4BBVA 2BLSA 4QWOA 3KSFA 3GMWA 4ZJ3A 4B88A 3E2KA 4WUJA 3UN7A 3T1SA 1RGZA 3ITBA 3BFEA 3LIAA 4IBRA 5F1GA 3MXSA 1XJ4A 4WZ4A 2B02A 1FSYA 2Q9MA 3QP8A 3GR2A 1G68A 4Y0UA 5HL6A 5AVFA 3SW1A 1NY0A 1YLJA 4MN7A 4ZTKA 1H8MA 1TS7A 3PAEA 5J4EA 3HCYA 1N9BA 2V1ZA 3CUEA 3RTYA 1I2SA 4KZ5A 4M4XA 1RGYA 1LI9A 5F68A 1S1ZA 1Y28A 2Q0OA 2EFUA 1TDGA 5FAQA 2Q9NA 4LV3A 4GDBA 3M2KA 3CHWP 4UQIS 2BG1A 2HDUA 1NRJA 4O7DA 4N92A 4UAAA 3IXDA 5JYPA 2PR6A 3UB6A 3VFHA 3VMAA 4X25A 1IOUA 3BLSA 4NXBA 3G6OA 3T4JA 4S2OA 1MWRA 4KZ8A 3N6IA 3IWQA 1T19A 4XT2B 1F5MA 5FATA 2VJWA 5M19A 3H7WB 2PD7A 3A3IA 2ZMAA 3OCLA 4ZRRA 1F9IA 5IS1A 1OTBA 4XT2A 1PZPA 5CGSA 2A49A 1PWDA 4S2MA 4WZ5C 3H7WA 1PIOA 3NDEA 5TR7A 3N8SA 1K0KA 1LL5A 4ZBEA 1IYOA 1EW0A 5IT5A 1K56D 4DF6A 3BFFA 3ZNYA 4NETA 3S1YA 3VP2A 3TRCA 3KYEA 1BSGA 1N9LA 4KG6A 3WS1A 2WKEA 3BRMA 5GLBA 1JTDA 4ZAMA 3NC8A 4S2IA 4EW7A 3C2WA 5CGXA 3GDIA 4QY5A 1SDNA 2EX6A 3DTKA 3IT9A 2PD8A 1V9YA 1XJ2A 4X56A 1DJCA 3BQAA 4I5SA 4B9OA 1D1JA 4Z1WA 3ZDJA 4Q0IA 5FEFA 1T1BA 1TDLA 3IF5A 3FZCA 3UE3A 3NULA 5DJUA 1NLYA 4MMNA 3IX3A 4DJ3A 4IUKA 5G4ZA 2VGLS 4FCFA 4G3WA 2Y2NA 1KE4A 1KGFA 4EU0A 4EUVA 2JKRM 3MMHA 4Y5FA 4GW9A 4BBUA 4R70A 3PBSA 1V9ZA 5CECA 1ZKJA 4WEJA 5EM0A 3IS2A 3I7JA 1XFNA 2EX9A 2Y2LA 1MWUA 3WWXA 3Q7ZA 4WLAA 5HAQA 3QP5A 3IXBA 3LIEA 4X68A 1LL9A 4E3JA 3CPTB 4KZ7A 4JPMA 2EWVA 2FZ0A 3Q07A 2WYXA 4LENA 1DP8A 4Y17A 3CPTA 1E4DA 1BZAA 1YSQA 3HLWA 2WKRA 2P74A 4R0QA 3DTIA 5HWVA 3N7WA 4GCZA 3T4KA 4EBPA 2Y8HA 3KSIA 1ZC2A 4QU3A 1H0MA 3T4OA 1P0ZA 1XPBA 1Z6FA 1J3WA 1YLYA 3V67A 1LL8A 3LY3A 1W8QA 4I39A 3PBTA 2XA7M 3HUOA 1FCMA 4E3MA 4PM9A 1XA7A 2Y2JA 4QD4A 2A3UA 4GB7A 2OAP1 5CEBA 2KDKA 3R4KA 1NLZA 2VX8A 4IVKA 3M2JA 3MXRA 4YNRA 3B33A 2ZBBA 2X01A 4DRTA 5HW3A 1S0WA 3S7QA 1HTZA 2HF6A 3PBNA 5FQ9A 5EVLA 4KZ6A 3E4OA 2K2NA 2VV8A 5DTSA 1JVJA 4S2PA 3H82B 3NHQA 2A24B 3UPOA 3MZDA 3MFDA 4EBNA 3TSGA 2RCXA 1SKFA 4NKPA 3H82A 3RXXA 3G4PA 2A24A 2PAVP 4EBLA 5DF7A 4LGWA 1OTEA 5BOHA 2WK0A 1OMEA 2PDRA 3IF6A 4KZAA 2C5WB 4LRYC 5FI6A 2WADA 3O88A 4BD0A 4II7A 2V1BA 5EV0A 5HDSA 1DP9A 4PM5A 5HDDA 3E98A 3EOIA 4HJ3A 3MQQA 2V2FF 3FPVA 1TD5A 4P0MA 3CJMA 3ZYTA 1W8YA 1EWZA 2WKQA 4IVIA 4C75A 3KX0X 4EEPA 3MKFA 1YMSA 4OPYA 3A3EA 4B93A 3RJUA 1YQSA 2L4RA 1ES2A 4LCMA 4OLGA 4LV0A 4KZ9A 3ZVTA 4S2NA 4OOMA 2P04A 4BL2A 1KE3A 1FILA 1OJGA 2M7VA 4B4XA 3VOLA 1S4RA 2Z2MB 1MC0A 2IWBA 2DCFA 2XDMA 1Q2PA 5F69A 2XD5A 3MS6A 3T1QB 4WN5A 4GJ4A 4E3LA 2IWCA 2FFFB 3CZDA 5AQ7A 4CPKA 3PHYA 2ZMVA 2J9PA 4N9KA 2JN7A 4P6BA 5JYOA 4ID4A 5GHZA 5DF9A 3SOIA 4LCLA 1D7EA 4R1GA 5EECA 1K57A 3RFBA 3W4QA 5HZHA 5G18A 4RX2A 1RP5A 3IXGA 2HJ9C 4MLLA 2NUPC 5KIZA 1PFLA 1S67L 2ZOIA 3UNWA 1WYBA 4O8GA 2D01A 3P09A 3ZQ5A 3LR0A 1KVMA 1IEMA 4EQ1A 3CWFA 4PM6A 3V50A 2JKTI 4UHUA 4Z9QA 2Z2LB 3GQZA 3LEQA 3ZG5A 5A92A 4CLCE 3VOZA 2PBDP 5FI7A 1GCEA 4OP5A 4E6XA 5KMWA 2H28A 3QNBA 4BJPA 2J3WA 5EVIA 4C3QA 4NG2A 4BQMA 4PHTA 4DE1A 1PWCA 1PWGA 1MZUA 2P08A 3PXPA 4H8RA 1XJ3A 2ZQDA 3Q7VB 1GHMA 4PAUA 3QHYA 2ZM0A 2ZC4B 3FYZA 5HL1A 4Y0TA 4HHDA 2J8YA 2EX2A 4KZ3A 2WKHA 4OQHA 2EA9A 2CMNA 2H0TA 3K2NA 2H0YA 2Y2QA 5U47A 2YKFA 3BECA 3MR0A 1DRMA 3VE4A 2OWJA 4EXOA 4WELA 4P6ZS 4Y2FA 1CJFA 2PBYA 4GZBA 2X71A 1K4FA 2XFTA 4RX3A 5CX7A 1E3UA 3S4XA 5HWTA 3A3DA 4XUXA 2EWWA 4DXCA 2ZOHA 4L9EA 4PKYG 5GHXA 4U3TA 3T1RA 4EQIA 1W7FA 3E4QA 4QPRA 3NOUC 1K25A 3SS4A 2V1AA 1TS6A 5DKKA 3UE1A 2ZQ7A 4OQ0A 4MBFA 1VHMA 3LEZA 2JCHA 4EWFA 1BULA 4S2LA 2MJ6A 2XEPA 3R7WB 4WYYA 2R78A 5J8XA 1ES3A 3VSKA 3LR5A 4EERA 1Q2QA 3A3FA 3R7WA 5F82A 4ETXA 3EQUA 4CLCB 2PYRA 2UV0E 3QNCA 1ERQA 3ZCZA 2B95A 4LV2A 2XQZA 5KSHA 4BBTA 4HP4A 5FQJA 4OOLA 4CLCA 2EX8A 4S2NC 4I3JA 1BTLA 2WGWB 1SKOB 4NXFA 2HGVA 4JGQA 1L0EA 2H5SA 3AGEA 1Y54A 1HZOA 3HLFA 4FH4A 5LBRA 2WGWA 2B5RA 1N4OA 1SKOA 3UY6A 1IKIA 1MWSA 5CHMA 1HLUP 3LIDA 2BASA 4MEZA 4ZDXA 4S2KA 4JKTA 1YMXA 5FDHA 1F98A 4CLCD 3SZTA 2V8FA 4QY6A 2VV6A 2GDNA 5CXWA 5HARA 2K31A 5KSCA 5DTKA 3UE6A 3V3RA 1TF1A 4O01A 4GOGA 4EESA 4BL3A 4JF6A 2KOIA 3TJZC 3S7NA 3S7PA 3O87A 4EV4A 1GHIA 3C8CA 1W63Q 1K57C 4WM9A 1IYPA 5IHVA 1SCWA 5DFXA 4MCWA 2PYPA 5A91A 1T1AA 4KG2A 3IS2B 1XX2A 5HFOA 4NK3A 1K55A 5F6AA 2Y79A 1JNUA 4AFIA 4PM8A 3WS0A 3VP0A 3PR6A 2WAFA 1BLPA 4QB8A 3ISGA 2JE5A 4GKUA 4Y15A 2XF3A 3IHAA 4BWIA 2WKIA 4MNRA 1BLHA 3KSHA 3LICA 3DTEA 3SH9A 5A90A 3L7HA 5FQKA 5MC7A 1N9OA 2G7UA 2XRNA 3W4OA 5HPFA 3IH9A 4HIAA 4GS9B 2V0UA 3ZG9B 1PW1A 1G6OA 1EROA 5EVEA 1P97A 3NI9A 2JKGA 5M1AA 4NXGA 4U0XA 1KDSA 1VEUB 3IXHA 4GS9A 2KX6A 4R3BA 4ESPA 3GRJA 5CTMA 4X1MA 4X55A 2PHYA 4DE3A 3IX8A 1S4SA 5I94A 1VEUA 3T12B 1K38A 2OWHA 5E2HA 1ZTUA 3JYIA 5J7EA 2GZAA 1MWTA 3CAXA 1X0OA 3GVBA 2C6WB 4KUKA 5TJJA 3TW8A 1UWNX 1XA1A 4DDSA 4NXEA 3UDFA 4GLQA 3EEAA 4ZJ2A 2ZLYA 5J3WA 3IWOA 1MKIA 5CRFA 3V5MA 3D3OA 3G31A 2R9WA 2XD1A 3PBRA 3WS2A 1MBLA 4DXBA 4KQQA 2AVXA 1LLBA 3CUEC 3V39A 4HBTA 5CHUA 1LT0A 2LB9A 2JKTM 2XSSA 4HBUA 5DJTA 1W63M 3A0SA 4EUZA 2GJ3A 4Y0OA 3C4OA 2EXAA 4CJNA 4OONA 3B3XA 4XXRA 4X6TA 1O7EA 4RYEA 3IF6B 3A0RA 3AGDA 4K91A 3MFXA 1LSXA 3UO9A 4E3OA 4HJ4A 4HQAA 1BUEA 1BLSA 1ZG6A 4IHQA 4R3AA 2B18A 2NUTC 2VZWA 3V3SA 1KDWA 3QP4A 3UPPA 1VQQA 4GD6A 3ZG8B 2PR5A 3DTMA 1CK3A 4X53A 3VP4A 2Y2IA 4JGPA 2ZC3B 1P9RA 5CTNA 4CLCC 1XP4A 4LFUA 1ACFA 1MPLA 5EM1A 3D9YA 1CI9A 2DRWA 4DDYA 1P9WA 3T4QA 2W1RA 2IWDA 4HESA 3KO6A 3RXWA 2FFYA 4OPQA 3MQ0A 2HP6A 3NCKA 3OBFA 5C5KA 1GA9A 5EUAA 4DJ2A 1A0KA 5AQAA 3BJNA 2Y55A 5CGWA 5D3OA 1YLZA 1IYQA 4MBHA 2VEAA 2O9AA 4XUZA 5F1FA 5G4YA 4KQOA 1YLWA 1K54A 4JGRA 1RCJA 3SH8A 3PBQA 2EFXA 2E8IA 4P87A 5CHJA 4R23A 3OPPA 4P6ZM 5TFQA 2VA0A 3HLBA 4OQGA 2HP5A 3H9WA 4F3LB 2JBFA 4LRXC 3KYZA 5A8BA 1W79A 4PMAA 3LR3A 3OC2A
chains in the Genus database with same CATH topology
1N9LA 1D06A 4WELA 4EXOA 4P6ZS 4Y2FA 2Z6CA 4EW7A 3F1NB 3O5YA 2O99A 4F3LA 3C2WA 3GDIA 2W3DA 1XFQA 2PD8A 5CX7A 1V9YA 1WA9A 4WF0A 1XJ2A 4DMZA 5HWTA 2L1MA 3EQVA 2PT7A 3PBOA 3BQAA 4I5SA 4B9OA 4LPZA 1OTIA 4Z1WA 2EWWA 3F1NA 4Q0IA 1T1BA 2Z6DA 1T1CA 1DP6A 3D72A 2ZOHA 2FH5A 4L9EA 4PKYG 3UE3A 5DJUA 1NLYA 4MMNA 3E4QA 4R6LA 1OJ5A 4QPRA 3NOUC 4DJ3A 4IUKA 2V1AA 4G3KA 5G4ZA 2M1CA 2VGLS 3B47A 4LRZE 4G3WA 1TS6A 3EGXC 3IBJA 1G28A 5DKKA 3S7OA 4LLOB 3B42A 4KUOA 4EU0A 4EUVA 2JKRM 3MMHA 4I38A 4Y5FA 3T4TA 3LR3A 1VHMA 4GW9A 2O0YA 4R70A 3PBSA 3CI6A 4BBUA 2LB5A 1LSVA 2IA2A 3RH8B 2MJ6A 1V9ZA 4WEJA 4UQIM 3K3DA 3KYQA 3IS2A 3R7WB 2R78A 1XFNA 3MJQA 5EFWA 4L0LA 4FOFA 1TS8A 1S1YA 3A0VA 3LR5A 4HJ6A 4K08A 4WLAA 4EERA 4HY8A 3LIEA 2VV7A 2QWSA 2W1TB 3R7WA 3MQOA 4ETXA 3EQUA 4IJGA 3P7NA 4CLCB 2PYRA 2EWVA 4HH3A 2FZ0A 1YSPA 1DP8A 2JKRI 2P7JA 2W1TA 5KSHA 4BBTA 4HP4A 4HP9A 4OOLA 1YSQA 4CLCA 2WKRA 4I3JA 2W3HA 5HWVA 4GCZA 3T4KA 3P01A 2O9CA 4NXFA 2HGVA 4EEUA 2Y8HA 3KSIA 4JGQA 1GSXA 3JVUA 4HNBA 1ODVA 3T4OA 5HWWA 1P0ZA 3T4SA 4I3AA 1XJ6A 3F1PB 5LBRA 4PKYA 3V67A 2QJ7A 1GSWA 1LL8A 3LUQA 4MN5A 4I39A 3PBTA 2XA7M 4WL9A 3LIDA 3EGDC 3UB9A 3E0YA 2BASA 2GNXA 2OAP1 3F1PA 1H3QA 4ARZB 4G3VA 3K3CA 4MN6A 3FG8A 2KDKA 3R4KA 4YOFA 2XA7S 1F98A 4CLCD 1NLZA 2VX8A 2VV6A 3TE8A 3BY9A 2K31A 4ARZA 3UE6A 4I3IA 1TF1A 4O01A 3B33A 4YNRA 2M7UA 4EESA 4FSFA 2VKSA 1YAXA 2ZBBA 2KOIA 3TJZC 3S7NA 3S7PA 2VLGA 4KQDA 4L9FA 5AVEA 4BMWA 3BQ8A 1T18A 5K5BA 1UWPX 2QYBA 3C8CA 1W63Q 4WEKA 2VGLM 3S7QA 3UB8A 4Y3IA 2HF6A 3PBNA 5DFXA 4MCWA 4JGOA 2PYPA 1T1AA 4HI4A 3E4OA 2K2NA 2VV8A 2DMWA 3OLOA 3IS2B 1UGUA 3H82B 2J80A 2A24B 3NHQA 5TBMB 2V9AA 5F6AA 2Y79A 3UB7A 1JNUA 3FC7A 4AFIA 2YKHA 3T4LA 1OT6A 3NJAA 3W2ZA 3BY8A 1YKDA 4NKPA 3H82A 4H6JB 3MF0A 2A24A 3DBAA 2WKPA 4Q0JA 5TBMA 3PR6A 1OTAA 2JHEA 3C38A 3KSGA 2J3TC 4L9GA 1OTEA 3NOPC 3EEHA 4BWIA 4RQ9A 4H6JA 3KSHA 3UMEA 3LICA 2PDRA 2V0WA 3LR4A 4LRYC 4Q0HA 2HV1A 3UMDA 3VV4A 4II7A 2V1BA 5HDSA 1DP9A 3FPWA 3ICYA 5MC7A 1N9OA 3BW6A 2G7UA 2L0WA 2K7SA 3E98A 2XRNA 3EOIA 5HDDA 3NOTC 4HJ3A 5HPFA 3MQQA 3FPVA 1TD5A 3EWKA 4HH2A 2OOLA 3ZYTA 1VB6A 3LIFA 1KOUA 1NWZA 4HIAA 2WKQA 4GS9B 2V0UA 3KX0X 2W3EA 4EEPA 1G6OA 1P97A 2QJ5A 5HD5A 5HPIA 5F5YA 4NXGA 1ZHHB 5DFYA 2W3FA 1S66L 4B93A 2A2LA 1MKMA 1OPXA 2L4RA 2GX5A 4GHIB 4GS9A 2KX6A 4NEED 5FL3A 2ZMFA 1OTDA 4OOMA 2P04A 3E4PA 5IU1A 2I9VA 3T50A 2PHYA 2M7VA 1OJGA 2W0NA 1S4SA 3VOLA 3GECA 4GHIA 5I5LA 1S4RA 2OWHA 3VE3A 3HJKA 1ZTUA 1MC0A 5J7EA 2GZAA 3CAXA 1X0OA 4HOIA 2QHKA 4KUKA 4R38A 2D02A 5TJJA 3TW8A 5F69A 1UWNX 4BBVA 2OAQ1 2O9BA 1BYWA 4NXEA 4WN5A 2HJEA 4YWZA 4GLQA 3KSFA 1N9NA 3EEAA 4GJ4A 5J3WA 4WUJA 4ETZA 2W27A 4O0PA 3HJIA 3PHYA 5HD3A 2ZMVA 3D3OA 3LIAA 2JN7A 3PBRA 2KLIA 4EETB 3LYXA 5DKLA 3VE4A 1XJ4A 2XROA 2B02A 4CQHA 4MDZA 3CUEC 5DF9A 1LT0A 5HL6A 2LB9A 2JKTM 5AVFA 3SW1A 2XSSA 4MN7A 1IFQA 3LI9A 5DJTA 1W63M 1D7EA 4E04A 3A0SA 3ULFA 3LFVA 3LI8A 3F1OB 1H8MA 5L8MA 2GJ3A 1TS7A 3RFBA 5HZHA 5J4EA 4IUHA 3U2AA 3HCYA 1STZA 2HJ9C 3IBRA 3MXQA 2NUPC 5KIZA 3CUEA 3A0RA 4ME4A 1S67L 2ZOIA 3RTYA 3MFXA 1LSXA 4M4XA 3F1OA 4O8GA 4HJ4A 4HQAA 2D01A 4IHQA 4R3AA 5F68A 2B18A 2NUTC 1S1ZA 2VZWA 1Y28A 3ZQ5A 5HSQA 3LR0A 3PYPA 3CITA 4EQ1A 3CWFA 2PR5A 2JKTI 4JGPA 1P9RA 3C30A 4UQIS 4CLCC 4CLCE 1NRJA 3OOVA 2PR6A 3UB6A 2H28A 1P9WA 4BJPA 1IOUA 4NXBA 2W1RA 3T4QA 3KO6A 3OCNA 3MQ0A 3OBFA 2W3GA 2J3WA 3G6OA 3T4JA 4PHTA 5C5KA 1MZUA 1LSWA 1T19A 4XT2B 4DJ2A 3LIBA 2P08A 1F5MA 3PXPA 2VJWA 3H7WB 3BJNA 1XJ3A 2PD7A 3CLOA 5AJGA 2VEAA 4PAUA 2O9AA 1TS0A 3OCLA 4DN0A 4ZRRA 5G4YA 1F9IA 3BWLA 5IS1A 4KQOA 1OTBA 4XT2A 2J3TD 4JGRA 2INWA 1GSVA 4HHDA 3H7WA 3JVVA 3PBQA 5HDCA 2QKPA 4P6ZM 1EW0A 2VA0A 2EA9A 5IT5A 2CMNA 3H9WA 3K2NA 4F3LB 2YKFA 3MR0A 4UEYA 4LRXC 3KYZA 5A8BA 1DRMA 3TRCA 1OT9A 3OC2A 2OWJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N9L A;  1D06 A;  4EXO A;  2Z6C A;  4EW7 A;  3F1N B;  4F3L A;  3C2W A;  3GDI A;  1XFQ A;  2PD8 A;  1V9Y A;  1WA9 A;  4WF0 A;  1XJ2 A;  5HWT A;  2L1M A;  4I5S A;  4B9O A;  4LPZ A;  1OTI A;  3F1N A;  1T1B A;  2Z6D A;  1T1C A;  1DP6 A;  3D72 A;  2ZOH A;  4L9E A;  4PKY G;  5DJU A;  3E4Q A;  4R6L A;  1OJ5 A;  3NOU C;  4DJ3 A;  2V1A A;  5G4Z A;  2M1C A;  4LRZ E;  1TS6 A;  1G28 A;  5DKK A;  4LLO B;  4KUO A;  4I38 A;  4GW9 A;  4BBU A;  4R70 A;  1LSV A;  3RH8 B;  1V9Z A;  3K3D A;  3IS2 A;  2R78 A;  1XFN A;  3MJQ A;  5EFW A;  1TS8 A;  1S1Y A;  3A0V A;  4HJ6 A;  4WLA A;  4EER A;  4HY8 A;  3LIE A;  2VV7 A;  2QWS A;  3MQO A;  3P7N A;  2PYR A;  4HH3 A;  1DP8 A;  2P7J A;  4BBT A;  4HP4 A;  4HP9 A;  2WKR A;  4I3J A;  5HWV A;  4GCZ A;  4NXF A;  4EEU A;  4JGQ A;  1GSX A;  4HNB A;  1ODV A;  5HWW A;  1P0Z A;  4I3A A;  1XJ6 A;  3F1P B;  4PKY A;  2QJ7 A;  1GSW A;  1LL8 A;  3LUQ A;  4MN5 A;  4I39 A;  4WL9 A;  3LID A;  3UB9 A;  2BAS A;  3F1P A;  3K3C A;  4MN6 A;  3FG8 A;  2KDK A;  1F98 A;  2VV6 A;  3BY9 A;  3UE6 A;  2OWJ A;  4I3I A;  3B33 A;  4EES A;  2ZBB A;  2VLG A;  4KQD A;  4L9F A;  5AVE A;  1T18 A;  1UWP X;  3C8C A;  3UB8 A;  4JGO A;  2PYP A;  1T1A A;  4HI4 A;  3E4O A;  2VV8 A;  3OLO A;  3IS2 B;  1UGU A;  3H82 B;  2J80 A;  2A24 B;  5TBM B;  3NHQ A;  2V9A A;  5F6A A;  3UB7 A;  1JNU A;  3FC7 A;  2YKH A;  1OT6 A;  3NJA A;  3BY8 A;  3H82 A;  4H6J B;  2A24 A;  5TBM A;  2WKP A;  1OTA A;  2JHE A;  4L9G A;  1OTE A;  3NOP C;  3EEH A;  4RQ9 A;  4H6J A;  3UME A;  3LIC A;  2PDR A;  2V0W A;  4LRY C;  2HV1 A;  3UMD A;  2V1B A;  5HDS A;  1DP9 A;  3ICY A;  1N9O A;  5HDD A;  2L0W A;  2K7S A;  3NOT C;  4HJ3 A;  3MQQ A;  3EWK A;  4HH2 A;  2OOL A;  1VB6 A;  3LIF A;  1KOU A;  1NWZ A;  4HIA A;  2WKQ A;  4GS9 B;  2V0U A;  3KX0 X;  4EEP A;  1P97 A;  2QJ5 A;  5HD5 A;  5F5Y A;  4NXG A;  1S66 L;  2L4R A;  4GHI B;  4GS9 A;  2KX6 A;  1OTD A;  3E4P A;  5IU1 A;  2I9V A;  3T50 A;  2PHY A;  1OJG A;  2W0N A;  1S4S A;  3VOL A;  3GEC A;  4GHI A;  5I5L A;  1S4R A;  2OWH A;  3VE3 A;  3HJK A;  5J7E A;  3CAX A;  1X0O A;  4HOI A;  2QHK A;  4KUK A;  4R38 A;  2D02 A;  5F69 A;  1UWN X;  4BBV A;  1BYW A;  4NXE A;  4WN5 A;  4YWZ A;  1N9N A;  5J3W A;  4WUJ A;  2W27 A;  3HJI A;  3PHY A;  5HD3 A;  3LIA A;  2JN7 A;  4EET B;  3LYX A;  5DKL A;  1XJ4 A;  2B02 A;  1LT0 A;  5AVF A;  3SW1 A;  3LI9 A;  5DJT A;  4E04 A;  1D7E A;  3A0S A;  3ULF A;  3LI8 A;  3F1O B;  2GJ3 A;  1TS7 A;  5HZH A;  5J4E A;  3IBR A;  3MXQ A;  5KIZ A;  3A0R A;  1S67 L;  2ZOI A;  3RTY A;  3MFX A;  1LSX A;  4M4X A;  3F1O A;  4HJ4 A;  4HQA A;  2D01 A;  4R3A A;  5F68 A;  1S1Z A;  1Y28 A;  3ZQ5 A;  5HSQ A;  3PYP A;  4EQ1 A;  3CWF A;  2PR5 A;  4JGP A;  2PR6 A;  3UB6 A;  2H28 A;  4NXB A;  3G6O A;  1MZU A;  1LSW A;  1T19 A;  4XT2 B;  4DJ2 A;  3LIB A;  3H7W B;  1XJ3 A;  2PD7 A;  3CLO A;  2VEA A;  1TS0 A;  5G4Y A;  1F9I A;  3BWL A;  5IS1 A;  1OTB A;  4XT2 A;  4JGR A;  2INW A;  1GSV A;  4HHD A;  3H7W A;  5HDC A;  2QKP A;  1EW0 A;  2EA9 A;  2CMN A;  3H9W A;  4F3L B;  2YKF A;  3MR0 A;  4LRX C;  5A8B A;  1DRM A;  1OT9 A;  3VE4 A;  4K08 A; 
#chains in the Genus database with same CATH topology
 1MY8 A;  2HDS A;  2Z6C A;  4WZ5 A;  1NYM A;  4UA6 A;  2EXB A;  3F1N B;  3O5Y A;  2O99 A;  4F3L A;  4E3N A;  4WF0 A;  2H10 A;  2PT7 A;  3EQV A;  2HPB A;  3ZG0 A;  1OTI A;  1Z09 A;  3F1N A;  1T1C A;  1DP6 A;  3D72 A;  3ITA A;  3ZFZ A;  1I2W A;  2FH5 A;  3QP2 A;  2Y2G A;  2ZM8 A;  2ZQ9 A;  4FH2 A;  1W5D A;  3FV7 A;  2OLV A;  4X69 A;  5FQI A;  5FAS A;  3B47 A;  3S7O A;  1G28 A;  2QPN A;  3B42 A;  4KUO A;  4MBK A;  5FI2 A;  3T4T A;  1NZO A;  2ZC6 B;  3BEB A;  3CI6 A;  2LB5 A;  2XGN A;  1LSV A;  3RH8 B;  2X02 A;  3VP1 A;  3IH8 A;  4UQI M;  1IKG A;  4C6Y A;  4FOF A;  1S1Y A;  2ZQC A;  5E2F A;  2HP9 A;  2VV7 A;  5EVI B;  3ZVW A;  4IJG A;  3O86 A;  3UDX A;  1YSP A;  3N8R A;  4FUW A;  4HEF A;  4HP9 A;  1WE4 A;  2WUQ A;  1WYC A;  4Y13 A;  2BTF P;  1JTG A;  2W3H A;  3IX4 A;  3VP3 A;  4P85 A;  3P01 A;  3CG5 A;  2XR0 A;  1HD8 A;  4HNB A;  5E2E A;  3IHB A;  4UA7 A;  3E2L A;  1AXB A;  4R4R A;  2QJ7 A;  3LUQ A;  1PW8 A;  3WS5 A;  2XK1 A;  2CC1 A;  2UWX A;  5FQM A;  1H3Q A;  3BLM A;  3DW0 A;  3K3C A;  5FDS A;  3FG8 A;  3C5A A;  5EVI D;  4N9L A;  3SS3 A;  4OQI A;  2VGK A;  2OV5 A;  1ERM A;  3TE8 A;  1MXO A;  3MBZ A;  1ESI A;  2VKS A;  4R3J A;  4RA7 A;  5AVE A;  3BQ8 A;  1G6A A;  4OH0 A;  2VGL M;  5L2F A;  4Y3I A;  1Y4O A;  4KZB A;  5EE8 A;  4R4S A;  4JGO A;  3MZF A;  5A93 A;  2DMW A;  1PNE A;  4JXS A;  5TBM B;  1XKZ A;  2V9A A;  4BD1 A;  3FC7 A;  3SH7 A;  1OT6 A;  3OPH A;  3NJA A;  4KG5 A;  1PI5 A;  3IF6 C;  3DBA A;  5TBM A;  2WKP A;  3C38 A;  1E3U D;  1H5X A;  4E3K A;  1F2K A;  2QMI A;  3M6H A;  2G2W A;  4GD8 A;  2PU2 A;  3C4P A;  3IQA A;  3VFF A;  1FSW A;  3EEH A;  4RQ9 A;  3UME A;  2ZQ8 A;  3PAG A;  3WS4 A;  1PZO A;  1PRQ A;  2V0W A;  3LR4 A;  4Q0H A;  1IEL A;  4FTX A;  3UMD A;  3VV4 A;  1KVL A;  3FPW A;  3G2Y A;  4OOY A;  2K7S A;  3NOT C;  1ESU A;  5GLC A;  3HBR A;  4KQR A;  1LI0 A;  4HH2 A;  5F83 A;  1I5Q A;  1VB6 A;  3HLG A;  5EOO A;  4S2J A;  3ZG7 B;  4F94 A;  5HAP A;  1K56 A;  4JXV A;  5DFY A;  1ZHH B;  2R9X A;  5GLA A;  3HUM A;  4OP8 A;  1K54 C;  1MKM A;  3NY4 A;  4WMC A;  4GHI B;  4NEE D;  1L0F A;  4GDN A;  4DE0 A;  2ZC5 B;  2XH9 A;  3JPU A;  4DE2 A;  2ZMF A;  3E4P A;  2I9V A;  3T50 A;  2W0N A;  5GLD A;  4U0T A;  4YFM A;  1KGE A;  3GEC A;  4GHI A;  4RVA A;  3HJK A;  3G32 A;  2Y2H A;  3NIA A;  4HOI A;  2QHK A;  4R38 A;  1L2S A;  2OAQ 1;  1NYY A;  2O9B A;  1BYW A;  1G5U A;  2HJE A;  2WAE A;  4QHC A;  4YWZ A;  1QME A;  1N9N A;  3N8L A;  1E25 A;  2I72 A;  4DKI A;  4ETZ A;  3GSG A;  1H8Y A;  1JWP A;  5CED A;  2W27 A;  3G2Z A;  4O0P A;  1L0G A;  3HJI A;  5HD3 A;  4WMC D;  4JBF A;  3UE0 A;  4YIN A;  3MZE A;  1CI8 A;  2KLI A;  4EET B;  1DJB A;  3LYX A;  5DKL A;  5L07 A;  2XRO A;  4CQH A;  4MDZ A;  5L10 A;  5AQB A;  4PPR A;  2V20 A;  5DVA A;  5EOE A;  5DTT A;  1IFQ A;  3LI9 A;  3DAV A;  4E04 A;  2ZJ9 A;  3ULF A;  3LFV A;  3LI8 A;  3F1O B;  5HX9 A;  5L8M A;  1VET B;  1CQA A;  4IUH A;  3P98 A;  3U2A A;  3M6B A;  1STZ A;  3IBR A;  3BFG A;  2WZX A;  3MXQ A;  4X1L A;  4ME4 A;  4IED A;  2ZQA A;  3F1O A;  1ES5 A;  3FKV A;  3DWK A;  5AQ9 A;  1VET A;  5HSQ A;  1AWI A;  3LGO A;  1J9M A;  3LCE A;  3G34 A;  3LO7 A;  3PYP A;  3CIT A;  3Q81 A;  4KZ4 A;  4JXW A;  4ZJ1 A;  3A3J A;  5EVI C;  3C30 A;  3NBL A;  1FQG A;  3UDI A;  4E3I A;  2ZD8 A;  3PTE A;  3OOV A;  3QP1 A;  2WGI A;  3HRE A;  3W4P A;  5GL9 A;  1CF0 A;  4JLF A;  3OCN A;  1CEG A;  1DY6 A;  2W3G A;  2JC7 A;  3HLD A;  1TEM A;  4Y7P A;  1ALQ A;  1LSW A;  3LIB A;  2JKF A;  2PRF A;  4KEN B;  3CLO A;  5AJG A;  1XXM A;  4UA9 A;  2J7V A;  1TS0 A;  4DN0 A;  3BWL A;  4D2O A;  2PU4 A;  2J3T D;  3BFC A;  2INW A;  4N1H A;  1GSV A;  3JVV A;  2E8J A;  5HDC A;  3TOI A;  3CMZ A;  2QKP A;  2XFS A;  1SHV A;  1PYY A;  1ZG4 A;  4UEY A;  1FOF A;  1OT9 A;  3HVF A;  4K08 A;  5EPH A;  3HL9 A;  1D06 A;  2Y59 A;  3OPR A;  4OLD A;  2HDR A;  3IWI A;  1DJA A;  2V8C A;  4OPR A;  1KGG A;  2W3D A;  5FEG A;  1XFQ A;  2ACG A;  1WA9 A;  4DMZ A;  2L1M A;  3PBO A;  4LPZ A;  4K0X A;  5M18 A;  1YM1 A;  2Z6D A;  4BEN A;  4PM7 A;  1BT5 A;  1FIK A;  2Y2P A;  2Y4A A;  1K4E A;  4R6L A;  1OJ5 A;  3ZHH A;  4G3K A;  4IBX A;  2M1C A;  4LRZ E;  3EGX C;  3IBJ A;  4LLO B;  4WBG A;  5E43 A;  4I38 A;  3QP6 A;  2O0Y A;  1EI5 A;  5L09 A;  3BM6 A;  2IA2 A;  2OLU A;  3K3D A;  3KYQ A;  4OPZ A;  3HLE A;  3U4L P;  3MJQ A;  5FSR A;  5EFW A;  1CEF A;  4L0L A;  1TS8 A;  1FCN A;  3A0V A;  1YPR A;  4HJ6 A;  1PI4 A;  5DF8 A;  4QJG A;  4HY8 A;  2WZZ A;  3VOY A;  2QWS A;  2DNS A;  2W1T B;  3MQO A;  3ZGA B;  3P7N A;  3G30 A;  4HH3 A;  3OPL A;  2J9O A;  4E6W A;  2JKR I;  2P7J A;  1M6K A;  2W1T A;  3BYD A;  3Q82 A;  2WGV A;  5KZH A;  1ONG A;  3DWZ A;  1YLT A;  2O9C A;  4M3K A;  3UPN A;  1TVF A;  3Q1F A;  4EEU A;  1GSX A;  2Y2K A;  3JVU A;  1JWV A;  1ODV A;  5HWW A;  3T4S A;  4I3A A;  1XJ6 A;  3F1P B;  1L0D A;  3N4I A;  4PKY A;  1S6R A;  1GSW A;  4MN5 A;  4N1X A;  2HDQ A;  4WL9 A;  2VGJ A;  1NZU A;  1GA0 A;  3EGD C;  3ZNT A;  3UB9 A;  3E0Y A;  4A5R A;  2GNX A;  1SDE A;  2ZM2 A;  3F1P A;  4ARZ B;  4G3V A;  4MN6 A;  4YOF A;  2QZ6 A;  1L3L A;  3HUN A;  2XA7 S;  3LY4 A;  1FCO A;  5E2G A;  3BY9 A;  3WRZ A;  1SZV A;  4ARZ A;  4I3I A;  2M7U A;  4FSF A;  1YAX A;  1K55 C;  2VLG A;  4GN2 A;  4KQD A;  3TG9 A;  4L9F A;  1QMF A;  4BMW A;  5K5B A;  1T18 A;  1UWP X;  2QYB A;  4WEK A;  3UB8 A;  1M40 A;  5CER A;  5TGF A;  4BLM A;  3G35 A;  5FA7 A;  4HI4 A;  4LV1 A;  3L9K A;  3VSL A;  3OLO A;  1UGU A;  2RL3 A;  2J80 A;  1K6R A;  1LHY A;  1HVB A;  4OVD A;  3UB7 A;  3AGF A;  1GHP A;  2YKH A;  3T4L A;  1H8Z A;  3C7V A;  3W2Z A;  4FD8 A;  3BY8 A;  1YKD A;  2OSU A;  4H6J B;  3MF0 A;  4Q0J A;  2VK3 A;  1OTA A;  4GNU A;  1NRF A;  2JHE A;  1ES4 A;  3GTC A;  5FAO A;  3KSG A;  2Y2M A;  2XLN A;  1JWZ A;  2ZC7 A;  2J3T C;  1YT4 A;  4L9G A;  3S22 A;  3UB5 P;  3NOP C;  4D60 A;  4H6J A;  3NEC A;  2Y91 A;  5GHY A;  1KE0 A;  1BLC A;  2HV1 A;  3FKW A;  1ONH A;  1XGJ A;  1FR1 A;  5HAI A;  1FR6 A;  4B4Z A;  1NJ4 A;  3ICY A;  3MSH A;  3BW6 A;  2L0W A;  3EWK A;  3WRT A;  2OOL A;  3GV9 A;  4JF4 A;  3W8K A;  3LIF A;  3MKE A;  1KOU A;  1NWZ A;  1XGI A;  5FQQ A;  5FAP A;  2W3E A;  1IYS A;  3NDG A;  2Y2O A;  4OKP A;  1YLP A;  1O07 A;  1VM1 A;  4JXG A;  2QJ5 A;  5HD5 A;  3SS5 A;  5HPI A;  5F5Y A;  3C7U A;  3FWL A;  2W3F A;  1S66 L;  2A2L A;  1OPX A;  3OZH A;  2GX5 A;  2G2U A;  2P9V B;  5FL3 A;  3D4F A;  1OTD A;  4JF5 A;  4K0W A;  5IU1 A;  3HLC A;  2ZL1 B;  4Q8I A;  5I5L A;  3VE3 A;  2P9V A;  1NXY A;  1C3B A;  3BFD A;  3T1X A;  1U60 A;  2D02 A;  2HZ5 A;  3O3V A;  2ZL1 A;  3Q7V A;  1K6S A;  4BBV A;  2BLS A;  4QWO A;  3KSF A;  3GMW A;  4ZJ3 A;  4B88 A;  3E2K A;  4WUJ A;  3UN7 A;  3T1S A;  1RGZ A;  3ITB A;  3BFE A;  3LIA A;  4IBR A;  5F1G A;  3MXS A;  1XJ4 A;  4WZ4 A;  2B02 A;  1FSY A;  2Q9M A;  3QP8 A;  3GR2 A;  1G68 A;  4Y0U A;  5HL6 A;  5AVF A;  3SW1 A;  1NY0 A;  1YLJ A;  4MN7 A;  4ZTK A;  1H8M A;  1TS7 A;  3PAE A;  5J4E A;  3HCY A;  1N9B A;  2V1Z A;  3CUE A;  3RTY A;  1I2S A;  4KZ5 A;  4M4X A;  1RGY A;  1LI9 A;  5F68 A;  1S1Z A;  1Y28 A;  2Q0O A;  2EFU A;  1TDG A;  5FAQ A;  2Q9N A;  4LV3 A;  4GDB A;  3M2K A;  3CHW P;  4UQI S;  2BG1 A;  2HDU A;  1NRJ A;  4O7D A;  4N92 A;  4UAA A;  3IXD A;  5JYP A;  2PR6 A;  3UB6 A;  3VFH A;  3VMA A;  4X25 A;  1IOU A;  3BLS A;  4NXB A;  3G6O A;  3T4J A;  4S2O A;  1MWR A;  4KZ8 A;  3N6I A;  3IWQ A;  1T19 A;  4XT2 B;  1F5M A;  5FAT A;  2VJW A;  5M19 A;  3H7W B;  2PD7 A;  3A3I A;  2ZMA A;  3OCL A;  4ZRR A;  1F9I A;  5IS1 A;  1OTB A;  4XT2 A;  1PZP A;  5CGS A;  2A49 A;  1PWD A;  4S2M A;  4WZ5 C;  3H7W A;  1PIO A;  3NDE A;  5TR7 A;  3N8S A;  1K0K A;  1LL5 A;  4ZBE A;  1IYO A;  1EW0 A;  5IT5 A;  1K56 D;  4DF6 A;  3BFF A;  3ZNY A;  4NET A;  3S1Y A;  3VP2 A;  3TRC A;  3KYE A;  1BSG A;  1N9L A;  4KG6 A;  3WS1 A;  2WKE A;  3BRM A;  5GLB A;  1JTD A;  4ZAM A;  3NC8 A;  4S2I A;  4EW7 A;  3C2W A;  5CGX A;  3GDI A;  4QY5 A;  1SDN A;  2EX6 A;  3DTK A;  3IT9 A;  2PD8 A;  1V9Y A;  1XJ2 A;  4X56 A;  1DJC A;  3BQA A;  4I5S A;  4B9O A;  1D1J A;  4Z1W A;  3ZDJ A;  4Q0I A;  5FEF A;  1T1B A;  1TDL A;  3IF5 A;  3FZC A;  3UE3 A;  3NUL A;  5DJU A;  1NLY A;  4MMN A;  3IX3 A;  4DJ3 A;  4IUK A;  5G4Z A;  2VGL S;  4FCF A;  4G3W A;  2Y2N A;  1KE4 A;  1KGF A;  4EU0 A;  4EUV A;  2JKR M;  3MMH A;  4Y5F A;  4GW9 A;  4BBU A;  4R70 A;  3PBS A;  1V9Z A;  5CEC A;  1ZKJ A;  4WEJ A;  5EM0 A;  3IS2 A;  3I7J A;  1XFN A;  2EX9 A;  2Y2L A;  1MWU A;  3WWX A;  3Q7Z A;  4WLA A;  5HAQ A;  3QP5 A;  3IXB A;  3LIE A;  4X68 A;  1LL9 A;  4E3J A;  3CPT B;  4KZ7 A;  4JPM A;  2EWV A;  2FZ0 A;  3Q07 A;  2WYX A;  4LEN A;  1DP8 A;  4Y17 A;  3CPT A;  1E4D A;  1BZA A;  1YSQ A;  3HLW A;  2WKR A;  2P74 A;  4R0Q A;  3DTI A;  5HWV A;  3N7W A;  4GCZ A;  3T4K A;  4EBP A;  2Y8H A;  3KSI A;  1ZC2 A;  4QU3 A;  1H0M A;  3T4O A;  1P0Z A;  1XPB A;  1Z6F A;  1J3W A;  1YLY A;  3V67 A;  1LL8 A;  3LY3 A;  1W8Q A;  4I39 A;  3PBT A;  2XA7 M;  3HUO A;  1FCM A;  4E3M A;  4PM9 A;  1XA7 A;  2Y2J A;  4QD4 A;  2A3U A;  4GB7 A;  2OAP 1;  5CEB A;  2KDK A;  3R4K A;  1NLZ A;  2VX8 A;  4IVK A;  3M2J A;  3MXR A;  4YNR A;  3B33 A;  2ZBB A;  2X01 A;  4DRT A;  5HW3 A;  1S0W A;  3S7Q A;  1HTZ A;  2HF6 A;  3PBN A;  5FQ9 A;  5EVL A;  4KZ6 A;  3E4O A;  2K2N A;  2VV8 A;  5DTS A;  1JVJ A;  4S2P A;  3H82 B;  3NHQ A;  2A24 B;  3UPO A;  3MZD A;  3MFD A;  4EBN A;  3TSG A;  2RCX A;  1SKF A;  4NKP A;  3H82 A;  3RXX A;  3G4P A;  2A24 A;  2PAV P;  4EBL A;  5DF7 A;  4LGW A;  1OTE A;  5BOH A;  2WK0 A;  1OME A;  2PDR A;  3IF6 A;  4KZA A;  2C5W B;  4LRY C;  5FI6 A;  2WAD A;  3O88 A;  4BD0 A;  4II7 A;  2V1B A;  5EV0 A;  5HDS A;  1DP9 A;  4PM5 A;  5HDD A;  3E98 A;  3EOI A;  4HJ3 A;  3MQQ A;  2V2F F;  3FPV A;  1TD5 A;  4P0M A;  3CJM A;  3ZYT A;  1W8Y A;  1EWZ A;  2WKQ A;  4IVI A;  4C75 A;  3KX0 X;  4EEP A;  3MKF A;  1YMS A;  4OPY A;  3A3E A;  4B93 A;  3RJU A;  1YQS A;  2L4R A;  1ES2 A;  4LCM A;  4OLG A;  4LV0 A;  4KZ9 A;  3ZVT A;  4S2N A;  4OOM A;  2P04 A;  4BL2 A;  1KE3 A;  1FIL A;  1OJG A;  2M7V A;  4B4X A;  3VOL A;  1S4R A;  2Z2M B;  1MC0 A;  2IWB A;  2DCF A;  2XDM A;  1Q2P A;  5F69 A;  2XD5 A;  3MS6 A;  3T1Q B;  4WN5 A;  4GJ4 A;  4E3L A;  2IWC A;  2FFF B;  3CZD A;  5AQ7 A;  4CPK A;  3PHY A;  2ZMV A;  2J9P A;  4N9K A;  2JN7 A;  4P6B A;  5JYO A;  4ID4 A;  5GHZ A;  5DF9 A;  3SOI A;  4LCL A;  1D7E A;  4R1G A;  5EEC A;  1K57 A;  3RFB A;  3W4Q A;  5HZH A;  5G18 A;  4RX2 A;  1RP5 A;  3IXG A;  2HJ9 C;  4MLL A;  2NUP C;  5KIZ A;  1PFL A;  1S67 L;  2ZOI A;  3UNW A;  1WYB A;  4O8G A;  2D01 A;  3P09 A;  3ZQ5 A;  3LR0 A;  1KVM A;  1IEM A;  4EQ1 A;  3CWF A;  4PM6 A;  3V50 A;  2JKT I;  4UHU A;  4Z9Q A;  2Z2L B;  3GQZ A;  3LEQ A;  3ZG5 A;  5A92 A;  4CLC E;  3VOZ A;  2PBD P;  5FI7 A;  1GCE A;  4OP5 A;  4E6X A;  5KMW A;  2H28 A;  3QNB A;  4BJP A;  2J3W A;  5EVI A;  4C3Q A;  4NG2 A;  4BQM A;  4PHT A;  4DE1 A;  1PWC A;  1PWG A;  1MZU A;  2P08 A;  3PXP A;  4H8R A;  1XJ3 A;  2ZQD A;  3Q7V B;  1GHM A;  4PAU A;  3QHY A;  2ZM0 A;  2ZC4 B;  3FYZ A;  5HL1 A;  4Y0T A;  4HHD A;  2J8Y A;  2EX2 A;  4KZ3 A;  2WKH A;  4OQH A;  2EA9 A;  2CMN A;  2H0T A;  3K2N A;  2H0Y A;  2Y2Q A;  5U47 A;  2YKF A;  3BEC A;  3MR0 A;  1DRM A;  3VE4 A;  2OWJ A;  4EXO A;  4WEL A;  4P6Z S;  4Y2F A;  1CJF A;  2PBY A;  4GZB A;  2X71 A;  1K4F A;  2XFT A;  4RX3 A;  5CX7 A;  1E3U A;  3S4X A;  5HWT A;  3A3D A;  4XUX A;  2EWW A;  4DXC A;  2ZOH A;  4L9E A;  4PKY G;  5GHX A;  4U3T A;  3T1R A;  4EQI A;  1W7F A;  3E4Q A;  4QPR A;  3NOU C;  1K25 A;  3SS4 A;  2V1A A;  1TS6 A;  5DKK A;  3UE1 A;  2ZQ7 A;  4OQ0 A;  4MBF A;  1VHM A;  3LEZ A;  2JCH A;  4EWF A;  1BUL A;  4S2L A;  2MJ6 A;  2XEP A;  3R7W B;  4WYY A;  2R78 A;  5J8X A;  1ES3 A;  3VSK A;  3LR5 A;  4EER A;  1Q2Q A;  3A3F A;  3R7W A;  5F82 A;  4ETX A;  3EQU A;  4CLC B;  2PYR A;  2UV0 E;  3QNC A;  1ERQ A;  3ZCZ A;  2B95 A;  4LV2 A;  2XQZ A;  5KSH A;  4BBT A;  4HP4 A;  5FQJ A;  4OOL A;  4CLC A;  2EX8 A;  4S2N C;  4I3J A;  1BTL A;  2WGW B;  1SKO B;  4NXF A;  2HGV A;  4JGQ A;  1L0E A;  2H5S A;  3AGE A;  1Y54 A;  1HZO A;  3HLF A;  4FH4 A;  5LBR A;  2WGW A;  2B5R A;  1N4O A;  1SKO A;  3UY6 A;  1IKI A;  1MWS A;  5CHM A;  1HLU P;  3LID A;  2BAS A;  4MEZ A;  4ZDX A;  4S2K A;  4JKT A;  1YMX A;  5FDH A;  1F98 A;  4CLC D;  3SZT A;  2V8F A;  4QY6 A;  2VV6 A;  2GDN A;  5CXW A;  5HAR A;  2K31 A;  5KSC A;  5DTK A;  3UE6 A;  3V3R A;  1TF1 A;  4O01 A;  4GOG A;  4EES A;  4BL3 A;  4JF6 A;  2KOI A;  3TJZ C;  3S7N A;  3S7P A;  3O87 A;  4EV4 A;  1GHI A;  3C8C A;  1W63 Q;  1K57 C;  4WM9 A;  1IYP A;  5IHV A;  1SCW A;  5DFX A;  4MCW A;  2PYP A;  5A91 A;  1T1A A;  4KG2 A;  3IS2 B;  1XX2 A;  5HFO A;  4NK3 A;  1K55 A;  5F6A A;  2Y79 A;  1JNU A;  4AFI A;  4PM8 A;  3WS0 A;  3VP0 A;  3PR6 A;  2WAF A;  1BLP A;  4QB8 A;  3ISG A;  2JE5 A;  4GKU A;  4Y15 A;  2XF3 A;  3IHA A;  4BWI A;  2WKI A;  4MNR A;  1BLH A;  3KSH A;  3LIC A;  3DTE A;  3SH9 A;  5A90 A;  3L7H A;  5FQK A;  5MC7 A;  1N9O A;  2G7U A;  2XRN A;  3W4O A;  5HPF A;  3IH9 A;  4HIA A;  4GS9 B;  2V0U A;  3ZG9 B;  1PW1 A;  1G6O A;  1ERO A;  5EVE A;  1P97 A;  3NI9 A;  2JKG A;  5M1A A;  4NXG A;  4U0X A;  1KDS A;  1VEU B;  3IXH A;  4GS9 A;  2KX6 A;  4R3B A;  4ESP A;  3GRJ A;  5CTM A;  4X1M A;  4X55 A;  2PHY A;  4DE3 A;  3IX8 A;  1S4S A;  5I94 A;  1VEU A;  3T12 B;  1K38 A;  2OWH A;  5E2H A;  1ZTU A;  3JYI A;  5J7E A;  2GZA A;  1MWT A;  3CAX A;  1X0O A;  3GVB A;  2C6W B;  4KUK A;  5TJJ A;  3TW8 A;  1UWN X;  1XA1 A;  4DDS A;  4NXE A;  3UDF A;  4GLQ A;  3EEA A;  4ZJ2 A;  2ZLY A;  5J3W A;  3IWO A;  1MKI A;  5CRF A;  3V5M A;  3D3O A;  3G31 A;  2R9W A;  2XD1 A;  3PBR A;  3WS2 A;  1MBL A;  4DXB A;  4KQQ A;  2AVX A;  1LLB A;  3CUE C;  3V39 A;  4HBT A;  5CHU A;  1LT0 A;  2LB9 A;  2JKT M;  2XSS A;  4HBU A;  5DJT A;  1W63 M;  3A0S A;  4EUZ A;  2GJ3 A;  4Y0O A;  3C4O A;  2EXA A;  4CJN A;  4OON A;  3B3X A;  4XXR A;  4X6T A;  1O7E A;  4RYE A;  3IF6 B;  3A0R A;  3AGD A;  4K91 A;  3MFX A;  1LSX A;  3UO9 A;  4E3O A;  4HJ4 A;  4HQA A;  1BUE A;  1BLS A;  1ZG6 A;  4IHQ A;  4R3A A;  2B18 A;  2NUT C;  2VZW A;  3V3S A;  1KDW A;  3QP4 A;  3UPP A;  1VQQ A;  4GD6 A;  3ZG8 B;  2PR5 A;  3DTM A;  1CK3 A;  4X53 A;  3VP4 A;  2Y2I A;  4JGP A;  2ZC3 B;  1P9R A;  5CTN A;  4CLC C;  1XP4 A;  4LFU A;  1ACF A;  1MPL A;  5EM1 A;  3D9Y A;  1CI9 A;  2DRW A;  4DDY A;  1P9W A;  3T4Q A;  2W1R A;  2IWD A;  4HES A;  3KO6 A;  3RXW A;  2FFY A;  4OPQ A;  3MQ0 A;  2HP6 A;  3NCK A;  3OBF A;  5C5K A;  1GA9 A;  5EUA A;  4DJ2 A;  1A0K A;  5AQA A;  3BJN A;  2Y55 A;  5CGW A;  5D3O A;  1YLZ A;  1IYQ A;  4MBH A;  2VEA A;  2O9A A;  4XUZ A;  5F1F A;  5G4Y A;  4KQO A;  1YLW A;  1K54 A;  4JGR A;  1RCJ A;  3SH8 A;  3PBQ A;  2EFX A;  2E8I A;  4P87 A;  5CHJ A;  4R23 A;  3OPP A;  4P6Z M;  5TFQ A;  2VA0 A;  3HLB A;  4OQG A;  2HP5 A;  3H9W A;  4F3L B;  2JBF A;  4LRX C;  3KYZ A;  5A8B A;  1W79 A;  4PMA A;  3LR3 A;  3OC2 A; 
#chains in the Genus database with same CATH homology
 1N9L A;  1D06 A;  4WEL A;  4EXO A;  4P6Z S;  4Y2F A;  2Z6C A;  4EW7 A;  3F1N B;  3O5Y A;  2O99 A;  4F3L A;  3C2W A;  3GDI A;  2W3D A;  1XFQ A;  2PD8 A;  5CX7 A;  1V9Y A;  1WA9 A;  4WF0 A;  1XJ2 A;  4DMZ A;  5HWT A;  2L1M A;  3EQV A;  2PT7 A;  3PBO A;  3BQA A;  4I5S A;  4B9O A;  4LPZ A;  1OTI A;  4Z1W A;  2EWW A;  3F1N A;  4Q0I A;  1T1B A;  2Z6D A;  1T1C A;  1DP6 A;  3D72 A;  2ZOH A;  2FH5 A;  4L9E A;  4PKY G;  3UE3 A;  5DJU A;  1NLY A;  4MMN A;  3E4Q A;  4R6L A;  1OJ5 A;  4QPR A;  3NOU C;  4DJ3 A;  4IUK A;  2V1A A;  4G3K A;  5G4Z A;  2M1C A;  2VGL S;  3B47 A;  4LRZ E;  4G3W A;  1TS6 A;  3EGX C;  3IBJ A;  1G28 A;  5DKK A;  3S7O A;  4LLO B;  3B42 A;  4KUO A;  4EU0 A;  4EUV A;  2JKR M;  3MMH A;  4I38 A;  4Y5F A;  3T4T A;  3LR3 A;  1VHM A;  4GW9 A;  2O0Y A;  4R70 A;  3PBS A;  3CI6 A;  4BBU A;  2LB5 A;  1LSV A;  2IA2 A;  3RH8 B;  2MJ6 A;  1V9Z A;  4WEJ A;  4UQI M;  3K3D A;  3KYQ A;  3IS2 A;  3R7W B;  2R78 A;  1XFN A;  3MJQ A;  5EFW A;  4L0L A;  4FOF A;  1TS8 A;  1S1Y A;  3A0V A;  3LR5 A;  4HJ6 A;  4K08 A;  4WLA A;  4EER A;  4HY8 A;  3LIE A;  2VV7 A;  2QWS A;  2W1T B;  3R7W A;  3MQO A;  4ETX A;  3EQU A;  4IJG A;  3P7N A;  4CLC B;  2PYR A;  2EWV A;  4HH3 A;  2FZ0 A;  1YSP A;  1DP8 A;  2JKR I;  2P7J A;  2W1T A;  5KSH A;  4BBT A;  4HP4 A;  4HP9 A;  4OOL A;  1YSQ A;  4CLC A;  2WKR A;  4I3J A;  2W3H A;  5HWV A;  4GCZ A;  3T4K A;  3P01 A;  2O9C A;  4NXF A;  2HGV A;  4EEU A;  2Y8H A;  3KSI A;  4JGQ A;  1GSX A;  3JVU A;  4HNB A;  1ODV A;  3T4O A;  5HWW A;  1P0Z A;  3T4S A;  4I3A A;  1XJ6 A;  3F1P B;  5LBR A;  4PKY A;  3V67 A;  2QJ7 A;  1GSW A;  1LL8 A;  3LUQ A;  4MN5 A;  4I39 A;  3PBT A;  2XA7 M;  4WL9 A;  3LID A;  3EGD C;  3UB9 A;  3E0Y A;  2BAS A;  2GNX A;  2OAP 1;  3F1P A;  1H3Q A;  4ARZ B;  4G3V A;  3K3C A;  4MN6 A;  3FG8 A;  2KDK A;  3R4K A;  4YOF A;  2XA7 S;  1F98 A;  4CLC D;  1NLZ A;  2VX8 A;  2VV6 A;  3TE8 A;  3BY9 A;  2K31 A;  4ARZ A;  3UE6 A;  4I3I A;  1TF1 A;  4O01 A;  3B33 A;  4YNR A;  2M7U A;  4EES A;  4FSF A;  2VKS A;  1YAX A;  2ZBB A;  2KOI A;  3TJZ C;  3S7N A;  3S7P A;  2VLG A;  4KQD A;  4L9F A;  5AVE A;  4BMW A;  3BQ8 A;  1T18 A;  5K5B A;  1UWP X;  2QYB A;  3C8C A;  1W63 Q;  4WEK A;  2VGL M;  3S7Q A;  3UB8 A;  4Y3I A;  2HF6 A;  3PBN A;  5DFX A;  4MCW A;  4JGO A;  2PYP A;  1T1A A;  4HI4 A;  3E4O A;  2K2N A;  2VV8 A;  2DMW A;  3OLO A;  3IS2 B;  1UGU A;  3H82 B;  2J80 A;  2A24 B;  3NHQ A;  5TBM B;  2V9A A;  5F6A A;  2Y79 A;  3UB7 A;  1JNU A;  3FC7 A;  4AFI A;  2YKH A;  3T4L A;  1OT6 A;  3NJA A;  3W2Z A;  3BY8 A;  1YKD A;  4NKP A;  3H82 A;  4H6J B;  3MF0 A;  2A24 A;  3DBA A;  2WKP A;  4Q0J A;  5TBM A;  3PR6 A;  1OTA A;  2JHE A;  3C38 A;  3KSG A;  2J3T C;  4L9G A;  1OTE A;  3NOP C;  3EEH A;  4BWI A;  4RQ9 A;  4H6J A;  3KSH A;  3UME A;  3LIC A;  2PDR A;  2V0W A;  3LR4 A;  4LRY C;  4Q0H A;  2HV1 A;  3UMD A;  3VV4 A;  4II7 A;  2V1B A;  5HDS A;  1DP9 A;  3FPW A;  3ICY A;  5MC7 A;  1N9O A;  3BW6 A;  2G7U A;  2L0W A;  2K7S A;  3E98 A;  2XRN A;  3EOI A;  5HDD A;  3NOT C;  4HJ3 A;  5HPF A;  3MQQ A;  3FPV A;  1TD5 A;  3EWK A;  4HH2 A;  2OOL A;  3ZYT A;  1VB6 A;  3LIF A;  1KOU A;  1NWZ A;  4HIA A;  2WKQ A;  4GS9 B;  2V0U A;  3KX0 X;  2W3E A;  4EEP A;  1G6O A;  1P97 A;  2QJ5 A;  5HD5 A;  5HPI A;  5F5Y A;  4NXG A;  1ZHH B;  5DFY A;  2W3F A;  1S66 L;  4B93 A;  2A2L A;  1MKM A;  1OPX A;  2L4R A;  2GX5 A;  4GHI B;  4GS9 A;  2KX6 A;  4NEE D;  5FL3 A;  2ZMF A;  1OTD A;  4OOM A;  2P04 A;  3E4P A;  5IU1 A;  2I9V A;  3T50 A;  2PHY A;  2M7V A;  1OJG A;  2W0N A;  1S4S A;  3VOL A;  3GEC A;  4GHI A;  5I5L A;  1S4R A;  2OWH A;  3VE3 A;  3HJK A;  1ZTU A;  1MC0 A;  5J7E A;  2GZA A;  3CAX A;  1X0O A;  4HOI A;  2QHK A;  4KUK A;  4R38 A;  2D02 A;  5TJJ A;  3TW8 A;  5F69 A;  1UWN X;  4BBV A;  2OAQ 1;  2O9B A;  1BYW A;  4NXE A;  4WN5 A;  2HJE A;  4YWZ A;  4GLQ A;  3KSF A;  1N9N A;  3EEA A;  4GJ4 A;  5J3W A;  4WUJ A;  4ETZ A;  2W27 A;  4O0P A;  3HJI A;  3PHY A;  5HD3 A;  2ZMV A;  3D3O A;  3LIA A;  2JN7 A;  3PBR A;  2KLI A;  4EET B;  3LYX A;  5DKL A;  3VE4 A;  1XJ4 A;  2XRO A;  2B02 A;  4CQH A;  4MDZ A;  3CUE C;  5DF9 A;  1LT0 A;  5HL6 A;  2LB9 A;  2JKT M;  5AVF A;  3SW1 A;  2XSS A;  4MN7 A;  1IFQ A;  3LI9 A;  5DJT A;  1W63 M;  1D7E A;  4E04 A;  3A0S A;  3ULF A;  3LFV A;  3LI8 A;  3F1O B;  1H8M A;  5L8M A;  2GJ3 A;  1TS7 A;  3RFB A;  5HZH A;  5J4E A;  4IUH A;  3U2A A;  3HCY A;  1STZ A;  2HJ9 C;  3IBR A;  3MXQ A;  2NUP C;  5KIZ A;  3CUE A;  3A0R A;  4ME4 A;  1S67 L;  2ZOI A;  3RTY A;  3MFX A;  1LSX A;  4M4X A;  3F1O A;  4O8G A;  4HJ4 A;  4HQA A;  2D01 A;  4IHQ A;  4R3A A;  5F68 A;  2B18 A;  2NUT C;  1S1Z A;  2VZW A;  1Y28 A;  3ZQ5 A;  5HSQ A;  3LR0 A;  3PYP A;  3CIT A;  4EQ1 A;  3CWF A;  2PR5 A;  2JKT I;  4JGP A;  1P9R A;  3C30 A;  4UQI S;  4CLC C;  4CLC E;  1NRJ A;  3OOV A;  2PR6 A;  3UB6 A;  2H28 A;  1P9W A;  4BJP A;  1IOU A;  4NXB A;  2W1R A;  3T4Q A;  3KO6 A;  3OCN A;  3MQ0 A;  3OBF A;  2W3G A;  2J3W A;  3G6O A;  3T4J A;  4PHT A;  5C5K A;  1MZU A;  1LSW A;  1T19 A;  4XT2 B;  4DJ2 A;  3LIB A;  2P08 A;  1F5M A;  3PXP A;  2VJW A;  3H7W B;  3BJN A;  1XJ3 A;  2PD7 A;  3CLO A;  5AJG A;  2VEA A;  4PAU A;  2O9A A;  1TS0 A;  3OCL A;  4DN0 A;  4ZRR A;  5G4Y A;  1F9I A;  3BWL A;  5IS1 A;  4KQO A;  1OTB A;  4XT2 A;  2J3T D;  4JGR A;  2INW A;  1GSV A;  4HHD A;  3H7W A;  3JVV A;  3PBQ A;  5HDC A;  2QKP A;  4P6Z M;  1EW0 A;  2VA0 A;  2EA9 A;  5IT5 A;  2CMN A;  3H9W A;  3K2N A;  4F3L B;  2YKF A;  3MR0 A;  4UEY A;  4LRX C;  3KYZ A;  5A8B A;  1DRM A;  3TRC A;  1OT9 A;  3OC2 A;  2OWJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...