1DRMA

Crystal structure of the ligand free bjfixl heme domain
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
119
structure length
119
Chain Sequence
b'IPDAMIVIDGHGIIQLFSTAAERLFGWSELEAIGQNVNILMPEPDRSRHDSYISRYRTTSDPHIIGIGRIVTGKRRDGTTFPMHLSIGEMQSGGEPYFTGFVRDLTEHQQTQARLQELQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords SENSOR PROTEIN FIXL
molecule tags Transferase
source organism Bradyrhizobium japonicum
publication title Structure of a biological oxygen sensor: a new mechanism for heme-driven signal transduction.
pubmed doi rcsb
total genus 31
structure length 119
sequence length 119
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2000-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1drmA00
2WKPA 4JGRA 2I9VA 4EEUA 2VEAA 2PR6A 4M4XA 2QWSA 4H6JB 3UE6A 3OLOA 4L9FA 3PHYA 2QJ7A 3UB7A 4NXFA 4BBTA 3LYXA 1N9OA 1XJ2A 1GSXA 2OWJA 3K3DA 2CMNA 4YWZA 3NHQA 1ODVA 4NXEA 4I38A 4PKYA 5HDSA 3C2WA 2R78A 4F3LA 3IS2B 2A24B 4HY8A 5AVEA 2ZOIA 1MZUA 3IS2A 1NWZA 3BWLA 3F1NA 2VV7A 4HJ4A 4L9GA 4NXBA 5F5YA 5HWTA 3VE4A 3K3CA 3UMDA 4PKYG 3LUQA 2PYRA 1D7EA 3CWFA 4HQAA 5HWWA 3T50A 3ZQ5A 2QKPA 1KOUA 4E04A 1DP8A 3LIDA 2BASA 1OJ5A 2PD8A 3VE3A 1TS8A 2L4RA 4WN5A 3F1PA 4EETB 4HP9A 2KX6A 1TS0A 5J3WA 4DJ2A 3RH8B 5KIZA 2PD7A 2YKFA 4JGOA 4I5SA 2J80A 1DP6A 3F1NB 3HJIA 4I3IA 4BBVA 5DJTA 5TBMB 4HH3A 1GSWA 1N9NA 3F1OB 4EEPA 1S1ZA 1LSVA 4HI4A 3E4PA 4WL9A 4L9EA 2VLGA 1P0ZA 1F9IA 2OWHA 3MQOA 3MR0A 1OTBA 2D02A 2PR5A 3A0RA 3E4OA 3LIEA 2HV1A 2L0WA 3C8CA 4R3AA 2K7SA 1VB6A 2EA9A 5G4YA 2PYPA 4KUKA 5G4ZA 1X0OA 4HP4A 3NOTC 5DKLA 5IU1A 4JGPA 5I5LA 4EERA 1G28A 1OTIA 2PHYA 4LRZE 1BYWA 3NOPC 4XT2A 1P97A 5J4EA 2JHEA 3FG8A 2VV6A 3MJQA 4HOIA 4K08A 4LLOB 2A24A 1T1CA 2GJ3A 1OT9A 2ZBBA 3HJKA 3KX0X 3CLOA 3H82B 2ZOHA 4GHIB 5AVFA 3RTYA 1T1BA 4HHDA 5F68A 1UGUA 3NJAA 2M1CA 4KUOA 1LSWA 4EQ1A 4F3LB 5HSQA 5HDDA 3BY8A 4EESA 2JN7A 5HD5A 3D72A 3GECA 3F1OA 4LRYC 4I3AA 3IBRA 5DJUA 4DJ3A 4R70A 1N9LA 3LIFA 1T18A 1V9YA 2INWA 1T1AA 1OTDA 3MXQA 3SW1A 3H9WA 1EW0A 3LI8A 2WKQA 1V9ZA 3LI9A 3LIBA 5TBMA 4H6JA 4BBUA 4I3JA 3LICA 2V0WA 2QJ5A 3A0SA 5EFWA 2OOLA 1LSXA 4NXGA 4R38A 2KDKA 4HIAA 3VOLA 1DP9A 2W0NA 3H7WB 5HZHA 3PYPA 3UB9A 4EXOA 1OJGA 5A8BA 4GHIA 1GSVA 4R6LA 2V0UA 3P7NA 1JNUA 1OTAA 3ULFA 1XFQA 1OT6A 1LL8A 4MN5A 3UB8A 1S66L 4GW9A 1T19A 1OTEA 4WF0A 5DKKA 4MN6A 4LRXC 3ICYA 1DRMA 5F6AA 1S4SA 5F69A 2Z6DA 4JGQA 2W27A 3LIAA 1S4RA 2WKRA 2P7JA 3CAXA 2D01A 3GDIA 3NOUC 4HH2A 4RQ9A 3UMEA 3H82A 1S67L 3A0VA 1F98A 4HNBA 5HDCA 1WA9A 4I39A 3BY9A 2YKHA 3EWKA 4HJ3A 1UWPX 5HWVA 1XJ4A 4WLAA 2QHKA 1XJ6A 1S1YA 2H28A 3E4QA 2VV8A 2L1MA 4LPZA 1XJ3A 4B9OA 4EW7A 2V1AA 1D06A 3B33A 5HD3A 3F1PB 3EEHA 4WUJA 3FC7A 3G6OA 1Y28A 4HJ6A 1LT0A 2B02A 4KQDA 4XT2B 1TS6A 3H7WA 5J7EA 5IS1A 1UWNX 1XFNA 3MQQA 4GS9A 2PDRA 4GCZA 3UB6A 1TS7A 3MFXA 4GS9B 2V1BA 2V9AA 2Z6CA
chains in the Genus database with same CATH superfamily
3WS1A 3S22A 2NUPC 4BBTA 3LYXA 1VETB 4PM7A 5HDSA 2VX8A 3BM6A 3PXPA 3O5YA 3BFEA 2VGLS 2Y79A 3BFFA 1DP8A 1RP5A 1I2WA 1PYYA 3QNCA 4EETB 4YINA 4BD1A 4G3KA 4O8GA 1D1JA 3NCKA 5G18A 3EGDC 3UNWA 4C3QA 2XGNA 4FOFA 3C30A 5DTSA 2A49A 3HLWA 4L9EA 3MQOA 3E4OA 3JYIA 4JXWA 4C6YA 3UDXA 5A91A 5U47A 1P97A 1L0GA 4HOIA 3BJNA 5EE8A 1KE4A 4EBPA 3LY3A 1HZOA 5LBRA 2BTFP 4QU3A 3BY8A 3UPOA 1PZOA 4R70A 4P6ZM 2J9PA 4CJNA 1ZG6A 3HLGA 4H6JA 4LCLA 4FSFA 5FDHA 2OOLA 5AQAA 2W0NA 2G2WA 4IBRA 5CGXA 3C7UA 4G3WA 5K5BA 3UE3A 4S2MA 3NOUC 1VQQA 2D01A 2XK1A 4BBUA 1PFLA 2W1TA 1S1YA 2V20A 4LPZA 1XPBA 4IEDA 4OPYA 3V67A 3ZNYA 4ZAMA 1CK3A 2Y91A 2QPNA 3KSIA 1BLHA 2Z6CA 3IXHA 2WKPA 3MZFA 3M2KA 4EEUA 3MQ0A 1ES2A 1TDGA 4Y0TA 2FFYA 1DJAA 4X1LA 1MZUA 3UDFA 3NI9A 2VV7A 3CJMA 2ZC5B 2XF3A 3IXGA 3N4IA 3O86A 4HP9A 3W2ZA 5KIZA 1A0KA 2BG1A 2Y2NA 4OOMA 3S7PA 3KSGA 2DRWA 2HV1A 4ZTKA 4N92A 2PHYA 3FG8A 4K08A 3BQ8A 5DTKA 5E2EA 1MY8A 4IVIA 3HL9A 1EROA 3LO7A 3N8SA 3IBRA 1V9YA 4GDNA 1NZUA 3LI8A 3IHBA 3K2NA 3LI9A 3LIBA 4NG2A 4RVAA 4QY5A 5HPFA 1KDWA 3WS0A 3JPUA 3ULFA 3GTCA 4KZ3A 1FR1A 3RFBA 3ZG5A 5F6AA 2J7VA 3KYQA 2WGVA 4PM9A 1YSPA 1N4OA 2H28A 2JKFA 1CF0A 2V1AA 3BYDA 5J7EA 1S6RA 3OC2A 3C5AA 3LCEA 1K6RA 4NXFA 5I94A 2PT7A 3Q07A 1ODVA 4GOGA 3R7WB 3OBFA 4LV0A 3BWLA 3W4PA 5BOHA 1TDLA 4HESA 1TS8A 5HFOA 2HJEA 2XDMA 3IQAA 5HAIA 2Q9MA 4DE1A 5DJTA 3HREA 1N9NA 3ZHHA 2WAEA 2ZJ9A 4S2KA 3ZVWA 1ES3A 3V50A 4Y0OA 5DKLA 2PBDP 4UA9A 3U4LP 3KSFA 2QYBA 4KQRA 4LFUA 2HP6A 3HUMA 3TSGA 3C38A 3BW6A 3E0YA 3GRJA 1HLUP 4E3JA 4IHQA 5HD5A 1IOUA 3D72A 2C5WB 3VP2A 4N1HA 4N1XA 2J9OA 3D9YA 1RGZA 2NUTC 2INWA 1IYPA 1OTDA 3MFDA 1XGJA 3HCYA 3BLMA 5DF8A 4R38A 1DP9A 3DBAA 4WM9A 2OAP1 1G5UA 2JCHA 2ZC6B 1Q2QA 3NDEA 1H3QA 4DKIA 3ZNTA 3MZDA 4KZBA 2W27A 2W3EA 3A0VA 4HNBA 2ZMFA 3IBJA 1XX2A 3EWKA 4DMZA 5EM0A 1MWTA 3E4QA 1YLTA 2J3TD 1ERMA 5GLCA 5IS1A 4GS9A 4GKUA 3HLDA 1EWZA 4R23A 4R0QA 3FPWA 5FQIA 5GLAA 3NHQA 3Q7ZA 4PKYA 2WADA 4QD4A 3C2WA 3IS2B 2A24B 2P9VA 2XD1A 4IBXA 5F83A 1KGEA 4EU0A 3F1NA 5HWTA 5F5YA 3LUQA 3HUNA 2WGIA 2QKPA 4O0PA 1WYCA 5FI7A 2B95A 3VE3A 4PM5A 4S2PA 1DP6A 5FQ9A 1QMFA 5L8MA 2D02A 3N8RA 4E3IA 4LRZE 4XT2A 2P74A 4FTXA 1YT4A 3HJKA 5AQBA 2WKIA 4GHIB 2AVXA 4HHDA 4WBGA 4Q0JA 2ZMVA 4UA6A 5FATA 3G34A 3UB5P 3BLSA 2EX9A 4EESA 4PPRA 2JN7A 1MPLA 5CHUA 3H9WA 3LEQA 4CLCD 4Q0IA 2M7UA 4G3VA 3SOIA 2QJ5A 2Y8HA 3VOLA 4KQQA 1ALQA 4DF6A 5A8BA 2V0UA 2XRNA 2VA0A 2XFSA 2E8JA 3V39A 4LV2A 3RJUA 1OTEA 2EX8A 2ZQ9A 3CAXA 4HH2A 4UQIS 4HJ3A 3MXSA 3MXRA 1ONHA 2R9WA 2A3UA 5D3OA 4JPMA 2CC1A 3NBLA 1VEUA 3QP5A 4GS9B 3G35A 3TG9A 4CLCA 2EWVA 1IELA 3UE6A 2V1ZA 4L9FA 3LR0A 4WZ5A 1W8QA 2ZM0A 4XXRA 3IXBA 5DTTA 4MN7A 1JTDA 3O87A 1O7EA 1KOUA 4GLQA 2PD8A 2XA7M 1CI9A 2X01A 3T4SA 1JWZA 5HAQA 3E98A 4EEPA 3M6BA 1LSVA 4HI4A 4BWIA 2Y59A 1Q2PA 3S4XA 4MDZA 2EA9A 3N8LA 1IFQA 1LI9A 1ES4A 4DRTA 1PWDA 4BLMA 3KO6A 2M1CA 2HDUA 1LSWA 5HSQA 1U60A 5E2GA 4B93A 1JWPA 1T18A 4X6TA 4QY6A 4HIAA 5FL3A 2W1TB 3PYPA 2H5SA 4KQOA 4LV3A 1SHVA 3DW0A 1T19A 2IWDA 1VHMA 4C75A 3LIAA 3UMEA 1MBLA 1JVJA 3PBTA 4P87A 5AQ7A 4K91A 3B33A 1PWGA 2ZL1B 2ZD8A 4MEZA 1HD8A 4OQHA 5GHZA 4GJ4A 1NY0A 1TS7A 1K38A 1AWIA 3S7OA 3A3JA 2EFXA 4DE2A 4H6JB 3OLOA 1MC0A 2QJ7A 4KZ9A 1N9OA 1LL9A 1MWSA 5EVLA 4KZ7A 1FCOA 1ERQA 4L9GA 5FDSA 1Y4OA 2PYRA 3CWFA 2ZC7A 3MKFA 4JXGA 3OCNA 4MLLA 3MZEA 4GN2A 2JKRM 1YMSA 3A3EA 3IH9A 1F2KA 3F1OB 2G2UA 2KLIA 2VLGA 4X69A 3AGFA 4M3KA 4E6WA 1CI8A 3OPLA 3NOPC 4WEJA 4LGWA 4LLOB 5E2FA 1IKGA 5A93A 5F1GA 5AVFA 2ZM2A 1UGUA 4K0XA 3UN7A 4NETA 4GDBA 3CZDA 3GQZA 4QB8A 3LY4A 3DTKA 3OPRA 1V9ZA 2JKTM 3EOIA 3V3SA 3VFFA 3G31A 2HZ5A 3AGEA 4X25A 2ZQ7A 2PBYA 2E8IA 4LRXC 4O01A 2Z6DA 5KSHA 3MMHA 2P7JA 2OAQ1 4NEED 2WGWA 4ZJ1A 4WZ5C 2PAVP 3IH8A 1YM1A 2Y2PA 2XA7S 5HWVA 1H5XA 4OQGA 1ONGA 2ZC4B 4WUJA 2ZM8A 3OCLA 2X71A 1I2SA 1XFNA 2XEPA 3MQQA 5CRFA 3MFXA 1K6SA 3W4OA 4GD8A 4R3JA 3SH8A 2GNXA 3S7QA 4FUWA 3CI6A 3AGDA 2PRFA 1M40A 1VM1A 2XR0A 5EV0A 3T50A 4OQ0A 3T4QA 2B18A 3N7WA 4S2JA 5FQKA 1TS0A 3RH8B 2UV0E 3HLEA 1P9RA 5L2FA 3F1NB 1KE0A 5TBMB 1GSWA 4R4SA 4E3KA 5EVEA 1F9IA 1KDSA 3A0RA 1BSGA 4Y13A 2V8CA 5G4YA 5TJJA 1K0KA 2QMIA 1OTIA 2Y55A 3SZTA 1ZG4A 4ID4A 1BLSA 2GJ3A 3BFGA 3L9KA 3UE1A 5CHJA 2V2FF 5F1FA 1YLJA 3ZGAB 2WUQA 3F1OA 2WZZA 3KYEA 1FCMA 3MXQA 1EW0A 3ZG9B 5DF9A 5DFXA 4E3NA 3O88A 1CEFA 4KZAA 1S66L 5HX9A 4XUXA 4F94A 5GLBA 3Q7VB 4MMNA 1KGFA 3GDIA 1E3UD 3T1RA 1SCWA 2W3DA 5EVID 3PR6A 4Y5FA 4OVDA 2FH5A 2Y2HA 5FEGA 2LB9A 2RCXA 3EQUA 3CPTA 5E43A 3TJZC 3LR5A 1K54A 2LB5A 2Y4AA 1GSXA 3VP3A 2WGWB 4IVKA 3T4OA 3IF5A 2Y2QA 2QZ6A 4Z1WA 4Z9QA 4ZJ3A 2FZ0A 4KZ4A 3ZG7B 3WS4A 1PW1A 5JYOA 4I5SA 5FSRA 2J80A 2EWWA 2VKSA 3T4LA 4U0TA 4NK3A 5C5KA 4U3TA 1MKIA 1PI5A 3LIEA 1E25A 2G7UA 1IKIA 3HLCA 5I5LA 3MKEA 3FYZA 3GMWA 4PMAA 5HW3A 1NZOA 4ZRRA 1OT9A 3NULA 5FQQA 3RTYA 5EOOA 5HDDA 1ESIA 3NY4A 5CTMA 1PI4A 3EQVA 3CUEA 4YFMA 1NXYA 4Q0HA 1SZVA 1H8MA 3GVBA 3UY6A 5EOEA 2Y2GA 3UPPA 3H7WB 4R6LA 5CECA 5HAPA 1JNUA 2P9VB 1XFQA 4GW9A 3GV9A 4PAUA 1S4SA 5F69A 5FAQA 2HGVA 3HUOA 4BENA 2OLUA 1F98A 2J8YA 1NJ4A 1XJ4A 4II7A 4EW7A 2VGKA 1QMEA 3E2LA 3H7WA 4RA7A 3VP4A 5FAPA 3SH9A 3PBQA 3K3DA 3Q7VA 4YWZA 3VV4A 2XH9A 3OPPA 2ZOIA 4BJPA 5A92A 3PBSA 5CX7A 5CERA 2O0YA 4N9KA 3TRCA 1BT5A 2EX2A 2JBFA 4DE0A 2X02A 3E4PA 4X55A 3IWIA 4QPRA 2DNSA 3BFCA 4FH2A 4MBHA 1G28A 4Y17A 1AXBA 1T1CA 5TGFA 2WK0A 5F68A 4H8RA 1YAXA 4E6XA 4LRYC 4O7DA 3SS5A 4UEYA 5HL1A 4OH0A 1IEMA 5AJGA 1SKOA 3LICA 3V3RA 3ZG0A 4KZ8A 4OLDA 4OONA 1XP4A 3P7NA 2XQZA 4ETXA 4YNRA 3UB8A 1PWCA 4UAAA 3RXXA 1VEUB 4R1GA 2WKRA 1K57A 4RQ9A 1S67L 1XA7A 3QNBA 3Q81A 2QHKA 4GD6A 4XUZA 4Y15A 4E3LA 1ZHHB 1D06A 1IYQA 1BZAA 2HF6A 1OPXA 1C3BA 3G6OA 4B4XA 4KQDA 1RCJA 1TS6A 4JLFA 1LLBA 4RX3A 2V1BA 4JGRA 2I9VA 5GLDA 4WMCD 3VOYA 1G6OA 1SKFA 5FI6A 4ARZA 5FAOA 3VSKA 1NLYA 4HJ4A 3T4KA 4NXBA 1WE4A 3BECA 4UA7A 3K3CA 4PKYG 1LHYA 5KSCA 3C7VA 2Y2JA 4DJ2A 3IWQA 3M6HA 5HARA 2IWCA 2PU2A 1K4EA 2PR5A 4OOYA 1YLYA 5HPIA 5G4ZA 4X68A 3I7JA 4JGPA 2OLVA 4JXSA 1BYWA 1PW8A 3FZCA 3JVUA 3KX0X 3WRZA 3WRTA 4I3AA 5DJUA 3HLBA 3SS3A 2FFFB 2HPBA 2GZAA 5TBMA 3CPTB 4FCFA 4OLGA 2V0WA 4Y7PA 1NRFA 1PZPA 3GR2A 1ZTUA 3RXWA 3A3IA 5FQMA 5HZHA 4EXOA 1WYBA 1MKMA 4MN5A 1FR6A 3UB9A 3P01A 3FKVA 4EUVA 5HDCA 5A90A 3BY9A 4BL2A 1YQSA 1HVBA 1PIOA 3CG5A 3DWKA 1XA1A 3DTMA 1K25A 2V9AA 4MN6A 4P85A 1NLZA 2VZWA 1YMXA 3CUEC 5F82A 4JF4A 1MWRA 1ZC2A 1NWZA 3G30A 3A3DA 3UPNA 3MSHA 3ZYTA 1BTLA 1XKZA 1OJ5A 4KG6A 3F1PA 5J3WA 2EX6A 5TFQA 2K31A 1SDEA 2WZXA 2YKFA 3U2AA 3NIAA 3R7WA 3MR0A 2W3GA 4IJGA 4KUKA 4HP4A 5IU1A 5MC7A 5J4EA 4JF5A 2ZL1A 1GHIA 1K55C 2ZBBA 1KGGA 3QP1A 3H82B 2JC7A 5EPHA 3SH7A 4R3BA 5CGSA 3HBRA 3DTEA 1IYOA 2R9XA 4JBFA 1N9LA 3LIFA 4LCMA 3DWZA 3P09A 1N9BA 4JF6A 1FIKA 5KMWA 1H0MA 3PBRA 4I3JA 5EFWA 3NECA 4IUHA 2KDKA 3CMZA 5CXWA 5EUAA 4RX2A 3ZFZA 3OOVA 2WAFA 4WF0A 5DKKA 4EV4A 1DRMA 1E4DA 4JGQA 1L0FA 1YLZA 2EXBA 4I39A 3JVVA 2EFUA 2YKHA 1UWPX 4WLAA 4MBFA 2VV8A 2L1MA 1TVFA 3S1YA 3EEHA 4HJ6A 5EM1A 2IWBA 4XT2B 4ETZA 3UB6A 4S2OA 4WEKA 3CHWP 3TW8A 1J9MA 1BULA 4N9LA 4NXEA 2K2NA 3Q1FA 4HY8A 1GA0A 4Y2FA 5M19A 3VE4A 3IF6A 4P6ZS 2BASA 2XD5A 2ZQDA 1J3WA 5TR7A 3BEBA 1G68A 2VGJA 2HDSA 3MS6A 2JKGA 4CPKA 4DN0A 2XROA 1LI0A 2HDRA 4EQIA 4EWFA 1F5MA 3O3VA 2OWHA 3FWLA 1DJCA 4ZJ2A 2K7SA 2H10A 3A3FA 4KG5A 5DF7A 4EERA 4FD8A 3S7NA 1YLWA 2J3WA 2Y2OA 2VK3A 1TF1A 5KZHA 1YLPA 1T1BA 1JWVA 3G4PA 4OP8A 4CQHA 4QJGA 3Q82A 2ZMAA 1BLPA 3PAGA 2WKQA 3G2ZA 4RYEA 2UWXA 3D3OA 1GHMA 4GHIA 5E2HA 1OT6A 3UO9A 2JKRI 2VJWA 4L0LA 2HDQA 3LEZA 1YPRA 1MXOA 2HP5A 1S4RA 4ESPA 4DDYA 3G32A 2IA2A 5DVAA 1W8YA 3PBOA 2H0TA 4DE3A 3IHAA 3T4TA 2VEAA 5EECA 4M4XA 4WZ4A 3IX4A 4F3LA 2Q9NA 2CMNA 1OMEA 4S2NA 4X1MA 2R78A 2HP9A 5AVEA 3IS2A 1D7EA 5HWWA 3V5MA 1ZKJA 3IX8A 2M7VA 2Y2LA 3VMAA 3UDIA 5FQJA 5CEDA 3HJIA 3KYZA 1DJBA 1P0ZA 3CITA 3P98A 3C8CA 1VB6A 3IWOA 4WMCA 5EVIB 2W1RA 1Z09A 4KZ5A 4YOFA 5IT5A 2JHEA 1NYYA 1FQGA 3CLOA 2OSUA 3GSGA 3NJAA 4EQ1A 3LGOA 4F3LB 1FCNA 4HBTA 3MBZA 3IT9A 3WWXA 4EBLA 3LR4A 3BQAA 4X56A 2ACGA 3T1SA 4KG2A 4Y3IA 1EI5A 3ZG8B 3ITBA 1STZA 2JKTI 5L10A 3PBNA 2P08A 3QP2A 5JYPA 1VETA 4KENB 3KSHA 3BRMA 1GSVA 1FSWA 2ZQCA 4BL3A 1OTAA 1LL8A 3T12B 2H0YA 3ZCZA 1KVMA 1MWUA 2O9BA 4CLCC 1L2SA 4OPQA 1XJ3A 1CEGA 5IHVA 4WELA 5FI2A 1LT0A 4ME4A 4MCWA 4GCZA 1K55A 4D60A 4ZDXA 1ESUA 4D2OA 2QWSA 3E2KA 3UB7A 1K56A 2OWJA 1K57C 4UHUA 1KVLA 1L0DA 2I72A 2ZQ8A 1M6KA 4CLCE 3TE8A 4E04A 3LIDA 2ZQAA 4KZ6A 1YKDA 4Q8IA 4OQIA 2PD7A 4JGOA 2WKHA 1SDNA 4BD0A 1FSYA 4QHCA 4MNRA 3OZHA 4HEFA 4P0MA 3PAEA 4R3AA 2PYPA 1G6AA 3LR3A 1X0OA 3IF6B 1XGIA 1K54C 4EBNA 1W79A 3BFDA 1Z6FA 4BQMA 3C4OA 2Y2MA 1BUEA 4KUOA 3VP0A 4LV1A 1TD5A 4K0WA 2XLNA 4JKTA 4PHTA 3UE0A 1H8YA 2JE5A 2GX5A 1LSXA 2J3TC 1K4FA 2EXAA 3FKWA 3QP6A 3VOZA 4NKPA 1ACFA 2V8FA 1FOFA 3HLFA 3IF6C 1ES5A 2ZLYA 5J8XA 4DXCA 2ZC3B 3L7HA 2A2LA 2W3HA 3ISGA 4AFIA 1WA9A 4ZBEA 3TOIA 4B9OA 1XJ6A 4UQIM 1NYMA 5GHYA 2WKEA 1TEMA 4ARZB 5FASA 4GB7A 1UWNX 3ITAA 3QP4A 5DFYA 3OPHA 2PR6A 3PHYA 4I38A 3VFHA 2WYXA 1DY6A 4S2LA 3UMDA 4B88A 1Y54A 4HQAA 3ZQ5A 1YSQA 3NC8A 3WS2A 2L4RA 3C4PA 4QWOA 4HH3A 3EEAA 2Z2LB 3W8KA 3G2YA 1S0WA 3M2JA 3T4JA 1O07A 1JTGA 1OTBA 2L0WA 3FPVA 4X53A 5L07A 2Y2KA 1I5QA 4OKPA 2HJ9C 1KE3A 3NDGA 2A24A 4EUZA 2O9CA 4PM6A 2B5RA 1E3UA 4DJ3A 3VP1A 5HL6A 2O99A 3R4KA 2KOIA 1T1AA 4S2NC 4B4ZA 4GNUA 1W5DA 3MF0A 2DMWA 3B47A 2BLSA 4JXVA 4NXGA 1HTZA 3WS5A 3ZDJA 5CHMA 5CEBA 2MJ6A 4OOLA 1W63M 1XXMA 1H8ZA 3N6IA 2VGLM 3SS4A 3DTIA 5CTNA 1CJFA 5CGWA 5GHXA 5HD3A 5FEFA 3FC7A 1Y28A 2Q0OA 1NRJA 2PDRA 1L0EA 4DDSA 2GDNA 1PNEA 3T1XA 1XJ2A 3LFVA 1GCEA 1L3LA 2O9AA 2RL3A 1K56D 1GA9A 2Y2IA 5EVIC 3IX3A 2OV5A 1LL5A 4LENA 4WN5A 2KX6A 4E3OA 5GL9A 5M18A 2P04A 4I3IA 1CQAA 1P9WA 3W4QA 1S1ZA 4WL9A 3B42A 5AQ9A 1RGYA 4OP5A 4DXBA 2W3FA 3B3XA 1GHPA 4A5RA 3NOTC 3ZVTA 2XSSA 1W7FA 3MJQA 2VV6A 4BBVA 4GZBA 2C6WB 4P6BA 2ZOHA 5M1AA 4BMWA 5EVIA 3QHYA 3HVFA 3GECA 4OPRA 4IUKA 2XFTA 3EGXC 2Z2MB 3SW1A 1IYSA 1PRQA 3DAVA 5L09A 4CLCB 3D4FA 3A0SA 4HBUA 4MBKA 1W63Q 4FH4A 1OJGA 3VSLA 3QP8A 3IXDA 3ICYA 4PM8A 4Y0UA 4WYYA 3H82A 2PU4A 4R4RA 1SKOB 2DCFA 3PTEA 1FILA 3T1QB 4E3MA 1BLCA 4OPZA 5FA7A 2B02A 3F1PB 3FV7A 4S2IA 4U0XA
chains in the Genus database with same CATH topology
2VEAA 4CLCA 4M4XA 3PBQA 2EWVA 3UE6A 4L9FA 2NUPC 3LR0A 4BBTA 4F3LA 3LYXA 3K3DA 2CMNA 4YWZA 3VV4A 5HDSA 2VX8A 2R78A 5AVEA 2ZOIA 4BJPA 3IS2A 3PXPA 3O5YA 4MN7A 1D7EA 3PBSA 2VGLS 2Y79A 5CX7A 5HWWA 1KOUA 2O0YA 1DP8A 2M7VA 3TRCA 4GLQA 2PD8A 2XA7M 4EETB 4G3KA 4O8GA 3EGDC 3T4SA 3HJIA 3E98A 3KYZA 4FOFA 4EEPA 3C30A 1LSVA 4HI4A 3E4PA 4BWIA 4L9EA 1P0ZA 3MQOA 3CITA 4MDZA 3E4OA 4QPRA 3C8CA 1VB6A 2EA9A 1IFQA 2W1RA 1G28A 4YOFA 5IT5A 1P97A 2JHEA 4HOIA 1T1CA 3BJNA 3CLOA 3KO6A 5F68A 5LBRA 3NJAA 1YAXA 2M1CA 1LSWA 4EQ1A 4F3LB 5HSQA 3BY8A 4LRYC 3LR4A 4B93A 4R70A 4UEYA 4P6ZM 1T18A 3BQAA 4Y3IA 5AJGA 4H6JA 4FSFA 3LICA 1STZA 2JKTI 2OOLA 3PBNA 2P08A 4HIAA 5FL3A 2W0NA 2W1TB 3PYPA 3KSHA 4KQOA 1GSVA 4G3WA 3P7NA 4ETXA 5K5BA 4YNRA 1OTAA 3UE3A 1LL8A 3UB8A 1T19A 1VHMA 3LIAA 2WKRA 3NOUC 4BBUA 2D01A 3UMEA 4RQ9A 1S67L 2W1TA 2O9BA 4CLCC 2QHKA 1S1YA 3PBTA 4LPZA 1XJ3A 1ZHHB 3B33A 1D06A 3V67A 2HF6A 4WELA 1OPXA 3G6OA 4KQDA 1LT0A 1TS6A 4ME4A 4MCWA 4GJ4A 4GCZA 3KSIA 1TS7A 2V1BA 2Z6CA 3S7OA 2WKPA 4JGRA 2I9VA 4EEUA 3MQ0A 2QWSA 4H6JB 3OLOA 1MC0A 2QJ7A 3UB7A 1N9OA 2OWJA 1G6OA 4ARZA 1MZUA 1NLYA 4L9GA 2VV7A 4HJ4A 4NXBA 3T4KA 4CLCE 3TE8A 3K3CA 4PKYG 2PYRA 3CWFA 4E04A 3LIDA 3OCNA 4HP9A 4DJ2A 3W2ZA 1YKDA 5KIZA 2PD7A 4JGOA 2JKRM 4OOMA 3S7PA 3F1OB 2KLIA 3KSGA 2VLGA 2PR5A 2HV1A 4R3AA 5HPIA 2PYPA 5G4ZA 3LR3A 1X0OA 4JGPA 2PHYA 4WEJA 1BYWA 3NOPC 3FG8A 4K08A 3JVUA 4LLOB 3BQ8A 3KX0X 5AVFA 1UGUA 4KUOA 4I3AA 3IBRA 5DJUA 1V9YA 1TD5A 4PHTA 3LI8A 2GZAA 3K2NA 5TBMA 1V9ZA 3LI9A 3LIBA 2JKTM 2V0WA 3EOIA 2GX5A 1LSXA 2J3TC 1ZTUA 5HPFA 5HZHA 4NKPA 4EXOA 1MKMA 3ULFA 4MN5A 3RFBA 2A2LA 3UB9A 5F6AA 3P01A 4LRXC 4O01A 2Z6DA 5KSHA 3MMHA 3KYQA 2W3HA 2P7JA 2OAQ1 4NEED 4AFIA 4EUVA 5HDCA 1WA9A 3BY9A 1YSPA 2XA7S 5HWVA 4B9OA 1XJ6A 2H28A 4UQIM 2V1AA 4WUJA 4ARZB 3OCLA 5J7EA 1UWNX 3OC2A 1XFNA 3MQQA 5DFYA 3MFXA 2V9AA 4MN6A 1NLZA 2PR6A 2VZWA 3PHYA 3CUEC 4NXFA 2GNXA 3S7QA 2PT7A 3CI6A 1ODVA 4I38A 3R7WB 3OBFA 1NWZA 3BWLA 3UMDA 3ZYTA 4HQAA 3T50A 3ZQ5A 1YSQA 3T4QA 2B18A 1OJ5A 1TS8A 2L4RA 3F1PA 1TS0A 5J3WA 2HJEA 3RH8B 1P9RA 2K31A 2YKFA 3F1NB 5DJTA 5TBMB 4HH3A 1GSWA 3EEAA 3U2AA 1N9NA 3R7WA 3T4JA 1F9IA 3MR0A 2W3GA 1OTBA 3A0RA 2L0WA 4IJGA 3FPVA 5G4YA 4KUKA 5TJJA 4HP4A 5DKLA 5IU1A 3KSFA 2QYBA 1OTIA 5MC7A 2HJ9C 5J4EA 2A24A 2GJ3A 2ZBBA 3H82B 3C38A 3BW6A 3E0YA 2O9CA 4IHQA 5HD5A 1IOUA 3D72A 3F1OA 4DJ3A 5HL6A 1N9LA 2O99A 3LIFA 2KOIA 3R4KA 2NUTC 2INWA 1T1AA 1OTDA 3MXQA 1EW0A 5DF9A 3MF0A 3PBRA 4I3JA 2DMWA 3HCYA 5EFWA 3B47A 4NXGA 4R38A 4IUHA 2KDKA 1DP9A 3DBAA 2OAP1 5DFXA 1S66L 3OOVA 1H3QA 2MJ6A 4OOLA 4WF0A 5DKKA 1DRMA 1W63M 4MMNA 4JGQA 2W27A 2VGLM 3GDIA 2W3EA 3A0VA 4HNBA 2ZMFA 3IBJA 4I39A 3JVVA 2YKHA 3EWKA 1UWPX 4DMZA 4WLAA 2W3DA 3E4QA 2VV8A 2L1MA 3PR6A 4Y5FA 2FH5A 2J3TD 5HD3A 3EEHA 3FC7A 1Y28A 4HJ6A 4XT2B 5IS1A 4ETZA 4GS9A 1NRJA 2PDRA 3UB6A 2LB9A 4WEKA 3EQUA 3TJZC 3FPWA 3LR5A 3TW8A 2LB5A 1XJ2A 1GSXA 3LFVA 3NHQA 4NXEA 4PKYA 2K2NA 3C2WA 3IS2B 2A24B 2O9AA 4HY8A 4Y2FA 3T4OA 4EU0A 3F1NA 5HWTA 5F5YA 3VE4A 3LUQA 4P6ZS 4Z1WA 2QKPA 4O0PA 2BASA 3VE3A 2FZ0A 4WN5A 2KX6A 2P04A 4I5SA 2J80A 1DP6A 1P9WA 2EWWA 2VKSA 4I3IA 4DN0A 2XROA 3T4LA 1S1ZA 1F5MA 4WL9A 5C5KA 3B42A 2OWHA 5L8MA 2D02A 2W3FA 3LIEA 2G7UA 2K7SA 3NOTC 5I5LA 4EERA 2XSSA 4LRZE 4XT2A 3MJQA 2VV6A 3S7NA 4BBVA 4ZRRA 1OT9A 2J3WA 3HJKA 1TF1A 2ZOHA 4GHIB 3RTYA 4BMWA 1T1BA 4HHDA 4Q0JA 2ZMVA 4CQHA 5HDDA 4EESA 2JN7A 3EQVA 3GECA 4IUKA 3CUEA 3EGXC 3SW1A 4Q0HA 3H9WA 2WKQA 4CLCD 4CLCB 4Q0IA 2M7UA 4G3VA 1H8MA 2QJ5A 3A0SA 3D3OA 1W63Q 2Y8HA 3H7WB 3VOLA 1OJGA 5A8BA 4GHIA 4R6LA 2V0UA 2XRNA 1JNUA 2VA0A 1XFQA 1OT6A 2JKRI 2VJWA 4L0LA 4GW9A 1OTEA 3ICYA 4PAUA 1S4SA 5F69A 1S4RA 3CAXA 2HGVA 4HH2A 3H82A 1F98A 4UQIS 2IA2A 4HJ3A 1XJ4A 4II7A 4EW7A 3PBOA 2B02A 3H7WA 3F1PB 4GS9B 3T4TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WKP A;  4JGR A;  2I9V A;  4EEU A;  2VEA A;  2PR6 A;  4M4X A;  2QWS A;  4H6J B;  3UE6 A;  3OLO A;  4L9F A;  3PHY A;  2QJ7 A;  3UB7 A;  4NXF A;  4BBT A;  3LYX A;  1N9O A;  1XJ2 A;  1GSX A;  2OWJ A;  3K3D A;  2CMN A;  4YWZ A;  3NHQ A;  1ODV A;  4NXE A;  4I38 A;  4PKY A;  5HDS A;  3C2W A;  2R78 A;  4F3L A;  3IS2 B;  2A24 B;  4HY8 A;  5AVE A;  2ZOI A;  1MZU A;  3IS2 A;  1NWZ A;  3BWL A;  3F1N A;  2VV7 A;  4HJ4 A;  4L9G A;  4NXB A;  5F5Y A;  5HWT A;  3VE4 A;  3K3C A;  3UMD A;  4PKY G;  3LUQ A;  2PYR A;  1D7E A;  3CWF A;  4HQA A;  5HWW A;  3T50 A;  3ZQ5 A;  2QKP A;  1KOU A;  4E04 A;  1DP8 A;  3LID A;  2BAS A;  1OJ5 A;  2PD8 A;  3VE3 A;  1TS8 A;  2L4R A;  4WN5 A;  3F1P A;  4EET B;  4HP9 A;  2KX6 A;  1TS0 A;  5J3W A;  4DJ2 A;  3RH8 B;  5KIZ A;  2PD7 A;  2YKF A;  4JGO A;  4I5S A;  2J80 A;  1DP6 A;  3F1N B;  3HJI A;  4I3I A;  4BBV A;  5DJT A;  5TBM B;  4HH3 A;  1GSW A;  1N9N A;  3F1O B;  4EEP A;  1S1Z A;  1LSV A;  4HI4 A;  3E4P A;  4WL9 A;  4L9E A;  2VLG A;  1P0Z A;  1F9I A;  2OWH A;  3MQO A;  3MR0 A;  1OTB A;  2D02 A;  2PR5 A;  3A0R A;  3E4O A;  3LIE A;  2HV1 A;  2L0W A;  3C8C A;  4R3A A;  2K7S A;  1VB6 A;  2EA9 A;  5G4Y A;  2PYP A;  4KUK A;  5G4Z A;  1X0O A;  4HP4 A;  3NOT C;  5DKL A;  5IU1 A;  4JGP A;  5I5L A;  4EER A;  1G28 A;  1OTI A;  2PHY A;  4LRZ E;  1BYW A;  3NOP C;  4XT2 A;  1P97 A;  5J4E A;  2JHE A;  3FG8 A;  2VV6 A;  3MJQ A;  4HOI A;  4K08 A;  4LLO B;  2A24 A;  1T1C A;  2GJ3 A;  1OT9 A;  2ZBB A;  3HJK A;  3KX0 X;  3CLO A;  3H82 B;  2ZOH A;  4GHI B;  5AVF A;  3RTY A;  1T1B A;  4HHD A;  5F68 A;  1UGU A;  3NJA A;  2M1C A;  4KUO A;  1LSW A;  4EQ1 A;  4F3L B;  5HSQ A;  5HDD A;  3BY8 A;  4EES A;  2JN7 A;  5HD5 A;  3D72 A;  3GEC A;  3F1O A;  4LRY C;  4I3A A;  3IBR A;  5DJU A;  4DJ3 A;  4R70 A;  1N9L A;  3LIF A;  1T18 A;  1V9Y A;  2INW A;  1T1A A;  1OTD A;  3MXQ A;  3SW1 A;  3H9W A;  1EW0 A;  3LI8 A;  2WKQ A;  1V9Z A;  3LI9 A;  3LIB A;  5TBM A;  4H6J A;  4BBU A;  4I3J A;  3LIC A;  2V0W A;  2QJ5 A;  3A0S A;  5EFW A;  2OOL A;  1LSX A;  4NXG A;  4R38 A;  2KDK A;  4HIA A;  3VOL A;  1DP9 A;  2W0N A;  3H7W B;  5HZH A;  3PYP A;  3UB9 A;  4EXO A;  1OJG A;  5A8B A;  4GHI A;  1GSV A;  4R6L A;  2V0U A;  3P7N A;  1JNU A;  1OTA A;  3ULF A;  1XFQ A;  1OT6 A;  1LL8 A;  4MN5 A;  3UB8 A;  1S66 L;  4GW9 A;  1T19 A;  1OTE A;  4WF0 A;  5DKK A;  4MN6 A;  4LRX C;  3ICY A;  1DRM A;  5F6A A;  1S4S A;  5F69 A;  2Z6D A;  4JGQ A;  2W27 A;  3LIA A;  1S4R A;  2WKR A;  2P7J A;  3CAX A;  2D01 A;  3GDI A;  3NOU C;  4HH2 A;  4RQ9 A;  3UME A;  3H82 A;  1S67 L;  3A0V A;  1F98 A;  4HNB A;  5HDC A;  1WA9 A;  4I39 A;  3BY9 A;  2YKH A;  3EWK A;  4HJ3 A;  1UWP X;  5HWV A;  1XJ4 A;  4WLA A;  2QHK A;  1XJ6 A;  1S1Y A;  2H28 A;  3E4Q A;  2VV8 A;  2L1M A;  4LPZ A;  1XJ3 A;  4B9O A;  4EW7 A;  2V1A A;  1D06 A;  3B33 A;  5HD3 A;  3F1P B;  3EEH A;  4WUJ A;  3FC7 A;  3G6O A;  1Y28 A;  4HJ6 A;  1LT0 A;  2B02 A;  4KQD A;  4XT2 B;  1TS6 A;  3H7W A;  5J7E A;  5IS1 A;  1UWN X;  1XFN A;  3MQQ A;  4GS9 A;  2PDR A;  4GCZ A;  3UB6 A;  1TS7 A;  3MFX A;  4GS9 B;  2V1B A;  2V9A A;  2Z6C A; 
#chains in the Genus database with same CATH topology
 3WS1 A;  3S22 A;  2NUP C;  4BBT A;  3LYX A;  1VET B;  4PM7 A;  5HDS A;  2VX8 A;  3BM6 A;  3PXP A;  3O5Y A;  3BFE A;  2VGL S;  2Y79 A;  3BFF A;  1DP8 A;  1RP5 A;  1I2W A;  1PYY A;  3QNC A;  4EET B;  4YIN A;  4BD1 A;  4G3K A;  4O8G A;  1D1J A;  3NCK A;  5G18 A;  3EGD C;  3UNW A;  4C3Q A;  2XGN A;  4FOF A;  3C30 A;  5DTS A;  2A49 A;  3HLW A;  4L9E A;  3MQO A;  3E4O A;  3JYI A;  4JXW A;  4C6Y A;  3UDX A;  5A91 A;  5U47 A;  1P97 A;  1L0G A;  4HOI A;  3BJN A;  5EE8 A;  1KE4 A;  4EBP A;  3LY3 A;  1HZO A;  5LBR A;  2BTF P;  4QU3 A;  3BY8 A;  3UPO A;  1PZO A;  4R70 A;  4P6Z M;  2J9P A;  4CJN A;  1ZG6 A;  3HLG A;  4H6J A;  4LCL A;  4FSF A;  5FDH A;  2OOL A;  5AQA A;  2W0N A;  2G2W A;  4IBR A;  5CGX A;  3C7U A;  4G3W A;  5K5B A;  3UE3 A;  4S2M A;  3NOU C;  1VQQ A;  2D01 A;  2XK1 A;  4BBU A;  1PFL A;  2W1T A;  1S1Y A;  2V20 A;  4LPZ A;  1XPB A;  4IED A;  4OPY A;  3V67 A;  3ZNY A;  4ZAM A;  1CK3 A;  2Y91 A;  2QPN A;  3KSI A;  1BLH A;  2Z6C A;  3IXH A;  2WKP A;  3MZF A;  3M2K A;  4EEU A;  3MQ0 A;  1ES2 A;  1TDG A;  4Y0T A;  2FFY A;  1DJA A;  4X1L A;  1MZU A;  3UDF A;  3NI9 A;  2VV7 A;  3CJM A;  2ZC5 B;  2XF3 A;  3IXG A;  3N4I A;  3O86 A;  4HP9 A;  3W2Z A;  5KIZ A;  1A0K A;  2BG1 A;  2Y2N A;  4OOM A;  3S7P A;  3KSG A;  2DRW A;  2HV1 A;  4ZTK A;  4N92 A;  2PHY A;  3FG8 A;  4K08 A;  3BQ8 A;  5DTK A;  5E2E A;  1MY8 A;  4IVI A;  3HL9 A;  1ERO A;  3LO7 A;  3N8S A;  3IBR A;  1V9Y A;  4GDN A;  1NZU A;  3LI8 A;  3IHB A;  3K2N A;  3LI9 A;  3LIB A;  4NG2 A;  4RVA A;  4QY5 A;  5HPF A;  1KDW A;  3WS0 A;  3JPU A;  3ULF A;  3GTC A;  4KZ3 A;  1FR1 A;  3RFB A;  3ZG5 A;  5F6A A;  2J7V A;  3KYQ A;  2WGV A;  4PM9 A;  1YSP A;  1N4O A;  2H28 A;  2JKF A;  1CF0 A;  2V1A A;  3BYD A;  5J7E A;  1S6R A;  3OC2 A;  3C5A A;  3LCE A;  1K6R A;  4NXF A;  5I94 A;  2PT7 A;  3Q07 A;  1ODV A;  4GOG A;  3R7W B;  3OBF A;  4LV0 A;  3BWL A;  3W4P A;  5BOH A;  1TDL A;  4HES A;  1TS8 A;  5HFO A;  2HJE A;  2XDM A;  3IQA A;  5HAI A;  2Q9M A;  4DE1 A;  5DJT A;  3HRE A;  1N9N A;  3ZHH A;  2WAE A;  2ZJ9 A;  4S2K A;  3ZVW A;  1ES3 A;  3V50 A;  4Y0O A;  5DKL A;  2PBD P;  4UA9 A;  3U4L P;  3KSF A;  2QYB A;  4KQR A;  4LFU A;  2HP6 A;  3HUM A;  3TSG A;  3C38 A;  3BW6 A;  3E0Y A;  3GRJ A;  1HLU P;  4E3J A;  4IHQ A;  5HD5 A;  1IOU A;  3D72 A;  2C5W B;  3VP2 A;  4N1H A;  4N1X A;  2J9O A;  3D9Y A;  1RGZ A;  2NUT C;  2INW A;  1IYP A;  1OTD A;  3MFD A;  1XGJ A;  3HCY A;  3BLM A;  5DF8 A;  4R38 A;  1DP9 A;  3DBA A;  4WM9 A;  2OAP 1;  1G5U A;  2JCH A;  2ZC6 B;  1Q2Q A;  3NDE A;  1H3Q A;  4DKI A;  3ZNT A;  3MZD A;  4KZB A;  2W27 A;  2W3E A;  3A0V A;  4HNB A;  2ZMF A;  3IBJ A;  1XX2 A;  3EWK A;  4DMZ A;  5EM0 A;  1MWT A;  3E4Q A;  1YLT A;  2J3T D;  1ERM A;  5GLC A;  5IS1 A;  4GS9 A;  4GKU A;  3HLD A;  1EWZ A;  4R23 A;  4R0Q A;  3FPW A;  5FQI A;  5GLA A;  3NHQ A;  3Q7Z A;  4PKY A;  2WAD A;  4QD4 A;  3C2W A;  3IS2 B;  2A24 B;  2P9V A;  2XD1 A;  4IBX A;  5F83 A;  1KGE A;  4EU0 A;  3F1N A;  5HWT A;  5F5Y A;  3LUQ A;  3HUN A;  2WGI A;  2QKP A;  4O0P A;  1WYC A;  5FI7 A;  2B95 A;  3VE3 A;  4PM5 A;  4S2P A;  1DP6 A;  5FQ9 A;  1QMF A;  5L8M A;  2D02 A;  3N8R A;  4E3I A;  4LRZ E;  4XT2 A;  2P74 A;  4FTX A;  1YT4 A;  3HJK A;  5AQB A;  2WKI A;  4GHI B;  2AVX A;  4HHD A;  4WBG A;  4Q0J A;  2ZMV A;  4UA6 A;  5FAT A;  3G34 A;  3UB5 P;  3BLS A;  2EX9 A;  4EES A;  4PPR A;  2JN7 A;  1MPL A;  5CHU A;  3H9W A;  3LEQ A;  4CLC D;  4Q0I A;  2M7U A;  4G3V A;  3SOI A;  2QJ5 A;  2Y8H A;  3VOL A;  4KQQ A;  1ALQ A;  4DF6 A;  5A8B A;  2V0U A;  2XRN A;  2VA0 A;  2XFS A;  2E8J A;  3V39 A;  4LV2 A;  3RJU A;  1OTE A;  2EX8 A;  2ZQ9 A;  3CAX A;  4HH2 A;  4UQI S;  4HJ3 A;  3MXS A;  3MXR A;  1ONH A;  2R9W A;  2A3U A;  5D3O A;  4JPM A;  2CC1 A;  3NBL A;  1VEU A;  3QP5 A;  4GS9 B;  3G35 A;  3TG9 A;  4CLC A;  2EWV A;  1IEL A;  3UE6 A;  2V1Z A;  4L9F A;  3LR0 A;  4WZ5 A;  1W8Q A;  2ZM0 A;  4XXR A;  3IXB A;  5DTT A;  4MN7 A;  1JTD A;  3O87 A;  1O7E A;  1KOU A;  4GLQ A;  2PD8 A;  2XA7 M;  1CI9 A;  2X01 A;  3T4S A;  1JWZ A;  5HAQ A;  3E98 A;  4EEP A;  3M6B A;  1LSV A;  4HI4 A;  4BWI A;  2Y59 A;  1Q2P A;  3S4X A;  4MDZ A;  2EA9 A;  3N8L A;  1IFQ A;  1LI9 A;  1ES4 A;  4DRT A;  1PWD A;  4BLM A;  3KO6 A;  2M1C A;  2HDU A;  1LSW A;  5HSQ A;  1U60 A;  5E2G A;  4B93 A;  1JWP A;  1T18 A;  4X6T A;  4QY6 A;  4HIA A;  5FL3 A;  2W1T B;  3PYP A;  2H5S A;  4KQO A;  4LV3 A;  1SHV A;  3DW0 A;  1T19 A;  2IWD A;  1VHM A;  4C75 A;  3LIA A;  3UME A;  1MBL A;  1JVJ A;  3PBT A;  4P87 A;  5AQ7 A;  4K91 A;  3B33 A;  1PWG A;  2ZL1 B;  2ZD8 A;  4MEZ A;  1HD8 A;  4OQH A;  5GHZ A;  4GJ4 A;  1NY0 A;  1TS7 A;  1K38 A;  1AWI A;  3S7O A;  3A3J A;  2EFX A;  4DE2 A;  4H6J B;  3OLO A;  1MC0 A;  2QJ7 A;  4KZ9 A;  1N9O A;  1LL9 A;  1MWS A;  5EVL A;  4KZ7 A;  1FCO A;  1ERQ A;  4L9G A;  5FDS A;  1Y4O A;  2PYR A;  3CWF A;  2ZC7 A;  3MKF A;  4JXG A;  3OCN A;  4MLL A;  3MZE A;  4GN2 A;  2JKR M;  1YMS A;  3A3E A;  3IH9 A;  1F2K A;  3F1O B;  2G2U A;  2KLI A;  2VLG A;  4X69 A;  3AGF A;  4M3K A;  4E6W A;  1CI8 A;  3OPL A;  3NOP C;  4WEJ A;  4LGW A;  4LLO B;  5E2F A;  1IKG A;  5A93 A;  5F1G A;  5AVF A;  2ZM2 A;  1UGU A;  4K0X A;  3UN7 A;  4NET A;  4GDB A;  3CZD A;  3GQZ A;  4QB8 A;  3LY4 A;  3DTK A;  3OPR A;  1V9Z A;  2JKT M;  3EOI A;  3V3S A;  3VFF A;  3G31 A;  2HZ5 A;  3AGE A;  4X25 A;  2ZQ7 A;  2PBY A;  2E8I A;  4LRX C;  4O01 A;  2Z6D A;  5KSH A;  3MMH A;  2P7J A;  2OAQ 1;  4NEE D;  2WGW A;  4ZJ1 A;  4WZ5 C;  2PAV P;  3IH8 A;  1YM1 A;  2Y2P A;  2XA7 S;  5HWV A;  1H5X A;  4OQG A;  1ONG A;  2ZC4 B;  4WUJ A;  2ZM8 A;  3OCL A;  2X71 A;  1I2S A;  1XFN A;  2XEP A;  3MQQ A;  5CRF A;  3MFX A;  1K6S A;  3W4O A;  4GD8 A;  4R3J A;  3SH8 A;  2GNX A;  3S7Q A;  4FUW A;  3CI6 A;  3AGD A;  2PRF A;  1M40 A;  1VM1 A;  2XR0 A;  5EV0 A;  3T50 A;  4OQ0 A;  3T4Q A;  2B18 A;  3N7W A;  4S2J A;  5FQK A;  1TS0 A;  3RH8 B;  2UV0 E;  3HLE A;  1P9R A;  5L2F A;  3F1N B;  1KE0 A;  5TBM B;  1GSW A;  4R4S A;  4E3K A;  5EVE A;  1F9I A;  1KDS A;  3A0R A;  1BSG A;  4Y13 A;  2V8C A;  5G4Y A;  5TJJ A;  1K0K A;  2QMI A;  1OTI A;  2Y55 A;  3SZT A;  1ZG4 A;  4ID4 A;  1BLS A;  2GJ3 A;  3BFG A;  3L9K A;  3UE1 A;  5CHJ A;  2V2F F;  5F1F A;  1YLJ A;  3ZGA B;  2WUQ A;  3F1O A;  2WZZ A;  3KYE A;  1FCM A;  3MXQ A;  1EW0 A;  3ZG9 B;  5DF9 A;  5DFX A;  4E3N A;  3O88 A;  1CEF A;  4KZA A;  1S66 L;  5HX9 A;  4XUX A;  4F94 A;  5GLB A;  3Q7V B;  4MMN A;  1KGF A;  3GDI A;  1E3U D;  3T1R A;  1SCW A;  2W3D A;  5EVI D;  3PR6 A;  4Y5F A;  4OVD A;  2FH5 A;  2Y2H A;  5FEG A;  2LB9 A;  2RCX A;  3EQU A;  3CPT A;  5E43 A;  3TJZ C;  3LR5 A;  1K54 A;  2LB5 A;  2Y4A A;  1GSX A;  3VP3 A;  2WGW B;  4IVK A;  3T4O A;  3IF5 A;  2Y2Q A;  2QZ6 A;  4Z1W A;  4Z9Q A;  4ZJ3 A;  2FZ0 A;  4KZ4 A;  3ZG7 B;  3WS4 A;  1PW1 A;  5JYO A;  4I5S A;  5FSR A;  2J80 A;  2EWW A;  2VKS A;  3T4L A;  4U0T A;  4NK3 A;  5C5K A;  4U3T A;  1MKI A;  1PI5 A;  3LIE A;  1E25 A;  2G7U A;  1IKI A;  3HLC A;  5I5L A;  3MKE A;  3FYZ A;  3GMW A;  4PMA A;  5HW3 A;  1NZO A;  4ZRR A;  1OT9 A;  3NUL A;  5FQQ A;  3RTY A;  5EOO A;  5HDD A;  1ESI A;  3NY4 A;  5CTM A;  1PI4 A;  3EQV A;  3CUE A;  4YFM A;  1NXY A;  4Q0H A;  1SZV A;  1H8M A;  3GVB A;  3UY6 A;  5EOE A;  2Y2G A;  3UPP A;  3H7W B;  4R6L A;  5CEC A;  5HAP A;  1JNU A;  2P9V B;  1XFQ A;  4GW9 A;  3GV9 A;  4PAU A;  1S4S A;  5F69 A;  5FAQ A;  2HGV A;  3HUO A;  4BEN A;  2OLU A;  1F98 A;  2J8Y A;  1NJ4 A;  1XJ4 A;  4II7 A;  4EW7 A;  2VGK A;  1QME A;  3E2L A;  3H7W A;  4RA7 A;  3VP4 A;  5FAP A;  3SH9 A;  3PBQ A;  3K3D A;  3Q7V A;  4YWZ A;  3VV4 A;  2XH9 A;  3OPP A;  2ZOI A;  4BJP A;  5A92 A;  3PBS A;  5CX7 A;  5CER A;  2O0Y A;  4N9K A;  3TRC A;  1BT5 A;  2EX2 A;  2JBF A;  4DE0 A;  2X02 A;  3E4P A;  4X55 A;  3IWI A;  4QPR A;  2DNS A;  3BFC A;  4FH2 A;  4MBH A;  1G28 A;  4Y17 A;  1AXB A;  1T1C A;  5TGF A;  2WK0 A;  5F68 A;  4H8R A;  1YAX A;  4E6X A;  4LRY C;  4O7D A;  3SS5 A;  4UEY A;  5HL1 A;  4OH0 A;  1IEM A;  5AJG A;  1SKO A;  3LIC A;  3V3R A;  3ZG0 A;  4KZ8 A;  4OLD A;  4OON A;  1XP4 A;  3P7N A;  2XQZ A;  4ETX A;  4YNR A;  3UB8 A;  1PWC A;  4UAA A;  3RXX A;  1VEU B;  4R1G A;  2WKR A;  1K57 A;  4RQ9 A;  1S67 L;  1XA7 A;  3QNB A;  3Q81 A;  2QHK A;  4GD6 A;  4XUZ A;  4Y15 A;  4E3L A;  1ZHH B;  1D06 A;  1IYQ A;  1BZA A;  2HF6 A;  1OPX A;  1C3B A;  3G6O A;  4B4X A;  4KQD A;  1RCJ A;  1TS6 A;  4JLF A;  1LLB A;  4RX3 A;  2V1B A;  4JGR A;  2I9V A;  5GLD A;  4WMC D;  3VOY A;  1G6O A;  1SKF A;  5FI6 A;  4ARZ A;  5FAO A;  3VSK A;  1NLY A;  4HJ4 A;  3T4K A;  4NXB A;  1WE4 A;  3BEC A;  4UA7 A;  3K3C A;  4PKY G;  1LHY A;  5KSC A;  3C7V A;  2Y2J A;  4DJ2 A;  3IWQ A;  3M6H A;  5HAR A;  2IWC A;  2PU2 A;  1K4E A;  2PR5 A;  4OOY A;  1YLY A;  5HPI A;  5G4Z A;  4X68 A;  3I7J A;  4JGP A;  2OLV A;  4JXS A;  1BYW A;  1PW8 A;  3FZC A;  3JVU A;  3KX0 X;  3WRZ A;  3WRT A;  4I3A A;  5DJU A;  3HLB A;  3SS3 A;  2FFF B;  2HPB A;  2GZA A;  5TBM A;  3CPT B;  4FCF A;  4OLG A;  2V0W A;  4Y7P A;  1NRF A;  1PZP A;  3GR2 A;  1ZTU A;  3RXW A;  3A3I A;  5FQM A;  5HZH A;  4EXO A;  1WYB A;  1MKM A;  4MN5 A;  1FR6 A;  3UB9 A;  3P01 A;  3FKV A;  4EUV A;  5HDC A;  5A90 A;  3BY9 A;  4BL2 A;  1YQS A;  1HVB A;  1PIO A;  3CG5 A;  3DWK A;  1XA1 A;  3DTM A;  1K25 A;  2V9A A;  4MN6 A;  4P85 A;  1NLZ A;  2VZW A;  1YMX A;  3CUE C;  5F82 A;  4JF4 A;  1MWR A;  1ZC2 A;  1NWZ A;  3G30 A;  3A3D A;  3UPN A;  3MSH A;  3ZYT A;  1BTL A;  1XKZ A;  1OJ5 A;  4KG6 A;  3F1P A;  5J3W A;  2EX6 A;  5TFQ A;  2K31 A;  1SDE A;  2WZX A;  2YKF A;  3U2A A;  3NIA A;  3R7W A;  3MR0 A;  2W3G A;  4IJG A;  4KUK A;  4HP4 A;  5IU1 A;  5MC7 A;  5J4E A;  4JF5 A;  2ZL1 A;  1GHI A;  1K55 C;  2ZBB A;  1KGG A;  3QP1 A;  3H82 B;  2JC7 A;  5EPH A;  3SH7 A;  4R3B A;  5CGS A;  3HBR A;  3DTE A;  1IYO A;  2R9X A;  4JBF A;  1N9L A;  3LIF A;  4LCM A;  3DWZ A;  3P09 A;  1N9B A;  4JF6 A;  1FIK A;  5KMW A;  1H0M A;  3PBR A;  4I3J A;  5EFW A;  3NEC A;  4IUH A;  2KDK A;  3CMZ A;  5CXW A;  5EUA A;  4RX2 A;  3ZFZ A;  3OOV A;  2WAF A;  4WF0 A;  5DKK A;  4EV4 A;  1DRM A;  1E4D A;  4JGQ A;  1L0F A;  1YLZ A;  2EXB A;  4I39 A;  3JVV A;  2EFU A;  2YKH A;  1UWP X;  4WLA A;  4MBF A;  2VV8 A;  2L1M A;  1TVF A;  3S1Y A;  3EEH A;  4HJ6 A;  5EM1 A;  2IWB A;  4XT2 B;  4ETZ A;  3UB6 A;  4S2O A;  4WEK A;  3CHW P;  3TW8 A;  1J9M A;  1BUL A;  4N9L A;  4NXE A;  2K2N A;  3Q1F A;  4HY8 A;  1GA0 A;  4Y2F A;  5M19 A;  3VE4 A;  3IF6 A;  4P6Z S;  2BAS A;  2XD5 A;  2ZQD A;  1J3W A;  5TR7 A;  3BEB A;  1G68 A;  2VGJ A;  2HDS A;  3MS6 A;  2JKG A;  4CPK A;  4DN0 A;  2XRO A;  1LI0 A;  2HDR A;  4EQI A;  4EWF A;  1F5M A;  3O3V A;  2OWH A;  3FWL A;  1DJC A;  4ZJ2 A;  2K7S A;  2H10 A;  3A3F A;  4KG5 A;  5DF7 A;  4EER A;  4FD8 A;  3S7N A;  1YLW A;  2J3W A;  2Y2O A;  2VK3 A;  1TF1 A;  5KZH A;  1YLP A;  1T1B A;  1JWV A;  3G4P A;  4OP8 A;  4CQH A;  4QJG A;  3Q82 A;  2ZMA A;  1BLP A;  3PAG A;  2WKQ A;  3G2Z A;  4RYE A;  2UWX A;  3D3O A;  1GHM A;  4GHI A;  5E2H A;  1OT6 A;  3UO9 A;  2JKR I;  2VJW A;  4L0L A;  2HDQ A;  3LEZ A;  1YPR A;  1MXO A;  2HP5 A;  1S4R A;  4ESP A;  4DDY A;  3G32 A;  2IA2 A;  5DVA A;  1W8Y A;  3PBO A;  2H0T A;  4DE3 A;  3IHA A;  3T4T A;  2VEA A;  5EEC A;  4M4X A;  4WZ4 A;  3IX4 A;  4F3L A;  2Q9N A;  2CMN A;  1OME A;  4S2N A;  4X1M A;  2R78 A;  2HP9 A;  5AVE A;  3IS2 A;  1D7E A;  5HWW A;  3V5M A;  1ZKJ A;  3IX8 A;  2M7V A;  2Y2L A;  3VMA A;  3UDI A;  5FQJ A;  5CED A;  3HJI A;  3KYZ A;  1DJB A;  1P0Z A;  3CIT A;  3P98 A;  3C8C A;  1VB6 A;  3IWO A;  4WMC A;  5EVI B;  2W1R A;  1Z09 A;  4KZ5 A;  4YOF A;  5IT5 A;  2JHE A;  1NYY A;  1FQG A;  3CLO A;  2OSU A;  3GSG A;  3NJA A;  4EQ1 A;  3LGO A;  4F3L B;  1FCN A;  4HBT A;  3MBZ A;  3IT9 A;  3WWX A;  4EBL A;  3LR4 A;  3BQA A;  4X56 A;  2ACG A;  3T1S A;  4KG2 A;  4Y3I A;  1EI5 A;  3ZG8 B;  3ITB A;  1STZ A;  2JKT I;  5L10 A;  3PBN A;  2P08 A;  3QP2 A;  5JYP A;  1VET A;  4KEN B;  3KSH A;  3BRM A;  1GSV A;  1FSW A;  2ZQC A;  4BL3 A;  1OTA A;  1LL8 A;  3T12 B;  2H0Y A;  3ZCZ A;  1KVM A;  1MWU A;  2O9B A;  4CLC C;  1L2S A;  4OPQ A;  1XJ3 A;  1CEG A;  5IHV A;  4WEL A;  5FI2 A;  1LT0 A;  4ME4 A;  4MCW A;  4GCZ A;  1K55 A;  4D60 A;  4ZDX A;  1ESU A;  4D2O A;  2QWS A;  3E2K A;  3UB7 A;  1K56 A;  2OWJ A;  1K57 C;  4UHU A;  1KVL A;  1L0D A;  2I72 A;  2ZQ8 A;  1M6K A;  4CLC E;  3TE8 A;  4E04 A;  3LID A;  2ZQA A;  4KZ6 A;  1YKD A;  4Q8I A;  4OQI A;  2PD7 A;  4JGO A;  2WKH A;  1SDN A;  4BD0 A;  1FSY A;  4QHC A;  4MNR A;  3OZH A;  4HEF A;  4P0M A;  3PAE A;  4R3A A;  2PYP A;  1G6A A;  3LR3 A;  1X0O A;  3IF6 B;  1XGI A;  1K54 C;  4EBN A;  1W79 A;  3BFD A;  1Z6F A;  4BQM A;  3C4O A;  2Y2M A;  1BUE A;  4KUO A;  3VP0 A;  4LV1 A;  1TD5 A;  4K0W A;  2XLN A;  4JKT A;  4PHT A;  3UE0 A;  1H8Y A;  2JE5 A;  2GX5 A;  1LSX A;  2J3T C;  1K4F A;  2EXA A;  3FKW A;  3QP6 A;  3VOZ A;  4NKP A;  1ACF A;  2V8F A;  1FOF A;  3HLF A;  3IF6 C;  1ES5 A;  2ZLY A;  5J8X A;  4DXC A;  2ZC3 B;  3L7H A;  2A2L A;  2W3H A;  3ISG A;  4AFI A;  1WA9 A;  4ZBE A;  3TOI A;  4B9O A;  1XJ6 A;  4UQI M;  1NYM A;  5GHY A;  2WKE A;  1TEM A;  4ARZ B;  5FAS A;  4GB7 A;  1UWN X;  3ITA A;  3QP4 A;  5DFY A;  3OPH A;  2PR6 A;  3PHY A;  4I38 A;  3VFH A;  2WYX A;  1DY6 A;  4S2L A;  3UMD A;  4B88 A;  1Y54 A;  4HQA A;  3ZQ5 A;  1YSQ A;  3NC8 A;  3WS2 A;  2L4R A;  3C4P A;  4QWO A;  4HH3 A;  3EEA A;  2Z2L B;  3W8K A;  3G2Y A;  1S0W A;  3M2J A;  3T4J A;  1O07 A;  1JTG A;  1OTB A;  2L0W A;  3FPV A;  4X53 A;  5L07 A;  2Y2K A;  1I5Q A;  4OKP A;  2HJ9 C;  1KE3 A;  3NDG A;  2A24 A;  4EUZ A;  2O9C A;  4PM6 A;  2B5R A;  1E3U A;  4DJ3 A;  3VP1 A;  5HL6 A;  2O99 A;  3R4K A;  2KOI A;  1T1A A;  4S2N C;  4B4Z A;  4GNU A;  1W5D A;  3MF0 A;  2DMW A;  3B47 A;  2BLS A;  4JXV A;  4NXG A;  1HTZ A;  3WS5 A;  3ZDJ A;  5CHM A;  5CEB A;  2MJ6 A;  4OOL A;  1W63 M;  1XXM A;  1H8Z A;  3N6I A;  2VGL M;  3SS4 A;  3DTI A;  5CTN A;  1CJF A;  5CGW A;  5GHX A;  5HD3 A;  5FEF A;  3FC7 A;  1Y28 A;  2Q0O A;  1NRJ A;  2PDR A;  1L0E A;  4DDS A;  2GDN A;  1PNE A;  3T1X A;  1XJ2 A;  3LFV A;  1GCE A;  1L3L A;  2O9A A;  2RL3 A;  1K56 D;  1GA9 A;  2Y2I A;  5EVI C;  3IX3 A;  2OV5 A;  1LL5 A;  4LEN A;  4WN5 A;  2KX6 A;  4E3O A;  5GL9 A;  5M18 A;  2P04 A;  4I3I A;  1CQA A;  1P9W A;  3W4Q A;  1S1Z A;  4WL9 A;  3B42 A;  5AQ9 A;  1RGY A;  4OP5 A;  4DXB A;  2W3F A;  3B3X A;  1GHP A;  4A5R A;  3NOT C;  3ZVT A;  2XSS A;  1W7F A;  3MJQ A;  2VV6 A;  4BBV A;  4GZB A;  2C6W B;  4P6B A;  2ZOH A;  5M1A A;  4BMW A;  5EVI A;  3QHY A;  3HVF A;  3GEC A;  4OPR A;  4IUK A;  2XFT A;  3EGX C;  2Z2M B;  3SW1 A;  1IYS A;  1PRQ A;  3DAV A;  5L09 A;  4CLC B;  3D4F A;  3A0S A;  4HBU A;  4MBK A;  1W63 Q;  4FH4 A;  1OJG A;  3VSL A;  3QP8 A;  3IXD A;  3ICY A;  4PM8 A;  4Y0U A;  4WYY A;  3H82 A;  2PU4 A;  4R4R A;  1SKO B;  2DCF A;  3PTE A;  1FIL A;  3T1Q B;  4E3M A;  1BLC A;  4OPZ A;  5FA7 A;  2B02 A;  3F1P B;  3FV7 A;  4S2I A;  4U0X A; 
#chains in the Genus database with same CATH homology
 2VEA A;  4CLC A;  4M4X A;  3PBQ A;  2EWV A;  3UE6 A;  4L9F A;  2NUP C;  3LR0 A;  4BBT A;  4F3L A;  3LYX A;  3K3D A;  2CMN A;  4YWZ A;  3VV4 A;  5HDS A;  2VX8 A;  2R78 A;  5AVE A;  2ZOI A;  4BJP A;  3IS2 A;  3PXP A;  3O5Y A;  4MN7 A;  1D7E A;  3PBS A;  2VGL S;  2Y79 A;  5CX7 A;  5HWW A;  1KOU A;  2O0Y A;  1DP8 A;  2M7V A;  3TRC A;  4GLQ A;  2PD8 A;  2XA7 M;  4EET B;  4G3K A;  4O8G A;  3EGD C;  3T4S A;  3HJI A;  3E98 A;  3KYZ A;  4FOF A;  4EEP A;  3C30 A;  1LSV A;  4HI4 A;  3E4P A;  4BWI A;  4L9E A;  1P0Z A;  3MQO A;  3CIT A;  4MDZ A;  3E4O A;  4QPR A;  3C8C A;  1VB6 A;  2EA9 A;  1IFQ A;  2W1R A;  1G28 A;  4YOF A;  5IT5 A;  1P97 A;  2JHE A;  4HOI A;  1T1C A;  3BJN A;  3CLO A;  3KO6 A;  5F68 A;  5LBR A;  3NJA A;  1YAX A;  2M1C A;  1LSW A;  4EQ1 A;  4F3L B;  5HSQ A;  3BY8 A;  4LRY C;  3LR4 A;  4B93 A;  4R70 A;  4UEY A;  4P6Z M;  1T18 A;  3BQA A;  4Y3I A;  5AJG A;  4H6J A;  4FSF A;  3LIC A;  1STZ A;  2JKT I;  2OOL A;  3PBN A;  2P08 A;  4HIA A;  5FL3 A;  2W0N A;  2W1T B;  3PYP A;  3KSH A;  4KQO A;  1GSV A;  4G3W A;  3P7N A;  4ETX A;  5K5B A;  4YNR A;  1OTA A;  3UE3 A;  1LL8 A;  3UB8 A;  1T19 A;  1VHM A;  3LIA A;  2WKR A;  3NOU C;  4BBU A;  2D01 A;  3UME A;  4RQ9 A;  1S67 L;  2W1T A;  2O9B A;  4CLC C;  2QHK A;  1S1Y A;  3PBT A;  4LPZ A;  1XJ3 A;  1ZHH B;  3B33 A;  1D06 A;  3V67 A;  2HF6 A;  4WEL A;  1OPX A;  3G6O A;  4KQD A;  1LT0 A;  1TS6 A;  4ME4 A;  4MCW A;  4GJ4 A;  4GCZ A;  3KSI A;  1TS7 A;  2V1B A;  2Z6C A;  3S7O A;  2WKP A;  4JGR A;  2I9V A;  4EEU A;  3MQ0 A;  2QWS A;  4H6J B;  3OLO A;  1MC0 A;  2QJ7 A;  3UB7 A;  1N9O A;  2OWJ A;  1G6O A;  4ARZ A;  1MZU A;  1NLY A;  4L9G A;  2VV7 A;  4HJ4 A;  4NXB A;  3T4K A;  4CLC E;  3TE8 A;  3K3C A;  4PKY G;  2PYR A;  3CWF A;  4E04 A;  3LID A;  3OCN A;  4HP9 A;  4DJ2 A;  3W2Z A;  1YKD A;  5KIZ A;  2PD7 A;  4JGO A;  2JKR M;  4OOM A;  3S7P A;  3F1O B;  2KLI A;  3KSG A;  2VLG A;  2PR5 A;  2HV1 A;  4R3A A;  5HPI A;  2PYP A;  5G4Z A;  3LR3 A;  1X0O A;  4JGP A;  2PHY A;  4WEJ A;  1BYW A;  3NOP C;  3FG8 A;  4K08 A;  3JVU A;  4LLO B;  3BQ8 A;  3KX0 X;  5AVF A;  1UGU A;  4KUO A;  4I3A A;  3IBR A;  5DJU A;  1V9Y A;  1TD5 A;  4PHT A;  3LI8 A;  2GZA A;  3K2N A;  5TBM A;  1V9Z A;  3LI9 A;  3LIB A;  2JKT M;  2V0W A;  3EOI A;  2GX5 A;  1LSX A;  2J3T C;  1ZTU A;  5HPF A;  5HZH A;  4NKP A;  4EXO A;  1MKM A;  3ULF A;  4MN5 A;  3RFB A;  2A2L A;  3UB9 A;  5F6A A;  3P01 A;  4LRX C;  4O01 A;  2Z6D A;  5KSH A;  3MMH A;  3KYQ A;  2W3H A;  2P7J A;  2OAQ 1;  4NEE D;  4AFI A;  4EUV A;  5HDC A;  1WA9 A;  3BY9 A;  1YSP A;  2XA7 S;  5HWV A;  4B9O A;  1XJ6 A;  2H28 A;  4UQI M;  2V1A A;  4WUJ A;  4ARZ B;  3OCL A;  5J7E A;  1UWN X;  3OC2 A;  1XFN A;  3MQQ A;  5DFY A;  3MFX A;  2V9A A;  4MN6 A;  1NLZ A;  2PR6 A;  2VZW A;  3PHY A;  3CUE C;  4NXF A;  2GNX A;  3S7Q A;  2PT7 A;  3CI6 A;  1ODV A;  4I38 A;  3R7W B;  3OBF A;  1NWZ A;  3BWL A;  3UMD A;  3ZYT A;  4HQA A;  3T50 A;  3ZQ5 A;  1YSQ A;  3T4Q A;  2B18 A;  1OJ5 A;  1TS8 A;  2L4R A;  3F1P A;  1TS0 A;  5J3W A;  2HJE A;  3RH8 B;  1P9R A;  2K31 A;  2YKF A;  3F1N B;  5DJT A;  5TBM B;  4HH3 A;  1GSW A;  3EEA A;  3U2A A;  1N9N A;  3R7W A;  3T4J A;  1F9I A;  3MR0 A;  2W3G A;  1OTB A;  3A0R A;  2L0W A;  4IJG A;  3FPV A;  5G4Y A;  4KUK A;  5TJJ A;  4HP4 A;  5DKL A;  5IU1 A;  3KSF A;  2QYB A;  1OTI A;  5MC7 A;  2HJ9 C;  5J4E A;  2A24 A;  2GJ3 A;  2ZBB A;  3H82 B;  3C38 A;  3BW6 A;  3E0Y A;  2O9C A;  4IHQ A;  5HD5 A;  1IOU A;  3D72 A;  3F1O A;  4DJ3 A;  5HL6 A;  1N9L A;  2O99 A;  3LIF A;  2KOI A;  3R4K A;  2NUT C;  2INW A;  1T1A A;  1OTD A;  3MXQ A;  1EW0 A;  5DF9 A;  3MF0 A;  3PBR A;  4I3J A;  2DMW A;  3HCY A;  5EFW A;  3B47 A;  4NXG A;  4R38 A;  4IUH A;  2KDK A;  1DP9 A;  3DBA A;  2OAP 1;  5DFX A;  1S66 L;  3OOV A;  1H3Q A;  2MJ6 A;  4OOL A;  4WF0 A;  5DKK A;  1DRM A;  1W63 M;  4MMN A;  4JGQ A;  2W27 A;  2VGL M;  3GDI A;  2W3E A;  3A0V A;  4HNB A;  2ZMF A;  3IBJ A;  4I39 A;  3JVV A;  2YKH A;  3EWK A;  1UWP X;  4DMZ A;  4WLA A;  2W3D A;  3E4Q A;  2VV8 A;  2L1M A;  3PR6 A;  4Y5F A;  2FH5 A;  2J3T D;  5HD3 A;  3EEH A;  3FC7 A;  1Y28 A;  4HJ6 A;  4XT2 B;  5IS1 A;  4ETZ A;  4GS9 A;  1NRJ A;  2PDR A;  3UB6 A;  2LB9 A;  4WEK A;  3EQU A;  3TJZ C;  3FPW A;  3LR5 A;  3TW8 A;  2LB5 A;  1XJ2 A;  1GSX A;  3LFV A;  3NHQ A;  4NXE A;  4PKY A;  2K2N A;  3C2W A;  3IS2 B;  2A24 B;  2O9A A;  4HY8 A;  4Y2F A;  3T4O A;  4EU0 A;  3F1N A;  5HWT A;  5F5Y A;  3VE4 A;  3LUQ A;  4P6Z S;  4Z1W A;  2QKP A;  4O0P A;  2BAS A;  3VE3 A;  2FZ0 A;  4WN5 A;  2KX6 A;  2P04 A;  4I5S A;  2J80 A;  1DP6 A;  1P9W A;  2EWW A;  2VKS A;  4I3I A;  4DN0 A;  2XRO A;  3T4L A;  1S1Z A;  1F5M A;  4WL9 A;  5C5K A;  3B42 A;  2OWH A;  5L8M A;  2D02 A;  2W3F A;  3LIE A;  2G7U A;  2K7S A;  3NOT C;  5I5L A;  4EER A;  2XSS A;  4LRZ E;  4XT2 A;  3MJQ A;  2VV6 A;  3S7N A;  4BBV A;  4ZRR A;  1OT9 A;  2J3W A;  3HJK A;  1TF1 A;  2ZOH A;  4GHI B;  3RTY A;  4BMW A;  1T1B A;  4HHD A;  4Q0J A;  2ZMV A;  4CQH A;  5HDD A;  4EES A;  2JN7 A;  3EQV A;  3GEC A;  4IUK A;  3CUE A;  3EGX C;  3SW1 A;  4Q0H A;  3H9W A;  2WKQ A;  4CLC D;  4CLC B;  4Q0I A;  2M7U A;  4G3V A;  1H8M A;  2QJ5 A;  3A0S A;  3D3O A;  1W63 Q;  2Y8H A;  3H7W B;  3VOL A;  1OJG A;  5A8B A;  4GHI A;  4R6L A;  2V0U A;  2XRN A;  1JNU A;  2VA0 A;  1XFQ A;  1OT6 A;  2JKR I;  2VJW A;  4L0L A;  4GW9 A;  1OTE A;  3ICY A;  4PAU A;  1S4S A;  5F69 A;  1S4R A;  3CAX A;  2HGV A;  4HH2 A;  3H82 A;  1F98 A;  4UQI S;  2IA2 A;  4HJ3 A;  1XJ4 A;  4II7 A;  4EW7 A;  3PBO A;  2B02 A;  3H7W A;  3F1P B;  4GS9 B;  3T4T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...