1DRMA

Crystal structure of the ligand free bjfixl heme domain
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
119
structure length
119
Chain Sequence
IPDAMIVIDGHGIIQLFSTAAERLFGWSELEAIGQNVNILMPEPDRSRHDSYISRYRTTSDPHIIGIGRIVTGKRRDGTTFPMHLSIGEMQSGGEPYFTGFVRDLTEHQQTQARLQELQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords SENSOR PROTEIN FIXL
publication title Structure of a biological oxygen sensor: a new mechanism for heme-driven signal transduction.
pubmed doi rcsb
source organism Bradyrhizobium japonicum
molecule tags Transferase
total genus 31
structure length 119
sequence length 119
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2000-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1drmA00
3C2WA 1OTEA 3UB6A 2WKPA 3H82B 4H6JA 5DJTA 2PHYA 1D7EA 2KDKA 4I5SA 1S4RA 3MXQA 3NJAA 5IS1A 1MZUA 1P97A 1EW0A 4KQDA 5I5LA 3RTYA 1LT0A 1S1ZA 4JGPA 1S67L 4DJ2A 3H82A 4R3AA 4HHDA 2W0NA 3NOUC 2QJ7A 1N9NA 3NOPC 1DRMA 1F9IA 5F69A 4LRZE 5KIZA 2P7JA 5HWTA 3HJIA 4PKYG 4HOIA 4EEUA 5DKKA 4GHIB 4I3AA 3GECA 1P0ZA 2D02A 4LRYC 3A0VA 5AVEA 5J4EA 4HNBA 4GS9B 1UWNX 4RQ9A 1S66L 3K3DA 3NHQA 4XT2B 3MFXA 2QHKA 1LSXA 1T19A 4GHIA 3PYPA 2EA9A 2OWHA 3B33A 2PR6A 3UB9A 1OTAA 2L4RA 3LI8A 5HDSA 4L9GA 4WF0A 2H28A 2INWA 4GS9A 1GSVA 4HQAA 4XT2A 4EEPA 1S4SA 5AVFA 1F98A 4I39A 3F1OB 4KUOA 3LIEA 4LLOB 4B9OA 1DP8A 1N9LA 3K3CA 4NXEA 1LL8A 4EW7A 1NWZA 2V0WA 5TBMB 4I3IA 1WA9A 1T1AA 4WUJA 2VV6A 4JGQA 1OT9A 3IBRA 4NXBA 2D01A 3F1OA 5HZHA 3ICYA 1JNUA 4HJ4A 5A8BA 3BY9A 2VV8A 5F68A 1LSWA 4DJ3A 2M1CA 2VV7A 2GJ3A 4HJ3A 4HH3A 5TBMA 1TS7A 1VB6A 2ZOHA 3FG8A 1X0OA 3GDIA 1OT6A 4EXOA 3UMEA 3OLOA 3KX0X 1LSVA 4HI4A 4GW9A 2ZOIA 3SW1A 2PDRA 5HSQA 2CMNA 2J80A 1UGUA 4YWZA 4WN5A 2V0UA 4HIAA 4I38A 4EETB 4R70A 3T50A 4NXGA 3CAXA 3FC7A 5EFWA 3LUQA 3VOLA 1UWPX 4K08A 3BY8A 3F1PB 4PKYA 4M4XA 3EWKA 5HDDA 3LIDA 2WKRA 3LICA 1TS0A 3LIAA 3UMDA 4LPZA 2OWJA 1D06A 2JN7A 4HP9A 1XJ4A 4HH2A 1DP9A 3F1PA 1S1YA 3A0SA 1Y28A 4JGOA 2V1AA 1V9ZA 3P7NA 3MJQA 3MQOA 2WKQA 1G28A 1T1BA 5IU1A 5HWWA 1GSXA 2QJ5A 4KUKA 4JGRA 3MQQA 2PYPA 2A24B 1GSWA 4GCZA 4EERA 1V9YA 3A0RA 2PR5A 2L0WA 1T1CA 2PD7A 1OJ5A 3H7WB 2L1MA 3EEHA 3G6OA 2KX6A 3IS2B 1OTIA 3UB7A 2VEAA 2A24A 1XFQA 4MN6A 3RH8B 2V9AA 3LI9A 4R6LA 2Z6CA 2HV1A 5HWVA 2ZBBA 3E4QA 1T18A 4L9FA 3VE3A 3H7WA 4MN5A 3MR0A 1TS8A 3NOTC 5J7EA 4HP4A 4NXFA 3IS2A 5F5YA 1OTBA 4EQ1A 5DJUA 1TS6A 3LIFA 2I9VA 5F6AA 3BWLA 4F3LB 5J3WA 2JHEA 4WL9A 3ULFA 3CLOA 4HY8A 4I3JA 3C8CA 3UE6A 3H9WA 2V1BA 1XFNA 1XJ6A 1BYWA 5G4YA 3PHYA 4R38A 5DKLA 3VE4A 2W27A 2OOLA 2QWSA 3E4PA 4BBVA 3LYXA 2YKFA 1ODVA 4F3LA 2QKPA 1DP6A 3F1NB 3UB8A 4LRXC 2BASA 3E4OA 2YKHA 2B02A 2R78A 4EESA 2PYRA 5HDCA 5G4ZA 1OJGA 4WLAA 4BBUA 5HD5A 2K7SA 2Z6DA 4E04A 4L9EA 3F1NA 1XJ2A 3HJKA 1XJ3A 4H6JB 1KOUA 5HD3A 1N9OA 3ZQ5A 4HJ6A 2PD8A 1OTDA 3D72A 4BBTA 2VLGA 3LIBA 3CWFA
chains in the Genus database with same CATH superfamily
3C2WA 3ZNTA 4QPRA 3OBFA 2EWVA 2WKPA 3NULA 3MFDA 3W2ZA 3PTEA 4QU3A 2ZC7A 1D7EA 2KDKA 1VEUA 2J3TC 3MXSA 4BLMA 1K0KA 4I5SA 4R23A 1W8QA 3HLBA 3MXQA 3PAGA 1KVMA 3OCLA 5IS1A 1BLCA 2PBDP 1EW0A 3ZDJA 3DWZA 4KZ7A 2VGLS 3LR3A 3RTYA 1LT0A 4DMZA 4P85A 1XA1A 4G3VA 2PU2A 4Y7PA 4R3AA 4XUXA 5CHUA 4HHDA 3Q82A 3U2AA 2V2FF 1LLBA 3OZHA 2HJEA 3O87A 4E3MA 2Q9NA 3DTKA 1DRMA 5GLAA 4QHCA 1F9IA 4DDSA 4C3QA 3IHBA 3Q07A 3CPTA 1SKFA 4ZJ1A 2ZJ9A 1PFLA 4DRTA 1YMSA 4GHIB 4I3AA 3FWLA 5EVLA 2FFFB 2XK1A 4X53A 4LFUA 4RVAA 5FL3A 4MNRA 4MMNA 4RQ9A 1S66L 3RJUA 3FKVA 4XT2B 4UQIM 3WS5A 5AQ9A 4R3JA 2OAP1 1T19A 2Q9MA 5E2GA 2EA9A 2L4RA 3O5YA 5HDSA 2BTFP 3ZFZA 2X01A 4QD4A 4WF0A 4GN2A 1E25A 3BEBA 4RX3A 5DTKA 2JKRM 5EVEA 4NEED 2XQZA 1BULA 2RL3A 4OQHA 4I39A 4RYEA 5GLCA 2PU4A 2XFTA 3E2LA 3UE1A 2ZM8A 4X68A 2QYBA 3OCNA 5G18A 4PM9A 1W63Q 1LL8A 5DTSA 2JKGA 3ZG5A 3SZTA 1L0DA 1NZUA 5FAOA 1T1AA 3M2KA 2W3GA 1GHMA 5IT5A 3IX3A 4NXBA 3C4PA 4OOLA 4Q0JA 5HZHA 5A8BA 3M2JA 5F68A 3HLEA 2OSUA 4JXVA 1C3BA 5HFOA 3UB5P 1RCJA 3BFEA 3V5MA 3QNBA 2Y2HA 2ZQ7A 5U47A 5EOOA 3NIAA 4EQIA 5FATA 1YSQA 4FCFA 3ZG8B 2XFSA 4S2LA 3PAEA 3C30A 3M6HA 3T4LA 3SW1A 4JF5A 4LV3A 3GSGA 1H8YA 2J80A 4YWZA 1F2KA 2DMWA 5HX9A 4E3IA 4EBNA 1SKOA 4JLFA 4HESA 3TRCA 1PI4A 3PXPA 1XKZA 3T50A 4IVKA 3QP5A 2ZMFA 1L0EA 4OLGA 1JWPA 4N1HA 5HL6A 2ZQ9A 3TE8A 5F1FA 5CERA 3VOLA 3BRMA 4Y17A 2JCHA 5FI2A 2ZM0A 2Y2GA 3N8LA 1HZOA 2WKHA 3G2YA 1PW1A 1BUEA 2EX8A 5FI6A 1VETA 5FSRA 2V8CA 2FH5A 3IF6B 3E98A 3T1RA 1D06A 2JN7A 3R7WA 1VQQA 3S7PA 1XJ4A 1NRJA 3CITA 4P0MA 3KO6A 2V1AA 3P7NA 4Y0OA 1IKGA 1NXYA 5EE8A 1J3WA 3PBQA 2WKQA 3V67A 1GSXA 3KSGA 2WAEA 3NBLA 2QJ5A 1QMFA 5DF8A 1EI5A 1GSWA 4QWOA 3ZCZA 1IELA 4GCZA 4WYYA 1M40A 3QP2A 1V9YA 3A0RA 4LCLA 4KG5A 1BLSA 3BYDA 2EXAA 3EEHA 3G6OA 1K55C 3EEAA 5CEBA 4XXRA 2WKIA 3IS2B 5FQ9A 1OTIA 3C38A 2W1TB 2A24A 1XGJA 3NC8A 1XFQA 3VP3A 5FDSA 3MXRA 1Z09A 4OPYA 2Z6CA 4C75A 5HWVA 3BFDA 4FSFA 5EOEA 3RFBA 1T18A 4L9FA 2ZMAA 3BQ8A 1AXBA 1ACFA 3IXBA 1GA0A 4MDZA 3H7WA 1G68A 4MN5A 3MR0A 5CHJA 4BENA 1TS8A 4OVDA 3NOTC 1IKIA 1K25A 3UO9A 5HAPA 5BOHA 2Y2QA 5IHVA 1TS6A 1K54C 1HVBA 3HVFA 1K4EA 3S7OA 2Y2KA 3VP4A 3LR0A 4F3LB 4ZJ3A 2H0YA 1S6RA 1PRQA 4I3JA 2M7VA 3H9WA 1BYWA 5M18A 1K55A 2OLUA 4R38A 3V3SA 5CGWA 1KE4A 3BW6A 4Z9QA 2DRWA 3LYXA 3E0YA 3HCYA 4E3OA 2Q0OA 1ODVA 4UA9A 2QKPA 3F1NB 1MBLA 3Q1FA 5KMWA 3BFGA 2B02A 1ZKJA 5FQQA 2R78A 2PYRA 5HDCA 5G4ZA 4K91A 1A0KA 3IHAA 4IVIA 2EX2A 4EWFA 3SS3A 2V20A 4JF6A 1K54A 3ITAA 4E3JA 4RA7A 5EM1A 4G3KA 2XF3A 3HJKA 4ME4A 2J7VA 3VOYA 4OQIA 1ZC2A 4FH2A 3IBJA 3DTEA 1HTZA 4P6ZM 3T1XA 2XRNA 5A90A 1PWDA 3CWFA 4BD0A 3KYZA 2JKRI 3TOIA 2GNXA 2P9VB 3W8KA 2B18A 1PWGA 4GD8A 1PZPA 4R3BA 2J9OA 2PHYA 3UDXA 1S4RA 5JYOA 5GL9A 5FQMA 4P87A 4O7DA 2ZQ8A 2VGLM 4KQDA 5I5LA 4B4ZA 2Y2LA 5I94A 3JYIA 3W4QA 4JGPA 4DJ2A 4O0PA 1MWUA 2QPNA 2ZC3B 3HUMA 2ACGA 2W0NA 5F83A 3DTMA 3IT9A 2HDSA 5TGFA 1BT5A 4ETXA 3PBTA 4WZ5C 2WAFA 5EECA 1ERQA 4OKPA 1BLHA 3C4OA 2P7JA 2XD5A 5HWTA 3P09A 3FV7A 3UPNA 2ZC5B 4UEYA 4HEFA 4N1XA 2VZWA 4S2IA 5L09A 2D02A 1SHVA 2Y2IA 3MQ0A 4S2NA 1P9RA 3WRTA 3BLMA 2RCXA 3MZFA 1IEMA 4GS9B 4OOMA 4R1GA 1IFQA 2WGVA 2J8YA 5DFXA 4Q0HA 5TJJA 5E43A 4S2OA 4GHIA 5CECA 2P74A 3MKEA 3B33A 3D3OA 1OTAA 4Y0TA 3LI8A 3T4JA 1YLTA 4KQQA 2K31A 3IWIA 2INWA 3IXDA 4HQAA 2O99A 4XT2A 1S4SA 5CHMA 2B95A 2PBYA 1F98A 1ONGA 1MWRA 1OMEA 2WZXA 3F1OB 4MBFA 2Z2MB 4YNRA 3V50A 2JKTI 1ERMA 4LLOB 2XSSA 1N9LA 2ZC4B 3LEQA 1NWZA 3A3FA 5TBMB 1W8YA 5HL1A 4WUJA 1H8MA 2VV6A 4ZJ2A 5DFYA 2D01A 1I2WA 3ICYA 4PAUA 3S22A 1Q2PA 4MLLA 1LSWA 1Y54A 4OP8A 2Y59A 2PRFA 2A3UA 4DE0A 3T4OA 2M1CA 2VV7A 4OH0A 4HJ3A 1PWCA 1L2SA 3FG8A 3FKWA 2J9PA 3IXGA 2IWBA 1MY8A 2OAQ1 4EXOA 3FPVA 1WYBA 3OLOA 2GX5A 2PDRA 4OP5A 2CMNA 2XD1A 1UGUA 2ZL1B 5KSHA 3MSHA 4E6XA 3UN7A 2HJ9C 3ISGA 4Z1WA 3DBAA 4Y13A 4NXGA 3CAXA 2JKFA 1YKDA 1NLZA 1KGEA 1IYSA 3TW8A 3ZVWA 4S2PA 3KYQA 1UWPX 2EFXA 1LL5A 2XR0A 3BY8A 1YT4A 3F1PB 1ES3A 4PKYA 4KZ9A 1VHMA 5FAQA 2WKRA 2IWCA 1TS0A 3LIAA 4CLCB 5K5BA 2OWJA 1JWVA 4WELA 5EVIB 1CI9A 1AWIA 3L7HA 5M19A 1EROA 3MKFA 1CI8A 3DAVA 3SH7A 4HH2A 3C5AA 2XLNA 1O7EA 3BM6A 1V9ZA 1PI5A 1MPLA 3MQOA 5EPHA 1T1BA 5HWWA 4Y0UA 3SH8A 2PYPA 3IF6A 2I72A 3IX8A 3Q7VB 3IX4A 4QY6A 3IWQA 4BL3A 2KX6A 1NY0A 3LY4A 4O8GA 1H0MA 4YFMA 1ES5A 2HP5A 3LEZA 3UDFA 3RH8B 2V9AA 1ES2A 5HAIA 4X25A 4K0XA 1VM1A 2X71A 5HPIA 4JXWA 1ALQA 1CQAA 1FILA 1OPXA 3MBZA 1BLPA 3S1YA 5FI7A 4JF4A 4U0XA 1E4DA 3FPWA 4NXFA 1N9BA 3IS2A 3G35A 1OTBA 3PBNA 2W1TA 3G32A 3OPLA 5M1AA 3SS5A 5F6AA 3BWLA 1K4FA 2O0YA 3EQUA 3PBSA 4DE1A 4WL9A 3M6BA 4KZ6A 1CF0A 3MZDA 2AVXA 5A91A 3UE6A 2Y91A 2ZMVA 3ZYTA 5FDHA 5FA7A 3VFFA 2OOLA 4X56A 2UV0E 3E4PA 4WMCA 2XA7S 3TJZC 4F3LA 1GCEA 1HD8A 1DJBA 2YKHA 4BBUA 1GHPA 5HD5A 4KG6A 3EQVA 1K57C 4LV0A 3JVUA 3KYEA 2VX8A 4R4RA 1Q2QA 2WKEA 3F1NA 1XJ2A 1IYOA 4H6JB 1TEMA 2W3HA 1N9OA 1KE0A 1KGGA 2DCFA 1OTDA 3DTIA 3BECA 1OTEA 2X02A 2WK0A 3UB6A 5EM0A 3H82B 4OQ0A 1FCMA 3C7VA 3LCEA 5DJTA 4OOYA 1S0WA 3HUNA 2WGWB 2MJ6A 1K57A 3SH9A 1YLZA 2PT7A 1YMXA 4WEKA 1LI9A 1S67L 4FH4A 2Y2JA 3NOUC 1TDGA 2QJ7A 1FSYA 1N9NA 4JXGA 3T4SA 1L3LA 1W5DA 4RX2A 1SZVA 3GV9A 1JTDA 5EUAA 5KIZA 1RP5A 3HLCA 3CMZA 4PKYG 2HDQA 4M3KA 4OPZA 3GECA 1XX2A 2OV5A 1P0ZA 2O9BA 4LRYC 2W3FA 1ESUA 3JVVA 4P6BA 3A0VA 4GDBA 5AVEA 4B88A 3GTCA 4PMAA 4HNBA 1WE4A 1DJCA 4HBTA 3W4PA 3K3DA 1KGFA 3NHQA 4GJ4A 3MZEA 1SCWA 3AGEA 3MFXA 4MBKA 4DDYA 2QHKA 4IUKA 4D60A 1LSXA 2WADA 3Q7ZA 4GZBA 4KQOA 3PYPA 3L9KA 3O88A 2OWHA 2NUPC 3U4LP 2HP6A 2ZM2A 3UB9A 5L10A 4OONA 1MC0A 4GKUA 2A49A 3GQZA 1NYMA 4Y15A 4GS9A 5TR7A 2XGNA 4WZ4A 3VV4A 4EEPA 3EGXC 1YQSA 3FYZA 1KE3A 5AVFA 4EBPA 3D9YA 4DXBA 5GLBA 4KUOA 5HAQA 4LGWA 1NJ4A 5GHYA 3HLGA 4ZAMA 2ZC6B 2ZQCA 2IWDA 4AFIA 1DP8A 2QMIA 4ZTKA 3K3CA 4LENA 4IUHA 4EW7A 2V0WA 1TD5A 3MF0A 2H0TA 3R4KA 4JGQA 1OT9A 1TF1A 3IBRA 3HUOA 3F1OA 4S2NC 1JNUA 4MCWA 1XXMA 3BY9A 4X1LA 3A3EA 2Y79A 2VV8A 2R9WA 4FOFA 4XUZA 1SDEA 3VSLA 2C5WB 1ES4A 3T12B 1NYYA 5CX7A 3TSGA 2GJ3A 3CZDA 3RXXA 4QB8A 5TBMA 4UAAA 2ZOHA 3IH8A 4OPQA 4ETZA 3N8SA 2P08A 4NK3A 4MN7A 5CTNA 3S7NA 2QZ6A 2ZLYA 4S2KA 1OT6A 1PNEA 3ZG9B 3BJNA 3CHWP 3KX0X 2HF6A 4HI4A 2KLIA 2NUTC 3G31A 5LBRA 3T4KA 4PM5A 5C5KA 3A3DA 4HIAA 5AQBA 4EETB 4R70A 2CC1A 4N9KA 1LI0A 3FC7A 2Z2LB 5EFWA 5HPFA 3LUQA 3QP6A 4PM7A 4E3KA 4Q0IA 4K08A 1D1JA 2UWXA 1K38A 2HDUA 4L0LA 2LB5A 4M4XA 2ZL1A 4S2MA 2GZAA 5HDDA 4KZ5A 4X69A 1ZG6A 3LIDA 5E2HA 5GHXA 4PPRA 3FZCA 1FSWA 3LICA 4S2JA 3UMDA 5DTTA 1MKMA 3WS1A 4BWIA 1TVFA 1NRFA 2HGVA 3LY3A 1ONHA 1YLPA 3HL9A 1XPBA 3DW0A 2WYXA 3N4IA 1STZA 3ZNYA 2ZD8A 4O01A 4HP9A 5J8XA 1DP9A 3F1PA 3A0SA 1Y28A 4JGOA 1YPRA 3MMHA 5CRFA 3SS4A 1RGYA 1G28A 3NDEA 3I7JA 4KUKA 4JGRA 4II7A 5KSCA 5A93A 4BJPA 5F1GA 2XDMA 3N7WA 1TDLA 1G6OA 4P6ZS 3ZG7B 3W4OA 2HZ5A 2V8FA 4H8RA 2H5SA 4KZ8A 3UNWA 4E6WA 1XP4A 4PM8A 2HP9A 1SDNA 2VJWA 1ZTUA 1YLWA 2K2NA 2PR5A 2L0WA 5E2EA 2PD7A 4E3LA 1OJ5A 2R9XA 4EU0A 4GNUA 3WS0A 4F94A 3KSFA 5FASA 5FEGA 3UB7A 4BQMA 3HLWA 3Q7VA 3KSHA 3LI9A 2W3EA 2WUQA 3LGOA 3BFCA 3NDGA 4IJGA 3T1SA 2ZBBA 4ARZB 3ZGAB 4NKPA 3DWKA 3VE3A 1XGIA 4JXSA 4G3WA 2VKSA 4HP4A 4Y3IA 2H10A 5F5YA 4EQ1A 1KVLA 5DJUA 2I9VA 3LFVA 1I5QA 1YAXA 1L0GA 4CJNA 4WMCD 2DNSA 3CLOA 1H5XA 4N92A 2V1BA 1H3QA 3HBRA 1XFNA 3IF6C 1XJ6A 5G4YA 2JE5A 3VE4A 1CJFA 2W27A 4KQRA 3VOZA 2XA7M 1G5UA 3BQAA 3T4TA 4JPMA 3E4OA 1IYQA 4KG2A 3GVBA 1O07A 4FD8A 3UPPA 4CPKA 3NI9A 4EESA 5KZHA 4GB7A 1OJGA 4WLAA 2EX6A 1MKIA 3T4QA 1CEGA 4BMWA 2B5RA 5AQ7A 1H8ZA 3BFFA 1CEFA 3BLSA 1EWZA 4L9EA 4ZBEA 1RGZA 3QP1A 1M6KA 2Y2MA 3UE0A 4UA7A 2M7UA 5HD3A 3HLFA 1VEUB 4DXCA 3ZQ5A 5MC7A 4HJ6A 4KZ4A 2EXBA 1DJAA 1W63M 5FEFA 1NZOA 3D72A 3HREA 2VLGA 3AGDA 3LIBA 3VP0A 5HARA 4N9LA 4GOGA 1P9WA 1FCNA 2W1RA 4IEDA 4GDNA 2HDRA 4H6JA 3QP4A 3PBOA 3TG9A 3IXHA 4LV1A 3QHYA 3ZHHA 3NJAA 1JVJA 1JTGA 3RXWA 3WWXA 1MZUA 1P97A 3LR4A 4U3TA 4NG2A 4Y2FA 2BG1A 2W3DA 5FQJA 4PM6A 1S1ZA 3CPTB 3G30A 3GRJA 5D3OA 3H82A 3P98A 4ESPA 2Y8HA 3CG5A 4IBRA 1FIKA 3OC2A 3G34A 3B42A 5CGXA 2WGWA 3ZVTA 3NOPC 5F82A 4BL2A 5F69A 4QY5A 4YINA 3SOIA 4LRZE 4X55A 1IYPA 1FR1A 2OLVA 3HJIA 2J3WA 2G2UA 4HOIA 1F5MA 3VSKA 4EEUA 4HBUA 3NY4A 5DKKA 3K2NA 3OPRA 3ITBA 5L2FA 1FCOA 3O3VA 2O9AA 4LCMA 3OPPA 3NECA 5J4EA 3WS2A 2FZ0A 4FTXA 1UWNX 2O9CA 4KZAA 3UE3A 4JKTA 4UQIS 4UA6A 1K6RA 1GHIA 2Y4AA 2PAVP 4B4XA 1PIOA 2VA0A 2G2WA 2PR6A 1MWTA 2G7UA 1PW8A 4L9GA 3P01A 2JKTM 1LL9A 3EGDC 2H28A 4X1MA 1GSVA 2V1ZA 1FR6A 3CI6A 5DF7A 1FOFA 1W79A 3IQAA 2ZQAA 3LIEA 3GMWA 4B9OA 1HLUP 3IH9A 1YLYA 3QNCA 4NXEA 3CUEC 1ZG4A 4I3IA 1WA9A 3PBRA 1L0FA 4A5RA 4LV2A 4DE3A 3QP8A 4D2OA 2E8JA 4HJ4A 4DE2A 5FQIA 3UDIA 4ID4A 3HLDA 4DJ3A 3CJMA 2P9VA 4WEJA 3KSIA 3UY6A 4HH3A 1SKOB 1TS7A 4R4SA 1VB6A 2ZQDA 1X0OA 4E3NA 3GDIA 5FQKA 5JYPA 5HW3A 3UMEA 4R0QA 1BZAA 1LSVA 4EV4A 2C6WB 1K56D 2E8IA 3CUEA 4GW9A 2ZOIA 1QMEA 5HSQA 4BD1A 4WN5A 5GLDA 2LB9A 2V0UA 2JBFA 3N8RA 2Y2NA 3G4PA 4I38A 4DKIA 4QJGA 4CLCE 1VETB 2XROA 5TFQA 4Y5FA 1K6SA 3R7WB 2JC7A 4JBFA 1YSPA 2GDNA 2Y2OA 4CQHA 3OPHA 4OLDA 3WRZA 3EWKA 3EOIA 4Q8IA 3IWOA 3D4FA 1E3UD 5DVAA 3C7UA 3S7QA 2Y55A 4IHQA 1Z6FA 1GA9A 4LPZA 4CLCD 4C6YA 1ESIA 3V39A 4B93A 5EVID 3Q81A 5CTMA 2WZZA 4X6TA 4KZ3A 3ZG0A 1IOUA 3VMAA 1S1YA 1Y4OA 4GD6A 4K0WA 2VGJA 3MJQA 3OOVA 5IU1A 1XA7A 4EUVA 4ZDXA 3MQQA 5L07A 3NCKA 2A24B 4YOFA 3V3RA 1PZOA 4U0TA 1YLJA 5CXWA 2EFUA 1PYYA 1W7FA 4WM9A 4EERA 4GLQA 1WYCA 3UPOA 1T1CA 3H7WB 1BTLA 2L1MA 4WBGA 1FQGA 1MWSA 2HPBA 3LO7A 4FUWA 1NLYA 5A92A 4MBHA 2VEAA 3JPUA 3S4XA 5AJGA 4MN6A 3E2KA 1JWZA 2FFYA 4R6LA 4OPRA 5L8MA 4EBLA 2HV1A 3B47A 3E4QA 1YM1A 5CEDA 2IA2A 1MXOA 1G6AA 5J7EA 3B3XA 1BSGA 4UHUA 1N4OA 4PHTA 4KZBA 3LIFA 3GR2A 4DF6A 3T1QB 2J3TD 2A2LA 5J3WA 2JHEA 1KDWA 3ULFA 3O86A 3A3JA 4ARZA 4HY8A 4KENB 4CLCC 3C8CA 4IBXA 4NETA 5EVIC 1ZHHB 1K56A 3PHYA 5E2FA 5DKLA 2BLSA 4DN0A 5AQAA 3AGFA 2QWSA 5FAPA 2KOIA 3LR5A 4BBVA 3VFHA 2VGKA 2YKFA 3WS4A 4OQGA 1DP6A 2EWWA 2Y2PA 2P04A 3UB8A 4LRXC 3VP1A 3VP2A 1U60A 2BASA 1LHYA 1I2SA 3A3IA 5GHZA 1KDSA 5DF9A 4EUZA 5CGSA 2XEPA 3G2ZA 3PR6A 2K7SA 1J9MA 2Z6DA 1E3UA 4E04A 5EV0A 4MEZA 3N6IA 3IF5A 4WZ5A 2EX9A 2XH9A 1XJ3A 4CLCA 1KOUA 5EVIA 3MS6A 2VK3A 4ZRRA 2WGIA 2PD8A 1DY6A 4BBTA 1CK3A
chains in the Genus database with same CATH topology
3C2WA 1OTEA 4QPRA 3OBFA 2EWVA 3KYZA 1P9WA 2JKRI 3UB6A 2WKPA 2GNXA 2W1RA 3W2ZA 3H82B 2B18A 4H6JA 5DJTA 2PHYA 1D7EA 3PBOA 2KDKA 2J3TC 4I5SA 1S4RA 3MXQA 2MJ6A 3NJAA 3OCLA 5IS1A 1MZUA 1P97A 1EW0A 2VGLM 4KQDA 5I5LA 3LR4A 2VGLS 3LR3A 2PT7A 4Y2FA 3RTYA 2W3DA 4WEKA 1LT0A 1S1ZA 4DMZA 4JGPA 1S67L 4DJ2A 4O0PA 3H82A 4G3VA 4R3AA 4HHDA 2W0NA 3U2AA 2Y8HA 3NOUC 2QJ7A 2HJEA 1N9NA 3OC2A 3T4SA 3B42A 4ETXA 3NOPC 3PBTA 1DRMA 1F9IA 5F69A 4LRZE 5KIZA 2P7JA 5HWTA 3HJIA 4UEYA 2J3WA 4PKYG 4HOIA 1F5MA 4EEUA 5DKKA 2VZWA 3K2NA 4GHIB 4I3AA 3GECA 1P0ZA 2D02A 2O9BA 4LRYC 2W3FA 3JVVA 3MQ0A 1P9RA 2O9AA 3A0VA 5AVEA 5J4EA 5FL3A 2FZ0A 4HNBA 4GS9B 4MMNA 4OOMA 1UWNX 2O9CA 4RQ9A 1S66L 1IFQA 3UE3A 3K3DA 3NHQA 4XT2B 4UQIM 4GJ4A 4UQIS 3MFXA 2QHKA 5DFXA 4IUKA 4Q0HA 2OAP1 1LSXA 5TJJA 4KQOA 1T19A 4GHIA 3PYPA 2EA9A 2OWHA 2VA0A 2NUPC 3B33A 2PR6A 3D3OA 3UB9A 1OTAA 2L4RA 2G7UA 3LI8A 3O5YA 5HDSA 3T4JA 4L9GA 1MC0A 2K31A 3P01A 2JKTM 4WF0A 3EGDC 2H28A 2INWA 4GS9A 1GSVA 4HQAA 2O99A 2JKRM 4XT2A 3VV4A 1S4SA 3EGXC 4NEED 4EEPA 3CI6A 5AVFA 1F98A 4I39A 3F1OB 4KUOA 4YNRA 3LIEA 2JKTI 4LLOB 4AFIA 2XSSA 1DP8A 4B9OA 2QYBA 1N9LA 3OCNA 3K3CA 4NXEA 3CUEC 1W63Q 4IUHA 1LL8A 4EW7A 1NWZA 2V0WA 1TD5A 3MF0A 5TBMB 4I3IA 3R4KA 1WA9A 3PBRA 1T1AA 2W3GA 4WUJA 1H8MA 2VV6A 4JGQA 1OT9A 1TF1A 5IT5A 5DFYA 3IBRA 4NXBA 2D01A 4OOLA 3F1OA 4Q0JA 5HZHA 3ICYA 1JNUA 4PAUA 4MCWA 4HJ4A 5A8BA 3BY9A 2Y79A 2VV8A 5F68A 4FOFA 1LSWA 4DJ3A 3T4OA 2M1CA 4WEJA 3KSIA 5CX7A 2VV7A 2GJ3A 4HJ3A 4HH3A 5TBMA 1TS7A 1VB6A 2ZOHA 3FG8A 1X0OA 4ETZA 2P08A 1YSQA 4MN7A 3GDIA 3S7NA 1OT6A 2OAQ1 4EXOA 3UMEA 3FPVA 3BJNA 3OLOA 3KX0X 1LSVA 2HF6A 3C30A 2GX5A 3T4LA 3CUEA 4GW9A 2ZOIA 4HI4A 3SW1A 2PDRA 2KLIA 2NUTC 5HSQA 2CMNA 2J80A 1UGUA 5LBRA 4YWZA 3T4KA 2DMWA 5KSHA 4WN5A 2LB9A 2V0UA 5C5KA 4HIAA 4I38A 4EETB 4R70A 4CLCE 2HJ9C 4Z1WA 3DBAA 3TRCA 3PXPA 2XROA 3T50A 4NXGA 2ZMFA 3CAXA 1YKDA 1NLZA 3TW8A 4Y5FA 5HL6A 3FC7A 3R7WB 3TE8A 5EFWA 5HPFA 3LUQA 1YSPA 3VOLA 3KYQA 4CQHA 1UWPX 4Q0IA 4K08A 3BY8A 3F1PB 4L0LA 4PKYA 2LB5A 3EWKA 4M4XA 3EOIA 2GZAA 5HDDA 3LIDA 1VHMA 2WKRA 3LICA 3S7QA 1TS0A 4IHQA 3LIAA 4CLCB 3UMDA 2FH5A 1MKMA 4BWIA 4LPZA 2HGVA 5K5BA 2OWJA 4WELA 3E98A 4CLCD 1D06A 2JN7A 3R7WA 1STZA 4B93A 4O01A 3S7PA 4HP9A 1XJ4A 4HH2A 1NRJA 1DP9A 3CITA 1IOUA 3F1PA 1S1YA 3A0SA 1Y28A 3KO6A 4JGOA 3MMHA 2V1AA 1V9ZA 3P7NA 3PBQA 3MJQA 3MQOA 2WKQA 1G28A 1T1BA 3OOVA 5IU1A 3V67A 4EUVA 5HWWA 1GSXA 3KSGA 2QJ5A 4KUKA 4JGRA 3MQQA 2PYPA 4II7A 4BJPA 2A24B 4YOFA 1GSWA 1G6OA 4P6ZS 4GCZA 4EERA 1V9YA 3A0RA 4GLQA 2VJWA 1ZTUA 2K2NA 2PR5A 2L0WA 1T1CA 2PD7A 1OJ5A 3H7WB 2L1MA 3EEHA 3G6OA 2KX6A 3EEAA 4O8GA 4EU0A 3IS2B 3KSFA 1NLYA 1OTIA 3C38A 3UB7A 2W1TB 2VEAA 2A24A 5AJGA 1XFQA 4MN6A 3RH8B 2V9AA 3KSHA 3LI9A 2W3EA 4IJGA 4R6LA 5L8MA 2Z6CA 2HV1A 5HPIA 5HWVA 2ZBBA 3B47A 4FSFA 3RFBA 4ARZB 3E4QA 1T18A 4L9FA 3BQ8A 4NKPA 2IA2A 3VE3A 1OPXA 4MDZA 3H7WA 4MN5A 3MR0A 1TS8A 4G3WA 3NOTC 2VKSA 5J7EA 4HP4A 3FPWA 4Y3IA 4NXFA 3IS2A 5F5YA 1OTBA 3PBNA 2W1TA 4PHTA 4EQ1A 5DJUA 1TS6A 3LIFA 2I9VA 3LFVA 5F6AA 2J3TD 3S7OA 3BWLA 1YAXA 3LR0A 4F3LB 2A2LA 2O0YA 3EQUA 5J3WA 3PBSA 2JHEA 4WL9A 3ULFA 3CLOA 4ARZA 4HY8A 4CLCC 4I3JA 3C8CA 3UE6A 2M7VA 3H9WA 2V1BA 1H3QA 1XFNA 1XJ6A 2ZMVA 1BYWA 1ZHHB 3ZYTA 5G4YA 3PHYA 4R38A 5DKLA 3VE4A 2W27A 4DN0A 2OOLA 2QWSA 2KOIA 3E4PA 3BW6A 3LR5A 4BBVA 3LYXA 3E0YA 3HCYA 2YKFA 1ODVA 2XA7M 2XA7S 3TJZC 4F3LA 2QKPA 1DP6A 2EWWA 3F1NB 3BQAA 3T4TA 2P04A 3UB8A 4LRXC 2BASA 3E4OA 2YKHA 2B02A 2R78A 4EESA 2PYRA 5HDCA 5G4ZA 1OJGA 4WLAA 4BBUA 5DF9A 5HD5A 3PR6A 3T4QA 2K7SA 4BMWA 3EQVA 2Z6DA 3JVUA 4E04A 2VX8A 4G3KA 4L9EA 3F1NA 1XJ2A 3HJKA 1XJ3A 4CLCA 4H6JB 4ME4A 1KOUA 2W3HA 2M7UA 5HD3A 1N9OA 3IBJA 5MC7A 3ZQ5A 4HJ6A 4P6ZM 4ZRRA 2XRNA 1W63M 2PD8A 1OTDA 3D72A 4BBTA 2VLGA 3LIBA 3CWFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C2W A;  1OTE A;  3UB6 A;  2WKP A;  3H82 B;  4H6J A;  5DJT A;  2PHY A;  1D7E A;  2KDK A;  4I5S A;  1S4R A;  3MXQ A;  3NJA A;  5IS1 A;  1MZU A;  1P97 A;  1EW0 A;  4KQD A;  5I5L A;  3RTY A;  1LT0 A;  1S1Z A;  4JGP A;  1S67 L;  4DJ2 A;  3H82 A;  4R3A A;  4HHD A;  2W0N A;  3NOU C;  2QJ7 A;  1N9N A;  3NOP C;  1DRM A;  1F9I A;  5F69 A;  4LRZ E;  5KIZ A;  2P7J A;  5HWT A;  3HJI A;  4PKY G;  4HOI A;  4EEU A;  5DKK A;  4GHI B;  4I3A A;  3GEC A;  1P0Z A;  2D02 A;  4LRY C;  3A0V A;  5AVE A;  5J4E A;  4HNB A;  4GS9 B;  1UWN X;  4RQ9 A;  1S66 L;  3K3D A;  3NHQ A;  4XT2 B;  3MFX A;  2QHK A;  1LSX A;  1T19 A;  4GHI A;  3PYP A;  2EA9 A;  2OWH A;  3B33 A;  2PR6 A;  3UB9 A;  1OTA A;  2L4R A;  3LI8 A;  5HDS A;  4L9G A;  4WF0 A;  2H28 A;  2INW A;  4GS9 A;  1GSV A;  4HQA A;  4XT2 A;  4EEP A;  1S4S A;  5AVF A;  1F98 A;  4I39 A;  3F1O B;  4KUO A;  3LIE A;  4LLO B;  4B9O A;  1DP8 A;  1N9L A;  3K3C A;  4NXE A;  1LL8 A;  4EW7 A;  1NWZ A;  2V0W A;  5TBM B;  4I3I A;  1WA9 A;  1T1A A;  4WUJ A;  2VV6 A;  4JGQ A;  1OT9 A;  3IBR A;  4NXB A;  2D01 A;  3F1O A;  5HZH A;  3ICY A;  1JNU A;  4HJ4 A;  5A8B A;  3BY9 A;  2VV8 A;  5F68 A;  1LSW A;  4DJ3 A;  2M1C A;  2VV7 A;  2GJ3 A;  4HJ3 A;  4HH3 A;  5TBM A;  1TS7 A;  1VB6 A;  2ZOH A;  3FG8 A;  1X0O A;  3GDI A;  1OT6 A;  4EXO A;  3UME A;  3OLO A;  3KX0 X;  1LSV A;  4HI4 A;  4GW9 A;  2ZOI A;  3SW1 A;  2PDR A;  5HSQ A;  2CMN A;  2J80 A;  1UGU A;  4YWZ A;  4WN5 A;  2V0U A;  4HIA A;  4I38 A;  4EET B;  4R70 A;  3T50 A;  4NXG A;  3CAX A;  3FC7 A;  5EFW A;  3LUQ A;  3VOL A;  1UWP X;  4K08 A;  3BY8 A;  3F1P B;  4PKY A;  4M4X A;  3EWK A;  5HDD A;  3LID A;  2WKR A;  3LIC A;  1TS0 A;  3LIA A;  3UMD A;  4LPZ A;  2OWJ A;  1D06 A;  2JN7 A;  4HP9 A;  1XJ4 A;  4HH2 A;  1DP9 A;  3F1P A;  1S1Y A;  3A0S A;  1Y28 A;  4JGO A;  2V1A A;  1V9Z A;  3P7N A;  3MJQ A;  3MQO A;  2WKQ A;  1G28 A;  1T1B A;  5IU1 A;  5HWW A;  1GSX A;  2QJ5 A;  4KUK A;  4JGR A;  3MQQ A;  2PYP A;  2A24 B;  1GSW A;  4GCZ A;  4EER A;  1V9Y A;  3A0R A;  2PR5 A;  2L0W A;  1T1C A;  2PD7 A;  1OJ5 A;  3H7W B;  2L1M A;  3EEH A;  3G6O A;  2KX6 A;  3IS2 B;  1OTI A;  3UB7 A;  2VEA A;  2A24 A;  1XFQ A;  4MN6 A;  3RH8 B;  2V9A A;  3LI9 A;  4R6L A;  2Z6C A;  2HV1 A;  5HWV A;  2ZBB A;  3E4Q A;  1T18 A;  4L9F A;  3VE3 A;  3H7W A;  4MN5 A;  3MR0 A;  1TS8 A;  3NOT C;  5J7E A;  4HP4 A;  4NXF A;  3IS2 A;  5F5Y A;  1OTB A;  4EQ1 A;  5DJU A;  1TS6 A;  3LIF A;  2I9V A;  5F6A A;  3BWL A;  4F3L B;  5J3W A;  2JHE A;  4WL9 A;  3ULF A;  3CLO A;  4HY8 A;  4I3J A;  3C8C A;  3UE6 A;  3H9W A;  2V1B A;  1XFN A;  1XJ6 A;  1BYW A;  5G4Y A;  3PHY A;  4R38 A;  5DKL A;  3VE4 A;  2W27 A;  2OOL A;  2QWS A;  3E4P A;  4BBV A;  3LYX A;  2YKF A;  1ODV A;  4F3L A;  2QKP A;  1DP6 A;  3F1N B;  3UB8 A;  4LRX C;  2BAS A;  3E4O A;  2YKH A;  2B02 A;  2R78 A;  4EES A;  2PYR A;  5HDC A;  5G4Z A;  1OJG A;  4WLA A;  4BBU A;  5HD5 A;  2K7S A;  2Z6D A;  4E04 A;  4L9E A;  3F1N A;  1XJ2 A;  3HJK A;  1XJ3 A;  4H6J B;  1KOU A;  5HD3 A;  1N9O A;  3ZQ5 A;  4HJ6 A;  2PD8 A;  1OTD A;  3D72 A;  4BBT A;  2VLG A;  3LIB A;  3CWF A; 
#chains in the Genus database with same CATH topology
 3C2W A;  3ZNT A;  4QPR A;  3OBF A;  2EWV A;  2WKP A;  3NUL A;  3MFD A;  3W2Z A;  3PTE A;  4QU3 A;  2ZC7 A;  1D7E A;  2KDK A;  1VEU A;  2J3T C;  3MXS A;  4BLM A;  1K0K A;  4I5S A;  4R23 A;  1W8Q A;  3HLB A;  3MXQ A;  3PAG A;  1KVM A;  3OCL A;  5IS1 A;  1BLC A;  2PBD P;  1EW0 A;  3ZDJ A;  3DWZ A;  4KZ7 A;  2VGL S;  3LR3 A;  3RTY A;  1LT0 A;  4DMZ A;  4P85 A;  1XA1 A;  4G3V A;  2PU2 A;  4Y7P A;  4R3A A;  4XUX A;  5CHU A;  4HHD A;  3Q82 A;  3U2A A;  2V2F F;  1LLB A;  3OZH A;  2HJE A;  3O87 A;  4E3M A;  2Q9N A;  3DTK A;  1DRM A;  5GLA A;  4QHC A;  1F9I A;  4DDS A;  4C3Q A;  3IHB A;  3Q07 A;  3CPT A;  1SKF A;  4ZJ1 A;  2ZJ9 A;  1PFL A;  4DRT A;  1YMS A;  4GHI B;  4I3A A;  3FWL A;  5EVL A;  2FFF B;  2XK1 A;  4X53 A;  4LFU A;  4RVA A;  5FL3 A;  4MNR A;  4MMN A;  4RQ9 A;  1S66 L;  3RJU A;  3FKV A;  4XT2 B;  4UQI M;  3WS5 A;  5AQ9 A;  4R3J A;  2OAP 1;  1T19 A;  2Q9M A;  5E2G A;  2EA9 A;  2L4R A;  3O5Y A;  5HDS A;  2BTF P;  3ZFZ A;  2X01 A;  4QD4 A;  4WF0 A;  4GN2 A;  1E25 A;  3BEB A;  4RX3 A;  5DTK A;  2JKR M;  5EVE A;  4NEE D;  2XQZ A;  1BUL A;  2RL3 A;  4OQH A;  4I39 A;  4RYE A;  5GLC A;  2PU4 A;  2XFT A;  3E2L A;  3UE1 A;  2ZM8 A;  4X68 A;  2QYB A;  3OCN A;  5G18 A;  4PM9 A;  1W63 Q;  1LL8 A;  5DTS A;  2JKG A;  3ZG5 A;  3SZT A;  1L0D A;  1NZU A;  5FAO A;  1T1A A;  3M2K A;  2W3G A;  1GHM A;  5IT5 A;  3IX3 A;  4NXB A;  3C4P A;  4OOL A;  4Q0J A;  5HZH A;  5A8B A;  3M2J A;  5F68 A;  3HLE A;  2OSU A;  4JXV A;  1C3B A;  5HFO A;  3UB5 P;  1RCJ A;  3BFE A;  3V5M A;  3QNB A;  2Y2H A;  2ZQ7 A;  5U47 A;  5EOO A;  3NIA A;  4EQI A;  5FAT A;  1YSQ A;  4FCF A;  3ZG8 B;  2XFS A;  4S2L A;  3PAE A;  3C30 A;  3M6H A;  3T4L A;  3SW1 A;  4JF5 A;  4LV3 A;  3GSG A;  1H8Y A;  2J80 A;  4YWZ A;  1F2K A;  2DMW A;  5HX9 A;  4E3I A;  4EBN A;  1SKO A;  4JLF A;  4HES A;  3TRC A;  1PI4 A;  3PXP A;  1XKZ A;  3T50 A;  4IVK A;  3QP5 A;  2ZMF A;  1L0E A;  4OLG A;  1JWP A;  4N1H A;  5HL6 A;  2ZQ9 A;  3TE8 A;  5F1F A;  5CER A;  3VOL A;  3BRM A;  4Y17 A;  2JCH A;  5FI2 A;  2ZM0 A;  2Y2G A;  3N8L A;  1HZO A;  2WKH A;  3G2Y A;  1PW1 A;  1BUE A;  2EX8 A;  5FI6 A;  1VET A;  5FSR A;  2V8C A;  2FH5 A;  3IF6 B;  3E98 A;  3T1R A;  1D06 A;  2JN7 A;  3R7W A;  1VQQ A;  3S7P A;  1XJ4 A;  1NRJ A;  3CIT A;  4P0M A;  3KO6 A;  2V1A A;  3P7N A;  4Y0O A;  1IKG A;  1NXY A;  5EE8 A;  1J3W A;  3PBQ A;  2WKQ A;  3V67 A;  1GSX A;  3KSG A;  2WAE A;  3NBL A;  2QJ5 A;  1QMF A;  5DF8 A;  1EI5 A;  1GSW A;  4QWO A;  3ZCZ A;  1IEL A;  4GCZ A;  4WYY A;  1M40 A;  3QP2 A;  1V9Y A;  3A0R A;  4LCL A;  4KG5 A;  1BLS A;  3BYD A;  2EXA A;  3EEH A;  3G6O A;  1K55 C;  3EEA A;  5CEB A;  4XXR A;  2WKI A;  3IS2 B;  5FQ9 A;  1OTI A;  3C38 A;  2W1T B;  2A24 A;  1XGJ A;  3NC8 A;  1XFQ A;  3VP3 A;  5FDS A;  3MXR A;  1Z09 A;  4OPY A;  2Z6C A;  4C75 A;  5HWV A;  3BFD A;  4FSF A;  5EOE A;  3RFB A;  1T18 A;  4L9F A;  2ZMA A;  3BQ8 A;  1AXB A;  1ACF A;  3IXB A;  1GA0 A;  4MDZ A;  3H7W A;  1G68 A;  4MN5 A;  3MR0 A;  5CHJ A;  4BEN A;  1TS8 A;  4OVD A;  3NOT C;  1IKI A;  1K25 A;  3UO9 A;  5HAP A;  5BOH A;  2Y2Q A;  5IHV A;  1TS6 A;  1K54 C;  1HVB A;  3HVF A;  1K4E A;  3S7O A;  2Y2K A;  3VP4 A;  3LR0 A;  4F3L B;  4ZJ3 A;  2H0Y A;  1S6R A;  1PRQ A;  4I3J A;  2M7V A;  3H9W A;  1BYW A;  5M18 A;  1K55 A;  2OLU A;  4R38 A;  3V3S A;  5CGW A;  1KE4 A;  3BW6 A;  4Z9Q A;  2DRW A;  3LYX A;  3E0Y A;  3HCY A;  4E3O A;  2Q0O A;  1ODV A;  4UA9 A;  2QKP A;  3F1N B;  1MBL A;  3Q1F A;  5KMW A;  3BFG A;  2B02 A;  1ZKJ A;  5FQQ A;  2R78 A;  2PYR A;  5HDC A;  5G4Z A;  4K91 A;  1A0K A;  3IHA A;  4IVI A;  2EX2 A;  4EWF A;  3SS3 A;  2V20 A;  4JF6 A;  1K54 A;  3ITA A;  4E3J A;  4RA7 A;  5EM1 A;  4G3K A;  2XF3 A;  3HJK A;  4ME4 A;  2J7V A;  3VOY A;  4OQI A;  1ZC2 A;  4FH2 A;  3IBJ A;  3DTE A;  1HTZ A;  4P6Z M;  3T1X A;  2XRN A;  5A90 A;  1PWD A;  3CWF A;  4BD0 A;  3KYZ A;  2JKR I;  3TOI A;  2GNX A;  2P9V B;  3W8K A;  2B18 A;  1PWG A;  4GD8 A;  1PZP A;  4R3B A;  2J9O A;  2PHY A;  3UDX A;  1S4R A;  5JYO A;  5GL9 A;  5FQM A;  4P87 A;  4O7D A;  2ZQ8 A;  2VGL M;  4KQD A;  5I5L A;  4B4Z A;  2Y2L A;  5I94 A;  3JYI A;  3W4Q A;  4JGP A;  4DJ2 A;  4O0P A;  1MWU A;  2QPN A;  2ZC3 B;  3HUM A;  2ACG A;  2W0N A;  5F83 A;  3DTM A;  3IT9 A;  2HDS A;  5TGF A;  1BT5 A;  4ETX A;  3PBT A;  4WZ5 C;  2WAF A;  5EEC A;  1ERQ A;  4OKP A;  1BLH A;  3C4O A;  2P7J A;  2XD5 A;  5HWT A;  3P09 A;  3FV7 A;  3UPN A;  2ZC5 B;  4UEY A;  4HEF A;  4N1X A;  2VZW A;  4S2I A;  5L09 A;  2D02 A;  1SHV A;  2Y2I A;  3MQ0 A;  4S2N A;  1P9R A;  3WRT A;  3BLM A;  2RCX A;  3MZF A;  1IEM A;  4GS9 B;  4OOM A;  4R1G A;  1IFQ A;  2WGV A;  2J8Y A;  5DFX A;  4Q0H A;  5TJJ A;  5E43 A;  4S2O A;  4GHI A;  5CEC A;  2P74 A;  3MKE A;  3B33 A;  3D3O A;  1OTA A;  4Y0T A;  3LI8 A;  3T4J A;  1YLT A;  4KQQ A;  2K31 A;  3IWI A;  2INW A;  3IXD A;  4HQA A;  2O99 A;  4XT2 A;  1S4S A;  5CHM A;  2B95 A;  2PBY A;  1F98 A;  1ONG A;  1MWR A;  1OME A;  2WZX A;  3F1O B;  4MBF A;  2Z2M B;  4YNR A;  3V50 A;  2JKT I;  1ERM A;  4LLO B;  2XSS A;  1N9L A;  2ZC4 B;  3LEQ A;  1NWZ A;  3A3F A;  5TBM B;  1W8Y A;  5HL1 A;  4WUJ A;  1H8M A;  2VV6 A;  4ZJ2 A;  5DFY A;  2D01 A;  1I2W A;  3ICY A;  4PAU A;  3S22 A;  1Q2P A;  4MLL A;  1LSW A;  1Y54 A;  4OP8 A;  2Y59 A;  2PRF A;  2A3U A;  4DE0 A;  3T4O A;  2M1C A;  2VV7 A;  4OH0 A;  4HJ3 A;  1PWC A;  1L2S A;  3FG8 A;  3FKW A;  2J9P A;  3IXG A;  2IWB A;  1MY8 A;  2OAQ 1;  4EXO A;  3FPV A;  1WYB A;  3OLO A;  2GX5 A;  2PDR A;  4OP5 A;  2CMN A;  2XD1 A;  1UGU A;  2ZL1 B;  5KSH A;  3MSH A;  4E6X A;  3UN7 A;  2HJ9 C;  3ISG A;  4Z1W A;  3DBA A;  4Y13 A;  4NXG A;  3CAX A;  2JKF A;  1YKD A;  1NLZ A;  1KGE A;  1IYS A;  3TW8 A;  3ZVW A;  4S2P A;  3KYQ A;  1UWP X;  2EFX A;  1LL5 A;  2XR0 A;  3BY8 A;  1YT4 A;  3F1P B;  1ES3 A;  4PKY A;  4KZ9 A;  1VHM A;  5FAQ A;  2WKR A;  2IWC A;  1TS0 A;  3LIA A;  4CLC B;  5K5B A;  2OWJ A;  1JWV A;  4WEL A;  5EVI B;  1CI9 A;  1AWI A;  3L7H A;  5M19 A;  1ERO A;  3MKF A;  1CI8 A;  3DAV A;  3SH7 A;  4HH2 A;  3C5A A;  2XLN A;  1O7E A;  3BM6 A;  1V9Z A;  1PI5 A;  1MPL A;  3MQO A;  5EPH A;  1T1B A;  5HWW A;  4Y0U A;  3SH8 A;  2PYP A;  3IF6 A;  2I72 A;  3IX8 A;  3Q7V B;  3IX4 A;  4QY6 A;  3IWQ A;  4BL3 A;  2KX6 A;  1NY0 A;  3LY4 A;  4O8G A;  1H0M A;  4YFM A;  1ES5 A;  2HP5 A;  3LEZ A;  3UDF A;  3RH8 B;  2V9A A;  1ES2 A;  5HAI A;  4X25 A;  4K0X A;  1VM1 A;  2X71 A;  5HPI A;  4JXW A;  1ALQ A;  1CQA A;  1FIL A;  1OPX A;  3MBZ A;  1BLP A;  3S1Y A;  5FI7 A;  4JF4 A;  4U0X A;  1E4D A;  3FPW A;  4NXF A;  1N9B A;  3IS2 A;  3G35 A;  1OTB A;  3PBN A;  2W1T A;  3G32 A;  3OPL A;  5M1A A;  3SS5 A;  5F6A A;  3BWL A;  1K4F A;  2O0Y A;  3EQU A;  3PBS A;  4DE1 A;  4WL9 A;  3M6B A;  4KZ6 A;  1CF0 A;  3MZD A;  2AVX A;  5A91 A;  3UE6 A;  2Y91 A;  2ZMV A;  3ZYT A;  5FDH A;  5FA7 A;  3VFF A;  2OOL A;  4X56 A;  2UV0 E;  3E4P A;  4WMC A;  2XA7 S;  3TJZ C;  4F3L A;  1GCE A;  1HD8 A;  1DJB A;  2YKH A;  4BBU A;  1GHP A;  5HD5 A;  4KG6 A;  3EQV A;  1K57 C;  4LV0 A;  3JVU A;  3KYE A;  2VX8 A;  4R4R A;  1Q2Q A;  2WKE A;  3F1N A;  1XJ2 A;  1IYO A;  4H6J B;  1TEM A;  2W3H A;  1N9O A;  1KE0 A;  1KGG A;  2DCF A;  1OTD A;  3DTI A;  3BEC A;  1OTE A;  2X02 A;  2WK0 A;  3UB6 A;  5EM0 A;  3H82 B;  4OQ0 A;  1FCM A;  3C7V A;  3LCE A;  5DJT A;  4OOY A;  1S0W A;  3HUN A;  2WGW B;  2MJ6 A;  1K57 A;  3SH9 A;  1YLZ A;  2PT7 A;  1YMX A;  4WEK A;  1LI9 A;  1S67 L;  4FH4 A;  2Y2J A;  3NOU C;  1TDG A;  2QJ7 A;  1FSY A;  1N9N A;  4JXG A;  3T4S A;  1L3L A;  1W5D A;  4RX2 A;  1SZV A;  3GV9 A;  1JTD A;  5EUA A;  5KIZ A;  1RP5 A;  3HLC A;  3CMZ A;  4PKY G;  2HDQ A;  4M3K A;  4OPZ A;  3GEC A;  1XX2 A;  2OV5 A;  1P0Z A;  2O9B A;  4LRY C;  2W3F A;  1ESU A;  3JVV A;  4P6B A;  3A0V A;  4GDB A;  5AVE A;  4B88 A;  3GTC A;  4PMA A;  4HNB A;  1WE4 A;  1DJC A;  4HBT A;  3W4P A;  3K3D A;  1KGF A;  3NHQ A;  4GJ4 A;  3MZE A;  1SCW A;  3AGE A;  3MFX A;  4MBK A;  4DDY A;  2QHK A;  4IUK A;  4D60 A;  1LSX A;  2WAD A;  3Q7Z A;  4GZB A;  4KQO A;  3PYP A;  3L9K A;  3O88 A;  2OWH A;  2NUP C;  3U4L P;  2HP6 A;  2ZM2 A;  3UB9 A;  5L10 A;  4OON A;  1MC0 A;  4GKU A;  2A49 A;  3GQZ A;  1NYM A;  4Y15 A;  4GS9 A;  5TR7 A;  2XGN A;  4WZ4 A;  3VV4 A;  4EEP A;  3EGX C;  1YQS A;  3FYZ A;  1KE3 A;  5AVF A;  4EBP A;  3D9Y A;  4DXB A;  5GLB A;  4KUO A;  5HAQ A;  4LGW A;  1NJ4 A;  5GHY A;  3HLG A;  4ZAM A;  2ZC6 B;  2ZQC A;  2IWD A;  4AFI A;  1DP8 A;  2QMI A;  4ZTK A;  3K3C A;  4LEN A;  4IUH A;  4EW7 A;  2V0W A;  1TD5 A;  3MF0 A;  2H0T A;  3R4K A;  4JGQ A;  1OT9 A;  1TF1 A;  3IBR A;  3HUO A;  3F1O A;  4S2N C;  1JNU A;  4MCW A;  1XXM A;  3BY9 A;  4X1L A;  3A3E A;  2Y79 A;  2VV8 A;  2R9W A;  4FOF A;  4XUZ A;  1SDE A;  3VSL A;  2C5W B;  1ES4 A;  3T12 B;  1NYY A;  5CX7 A;  3TSG A;  2GJ3 A;  3CZD A;  3RXX A;  4QB8 A;  5TBM A;  4UAA A;  2ZOH A;  3IH8 A;  4OPQ A;  4ETZ A;  3N8S A;  2P08 A;  4NK3 A;  4MN7 A;  5CTN A;  3S7N A;  2QZ6 A;  2ZLY A;  4S2K A;  1OT6 A;  1PNE A;  3ZG9 B;  3BJN A;  3CHW P;  3KX0 X;  2HF6 A;  4HI4 A;  2KLI A;  2NUT C;  3G31 A;  5LBR A;  3T4K A;  4PM5 A;  5C5K A;  3A3D A;  4HIA A;  5AQB A;  4EET B;  4R70 A;  2CC1 A;  4N9K A;  1LI0 A;  3FC7 A;  2Z2L B;  5EFW A;  5HPF A;  3LUQ A;  3QP6 A;  4PM7 A;  4E3K A;  4Q0I A;  4K08 A;  1D1J A;  2UWX A;  1K38 A;  2HDU A;  4L0L A;  2LB5 A;  4M4X A;  2ZL1 A;  4S2M A;  2GZA A;  5HDD A;  4KZ5 A;  4X69 A;  1ZG6 A;  3LID A;  5E2H A;  5GHX A;  4PPR A;  3FZC A;  1FSW A;  3LIC A;  4S2J A;  3UMD A;  5DTT A;  1MKM A;  3WS1 A;  4BWI A;  1TVF A;  1NRF A;  2HGV A;  3LY3 A;  1ONH A;  1YLP A;  3HL9 A;  1XPB A;  3DW0 A;  2WYX A;  3N4I A;  1STZ A;  3ZNY A;  2ZD8 A;  4O01 A;  4HP9 A;  5J8X A;  1DP9 A;  3F1P A;  3A0S A;  1Y28 A;  4JGO A;  1YPR A;  3MMH A;  5CRF A;  3SS4 A;  1RGY A;  1G28 A;  3NDE A;  3I7J A;  4KUK A;  4JGR A;  4II7 A;  5KSC A;  5A93 A;  4BJP A;  5F1G A;  2XDM A;  3N7W A;  1TDL A;  1G6O A;  4P6Z S;  3ZG7 B;  3W4O A;  2HZ5 A;  2V8F A;  4H8R A;  2H5S A;  4KZ8 A;  3UNW A;  4E6W A;  1XP4 A;  4PM8 A;  2HP9 A;  1SDN A;  2VJW A;  1ZTU A;  1YLW A;  2K2N A;  2PR5 A;  2L0W A;  5E2E A;  2PD7 A;  4E3L A;  1OJ5 A;  2R9X A;  4EU0 A;  4GNU A;  3WS0 A;  4F94 A;  3KSF A;  5FAS A;  5FEG A;  3UB7 A;  4BQM A;  3HLW A;  3Q7V A;  3KSH A;  3LI9 A;  2W3E A;  2WUQ A;  3LGO A;  3BFC A;  3NDG A;  4IJG A;  3T1S A;  2ZBB A;  4ARZ B;  3ZGA B;  4NKP A;  3DWK A;  3VE3 A;  1XGI A;  4JXS A;  4G3W A;  2VKS A;  4HP4 A;  4Y3I A;  2H10 A;  5F5Y A;  4EQ1 A;  1KVL A;  5DJU A;  2I9V A;  3LFV A;  1I5Q A;  1YAX A;  1L0G A;  4CJN A;  4WMC D;  2DNS A;  3CLO A;  1H5X A;  4N92 A;  2V1B A;  1H3Q A;  3HBR A;  1XFN A;  3IF6 C;  1XJ6 A;  5G4Y A;  2JE5 A;  3VE4 A;  1CJF A;  2W27 A;  4KQR A;  3VOZ A;  2XA7 M;  1G5U A;  3BQA A;  3T4T A;  4JPM A;  3E4O A;  1IYQ A;  4KG2 A;  3GVB A;  1O07 A;  4FD8 A;  3UPP A;  4CPK A;  3NI9 A;  4EES A;  5KZH A;  4GB7 A;  1OJG A;  4WLA A;  2EX6 A;  1MKI A;  3T4Q A;  1CEG A;  4BMW A;  2B5R A;  5AQ7 A;  1H8Z A;  3BFF A;  1CEF A;  3BLS A;  1EWZ A;  4L9E A;  4ZBE A;  1RGZ A;  3QP1 A;  1M6K A;  2Y2M A;  3UE0 A;  4UA7 A;  2M7U A;  5HD3 A;  3HLF A;  1VEU B;  4DXC A;  3ZQ5 A;  5MC7 A;  4HJ6 A;  4KZ4 A;  2EXB A;  1DJA A;  1W63 M;  5FEF A;  1NZO A;  3D72 A;  3HRE A;  2VLG A;  3AGD A;  3LIB A;  3VP0 A;  5HAR A;  4N9L A;  4GOG A;  1P9W A;  1FCN A;  2W1R A;  4IED A;  4GDN A;  2HDR A;  4H6J A;  3QP4 A;  3PBO A;  3TG9 A;  3IXH A;  4LV1 A;  3QHY A;  3ZHH A;  3NJA A;  1JVJ A;  1JTG A;  3RXW A;  3WWX A;  1MZU A;  1P97 A;  3LR4 A;  4U3T A;  4NG2 A;  4Y2F A;  2BG1 A;  2W3D A;  5FQJ A;  4PM6 A;  1S1Z A;  3CPT B;  3G30 A;  3GRJ A;  5D3O A;  3H82 A;  3P98 A;  4ESP A;  2Y8H A;  3CG5 A;  4IBR A;  1FIK A;  3OC2 A;  3G34 A;  3B42 A;  5CGX A;  2WGW A;  3ZVT A;  3NOP C;  5F82 A;  4BL2 A;  5F69 A;  4QY5 A;  4YIN A;  3SOI A;  4LRZ E;  4X55 A;  1IYP A;  1FR1 A;  2OLV A;  3HJI A;  2J3W A;  2G2U A;  4HOI A;  1F5M A;  3VSK A;  4EEU A;  4HBU A;  3NY4 A;  5DKK A;  3K2N A;  3OPR A;  3ITB A;  5L2F A;  1FCO A;  3O3V A;  2O9A A;  4LCM A;  3OPP A;  3NEC A;  5J4E A;  3WS2 A;  2FZ0 A;  4FTX A;  1UWN X;  2O9C A;  4KZA A;  3UE3 A;  4JKT A;  4UQI S;  4UA6 A;  1K6R A;  1GHI A;  2Y4A A;  2PAV P;  4B4X A;  1PIO A;  2VA0 A;  2G2W A;  2PR6 A;  1MWT A;  2G7U A;  1PW8 A;  4L9G A;  3P01 A;  2JKT M;  1LL9 A;  3EGD C;  2H28 A;  4X1M A;  1GSV A;  2V1Z A;  1FR6 A;  3CI6 A;  5DF7 A;  1FOF A;  1W79 A;  3IQA A;  2ZQA A;  3LIE A;  3GMW A;  4B9O A;  1HLU P;  3IH9 A;  1YLY A;  3QNC A;  4NXE A;  3CUE C;  1ZG4 A;  4I3I A;  1WA9 A;  3PBR A;  1L0F A;  4A5R A;  4LV2 A;  4DE3 A;  3QP8 A;  4D2O A;  2E8J A;  4HJ4 A;  4DE2 A;  5FQI A;  3UDI A;  4ID4 A;  3HLD A;  4DJ3 A;  3CJM A;  2P9V A;  4WEJ A;  3KSI A;  3UY6 A;  4HH3 A;  1SKO B;  1TS7 A;  4R4S A;  1VB6 A;  2ZQD A;  1X0O A;  4E3N A;  3GDI A;  5FQK A;  5JYP A;  5HW3 A;  3UME A;  4R0Q A;  1BZA A;  1LSV A;  4EV4 A;  2C6W B;  1K56 D;  2E8I A;  3CUE A;  4GW9 A;  2ZOI A;  1QME A;  5HSQ A;  4BD1 A;  4WN5 A;  5GLD A;  2LB9 A;  2V0U A;  2JBF A;  3N8R A;  2Y2N A;  3G4P A;  4I38 A;  4DKI A;  4QJG A;  4CLC E;  1VET B;  2XRO A;  5TFQ A;  4Y5F A;  1K6S A;  3R7W B;  2JC7 A;  4JBF A;  1YSP A;  2GDN A;  2Y2O A;  4CQH A;  3OPH A;  4OLD A;  3WRZ A;  3EWK A;  3EOI A;  4Q8I A;  3IWO A;  3D4F A;  1E3U D;  5DVA A;  3C7U A;  3S7Q A;  2Y55 A;  4IHQ A;  1Z6F A;  1GA9 A;  4LPZ A;  4CLC D;  4C6Y A;  1ESI A;  3V39 A;  4B93 A;  5EVI D;  3Q81 A;  5CTM A;  2WZZ A;  4X6T A;  4KZ3 A;  3ZG0 A;  1IOU A;  3VMA A;  1S1Y A;  1Y4O A;  4GD6 A;  4K0W A;  2VGJ A;  3MJQ A;  3OOV A;  5IU1 A;  1XA7 A;  4EUV A;  4ZDX A;  3MQQ A;  5L07 A;  3NCK A;  2A24 B;  4YOF A;  3V3R A;  1PZO A;  4U0T A;  1YLJ A;  5CXW A;  2EFU A;  1PYY A;  1W7F A;  4WM9 A;  4EER A;  4GLQ A;  1WYC A;  3UPO A;  1T1C A;  3H7W B;  1BTL A;  2L1M A;  4WBG A;  1FQG A;  1MWS A;  2HPB A;  3LO7 A;  4FUW A;  1NLY A;  5A92 A;  4MBH A;  2VEA A;  3JPU A;  3S4X A;  5AJG A;  4MN6 A;  3E2K A;  1JWZ A;  2FFY A;  4R6L A;  4OPR A;  5L8M A;  4EBL A;  2HV1 A;  3B47 A;  3E4Q A;  1YM1 A;  5CED A;  2IA2 A;  1MXO A;  1G6A A;  5J7E A;  3B3X A;  1BSG A;  4UHU A;  1N4O A;  4PHT A;  4KZB A;  3LIF A;  3GR2 A;  4DF6 A;  3T1Q B;  2J3T D;  2A2L A;  5J3W A;  2JHE A;  1KDW A;  3ULF A;  3O86 A;  3A3J A;  4ARZ A;  4HY8 A;  4KEN B;  4CLC C;  3C8C A;  4IBX A;  4NET A;  5EVI C;  1ZHH B;  1K56 A;  3PHY A;  5E2F A;  5DKL A;  2BLS A;  4DN0 A;  5AQA A;  3AGF A;  2QWS A;  5FAP A;  2KOI A;  3LR5 A;  4BBV A;  3VFH A;  2VGK A;  2YKF A;  3WS4 A;  4OQG A;  1DP6 A;  2EWW A;  2Y2P A;  2P04 A;  3UB8 A;  4LRX C;  3VP1 A;  3VP2 A;  1U60 A;  2BAS A;  1LHY A;  1I2S A;  3A3I A;  5GHZ A;  1KDS A;  5DF9 A;  4EUZ A;  5CGS A;  2XEP A;  3G2Z A;  3PR6 A;  2K7S A;  1J9M A;  2Z6D A;  1E3U A;  4E04 A;  5EV0 A;  4MEZ A;  3N6I A;  3IF5 A;  4WZ5 A;  2EX9 A;  2XH9 A;  1XJ3 A;  4CLC A;  1KOU A;  5EVI A;  3MS6 A;  2VK3 A;  4ZRR A;  2WGI A;  2PD8 A;  1DY6 A;  4BBT A;  1CK3 A; 
#chains in the Genus database with same CATH homology
 3C2W A;  1OTE A;  4QPR A;  3OBF A;  2EWV A;  3KYZ A;  1P9W A;  2JKR I;  3UB6 A;  2WKP A;  2GNX A;  2W1R A;  3W2Z A;  3H82 B;  2B18 A;  4H6J A;  5DJT A;  2PHY A;  1D7E A;  3PBO A;  2KDK A;  2J3T C;  4I5S A;  1S4R A;  3MXQ A;  2MJ6 A;  3NJA A;  3OCL A;  5IS1 A;  1MZU A;  1P97 A;  1EW0 A;  2VGL M;  4KQD A;  5I5L A;  3LR4 A;  2VGL S;  3LR3 A;  2PT7 A;  4Y2F A;  3RTY A;  2W3D A;  4WEK A;  1LT0 A;  1S1Z A;  4DMZ A;  4JGP A;  1S67 L;  4DJ2 A;  4O0P A;  3H82 A;  4G3V A;  4R3A A;  4HHD A;  2W0N A;  3U2A A;  2Y8H A;  3NOU C;  2QJ7 A;  2HJE A;  1N9N A;  3OC2 A;  3T4S A;  3B42 A;  4ETX A;  3NOP C;  3PBT A;  1DRM A;  1F9I A;  5F69 A;  4LRZ E;  5KIZ A;  2P7J A;  5HWT A;  3HJI A;  4UEY A;  2J3W A;  4PKY G;  4HOI A;  1F5M A;  4EEU A;  5DKK A;  2VZW A;  3K2N A;  4GHI B;  4I3A A;  3GEC A;  1P0Z A;  2D02 A;  2O9B A;  4LRY C;  2W3F A;  3JVV A;  3MQ0 A;  1P9R A;  2O9A A;  3A0V A;  5AVE A;  5J4E A;  5FL3 A;  2FZ0 A;  4HNB A;  4GS9 B;  4MMN A;  4OOM A;  1UWN X;  2O9C A;  4RQ9 A;  1S66 L;  1IFQ A;  3UE3 A;  3K3D A;  3NHQ A;  4XT2 B;  4UQI M;  4GJ4 A;  4UQI S;  3MFX A;  2QHK A;  5DFX A;  4IUK A;  4Q0H A;  2OAP 1;  1LSX A;  5TJJ A;  4KQO A;  1T19 A;  4GHI A;  3PYP A;  2EA9 A;  2OWH A;  2VA0 A;  2NUP C;  3B33 A;  2PR6 A;  3D3O A;  3UB9 A;  1OTA A;  2L4R A;  2G7U A;  3LI8 A;  3O5Y A;  5HDS A;  3T4J A;  4L9G A;  1MC0 A;  2K31 A;  3P01 A;  2JKT M;  4WF0 A;  3EGD C;  2H28 A;  2INW A;  4GS9 A;  1GSV A;  4HQA A;  2O99 A;  2JKR M;  4XT2 A;  3VV4 A;  1S4S A;  3EGX C;  4NEE D;  4EEP A;  3CI6 A;  5AVF A;  1F98 A;  4I39 A;  3F1O B;  4KUO A;  4YNR A;  3LIE A;  2JKT I;  4LLO B;  4AFI A;  2XSS A;  1DP8 A;  4B9O A;  2QYB A;  1N9L A;  3OCN A;  3K3C A;  4NXE A;  3CUE C;  1W63 Q;  4IUH A;  1LL8 A;  4EW7 A;  1NWZ A;  2V0W A;  1TD5 A;  3MF0 A;  5TBM B;  4I3I A;  3R4K A;  1WA9 A;  3PBR A;  1T1A A;  2W3G A;  4WUJ A;  1H8M A;  2VV6 A;  4JGQ A;  1OT9 A;  1TF1 A;  5IT5 A;  5DFY A;  3IBR A;  4NXB A;  2D01 A;  4OOL A;  3F1O A;  4Q0J A;  5HZH A;  3ICY A;  1JNU A;  4PAU A;  4MCW A;  4HJ4 A;  5A8B A;  3BY9 A;  2Y79 A;  2VV8 A;  5F68 A;  4FOF A;  1LSW A;  4DJ3 A;  3T4O A;  2M1C A;  4WEJ A;  3KSI A;  5CX7 A;  2VV7 A;  2GJ3 A;  4HJ3 A;  4HH3 A;  5TBM A;  1TS7 A;  1VB6 A;  2ZOH A;  3FG8 A;  1X0O A;  4ETZ A;  2P08 A;  1YSQ A;  4MN7 A;  3GDI A;  3S7N A;  1OT6 A;  2OAQ 1;  4EXO A;  3UME A;  3FPV A;  3BJN A;  3OLO A;  3KX0 X;  1LSV A;  2HF6 A;  3C30 A;  2GX5 A;  3T4L A;  3CUE A;  4GW9 A;  2ZOI A;  4HI4 A;  3SW1 A;  2PDR A;  2KLI A;  2NUT C;  5HSQ A;  2CMN A;  2J80 A;  1UGU A;  5LBR A;  4YWZ A;  3T4K A;  2DMW A;  5KSH A;  4WN5 A;  2LB9 A;  2V0U A;  5C5K A;  4HIA A;  4I38 A;  4EET B;  4R70 A;  4CLC E;  2HJ9 C;  4Z1W A;  3DBA A;  3TRC A;  3PXP A;  2XRO A;  3T50 A;  4NXG A;  2ZMF A;  3CAX A;  1YKD A;  1NLZ A;  3TW8 A;  4Y5F A;  5HL6 A;  3FC7 A;  3R7W B;  3TE8 A;  5EFW A;  5HPF A;  3LUQ A;  1YSP A;  3VOL A;  3KYQ A;  4CQH A;  1UWP X;  4Q0I A;  4K08 A;  3BY8 A;  3F1P B;  4L0L A;  4PKY A;  2LB5 A;  3EWK A;  4M4X A;  3EOI A;  2GZA A;  5HDD A;  3LID A;  1VHM A;  2WKR A;  3LIC A;  3S7Q A;  1TS0 A;  4IHQ A;  3LIA A;  4CLC B;  3UMD A;  2FH5 A;  1MKM A;  4BWI A;  4LPZ A;  2HGV A;  5K5B A;  2OWJ A;  4WEL A;  3E98 A;  4CLC D;  1D06 A;  2JN7 A;  3R7W A;  1STZ A;  4B93 A;  4O01 A;  3S7P A;  4HP9 A;  1XJ4 A;  4HH2 A;  1NRJ A;  1DP9 A;  3CIT A;  1IOU A;  3F1P A;  1S1Y A;  3A0S A;  1Y28 A;  3KO6 A;  4JGO A;  3MMH A;  2V1A A;  1V9Z A;  3P7N A;  3PBQ A;  3MJQ A;  3MQO A;  2WKQ A;  1G28 A;  1T1B A;  3OOV A;  5IU1 A;  3V67 A;  4EUV A;  5HWW A;  1GSX A;  3KSG A;  2QJ5 A;  4KUK A;  4JGR A;  3MQQ A;  2PYP A;  4II7 A;  4BJP A;  2A24 B;  4YOF A;  1GSW A;  1G6O A;  4P6Z S;  4GCZ A;  4EER A;  1V9Y A;  3A0R A;  4GLQ A;  2VJW A;  1ZTU A;  2K2N A;  2PR5 A;  2L0W A;  1T1C A;  2PD7 A;  1OJ5 A;  3H7W B;  2L1M A;  3EEH A;  3G6O A;  2KX6 A;  3EEA A;  4O8G A;  4EU0 A;  3IS2 B;  3KSF A;  1NLY A;  1OTI A;  3C38 A;  3UB7 A;  2W1T B;  2VEA A;  2A24 A;  5AJG A;  1XFQ A;  4MN6 A;  3RH8 B;  2V9A A;  3KSH A;  3LI9 A;  2W3E A;  4IJG A;  4R6L A;  5L8M A;  2Z6C A;  2HV1 A;  5HPI A;  5HWV A;  2ZBB A;  3B47 A;  4FSF A;  3RFB A;  4ARZ B;  3E4Q A;  1T18 A;  4L9F A;  3BQ8 A;  4NKP A;  2IA2 A;  3VE3 A;  1OPX A;  4MDZ A;  3H7W A;  4MN5 A;  3MR0 A;  1TS8 A;  4G3W A;  3NOT C;  2VKS A;  5J7E A;  4HP4 A;  3FPW A;  4Y3I A;  4NXF A;  3IS2 A;  5F5Y A;  1OTB A;  3PBN A;  2W1T A;  4PHT A;  4EQ1 A;  5DJU A;  1TS6 A;  3LIF A;  2I9V A;  3LFV A;  5F6A A;  2J3T D;  3S7O A;  3BWL A;  1YAX A;  3LR0 A;  4F3L B;  2A2L A;  2O0Y A;  3EQU A;  5J3W A;  3PBS A;  2JHE A;  4WL9 A;  3ULF A;  3CLO A;  4ARZ A;  4HY8 A;  4CLC C;  4I3J A;  3C8C A;  3UE6 A;  2M7V A;  3H9W A;  2V1B A;  1H3Q A;  1XFN A;  1XJ6 A;  2ZMV A;  1BYW A;  1ZHH B;  3ZYT A;  5G4Y A;  3PHY A;  4R38 A;  5DKL A;  3VE4 A;  2W27 A;  4DN0 A;  2OOL A;  2QWS A;  2KOI A;  3E4P A;  3BW6 A;  3LR5 A;  4BBV A;  3LYX A;  3E0Y A;  3HCY A;  2YKF A;  1ODV A;  2XA7 M;  2XA7 S;  3TJZ C;  4F3L A;  2QKP A;  1DP6 A;  2EWW A;  3F1N B;  3BQA A;  3T4T A;  2P04 A;  3UB8 A;  4LRX C;  2BAS A;  3E4O A;  2YKH A;  2B02 A;  2R78 A;  4EES A;  2PYR A;  5HDC A;  5G4Z A;  1OJG A;  4WLA A;  4BBU A;  5DF9 A;  5HD5 A;  3PR6 A;  3T4Q A;  2K7S A;  4BMW A;  3EQV A;  2Z6D A;  3JVU A;  4E04 A;  2VX8 A;  4G3K A;  4L9E A;  3F1N A;  1XJ2 A;  3HJK A;  1XJ3 A;  4CLC A;  4H6J B;  4ME4 A;  1KOU A;  2W3H A;  2M7U A;  5HD3 A;  1N9O A;  3IBJ A;  5MC7 A;  3ZQ5 A;  4HJ6 A;  4P6Z M;  4ZRR A;  2XRN A;  1W63 M;  2PD8 A;  1OTD A;  3D72 A;  4BBT A;  2VLG A;  3LIB A;  3CWF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...