2PYRA

Photoactive yellow protein, 1 nanosecond intermediate (287k)
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
125
structure length
122
Chain Sequence
MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVADSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Photoreceptor
molecule keywords PHOTOACTIVE YELLOW PROTEIN
publication title Energy transduction on the nanosecond time scale: early structural events in a xanthopsin photocycle.
pubmed doi rcsb
source organism Halorhodospira halophila
total genus 38
structure length 122
sequence length 125
ec nomenclature
pdb deposition date 1998-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2pyrA00
2OWHA 1F9IA 4WLAA 1EW0A 3A0VA 2INWA 2JN7A 4HJ6A 3EWKA 4K08A 4I39A 4NXFA 2WKPA 3BY8A 4GS9A 3K3DA 2W27A 1V9ZA 2B02A 3CAXA 4L9GA 5HSQA 4M4XA 4GCZA 4HOIA 4NXEA 4PKYG 4RQ9A 2P7JA 3ICYA 4HHDA 3GDIA 5TBMB 1P97A 1N9NA 2Z6CA 2PR6A 2K7SA 2GJ3A 1DRMA 3LIFA 3OLOA 2M1CA 1S4RA 1VB6A 3NJAA 4GHIA 1TS7A 4EW7A 1BYWA 3P7NA 1S1ZA 3MQOA 1S1YA 1XJ6A 2L1MA 2VV6A 1XJ3A 4PKYA 1S4SA 4BBTA 3ULFA 4NXBA 5HWTA 3F1PA 4WN5A 3UMDA 2EA9A 4E04A 5F5YA 4GW9A 2V0UA 2YKHA 4KQDA 1LSVA 5J4EA 1OTIA 4KUKA 3H82B 4LRXC 4DJ3A 3HJKA 3H9WA 2QWSA 2PYRA 3PHYA 3IS2B 3EEHA 4GHIB 3LI8A 3LIEA 3VOLA 1OJGA 1UWNX 5EFWA 2BASA 3A0RA 3LIDA 1OT9A 5A8BA 3HJIA 2QJ7A 3LI9A 4B9OA 4HJ4A 4R3AA 4EERA 4EEUA 1F98A 1D7EA 5HD5A 3F1OB 2OOLA 5AVEA 2HV1A 3E4QA 4I3AA 3UB8A 4EESA 3D72A 3K3CA 1DP9A 3FG8A 5F6AA 3UMEA 4HY8A 2WKRA 2V0WA 3H7WA 1V9YA 3F1NA 3RTYA 1GSVA 3UB9A 3MR0A 2QHKA 1P0ZA 3LIBA 4EETB 2PD7A 3IBRA 4HNBA 5DJTA 1JNUA 1N9LA 3LUQA 4JGOA 2VLGA 3UB7A 5HD3A 5IU1A 3C8CA 4HP4A 2L0WA 1DP6A 1OTEA 1T19A 2JHEA 3LIAA 1OT6A 3NOTC 3NOUC 5HZHA 4HH3A 2QJ5A 4NXGA 1T18A 3VE4A 4R70A 3H7WB 4GS9B 3NHQA 1S66L 4YWZA 2KDKA 5HDSA 1KOUA 3RH8B 4HIAA 2OWJA 2YKFA 1Y28A 4LLOB 4R38A 2W0NA 2QKPA 2VV7A 1D06A 4I3IA 2ZOIA 5F68A 3NOPC 2Z6DA 2VEAA 3T50A 3CWFA 1UWPX 2ZOHA 1XJ2A 1LSWA 3MJQA 4EXOA 3E4PA 1OTBA 3B33A 4BBVA 1TS0A 5AVFA 1DP8A 3F1PB 4MN6A 4LRZE 4XT2A 5I5LA 5TBMA 3A0SA 1NWZA 1TS8A 3C2WA 3MFXA 1MZUA 2L4RA 3LYXA 4I3JA 2A24A 1UGUA 4WL9A 3E4OA 3SW1A 4LRYC 5G4ZA 4EEPA 2R78A 5G4YA 2V1AA 4WF0A 3UE6A 2PD8A 3KX0X 4L9EA 1T1CA 2H28A 3PYPA 4HI4A 1GSXA 4HQAA 5F69A 5DKLA 5J7EA 5HDCA 4EQ1A 1X0OA 4DJ2A 2V9AA 4XT2B 1OJ5A 4F3LA 2WKQA 4JGRA 4HJ3A 3ZQ5A 2A24B 1WA9A 1T1BA 3H82A 3MQQA 2PR5A 1G28A 3G6OA 4JGQA 3BY9A 3FC7A 3F1NB 4KUOA 4WUJA 2V1BA 3IS2A 5KIZA 2CMNA 2J80A 5DKKA 2PYPA 1GSWA 3GECA 4I38A 4H6JA 5DJUA 3LICA 2PDRA 4R6LA 1T1AA 3F1OA 1LL8A 3MXQA 5IS1A 5HWVA 3CLOA 4JGPA 2ZBBA 4F3LB 2D02A 1LSXA 3VE3A 4LPZA 2I9VA 5J3WA 1TS6A 4MN5A 5HDDA 4HP9A 1OTDA 4H6JB 2VV8A 1ODVA 2D01A 4L9FA 1S67L 1XJ4A 1XFQA 2PHYA 1N9OA 5HWWA 3BWLA 4I5SA 1OTAA 1XFNA 4HH2A 3UB6A 1LT0A 2KX6A 4BBUA
chains in the Genus database with same CATH superfamily
4O7DA 4ZAMA 1CQAA 4MBFA 4X68A 1YPRA 3P98A 1VEUB 3BJNA 3OPPA 2XFSA 4MMNA 4I39A 4Y17A 2XA7S 4N9KA 4UQIS 3A3JA 4OOLA 3B47A 4L9GA 2PAVP 5DFXA 4NXEA 3SOIA 3T12B 4WZ5C 1XP4A 5EOOA 2J9OA 3ISGA 1QMEA 3FPVA 1K55A 2GJ3A 3R7WB 3W8KA 1YLYA 4Y3IA 3OLOA 3PBSA 2VJWA 1VB6A 2PU4A 3OCLA 5MC7A 3O3VA 3Q82A 2HDUA 2X01A 3C30A 2EFUA 3G34A 4EWFA 1KGFA 1W8YA 2Y2MA 2L1MA 4KENB 5FEFA 1YLTA 1K54A 2W3EA 1BLCA 2V1ZA 4PKYA 3QP2A 4WMCA 1F2KA 4S2IA 2A2LA 1S4SA 3LEQA 5F1GA 2GX5A 3ULFA 4PM8A 5L09A 1MC0A 3UPOA 2FFFB 3VP3A 3BFGA 4LV2A 3QP6A 4JF5A 5F5YA 1K6SA 3M2KA 2YKHA 4KQDA 1LSVA 2Y2KA 2EXAA 3H82B 3T4JA 1G6AA 3PBTA 1LLBA 2QWSA 3H9WA 5EVID 5F83A 1FSWA 5HW3A 3LI8A 2JKRI 3VOLA 1FR1A 2BG1A 1OJGA 2BASA 3A0RA 3VOYA 5A8BA 3CMZA 4B9OA 5HAQA 4FTXA 1NLZA 4R3AA 2H5SA 4RX2A 2Y2GA 3F1OB 3HREA 3BFEA 4OQGA 1TVFA 4ZBEA 4MBKA 3VP0A 5A92A 3LR4A 3EQVA 4JPMA 3MFDA 5F6AA 2A3UA 2WGWB 4S2JA 1ES3A 3H7WA 1V9YA 2ZJ9A 2XGNA 3M2JA 3CPTA 1XXMA 2WADA 4ZJ3A 3LIBA 4PPRA 5CGXA 4OP5A 2PD7A 1N9LA 2VLGA 3UB7A 1IYPA 2PRFA 5HD3A 5IU1A 1K25A 2EX8A 2QPNA 4QU3A 2A49A 3LIAA 3HLCA 5EOEA 1OT6A 3BECA 4XUZA 4N9LA 4IBXA 2BLSA 4NXGA 4O01A 4UHUA 4GOGA 3IF5A 4C75A 3DAVA 2XEPA 3Q7VA 2M7VA 4DRTA 2M7UA 4R70A 3WRZA 3H7WB 3NY4A 4C3QA 1S66L 4YWZA 3CPTB 5HFOA 2YKFA 4JXSA 4X6TA 2XLNA 3LGOA 4G3WA 3DW0A 3DTEA 3MXRA 2JKTI 2VV7A 1JWPA 2WZXA 4MNRA 4JF4A 1K56D 5FQIA 5EVLA 3CWFA 4CLCA 1K4EA 3BFDA 2ZOHA 1NJ4A 1SHVA 3T4LA 1BSGA 3WRTA 5DVAA 3E4PA 1PZPA 2UV0E 2Y55A 1I5QA 1MBLA 1OTBA 3A3DA 3T4TA 1MWSA 2Y2PA 1BLHA 2J3TC 3MS6A 5U47A 3TE8A 2X02A 3ZYTA 4KZ5A 1NWZA 3MFXA 2JE5A 5EE8A 3LY3A 3LYXA 4NEED 3GTCA 3RXXA 4BD0A 1TDGA 5G4ZA 2ZQ9A 2HDRA 5CHMA 5AQAA 4B4ZA 4CLCB 4EEPA 1JVJA 3IT9A 2O0YA 2HF6A 1MPLA 3S4XA 3V5MA 3BQ8A 4R1GA 3PBNA 1T1CA 2H28A 5F69A 4IVKA 4X55A 1CEFA 1IYSA 2ZM8A 4Z1WA 5DKLA 1XGIA 5J7EA 4E6XA 2HGVA 3D9YA 3PR6A 4GNUA 1MWRA 1HTZA 1OJ5A 4WEKA 3TW8A 5JYPA 1P9WA 3V3SA 2J3WA 3CUEC 3HUOA 3HVFA 3MQQA 3G6OA 1DJAA 4DF6A 3C38A 3HCYA 1FILA 1I2WA 4BL3A 2J80A 4B4XA 2W1RA 5M1AA 4I38A 1XPBA 4H6JA 3GRJA 3LR5A 1S0WA 4P85A 3WS4A 3LICA 4X1LA 3ZNYA 2PDRA 4WYYA 4P0MA 4R6LA 2Y2HA 4FH2A 2HP5A 3MBZA 1FCNA 4IJGA 5DTTA 1Z09A 3MXQA 5IS1A 1FCOA 2ZQAA 4JGPA 3VMAA 1MKIA 1PI4A 4MLLA 1LI0A 4EBPA 3MKFA 2D02A 1LSXA 2WKEA 2Z2LB 4QY5A 5J3WA 3S1YA 1GHIA 3W4PA 1K6RA 3IXBA 4KQRA 4Q8IA 1KDSA 4U0TA 5J8XA 2LB9A 5C5KA 2UWXA 3FV7A 3UE1A 4B88A 2VX8A 4H6JB 1E3UA 3QP5A 4L9FA 1ZG4A 2VGKA 3QP8A 4U3TA 1XX2A 3D3OA 3NBLA 2ZLYA 4HH2A 4ID4A 1LT0A 4BWIA 1NZUA 5I94A 1F9IA 4WLAA 1EW0A 2QYBA 1CF0A 3U2AA 3A0VA 2JN7A 4WM9A 1VM1A 5EPHA 1K0KA 4EU0A 3UNWA 4NXFA 4GD6A 1V9ZA 5HPFA 3CAXA 1W63M 3MSHA 4OVDA 4GCZA 4HOIA 3GMWA 4B93A 1NYYA 4KZ6A 2K7SA 1WYCA 5CHUA 2W1TA 2HDSA 1HVBA 1Q2PA 2Y2JA 4NETA 2Y59A 1KE0A 1S4RA 4RA7A 2EX2A 1TS7A 4ZRRA 5HPIA 4EW7A 3PTEA 1XA7A 4DE0A 1S1ZA 2XSSA 1XJ6A 1S1YA 3CUEA 3KYQA 5EUAA 4PM9A 3IH9A 1XJ3A 4GB7A 1IFQA 5HARA 4CLCD 5CRFA 5GHYA 4KZBA 4FD8A 2P08A 4NXBA 1MXOA 4WN5A 3NC8A 3NULA 4XXRA 3ZVTA 2RCXA 3AGEA 4QWOA 2VA0A 3GSGA 5GLAA 3MZDA 4IBRA 2W1TB 1ZTUA 4LRXC 5L07A 4DJ3A 2GDNA 3PHYA 3Q81A 3GV9A 3U4LP 1DY6A 3ZG9B 5AQ7A 1BZAA 5EFWA 1HLUP 4JXGA 2RL3A 1YT4A 3OBFA 1H3QA 3UN7A 4HJ4A 1L0DA 2JBFA 4EERA 4EEUA 1YSQA 1D7EA 3NECA 3D4FA 3FWLA 2HZ5A 4WEJA 2CC1A 3E4QA 3EQUA 1ALQA 3IX4A 3IF6C 1TEMA 4E3MA 4PM5A 4YFMA 2GNXA 4UEYA 1DP9A 3UDIA 3FG8A 4KG6A 1TDLA 4GD8A 5GLBA 4XUXA 2PBYA 2PBDP 2OSUA 4EUZA 3RTYA 2VKSA 1S6RA 4GDBA 4MEZA 3UB9A 3MR0A 3PBOA 3VFFA 3VP1A 4OQIA 1FCMA 1ACFA 1MWTA 4PHTA 3PXPA 2KLIA 4WBGA 4Y5FA 3N8LA 4HP4A 4DMZA 2XFTA 1OTEA 4JXWA 3SS5A 5HL1A 5GLCA 3S7PA 4HH3A 2QJ5A 3QNCA 3IHAA 4X1MA 1L0GA 1W79A 3UO9A 1EROA 4Q0HA 3DWKA 3ZFZA 2JKTM 5L10A 3KSGA 1HD8A 2KDKA 2O9CA 1Y28A 2Y4AA 3M6HA 4KZ9A 5CEBA 5IHVA 1Y54A 4CLCC 3W4OA 2ZC3B 4QHCA 1C3BA 1D06A 1E3UD 2XR0A 3NOPC 2EX9A 2Z6DA 2VEAA 4EBLA 5CECA 5AJGA 4DE3A 1NLYA 2LB5A 3ZG5A 5CTMA 4MN7A 1YLWA 3MJQA 1F5MA 3IWIA 1G5UA 2K31A 1DJCA 2J3TD 1VETA 2Q0OA 3QNBA 4JLFA 1L3LA 3B33A 3MXSA 1TS0A 5AVFA 1DP8A 3E2KA 2VGLM 5FI6A 5FQJA 4R3BA 1YKDA 3AGDA 4G3KA 5TBMA 1SDEA 1QMFA 1ES2A 1MZUA 2L4RA 1ESUA 3SW1A 4LRYC 4EUVA 1PZOA 3DTMA 3WS1A 2R78A 3IF6A 2ZQDA 3MZEA 1LI9A 1VQQA 3EGDC 2B5RA 4WF0A 4IUKA 3RFBA 4QPRA 3KX0X 5KZHA 4L9EA 4LV1A 4JBFA 1JWZA 1GSXA 4BLMA 4BENA 1A0KA 2HP6A 1KDWA 3VOZA 4UA6A 2O9BA 3JVUA 2Y2IA 5HDCA 3ZG0A 1MY8A 1KVMA 4BMWA 1D1JA 1E25A 3KYZA 4BJPA 2WKHA 5GHXA 3T1SA 3IWQA 4GZBA 3ITBA 1Y4OA 4F3LA 5HAPA 4FCFA 5FL3A 3MKEA 4E3IA 4HJ3A 1BLSA 1T1BA 1FR6A 2O99A 1AXBA 3E0YA 1BUEA 4DXBA 3V39A 3IS2A 3IF6B 4IEDA 1H8YA 2P9VA 4MDZA 4Q0IA 5D3OA 4P87A 5HX9A 4LGWA 3GECA 3O87A 3Q07A 1RCJA 1K38A 4JKTA 4RX3A 1T1AA 2ZMAA 5F82A 4AFIA 2H0YA 3TSGA 1GCEA 1ES5A 1YAXA 2HP9A 3G31A 4F3LB 3T1RA 3WS0A 5CHJA 3Q7VB 4DE2A 1ONHA 2Y2QA 3AGFA 4KZ7A 4BL2A 3L7HA 4DDYA 5GL9A 1AWIA 2P9VB 3BFFA 4R3JA 1YLJA 2VV8A 2D01A 4A5RA 3A3EA 1NY0A 1YMXA 3E2LA 3BWLA 1OTAA 5CTNA 4BBUA 3GQZA 1K57A 1KVLA 3T4OA 3IX8A 2OWHA 3OOVA 4OPYA 1J3WA 1YLZA 2INWA 3ZG8B 3EWKA 4OP8A 5TGFA 3S7QA 4ZTKA 4X25A 3M6BA 1FIKA 3RXWA 4HESA 2WKPA 5G18A 4GS9A 2Y2LA 3K3DA 2W27A 4ZJ1A 4DDSA 3W4QA 5M19A 5DF9A 1PFLA 1EI5A 5HSQA 4M4XA 2IWCA 4RQ9A 4WMCD 4X69A 2P7JA 3ICYA 3R4KA 1IOUA 3P01A 4QD4A 3GDIA 3N7WA 2PR6A 4HEFA 3IXHA 1IYQA 5FASA 3LIFA 2ZMVA 2X71A 2GZAA 2M1CA 3UE3A 5DFYA 2ZC6B 3PBQA 3NJAA 3C7UA 4GHIA 3WWXA 2DCFA 5IT5A 1BYWA 2ZQ7A 5L2FA 3FYZA 5GHZA 2I72A 1YM1A 4II7A 4WELA 2ZL1A 4BBTA 1IEMA 3NDGA 3O5YA 3F1PA 1PW8A 1PWCA 2P74A 3BLMA 5FDSA 1PIOA 2V0UA 1SZVA 5J4EA 1OTIA 2Y79A 3IQAA 3C5AA 2W3FA 3NDEA 2PYRA 3HUMA 3OZHA 3EEHA 4CJNA 4GHIB 1ZKJA 4R0QA 1IKIA 3VFHA 3HL9A 1IKGA 1EWZA 3L9KA 3LIEA 4ETZA 4QB8A 5FEGA 4YINA 1ZG6A 3T4KA 1U60A 3SZTA 2ZL1B 1LL9A 3KYEA 1BLPA 1F98A 4X53A 5CGSA 5CGWA 2FZ0A 4N1XA 4K0XA 4OKPA 1W5DA 2HV1A 2HJEA 4O8GA 4EESA 3VSKA 3D72A 4HBUA 2G2UA 3ZVWA 3G32A 2ZM2A 2ZC7A 3S22A 3UMEA 5A91A 1RGZA 4HY8A 2V0WA 1Z6FA 3F1NA 3GR2A 2H0TA 3CI6A 4P6ZM 4KG5A 5EM0A 2VGJA 2QHKA 3UDXA 2ZQ8A 4Y0OA 1HZOA 1P0ZA 2ZC4B 3IBRA 4OONA 3N8SA 5DJTA 4JGOA 3ITAA 3UB5P 4H8RA 4RYEA 5AQBA 3UPNA 3EOIA 3TOIA 1DP6A 1P9RA 3JPUA 3MZFA 4Q0JA 1T19A 5JYOA 1M6KA 3V3RA 3TG9A 5CERA 5HZHA 3LR3A 2WK0A 2VGLS 1JWVA 5FAPA 4OPQA 4O0PA 2XROA 2FH5A 4YNRA 3VE4A 2WAEA 4IVIA 1KGEA 2W3DA 3NHQA 1G6OA 2E8IA 2OWJA 4U0XA 4OH0A 1ZC2A 2ZQCA 5K5BA 2XDMA 4R38A 2V8FA 2ACGA 2W0NA 5A90A 1LHYA 2QKPA 1CI8A 3LY4A 3NIAA 2XRNA 4E3LA 3HLGA 2ZOIA 4DN0A 3JYIA 1ONGA 3IHBA 1L0FA 4HBTA 1XJ2A 1LSWA 3VSLA 4L0LA 4EXOA 3TJZC 2C5WB 2J8YA 1OPXA 4CQHA 1OMEA 5E2EA 4S2PA 2R9XA 1W7FA 2WGVA 5E2FA 4FSFA 5TR7A 4PM6A 4P6BA 3LCEA 1N9BA 1K56A 4XT2A 5I5LA 4KZ4A 4KQOA 1Q2QA 1TS8A 3C2WA 3FKWA 1N4OA 2W3GA 3R7WA 3LO7A 4I3JA 1UGUA 4C6YA 5TFQA 5G4YA 1RGYA 3G2ZA 3V67A 1M40A 4G3VA 5EVEA 2PD8A 1H8ZA 3VP2A 5E2GA 2EX6A 4GN2A 3T1XA 1CK3A 3EEAA 4HI4A 2OLUA 4OLGA 1CJFA 5KSHA 1K4FA 4OQHA 1PI5A 4JXVA 4EQ1A 1X0OA 3BYDA 4MBHA 3HLBA 2V9AA 1CEGA 3C4PA 4XT2B 2WYXA 3EGXC 1LL5A 3QP1A 2OAP1 5KSCA 3SH8A 4YOFA 4LCMA 2Q9NA 3S7OA 1STZA 2JC7A 2WKQA 2OV5A 4JGRA 1WA9A 3H82A 5FDHA 2PR5A 1G28A 3FC7A 1BTLA 4ZJ2A 4GDNA 2V1BA 3FZCA 4FOFA 5KIZA 2CMNA 2EWWA 4LFUA 3BM6A 5DJUA 2Y2OA 4DKIA 1GHPA 3HBRA 4PM7A 3UDFA 4DE1A 2WKIA 3BRMA 3OCNA 1CI9A 2XD5A 4Y7PA 3F1OA 1SDNA 1O07A 3W2ZA 1LL8A 3NCKA 1YMSA 3SH9A 3MQ0A 3MF0A 5HWVA 3OPHA 5CEDA 4QJGA 3WS2A 3CZDA 3IBJA 3N6IA 3HLDA 3LEZA 2I9VA 2PU2A 2WGWA 5EV0A 4EV4A 4Y13A 4CLCE 1SKOA 1TS6A 2E8JA 4OLDA 3T4QA 4MN5A 1FSYA 1SCWA 4FH4A 2IWBA 5HDDA 4HP9A 1OTDA 1SKFA 4PAUA 1YLPA 4E3OA 4Y0TA 1K57C 3OC2A 3HLFA 1ODVA 2J9PA 1S67L 2NUTC 2B18A 1PNEA 1XJ4A 3UE0A 5HWWA 5FI2A 5FATA 4BQMA 4I5SA 4K91A 1IELA 3UPPA 1PWDA 4E3KA 2K2NA 3G35A 4Y15A 3IWOA 1NRJA 4N92A 1KE4A 3I7JA 5L8MA 5FQKA 4HJ6A 1PYYA 4K08A 3JVVA 1VETB 4ME4A 4M3KA 1SKOB 3BY8A 3MMHA 4R4RA 4Y0UA 1XGJA 2B02A 3G30A 4E3JA 4S2LA 2DNSA 3P09A 1ZHHB 1TF1A 3ZHHA 2FFYA 4PKYG 5FAOA 3HLWA 3A3IA 4HHDA 4GKUA 2WAFA 5TBMB 1P97A 5TJJA 1N9NA 4OPZA 2Z6CA 4OOYA 4ZDXA 1DRMA 1NXYA 2B95A 3ZGAB 4EQIA 1L2SA 2G7UA 3OPLA 5AQ9A 2Y8HA 3BLSA 4WZ5A 3VP4A 3P7NA 3MQOA 5FSRA 2JCHA 4R23A 2VV6A 4OOMA 3K2NA 3HUNA 5M18A 3G4PA 3B42A 4LCLA 4UA7A 5FI7A 1O7EA 5FQMA 5HWTA 2ZM0A 1GA0A 3UMDA 5FQQA 2EA9A 4E04A 2V2FF 4Z9QA 2XH9A 4GW9A 4P6ZS 2XA7M 4CPKA 4UQIM 1WYBA 2MJ6A 4QY6A 4KUKA 4GLQA 3HJKA 2JKFA 3G2YA 3IS2B 4E6WA 3DTIA 1XKZA 3HLEA 3FPWA 4D60A 2BTFP 3LFVA 1UWNX 2ZC5B 5LBRA 3LIDA 1OT9A 1MWUA 2Z2MB 5EVIC 1J9MA 3HJIA 2QJ7A 3LI9A 3O86A 3KO6A 4UA9A 2V8CA 4KZ8A 3N4IA 5HD5A 4IHQA 4E3NA 2OOLA 5AVEA 2HPBA 4NG2A 4I3AA 1H8MA 3UB8A 1H5XA 3K3CA 4S2NC 5BOHA 3BQAA 2Y2NA 5EM1A 1NYMA 2WKRA 5F1FA 3GVBA 1ERMA 4S2OA 1XA1A 1JTDA 2DMWA 1I2SA 4KZAA 1GSVA 3IX3A 1W63Q 1PRQA 5DTSA 1ERQA 4EETB 1L0EA 4HNBA 1JNUA 3LUQA 5GLDA 4S2KA 3QHYA 3C8CA 1PW1A 2L0WA 3N8RA 3DBAA 1DJBA 1MKMA 2HJ9C 5E2HA 2O9AA 2IA2A 4OPRA 3E98A 2JHEA 3PAGA 4MCWA 3UY6A 2EWVA 3NOUC 3NOTC 1PWGA 4RVAA 3VV4A 4F94A 3LR0A 2G2WA 2JKGA 3T4SA 2IWDA 1NZOA 1T18A 1FOFA 4GS9B 3SS3A 3SH7A 1JTGA 5HDSA 3NI9A 3KSHA 1KOUA 1KE3A 3RH8B 4HIAA 2XD1A 4LLOB 2VK3A 2WZZA 3OPRA 3C7VA 4WZ4A 4I3IA 3QP4A 1GHMA 5F68A 5DTKA 3T50A 4NKPA 4JF6A 1TD5A 1UWPX 2DRWA 1BULA 3FKVA 4ARZA 3ZNTA 5DF7A 4K0WA 4KZ3A 1YQSA 3IH8A 3DTKA 3CITA 2NUPC 5A93A 1W8QA 4BBVA 3F1PB 1WE4A 4MN6A 4Y2FA 3PBRA 4LRZE 1ESIA 5EVIA 5FA7A 3A0SA 5DF8A 5FAQA 2EXBA 2Q9MA 3IXDA 3O88A 2A24A 2EFXA 4WL9A 3CG5A 3E4OA 2ZMFA 3CHWP 3B3XA 2J7VA 2AVXA 3KSFA 1VHMA 2V1AA 2QMIA 2XF3A 3Q1FA 4S2NA 4ARZB 1RP5A 3V50A 3UE6A 3A3FA 3PYPA 1NRFA 2R9WA 4BD1A 1K55C 2HDQA 4HQAA 4LV0A 4FUWA 4D2OA 4UAAA 4X56A 3ZG7B 3DWZA 4DJ2A 5EVIB 3WS5A 5E43A 5HL6A 2OLVA 4DXCA 1ES4A 4LV3A 3C4OA 5EECA 3RJUA 1K54C 3ZQ5A 2A24B 3ZDJA 4JGQA 3BY9A 5CXWA 3F1NB 4KUOA 3SS4A 1H0MA 4WUJA 3T1QB 2XQZA 5DKKA 2PYPA 3Q7ZA 4OQ0A 1GSWA 2PT7A 5HAIA 4R4SA 5KMWA 2XK1A 1G68A 4S2MA 4NK3A 3IXGA 3PAEA 3CJMA 4KG2A 4PMAA 1KGGA 4IUHA 2P04A 3S7NA 4ETXA 3CLOA 1E4DA 2JKRM 5CX7A 1VEUA 2ZBBA 2Y91A 3ZCZA 3BW6A 4LENA 3VE3A 4LPZA 2OAQ1 4ESPA 1FQGA 5FQ9A 4KQQA 4N1HA 2KOIA 1YSPA 2V20A 1IYOA 2W3HA 1BT5A 3BFCA 1XFQA 1GA9A 2WUQA 3TRCA 2PHYA 1N9OA 2QZ6A 3BEBA 4EBNA 2WGIA 1XFNA 4GJ4A 2C6WB 2VZWA 3UB6A 2KX6A 2H10A 3KSIA 2ZD8A
chains in the Genus database with same CATH topology
2OWHA 1F9IA 3OOVA 1NRJA 4WLAA 1EW0A 2QYBA 3BJNA 5L8MA 3U2AA 3A0VA 2INWA 2JN7A 4HJ6A 4MMNA 3EWKA 3S7QA 4K08A 3JVVA 4ME4A 4I39A 4EU0A 2XA7S 4UQIS 4NXFA 2WKPA 4OOLA 3BY8A 3MMHA 4GS9A 3K3DA 2W27A 3B47A 1V9ZA 5HPFA 2B02A 3CAXA 1W63M 4L9GA 5DF9A 1ZHHB 1TF1A 5DFXA 5HSQA 4M4XA 4GCZA 4HOIA 4NXEA 4PKYG 4RQ9A 2P7JA 3ICYA 3R4KA 1IOUA 3P01A 4HHDA 4B93A 3GDIA 5TBMB 1P97A 5TJJA 1N9NA 2Z6CA 2PR6A 2K7SA 3FPVA 2W1TA 2GJ3A 3R7WB 1DRMA 3LIFA 2ZMVA 4Y3IA 3OLOA 2GZAA 3PBSA 2M1CA 3UE3A 5DFYA 1S4RA 2VJWA 1VB6A 3OCLA 3PBQA 5MC7A 3NJAA 4GHIA 2G7UA 1TS7A 2Y8HA 4ZRRA 5HPIA 4EW7A 5IT5A 1BYWA 3P7NA 3C30A 1S1ZA 3MQOA 2XSSA 1S1YA 1XJ6A 2L1MA 3CUEA 3KYQA 2W3EA 2VV6A 1XJ3A 4II7A 4OOMA 4PKYA 4WELA 1IFQA 2A2LA 3K2NA 4CLCD 1S4SA 3B42A 4BBTA 2GX5A 3ULFA 2P08A 4NXBA 1MC0A 5HWTA 3O5YA 3F1PA 4WN5A 3UMDA 2EA9A 4E04A 5F5YA 4GW9A 4P6ZS 2V0UA 2YKHA 2XA7M 4KQDA 4UQIM 2VA0A 1LSVA 2MJ6A 5J4EA 1OTIA 2W1TB 1ZTUA 2Y79A 4KUKA 3H82B 4GLQA 4LRXC 3T4JA 2W3FA 4DJ3A 3HJKA 3PBTA 3H9WA 2QWSA 2PYRA 3PHYA 3IS2B 3EEHA 4GHIB 3LI8A 2JKRI 3FPWA 3LIEA 3VOLA 3LFVA 1OJGA 1UWNX 5EFWA 4ETZA 2BASA 5LBRA 3A0RA 3LIDA 1OT9A 5A8BA 3HJIA 2QJ7A 3LI9A 4B9OA 3KO6A 3T4KA 1NLZA 3OBFA 1H3QA 4HJ4A 4R3AA 4EERA 4EEUA 1YSQA 1F98A 1D7EA 5HD5A 2FZ0A 3F1OB 4IHQA 2OOLA 5AVEA 2HV1A 2HJEA 3EQUA 3E4QA 4WEJA 4I3AA 1H8MA 3UB8A 4O8GA 4EESA 2GNXA 3D72A 3K3CA 4UEYA 1DP9A 3LR4A 3BQAA 3EQVA 3FG8A 5F6AA 3UMEA 4HY8A 2WKRA 2V0WA 3H7WA 1V9YA 3F1NA 2VKSA 3RTYA 2DMWA 1GSVA 3CI6A 3UB9A 4P6ZM 3MR0A 3PBOA 1W63Q 2QHKA 1P0ZA 3LIBA 4EETB 2PD7A 3IBRA 4PHTA 4HNBA 5DJTA 1JNUA 1N9LA 3LUQA 4JGOA 2VLGA 3PXPA 3UB7A 2KLIA 5HD3A 5IU1A 3C8CA 4Y5FA 4HP4A 3EOIA 2L0WA 4DMZA 1DP6A 1P9RA 3DBAA 1OTEA 1MKMA 2HJ9C 1T19A 4Q0JA 2O9AA 2IA2A 3E98A 2JHEA 3LIAA 4MCWA 2EWVA 1OT6A 3NOTC 3NOUC 5HZHA 3S7PA 3LR3A 4HH3A 3VV4A 3LR0A 2VGLS 2QJ5A 4NXGA 4O01A 3T4SA 4O0PA 2XROA 2FH5A 4YNRA 1T18A 3VE4A 2M7VA 4Q0HA 2JKTM 2W3DA 2M7UA 4R70A 3H7WB 4GS9B 3NHQA 1G6OA 1S66L 3KSGA 4YWZA 2KDKA 5HDSA 2O9CA 3KSHA 1KOUA 3RH8B 4HIAA 2OWJA 2YKFA 1Y28A 4LLOB 5K5BA 4G3WA 4R38A 4CLCC 2W0NA 2QKPA 2JKTI 2VV7A 2XRNA 1D06A 4I3IA 2ZOIA 4DN0A 5F68A 3NOPC 2Z6DA 2VEAA 4NKPA 3T50A 1TD5A 3CWFA 5AJGA 1NLYA 4CLCA 1UWPX 2LB5A 2ZOHA 1XJ2A 4MN7A 3T4LA 1LSWA 4ARZA 3MJQA 1F5MA 4L0LA 4EXOA 2K31A 3E4PA 2J3TD 3TJZC 1OPXA 4CQHA 3CITA 1OTBA 2NUPC 3B33A 4BBVA 1TS0A 5AVFA 1DP8A 3T4TA 2VGLM 3F1PB 4FSFA 4MN6A 2J3TC 4Y2FA 3PBRA 3TE8A 1YKDA 4LRZE 4XT2A 5I5LA 3ZYTA 4G3KA 5TBMA 4KQOA 3A0SA 1NWZA 1TS8A 3C2WA 3MFXA 1MZUA 2W3GA 3R7WA 4NEED 2L4RA 3LYXA 4I3JA 2A24A 1UGUA 4WL9A 3E4OA 3SW1A 4LRYC 4EUVA 5G4ZA 2ZMFA 4CLCB 4EEPA 2R78A 5G4YA 3KSFA 1VHMA 3V67A 2V1AA 2O0YA 2HF6A 4G3VA 3EGDC 4WF0A 3RFBA 4IUKA 4ARZB 3BQ8A 4QPRA 3UE6A 2PD8A 3KX0X 4L9EA 3PBNA 1T1CA 2H28A 3PYPA 3EEAA 4HI4A 1GSXA 4HQAA 5F69A 5KSHA 4Z1WA 5DKLA 5J7EA 2O9BA 3JVUA 5HDCA 4EQ1A 2HGVA 1X0OA 4BMWA 4DJ2A 2V9AA 3PR6A 4XT2B 3KYZA 5HL6A 4BJPA 3EGXC 1OJ5A 2OAP1 4WEKA 3TW8A 4YOFA 3S7OA 1STZA 1P9WA 4F3LA 2J3WA 2WKQA 3CUEC 5FL3A 4JGRA 4HJ3A 3ZQ5A 2A24B 1WA9A 1T1BA 3H82A 2O99A 2PR5A 3MQQA 1G28A 3G6OA 4JGQA 3E0YA 3BY9A 3FC7A 3C38A 3F1NB 4KUOA 3HCYA 4WUJA 2V1BA 3IS2A 4FOFA 5KIZA 2CMNA 2J80A 2EWWA 5DKKA 2PYPA 4MDZA 4Q0IA 1GSWA 2PT7A 2W1RA 3GECA 4I38A 4H6JA 5DJUA 3LR5A 3LICA 2PDRA 3OCNA 4R6LA 1T1AA 4IUHA 3F1OA 2P04A 4IJGA 3S7NA 3W2ZA 1LL8A 4AFIA 3MXQA 5IS1A 3MQ0A 4ETXA 3MF0A 3CLOA 5CX7A 2JKRM 5HWVA 4JGPA 1YAXA 2ZBBA 4F3LB 3IBJA 3BW6A 2D02A 1LSXA 3VE3A 4LPZA 2I9VA 5J3WA 4CLCE 1TS6A 2OAQ1 3T4QA 4MN5A 5HDDA 4HP9A 1OTDA 2LB9A 5C5KA 2KOIA 4PAUA 1YSPA 2VX8A 4H6JB 3OC2A 2VV8A 1ODVA 2D01A 4L9FA 1S67L 2NUTC 2W3HA 2B18A 1XJ4A 1XFQA 3TRCA 2PHYA 1N9OA 5HWWA 3D3OA 3BWLA 4I5SA 1OTAA 1XFNA 4GJ4A 4HH2A 3UB6A 2VZWA 1LT0A 2KX6A 4BBUA 3KSIA 4BWIA 3T4OA 2K2NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OWH A;  1F9I A;  4WLA A;  1EW0 A;  3A0V A;  2INW A;  2JN7 A;  4HJ6 A;  3EWK A;  4K08 A;  4I39 A;  4NXF A;  2WKP A;  3BY8 A;  4GS9 A;  3K3D A;  2W27 A;  1V9Z A;  2B02 A;  3CAX A;  4L9G A;  5HSQ A;  4M4X A;  4GCZ A;  4HOI A;  4NXE A;  4PKY G;  4RQ9 A;  2P7J A;  3ICY A;  4HHD A;  3GDI A;  5TBM B;  1P97 A;  1N9N A;  2Z6C A;  2PR6 A;  2K7S A;  2GJ3 A;  1DRM A;  3LIF A;  3OLO A;  2M1C A;  1S4R A;  1VB6 A;  3NJA A;  4GHI A;  1TS7 A;  4EW7 A;  1BYW A;  3P7N A;  1S1Z A;  3MQO A;  1S1Y A;  1XJ6 A;  2L1M A;  2VV6 A;  1XJ3 A;  4PKY A;  1S4S A;  4BBT A;  3ULF A;  4NXB A;  5HWT A;  3F1P A;  4WN5 A;  3UMD A;  2EA9 A;  4E04 A;  5F5Y A;  4GW9 A;  2V0U A;  2YKH A;  4KQD A;  1LSV A;  5J4E A;  1OTI A;  4KUK A;  3H82 B;  4LRX C;  4DJ3 A;  3HJK A;  3H9W A;  2QWS A;  2PYR A;  3PHY A;  3IS2 B;  3EEH A;  4GHI B;  3LI8 A;  3LIE A;  3VOL A;  1OJG A;  1UWN X;  5EFW A;  2BAS A;  3A0R A;  3LID A;  1OT9 A;  5A8B A;  3HJI A;  2QJ7 A;  3LI9 A;  4B9O A;  4HJ4 A;  4R3A A;  4EER A;  4EEU A;  1F98 A;  1D7E A;  5HD5 A;  3F1O B;  2OOL A;  5AVE A;  2HV1 A;  3E4Q A;  4I3A A;  3UB8 A;  4EES A;  3D72 A;  3K3C A;  1DP9 A;  3FG8 A;  5F6A A;  3UME A;  4HY8 A;  2WKR A;  2V0W A;  3H7W A;  1V9Y A;  3F1N A;  3RTY A;  1GSV A;  3UB9 A;  3MR0 A;  2QHK A;  1P0Z A;  3LIB A;  4EET B;  2PD7 A;  3IBR A;  4HNB A;  5DJT A;  1JNU A;  1N9L A;  3LUQ A;  4JGO A;  2VLG A;  3UB7 A;  5HD3 A;  5IU1 A;  3C8C A;  4HP4 A;  2L0W A;  1DP6 A;  1OTE A;  1T19 A;  2JHE A;  3LIA A;  1OT6 A;  3NOT C;  3NOU C;  5HZH A;  4HH3 A;  2QJ5 A;  4NXG A;  1T18 A;  3VE4 A;  4R70 A;  3H7W B;  4GS9 B;  3NHQ A;  1S66 L;  4YWZ A;  2KDK A;  5HDS A;  1KOU A;  3RH8 B;  4HIA A;  2OWJ A;  2YKF A;  1Y28 A;  4LLO B;  4R38 A;  2W0N A;  2QKP A;  2VV7 A;  1D06 A;  4I3I A;  2ZOI A;  5F68 A;  3NOP C;  2Z6D A;  2VEA A;  3T50 A;  3CWF A;  1UWP X;  2ZOH A;  1XJ2 A;  1LSW A;  3MJQ A;  4EXO A;  3E4P A;  1OTB A;  3B33 A;  4BBV A;  1TS0 A;  5AVF A;  1DP8 A;  3F1P B;  4MN6 A;  4LRZ E;  4XT2 A;  5I5L A;  5TBM A;  3A0S A;  1NWZ A;  1TS8 A;  3C2W A;  3MFX A;  1MZU A;  2L4R A;  3LYX A;  4I3J A;  2A24 A;  1UGU A;  4WL9 A;  3E4O A;  3SW1 A;  4LRY C;  5G4Z A;  4EEP A;  2R78 A;  5G4Y A;  2V1A A;  4WF0 A;  3UE6 A;  2PD8 A;  3KX0 X;  4L9E A;  1T1C A;  2H28 A;  3PYP A;  4HI4 A;  1GSX A;  4HQA A;  5F69 A;  5DKL A;  5J7E A;  5HDC A;  4EQ1 A;  1X0O A;  4DJ2 A;  2V9A A;  4XT2 B;  1OJ5 A;  4F3L A;  2WKQ A;  4JGR A;  4HJ3 A;  3ZQ5 A;  2A24 B;  1WA9 A;  1T1B A;  3H82 A;  3MQQ A;  2PR5 A;  1G28 A;  3G6O A;  4JGQ A;  3BY9 A;  3FC7 A;  3F1N B;  4KUO A;  4WUJ A;  2V1B A;  3IS2 A;  5KIZ A;  2CMN A;  2J80 A;  5DKK A;  2PYP A;  1GSW A;  3GEC A;  4I38 A;  4H6J A;  5DJU A;  3LIC A;  2PDR A;  4R6L A;  1T1A A;  3F1O A;  1LL8 A;  3MXQ A;  5IS1 A;  5HWV A;  3CLO A;  4JGP A;  2ZBB A;  4F3L B;  2D02 A;  1LSX A;  3VE3 A;  4LPZ A;  2I9V A;  5J3W A;  1TS6 A;  4MN5 A;  5HDD A;  4HP9 A;  1OTD A;  4H6J B;  2VV8 A;  1ODV A;  2D01 A;  4L9F A;  1S67 L;  1XJ4 A;  1XFQ A;  2PHY A;  1N9O A;  5HWW A;  3BWL A;  4I5S A;  1OTA A;  1XFN A;  4HH2 A;  3UB6 A;  1LT0 A;  2KX6 A;  4BBU A; 
#chains in the Genus database with same CATH topology
 4O7D A;  4ZAM A;  1CQA A;  4MBF A;  4X68 A;  1YPR A;  3P98 A;  1VEU B;  3BJN A;  3OPP A;  2XFS A;  4MMN A;  4I39 A;  4Y17 A;  2XA7 S;  4N9K A;  4UQI S;  3A3J A;  4OOL A;  3B47 A;  4L9G A;  2PAV P;  5DFX A;  4NXE A;  3SOI A;  3T12 B;  4WZ5 C;  1XP4 A;  5EOO A;  2J9O A;  3ISG A;  1QME A;  3FPV A;  1K55 A;  2GJ3 A;  3R7W B;  3W8K A;  1YLY A;  4Y3I A;  3OLO A;  3PBS A;  2VJW A;  1VB6 A;  2PU4 A;  3OCL A;  5MC7 A;  3O3V A;  3Q82 A;  2HDU A;  2X01 A;  3C30 A;  2EFU A;  3G34 A;  4EWF A;  1KGF A;  1W8Y A;  2Y2M A;  2L1M A;  4KEN B;  5FEF A;  1YLT A;  1K54 A;  2W3E A;  1BLC A;  2V1Z A;  4PKY A;  3QP2 A;  4WMC A;  1F2K A;  4S2I A;  2A2L A;  1S4S A;  3LEQ A;  5F1G A;  2GX5 A;  3ULF A;  4PM8 A;  5L09 A;  1MC0 A;  3UPO A;  2FFF B;  3VP3 A;  3BFG A;  4LV2 A;  3QP6 A;  4JF5 A;  5F5Y A;  1K6S A;  3M2K A;  2YKH A;  4KQD A;  1LSV A;  2Y2K A;  2EXA A;  3H82 B;  3T4J A;  1G6A A;  3PBT A;  1LLB A;  2QWS A;  3H9W A;  5EVI D;  5F83 A;  1FSW A;  5HW3 A;  3LI8 A;  2JKR I;  3VOL A;  1FR1 A;  2BG1 A;  1OJG A;  2BAS A;  3A0R A;  3VOY A;  5A8B A;  3CMZ A;  4B9O A;  5HAQ A;  4FTX A;  1NLZ A;  4R3A A;  2H5S A;  4RX2 A;  2Y2G A;  3F1O B;  3HRE A;  3BFE A;  4OQG A;  1TVF A;  4ZBE A;  4MBK A;  3VP0 A;  5A92 A;  3LR4 A;  3EQV A;  4JPM A;  3MFD A;  5F6A A;  2A3U A;  2WGW B;  4S2J A;  1ES3 A;  3H7W A;  1V9Y A;  2ZJ9 A;  2XGN A;  3M2J A;  3CPT A;  1XXM A;  2WAD A;  4ZJ3 A;  3LIB A;  4PPR A;  5CGX A;  4OP5 A;  2PD7 A;  1N9L A;  2VLG A;  3UB7 A;  1IYP A;  2PRF A;  5HD3 A;  5IU1 A;  1K25 A;  2EX8 A;  2QPN A;  4QU3 A;  2A49 A;  3LIA A;  3HLC A;  5EOE A;  1OT6 A;  3BEC A;  4XUZ A;  4N9L A;  4IBX A;  2BLS A;  4NXG A;  4O01 A;  4UHU A;  4GOG A;  3IF5 A;  4C75 A;  3DAV A;  2XEP A;  3Q7V A;  2M7V A;  4DRT A;  2M7U A;  4R70 A;  3WRZ A;  3H7W B;  3NY4 A;  4C3Q A;  1S66 L;  4YWZ A;  3CPT B;  5HFO A;  2YKF A;  4JXS A;  4X6T A;  2XLN A;  3LGO A;  4G3W A;  3DW0 A;  3DTE A;  3MXR A;  2JKT I;  2VV7 A;  1JWP A;  2WZX A;  4MNR A;  4JF4 A;  1K56 D;  5FQI A;  5EVL A;  3CWF A;  4CLC A;  1K4E A;  3BFD A;  2ZOH A;  1NJ4 A;  1SHV A;  3T4L A;  1BSG A;  3WRT A;  5DVA A;  3E4P A;  1PZP A;  2UV0 E;  2Y55 A;  1I5Q A;  1MBL A;  1OTB A;  3A3D A;  3T4T A;  1MWS A;  2Y2P A;  1BLH A;  2J3T C;  3MS6 A;  5U47 A;  3TE8 A;  2X02 A;  3ZYT A;  4KZ5 A;  1NWZ A;  3MFX A;  2JE5 A;  5EE8 A;  3LY3 A;  3LYX A;  4NEE D;  3GTC A;  3RXX A;  4BD0 A;  1TDG A;  5G4Z A;  2ZQ9 A;  2HDR A;  5CHM A;  5AQA A;  4B4Z A;  4CLC B;  4EEP A;  1JVJ A;  3IT9 A;  2O0Y A;  2HF6 A;  1MPL A;  3S4X A;  3V5M A;  3BQ8 A;  4R1G A;  3PBN A;  1T1C A;  2H28 A;  5F69 A;  4IVK A;  4X55 A;  1CEF A;  1IYS A;  2ZM8 A;  4Z1W A;  5DKL A;  1XGI A;  5J7E A;  4E6X A;  2HGV A;  3D9Y A;  3PR6 A;  4GNU A;  1MWR A;  1HTZ A;  1OJ5 A;  4WEK A;  3TW8 A;  5JYP A;  1P9W A;  3V3S A;  2J3W A;  3CUE C;  3HUO A;  3HVF A;  3MQQ A;  3G6O A;  1DJA A;  4DF6 A;  3C38 A;  3HCY A;  1FIL A;  1I2W A;  4BL3 A;  2J80 A;  4B4X A;  2W1R A;  5M1A A;  4I38 A;  1XPB A;  4H6J A;  3GRJ A;  3LR5 A;  1S0W A;  4P85 A;  3WS4 A;  3LIC A;  4X1L A;  3ZNY A;  2PDR A;  4WYY A;  4P0M A;  4R6L A;  2Y2H A;  4FH2 A;  2HP5 A;  3MBZ A;  1FCN A;  4IJG A;  5DTT A;  1Z09 A;  3MXQ A;  5IS1 A;  1FCO A;  2ZQA A;  4JGP A;  3VMA A;  1MKI A;  1PI4 A;  4MLL A;  1LI0 A;  4EBP A;  3MKF A;  2D02 A;  1LSX A;  2WKE A;  2Z2L B;  4QY5 A;  5J3W A;  3S1Y A;  1GHI A;  3W4P A;  1K6R A;  3IXB A;  4KQR A;  4Q8I A;  1KDS A;  4U0T A;  5J8X A;  2LB9 A;  5C5K A;  2UWX A;  3FV7 A;  3UE1 A;  4B88 A;  2VX8 A;  4H6J B;  1E3U A;  3QP5 A;  4L9F A;  1ZG4 A;  2VGK A;  3QP8 A;  4U3T A;  1XX2 A;  3D3O A;  3NBL A;  2ZLY A;  4HH2 A;  4ID4 A;  1LT0 A;  4BWI A;  1NZU A;  5I94 A;  1F9I A;  4WLA A;  1EW0 A;  2QYB A;  1CF0 A;  3U2A A;  3A0V A;  2JN7 A;  4WM9 A;  1VM1 A;  5EPH A;  1K0K A;  4EU0 A;  3UNW A;  4NXF A;  4GD6 A;  1V9Z A;  5HPF A;  3CAX A;  1W63 M;  3MSH A;  4OVD A;  4GCZ A;  4HOI A;  3GMW A;  4B93 A;  1NYY A;  4KZ6 A;  2K7S A;  1WYC A;  5CHU A;  2W1T A;  2HDS A;  1HVB A;  1Q2P A;  2Y2J A;  4NET A;  2Y59 A;  1KE0 A;  1S4R A;  4RA7 A;  2EX2 A;  1TS7 A;  4ZRR A;  5HPI A;  4EW7 A;  3PTE A;  1XA7 A;  4DE0 A;  1S1Z A;  2XSS A;  1XJ6 A;  1S1Y A;  3CUE A;  3KYQ A;  5EUA A;  4PM9 A;  3IH9 A;  1XJ3 A;  4GB7 A;  1IFQ A;  5HAR A;  4CLC D;  5CRF A;  5GHY A;  4KZB A;  4FD8 A;  2P08 A;  4NXB A;  1MXO A;  4WN5 A;  3NC8 A;  3NUL A;  4XXR A;  3ZVT A;  2RCX A;  3AGE A;  4QWO A;  2VA0 A;  3GSG A;  5GLA A;  3MZD A;  4IBR A;  2W1T B;  1ZTU A;  4LRX C;  5L07 A;  4DJ3 A;  2GDN A;  3PHY A;  3Q81 A;  3GV9 A;  3U4L P;  1DY6 A;  3ZG9 B;  5AQ7 A;  1BZA A;  5EFW A;  1HLU P;  4JXG A;  2RL3 A;  1YT4 A;  3OBF A;  1H3Q A;  3UN7 A;  4HJ4 A;  1L0D A;  2JBF A;  4EER A;  4EEU A;  1YSQ A;  1D7E A;  3NEC A;  3D4F A;  3FWL A;  2HZ5 A;  4WEJ A;  2CC1 A;  3E4Q A;  3EQU A;  1ALQ A;  3IX4 A;  3IF6 C;  1TEM A;  4E3M A;  4PM5 A;  4YFM A;  2GNX A;  4UEY A;  1DP9 A;  3UDI A;  3FG8 A;  4KG6 A;  1TDL A;  4GD8 A;  5GLB A;  4XUX A;  2PBY A;  2PBD P;  2OSU A;  4EUZ A;  3RTY A;  2VKS A;  1S6R A;  4GDB A;  4MEZ A;  3UB9 A;  3MR0 A;  3PBO A;  3VFF A;  3VP1 A;  4OQI A;  1FCM A;  1ACF A;  1MWT A;  4PHT A;  3PXP A;  2KLI A;  4WBG A;  4Y5F A;  3N8L A;  4HP4 A;  4DMZ A;  2XFT A;  1OTE A;  4JXW A;  3SS5 A;  5HL1 A;  5GLC A;  3S7P A;  4HH3 A;  2QJ5 A;  3QNC A;  3IHA A;  4X1M A;  1L0G A;  1W79 A;  3UO9 A;  1ERO A;  4Q0H A;  3DWK A;  3ZFZ A;  2JKT M;  5L10 A;  3KSG A;  1HD8 A;  2KDK A;  2O9C A;  1Y28 A;  2Y4A A;  3M6H A;  4KZ9 A;  5CEB A;  5IHV A;  1Y54 A;  4CLC C;  3W4O A;  2ZC3 B;  4QHC A;  1C3B A;  1D06 A;  1E3U D;  2XR0 A;  3NOP C;  2EX9 A;  2Z6D A;  2VEA A;  4EBL A;  5CEC A;  5AJG A;  4DE3 A;  1NLY A;  2LB5 A;  3ZG5 A;  5CTM A;  4MN7 A;  1YLW A;  3MJQ A;  1F5M A;  3IWI A;  1G5U A;  2K31 A;  1DJC A;  2J3T D;  1VET A;  2Q0O A;  3QNB A;  4JLF A;  1L3L A;  3B33 A;  3MXS A;  1TS0 A;  5AVF A;  1DP8 A;  3E2K A;  2VGL M;  5FI6 A;  5FQJ A;  4R3B A;  1YKD A;  3AGD A;  4G3K A;  5TBM A;  1SDE A;  1QMF A;  1ES2 A;  1MZU A;  2L4R A;  1ESU A;  3SW1 A;  4LRY C;  4EUV A;  1PZO A;  3DTM A;  3WS1 A;  2R78 A;  3IF6 A;  2ZQD A;  3MZE A;  1LI9 A;  1VQQ A;  3EGD C;  2B5R A;  4WF0 A;  4IUK A;  3RFB A;  4QPR A;  3KX0 X;  5KZH A;  4L9E A;  4LV1 A;  4JBF A;  1JWZ A;  1GSX A;  4BLM A;  4BEN A;  1A0K A;  2HP6 A;  1KDW A;  3VOZ A;  4UA6 A;  2O9B A;  3JVU A;  2Y2I A;  5HDC A;  3ZG0 A;  1MY8 A;  1KVM A;  4BMW A;  1D1J A;  1E25 A;  3KYZ A;  4BJP A;  2WKH A;  5GHX A;  3T1S A;  3IWQ A;  4GZB A;  3ITB A;  1Y4O A;  4F3L A;  5HAP A;  4FCF A;  5FL3 A;  3MKE A;  4E3I A;  4HJ3 A;  1BLS A;  1T1B A;  1FR6 A;  2O99 A;  1AXB A;  3E0Y A;  1BUE A;  4DXB A;  3V39 A;  3IS2 A;  3IF6 B;  4IED A;  1H8Y A;  2P9V A;  4MDZ A;  4Q0I A;  5D3O A;  4P87 A;  5HX9 A;  4LGW A;  3GEC A;  3O87 A;  3Q07 A;  1RCJ A;  1K38 A;  4JKT A;  4RX3 A;  1T1A A;  2ZMA A;  5F82 A;  4AFI A;  2H0Y A;  3TSG A;  1GCE A;  1ES5 A;  1YAX A;  2HP9 A;  3G31 A;  4F3L B;  3T1R A;  3WS0 A;  5CHJ A;  3Q7V B;  4DE2 A;  1ONH A;  2Y2Q A;  3AGF A;  4KZ7 A;  4BL2 A;  3L7H A;  4DDY A;  5GL9 A;  1AWI A;  2P9V B;  3BFF A;  4R3J A;  1YLJ A;  2VV8 A;  2D01 A;  4A5R A;  3A3E A;  1NY0 A;  1YMX A;  3E2L A;  3BWL A;  1OTA A;  5CTN A;  4BBU A;  3GQZ A;  1K57 A;  1KVL A;  3T4O A;  3IX8 A;  2OWH A;  3OOV A;  4OPY A;  1J3W A;  1YLZ A;  2INW A;  3ZG8 B;  3EWK A;  4OP8 A;  5TGF A;  3S7Q A;  4ZTK A;  4X25 A;  3M6B A;  1FIK A;  3RXW A;  4HES A;  2WKP A;  5G18 A;  4GS9 A;  2Y2L A;  3K3D A;  2W27 A;  4ZJ1 A;  4DDS A;  3W4Q A;  5M19 A;  5DF9 A;  1PFL A;  1EI5 A;  5HSQ A;  4M4X A;  2IWC A;  4RQ9 A;  4WMC D;  4X69 A;  2P7J A;  3ICY A;  3R4K A;  1IOU A;  3P01 A;  4QD4 A;  3GDI A;  3N7W A;  2PR6 A;  4HEF A;  3IXH A;  1IYQ A;  5FAS A;  3LIF A;  2ZMV A;  2X71 A;  2GZA A;  2M1C A;  3UE3 A;  5DFY A;  2ZC6 B;  3PBQ A;  3NJA A;  3C7U A;  4GHI A;  3WWX A;  2DCF A;  5IT5 A;  1BYW A;  2ZQ7 A;  5L2F A;  3FYZ A;  5GHZ A;  2I72 A;  1YM1 A;  4II7 A;  4WEL A;  2ZL1 A;  4BBT A;  1IEM A;  3NDG A;  3O5Y A;  3F1P A;  1PW8 A;  1PWC A;  2P74 A;  3BLM A;  5FDS A;  1PIO A;  2V0U A;  1SZV A;  5J4E A;  1OTI A;  2Y79 A;  3IQA A;  3C5A A;  2W3F A;  3NDE A;  2PYR A;  3HUM A;  3OZH A;  3EEH A;  4CJN A;  4GHI B;  1ZKJ A;  4R0Q A;  1IKI A;  3VFH A;  3HL9 A;  1IKG A;  1EWZ A;  3L9K A;  3LIE A;  4ETZ A;  4QB8 A;  5FEG A;  4YIN A;  1ZG6 A;  3T4K A;  1U60 A;  3SZT A;  2ZL1 B;  1LL9 A;  3KYE A;  1BLP A;  1F98 A;  4X53 A;  5CGS A;  5CGW A;  2FZ0 A;  4N1X A;  4K0X A;  4OKP A;  1W5D A;  2HV1 A;  2HJE A;  4O8G A;  4EES A;  3VSK A;  3D72 A;  4HBU A;  2G2U A;  3ZVW A;  3G32 A;  2ZM2 A;  2ZC7 A;  3S22 A;  3UME A;  5A91 A;  1RGZ A;  4HY8 A;  2V0W A;  1Z6F A;  3F1N A;  3GR2 A;  2H0T A;  3CI6 A;  4P6Z M;  4KG5 A;  5EM0 A;  2VGJ A;  2QHK A;  3UDX A;  2ZQ8 A;  4Y0O A;  1HZO A;  1P0Z A;  2ZC4 B;  3IBR A;  4OON A;  3N8S A;  5DJT A;  4JGO A;  3ITA A;  3UB5 P;  4H8R A;  4RYE A;  5AQB A;  3UPN A;  3EOI A;  3TOI A;  1DP6 A;  1P9R A;  3JPU A;  3MZF A;  4Q0J A;  1T19 A;  5JYO A;  1M6K A;  3V3R A;  3TG9 A;  5CER A;  5HZH A;  3LR3 A;  2WK0 A;  2VGL S;  1JWV A;  5FAP A;  4OPQ A;  4O0P A;  2XRO A;  2FH5 A;  4YNR A;  3VE4 A;  2WAE A;  4IVI A;  1KGE A;  2W3D A;  3NHQ A;  1G6O A;  2E8I A;  2OWJ A;  4U0X A;  4OH0 A;  1ZC2 A;  2ZQC A;  5K5B A;  2XDM A;  4R38 A;  2V8F A;  2ACG A;  2W0N A;  5A90 A;  1LHY A;  2QKP A;  1CI8 A;  3LY4 A;  3NIA A;  2XRN A;  4E3L A;  3HLG A;  2ZOI A;  4DN0 A;  3JYI A;  1ONG A;  3IHB A;  1L0F A;  4HBT A;  1XJ2 A;  1LSW A;  3VSL A;  4L0L A;  4EXO A;  3TJZ C;  2C5W B;  2J8Y A;  1OPX A;  4CQH A;  1OME A;  5E2E A;  4S2P A;  2R9X A;  1W7F A;  2WGV A;  5E2F A;  4FSF A;  5TR7 A;  4PM6 A;  4P6B A;  3LCE A;  1N9B A;  1K56 A;  4XT2 A;  5I5L A;  4KZ4 A;  4KQO A;  1Q2Q A;  1TS8 A;  3C2W A;  3FKW A;  1N4O A;  2W3G A;  3R7W A;  3LO7 A;  4I3J A;  1UGU A;  4C6Y A;  5TFQ A;  5G4Y A;  1RGY A;  3G2Z A;  3V67 A;  1M40 A;  4G3V A;  5EVE A;  2PD8 A;  1H8Z A;  3VP2 A;  5E2G A;  2EX6 A;  4GN2 A;  3T1X A;  1CK3 A;  3EEA A;  4HI4 A;  2OLU A;  4OLG A;  1CJF A;  5KSH A;  1K4F A;  4OQH A;  1PI5 A;  4JXV A;  4EQ1 A;  1X0O A;  3BYD A;  4MBH A;  3HLB A;  2V9A A;  1CEG A;  3C4P A;  4XT2 B;  2WYX A;  3EGX C;  1LL5 A;  3QP1 A;  2OAP 1;  5KSC A;  3SH8 A;  4YOF A;  4LCM A;  2Q9N A;  3S7O A;  1STZ A;  2JC7 A;  2WKQ A;  2OV5 A;  4JGR A;  1WA9 A;  3H82 A;  5FDH A;  2PR5 A;  1G28 A;  3FC7 A;  1BTL A;  4ZJ2 A;  4GDN A;  2V1B A;  3FZC A;  4FOF A;  5KIZ A;  2CMN A;  2EWW A;  4LFU A;  3BM6 A;  5DJU A;  2Y2O A;  4DKI A;  1GHP A;  3HBR A;  4PM7 A;  3UDF A;  4DE1 A;  2WKI A;  3BRM A;  3OCN A;  1CI9 A;  2XD5 A;  4Y7P A;  3F1O A;  1SDN A;  1O07 A;  3W2Z A;  1LL8 A;  3NCK A;  1YMS A;  3SH9 A;  3MQ0 A;  3MF0 A;  5HWV A;  3OPH A;  5CED A;  4QJG A;  3WS2 A;  3CZD A;  3IBJ A;  3N6I A;  3HLD A;  3LEZ A;  2I9V A;  2PU2 A;  2WGW A;  5EV0 A;  4EV4 A;  4Y13 A;  4CLC E;  1SKO A;  1TS6 A;  2E8J A;  4OLD A;  3T4Q A;  4MN5 A;  1FSY A;  1SCW A;  4FH4 A;  2IWB A;  5HDD A;  4HP9 A;  1OTD A;  1SKF A;  4PAU A;  1YLP A;  4E3O A;  4Y0T A;  1K57 C;  3OC2 A;  3HLF A;  1ODV A;  2J9P A;  1S67 L;  2NUT C;  2B18 A;  1PNE A;  1XJ4 A;  3UE0 A;  5HWW A;  5FI2 A;  5FAT A;  4BQM A;  4I5S A;  4K91 A;  1IEL A;  3UPP A;  1PWD A;  4E3K A;  2K2N A;  3G35 A;  4Y15 A;  3IWO A;  1NRJ A;  4N92 A;  1KE4 A;  3I7J A;  5L8M A;  5FQK A;  4HJ6 A;  1PYY A;  4K08 A;  3JVV A;  1VET B;  4ME4 A;  4M3K A;  1SKO B;  3BY8 A;  3MMH A;  4R4R A;  4Y0U A;  1XGJ A;  2B02 A;  3G30 A;  4E3J A;  4S2L A;  2DNS A;  3P09 A;  1ZHH B;  1TF1 A;  3ZHH A;  2FFY A;  4PKY G;  5FAO A;  3HLW A;  3A3I A;  4HHD A;  4GKU A;  2WAF A;  5TBM B;  1P97 A;  5TJJ A;  1N9N A;  4OPZ A;  2Z6C A;  4OOY A;  4ZDX A;  1DRM A;  1NXY A;  2B95 A;  3ZGA B;  4EQI A;  1L2S A;  2G7U A;  3OPL A;  5AQ9 A;  2Y8H A;  3BLS A;  4WZ5 A;  3VP4 A;  3P7N A;  3MQO A;  5FSR A;  2JCH A;  4R23 A;  2VV6 A;  4OOM A;  3K2N A;  3HUN A;  5M18 A;  3G4P A;  3B42 A;  4LCL A;  4UA7 A;  5FI7 A;  1O7E A;  5FQM A;  5HWT A;  2ZM0 A;  1GA0 A;  3UMD A;  5FQQ A;  2EA9 A;  4E04 A;  2V2F F;  4Z9Q A;  2XH9 A;  4GW9 A;  4P6Z S;  2XA7 M;  4CPK A;  4UQI M;  1WYB A;  2MJ6 A;  4QY6 A;  4KUK A;  4GLQ A;  3HJK A;  2JKF A;  3G2Y A;  3IS2 B;  4E6W A;  3DTI A;  1XKZ A;  3HLE A;  3FPW A;  4D60 A;  2BTF P;  3LFV A;  1UWN X;  2ZC5 B;  5LBR A;  3LID A;  1OT9 A;  1MWU A;  2Z2M B;  5EVI C;  1J9M A;  3HJI A;  2QJ7 A;  3LI9 A;  3O86 A;  3KO6 A;  4UA9 A;  2V8C A;  4KZ8 A;  3N4I A;  5HD5 A;  4IHQ A;  4E3N A;  2OOL A;  5AVE A;  2HPB A;  4NG2 A;  4I3A A;  1H8M A;  3UB8 A;  1H5X A;  3K3C A;  4S2N C;  5BOH A;  3BQA A;  2Y2N A;  5EM1 A;  1NYM A;  2WKR A;  5F1F A;  3GVB A;  1ERM A;  4S2O A;  1XA1 A;  1JTD A;  2DMW A;  1I2S A;  4KZA A;  1GSV A;  3IX3 A;  1W63 Q;  1PRQ A;  5DTS A;  1ERQ A;  4EET B;  1L0E A;  4HNB A;  1JNU A;  3LUQ A;  5GLD A;  4S2K A;  3QHY A;  3C8C A;  1PW1 A;  2L0W A;  3N8R A;  3DBA A;  1DJB A;  1MKM A;  2HJ9 C;  5E2H A;  2O9A A;  2IA2 A;  4OPR A;  3E98 A;  2JHE A;  3PAG A;  4MCW A;  3UY6 A;  2EWV A;  3NOU C;  3NOT C;  1PWG A;  4RVA A;  3VV4 A;  4F94 A;  3LR0 A;  2G2W A;  2JKG A;  3T4S A;  2IWD A;  1NZO A;  1T18 A;  1FOF A;  4GS9 B;  3SS3 A;  3SH7 A;  1JTG A;  5HDS A;  3NI9 A;  3KSH A;  1KOU A;  1KE3 A;  3RH8 B;  4HIA A;  2XD1 A;  4LLO B;  2VK3 A;  2WZZ A;  3OPR A;  3C7V A;  4WZ4 A;  4I3I A;  3QP4 A;  1GHM A;  5F68 A;  5DTK A;  3T50 A;  4NKP A;  4JF6 A;  1TD5 A;  1UWP X;  2DRW A;  1BUL A;  3FKV A;  4ARZ A;  3ZNT A;  5DF7 A;  4K0W A;  4KZ3 A;  1YQS A;  3IH8 A;  3DTK A;  3CIT A;  2NUP C;  5A93 A;  1W8Q A;  4BBV A;  3F1P B;  1WE4 A;  4MN6 A;  4Y2F A;  3PBR A;  4LRZ E;  1ESI A;  5EVI A;  5FA7 A;  3A0S A;  5DF8 A;  5FAQ A;  2EXB A;  2Q9M A;  3IXD A;  3O88 A;  2A24 A;  2EFX A;  4WL9 A;  3CG5 A;  3E4O A;  2ZMF A;  3CHW P;  3B3X A;  2J7V A;  2AVX A;  3KSF A;  1VHM A;  2V1A A;  2QMI A;  2XF3 A;  3Q1F A;  4S2N A;  4ARZ B;  1RP5 A;  3V50 A;  3UE6 A;  3A3F A;  3PYP A;  1NRF A;  2R9W A;  4BD1 A;  1K55 C;  2HDQ A;  4HQA A;  4LV0 A;  4FUW A;  4D2O A;  4UAA A;  4X56 A;  3ZG7 B;  3DWZ A;  4DJ2 A;  5EVI B;  3WS5 A;  5E43 A;  5HL6 A;  2OLV A;  4DXC A;  1ES4 A;  4LV3 A;  3C4O A;  5EEC A;  3RJU A;  1K54 C;  3ZQ5 A;  2A24 B;  3ZDJ A;  4JGQ A;  3BY9 A;  5CXW A;  3F1N B;  4KUO A;  3SS4 A;  1H0M A;  4WUJ A;  3T1Q B;  2XQZ A;  5DKK A;  2PYP A;  3Q7Z A;  4OQ0 A;  1GSW A;  2PT7 A;  5HAI A;  4R4S A;  5KMW A;  2XK1 A;  1G68 A;  4S2M A;  4NK3 A;  3IXG A;  3PAE A;  3CJM A;  4KG2 A;  4PMA A;  1KGG A;  4IUH A;  2P04 A;  3S7N A;  4ETX A;  3CLO A;  1E4D A;  2JKR M;  5CX7 A;  1VEU A;  2ZBB A;  2Y91 A;  3ZCZ A;  3BW6 A;  4LEN A;  3VE3 A;  4LPZ A;  2OAQ 1;  4ESP A;  1FQG A;  5FQ9 A;  4KQQ A;  4N1H A;  2KOI A;  1YSP A;  2V20 A;  1IYO A;  2W3H A;  1BT5 A;  3BFC A;  1XFQ A;  1GA9 A;  2WUQ A;  3TRC A;  2PHY A;  1N9O A;  2QZ6 A;  3BEB A;  4EBN A;  2WGI A;  1XFN A;  4GJ4 A;  2C6W B;  2VZW A;  3UB6 A;  2KX6 A;  2H10 A;  3KSI A;  2ZD8 A; 
#chains in the Genus database with same CATH homology
 2OWH A;  1F9I A;  3OOV A;  1NRJ A;  4WLA A;  1EW0 A;  2QYB A;  3BJN A;  5L8M A;  3U2A A;  3A0V A;  2INW A;  2JN7 A;  4HJ6 A;  4MMN A;  3EWK A;  3S7Q A;  4K08 A;  3JVV A;  4ME4 A;  4I39 A;  4EU0 A;  2XA7 S;  4UQI S;  4NXF A;  2WKP A;  4OOL A;  3BY8 A;  3MMH A;  4GS9 A;  3K3D A;  2W27 A;  3B47 A;  1V9Z A;  5HPF A;  2B02 A;  3CAX A;  1W63 M;  4L9G A;  5DF9 A;  1ZHH B;  1TF1 A;  5DFX A;  5HSQ A;  4M4X A;  4GCZ A;  4HOI A;  4NXE A;  4PKY G;  4RQ9 A;  2P7J A;  3ICY A;  3R4K A;  1IOU A;  3P01 A;  4HHD A;  4B93 A;  3GDI A;  5TBM B;  1P97 A;  5TJJ A;  1N9N A;  2Z6C A;  2PR6 A;  2K7S A;  3FPV A;  2W1T A;  2GJ3 A;  3R7W B;  1DRM A;  3LIF A;  2ZMV A;  4Y3I A;  3OLO A;  2GZA A;  3PBS A;  2M1C A;  3UE3 A;  5DFY A;  1S4R A;  2VJW A;  1VB6 A;  3OCL A;  3PBQ A;  5MC7 A;  3NJA A;  4GHI A;  2G7U A;  1TS7 A;  2Y8H A;  4ZRR A;  5HPI A;  4EW7 A;  5IT5 A;  1BYW A;  3P7N A;  3C30 A;  1S1Z A;  3MQO A;  2XSS A;  1S1Y A;  1XJ6 A;  2L1M A;  3CUE A;  3KYQ A;  2W3E A;  2VV6 A;  1XJ3 A;  4II7 A;  4OOM A;  4PKY A;  4WEL A;  1IFQ A;  2A2L A;  3K2N A;  4CLC D;  1S4S A;  3B42 A;  4BBT A;  2GX5 A;  3ULF A;  2P08 A;  4NXB A;  1MC0 A;  5HWT A;  3O5Y A;  3F1P A;  4WN5 A;  3UMD A;  2EA9 A;  4E04 A;  5F5Y A;  4GW9 A;  4P6Z S;  2V0U A;  2YKH A;  2XA7 M;  4KQD A;  4UQI M;  2VA0 A;  1LSV A;  2MJ6 A;  5J4E A;  1OTI A;  2W1T B;  1ZTU A;  2Y79 A;  4KUK A;  3H82 B;  4GLQ A;  4LRX C;  3T4J A;  2W3F A;  4DJ3 A;  3HJK A;  3PBT A;  3H9W A;  2QWS A;  2PYR A;  3PHY A;  3IS2 B;  3EEH A;  4GHI B;  3LI8 A;  2JKR I;  3FPW A;  3LIE A;  3VOL A;  3LFV A;  1OJG A;  1UWN X;  5EFW A;  4ETZ A;  2BAS A;  5LBR A;  3A0R A;  3LID A;  1OT9 A;  5A8B A;  3HJI A;  2QJ7 A;  3LI9 A;  4B9O A;  3KO6 A;  3T4K A;  1NLZ A;  3OBF A;  1H3Q A;  4HJ4 A;  4R3A A;  4EER A;  4EEU A;  1YSQ A;  1F98 A;  1D7E A;  5HD5 A;  2FZ0 A;  3F1O B;  4IHQ A;  2OOL A;  5AVE A;  2HV1 A;  2HJE A;  3EQU A;  3E4Q A;  4WEJ A;  4I3A A;  1H8M A;  3UB8 A;  4O8G A;  4EES A;  2GNX A;  3D72 A;  3K3C A;  4UEY A;  1DP9 A;  3LR4 A;  3BQA A;  3EQV A;  3FG8 A;  5F6A A;  3UME A;  4HY8 A;  2WKR A;  2V0W A;  3H7W A;  1V9Y A;  3F1N A;  2VKS A;  3RTY A;  2DMW A;  1GSV A;  3CI6 A;  3UB9 A;  4P6Z M;  3MR0 A;  3PBO A;  1W63 Q;  2QHK A;  1P0Z A;  3LIB A;  4EET B;  2PD7 A;  3IBR A;  4PHT A;  4HNB A;  5DJT A;  1JNU A;  1N9L A;  3LUQ A;  4JGO A;  2VLG A;  3PXP A;  3UB7 A;  2KLI A;  5HD3 A;  5IU1 A;  3C8C A;  4Y5F A;  4HP4 A;  3EOI A;  2L0W A;  4DMZ A;  1DP6 A;  1P9R A;  3DBA A;  1OTE A;  1MKM A;  2HJ9 C;  1T19 A;  4Q0J A;  2O9A A;  2IA2 A;  3E98 A;  2JHE A;  3LIA A;  4MCW A;  2EWV A;  1OT6 A;  3NOT C;  3NOU C;  5HZH A;  3S7P A;  3LR3 A;  4HH3 A;  3VV4 A;  3LR0 A;  2VGL S;  2QJ5 A;  4NXG A;  4O01 A;  3T4S A;  4O0P A;  2XRO A;  2FH5 A;  4YNR A;  1T18 A;  3VE4 A;  2M7V A;  4Q0H A;  2JKT M;  2W3D A;  2M7U A;  4R70 A;  3H7W B;  4GS9 B;  3NHQ A;  1G6O A;  1S66 L;  3KSG A;  4YWZ A;  2KDK A;  5HDS A;  2O9C A;  3KSH A;  1KOU A;  3RH8 B;  4HIA A;  2OWJ A;  2YKF A;  1Y28 A;  4LLO B;  5K5B A;  4G3W A;  4R38 A;  4CLC C;  2W0N A;  2QKP A;  2JKT I;  2VV7 A;  2XRN A;  1D06 A;  4I3I A;  2ZOI A;  4DN0 A;  5F68 A;  3NOP C;  2Z6D A;  2VEA A;  4NKP A;  3T50 A;  1TD5 A;  3CWF A;  5AJG A;  1NLY A;  4CLC A;  1UWP X;  2LB5 A;  2ZOH A;  1XJ2 A;  4MN7 A;  3T4L A;  1LSW A;  4ARZ A;  3MJQ A;  1F5M A;  4L0L A;  4EXO A;  2K31 A;  3E4P A;  2J3T D;  3TJZ C;  1OPX A;  4CQH A;  3CIT A;  1OTB A;  2NUP C;  3B33 A;  4BBV A;  1TS0 A;  5AVF A;  1DP8 A;  3T4T A;  2VGL M;  3F1P B;  4FSF A;  4MN6 A;  2J3T C;  4Y2F A;  3PBR A;  3TE8 A;  1YKD A;  4LRZ E;  4XT2 A;  5I5L A;  3ZYT A;  4G3K A;  5TBM A;  4KQO A;  3A0S A;  1NWZ A;  1TS8 A;  3C2W A;  3MFX A;  1MZU A;  2W3G A;  3R7W A;  4NEE D;  2L4R A;  3LYX A;  4I3J A;  2A24 A;  1UGU A;  4WL9 A;  3E4O A;  3SW1 A;  4LRY C;  4EUV A;  5G4Z A;  2ZMF A;  4CLC B;  4EEP A;  2R78 A;  5G4Y A;  3KSF A;  1VHM A;  3V67 A;  2V1A A;  2O0Y A;  2HF6 A;  4G3V A;  3EGD C;  4WF0 A;  3RFB A;  4IUK A;  4ARZ B;  3BQ8 A;  4QPR A;  3UE6 A;  2PD8 A;  3KX0 X;  4L9E A;  3PBN A;  1T1C A;  2H28 A;  3PYP A;  3EEA A;  4HI4 A;  1GSX A;  4HQA A;  5F69 A;  5KSH A;  4Z1W A;  5DKL A;  5J7E A;  2O9B A;  3JVU A;  5HDC A;  4EQ1 A;  2HGV A;  1X0O A;  4BMW A;  4DJ2 A;  2V9A A;  3PR6 A;  4XT2 B;  3KYZ A;  5HL6 A;  4BJP A;  3EGX C;  1OJ5 A;  2OAP 1;  4WEK A;  3TW8 A;  4YOF A;  3S7O A;  1STZ A;  1P9W A;  4F3L A;  2J3W A;  2WKQ A;  3CUE C;  5FL3 A;  4JGR A;  4HJ3 A;  3ZQ5 A;  2A24 B;  1WA9 A;  1T1B A;  3H82 A;  2O99 A;  2PR5 A;  3MQQ A;  1G28 A;  3G6O A;  4JGQ A;  3E0Y A;  3BY9 A;  3FC7 A;  3C38 A;  3F1N B;  4KUO A;  3HCY A;  4WUJ A;  2V1B A;  3IS2 A;  4FOF A;  5KIZ A;  2CMN A;  2J80 A;  2EWW A;  5DKK A;  2PYP A;  4MDZ A;  4Q0I A;  1GSW A;  2PT7 A;  2W1R A;  3GEC A;  4I38 A;  4H6J A;  5DJU A;  3LR5 A;  3LIC A;  2PDR A;  3OCN A;  4R6L A;  1T1A A;  4IUH A;  3F1O A;  2P04 A;  4IJG A;  3S7N A;  3W2Z A;  1LL8 A;  4AFI A;  3MXQ A;  5IS1 A;  3MQ0 A;  4ETX A;  3MF0 A;  3CLO A;  5CX7 A;  2JKR M;  5HWV A;  4JGP A;  1YAX A;  2ZBB A;  4F3L B;  3IBJ A;  3BW6 A;  2D02 A;  1LSX A;  3VE3 A;  4LPZ A;  2I9V A;  5J3W A;  4CLC E;  1TS6 A;  2OAQ 1;  3T4Q A;  4MN5 A;  5HDD A;  4HP9 A;  1OTD A;  2LB9 A;  5C5K A;  2KOI A;  4PAU A;  1YSP A;  2VX8 A;  4H6J B;  3OC2 A;  2VV8 A;  1ODV A;  2D01 A;  4L9F A;  1S67 L;  2NUT C;  2W3H A;  2B18 A;  1XJ4 A;  1XFQ A;  3TRC A;  2PHY A;  1N9O A;  5HWW A;  3D3O A;  3BWL A;  4I5S A;  1OTA A;  1XFN A;  4GJ4 A;  4HH2 A;  3UB6 A;  2VZW A;  1LT0 A;  2KX6 A;  4BBU A;  3KSI A;  4BWI A;  3T4O A;  2K2N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...