3H82B

Crystal structure of the high affinity heterodimer of hif2 alpha and arnt c-terminal pas domains with the artificial ligand ths020
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
113
structure length
113
Chain Sequence
LNVCQPTRFISRHNIEGIFTFVDHRCVATVGYQPQELLGKNIVEFCHPEDQQLLRDSFQQVVKLKGQVLSVMFRFRSKNQEWLWMRTSSFTFQNPYSDEIEYIICTNTNVKNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords Aryl hydrocarbon receptor nuclear translocator
publication title Principles of ligand binding within a completely buried cavity in HIF2alpha PAS-B
pubmed doi rcsb
source organism Homo sapiens
total genus 32
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 2009-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF14598 PAS_11 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3h82B01
4HJ6A 2YKFA 3K3CA 1T1AA 4L9GA 2V0WA 1ODVA 3A0VA 2JN7A 3BY8A 4BBUA 2V1AA 1V9ZA 2OOLA 4L9FA 4WF0A 4EEUA 2PR5A 3E4PA 4GW9A 3GDIA 2QJ7A 5IU1A 3ZQ5A 1DP8A 2I9VA 5DJUA 1OTIA 1T19A 4R6LA 5G4YA 3LUQA 1OTBA 3LIFA 1OJ5A 1XJ4A 2W27A 3E4QA 2L4RA 4HOIA 1JNUA 3LIAA 5DKKA 2W0NA 3F1NA 4HH3A 2QHKA 3F1NB 5DKLA 2VV6A 3CAXA 5G4ZA 4RQ9A 4WLAA 4HQAA 5HSQA 2M1CA 5I5LA 5AVFA 4HJ3A 4GCZA 4WUJA 4HJ4A 1T1BA 1XFQA 1OT9A 2D01A 1VB6A 1WA9A 3EWKA 4JGRA 3LIDA 3ICYA 5HDDA 3B33A 4I39A 1UWNX 3GECA 5F5YA 4GHIA 2P7JA 4PKYG 4LLOB 4GHIB 3BY9A 2ZOHA 1XFNA 1F98A 3T50A 3NOPC 3F1OA 2L1MA 5HWTA 4H6JA 3SW1A 4WN5A 3UB7A 4KQDA 4I3AA 3UMEA 3F1OB 2PYPA 4H6JB 1GSXA 1P97A 1P0ZA 2HV1A 5IS1A 1DRMA 2A24A 3HJIA 2A24B 3LI9A 1TS8A 1V9YA 3NOTC 1LSVA 5KIZA 4R38A 4JGQA 4LRYC 3D72A 1F9IA 4BBTA 4MN6A 5HD3A 4F3LA 5F6AA 3UB9A 1OT6A 5J3WA 4F3LB 4GS9A 2WKRA 2BASA 3G6OA 3OLOA 1OTEA 3IS2A 3MQOA 4GS9B 5HDCA 3IS2B 2V9AA 2KX6A 3EEHA 2KDKA 2V1BA 5A8BA 1D06A 3H7WA 2INWA 1XJ2A 2J80A 3H7WB 2QJ5A 2QKPA 4DJ2A 2QWSA 5TBMA 3CWFA 1KOUA 5TBMB 4NXBA 1XJ6A 4HI4A 3KX0X 3NJAA 4R3AA 5HDSA 3PHYA 4EETB 3RH8B 4XT2A 1N9OA 5EFWA 3A0SA 4HP9A 1N9LA 3H82A 4XT2B 3MXQA 4EXOA 3H82B 1LL8A 3NHQA 4LPZA 4DJ3A 2Z6DA 1TS7A 1UWPX 2D02A 1GSVA 2PR6A 1DP9A 1T18A 2YKHA 3MJQA 1G28A 4I38A 4MN5A 4I5SA 4LRZE 5HZHA 2WKPA 4NXEA 2B02A 3FG8A 3MFXA 4EW7A 1S4SA 3LIEA 3UE6A 3UMDA 1EW0A 4PKYA 4HIAA 3H9WA 4EESA 4EQ1A 1LT0A 3LI8A 1DP6A 5F69A 1D7EA 4KUOA 3LYXA 1BYWA 1OTAA 3C2WA 3ULFA 1MZUA 2H28A 2V0UA 4JGOA 4L9EA 4NXFA 4I3JA 1S66L 1Y28A 5F68A 2PYRA 2CMNA 5HWVA 2JHEA 1GSWA 4YWZA 5DJTA 4LRXC 1NWZA 4B9OA 2GJ3A 2VLGA 4HNBA 3IBRA 1UGUA 5AVEA 3E4OA 3LIBA 4NXGA 3P7NA 4BBVA 5HD5A 3UB8A 1S67L 1T1CA 3VOLA 4HY8A 1N9NA 2R78A 4R70A 4E04A 3C8CA 2EA9A 4HHDA 4KUKA 4EEPA 2ZOIA 4I3IA 2WKQA 3HJKA 4HP4A 1X0OA 2L0WA 2VV7A 2OWHA 3CLOA 2PD7A 3FC7A 1S1ZA 3MQQA 3PYPA 1LSXA 2VEAA 4M4XA 3F1PA 2PD8A 2OWJA 2Z6CA 4WL9A 3VE4A 4HH2A 3F1PB 1LSWA 1S4RA 4EERA 4JGPA 1TS0A 1S1YA 3A0RA 1OJGA 2PDRA 3BWLA 1TS6A 2VV8A 5J7EA 3K3DA 3RTYA 3UB6A 1OTDA 5J4EA 3MR0A 4K08A 3NOUC 2K7SA 1XJ3A 2PHYA 3LICA 3VE3A 5HWWA 2ZBBA
chains in the Genus database with same CATH superfamily
4O7DA 4HJ6A 5E2FA 3A3DA 1SDEA 2Y2NA 1DJAA 3ZG0A 3G32A 2EWVA 5HPFA 4BENA 4E3NA 5K5BA 3A0VA 1YLJA 1V9ZA 3QP8A 4BL2A 3S7QA 4WF0A 2PR5A 3C7UA 2Y2MA 3MFDA 5JYPA 3GDIA 3BFDA 2QJ7A 4P6ZS 3ZQ5A 2I9VA 1RGYA 2XA7M 3KSFA 5DJUA 3T1XA 4IHQA 3LUQA 3CZDA 4NKPA 1HVBA 4HOIA 4X69A 4PM7A 1L0DA 4IUHA 4HH3A 4DRTA 2Z2LB 1BUEA 2R9WA 2VV6A 3P98A 3LR4A 4PM9A 1PWGA 4HQAA 2OSUA 2M1CA 4QD4A 4JXSA 5I5LA 3MBZA 3T1QB 4UHUA 4MNRA 4GCZA 4R4RA 2O9CA 4WUJA 4OPQA 2X71A 1YKDA 4GJ4A 4KZBA 1BULA 4GNUA 1KVMA 4I39A 1UWNX 2PU2A 2FFYA 3GECA 5F5YA 3SS3A 3KYEA 3BFGA 1BLSA 3QP2A 2H10A 2DNSA 2C6WB 1H0MA 3NOPC 4WN5A 2Y2JA 5HL1A 4C75A 5FAQA 3UE0A 2PYPA 2QPNA 1GSXA 1A0KA 4LV1A 1P0ZA 5FI2A 4UAAA 1DRMA 4IUKA 3N8SA 5AQBA 2WKIA 3ZFZA 1G6OA 1TS8A 1V9YA 1W8YA 3GR2A 3NOTC 4RX3A 4P87A 3HUMA 2ZC4B 5E43A 3IXBA 3PBQA 5G18A 5AJGA 4PAUA 3T12B 1RGZA 3UPNA 4II7A 1ERMA 4R0QA 3GVBA 3UNWA 1TD5A 3E0YA 4FUWA 2B5RA 5F6AA 1OT6A 4EWFA 2W1RA 1Y4OA 3IF6A 4WELA 1NJ4A 1GA0A 4WZ4A 3NBLA 1PRQA 3IF6B 5EPHA 5CGWA 2O9AA 2V9AA 3KO6A 4P85A 1ZG6A 1DJCA 2QZ6A 4ARZA 2V1BA 3H7WA 1ZHHB 3NDEA 2J7VA 4ARZB 4DE1A 3H7WB 4OOLA 4WEKA 2QWSA 3C4OA 1WYCA 4G3VA 3M6BA 1J9MA 3IQAA 3FKVA 1O07A 2B18A 2HDQA 1Z6FA 1ZG4A 4CJNA 3RH8B 4EETB 4S2KA 3VOZA 1OPXA 4Y0OA 4HP9A 3S7OA 4D60A 3IXDA 3HLDA 4MEZA 1ONHA 3WS0A 1IYSA 5KMWA 4R23A 4A5RA 1PWCA 5F1FA 4MBKA 1TDGA 3JVVA 3PR6A 2W3EA 2D02A 3EEAA 3T4SA 1DP9A 1YLZA 1IFQA 1T18A 2RL3A 1G28A 4XUXA 3BECA 2PBYA 4Y13A 2VGLS 4LV3A 2ZD8A 3UDFA 1L0EA 1S4SA 3VOYA 4KZ6A 4GZBA 1FCMA 2VX8A 1YQSA 1L0FA 1MKIA 4U0XA 4KZ3A 2JKFA 3D4FA 2ZQ9A 3LI8A 1DP6A 4ME4A 2H5SA 1N9BA 3IX8A 3DW0A 4Y5FA 1STZA 4GB7A 1PFLA 3S7PA 4ID4A 3FPWA 2V0UA 3OPLA 1G5UA 1Y28A 2PYRA 2I72A 3LCEA 2EX6A 3LY3A 2CMNA 2XEPA 4UA7A 4DE2A 4YWZA 1IYPA 4FH4A 2J3WA 2XA7S 4KG6A 2WZZA 4Q0JA 5FQKA 2XLNA 3ZG8B 4EBLA 3KSIA 3UB5P 5GHXA 4N1XA 4OPYA 2DRWA 1G6AA 2Y2QA 4BWIA 4X55A 1W7FA 4Q0HA 1N9NA 1OMEA 4QPRA 5DFYA 4E04A 4EBPA 2IWBA 4F94A 3C8CA 3V5MA 4HHDA 1SKFA 2Y59A 3LEZA 3G30A 4HP4A 3KSGA 3WS1A 2DMWA 3IXHA 2ZL1A 2L0WA 2XD1A 3QP6A 5E2GA 2J3TC 4H8RA 1BT5A 4Y7PA 2ZL1B 1H3QA 2PD7A 5CERA 4PMAA 4AFIA 2EX2A 3ZVWA 1PZPA 3WWXA 1FCOA 1NXYA 4OQ0A 1KVLA 1S1ZA 3MQQA 4KQOA 3QP1A 3T4JA 5FASA 1MC0A 5EECA 4RYEA 1LSXA 3S7NA 1P9RA 4M4XA 4ETZA 1E3UA 2OWJA 5CRFA 4DN0A 4KZ8A 3EQVA 3VP4A 3NY4A 1FR6A 5FL3A 3O5YA 1XP4A 3E98A 1I2SA 2PDRA 3BWLA 3FWLA 1TDLA 5TR7A 5J7EA 2W3HA 5EM0A 4UEYA 4Q8IA 4S2IA 3MR0A 4S2NA 5F82A 1IOUA 3UY6A 3NOUC 2PHYA 3CG5A 3VE3A 4EQIA 5HWWA 3PBRA 1ERQA 2J8YA 3DTIA 1W5DA 1WE4A 1NRJA 2XROA 5GHZA 1ESUA 1ODVA 5GLAA 1S6RA 5FI7A 2KLIA 4BQMA 1KDWA 4R1GA 1P9WA 5CHMA 3RXWA 1MPLA 3BFEA 1YSPA 3E4PA 4Y15A 4GW9A 4LENA 1DP8A 5HX9A 5CX7A 2O9BA 1GHMA 1K56D 4MN7A 4IVIA 1PW1A 5G4YA 3V39A 1OTBA 1OJ5A 4IBXA 1H8MA 3FV7A 2W27A 3O86A 3LIAA 5HAIA 2W0NA 1M6KA 3F1NA 1K55A 3CHWP 4JXVA 3F1NB 3V3SA 4RQ9A 2WYXA 4GD8A 2GDNA 5U47A 1EROA 5HSQA 2JKTI 5DVAA 4KZAA 3Q07A 5HARA 1F2KA 2PT7A 5CXWA 3JYIA 1ES4A 4HEFA 1PZOA 1L3LA 1ZTUA 3MQ0A 2FZ0A 1H8ZA 1W79A 2RCXA 1XFQA 1OT9A 5IT5A 2D01A 3UDXA 3ZYTA 1VB6A 3GQZA 4JXGA 1WA9A 4JGRA 2VA0A 3LIDA 2WZXA 2Y2OA 3BFCA 4OH0A 4QU3A 4CLCD 1NZOA 2JKRI 4WMCA 2P7JA 1QMFA 4MBFA 4LLOB 2EXAA 3TRCA 2ZOHA 1K38A 5FQMA 5CHJA 3TE8A 3CPTA 3T50A 2L1MA 1C3BA 4H6JA 2ACGA 1ES2A 3CPTB 1JWZA 4I3AA 5DF9A 4H6JB 2M7UA 1K6SA 1KGFA 4UQIM 2HV1A 4Z9QA 1EWZA 5IS1A 2A24A 2HP9A 2A24B 3LI9A 3MZDA 2Q0OA 2PAVP 3SOIA 4JGQA 5L8MA 1K0KA 3FPVA 3SH7A 4LRYC 3N6IA 4Y0UA 2X01A 2H0YA 4OPZA 1SCWA 4S2PA 3U2AA 2GZAA 4ZRRA 3A3IA 4MN6A 3QP4A 5HD3A 4X1MA 5FEGA 3CI6A 2HF6A 4MDZA 5GLCA 2LB5A 2OLUA 4RX2A 3UB9A 1FSYA 5J3WA 3UPOA 1FQGA 4JPMA 4NETA 2BASA 3MQOA 4U3TA 5HDCA 4FCFA 3Q1FA 3T4OA 3A3JA 3EEHA 2KDKA 5A8BA 2INWA 1IKIA 1XJ2A 2J80A 1FIKA 5J8XA 5FQ9A 4DDSA 5DF7A 3E2KA 5CHUA 3OOVA 3CWFA 1AWIA 1PW8A 1QMEA 3HLWA 1KOUA 4NXBA 1XJ6A 3W4PA 3CUEA 4S2NC 1BLCA 3VP1A 4XT2A 4ZBEA 4OQGA 3H82A 4XT2B 5HW3A 3MXQA 4QY5A 4Y3IA 1YLWA 3H82B 4PHTA 3M2KA 5CECA 1IYQA 2BG1A 5L2FA 3N4IA 2WK0A 1TS7A 5TJJA 1ONGA 2NUTC 4C3QA 1XKZA 3OPRA 1GSVA 5F83A 1CEFA 2W1TA 4I38A 1JWVA 1MKMA 4YFMA 4Y17A 2W1TB 2EX8A 3L7HA 3TJZC 2JE5A 2HP5A 5KSCA 2R9XA 4EW7A 4PPRA 4QY6A 2ZC6B 3UMDA 5CGSA 1EW0A 1GHIA 4KZ9A 3SS5A 4KENB 2V2FF 2X02A 5L07A 4EESA 2HDSA 1YPRA 2JKGA 3ZGAB 2VJWA 1D7EA 1MWSA 3KYZA 4NK3A 5EM1A 3LYXA 4U0TA 1BYWA 1BTLA 3ULFA 4X1LA 4DMZA 2BLSA 2O99A 3ITAA 4I3JA 4X68A 1S66L 3VP0A 4Y0TA 3R7WA 2ZC5B 4OVDA 2Y2GA 3BRMA 3EGXC 3R7WB 2JHEA 1GSWA 5DJTA 3Q81A 1YLYA 2Y2LA 3CITA 3EOIA 3T1RA 5FDHA 1NWZA 2M7VA 3WS5A 2WAFA 4B9OA 2G7UA 4DKIA 2V20A 2VLGA 3UPPA 4GLQA 4E6WA 2A49A 3IBRA 1UGUA 4PM8A 4D2OA 5AVEA 5FSRA 2Y55A 5EV0A 3P7NA 4X25A 4BBVA 3UO9A 3OZHA 1NLYA 3HUOA 2G2WA 4ZJ1A 1MXOA 3GTCA 1K54A 4MMNA 3Q7VA 3Q7VB 5EVIA 1KGEA 1U60A 4OLDA 2IA2A 4I3IA 5EVIB 3ZHHA 3S22A 1X0OA 2ZQ7A 2OWHA 3MZEA 1NYMA 2AVXA 3IHBA 3MZFA 4DF6A 5FQQA 2EXBA 1BLPA 4QJGA 4FOFA 3HLCA 5E2EA 1XGIA 1MWUA 4CLCE 4DXBA 1DJBA 3F1PA 1XA1A 3VE4A 3F1PB 1S4RA 5M18A 1Q2QA 1LLBA 5MC7A 3L9KA 3ZG7B 2EX9A 3W2ZA 1IELA 2Y2IA 3A0RA 4KZ7A 3IWOA 2O0YA 3LFVA 1RCJA 4UQIS 1PI5A 1XXMA 5C5KA 4Z1WA 4OQIA 5FQIA 1E4DA 1LHYA 4WYYA 2EFUA 3DTKA 3HLGA 2HDUA 1XJ3A 5KZHA 3BQ8A 3C5AA 3LICA 3UDIA 5KSHA 5GLDA 3HVFA 3IHAA 4FSFA 2HGVA 2YKFA 4JF5A 3ZG5A 3WRTA 2V0WA 4OKPA 1F5MA 3QNCA 1H5XA 4BBUA 2HP6A 2JBFA 3MXSA 1YSQA 4XUZA 2OOLA 2ZQCA 4EEUA 3TG9A 1MWTA 2ZQ8A 5FA7A 3SH8A 4KQQA 3ZNTA 5IU1A 3C7VA 4ESPA 5DTSA 1OTIA 2XSSA 3E2LA 1T19A 4R6LA 2Q9MA 3LIFA 1KDSA 3E4QA 2L4RA 2ZMFA 1JNUA 1K57A 5DKKA 3P09A 4M3KA 1O7EA 1E25A 2HPBA 3TSGA 3CAXA 2J9PA 3GSGA 3W4OA 4BLMA 3O87A 3HLEA 4WLAA 3ITBA 5TFQA 3HL9A 3D3OA 2V8FA 2W3GA 2PU4A 1SDNA 1VQQA 2ZQDA 2E8JA 4HJ3A 3T4LA 2WKEA 4E3MA 4MBHA 4FH2A 1IKGA 4O0PA 1L0GA 3ZDJA 1T1BA 3EWKA 3NIAA 1KE4A 3B33A 5FATA 5FAPA 2MJ6A 1XGJA 4GHIA 2K31A 4B88A 1YAXA 4PKYG 4GHIB 3BY9A 5HL6A 4E3OA 3IF6C 1K4FA 1XFNA 4Q0IA 3F1OA 2Y8HA 4WZ5A 3DWKA 2Q9NA 3F1OB 1CI8A 1P97A 1G68A 3C30A 2WADA 4OLGA 1N4OA 3VSLA 1D1JA 3G35A 5DTTA 3HJIA 1ES5A 4GDBA 1YMXA 1LSVA 5CTNA 2ZMAA 3D72A 4EUZA 4MLLA 3IX4A 4LV2A 4GOGA 5GLBA 3R4KA 4IVKA 4BBTA 3BLMA 5EVLA 5EVIC 2XDMA 4P6BA 3BYDA 1VEUA 4S2LA 4YOFA 2H0TA 1VEUB 4OOMA 3LO7A 3NI9A 4GS9A 1OTEA 4GS9B 2WGIA 3NCKA 2Y2HA 5E2HA 2J3TD 1K6RA 4FTXA 2JCHA 4B4XA 1W63M 5DF8A 3OCLA 2WGWA 2WGWB 2ZC7A 2QKPA 3D9YA 1FOFA 2A3UA 2OLVA 5TBMA 4ZTKA 5GL9A 5TBMB 3N8RA 3PBTA 3U4LP 3KX0X 4K91A 3PHYA 4X56A 5A92A 4G3WA 5EFWA 4Y2FA 2C5WB 2VGKA 1YMSA 3PBNA 3WRZA 3VFHA 1N9LA 3IXGA 2V8CA 4P0MA 1LL8A 3AGFA 1K25A 3B3XA 4DJ3A 4BD0A 3EGDC 3HLBA 3B47A 1DY6A 4R3JA 1UWPX 4QWOA 5TGFA 2XQZA 4ZJ3A 3AGEA 3G2YA 2PR6A 2VGJA 2PRFA 2YKHA 3MJQA 1SHVA 4MN5A 4I5SA 4LRZE 4EU0A 1IEMA 4NXEA 3FG8A 4KG5A 3MFXA 3LIEA 3UE6A 3BJNA 1K4EA 2JKTM 2P04A 3MKEA 2ZM8A 1YM1A 4EQ1A 3SH9A 3EQUA 1K57C 3VMAA 5A90A 2W3FA 4JXWA 4KUOA 4BD1A 2LB9A 3FZCA 1KGGA 3PTEA 5EOOA 2JC7A 2NUPC 1OTAA 4KZ5A 2P08A 1I2WA 3IWQA 3ZNYA 4ZJ2A 2JKRM 5EE8A 1GA9A 1GCEA 3OBFA 3W8KA 1LI9A 2CC1A 1CF0A 5FDSA 5L10A 4XXRA 5CTMA 1XA7A 4N92A 4HNBA 1W63Q 3IH9A 3OC2A 3P01A 2OAP1 1SZVA 4CPKA 2V1ZA 3UB8A 3VOLA 5D3OA 3RJUA 3V3RA 4WZ5C 3LR0A 4KUKA 1FCNA 4LCMA 5FQJA 3HJKA 2WAEA 2VV7A 2HJ9C 3CLOA 1XX2A 4MCWA 1AXBA 4OP5A 4N9LA 4YNRA 1ALQA 1CEGA 4HESA 4KQRA 1ESIA 3Q82A 4GD6A 5HPIA 2Z6CA 4WL9A 1GHPA 3HLFA 4HH2A 1W8QA 4PM5A 5AQ7A 4EERA 5LBRA 3O88A 3DAVA 1JTDA 2HZ5A 4JKTA 3KYQA 1M40A 3G34A 1CQAA 2Z2MB 1VETA 1RP5A 1TS6A 1VETB 2VV8A 3N8LA 4OOYA 4EV4A 3UB6A 1PI4A 5J4EA 1K56A 3DTEA 2XFSA 3NDGA 2Y79A 2K7SA 1K55C 2P9VA 5AQ9A 1BZAA 2XD5A 1NY0A 2P9VB 2ZBBA 4DXCA 3PAGA 1E3UD 2ZLYA 1PIOA 3K3CA 3RFBA 1T1AA 3OPPA 4L9GA 1LL9A 1JWPA 2JN7A 2EFXA 4QB8A 3BY8A 4IBRA 2V1AA 2VZWA 4KZ4A 5M19A 2QYBA 1FR1A 4L9FA 4EBNA 3WS4A 2XK1A 4L0LA 5HFOA 1MWRA 1I5QA 3VP2A 4HBUA 3QNBA 1S0WA 3LY4A 5GHYA 1XJ4A 1MY8A 3DWZA 3B42A 4E6XA 4CLCA 5JYOA 2EWWA 2QHKA 4CLCB 5DKLA 4E3KA 3FKWA 2WGVA 4O01A 4YINA 4OONA 5G4ZA 3MMHA 3Q7ZA 4ZDXA 2ZM2A 2FFFB 4ETXA 3PXPA 3TW8A 4BJPA 5AVFA 5HAPA 1Q2PA 2VK3A 3N7WA 3A3FA 1CJFA 4QHCA 1VHMA 3BLSA 4HJ4A 2E8IA 4IJGA 2DCFA 1ES3A 3MF0A 3G2ZA 3JVUA 3ICYA 5HDDA 4E3JA 2WUQA 3IT9A 2B95A 3IWIA 3M2JA 5HAQA 3T4QA 5CGXA 3AGDA 4FD8A 3NULA 1F98A 4E3LA 5HWTA 3SW1A 3MKFA 3UB7A 4RA7A 4KQDA 3NC8A 2Y2KA 3UMEA 4N9KA 1YT4A 3JPUA 3SS4A 4OPRA 1Y54A 3GRJA 3LGOA 4DE0A 4G3KA 3O3VA 4ZAMA 2IWDA 4LCLA 3UE3A 5KIZA 3NECA 4R38A 4GKUA 3VV4A 3T4KA 3IX3A 1JVJA 3IF5A 4B93A 4UA9A 4WMCD 1WYBA 1F9IA 3CUEC 3OCNA 1YLPA 4BL3A 2ZC3B 2BTFP 2GX5A 4F3LA 3T1SA 4X53A 1TEMA 3OPHA 3ZG9B 4JF6A 4F3LB 4K0XA 2WKRA 3G6OA 3OLOA 3IS2A 3RXXA 3CMZA 3BFFA 4OQHA 5DTKA 1FSWA 3PBSA 3IS2B 3PBOA 5A91A 4P6ZM 5FAOA 3HREA 4WBGA 3UN7A 1PWDA 2KX6A 4DDYA 1CK3A 2W3DA 1D06A 3WS2A 4WM9A 3VSKA 2ZQAA 3W4QA 1NLZA 2QJ5A 1NRFA 2UWXA 4DJ2A 1SKOA 1HTZA 3BQAA 1SKOB 3HUNA 2WKHA 1EI5A 2IWCA 1HD8A 3HBRA 1HLUP 5M1AA 1LL5A 4HI4A 3NJAA 1XPBA 4R3AA 3DTMA 5HDSA 3S1YA 3QHYA 4LV0A 1N9OA 3LEQA 3QP5A 3A0SA 3KSHA 1KE0A 4EXOA 3ZVTA 3NHQA 4LPZA 2Z6DA 3BEBA 2PBDP 3G31A 1JTGA 4UA6A 4EUVA 1BLHA 3LR5A 4PM6A 3GV9A 5CEDA 3C38A 3UE1A 1J3WA 2XRNA 2Y4AA 4GN2A 4RVAA 2HJEA 1L2SA 5EVEA 5HZHA 2WKPA 2B02A 1TF1A 2OAQ1 4NEED 4JLFA 1TVFA 3BW6A 4LGWA 2ZM0A 3BM6A 4PKYA 4HIAA 3C4PA 3H9WA 1H8YA 3I7JA 3IBJA 2Y2PA 1LT0A 4OP8A 3G4PA 4CLCC 5F69A 4C6YA 1CI9A 2UV0E 3DBAA 3SZTA 1K54C 1YLTA 4LFUA 4S2OA 4O8GA 3C2WA 2KOIA 1MZUA 3HCYA 2H28A 4JGOA 4L9EA 4NXFA 5F68A 2FH5A 4JF4A 3VFFA 5EUAA 4X6TA 5HWVA 2XH9A 2A2LA 3M6HA 1NYYA 4LRXC 3TOIA 3VP3A 5EOEA 2GJ3A 4NG2A 3V67A 1VM1A 2OV5A 1IYOA 1MBLA 2XR0A 4IEDA 3E4OA 3LIBA 4NXGA 3K2NA 4DE3A 4R3BA 5FI6A 3MXRA 4B4ZA 1KE3A 3CJMA 5HD5A 1ZC2A 1S67L 5A93A 1T1CA 4JBFA 4HY8A 5BOHA 5CEBA 5I94A 1HZOA 1ZKJA 2R78A 2ZMVA 4R70A 3V50A 2EA9A 2QMIA 4EEPA 3T4TA 1FILA 2ZJ9A 1PNEA 2P74A 1BSGA 2XFTA 2ZOIA 2WKQA 3ZCZA 3LR3A 4BMWA 4E3IA 3GMWA 4S2MA 4HBTA 1NZUA 3FC7A 1LI0A 4N1HA 4CQHA 3FYZA 2K2NA 3PYPA 5DFXA 5FEFA 2VEAA 5L09A 4GDNA 2XF3A 5AQAA 2PD8A 4S2JA 3MS6A 1LSWA 3A3EA 4K0WA 1ACFA 4JGPA 1TS0A 1S1YA 4KG2A 1PYYA 3IH8A 2HDRA 2J9OA 1OJGA 1Z09A 5EVID 4WEJA 2VKSA 2XGNA 2VGLM 5F1GA 3K3DA 3RTYA 2G2UA 5IHVA 1OTDA 4K08A 2GNXA 3MSHA 3PAEA 3ISGA 2Y91A 3S4XA 4R4SA
chains in the Genus database with same CATH topology
4HJ6A 4FSFA 2HGVA 2EWVA 2YKFA 5HPFA 3K3CA 1NRJA 3RFBA 1T1AA 4L9GA 5K5BA 2XROA 2V0WA 1ODVA 3A0VA 1F5MA 2JN7A 2KLIA 3BY8A 4BBUA 1P9WA 2V1AA 1YSQA 2VZWA 2QYBA 1V9ZA 3S7QA 1YSPA 2OOLA 4L9FA 4WF0A 4EEUA 2PR5A 3E4PA 4GW9A 3GDIA 2QJ7A 4P6ZS 5IU1A 4L0LA 3ZQ5A 1DP8A 2I9VA 2O9BA 5CX7A 2XA7M 3KSFA 5DJUA 1OTIA 4IHQA 2XSSA 4MN7A 1T19A 4R6LA 5G4YA 3LUQA 1OTBA 3LIFA 1OJ5A 1XJ4A 1H8MA 2W27A 3E4QA 2L4RA 2ZMFA 4NKPA 4HOIA 3B42A 4CLCA 1JNUA 2EWWA 3LIAA 5DKKA 2W0NA 4IUHA 3F1NA 4HH3A 2QHKA 4CLCB 3F1NB 5DKLA 2VV6A 3CAXA 4O01A 5G4ZA 4RQ9A 4WLAA 3LR4A 3MMHA 4HQAA 5HSQA 3D3OA 2JKTI 2M1CA 2W3GA 4ETXA 3PXPA 3TW8A 4BJPA 5I5LA 5AVFA 2PT7A 4HJ3A 3T4LA 1ZTUA 3MQ0A 4GCZA 1VHMA 4WUJA 2O9CA 2FZ0A 4HJ4A 4O0PA 1T1BA 4IJGA 1XFQA 1OT9A 5IT5A 2D01A 3ZYTA 1YKDA 1VB6A 1WA9A 3EWKA 4GJ4A 3MF0A 4JGRA 2VA0A 3JVUA 3LIDA 3ICYA 5HDDA 3B33A 4I39A 2MJ6A 1UWNX 4CLCD 2JKRI 3GECA 5F5YA 4GHIA 2K31A 3T4QA 2P7JA 1YAXA 4LLOB 4PKYG 3TRCA 4GHIB 3BY9A 5HL6A 2ZOHA 3TE8A 1XFNA 1F98A 4Q0IA 3T50A 3NOPC 3F1OA 2L1MA 5HWTA 4H6JA 2Y8HA 3SW1A 4WN5A 3UB7A 4KQDA 4I3AA 3UMEA 3F1OB 2PYPA 5DF9A 4H6JB 2M7UA 1GSXA 1P97A 4UQIM 1P0ZA 2HV1A 3C30A 5IS1A 4G3KA 1DRMA 2A24A 4IUKA 3HJIA 1G6OA 2A24B 3LI9A 1TS8A 1V9YA 3NOTC 3UE3A 1LSVA 5KIZA 4R38A 4JGQA 5L8MA 3VV4A 3FPVA 4LRYC 3T4KA 3PBQA 3D72A 5AJGA 4PAUA 4II7A 3U2AA 4B93A 2GZAA 3R4KA 1F9IA 3CUEC 4ZRRA 4BBTA 3OCNA 4MN6A 5HD3A 3CI6A 1TD5A 2GX5A 3E0YA 4YOFA 4F3LA 2HF6A 4MDZA 2LB5A 4OOMA 5F6AA 3UB9A 1OT6A 5J3WA 4F3LB 4GS9A 2WKRA 2W1RA 4WELA 2BASA 3G6OA 3OLOA 1OTEA 3IS2A 3MQOA 4GS9B 5HDCA 3PBSA 3IS2B 3PBOA 4P6ZM 2O9AA 2V9AA 2J3TD 3KO6A 2KX6A 3T4OA 3EEHA 2W3DA 2KDKA 4ARZA 2V1BA 1W63M 5A8BA 1D06A 3H7WA 2INWA 1ZHHB 3OCLA 1XJ2A 2J80A 4ARZB 3H7WB 4OOLA 1NLZA 2QJ5A 2QKPA 4WEKA 4DJ2A 2QWSA 3BQAA 5TBMA 3OOVA 3CWFA 4G3VA 1KOUA 5TBMB 4NXBA 3PBTA 1XJ6A 4HI4A 3KX0X 3NJAA 2B18A 4R3AA 5HDSA 3PHYA 3CUEA 4EETB 3RH8B 4XT2A 1N9OA 4G3WA 5EFWA 4Y2FA 1OPXA 3A0SA 3PBNA 3KSHA 4HP9A 3S7OA 1N9LA 3H82A 4XT2B 3MXQA 4EXOA 4Y3IA 4PHTA 3H82B 1LL8A 3NHQA 4LPZA 4DJ3A 3EGDC 3JVVA 2Z6DA 1TS7A 3PR6A 3B47A 5TJJA 2W3EA 1UWPX 2D02A 3EEAA 2NUTC 3T4SA 4EUVA 1GSVA 2PR6A 1DP9A 3LR5A 1IFQA 1T18A 2YKHA 3MJQA 1G28A 2W1TA 4I38A 3C38A 1MKMA 4MN5A 2XRNA 4I5SA 2HJEA 2VGLS 4LRZE 2W1TB 4EU0A 3TJZC 5HZHA 2WKPA 4NXEA 2B02A 1TF1A 3FG8A 3MFXA 2OAQ1 4NEED 1S4SA 3LIEA 3UE6A 4EW7A 3BJNA 3BW6A 3UMDA 1EW0A 2VX8A 2JKTM 2P04A 4PKYA 4HIAA 3H9WA 4EESA 4EQ1A 3IBJA 1LT0A 3EQUA 3LI8A 1DP6A 4CLCC 4ME4A 5F69A 3DBAA 2VJWA 1D7EA 2W3FA 4KUOA 2LB9A 3KYZA 4Y5FA 1STZA 3LYXA 1BYWA 2NUPC 1OTAA 4O8GA 3C2WA 2KOIA 1MZUA 3HCYA 3S7PA 2H28A 3ULFA 4DMZA 3FPWA 2V0UA 2P08A 2O99A 4JGOA 4L9EA 4NXFA 4I3JA 1S66L 1Y28A 5F68A 3R7WA 2FH5A 2PYRA 2JKRM 2CMNA 3OBFA 5HWVA 3EGXC 3R7WB 2JHEA 1GSWA 4YWZA 2A2LA 2J3WA 5DJTA 2XA7S 3CITA 3EOIA 4LRXC 4Q0JA 1NWZA 2M7VA 4B9OA 2G7UA 2GJ3A 2VLGA 3V67A 4GLQA 4HNBA 3IBRA 3KSIA 1UGUA 1W63Q 5AVEA 3E4OA 3LIBA 4NXGA 3K2NA 3OC2A 3P01A 2OAP1 3P7NA 4BBVA 5HD5A 3UB8A 1S67L 1T1CA 3VOLA 4HY8A 4BWIA 1NLYA 4Q0HA 1N9NA 2R78A 4QPRA 4MMNA 2ZMVA 4R70A 5DFYA 4E04A 3C8CA 2EA9A 4HHDA 3LR0A 4KUKA 4EEPA 3T4TA 2IA2A 2ZOIA 4I3IA 2WKQA 3HJKA 3KSGA 4HP4A 2DMWA 3LR3A 1X0OA 4BMWA 2L0WA 2HJ9C 2OWHA 2VV7A 3CLOA 4MCWA 2J3TC 4YNRA 1H3QA 2PD7A 3FC7A 4AFIA 4CQHA 4FOFA 2K2NA 1S1ZA 3MQQA 3PYPA 4KQOA 3T4JA 1MC0A 5DFXA 4CLCE 1LSXA 3S7NA 2VEAA 1P9RA 4M4XA 3F1PA 2PD8A 4ETZA 5HPIA 2OWJA 2Z6CA 4WL9A 3VE4A 4DN0A 4HH2A 3F1PB 1LSWA 1S4RA 3EQVA 5MC7A 4EERA 3W2ZA 5LBRA 4JGPA 1TS0A 1S1YA 5FL3A 3A0RA 3O5YA 3KYQA 1OJGA 2O0YA 3LFVA 4UQIS 3E98A 2PDRA 5C5KA 3BWLA 4WEJA 2VKSA 1TS6A 4Z1WA 2VGLM 2VV8A 5J7EA 3K3DA 3RTYA 2W3HA 3UB6A 4UEYA 1OTDA 5J4EA 3MR0A 4K08A 2GNXA 1IOUA 3NOUC 2Y79A 2K7SA 1XJ3A 2PHYA 3BQ8A 3LICA 5KSHA 3VE3A 5HWWA 3PBRA 2ZBBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HJ6 A;  2YKF A;  3K3C A;  1T1A A;  4L9G A;  2V0W A;  1ODV A;  3A0V A;  2JN7 A;  3BY8 A;  4BBU A;  2V1A A;  1V9Z A;  2OOL A;  4L9F A;  4WF0 A;  4EEU A;  2PR5 A;  3E4P A;  4GW9 A;  3GDI A;  2QJ7 A;  5IU1 A;  3ZQ5 A;  1DP8 A;  2I9V A;  5DJU A;  1OTI A;  1T19 A;  4R6L A;  5G4Y A;  3LUQ A;  1OTB A;  3LIF A;  1OJ5 A;  1XJ4 A;  2W27 A;  3E4Q A;  2L4R A;  4HOI A;  1JNU A;  3LIA A;  5DKK A;  2W0N A;  3F1N A;  4HH3 A;  2QHK A;  3F1N B;  5DKL A;  2VV6 A;  3CAX A;  5G4Z A;  4RQ9 A;  4WLA A;  4HQA A;  5HSQ A;  2M1C A;  5I5L A;  5AVF A;  4HJ3 A;  4GCZ A;  4WUJ A;  4HJ4 A;  1T1B A;  1XFQ A;  1OT9 A;  2D01 A;  1VB6 A;  1WA9 A;  3EWK A;  4JGR A;  3LID A;  3ICY A;  5HDD A;  3B33 A;  4I39 A;  1UWN X;  3GEC A;  5F5Y A;  4GHI A;  2P7J A;  4PKY G;  4LLO B;  4GHI B;  3BY9 A;  2ZOH A;  1XFN A;  1F98 A;  3T50 A;  3NOP C;  3F1O A;  2L1M A;  5HWT A;  4H6J A;  3SW1 A;  4WN5 A;  3UB7 A;  4KQD A;  4I3A A;  3UME A;  3F1O B;  2PYP A;  4H6J B;  1GSX A;  1P97 A;  1P0Z A;  2HV1 A;  5IS1 A;  1DRM A;  2A24 A;  3HJI A;  2A24 B;  3LI9 A;  1TS8 A;  1V9Y A;  3NOT C;  1LSV A;  5KIZ A;  4R38 A;  4JGQ A;  4LRY C;  3D72 A;  1F9I A;  4BBT A;  4MN6 A;  5HD3 A;  4F3L A;  5F6A A;  3UB9 A;  1OT6 A;  5J3W A;  4F3L B;  4GS9 A;  2WKR A;  2BAS A;  3G6O A;  3OLO A;  1OTE A;  3IS2 A;  3MQO A;  4GS9 B;  5HDC A;  3IS2 B;  2V9A A;  2KX6 A;  3EEH A;  2KDK A;  2V1B A;  5A8B A;  1D06 A;  3H7W A;  2INW A;  1XJ2 A;  2J80 A;  3H7W B;  2QJ5 A;  2QKP A;  4DJ2 A;  2QWS A;  5TBM A;  3CWF A;  1KOU A;  5TBM B;  4NXB A;  1XJ6 A;  4HI4 A;  3KX0 X;  3NJA A;  4R3A A;  5HDS A;  3PHY A;  4EET B;  3RH8 B;  4XT2 A;  1N9O A;  5EFW A;  3A0S A;  4HP9 A;  1N9L A;  3H82 A;  4XT2 B;  3MXQ A;  4EXO A;  3H82 B;  1LL8 A;  3NHQ A;  4LPZ A;  4DJ3 A;  2Z6D A;  1TS7 A;  1UWP X;  2D02 A;  1GSV A;  2PR6 A;  1DP9 A;  1T18 A;  2YKH A;  3MJQ A;  1G28 A;  4I38 A;  4MN5 A;  4I5S A;  4LRZ E;  5HZH A;  2WKP A;  4NXE A;  2B02 A;  3FG8 A;  3MFX A;  4EW7 A;  1S4S A;  3LIE A;  3UE6 A;  3UMD A;  1EW0 A;  4PKY A;  4HIA A;  3H9W A;  4EES A;  4EQ1 A;  1LT0 A;  3LI8 A;  1DP6 A;  5F69 A;  1D7E A;  4KUO A;  3LYX A;  1BYW A;  1OTA A;  3C2W A;  3ULF A;  1MZU A;  2H28 A;  2V0U A;  4JGO A;  4L9E A;  4NXF A;  4I3J A;  1S66 L;  1Y28 A;  5F68 A;  2PYR A;  2CMN A;  5HWV A;  2JHE A;  1GSW A;  4YWZ A;  5DJT A;  4LRX C;  1NWZ A;  4B9O A;  2GJ3 A;  2VLG A;  4HNB A;  3IBR A;  1UGU A;  5AVE A;  3E4O A;  3LIB A;  4NXG A;  3P7N A;  4BBV A;  5HD5 A;  3UB8 A;  1S67 L;  1T1C A;  3VOL A;  4HY8 A;  1N9N A;  2R78 A;  4R70 A;  4E04 A;  3C8C A;  2EA9 A;  4HHD A;  4KUK A;  4EEP A;  2ZOI A;  4I3I A;  2WKQ A;  3HJK A;  4HP4 A;  1X0O A;  2L0W A;  2VV7 A;  2OWH A;  3CLO A;  2PD7 A;  3FC7 A;  1S1Z A;  3MQQ A;  3PYP A;  1LSX A;  2VEA A;  4M4X A;  3F1P A;  2PD8 A;  2OWJ A;  2Z6C A;  4WL9 A;  3VE4 A;  4HH2 A;  3F1P B;  1LSW A;  1S4R A;  4EER A;  4JGP A;  1TS0 A;  1S1Y A;  3A0R A;  1OJG A;  2PDR A;  3BWL A;  1TS6 A;  2VV8 A;  5J7E A;  3K3D A;  3RTY A;  3UB6 A;  1OTD A;  5J4E A;  3MR0 A;  4K08 A;  3NOU C;  2K7S A;  1XJ3 A;  2PHY A;  3LIC A;  3VE3 A;  5HWW A;  2ZBB A; 
#chains in the Genus database with same CATH topology
 4O7D A;  4HJ6 A;  5E2F A;  3A3D A;  1SDE A;  2Y2N A;  1DJA A;  3ZG0 A;  3G32 A;  2EWV A;  5HPF A;  4BEN A;  4E3N A;  5K5B A;  3A0V A;  1YLJ A;  1V9Z A;  3QP8 A;  4BL2 A;  3S7Q A;  4WF0 A;  2PR5 A;  3C7U A;  2Y2M A;  3MFD A;  5JYP A;  3GDI A;  3BFD A;  2QJ7 A;  4P6Z S;  3ZQ5 A;  2I9V A;  1RGY A;  2XA7 M;  3KSF A;  5DJU A;  3T1X A;  4IHQ A;  3LUQ A;  3CZD A;  4NKP A;  1HVB A;  4HOI A;  4X69 A;  4PM7 A;  1L0D A;  4IUH A;  4HH3 A;  4DRT A;  2Z2L B;  1BUE A;  2R9W A;  2VV6 A;  3P98 A;  3LR4 A;  4PM9 A;  1PWG A;  4HQA A;  2OSU A;  2M1C A;  4QD4 A;  4JXS A;  5I5L A;  3MBZ A;  3T1Q B;  4UHU A;  4MNR A;  4GCZ A;  4R4R A;  2O9C A;  4WUJ A;  4OPQ A;  2X71 A;  1YKD A;  4GJ4 A;  4KZB A;  1BUL A;  4GNU A;  1KVM A;  4I39 A;  1UWN X;  2PU2 A;  2FFY A;  3GEC A;  5F5Y A;  3SS3 A;  3KYE A;  3BFG A;  1BLS A;  3QP2 A;  2H10 A;  2DNS A;  2C6W B;  1H0M A;  3NOP C;  4WN5 A;  2Y2J A;  5HL1 A;  4C75 A;  5FAQ A;  3UE0 A;  2PYP A;  2QPN A;  1GSX A;  1A0K A;  4LV1 A;  1P0Z A;  5FI2 A;  4UAA A;  1DRM A;  4IUK A;  3N8S A;  5AQB A;  2WKI A;  3ZFZ A;  1G6O A;  1TS8 A;  1V9Y A;  1W8Y A;  3GR2 A;  3NOT C;  4RX3 A;  4P87 A;  3HUM A;  2ZC4 B;  5E43 A;  3IXB A;  3PBQ A;  5G18 A;  5AJG A;  4PAU A;  3T12 B;  1RGZ A;  3UPN A;  4II7 A;  1ERM A;  4R0Q A;  3GVB A;  3UNW A;  1TD5 A;  3E0Y A;  4FUW A;  2B5R A;  5F6A A;  1OT6 A;  4EWF A;  2W1R A;  1Y4O A;  3IF6 A;  4WEL A;  1NJ4 A;  1GA0 A;  4WZ4 A;  3NBL A;  1PRQ A;  3IF6 B;  5EPH A;  5CGW A;  2O9A A;  2V9A A;  3KO6 A;  4P85 A;  1ZG6 A;  1DJC A;  2QZ6 A;  4ARZ A;  2V1B A;  3H7W A;  1ZHH B;  3NDE A;  2J7V A;  4ARZ B;  4DE1 A;  3H7W B;  4OOL A;  4WEK A;  2QWS A;  3C4O A;  1WYC A;  4G3V A;  3M6B A;  1J9M A;  3IQA A;  3FKV A;  1O07 A;  2B18 A;  2HDQ A;  1Z6F A;  1ZG4 A;  4CJN A;  3RH8 B;  4EET B;  4S2K A;  3VOZ A;  1OPX A;  4Y0O A;  4HP9 A;  3S7O A;  4D60 A;  3IXD A;  3HLD A;  4MEZ A;  1ONH A;  3WS0 A;  1IYS A;  5KMW A;  4R23 A;  4A5R A;  1PWC A;  5F1F A;  4MBK A;  1TDG A;  3JVV A;  3PR6 A;  2W3E A;  2D02 A;  3EEA A;  3T4S A;  1DP9 A;  1YLZ A;  1IFQ A;  1T18 A;  2RL3 A;  1G28 A;  4XUX A;  3BEC A;  2PBY A;  4Y13 A;  2VGL S;  4LV3 A;  2ZD8 A;  3UDF A;  1L0E A;  1S4S A;  3VOY A;  4KZ6 A;  4GZB A;  1FCM A;  2VX8 A;  1YQS A;  1L0F A;  1MKI A;  4U0X A;  4KZ3 A;  2JKF A;  3D4F A;  2ZQ9 A;  3LI8 A;  1DP6 A;  4ME4 A;  2H5S A;  1N9B A;  3IX8 A;  3DW0 A;  4Y5F A;  1STZ A;  4GB7 A;  1PFL A;  3S7P A;  4ID4 A;  3FPW A;  2V0U A;  3OPL A;  1G5U A;  1Y28 A;  2PYR A;  2I72 A;  3LCE A;  2EX6 A;  3LY3 A;  2CMN A;  2XEP A;  4UA7 A;  4DE2 A;  4YWZ A;  1IYP A;  4FH4 A;  2J3W A;  2XA7 S;  4KG6 A;  2WZZ A;  4Q0J A;  5FQK A;  2XLN A;  3ZG8 B;  4EBL A;  3KSI A;  3UB5 P;  5GHX A;  4N1X A;  4OPY A;  2DRW A;  1G6A A;  2Y2Q A;  4BWI A;  4X55 A;  1W7F A;  4Q0H A;  1N9N A;  1OME A;  4QPR A;  5DFY A;  4E04 A;  4EBP A;  2IWB A;  4F94 A;  3C8C A;  3V5M A;  4HHD A;  1SKF A;  2Y59 A;  3LEZ A;  3G30 A;  4HP4 A;  3KSG A;  3WS1 A;  2DMW A;  3IXH A;  2ZL1 A;  2L0W A;  2XD1 A;  3QP6 A;  5E2G A;  2J3T C;  4H8R A;  1BT5 A;  4Y7P A;  2ZL1 B;  1H3Q A;  2PD7 A;  5CER A;  4PMA A;  4AFI A;  2EX2 A;  3ZVW A;  1PZP A;  3WWX A;  1FCO A;  1NXY A;  4OQ0 A;  1KVL A;  1S1Z A;  3MQQ A;  4KQO A;  3QP1 A;  3T4J A;  5FAS A;  1MC0 A;  5EEC A;  4RYE A;  1LSX A;  3S7N A;  1P9R A;  4M4X A;  4ETZ A;  1E3U A;  2OWJ A;  5CRF A;  4DN0 A;  4KZ8 A;  3EQV A;  3VP4 A;  3NY4 A;  1FR6 A;  5FL3 A;  3O5Y A;  1XP4 A;  3E98 A;  1I2S A;  2PDR A;  3BWL A;  3FWL A;  1TDL A;  5TR7 A;  5J7E A;  2W3H A;  5EM0 A;  4UEY A;  4Q8I A;  4S2I A;  3MR0 A;  4S2N A;  5F82 A;  1IOU A;  3UY6 A;  3NOU C;  2PHY A;  3CG5 A;  3VE3 A;  4EQI A;  5HWW A;  3PBR A;  1ERQ A;  2J8Y A;  3DTI A;  1W5D A;  1WE4 A;  1NRJ A;  2XRO A;  5GHZ A;  1ESU A;  1ODV A;  5GLA A;  1S6R A;  5FI7 A;  2KLI A;  4BQM A;  1KDW A;  4R1G A;  1P9W A;  5CHM A;  3RXW A;  1MPL A;  3BFE A;  1YSP A;  3E4P A;  4Y15 A;  4GW9 A;  4LEN A;  1DP8 A;  5HX9 A;  5CX7 A;  2O9B A;  1GHM A;  1K56 D;  4MN7 A;  4IVI A;  1PW1 A;  5G4Y A;  3V39 A;  1OTB A;  1OJ5 A;  4IBX A;  1H8M A;  3FV7 A;  2W27 A;  3O86 A;  3LIA A;  5HAI A;  2W0N A;  1M6K A;  3F1N A;  1K55 A;  3CHW P;  4JXV A;  3F1N B;  3V3S A;  4RQ9 A;  2WYX A;  4GD8 A;  2GDN A;  5U47 A;  1ERO A;  5HSQ A;  2JKT I;  5DVA A;  4KZA A;  3Q07 A;  5HAR A;  1F2K A;  2PT7 A;  5CXW A;  3JYI A;  1ES4 A;  4HEF A;  1PZO A;  1L3L A;  1ZTU A;  3MQ0 A;  2FZ0 A;  1H8Z A;  1W79 A;  2RCX A;  1XFQ A;  1OT9 A;  5IT5 A;  2D01 A;  3UDX A;  3ZYT A;  1VB6 A;  3GQZ A;  4JXG A;  1WA9 A;  4JGR A;  2VA0 A;  3LID A;  2WZX A;  2Y2O A;  3BFC A;  4OH0 A;  4QU3 A;  4CLC D;  1NZO A;  2JKR I;  4WMC A;  2P7J A;  1QMF A;  4MBF A;  4LLO B;  2EXA A;  3TRC A;  2ZOH A;  1K38 A;  5FQM A;  5CHJ A;  3TE8 A;  3CPT A;  3T50 A;  2L1M A;  1C3B A;  4H6J A;  2ACG A;  1ES2 A;  3CPT B;  1JWZ A;  4I3A A;  5DF9 A;  4H6J B;  2M7U A;  1K6S A;  1KGF A;  4UQI M;  2HV1 A;  4Z9Q A;  1EWZ A;  5IS1 A;  2A24 A;  2HP9 A;  2A24 B;  3LI9 A;  3MZD A;  2Q0O A;  2PAV P;  3SOI A;  4JGQ A;  5L8M A;  1K0K A;  3FPV A;  3SH7 A;  4LRY C;  3N6I A;  4Y0U A;  2X01 A;  2H0Y A;  4OPZ A;  1SCW A;  4S2P A;  3U2A A;  2GZA A;  4ZRR A;  3A3I A;  4MN6 A;  3QP4 A;  5HD3 A;  4X1M A;  5FEG A;  3CI6 A;  2HF6 A;  4MDZ A;  5GLC A;  2LB5 A;  2OLU A;  4RX2 A;  3UB9 A;  1FSY A;  5J3W A;  3UPO A;  1FQG A;  4JPM A;  4NET A;  2BAS A;  3MQO A;  4U3T A;  5HDC A;  4FCF A;  3Q1F A;  3T4O A;  3A3J A;  3EEH A;  2KDK A;  5A8B A;  2INW A;  1IKI A;  1XJ2 A;  2J80 A;  1FIK A;  5J8X A;  5FQ9 A;  4DDS A;  5DF7 A;  3E2K A;  5CHU A;  3OOV A;  3CWF A;  1AWI A;  1PW8 A;  1QME A;  3HLW A;  1KOU A;  4NXB A;  1XJ6 A;  3W4P A;  3CUE A;  4S2N C;  1BLC A;  3VP1 A;  4XT2 A;  4ZBE A;  4OQG A;  3H82 A;  4XT2 B;  5HW3 A;  3MXQ A;  4QY5 A;  4Y3I A;  1YLW A;  3H82 B;  4PHT A;  3M2K A;  5CEC A;  1IYQ A;  2BG1 A;  5L2F A;  3N4I A;  2WK0 A;  1TS7 A;  5TJJ A;  1ONG A;  2NUT C;  4C3Q A;  1XKZ A;  3OPR A;  1GSV A;  5F83 A;  1CEF A;  2W1T A;  4I38 A;  1JWV A;  1MKM A;  4YFM A;  4Y17 A;  2W1T B;  2EX8 A;  3L7H A;  3TJZ C;  2JE5 A;  2HP5 A;  5KSC A;  2R9X A;  4EW7 A;  4PPR A;  4QY6 A;  2ZC6 B;  3UMD A;  5CGS A;  1EW0 A;  1GHI A;  4KZ9 A;  3SS5 A;  4KEN B;  2V2F F;  2X02 A;  5L07 A;  4EES A;  2HDS A;  1YPR A;  2JKG A;  3ZGA B;  2VJW A;  1D7E A;  1MWS A;  3KYZ A;  4NK3 A;  5EM1 A;  3LYX A;  4U0T A;  1BYW A;  1BTL A;  3ULF A;  4X1L A;  4DMZ A;  2BLS A;  2O99 A;  3ITA A;  4I3J A;  4X68 A;  1S66 L;  3VP0 A;  4Y0T A;  3R7W A;  2ZC5 B;  4OVD A;  2Y2G A;  3BRM A;  3EGX C;  3R7W B;  2JHE A;  1GSW A;  5DJT A;  3Q81 A;  1YLY A;  2Y2L A;  3CIT A;  3EOI A;  3T1R A;  5FDH A;  1NWZ A;  2M7V A;  3WS5 A;  2WAF A;  4B9O A;  2G7U A;  4DKI A;  2V20 A;  2VLG A;  3UPP A;  4GLQ A;  4E6W A;  2A49 A;  3IBR A;  1UGU A;  4PM8 A;  4D2O A;  5AVE A;  5FSR A;  2Y55 A;  5EV0 A;  3P7N A;  4X25 A;  4BBV A;  3UO9 A;  3OZH A;  1NLY A;  3HUO A;  2G2W A;  4ZJ1 A;  1MXO A;  3GTC A;  1K54 A;  4MMN A;  3Q7V A;  3Q7V B;  5EVI A;  1KGE A;  1U60 A;  4OLD A;  2IA2 A;  4I3I A;  5EVI B;  3ZHH A;  3S22 A;  1X0O A;  2ZQ7 A;  2OWH A;  3MZE A;  1NYM A;  2AVX A;  3IHB A;  3MZF A;  4DF6 A;  5FQQ A;  2EXB A;  1BLP A;  4QJG A;  4FOF A;  3HLC A;  5E2E A;  1XGI A;  1MWU A;  4CLC E;  4DXB A;  1DJB A;  3F1P A;  1XA1 A;  3VE4 A;  3F1P B;  1S4R A;  5M18 A;  1Q2Q A;  1LLB A;  5MC7 A;  3L9K A;  3ZG7 B;  2EX9 A;  3W2Z A;  1IEL A;  2Y2I A;  3A0R A;  4KZ7 A;  3IWO A;  2O0Y A;  3LFV A;  1RCJ A;  4UQI S;  1PI5 A;  1XXM A;  5C5K A;  4Z1W A;  4OQI A;  5FQI A;  1E4D A;  1LHY A;  4WYY A;  2EFU A;  3DTK A;  3HLG A;  2HDU A;  1XJ3 A;  5KZH A;  3BQ8 A;  3C5A A;  3LIC A;  3UDI A;  5KSH A;  5GLD A;  3HVF A;  3IHA A;  4FSF A;  2HGV A;  2YKF A;  4JF5 A;  3ZG5 A;  3WRT A;  2V0W A;  4OKP A;  1F5M A;  3QNC A;  1H5X A;  4BBU A;  2HP6 A;  2JBF A;  3MXS A;  1YSQ A;  4XUZ A;  2OOL A;  2ZQC A;  4EEU A;  3TG9 A;  1MWT A;  2ZQ8 A;  5FA7 A;  3SH8 A;  4KQQ A;  3ZNT A;  5IU1 A;  3C7V A;  4ESP A;  5DTS A;  1OTI A;  2XSS A;  3E2L A;  1T19 A;  4R6L A;  2Q9M A;  3LIF A;  1KDS A;  3E4Q A;  2L4R A;  2ZMF A;  1JNU A;  1K57 A;  5DKK A;  3P09 A;  4M3K A;  1O7E A;  1E25 A;  2HPB A;  3TSG A;  3CAX A;  2J9P A;  3GSG A;  3W4O A;  4BLM A;  3O87 A;  3HLE A;  4WLA A;  3ITB A;  5TFQ A;  3HL9 A;  3D3O A;  2V8F A;  2W3G A;  2PU4 A;  1SDN A;  1VQQ A;  2ZQD A;  2E8J A;  4HJ3 A;  3T4L A;  2WKE A;  4E3M A;  4MBH A;  4FH2 A;  1IKG A;  4O0P A;  1L0G A;  3ZDJ A;  1T1B A;  3EWK A;  3NIA A;  1KE4 A;  3B33 A;  5FAT A;  5FAP A;  2MJ6 A;  1XGJ A;  4GHI A;  2K31 A;  4B88 A;  1YAX A;  4PKY G;  4GHI B;  3BY9 A;  5HL6 A;  4E3O A;  3IF6 C;  1K4F A;  1XFN A;  4Q0I A;  3F1O A;  2Y8H A;  4WZ5 A;  3DWK A;  2Q9N A;  3F1O B;  1CI8 A;  1P97 A;  1G68 A;  3C30 A;  2WAD A;  4OLG A;  1N4O A;  3VSL A;  1D1J A;  3G35 A;  5DTT A;  3HJI A;  1ES5 A;  4GDB A;  1YMX A;  1LSV A;  5CTN A;  2ZMA A;  3D72 A;  4EUZ A;  4MLL A;  3IX4 A;  4LV2 A;  4GOG A;  5GLB A;  3R4K A;  4IVK A;  4BBT A;  3BLM A;  5EVL A;  5EVI C;  2XDM A;  4P6B A;  3BYD A;  1VEU A;  4S2L A;  4YOF A;  2H0T A;  1VEU B;  4OOM A;  3LO7 A;  3NI9 A;  4GS9 A;  1OTE A;  4GS9 B;  2WGI A;  3NCK A;  2Y2H A;  5E2H A;  2J3T D;  1K6R A;  4FTX A;  2JCH A;  4B4X A;  1W63 M;  5DF8 A;  3OCL A;  2WGW A;  2WGW B;  2ZC7 A;  2QKP A;  3D9Y A;  1FOF A;  2A3U A;  2OLV A;  5TBM A;  4ZTK A;  5GL9 A;  5TBM B;  3N8R A;  3PBT A;  3U4L P;  3KX0 X;  4K91 A;  3PHY A;  4X56 A;  5A92 A;  4G3W A;  5EFW A;  4Y2F A;  2C5W B;  2VGK A;  1YMS A;  3PBN A;  3WRZ A;  3VFH A;  1N9L A;  3IXG A;  2V8C A;  4P0M A;  1LL8 A;  3AGF A;  1K25 A;  3B3X A;  4DJ3 A;  4BD0 A;  3EGD C;  3HLB A;  3B47 A;  1DY6 A;  4R3J A;  1UWP X;  4QWO A;  5TGF A;  2XQZ A;  4ZJ3 A;  3AGE A;  3G2Y A;  2PR6 A;  2VGJ A;  2PRF A;  2YKH A;  3MJQ A;  1SHV A;  4MN5 A;  4I5S A;  4LRZ E;  4EU0 A;  1IEM A;  4NXE A;  3FG8 A;  4KG5 A;  3MFX A;  3LIE A;  3UE6 A;  3BJN A;  1K4E A;  2JKT M;  2P04 A;  3MKE A;  2ZM8 A;  1YM1 A;  4EQ1 A;  3SH9 A;  3EQU A;  1K57 C;  3VMA A;  5A90 A;  2W3F A;  4JXW A;  4KUO A;  4BD1 A;  2LB9 A;  3FZC A;  1KGG A;  3PTE A;  5EOO A;  2JC7 A;  2NUP C;  1OTA A;  4KZ5 A;  2P08 A;  1I2W A;  3IWQ A;  3ZNY A;  4ZJ2 A;  2JKR M;  5EE8 A;  1GA9 A;  1GCE A;  3OBF A;  3W8K A;  1LI9 A;  2CC1 A;  1CF0 A;  5FDS A;  5L10 A;  4XXR A;  5CTM A;  1XA7 A;  4N92 A;  4HNB A;  1W63 Q;  3IH9 A;  3OC2 A;  3P01 A;  2OAP 1;  1SZV A;  4CPK A;  2V1Z A;  3UB8 A;  3VOL A;  5D3O A;  3RJU A;  3V3R A;  4WZ5 C;  3LR0 A;  4KUK A;  1FCN A;  4LCM A;  5FQJ A;  3HJK A;  2WAE A;  2VV7 A;  2HJ9 C;  3CLO A;  1XX2 A;  4MCW A;  1AXB A;  4OP5 A;  4N9L A;  4YNR A;  1ALQ A;  1CEG A;  4HES A;  4KQR A;  1ESI A;  3Q82 A;  4GD6 A;  5HPI A;  2Z6C A;  4WL9 A;  1GHP A;  3HLF A;  4HH2 A;  1W8Q A;  4PM5 A;  5AQ7 A;  4EER A;  5LBR A;  3O88 A;  3DAV A;  1JTD A;  2HZ5 A;  4JKT A;  3KYQ A;  1M40 A;  3G34 A;  1CQA A;  2Z2M B;  1VET A;  1RP5 A;  1TS6 A;  1VET B;  2VV8 A;  3N8L A;  4OOY A;  4EV4 A;  3UB6 A;  1PI4 A;  5J4E A;  1K56 A;  3DTE A;  2XFS A;  3NDG A;  2Y79 A;  2K7S A;  1K55 C;  2P9V A;  5AQ9 A;  1BZA A;  2XD5 A;  1NY0 A;  2P9V B;  2ZBB A;  4DXC A;  3PAG A;  1E3U D;  2ZLY A;  1PIO A;  3K3C A;  3RFB A;  1T1A A;  3OPP A;  4L9G A;  1LL9 A;  1JWP A;  2JN7 A;  2EFX A;  4QB8 A;  3BY8 A;  4IBR A;  2V1A A;  2VZW A;  4KZ4 A;  5M19 A;  2QYB A;  1FR1 A;  4L9F A;  4EBN A;  3WS4 A;  2XK1 A;  4L0L A;  5HFO A;  1MWR A;  1I5Q A;  3VP2 A;  4HBU A;  3QNB A;  1S0W A;  3LY4 A;  5GHY A;  1XJ4 A;  1MY8 A;  3DWZ A;  3B42 A;  4E6X A;  4CLC A;  5JYO A;  2EWW A;  2QHK A;  4CLC B;  5DKL A;  4E3K A;  3FKW A;  2WGV A;  4O01 A;  4YIN A;  4OON A;  5G4Z A;  3MMH A;  3Q7Z A;  4ZDX A;  2ZM2 A;  2FFF B;  4ETX A;  3PXP A;  3TW8 A;  4BJP A;  5AVF A;  5HAP A;  1Q2P A;  2VK3 A;  3N7W A;  3A3F A;  1CJF A;  4QHC A;  1VHM A;  3BLS A;  4HJ4 A;  2E8I A;  4IJG A;  2DCF A;  1ES3 A;  3MF0 A;  3G2Z A;  3JVU A;  3ICY A;  5HDD A;  4E3J A;  2WUQ A;  3IT9 A;  2B95 A;  3IWI A;  3M2J A;  5HAQ A;  3T4Q A;  5CGX A;  3AGD A;  4FD8 A;  3NUL A;  1F98 A;  4E3L A;  5HWT A;  3SW1 A;  3MKF A;  3UB7 A;  4RA7 A;  4KQD A;  3NC8 A;  2Y2K A;  3UME A;  4N9K A;  1YT4 A;  3JPU A;  3SS4 A;  4OPR A;  1Y54 A;  3GRJ A;  3LGO A;  4DE0 A;  4G3K A;  3O3V A;  4ZAM A;  2IWD A;  4LCL A;  3UE3 A;  5KIZ A;  3NEC A;  4R38 A;  4GKU A;  3VV4 A;  3T4K A;  3IX3 A;  1JVJ A;  3IF5 A;  4B93 A;  4UA9 A;  4WMC D;  1WYB A;  1F9I A;  3CUE C;  3OCN A;  1YLP A;  4BL3 A;  2ZC3 B;  2BTF P;  2GX5 A;  4F3L A;  3T1S A;  4X53 A;  1TEM A;  3OPH A;  3ZG9 B;  4JF6 A;  4F3L B;  4K0X A;  2WKR A;  3G6O A;  3OLO A;  3IS2 A;  3RXX A;  3CMZ A;  3BFF A;  4OQH A;  5DTK A;  1FSW A;  3PBS A;  3IS2 B;  3PBO A;  5A91 A;  4P6Z M;  5FAO A;  3HRE A;  4WBG A;  3UN7 A;  1PWD A;  2KX6 A;  4DDY A;  1CK3 A;  2W3D A;  1D06 A;  3WS2 A;  4WM9 A;  3VSK A;  2ZQA A;  3W4Q A;  1NLZ A;  2QJ5 A;  1NRF A;  2UWX A;  4DJ2 A;  1SKO A;  1HTZ A;  3BQA A;  1SKO B;  3HUN A;  2WKH A;  1EI5 A;  2IWC A;  1HD8 A;  3HBR A;  1HLU P;  5M1A A;  1LL5 A;  4HI4 A;  3NJA A;  1XPB A;  4R3A A;  3DTM A;  5HDS A;  3S1Y A;  3QHY A;  4LV0 A;  1N9O A;  3LEQ A;  3QP5 A;  3A0S A;  3KSH A;  1KE0 A;  4EXO A;  3ZVT A;  3NHQ A;  4LPZ A;  2Z6D A;  3BEB A;  2PBD P;  3G31 A;  1JTG A;  4UA6 A;  4EUV A;  1BLH A;  3LR5 A;  4PM6 A;  3GV9 A;  5CED A;  3C38 A;  3UE1 A;  1J3W A;  2XRN A;  2Y4A A;  4GN2 A;  4RVA A;  2HJE A;  1L2S A;  5EVE A;  5HZH A;  2WKP A;  2B02 A;  1TF1 A;  2OAQ 1;  4NEE D;  4JLF A;  1TVF A;  3BW6 A;  4LGW A;  2ZM0 A;  3BM6 A;  4PKY A;  4HIA A;  3C4P A;  3H9W A;  1H8Y A;  3I7J A;  3IBJ A;  2Y2P A;  1LT0 A;  4OP8 A;  3G4P A;  4CLC C;  5F69 A;  4C6Y A;  1CI9 A;  2UV0 E;  3DBA A;  3SZT A;  1K54 C;  1YLT A;  4LFU A;  4S2O A;  4O8G A;  3C2W A;  2KOI A;  1MZU A;  3HCY A;  2H28 A;  4JGO A;  4L9E A;  4NXF A;  5F68 A;  2FH5 A;  4JF4 A;  3VFF A;  5EUA A;  4X6T A;  5HWV A;  2XH9 A;  2A2L A;  3M6H A;  1NYY A;  4LRX C;  3TOI A;  3VP3 A;  5EOE A;  2GJ3 A;  4NG2 A;  3V67 A;  1VM1 A;  2OV5 A;  1IYO A;  1MBL A;  2XR0 A;  4IED A;  3E4O A;  3LIB A;  4NXG A;  3K2N A;  4DE3 A;  4R3B A;  5FI6 A;  3MXR A;  4B4Z A;  1KE3 A;  3CJM A;  5HD5 A;  1ZC2 A;  1S67 L;  5A93 A;  1T1C A;  4JBF A;  4HY8 A;  5BOH A;  5CEB A;  5I94 A;  1HZO A;  1ZKJ A;  2R78 A;  2ZMV A;  4R70 A;  3V50 A;  2EA9 A;  2QMI A;  4EEP A;  3T4T A;  1FIL A;  2ZJ9 A;  1PNE A;  2P74 A;  1BSG A;  2XFT A;  2ZOI A;  2WKQ A;  3ZCZ A;  3LR3 A;  4BMW A;  4E3I A;  3GMW A;  4S2M A;  4HBT A;  1NZU A;  3FC7 A;  1LI0 A;  4N1H A;  4CQH A;  3FYZ A;  2K2N A;  3PYP A;  5DFX A;  5FEF A;  2VEA A;  5L09 A;  4GDN A;  2XF3 A;  5AQA A;  2PD8 A;  4S2J A;  3MS6 A;  1LSW A;  3A3E A;  4K0W A;  1ACF A;  4JGP A;  1TS0 A;  1S1Y A;  4KG2 A;  1PYY A;  3IH8 A;  2HDR A;  2J9O A;  1OJG A;  1Z09 A;  5EVI D;  4WEJ A;  2VKS A;  2XGN A;  2VGL M;  5F1G A;  3K3D A;  3RTY A;  2G2U A;  5IHV A;  1OTD A;  4K08 A;  2GNX A;  3MSH A;  3PAE A;  3ISG A;  2Y91 A;  3S4X A;  4R4S A; 
#chains in the Genus database with same CATH homology
 4HJ6 A;  4FSF A;  2HGV A;  2EWV A;  2YKF A;  5HPF A;  3K3C A;  1NRJ A;  3RFB A;  1T1A A;  4L9G A;  5K5B A;  2XRO A;  2V0W A;  1ODV A;  3A0V A;  1F5M A;  2JN7 A;  2KLI A;  3BY8 A;  4BBU A;  1P9W A;  2V1A A;  1YSQ A;  2VZW A;  2QYB A;  1V9Z A;  3S7Q A;  1YSP A;  2OOL A;  4L9F A;  4WF0 A;  4EEU A;  2PR5 A;  3E4P A;  4GW9 A;  3GDI A;  2QJ7 A;  4P6Z S;  5IU1 A;  4L0L A;  3ZQ5 A;  1DP8 A;  2I9V A;  2O9B A;  5CX7 A;  2XA7 M;  3KSF A;  5DJU A;  1OTI A;  4IHQ A;  2XSS A;  4MN7 A;  1T19 A;  4R6L A;  5G4Y A;  3LUQ A;  1OTB A;  3LIF A;  1OJ5 A;  1XJ4 A;  1H8M A;  2W27 A;  3E4Q A;  2L4R A;  2ZMF A;  4NKP A;  4HOI A;  3B42 A;  4CLC A;  1JNU A;  2EWW A;  3LIA A;  5DKK A;  2W0N A;  4IUH A;  3F1N A;  4HH3 A;  2QHK A;  4CLC B;  3F1N B;  5DKL A;  2VV6 A;  3CAX A;  4O01 A;  5G4Z A;  4RQ9 A;  4WLA A;  3LR4 A;  3MMH A;  4HQA A;  5HSQ A;  3D3O A;  2JKT I;  2M1C A;  2W3G A;  4ETX A;  3PXP A;  3TW8 A;  4BJP A;  5I5L A;  5AVF A;  2PT7 A;  4HJ3 A;  3T4L A;  1ZTU A;  3MQ0 A;  4GCZ A;  1VHM A;  4WUJ A;  2O9C A;  2FZ0 A;  4HJ4 A;  4O0P A;  1T1B A;  4IJG A;  1XFQ A;  1OT9 A;  5IT5 A;  2D01 A;  3ZYT A;  1YKD A;  1VB6 A;  1WA9 A;  3EWK A;  4GJ4 A;  3MF0 A;  4JGR A;  2VA0 A;  3JVU A;  3LID A;  3ICY A;  5HDD A;  3B33 A;  4I39 A;  2MJ6 A;  1UWN X;  4CLC D;  2JKR I;  3GEC A;  5F5Y A;  4GHI A;  2K31 A;  3T4Q A;  2P7J A;  1YAX A;  4LLO B;  4PKY G;  3TRC A;  4GHI B;  3BY9 A;  5HL6 A;  2ZOH A;  3TE8 A;  1XFN A;  1F98 A;  4Q0I A;  3T50 A;  3NOP C;  3F1O A;  2L1M A;  5HWT A;  4H6J A;  2Y8H A;  3SW1 A;  4WN5 A;  3UB7 A;  4KQD A;  4I3A A;  3UME A;  3F1O B;  2PYP A;  5DF9 A;  4H6J B;  2M7U A;  1GSX A;  1P97 A;  4UQI M;  1P0Z A;  2HV1 A;  3C30 A;  5IS1 A;  4G3K A;  1DRM A;  2A24 A;  4IUK A;  3HJI A;  1G6O A;  2A24 B;  3LI9 A;  1TS8 A;  1V9Y A;  3NOT C;  3UE3 A;  1LSV A;  5KIZ A;  4R38 A;  4JGQ A;  5L8M A;  3VV4 A;  3FPV A;  4LRY C;  3T4K A;  3PBQ A;  3D72 A;  5AJG A;  4PAU A;  4II7 A;  3U2A A;  4B93 A;  2GZA A;  3R4K A;  1F9I A;  3CUE C;  4ZRR A;  4BBT A;  3OCN A;  4MN6 A;  5HD3 A;  3CI6 A;  1TD5 A;  2GX5 A;  3E0Y A;  4YOF A;  4F3L A;  2HF6 A;  4MDZ A;  2LB5 A;  4OOM A;  5F6A A;  3UB9 A;  1OT6 A;  5J3W A;  4F3L B;  4GS9 A;  2WKR A;  2W1R A;  4WEL A;  2BAS A;  3G6O A;  3OLO A;  1OTE A;  3IS2 A;  3MQO A;  4GS9 B;  5HDC A;  3PBS A;  3IS2 B;  3PBO A;  4P6Z M;  2O9A A;  2V9A A;  2J3T D;  3KO6 A;  2KX6 A;  3T4O A;  3EEH A;  2W3D A;  2KDK A;  4ARZ A;  2V1B A;  1W63 M;  5A8B A;  1D06 A;  3H7W A;  2INW A;  1ZHH B;  3OCL A;  1XJ2 A;  2J80 A;  4ARZ B;  3H7W B;  4OOL A;  1NLZ A;  2QJ5 A;  2QKP A;  4WEK A;  4DJ2 A;  2QWS A;  3BQA A;  5TBM A;  3OOV A;  3CWF A;  4G3V A;  1KOU A;  5TBM B;  4NXB A;  3PBT A;  1XJ6 A;  4HI4 A;  3KX0 X;  3NJA A;  2B18 A;  4R3A A;  5HDS A;  3PHY A;  3CUE A;  4EET B;  3RH8 B;  4XT2 A;  1N9O A;  4G3W A;  5EFW A;  4Y2F A;  1OPX A;  3A0S A;  3PBN A;  3KSH A;  4HP9 A;  3S7O A;  1N9L A;  3H82 A;  4XT2 B;  3MXQ A;  4EXO A;  4Y3I A;  4PHT A;  3H82 B;  1LL8 A;  3NHQ A;  4LPZ A;  4DJ3 A;  3EGD C;  3JVV A;  2Z6D A;  1TS7 A;  3PR6 A;  3B47 A;  5TJJ A;  2W3E A;  1UWP X;  2D02 A;  3EEA A;  2NUT C;  3T4S A;  4EUV A;  1GSV A;  2PR6 A;  1DP9 A;  3LR5 A;  1IFQ A;  1T18 A;  2YKH A;  3MJQ A;  1G28 A;  2W1T A;  4I38 A;  3C38 A;  1MKM A;  4MN5 A;  2XRN A;  4I5S A;  2HJE A;  2VGL S;  4LRZ E;  2W1T B;  4EU0 A;  3TJZ C;  5HZH A;  2WKP A;  4NXE A;  2B02 A;  1TF1 A;  3FG8 A;  3MFX A;  2OAQ 1;  4NEE D;  1S4S A;  3LIE A;  3UE6 A;  4EW7 A;  3BJN A;  3BW6 A;  3UMD A;  1EW0 A;  2VX8 A;  2JKT M;  2P04 A;  4PKY A;  4HIA A;  3H9W A;  4EES A;  4EQ1 A;  3IBJ A;  1LT0 A;  3EQU A;  3LI8 A;  1DP6 A;  4CLC C;  4ME4 A;  5F69 A;  3DBA A;  2VJW A;  1D7E A;  2W3F A;  4KUO A;  2LB9 A;  3KYZ A;  4Y5F A;  1STZ A;  3LYX A;  1BYW A;  2NUP C;  1OTA A;  4O8G A;  3C2W A;  2KOI A;  1MZU A;  3HCY A;  3S7P A;  2H28 A;  3ULF A;  4DMZ A;  3FPW A;  2V0U A;  2P08 A;  2O99 A;  4JGO A;  4L9E A;  4NXF A;  4I3J A;  1S66 L;  1Y28 A;  5F68 A;  3R7W A;  2FH5 A;  2PYR A;  2JKR M;  2CMN A;  3OBF A;  5HWV A;  3EGX C;  3R7W B;  2JHE A;  1GSW A;  4YWZ A;  2A2L A;  2J3W A;  5DJT A;  2XA7 S;  3CIT A;  3EOI A;  4LRX C;  4Q0J A;  1NWZ A;  2M7V A;  4B9O A;  2G7U A;  2GJ3 A;  2VLG A;  3V67 A;  4GLQ A;  4HNB A;  3IBR A;  3KSI A;  1UGU A;  1W63 Q;  5AVE A;  3E4O A;  3LIB A;  4NXG A;  3K2N A;  3OC2 A;  3P01 A;  2OAP 1;  3P7N A;  4BBV A;  5HD5 A;  3UB8 A;  1S67 L;  1T1C A;  3VOL A;  4HY8 A;  4BWI A;  1NLY A;  4Q0H A;  1N9N A;  2R78 A;  4QPR A;  4MMN A;  2ZMV A;  4R70 A;  5DFY A;  4E04 A;  3C8C A;  2EA9 A;  4HHD A;  3LR0 A;  4KUK A;  4EEP A;  3T4T A;  2IA2 A;  2ZOI A;  4I3I A;  2WKQ A;  3HJK A;  3KSG A;  4HP4 A;  2DMW A;  3LR3 A;  1X0O A;  4BMW A;  2L0W A;  2HJ9 C;  2OWH A;  2VV7 A;  3CLO A;  4MCW A;  2J3T C;  4YNR A;  1H3Q A;  2PD7 A;  3FC7 A;  4AFI A;  4CQH A;  4FOF A;  2K2N A;  1S1Z A;  3MQQ A;  3PYP A;  4KQO A;  3T4J A;  1MC0 A;  5DFX A;  4CLC E;  1LSX A;  3S7N A;  2VEA A;  1P9R A;  4M4X A;  3F1P A;  2PD8 A;  4ETZ A;  5HPI A;  2OWJ A;  2Z6C A;  4WL9 A;  3VE4 A;  4DN0 A;  4HH2 A;  3F1P B;  1LSW A;  1S4R A;  3EQV A;  5MC7 A;  4EER A;  3W2Z A;  5LBR A;  4JGP A;  1TS0 A;  1S1Y A;  5FL3 A;  3A0R A;  3O5Y A;  3KYQ A;  1OJG A;  2O0Y A;  3LFV A;  4UQI S;  3E98 A;  2PDR A;  5C5K A;  3BWL A;  4WEJ A;  2VKS A;  1TS6 A;  4Z1W A;  2VGL M;  2VV8 A;  5J7E A;  3K3D A;  3RTY A;  2W3H A;  3UB6 A;  4UEY A;  1OTD A;  5J4E A;  3MR0 A;  4K08 A;  2GNX A;  1IOU A;  3NOU C;  2Y79 A;  2K7S A;  1XJ3 A;  2PHY A;  3BQ8 A;  3LIC A;  5KSH A;  3VE3 A;  5HWW A;  3PBR A;  2ZBB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...