1DRMA

Crystal structure of the ligand free bjfixl heme domain
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
119
structure length
119
Chain Sequence
IPDAMIVIDGHGIIQLFSTAAERLFGWSELEAIGQNVNILMPEPDRSRHDSYISRYRTTSDPHIIGIGRIVTGKRRDGTTFPMHLSIGEMQSGGEPYFTGFVRDLTEHQQTQARLQELQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords SENSOR PROTEIN FIXL
publication title Structure of a biological oxygen sensor: a new mechanism for heme-driven signal transduction.
pubmed doi rcsb
source organism Bradyrhizobium japonicum
total genus 31
structure length 119
sequence length 119
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2000-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1drmA00
4BBTA 3K3DA 5HWTA 3PYPA 1TS8A 2VEAA 5TBMA 4F3LA 5DKLA 2YKFA 2M1CA 5A8BA 4HHDA 5J3WA 3PHYA 5DJUA 1DP6A 3F1NA 5HWVA 4L9GA 4KUOA 1OJ5A 5TBMB 1XFQA 1KOUA 2K7SA 2PR5A 5HD3A 2PYPA 4NXEA 1XJ6A 3UMEA 3F1NB 1NWZA 1DP9A 4WLAA 3F1PB 3BWLA 2VLGA 2CMNA 4DJ2A 4NXGA 4I3JA 5AVFA 4MN5A 5EFWA 2OWHA 2QJ7A 4GCZA 4HIAA 1T1BA 3G6OA 4H6JB 5J7EA 3HJIA 4I5SA 2GJ3A 3C8CA 4HOIA 4NXBA 4I39A 2PHYA 4GS9A 3A0VA 1XJ2A 3ICYA 1TS0A 1DP8A 1BYWA 2H28A 1T1CA 3H82A 4L9EA 3LIEA 4JGPA 2D01A 2V1BA 5HDSA 5IS1A 2INWA 3LUQA 2L4RA 4GS9B 3BY8A 5IU1A 2WKPA 1LSWA 3LIDA 4HJ4A 1TS7A 1D06A 1V9ZA 1S1ZA 5G4YA 4EEUA 4LRYC 3LI9A 2QHKA 2QKPA 4I3IA 3IBRA 1T1AA 5HSQA 5J4EA 2QJ5A 1EW0A 3E4OA 2WKQA 4EERA 4I3AA 1X0OA 4K08A 5KIZA 1GSVA 1P97A 3T50A 4R6LA 1D7EA 4F3LB 2ZOIA 3NOPC 4LRXC 3HJKA 1XFNA 4B9OA 3MQQA 4HH3A 4JGQA 3IS2A 4GW9A 1T18A 3UB7A 3MJQA 2ZOHA 4WUJA 1OTEA 4HJ6A 2Z6CA 4EQ1A 2B02A 3BY9A 4WL9A 4WN5A 3GDIA 4WF0A 4EESA 4HY8A 3IS2B 4GHIA 2EA9A 4I38A 1G28A 3LIBA 2VV7A 3CLOA 3H9WA 1S4SA 3MXQA 4M4XA 1VB6A 2KDKA 2A24A 3EWKA 5F69A 5HWWA 3GECA 3K3CA 2Z6DA 1N9LA 4R38A 4EXOA 2P7JA 4GHIB 3P7NA 1V9YA 3FG8A 3VOLA 4HP9A 4XT2A 1MZUA 1Y28A 1XJ3A 2A24B 3UB9A 3LICA 4HH2A 3F1OA 3ULFA 3SW1A 3VE4A 2V0UA 1OT6A 2V0WA 4HJ3A 5AVEA 2I9VA 2W27A 4JGOA 1S67L 2OOLA 2YKHA 3B33A 2KX6A 3H82B 2D02A 2R78A 3RTYA 4L9FA 1OJGA 1UWNX 3F1OB 1F9IA 3E4PA 4BBUA 1OTBA 1XJ4A 3KX0X 1LSVA 1OTDA 1OTIA 5F6AA 1JNUA 3MFXA 1T19A 1S66L 4PKYA 3D72A 4HP4A 1F98A 1LSXA 2PD8A 4EEPA 2W0NA 1N9OA 4KQDA 1S4RA 2JHEA 3ZQ5A 3VE3A 3UMDA 3LYXA 2L0WA 3UB8A 1OT9A 2PR6A 4HI4A 3F1PA 3H7WA 1N9NA 4EW7A 2WKRA 1DRMA 4HNBA 5DJTA 2PYRA 3CWFA 1P0ZA 1OTAA 4EETB 3EEHA 5HD5A 4LRZE 2VV8A 3UE6A 5HDDA 2L1MA 5DKKA 2VV6A 4H6JA 3H7WB 3LIAA 1WA9A 1UWPX 2PD7A 1S1YA 3LI8A 2ZBBA 3OLOA 4LLOB 4BBVA 5HDCA 4LPZA 4HQAA 2QWSA 5F68A 4JGRA 3FC7A 2OWJA 3MR0A 3LIFA 4RQ9A 3NHQA 3NOTC 3C2WA 1LL8A 2V1AA 2V9AA 3RH8B 1GSXA 1ODVA 5F5YA 1TS6A 2PDRA 4R3AA 1GSWA 5G4ZA 4NXFA 3NOUC 4DJ3A 2JN7A 4E04A 2BASA 3E4QA 3CAXA 4MN6A 5HZHA 3MQOA 4YWZA 3UB6A 4KUKA 3NJAA 3A0RA 1LT0A 4XT2B 1UGUA 3A0SA 4R70A 2HV1A 2J80A 5I5LA 4PKYG
chains in the Genus database with same CATH superfamily
1PIOA 5E2FA 4BBTA 4C75A 2J7VA 1GA9A 1L0FA 2J3TC 3K3DA 3NI9A 4U3TA 2XQZA 4F3LA 2HDSA 2NUPC 3LFVA 5A92A 4OPQA 3TJZC 1MPLA 4KG6A 1M6KA 1W63Q 3QP8A 1WYCA 2W1RA 3CG5A 3G32A 4L9GA 2XSSA 1ES3A 2VGJA 3GRJA 4UQIS 2X71A 3WS1A 1YSPA 1G68A 3L7HA 3QHYA 3LCEA 2J8YA 3UMEA 1NWZA 4QY5A 2LB9A 2VLGA 2CMNA 3UPNA 3AGFA 4R4RA 3B42A 4FD8A 4Y5FA 2HP5A 3NBLA 2OWHA 2QJ7A 3IXBA 4WM9A 4H6JB 2P74A 5J7EA 3BQ8A 4I5SA 3UN7A 4P85A 2WAEA 2PRFA 4KQQA 3HL9A 5GLCA 2ZQ9A 3GVBA 1KE3A 3O5YA 1TS0A 1DP8A 3RJUA 4ZJ3A 4LCMA 2RCXA 2XA7M 4NG2A 3H82A 2ZJ9A 1NY0A 2Y2KA 5BOHA 4Q0JA 1YM1A 3LUQA 4IEDA 2JKFA 2ZQCA 4WZ5A 5FEGA 3AGEA 4WYYA 3VV4A 1V9ZA 2GDNA 1CEGA 3IF6C 1YSQA 3WWXA 4LRYC 5FASA 4O8GA 3BECA 2WGVA 1N4OA 3N6IA 2A3UA 5HSQA 2Y91A 5J4EA 1PWCA 2O99A 3HLBA 2OLVA 4K08A 4BENA 4BLMA 1DY6A 4FCFA 4E3KA 2XLNA 3WRTA 3W4OA 1VEUB 2IA2A 4Y3IA 3HJKA 4B93A 4DE0A 1FSWA 4CLCC 3MFDA 2MJ6A 4F94A 1YLZA 4QY6A 3SZTA 3C30A 1AWIA 3Q7VA 4YFMA 1K56D 1T18A 1K55C 1J9MA 3R7WA 4OPYA 2ZOHA 4RA7A 2Y2PA 1SDEA 4PM5A 4AFIA 4EQ1A 2Y4AA 3BY9A 3B3XA 4WL9A 4WN5A 4S2LA 4KZ4A 1SHVA 1L3LA 4GD8A 4HY8A 5HPFA 1G28A 4X53A 3MXQA 3IWIA 3MBZA 3CJMA 5DTSA 2HZ5A 4R1GA 3EWKA 3MF0A 3S4XA 4KQRA 3P98A 2WGIA 1S6RA 3PBQA 3QNBA 2QPNA 1XGJA 3CHWP 2QMIA 3HCYA 3EQUA 2M7UA 4FSFA 4P6BA 1NYYA 2A24B 3BFGA 4KZ8A 1Q2QA 3SW1A 1G6OA 4HJ3A 5AVEA 4P0MA 4JKTA 4JGOA 2X01A 2ZD8A 2XDMA 4LGWA 1YLTA 2ZMFA 3W8KA 2ZL1B 5AQAA 3ZVTA 1NLYA 1SKOB 1CK3A 5GHXA 3KYEA 3RTYA 2Y2QA 3OC2A 4Y7PA 4LV3A 1BZAA 5EM1A 4X55A 3K2NA 1HD8A 4HESA 2H5SA 1VQQA 2ZMVA 1LSVA 3ZHHA 1TVFA 1SCWA 1ESIA 3VP2A 4UHUA 3DTEA 3VP0A 5MC7A 1ONHA 1O7EA 1T19A 4EBPA 3U2AA 2EXBA 4FH4A 1E3UD 2QZ6A 3TRCA 1E3UA 3P09A 2V1ZA 1IELA 4P6ZM 5M18A 4WBGA 2EFUA 3DW0A 1L2SA 4S2PA 4GZBA 1PZPA 1OT9A 4Y0TA 4QHCA 3H7WA 4MBKA 3VFFA 5DF7A 1PYYA 3BQAA 2IWCA 2PYRA 4X69A 3CWFA 1P0ZA 4MEZA 5FDSA 4XUXA 4E3OA 3S7PA 4LRZE 2VV8A 5EVID 3BLSA 5FATA 1JWVA 1QMFA 3Q7ZA 4O7DA 2VV6A 5EVIA 4H6JA 2JKGA 3OPPA 3UE0A 1A0KA 2PD7A 3LI8A 5HAPA 3HUMA 4ZJ2A 4OQ0A 4BBVA 1ES4A 2WZXA 3T1RA 5LBRA 3UB5P 5KSCA 5F68A 5DF8A 3IWOA 3JVUA 2OWJA 3L9KA 3NHQA 1SDNA 1YLWA 2BG1A 3KSHA 3N8SA 2W3DA 2HDRA 2PDRA 5F1GA 3S1YA 4Y2FA 2OLUA 5G4ZA 2VGKA 4S2OA 2G2UA 2WKHA 2EX2A 2BASA 2FFFB 4YOFA 4OH0A 3IQAA 3S7NA 3N8LA 3ZGAB 2O9AA 3ZFZA 4JXWA 3LY4A 1I2SA 2C6WB 4KUKA 3KO6A 2E8JA 3A0RA 3TSGA 3VP3A 5EE8A 5TR7A 4MLLA 3NIAA 2HV1A 5CHUA 1XPBA 5E2HA 4JXVA 2P9VA 4R4SA 3EGXC 4BL3A 5I5LA 2Y2IA 2R9XA 4ZTKA 3ZNYA 2Y2JA 1CJFA 1VEUA 1YMSA 2PT7A 3TG9A 5TBMA 5DVAA 5DKLA 4UEYA 3U4LP 2YKFA 4PM8A 5A8BA 3DAVA 3D4FA 3FPWA 4IUKA 5EM0A 5J3WA 2UWXA 2B95A 3C38A 3C7VA 3CZDA 3JVVA 3RXXA 5HWVA 1LI0A 2K2NA 2EX6A 3WS2A 1FIKA 1NJ4A 4B4ZA 3LO7A 2IWBA 3IHAA 3IBJA 2P08A 2PR5A 2PYPA 3F1NB 1MBLA 2HP9A 4X56A 4E3NA 5GLAA 4DDYA 4UQIM 3DWZA 1ACFA 5FQQA 3TOIA 2ZQ8A 4NXGA 1K25A 4I3JA 4LENA 5F83A 4S2NA 4WZ5C 4GCZA 2O0YA 2PBYA 4HIAA 4Z9QA 1T1BA 3FZCA 3EGDC 4IHQA 2GJ3A 3G2YA 1RCJA 1K6RA 2X02A 5HFOA 3WS5A 1KGEA 4ZBEA 3MZEA 2Q9NA 4YNRA 3LGOA 4S2MA 1W7FA 5AQ7A 4I39A 3VSLA 3CPTA 3A3IA 1XJ2A 1F5MA 1YT4A 4LFUA 3NCKA 1N9BA 2XFTA 4OLDA 2EX9A 1Z09A 3C4OA 1SKOA 3NECA 4FH2A 5HL6A 1VM1A 4MMNA 4BWIA 3GV9A 3A3DA 1BTLA 3KYZA 2D01A 2JKRI 2V1BA 5E43A 4N9LA 3G4PA 2INWA 5FL3A 3Q1FA 4GS9B 3BY8A 3MXRA 1H3QA 5CECA 4FOFA 3TW8A 1VHMA 2XK1A 4HJ4A 3VP1A 4R3BA 3UY6A 3KYQA 1IKGA 4GDNA 1S1ZA 2WGWB 4O01A 4EEUA 1E25A 5DFYA 3C7UA 2A49A 1MY8A 2EFXA 2WUQA 3LI9A 3MQ0A 2XFSA 4I3IA 1T1AA 5G18A 1BLHA 1EW0A 1K54A 3E4OA 4EUVA 4IBRA 4I3AA 4ZRRA 4Y0UA 5KIZA 1ZG6A 4PHTA 3UO9A 4BQMA 2HJ9C 1K6SA 3BYDA 1IYOA 3HVFA 3M2JA 3KSFA 3IH8A 5FI7A 4LRXC 3T4OA 2GZAA 2JCHA 3VSKA 3ZYTA 5GHZA 1ES2A 1FCNA 4WEJA 1LI9A 2HDQA 5TGFA 4L0LA 4KZ6A 2W1TB 2V8CA 3QP5A 3Q82A 3IX4A 3MZDA 2O9BA 3D3OA 1YLJA 4K0WA 3E98A 4WF0A 4OQGA 3OPHA 3IS2B 4GHIA 5FSRA 2XD1A 3IXHA 1F2KA 4KZAA 4JF5A 3HLDA 3H9WA 2ZC5B 2JKTI 4ZJ1A 1GA0A 1TF1A 3IF6B 2EXAA 1IFQA 2Q9MA 4KZ7A 3HLEA 3FYZA 3QP6A 4DE3A 3OPRA 5CHJA 4C6YA 3MZFA 3O3VA 2KLIA 1H8ZA 3M6BA 3FG8A 4CQHA 3W4PA 1I2WA 1CI9A 3LR0A 1LLBA 3GTCA 3LICA 3F1OA 1CQAA 3ULFA 2VGLM 2V0WA 3SOIA 1YQSA 2I9VA 2W27A 3OZHA 4CLCB 5A91A 3I7JA 4QJGA 1VETA 2D02A 2R78A 4OP8A 2PU4A 2K31A 1F9IA 5EVIC 3E4PA 4BBUA 5E2GA 3BFEA 1DJCA 1OTIA 3T12B 4KZ3A 2XRNA 1MWUA 5L10A 1S66L 5GHYA 4HP4A 3OCNA 4WEKA 2HDUA 4ZDXA 1LSXA 4EEPA 1YKDA 4KQDA 3HLCA 3M6HA 1MKMA 2JHEA 3VE3A 2EWVA 2L0WA 3UB8A 4HI4A 1XA1A 3IH9A 3RXWA 1W8YA 2WKRA 3V3RA 3S22A 1XA7A 2V8FA 4RX3A 5FI2A 3TE8A 5HD5A 4E3MA 3WS0A 3UE6A 5HL1A 4JXSA 3E2KA 3GR2A 5DKKA 4EU0A 5I94A 4IVIA 3MKFA 4BL2A 3SS5A 3HLWA 3ZG0A 3V5MA 2DNSA 1K4FA 5K5BA 3QP4A 2J3TD 3MSHA 1FOFA 3ITBA 5HDCA 3IHBA 2JBFA 3HUNA 5HAIA 1K4EA 2QWSA 3N8RA 4M3KA 4ARZA 3MR0A 4PPRA 4RQ9A 4Z1WA 2W3EA 3N4IA 1MWTA 4JF6A 3NOTC 1XX2A 2OAQ1 1LL8A 3C2WA 2V1AA 1KE4A 3NY4A 2XA7S 3FV7A 3QP2A 1JVJA 1KVMA 2EX8A 4R3AA 2A2LA 2AVXA 1S0WA 2FH5A 2Y2GA 4YINA 1JTGA 3CAXA 4CLCE 4BJPA 5HZHA 3ZG7B 3MQOA 3UB6A 1U60A 4OLGA 2WGWA 3ZCZA 3T4JA 3SH7A 1CF0A 1KGGA 4R70A 3NULA 4ZAMA 1W63M 2PBDP 5KZHA 4ESPA 2VK3A 3UDFA 1YAXA 4PKYG 1NZUA 3BEBA 3PBTA 1H5XA 3BJNA 5HWTA 3PYPA 1TS8A 3BFFA 2W3FA 3A3FA 3DWKA 4WELA 2IWDA 1ERMA 4HHDA 4WZ4A 2OSUA 1W8QA 4KUOA 4ID4A 5JYPA 1AXBA 2K7SA 4RX2A 1BSGA 4NXEA 4EV4A 4DXBA 4IBXA 2ZM8A 4PMAA 4OOMA 2OV5A 1DP9A 4WLAA 4KZ9A 3IX3A 4GKUA 4DJ2A 3BLMA 1XKZA 3A3EA 1SZVA 1ALQA 5AVFA 4UAAA 4DRTA 4PM9A 5EFWA 2NUTC 3N7WA 3IF5A 3T4QA 3CITA 3BRMA 1K0KA 1RGYA 2PAVP 3P01A 5AQBA 5EPHA 3G6OA 1FR1A 4G3WA 4R3JA 5CTMA 4OPZA 4NEED 2ZC3B 5IT5A 4HOIA 3IXGA 4FUWA 2ZM0A 4Q0IA 3ZG9B 1E4DA 2PHYA 2Q0OA 2VA0A 3M2KA 5GLDA 4CLCD 3ICYA 3B47A 5FQIA 4OQIA 4IUHA 4CLCA 4RVAA 1TEMA 1T1CA 4DXCA 1MWSA 4L9EA 1XP4A 2WKEA 3PBNA 4OOYA 3LY3A 4Y15A 4UA6A 5IS1A 1CI8A 2ZQ7A 1BLPA 5IU1A 2WKPA 1LSWA 3R4KA 3LIDA 4QU3A 1TS7A 3DTKA 3EQVA 5A93A 4UA7A 3JPUA 2VJWA 5G4YA 1MC0A 2QHKA 2XF3A 3BFCA 4MBHA 4E3IA 4GJ4A 2VX8A 2R9WA 5GLBA 3PBOA 1BUEA 3HLFA 4EERA 1PW8A 5CERA 2Z2LB 4XXRA 4KENB 1P97A 3T50A 3CUEA 1D7EA 4UA9A 1XFNA 1K38A 5EOEA 1G5UA 3MMHA 3VOZA 4K91A 5HX9A 2FZ0A 4P87A 3MQQA 4N9KA 4HH3A 4GW9A 3MJQA 4IJGA 3SH9A 2JKRM 4HJ6A 5F82A 4GLQA 4FTXA 2XROA 4PM7A 2B02A 1KDWA 4JF4A 3T4TA 3JYIA 3GDIA 2WYXA 3G31A 1Y4OA 2Y55A 2Y2NA 2HGVA 3PAEA 3LIBA 1PNEA 1JWZA 4N1XA 2VV7A 1BULA 1S4SA 4M4XA 1BLCA 2KDKA 2WAFA 3D9YA 1ZC2A 2J3WA 2A24A 4H8RA 5HWWA 3GECA 3K3CA 2Z6DA 1L0EA 1WYBA 3DTMA 4R38A 4EXOA 3G30A 4R23A 4II7A 2XEPA 2V20A 1YLYA 5KSHA 3VOLA 2HPBA 2ZL1A 1YLPA 1MZUA 4E6WA 1Y54A 4GNUA 2ACGA 3LR5A 1XJ3A 2LB5A 4HH2A 1TDGA 3VE4A 2V0UA 1OT6A 3PTEA 2WZZA 4ME4A 1S67L 1IYSA 3MKEA 4DE1A 2OOLA 1MWRA 3B33A 2KX6A 4Y17A 4QB8A 4B88A 4L9FA 4U0XA 4KZ5A 1PW1A 1OTBA 1XJ4A 3KX0X 5JYOA 1OTDA 5DTKA 4E3LA 1EWZA 3AGDA 4OP5A 3ZG8B 5CRFA 3V50A 3MFXA 3UE3A 4NKPA 1IKIA 4PKYA 4A5RA 3UPPA 2JKTM 1S4RA 4PAUA 3ZQ5A 5CGWA 3OCLA 3UMDA 2PR6A 5GL9A 4EQIA 1OPXA 3VFHA 2G7UA 1Q2PA 1DRMA 4MBFA 1DJBA 4HNBA 5CX7A 5DJTA 4LCLA 1SKFA 1OTAA 1TDLA 1EROA 3W4QA 1Z6FA 4QD4A 5HDDA 2BLSA 2CC1A 4LV0A 1KGFA 1JWPA 3H7WB 5FQJA 1C3BA 1PWGA 2DCFA 1UWPX 1PI4A 3SS3A 5CHMA 2W3GA 1S1YA 3OLOA 4LLOB 4OONA 3NC8A 4OVDA 4LV2A 4LPZA 3EOIA 1W5DA 4QWOA 4JGRA 3SH8A 1NRJA 3FC7A 5EVIB 5EECA 4DN0A 2Y2MA 2Y59A 1IOUA 1JTDA 4GD6A 2V9AA 1GSXA 1ODVA 3ISGA 4RYEA 4Q8IA 2ZC6B 3O87A 2M7VA 1GSWA 3O86A 4DJ3A 3E4QA 1PZOA 5HW3A 5EOOA 1QMEA 3Q07A 3MS6A 1FCMA 3NJAA 1LT0A 3ZG5A 2G2WA 4DE2A 2O9CA 5L2FA 2XH9A 4XT2B 1ZTUA 4CJNA 5L07A 2UV0E 3KSGA 2JE5A 2J80A 4B4XA 1H0MA 1ZHHB 1GHIA 3FKVA 1YMXA 1NRFA 1ERQA 1HLUP 3CMZA 4HEFA 2VEAA 3HBRA 3ITAA 1J3WA 3ZDJA 1K57A 1GHMA 2B18A 3ZNTA 2M1CA 5FAQA 1ES5A 3VOYA 2P9VB 3PHYA 1DP6A 5DJUA 3F1NA 1PRQA 3GMWA 5M1AA 5FDHA 4X6TA 3FPVA 4EBLA 3G35A 1G6AA 1NZOA 4DDSA 3T1SA 1OJ5A 5TBMB 1XFQA 1XGIA 4KQOA 1KOUA 4OQHA 4DKIA 5HD3A 1XJ6A 4OKPA 1I5QA 3VMAA 3F1PB 3BWLA 5DF9A 4G3VA 4JPMA 3E0YA 4D60A 1K56A 4C3QA 1M40A 4MN5A 3T4SA 1H8MA 2Y2LA 3V67A 1BLSA 3O88A 4K0XA 4S2KA 3HJIA 4Y13A 1NYMA 3C8CA 3LEZA 4NXBA 4X68A 4EBNA 4XUZA 5CGSA 5FQKA 2Y2HA 3PXPA 2PU2A 2VGLS 1ESUA 4GS9A 3A0VA 3CUEC 5E2EA 1BYWA 1IYPA 2H28A 2Y2OA 3IT9A 4U0TA 2GNXA 2WADA 3UDIA 2J9OA 4MCWA 1IEMA 3LIEA 4OOLA 4JGPA 2ZQDA 3CPTB 5HDSA 3MXSA 1GCEA 2BTFP 2L4RA 1OMEA 1NLZA 2XR0A 3RFBA 1D06A 4S2NC 1PI5A 5HARA 4NK3A 1LL5A 1FCOA 3IX8A 2XD5A 5FI6A 3BW6A 2Y8HA 2QKPA 5L09A 3IBRA 4ETXA 2C5WB 1HVBA 2QJ5A 3HLGA 3NDEA 4DMZA 2WKQA 5A90A 1X0OA 1BT5A 1ZG4A 3PBRA 2ZM2A 1H8YA 3HUOA 1GSVA 4MNRA 2DRWA 3GSGA 1ONGA 2RL3A 4R6LA 2W1TA 1PWDA 3QP1A 4F3LB 2ZOIA 3NOPC 1PFLA 4R0QA 4ETZA 5DFXA 3W2ZA 4B9OA 3Q81A 3FWLA 4BD0A 2HP6A 2HJEA 4JGQA 4GN2A 3IS2A 4QPRA 4N92A 3UB7A 1CEFA 5CEDA 4NETA 3VP4A 5CGXA 3PR6A 2J9PA 5D3OA 4BMWA 4WUJA 1OTEA 2W3HA 2Z6CA 1EI5A 3IF6A 2E8IA 3OPLA 3T4KA 4S2JA 4CPKA 5FQMA 2WK0A 4EESA 4GOGA 3ZVWA 2EA9A 5AJGA 2DMWA 4I38A 3G2ZA 4KG5A 4X25A 1STZA 3KSIA 3PAGA 3CLOA 4EUZA 3V3SA 5FA7A 1VB6A 1K54C 5FAPA 2ZQAA 1MKIA 5F69A 1N9LA 2B5RA 2P7JA 2QYBA 4GB7A 4GHIB 4HBTA 5AQ9A 3QNCA 3OBFA 3P7NA 1V9YA 1L0DA 5HPIA 4HP9A 4XT2A 3E2LA 1RP5A 1Y28A 1L0GA 3UB9A 3C4PA 1P9RA 1LHYA 3LR3A 1K55A 2ZLYA 5L8MA 1FR6A 5U47A 4GDBA 1MXOA 5FAOA 5FEFA 3HREA 3IXDA 5M19A 1W79A 5DTTA 4MN7A 3LEQA 2YKHA 3C5AA 5EVEA 3H82B 1GHPA 3WRZA 2FFYA 1OJGA 1UWNX 4O0PA 2OAP1 1WE4A 4S2IA 2Y79A 3F1OB 3V39A 2GX5A 3UDXA 5HAQA 1O07A 3BFDA 2XGNA 2JC7A 4P6ZS 5EV0A 5CEBA 5F6AA 2EWWA 5IHVA 2VKSA 1JNUA 4E6XA 3NDGA 1VETB 2VZWA 5J8XA 1YPRA 3D72A 2HF6A 3DBAA 1F98A 3CI6A 2PD8A 2W0NA 4G3KA 1N9OA 4JBFA 3OOVA 1RGZA 3GQZA 3S7OA 3LYXA 1P9WA 3T1QB 3EEAA 3F1PA 2Z2MB 1TD5A 1N9NA 4EW7A 3A3JA 3G34A 4N1HA 3UNWA 3BM6A 4EETB 3FKWA 5EUAA 4EWFA 3EEHA 4OPRA 5FQ9A 5EVLA 1ZKJA 2L1MA 4DF6A 1D1JA 5CXWA 3UPOA 4E3JA 3LIAA 1WA9A 3Q7VB 2H0TA 2ZBBA 4Q0HA 3R7WB 1KE0A 2ZC7A 3PBSA 4HQAA 1FQGA 3T1XA 4WMCD 4D2OA 3LIFA 1FILA 4WMCA 1XXMA 4X1MA 5TJJA 2I72A 4JLFA 4IVKA 4Y0OA 2V2FF 1K57C 4LV1A 3S7QA 3RH8B 5F5YA 4PM6A 1TS6A 1HZOA 4BD1A 1KDSA 1LL9A 4KG2A 5CTNA 4KZBA 2ZMAA 4NXFA 4ARZB 3NOUC 2JN7A 4E04A 2WKIA 4MN6A 2H10A 4MDZA 3SS4A 3UE1A 1KVLA 4YWZA 1HTZA 3IWQA 3LR4A 3T4LA 5F1FA 2ZC4B 1FSYA 1IYQA 2H0YA 1UGUA 3A0SA 1DJAA 3WS4A 4JXGA 1NXYA 2KOIA 4HBUA 5KMWA 3DTIA 2P04A 5TFQA 5C5KA 4X1LA
chains in the Genus database with same CATH topology
3PBTA 4BBTA 3BJNA 2J3TC 3K3DA 5HWTA 3PYPA 2PT7A 1TS8A 2VEAA 5TBMA 4F3LA 2W3FA 5DKLA 4UEYA 2YKFA 2B18A 4WELA 2M1CA 2NUPC 5A8BA 3LFVA 3FPWA 4IUKA 3TJZC 4HHDA 5J3WA 3PHYA 5DJUA 1DP6A 3C38A 1W63Q 3F1NA 3JVVA 5HWVA 2W1RA 2K2NA 3FPVA 4L9GA 2XSSA 4KUOA 1OJ5A 5TBMB 1XFQA 4UQIS 3IBJA 4KQOA 1KOUA 2K7SA 2P08A 1YSPA 2PR5A 5HD3A 2PYPA 4NXEA 1XJ6A 3UMEA 3F1NB 4OOMA 1NWZA 1DP9A 4WLAA 2LB9A 3F1PB 3BWLA 5DF9A 2VLGA 2CMNA 4G3VA 4DJ2A 3E0YA 4UQIM 3B42A 4NXGA 4Y5FA 4I3JA 5AVFA 4MN5A 5EFWA 2NUTC 2OWHA 2QJ7A 4GCZA 2O0YA 3T4QA 3CITA 3T4SA 4HIAA 1H8MA 3V67A 3P01A 1T1BA 3G6OA 4H6JB 5J7EA 3EGDC 4IHQA 3HJIA 3BQ8A 4I5SA 2GJ3A 4G3WA 4NEED 3C8CA 5IT5A 4HOIA 4NXBA 4YNRA 4I39A 4Q0IA 2PHYA 2VA0A 3PXPA 2VGLS 4GS9A 3O5YA 3A0VA 4CLCD 3CUEC 1XJ2A 3ICYA 1F5MA 3B47A 1TS0A 1DP8A 4IUHA 1BYWA 4CLCA 2H28A 2GNXA 2XA7M 1T1CA 3H82A 4L9EA 4MCWA 3LIEA 3PBNA 4JGPA 4OOLA 5HL6A 4MMNA 4BWIA 3KYZA 2D01A 2JKRI 2V1BA 5HDSA 5IS1A 4Q0JA 2INWA 5FL3A 3LUQA 2L4RA 4GS9B 3BY8A 5IU1A 1NLZA 1H3QA 4FOFA 2WKPA 3TW8A 1LSWA 3R4KA 3RFBA 3LIDA 3VV4A 1VHMA 4HJ4A 1TS7A 1D06A 3KYQA 1V9ZA 3EQVA 1YSQA 1S1ZA 2VJWA 5G4YA 4O01A 4EEUA 5DFYA 4LRYC 1MC0A 3LI9A 3BW6A 2QHKA 2Y8HA 3MQ0A 2QKPA 4O8GA 4I3IA 3IBRA 4ETXA 1T1AA 5HSQA 4GJ4A 2VX8A 5J4EA 2QJ5A 1EW0A 2O99A 4DMZA 3E4OA 3PBOA 2WKQA 4EERA 4EUVA 4I3AA 1X0OA 4K08A 4ZRRA 3PBRA 5KIZA 1GSVA 4PHTA 1P97A 3T50A 3CUEA 2HJ9C 4R6LA 2W1TA 1D7EA 2IA2A 4F3LB 2ZOIA 3KSFA 4Y3IA 3NOPC 4LRXC 3HJKA 3T4OA 1XFNA 2GZAA 4B93A 4ETZA 3MMHA 4CLCC 5DFXA 3W2ZA 3ZYTA 2FZ0A 4B9OA 2MJ6A 4WEJA 3MQQA 2HJEA 3C30A 4HH3A 4JGQA 4L0LA 3IS2A 4GW9A 4QPRA 1T18A 3UB7A 2W1TB 3MJQA 4IJGA 3PR6A 3R7WA 2JKRM 4BMWA 2ZOHA 4WUJA 1OTEA 2W3HA 2Z6CA 4HJ6A 4GLQA 2O9BA 3D3OA 2XROA 4AFIA 4EQ1A 2B02A 3BY9A 4WL9A 4WN5A 3T4KA 3T4TA 3E98A 3GDIA 4WF0A 4EESA 4HY8A 3IS2B 2EA9A 4GHIA 5HPFA 2HGVA 5AJGA 2DMWA 1G28A 3LIBA 4I38A 1STZA 2VV7A 3KSIA 3CLOA 3H9WA 1S4SA 3MXQA 4M4XA 2JKTI 1VB6A 2KDKA 1TF1A 2J3WA 2A24A 1IFQA 3EWKA 5F69A 5HWWA 3GECA 3MF0A 3K3CA 2Z6DA 1N9LA 4R38A 4EXOA 2P7JA 2QYBA 4II7A 2KLIA 3PBQA 4GHIB 3OBFA 3P7NA 1V9YA 3FG8A 5KSHA 3HCYA 3EQUA 3VOLA 5HPIA 4HP9A 4CQHA 4XT2A 2M7UA 1MZUA 1Y28A 4FSFA 3LR0A 3LR5A 1XJ3A 2A24B 3UB9A 2LB5A 3LICA 1P9RA 3F1OA 4HH2A 3LR3A 3ULFA 2VGLM 3SW1A 5L8MA 3VE4A 2V0UA 1OT6A 2V0WA 1G6OA 4HJ3A 5AVEA 2I9VA 2W27A 4ME4A 4JGOA 1S67L 4CLCB 2ZMFA 2OOLA 4MN7A 2YKHA 3B33A 2KX6A 1NLYA 3H82B 2D02A 2R78A 3RTYA 3OC2A 4L9FA 1OJGA 1UWNX 4O0PA 2OAP1 2Y79A 2K31A 3F1OB 3K2NA 1F9IA 3E4PA 2GX5A 4BBUA 1OTBA 3KX0X 1XJ4A 2ZMVA 1LSVA 1OTDA 1OTIA 4P6ZS 5F6AA 2EWWA 2VKSA 2XRNA 1JNUA 3MFXA 3UE3A 4NKPA 5MC7A 1T19A 2VZWA 1S66L 4PKYA 3D72A 3U2AA 2JKTM 2HF6A 4HP4A 3DBAA 3OCNA 4WEKA 3TRCA 1F98A 3CI6A 1LSXA 2PD8A 4EEPA 2W0NA 4G3KA 1N9OA 1YKDA 4KQDA 1S4RA 1MKMA 2JHEA 4P6ZM 3OOVA 4PAUA 3VE3A 3ZQ5A 3OCLA 3S7OA 3UMDA 3LYXA 2EWVA 2L0WA 3UB8A 1P9WA 1OT9A 2PR6A 1OPXA 4HI4A 3EEAA 3F1PA 3H7WA 2G7UA 1TD5A 1N9NA 4EW7A 2WKRA 1DRMA 3BQAA 4HNBA 5CX7A 5DJTA 2PYRA 3CWFA 1P0ZA 1OTAA 4EETB 3EEHA 3TE8A 5HD5A 3S7PA 4LRZE 2VV8A 3UE6A 5HDDA 2L1MA 5DKKA 2VV6A 4EU0A 4H6JA 3H7WB 3LIAA 1WA9A 1UWPX 2W3GA 2PD7A 1S1YA 3LI8A 2ZBBA 3OLOA 4LLOB 4Q0HA 3R7WB 4BBVA 5K5BA 3PBSA 2J3TD 5HDCA 4LPZA 4HQAA 5LBRA 2QWSA 3EOIA 5F68A 4ARZA 4JGRA 1NRJA 3FC7A 3JVUA 2OWJA 3MR0A 3LIFA 4RQ9A 4Z1WA 3NHQA 5TJJA 4DN0A 2W3EA 3NOTC 1IOUA 2OAQ1 1LL8A 3C2WA 2V1AA 3KSHA 3S7QA 2V9AA 2W3DA 3RH8B 1GSXA 1ODVA 5F5YA 1TS6A 2XA7S 2PDRA 4Y2FA 4R3AA 2A2LA 2M7VA 1GSWA 5G4ZA 4NXFA 4ARZB 3NOUC 4DJ3A 2JN7A 2FH5A 4E04A 2BASA 3E4QA 4YOFA 3CAXA 3S7NA 4MN6A 4MDZA 4CLCE 2O9AA 4BJPA 5HZHA 3MQOA 4YWZA 3UB6A 4KUKA 3KO6A 3NJAA 3A0RA 1LT0A 3LR4A 3T4LA 2O9CA 4XT2B 1ZTUA 1UGUA 3A0SA 3T4JA 4R70A 2HV1A 1W63M 2KOIA 3KSGA 3EGXC 2J80A 1YAXA 5I5LA 2P04A 1ZHHB 5C5KA 4PKYG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BBT A;  3K3D A;  5HWT A;  3PYP A;  1TS8 A;  2VEA A;  5TBM A;  4F3L A;  5DKL A;  2YKF A;  2M1C A;  5A8B A;  4HHD A;  5J3W A;  3PHY A;  5DJU A;  1DP6 A;  3F1N A;  5HWV A;  4L9G A;  4KUO A;  1OJ5 A;  5TBM B;  1XFQ A;  1KOU A;  2K7S A;  2PR5 A;  5HD3 A;  2PYP A;  4NXE A;  1XJ6 A;  3UME A;  3F1N B;  1NWZ A;  1DP9 A;  4WLA A;  3F1P B;  3BWL A;  2VLG A;  2CMN A;  4DJ2 A;  4NXG A;  4I3J A;  5AVF A;  4MN5 A;  5EFW A;  2OWH A;  2QJ7 A;  4GCZ A;  4HIA A;  1T1B A;  3G6O A;  4H6J B;  5J7E A;  3HJI A;  4I5S A;  2GJ3 A;  3C8C A;  4HOI A;  4NXB A;  4I39 A;  2PHY A;  4GS9 A;  3A0V A;  1XJ2 A;  3ICY A;  1TS0 A;  1DP8 A;  1BYW A;  2H28 A;  1T1C A;  3H82 A;  4L9E A;  3LIE A;  4JGP A;  2D01 A;  2V1B A;  5HDS A;  5IS1 A;  2INW A;  3LUQ A;  2L4R A;  4GS9 B;  3BY8 A;  5IU1 A;  2WKP A;  1LSW A;  3LID A;  4HJ4 A;  1TS7 A;  1D06 A;  1V9Z A;  1S1Z A;  5G4Y A;  4EEU A;  4LRY C;  3LI9 A;  2QHK A;  2QKP A;  4I3I A;  3IBR A;  1T1A A;  5HSQ A;  5J4E A;  2QJ5 A;  1EW0 A;  3E4O A;  2WKQ A;  4EER A;  4I3A A;  1X0O A;  4K08 A;  5KIZ A;  1GSV A;  1P97 A;  3T50 A;  4R6L A;  1D7E A;  4F3L B;  2ZOI A;  3NOP C;  4LRX C;  3HJK A;  1XFN A;  4B9O A;  3MQQ A;  4HH3 A;  4JGQ A;  3IS2 A;  4GW9 A;  1T18 A;  3UB7 A;  3MJQ A;  2ZOH A;  4WUJ A;  1OTE A;  4HJ6 A;  2Z6C A;  4EQ1 A;  2B02 A;  3BY9 A;  4WL9 A;  4WN5 A;  3GDI A;  4WF0 A;  4EES A;  4HY8 A;  3IS2 B;  4GHI A;  2EA9 A;  4I38 A;  1G28 A;  3LIB A;  2VV7 A;  3CLO A;  3H9W A;  1S4S A;  3MXQ A;  4M4X A;  1VB6 A;  2KDK A;  2A24 A;  3EWK A;  5F69 A;  5HWW A;  3GEC A;  3K3C A;  2Z6D A;  1N9L A;  4R38 A;  4EXO A;  2P7J A;  4GHI B;  3P7N A;  1V9Y A;  3FG8 A;  3VOL A;  4HP9 A;  4XT2 A;  1MZU A;  1Y28 A;  1XJ3 A;  2A24 B;  3UB9 A;  3LIC A;  4HH2 A;  3F1O A;  3ULF A;  3SW1 A;  3VE4 A;  2V0U A;  1OT6 A;  2V0W A;  4HJ3 A;  5AVE A;  2I9V A;  2W27 A;  4JGO A;  1S67 L;  2OOL A;  2YKH A;  3B33 A;  2KX6 A;  3H82 B;  2D02 A;  2R78 A;  3RTY A;  4L9F A;  1OJG A;  1UWN X;  3F1O B;  1F9I A;  3E4P A;  4BBU A;  1OTB A;  1XJ4 A;  3KX0 X;  1LSV A;  1OTD A;  1OTI A;  5F6A A;  1JNU A;  3MFX A;  1T19 A;  1S66 L;  4PKY A;  3D72 A;  4HP4 A;  1F98 A;  1LSX A;  2PD8 A;  4EEP A;  2W0N A;  1N9O A;  4KQD A;  1S4R A;  2JHE A;  3ZQ5 A;  3VE3 A;  3UMD A;  3LYX A;  2L0W A;  3UB8 A;  1OT9 A;  2PR6 A;  4HI4 A;  3F1P A;  3H7W A;  1N9N A;  4EW7 A;  2WKR A;  1DRM A;  4HNB A;  5DJT A;  2PYR A;  3CWF A;  1P0Z A;  1OTA A;  4EET B;  3EEH A;  5HD5 A;  4LRZ E;  2VV8 A;  3UE6 A;  5HDD A;  2L1M A;  5DKK A;  2VV6 A;  4H6J A;  3H7W B;  3LIA A;  1WA9 A;  1UWP X;  2PD7 A;  1S1Y A;  3LI8 A;  2ZBB A;  3OLO A;  4LLO B;  4BBV A;  5HDC A;  4LPZ A;  4HQA A;  2QWS A;  5F68 A;  4JGR A;  3FC7 A;  2OWJ A;  3MR0 A;  3LIF A;  4RQ9 A;  3NHQ A;  3NOT C;  3C2W A;  1LL8 A;  2V1A A;  2V9A A;  3RH8 B;  1GSX A;  1ODV A;  5F5Y A;  1TS6 A;  2PDR A;  4R3A A;  1GSW A;  5G4Z A;  4NXF A;  3NOU C;  4DJ3 A;  2JN7 A;  4E04 A;  2BAS A;  3E4Q A;  3CAX A;  4MN6 A;  5HZH A;  3MQO A;  4YWZ A;  3UB6 A;  4KUK A;  3NJA A;  3A0R A;  1LT0 A;  4XT2 B;  1UGU A;  3A0S A;  4R70 A;  2HV1 A;  2J80 A;  5I5L A;  4PKY G; 
#chains in the Genus database with same CATH topology
 1PIO A;  5E2F A;  4BBT A;  4C75 A;  2J7V A;  1GA9 A;  1L0F A;  2J3T C;  3K3D A;  3NI9 A;  4U3T A;  2XQZ A;  4F3L A;  2HDS A;  2NUP C;  3LFV A;  5A92 A;  4OPQ A;  3TJZ C;  1MPL A;  4KG6 A;  1M6K A;  1W63 Q;  3QP8 A;  1WYC A;  2W1R A;  3CG5 A;  3G32 A;  4L9G A;  2XSS A;  1ES3 A;  2VGJ A;  3GRJ A;  4UQI S;  2X71 A;  3WS1 A;  1YSP A;  1G68 A;  3L7H A;  3QHY A;  3LCE A;  2J8Y A;  3UME A;  1NWZ A;  4QY5 A;  2LB9 A;  2VLG A;  2CMN A;  3UPN A;  3AGF A;  4R4R A;  3B42 A;  4FD8 A;  4Y5F A;  2HP5 A;  3NBL A;  2OWH A;  2QJ7 A;  3IXB A;  4WM9 A;  4H6J B;  2P74 A;  5J7E A;  3BQ8 A;  4I5S A;  3UN7 A;  4P85 A;  2WAE A;  2PRF A;  4KQQ A;  3HL9 A;  5GLC A;  2ZQ9 A;  3GVB A;  1KE3 A;  3O5Y A;  1TS0 A;  1DP8 A;  3RJU A;  4ZJ3 A;  4LCM A;  2RCX A;  2XA7 M;  4NG2 A;  3H82 A;  2ZJ9 A;  1NY0 A;  2Y2K A;  5BOH A;  4Q0J A;  1YM1 A;  3LUQ A;  4IED A;  2JKF A;  2ZQC A;  4WZ5 A;  5FEG A;  3AGE A;  4WYY A;  3VV4 A;  1V9Z A;  2GDN A;  1CEG A;  3IF6 C;  1YSQ A;  3WWX A;  4LRY C;  5FAS A;  4O8G A;  3BEC A;  2WGV A;  1N4O A;  3N6I A;  2A3U A;  5HSQ A;  2Y91 A;  5J4E A;  1PWC A;  2O99 A;  3HLB A;  2OLV A;  4K08 A;  4BEN A;  4BLM A;  1DY6 A;  4FCF A;  4E3K A;  2XLN A;  3WRT A;  3W4O A;  1VEU B;  2IA2 A;  4Y3I A;  3HJK A;  4B93 A;  4DE0 A;  1FSW A;  4CLC C;  3MFD A;  2MJ6 A;  4F94 A;  1YLZ A;  4QY6 A;  3SZT A;  3C30 A;  1AWI A;  3Q7V A;  4YFM A;  1K56 D;  1T18 A;  1K55 C;  1J9M A;  3R7W A;  4OPY A;  2ZOH A;  4RA7 A;  2Y2P A;  1SDE A;  4PM5 A;  4AFI A;  4EQ1 A;  2Y4A A;  3BY9 A;  3B3X A;  4WL9 A;  4WN5 A;  4S2L A;  4KZ4 A;  1SHV A;  1L3L A;  4GD8 A;  4HY8 A;  5HPF A;  1G28 A;  4X53 A;  3MXQ A;  3IWI A;  3MBZ A;  3CJM A;  5DTS A;  2HZ5 A;  4R1G A;  3EWK A;  3MF0 A;  3S4X A;  4KQR A;  3P98 A;  2WGI A;  1S6R A;  3PBQ A;  3QNB A;  2QPN A;  1XGJ A;  3CHW P;  2QMI A;  3HCY A;  3EQU A;  2M7U A;  4FSF A;  4P6B A;  1NYY A;  2A24 B;  3BFG A;  4KZ8 A;  1Q2Q A;  3SW1 A;  1G6O A;  4HJ3 A;  5AVE A;  4P0M A;  4JKT A;  4JGO A;  2X01 A;  2ZD8 A;  2XDM A;  4LGW A;  1YLT A;  2ZMF A;  3W8K A;  2ZL1 B;  5AQA A;  3ZVT A;  1NLY A;  1SKO B;  1CK3 A;  5GHX A;  3KYE A;  3RTY A;  2Y2Q A;  3OC2 A;  4Y7P A;  4LV3 A;  1BZA A;  5EM1 A;  4X55 A;  3K2N A;  1HD8 A;  4HES A;  2H5S A;  1VQQ A;  2ZMV A;  1LSV A;  3ZHH A;  1TVF A;  1SCW A;  1ESI A;  3VP2 A;  4UHU A;  3DTE A;  3VP0 A;  5MC7 A;  1ONH A;  1O7E A;  1T19 A;  4EBP A;  3U2A A;  2EXB A;  4FH4 A;  1E3U D;  2QZ6 A;  3TRC A;  1E3U A;  3P09 A;  2V1Z A;  1IEL A;  4P6Z M;  5M18 A;  4WBG A;  2EFU A;  3DW0 A;  1L2S A;  4S2P A;  4GZB A;  1PZP A;  1OT9 A;  4Y0T A;  4QHC A;  3H7W A;  4MBK A;  3VFF A;  5DF7 A;  1PYY A;  3BQA A;  2IWC A;  2PYR A;  4X69 A;  3CWF A;  1P0Z A;  4MEZ A;  5FDS A;  4XUX A;  4E3O A;  3S7P A;  4LRZ E;  2VV8 A;  5EVI D;  3BLS A;  5FAT A;  1JWV A;  1QMF A;  3Q7Z A;  4O7D A;  2VV6 A;  5EVI A;  4H6J A;  2JKG A;  3OPP A;  3UE0 A;  1A0K A;  2PD7 A;  3LI8 A;  5HAP A;  3HUM A;  4ZJ2 A;  4OQ0 A;  4BBV A;  1ES4 A;  2WZX A;  3T1R A;  5LBR A;  3UB5 P;  5KSC A;  5F68 A;  5DF8 A;  3IWO A;  3JVU A;  2OWJ A;  3L9K A;  3NHQ A;  1SDN A;  1YLW A;  2BG1 A;  3KSH A;  3N8S A;  2W3D A;  2HDR A;  2PDR A;  5F1G A;  3S1Y A;  4Y2F A;  2OLU A;  5G4Z A;  2VGK A;  4S2O A;  2G2U A;  2WKH A;  2EX2 A;  2BAS A;  2FFF B;  4YOF A;  4OH0 A;  3IQA A;  3S7N A;  3N8L A;  3ZGA B;  2O9A A;  3ZFZ A;  4JXW A;  3LY4 A;  1I2S A;  2C6W B;  4KUK A;  3KO6 A;  2E8J A;  3A0R A;  3TSG A;  3VP3 A;  5EE8 A;  5TR7 A;  4MLL A;  3NIA A;  2HV1 A;  5CHU A;  1XPB A;  5E2H A;  4JXV A;  2P9V A;  4R4S A;  3EGX C;  4BL3 A;  5I5L A;  2Y2I A;  2R9X A;  4ZTK A;  3ZNY A;  2Y2J A;  1CJF A;  1VEU A;  1YMS A;  2PT7 A;  3TG9 A;  5TBM A;  5DVA A;  5DKL A;  4UEY A;  3U4L P;  2YKF A;  4PM8 A;  5A8B A;  3DAV A;  3D4F A;  3FPW A;  4IUK A;  5EM0 A;  5J3W A;  2UWX A;  2B95 A;  3C38 A;  3C7V A;  3CZD A;  3JVV A;  3RXX A;  5HWV A;  1LI0 A;  2K2N A;  2EX6 A;  3WS2 A;  1FIK A;  1NJ4 A;  4B4Z A;  3LO7 A;  2IWB A;  3IHA A;  3IBJ A;  2P08 A;  2PR5 A;  2PYP A;  3F1N B;  1MBL A;  2HP9 A;  4X56 A;  4E3N A;  5GLA A;  4DDY A;  4UQI M;  3DWZ A;  1ACF A;  5FQQ A;  3TOI A;  2ZQ8 A;  4NXG A;  1K25 A;  4I3J A;  4LEN A;  5F83 A;  4S2N A;  4WZ5 C;  4GCZ A;  2O0Y A;  2PBY A;  4HIA A;  4Z9Q A;  1T1B A;  3FZC A;  3EGD C;  4IHQ A;  2GJ3 A;  3G2Y A;  1RCJ A;  1K6R A;  2X02 A;  5HFO A;  3WS5 A;  1KGE A;  4ZBE A;  3MZE A;  2Q9N A;  4YNR A;  3LGO A;  4S2M A;  1W7F A;  5AQ7 A;  4I39 A;  3VSL A;  3CPT A;  3A3I A;  1XJ2 A;  1F5M A;  1YT4 A;  4LFU A;  3NCK A;  1N9B A;  2XFT A;  4OLD A;  2EX9 A;  1Z09 A;  3C4O A;  1SKO A;  3NEC A;  4FH2 A;  5HL6 A;  1VM1 A;  4MMN A;  4BWI A;  3GV9 A;  3A3D A;  1BTL A;  3KYZ A;  2D01 A;  2JKR I;  2V1B A;  5E43 A;  4N9L A;  3G4P A;  2INW A;  5FL3 A;  3Q1F A;  4GS9 B;  3BY8 A;  3MXR A;  1H3Q A;  5CEC A;  4FOF A;  3TW8 A;  1VHM A;  2XK1 A;  4HJ4 A;  3VP1 A;  4R3B A;  3UY6 A;  3KYQ A;  1IKG A;  4GDN A;  1S1Z A;  2WGW B;  4O01 A;  4EEU A;  1E25 A;  5DFY A;  3C7U A;  2A49 A;  1MY8 A;  2EFX A;  2WUQ A;  3LI9 A;  3MQ0 A;  2XFS A;  4I3I A;  1T1A A;  5G18 A;  1BLH A;  1EW0 A;  1K54 A;  3E4O A;  4EUV A;  4IBR A;  4I3A A;  4ZRR A;  4Y0U A;  5KIZ A;  1ZG6 A;  4PHT A;  3UO9 A;  4BQM A;  2HJ9 C;  1K6S A;  3BYD A;  1IYO A;  3HVF A;  3M2J A;  3KSF A;  3IH8 A;  5FI7 A;  4LRX C;  3T4O A;  2GZA A;  2JCH A;  3VSK A;  3ZYT A;  5GHZ A;  1ES2 A;  1FCN A;  4WEJ A;  1LI9 A;  2HDQ A;  5TGF A;  4L0L A;  4KZ6 A;  2W1T B;  2V8C A;  3QP5 A;  3Q82 A;  3IX4 A;  3MZD A;  2O9B A;  3D3O A;  1YLJ A;  4K0W A;  3E98 A;  4WF0 A;  4OQG A;  3OPH A;  3IS2 B;  4GHI A;  5FSR A;  2XD1 A;  3IXH A;  1F2K A;  4KZA A;  4JF5 A;  3HLD A;  3H9W A;  2ZC5 B;  2JKT I;  4ZJ1 A;  1GA0 A;  1TF1 A;  3IF6 B;  2EXA A;  1IFQ A;  2Q9M A;  4KZ7 A;  3HLE A;  3FYZ A;  3QP6 A;  4DE3 A;  3OPR A;  5CHJ A;  4C6Y A;  3MZF A;  3O3V A;  2KLI A;  1H8Z A;  3M6B A;  3FG8 A;  4CQH A;  3W4P A;  1I2W A;  1CI9 A;  3LR0 A;  1LLB A;  3GTC A;  3LIC A;  3F1O A;  1CQA A;  3ULF A;  2VGL M;  2V0W A;  3SOI A;  1YQS A;  2I9V A;  2W27 A;  3OZH A;  4CLC B;  5A91 A;  3I7J A;  4QJG A;  1VET A;  2D02 A;  2R78 A;  4OP8 A;  2PU4 A;  2K31 A;  1F9I A;  5EVI C;  3E4P A;  4BBU A;  5E2G A;  3BFE A;  1DJC A;  1OTI A;  3T12 B;  4KZ3 A;  2XRN A;  1MWU A;  5L10 A;  1S66 L;  5GHY A;  4HP4 A;  3OCN A;  4WEK A;  2HDU A;  4ZDX A;  1LSX A;  4EEP A;  1YKD A;  4KQD A;  3HLC A;  3M6H A;  1MKM A;  2JHE A;  3VE3 A;  2EWV A;  2L0W A;  3UB8 A;  4HI4 A;  1XA1 A;  3IH9 A;  3RXW A;  1W8Y A;  2WKR A;  3V3R A;  3S22 A;  1XA7 A;  2V8F A;  4RX3 A;  5FI2 A;  3TE8 A;  5HD5 A;  4E3M A;  3WS0 A;  3UE6 A;  5HL1 A;  4JXS A;  3E2K A;  3GR2 A;  5DKK A;  4EU0 A;  5I94 A;  4IVI A;  3MKF A;  4BL2 A;  3SS5 A;  3HLW A;  3ZG0 A;  3V5M A;  2DNS A;  1K4F A;  5K5B A;  3QP4 A;  2J3T D;  3MSH A;  1FOF A;  3ITB A;  5HDC A;  3IHB A;  2JBF A;  3HUN A;  5HAI A;  1K4E A;  2QWS A;  3N8R A;  4M3K A;  4ARZ A;  3MR0 A;  4PPR A;  4RQ9 A;  4Z1W A;  2W3E A;  3N4I A;  1MWT A;  4JF6 A;  3NOT C;  1XX2 A;  2OAQ 1;  1LL8 A;  3C2W A;  2V1A A;  1KE4 A;  3NY4 A;  2XA7 S;  3FV7 A;  3QP2 A;  1JVJ A;  1KVM A;  2EX8 A;  4R3A A;  2A2L A;  2AVX A;  1S0W A;  2FH5 A;  2Y2G A;  4YIN A;  1JTG A;  3CAX A;  4CLC E;  4BJP A;  5HZH A;  3ZG7 B;  3MQO A;  3UB6 A;  1U60 A;  4OLG A;  2WGW A;  3ZCZ A;  3T4J A;  3SH7 A;  1CF0 A;  1KGG A;  4R70 A;  3NUL A;  4ZAM A;  1W63 M;  2PBD P;  5KZH A;  4ESP A;  2VK3 A;  3UDF A;  1YAX A;  4PKY G;  1NZU A;  3BEB A;  3PBT A;  1H5X A;  3BJN A;  5HWT A;  3PYP A;  1TS8 A;  3BFF A;  2W3F A;  3A3F A;  3DWK A;  4WEL A;  2IWD A;  1ERM A;  4HHD A;  4WZ4 A;  2OSU A;  1W8Q A;  4KUO A;  4ID4 A;  5JYP A;  1AXB A;  2K7S A;  4RX2 A;  1BSG A;  4NXE A;  4EV4 A;  4DXB A;  4IBX A;  2ZM8 A;  4PMA A;  4OOM A;  2OV5 A;  1DP9 A;  4WLA A;  4KZ9 A;  3IX3 A;  4GKU A;  4DJ2 A;  3BLM A;  1XKZ A;  3A3E A;  1SZV A;  1ALQ A;  5AVF A;  4UAA A;  4DRT A;  4PM9 A;  5EFW A;  2NUT C;  3N7W A;  3IF5 A;  3T4Q A;  3CIT A;  3BRM A;  1K0K A;  1RGY A;  2PAV P;  3P01 A;  5AQB A;  5EPH A;  3G6O A;  1FR1 A;  4G3W A;  4R3J A;  5CTM A;  4OPZ A;  4NEE D;  2ZC3 B;  5IT5 A;  4HOI A;  3IXG A;  4FUW A;  2ZM0 A;  4Q0I A;  3ZG9 B;  1E4D A;  2PHY A;  2Q0O A;  2VA0 A;  3M2K A;  5GLD A;  4CLC D;  3ICY A;  3B47 A;  5FQI A;  4OQI A;  4IUH A;  4CLC A;  4RVA A;  1TEM A;  1T1C A;  4DXC A;  1MWS A;  4L9E A;  1XP4 A;  2WKE A;  3PBN A;  4OOY A;  3LY3 A;  4Y15 A;  4UA6 A;  5IS1 A;  1CI8 A;  2ZQ7 A;  1BLP A;  5IU1 A;  2WKP A;  1LSW A;  3R4K A;  3LID A;  4QU3 A;  1TS7 A;  3DTK A;  3EQV A;  5A93 A;  4UA7 A;  3JPU A;  2VJW A;  5G4Y A;  1MC0 A;  2QHK A;  2XF3 A;  3BFC A;  4MBH A;  4E3I A;  4GJ4 A;  2VX8 A;  2R9W A;  5GLB A;  3PBO A;  1BUE A;  3HLF A;  4EER A;  1PW8 A;  5CER A;  2Z2L B;  4XXR A;  4KEN B;  1P97 A;  3T50 A;  3CUE A;  1D7E A;  4UA9 A;  1XFN A;  1K38 A;  5EOE A;  1G5U A;  3MMH A;  3VOZ A;  4K91 A;  5HX9 A;  2FZ0 A;  4P87 A;  3MQQ A;  4N9K A;  4HH3 A;  4GW9 A;  3MJQ A;  4IJG A;  3SH9 A;  2JKR M;  4HJ6 A;  5F82 A;  4GLQ A;  4FTX A;  2XRO A;  4PM7 A;  2B02 A;  1KDW A;  4JF4 A;  3T4T A;  3JYI A;  3GDI A;  2WYX A;  3G31 A;  1Y4O A;  2Y55 A;  2Y2N A;  2HGV A;  3PAE A;  3LIB A;  1PNE A;  1JWZ A;  4N1X A;  2VV7 A;  1BUL A;  1S4S A;  4M4X A;  1BLC A;  2KDK A;  2WAF A;  3D9Y A;  1ZC2 A;  2J3W A;  2A24 A;  4H8R A;  5HWW A;  3GEC A;  3K3C A;  2Z6D A;  1L0E A;  1WYB A;  3DTM A;  4R38 A;  4EXO A;  3G30 A;  4R23 A;  4II7 A;  2XEP A;  2V20 A;  1YLY A;  5KSH A;  3VOL A;  2HPB A;  2ZL1 A;  1YLP A;  1MZU A;  4E6W A;  1Y54 A;  4GNU A;  2ACG A;  3LR5 A;  1XJ3 A;  2LB5 A;  4HH2 A;  1TDG A;  3VE4 A;  2V0U A;  1OT6 A;  3PTE A;  2WZZ A;  4ME4 A;  1S67 L;  1IYS A;  3MKE A;  4DE1 A;  2OOL A;  1MWR A;  3B33 A;  2KX6 A;  4Y17 A;  4QB8 A;  4B88 A;  4L9F A;  4U0X A;  4KZ5 A;  1PW1 A;  1OTB A;  1XJ4 A;  3KX0 X;  5JYO A;  1OTD A;  5DTK A;  4E3L A;  1EWZ A;  3AGD A;  4OP5 A;  3ZG8 B;  5CRF A;  3V50 A;  3MFX A;  3UE3 A;  4NKP A;  1IKI A;  4PKY A;  4A5R A;  3UPP A;  2JKT M;  1S4R A;  4PAU A;  3ZQ5 A;  5CGW A;  3OCL A;  3UMD A;  2PR6 A;  5GL9 A;  4EQI A;  1OPX A;  3VFH A;  2G7U A;  1Q2P A;  1DRM A;  4MBF A;  1DJB A;  4HNB A;  5CX7 A;  5DJT A;  4LCL A;  1SKF A;  1OTA A;  1TDL A;  1ERO A;  3W4Q A;  1Z6F A;  4QD4 A;  5HDD A;  2BLS A;  2CC1 A;  4LV0 A;  1KGF A;  1JWP A;  3H7W B;  5FQJ A;  1C3B A;  1PWG A;  2DCF A;  1UWP X;  1PI4 A;  3SS3 A;  5CHM A;  2W3G A;  1S1Y A;  3OLO A;  4LLO B;  4OON A;  3NC8 A;  4OVD A;  4LV2 A;  4LPZ A;  3EOI A;  1W5D A;  4QWO A;  4JGR A;  3SH8 A;  1NRJ A;  3FC7 A;  5EVI B;  5EEC A;  4DN0 A;  2Y2M A;  2Y59 A;  1IOU A;  1JTD A;  4GD6 A;  2V9A A;  1GSX A;  1ODV A;  3ISG A;  4RYE A;  4Q8I A;  2ZC6 B;  3O87 A;  2M7V A;  1GSW A;  3O86 A;  4DJ3 A;  3E4Q A;  1PZO A;  5HW3 A;  5EOO A;  1QME A;  3Q07 A;  3MS6 A;  1FCM A;  3NJA A;  1LT0 A;  3ZG5 A;  2G2W A;  4DE2 A;  2O9C A;  5L2F A;  2XH9 A;  4XT2 B;  1ZTU A;  4CJN A;  5L07 A;  2UV0 E;  3KSG A;  2JE5 A;  2J80 A;  4B4X A;  1H0M A;  1ZHH B;  1GHI A;  3FKV A;  1YMX A;  1NRF A;  1ERQ A;  1HLU P;  3CMZ A;  4HEF A;  2VEA A;  3HBR A;  3ITA A;  1J3W A;  3ZDJ A;  1K57 A;  1GHM A;  2B18 A;  3ZNT A;  2M1C A;  5FAQ A;  1ES5 A;  3VOY A;  2P9V B;  3PHY A;  1DP6 A;  5DJU A;  3F1N A;  1PRQ A;  3GMW A;  5M1A A;  5FDH A;  4X6T A;  3FPV A;  4EBL A;  3G35 A;  1G6A A;  1NZO A;  4DDS A;  3T1S A;  1OJ5 A;  5TBM B;  1XFQ A;  1XGI A;  4KQO A;  1KOU A;  4OQH A;  4DKI A;  5HD3 A;  1XJ6 A;  4OKP A;  1I5Q A;  3VMA A;  3F1P B;  3BWL A;  5DF9 A;  4G3V A;  4JPM A;  3E0Y A;  4D60 A;  1K56 A;  4C3Q A;  1M40 A;  4MN5 A;  3T4S A;  1H8M A;  2Y2L A;  3V67 A;  1BLS A;  3O88 A;  4K0X A;  4S2K A;  3HJI A;  4Y13 A;  1NYM A;  3C8C A;  3LEZ A;  4NXB A;  4X68 A;  4EBN A;  4XUZ A;  5CGS A;  5FQK A;  2Y2H A;  3PXP A;  2PU2 A;  2VGL S;  1ESU A;  4GS9 A;  3A0V A;  3CUE C;  5E2E A;  1BYW A;  1IYP A;  2H28 A;  2Y2O A;  3IT9 A;  4U0T A;  2GNX A;  2WAD A;  3UDI A;  2J9O A;  4MCW A;  1IEM A;  3LIE A;  4OOL A;  4JGP A;  2ZQD A;  3CPT B;  5HDS A;  3MXS A;  1GCE A;  2BTF P;  2L4R A;  1OME A;  1NLZ A;  2XR0 A;  3RFB A;  1D06 A;  4S2N C;  1PI5 A;  5HAR A;  4NK3 A;  1LL5 A;  1FCO A;  3IX8 A;  2XD5 A;  5FI6 A;  3BW6 A;  2Y8H A;  2QKP A;  5L09 A;  3IBR A;  4ETX A;  2C5W B;  1HVB A;  2QJ5 A;  3HLG A;  3NDE A;  4DMZ A;  2WKQ A;  5A90 A;  1X0O A;  1BT5 A;  1ZG4 A;  3PBR A;  2ZM2 A;  1H8Y A;  3HUO A;  1GSV A;  4MNR A;  2DRW A;  3GSG A;  1ONG A;  2RL3 A;  4R6L A;  2W1T A;  1PWD A;  3QP1 A;  4F3L B;  2ZOI A;  3NOP C;  1PFL A;  4R0Q A;  4ETZ A;  5DFX A;  3W2Z A;  4B9O A;  3Q81 A;  3FWL A;  4BD0 A;  2HP6 A;  2HJE A;  4JGQ A;  4GN2 A;  3IS2 A;  4QPR A;  4N92 A;  3UB7 A;  1CEF A;  5CED A;  4NET A;  3VP4 A;  5CGX A;  3PR6 A;  2J9P A;  5D3O A;  4BMW A;  4WUJ A;  1OTE A;  2W3H A;  2Z6C A;  1EI5 A;  3IF6 A;  2E8I A;  3OPL A;  3T4K A;  4S2J A;  4CPK A;  5FQM A;  2WK0 A;  4EES A;  4GOG A;  3ZVW A;  2EA9 A;  5AJG A;  2DMW A;  4I38 A;  3G2Z A;  4KG5 A;  4X25 A;  1STZ A;  3KSI A;  3PAG A;  3CLO A;  4EUZ A;  3V3S A;  5FA7 A;  1VB6 A;  1K54 C;  5FAP A;  2ZQA A;  1MKI A;  5F69 A;  1N9L A;  2B5R A;  2P7J A;  2QYB A;  4GB7 A;  4GHI B;  4HBT A;  5AQ9 A;  3QNC A;  3OBF A;  3P7N A;  1V9Y A;  1L0D A;  5HPI A;  4HP9 A;  4XT2 A;  3E2L A;  1RP5 A;  1Y28 A;  1L0G A;  3UB9 A;  3C4P A;  1P9R A;  1LHY A;  3LR3 A;  1K55 A;  2ZLY A;  5L8M A;  1FR6 A;  5U47 A;  4GDB A;  1MXO A;  5FAO A;  5FEF A;  3HRE A;  3IXD A;  5M19 A;  1W79 A;  5DTT A;  4MN7 A;  3LEQ A;  2YKH A;  3C5A A;  5EVE A;  3H82 B;  1GHP A;  3WRZ A;  2FFY A;  1OJG A;  1UWN X;  4O0P A;  2OAP 1;  1WE4 A;  4S2I A;  2Y79 A;  3F1O B;  3V39 A;  2GX5 A;  3UDX A;  5HAQ A;  1O07 A;  3BFD A;  2XGN A;  2JC7 A;  4P6Z S;  5EV0 A;  5CEB A;  5F6A A;  2EWW A;  5IHV A;  2VKS A;  1JNU A;  4E6X A;  3NDG A;  1VET B;  2VZW A;  5J8X A;  1YPR A;  3D72 A;  2HF6 A;  3DBA A;  1F98 A;  3CI6 A;  2PD8 A;  2W0N A;  4G3K A;  1N9O A;  4JBF A;  3OOV A;  1RGZ A;  3GQZ A;  3S7O A;  3LYX A;  1P9W A;  3T1Q B;  3EEA A;  3F1P A;  2Z2M B;  1TD5 A;  1N9N A;  4EW7 A;  3A3J A;  3G34 A;  4N1H A;  3UNW A;  3BM6 A;  4EET B;  3FKW A;  5EUA A;  4EWF A;  3EEH A;  4OPR A;  5FQ9 A;  5EVL A;  1ZKJ A;  2L1M A;  4DF6 A;  1D1J A;  5CXW A;  3UPO A;  4E3J A;  3LIA A;  1WA9 A;  3Q7V B;  2H0T A;  2ZBB A;  4Q0H A;  3R7W B;  1KE0 A;  2ZC7 A;  3PBS A;  4HQA A;  1FQG A;  3T1X A;  4WMC D;  4D2O A;  3LIF A;  1FIL A;  4WMC A;  1XXM A;  4X1M A;  5TJJ A;  2I72 A;  4JLF A;  4IVK A;  4Y0O A;  2V2F F;  1K57 C;  4LV1 A;  3S7Q A;  3RH8 B;  5F5Y A;  4PM6 A;  1TS6 A;  1HZO A;  4BD1 A;  1KDS A;  1LL9 A;  4KG2 A;  5CTN A;  4KZB A;  2ZMA A;  4NXF A;  4ARZ B;  3NOU C;  2JN7 A;  4E04 A;  2WKI A;  4MN6 A;  2H10 A;  4MDZ A;  3SS4 A;  3UE1 A;  1KVL A;  4YWZ A;  1HTZ A;  3IWQ A;  3LR4 A;  3T4L A;  5F1F A;  2ZC4 B;  1FSY A;  1IYQ A;  2H0Y A;  1UGU A;  3A0S A;  1DJA A;  3WS4 A;  4JXG A;  1NXY A;  2KOI A;  4HBU A;  5KMW A;  3DTI A;  2P04 A;  5TFQ A;  5C5K A;  4X1L A; 
#chains in the Genus database with same CATH homology
 3PBT A;  4BBT A;  3BJN A;  2J3T C;  3K3D A;  5HWT A;  3PYP A;  2PT7 A;  1TS8 A;  2VEA A;  5TBM A;  4F3L A;  2W3F A;  5DKL A;  4UEY A;  2YKF A;  2B18 A;  4WEL A;  2M1C A;  2NUP C;  5A8B A;  3LFV A;  3FPW A;  4IUK A;  3TJZ C;  4HHD A;  5J3W A;  3PHY A;  5DJU A;  1DP6 A;  3C38 A;  1W63 Q;  3F1N A;  3JVV A;  5HWV A;  2W1R A;  2K2N A;  3FPV A;  4L9G A;  2XSS A;  4KUO A;  1OJ5 A;  5TBM B;  1XFQ A;  4UQI S;  3IBJ A;  4KQO A;  1KOU A;  2K7S A;  2P08 A;  1YSP A;  2PR5 A;  5HD3 A;  2PYP A;  4NXE A;  1XJ6 A;  3UME A;  3F1N B;  4OOM A;  1NWZ A;  1DP9 A;  4WLA A;  2LB9 A;  3F1P B;  3BWL A;  5DF9 A;  2VLG A;  2CMN A;  4G3V A;  4DJ2 A;  3E0Y A;  4UQI M;  3B42 A;  4NXG A;  4Y5F A;  4I3J A;  5AVF A;  4MN5 A;  5EFW A;  2NUT C;  2OWH A;  2QJ7 A;  4GCZ A;  2O0Y A;  3T4Q A;  3CIT A;  3T4S A;  4HIA A;  1H8M A;  3V67 A;  3P01 A;  1T1B A;  3G6O A;  4H6J B;  5J7E A;  3EGD C;  4IHQ A;  3HJI A;  3BQ8 A;  4I5S A;  2GJ3 A;  4G3W A;  4NEE D;  3C8C A;  5IT5 A;  4HOI A;  4NXB A;  4YNR A;  4I39 A;  4Q0I A;  2PHY A;  2VA0 A;  3PXP A;  2VGL S;  4GS9 A;  3O5Y A;  3A0V A;  4CLC D;  3CUE C;  1XJ2 A;  3ICY A;  1F5M A;  3B47 A;  1TS0 A;  1DP8 A;  4IUH A;  1BYW A;  4CLC A;  2H28 A;  2GNX A;  2XA7 M;  1T1C A;  3H82 A;  4L9E A;  4MCW A;  3LIE A;  3PBN A;  4JGP A;  4OOL A;  5HL6 A;  4MMN A;  4BWI A;  3KYZ A;  2D01 A;  2JKR I;  2V1B A;  5HDS A;  5IS1 A;  4Q0J A;  2INW A;  5FL3 A;  3LUQ A;  2L4R A;  4GS9 B;  3BY8 A;  5IU1 A;  1NLZ A;  1H3Q A;  4FOF A;  2WKP A;  3TW8 A;  1LSW A;  3R4K A;  3RFB A;  3LID A;  3VV4 A;  1VHM A;  4HJ4 A;  1TS7 A;  1D06 A;  3KYQ A;  1V9Z A;  3EQV A;  1YSQ A;  1S1Z A;  2VJW A;  5G4Y A;  4O01 A;  4EEU A;  5DFY A;  4LRY C;  1MC0 A;  3LI9 A;  3BW6 A;  2QHK A;  2Y8H A;  3MQ0 A;  2QKP A;  4O8G A;  4I3I A;  3IBR A;  4ETX A;  1T1A A;  5HSQ A;  4GJ4 A;  2VX8 A;  5J4E A;  2QJ5 A;  1EW0 A;  2O99 A;  4DMZ A;  3E4O A;  3PBO A;  2WKQ A;  4EER A;  4EUV A;  4I3A A;  1X0O A;  4K08 A;  4ZRR A;  3PBR A;  5KIZ A;  1GSV A;  4PHT A;  1P97 A;  3T50 A;  3CUE A;  2HJ9 C;  4R6L A;  2W1T A;  1D7E A;  2IA2 A;  4F3L B;  2ZOI A;  3KSF A;  4Y3I A;  3NOP C;  4LRX C;  3HJK A;  3T4O A;  1XFN A;  2GZA A;  4B93 A;  4ETZ A;  3MMH A;  4CLC C;  5DFX A;  3W2Z A;  3ZYT A;  2FZ0 A;  4B9O A;  2MJ6 A;  4WEJ A;  3MQQ A;  2HJE A;  3C30 A;  4HH3 A;  4JGQ A;  4L0L A;  3IS2 A;  4GW9 A;  4QPR A;  1T18 A;  3UB7 A;  2W1T B;  3MJQ A;  4IJG A;  3PR6 A;  3R7W A;  2JKR M;  4BMW A;  2ZOH A;  4WUJ A;  1OTE A;  2W3H A;  2Z6C A;  4HJ6 A;  4GLQ A;  2O9B A;  3D3O A;  2XRO A;  4AFI A;  4EQ1 A;  2B02 A;  3BY9 A;  4WL9 A;  4WN5 A;  3T4K A;  3T4T A;  3E98 A;  3GDI A;  4WF0 A;  4EES A;  4HY8 A;  3IS2 B;  2EA9 A;  4GHI A;  5HPF A;  2HGV A;  5AJG A;  2DMW A;  1G28 A;  3LIB A;  4I38 A;  1STZ A;  2VV7 A;  3KSI A;  3CLO A;  3H9W A;  1S4S A;  3MXQ A;  4M4X A;  2JKT I;  1VB6 A;  2KDK A;  1TF1 A;  2J3W A;  2A24 A;  1IFQ A;  3EWK A;  5F69 A;  5HWW A;  3GEC A;  3MF0 A;  3K3C A;  2Z6D A;  1N9L A;  4R38 A;  4EXO A;  2P7J A;  2QYB A;  4II7 A;  2KLI A;  3PBQ A;  4GHI B;  3OBF A;  3P7N A;  1V9Y A;  3FG8 A;  5KSH A;  3HCY A;  3EQU A;  3VOL A;  5HPI A;  4HP9 A;  4CQH A;  4XT2 A;  2M7U A;  1MZU A;  1Y28 A;  4FSF A;  3LR0 A;  3LR5 A;  1XJ3 A;  2A24 B;  3UB9 A;  2LB5 A;  3LIC A;  1P9R A;  3F1O A;  4HH2 A;  3LR3 A;  3ULF A;  2VGL M;  3SW1 A;  5L8M A;  3VE4 A;  2V0U A;  1OT6 A;  2V0W A;  1G6O A;  4HJ3 A;  5AVE A;  2I9V A;  2W27 A;  4ME4 A;  4JGO A;  1S67 L;  4CLC B;  2ZMF A;  2OOL A;  4MN7 A;  2YKH A;  3B33 A;  2KX6 A;  1NLY A;  3H82 B;  2D02 A;  2R78 A;  3RTY A;  3OC2 A;  4L9F A;  1OJG A;  1UWN X;  4O0P A;  2OAP 1;  2Y79 A;  2K31 A;  3F1O B;  3K2N A;  1F9I A;  3E4P A;  2GX5 A;  4BBU A;  1OTB A;  3KX0 X;  1XJ4 A;  2ZMV A;  1LSV A;  1OTD A;  1OTI A;  4P6Z S;  5F6A A;  2EWW A;  2VKS A;  2XRN A;  1JNU A;  3MFX A;  3UE3 A;  4NKP A;  5MC7 A;  1T19 A;  2VZW A;  1S66 L;  4PKY A;  3D72 A;  3U2A A;  2JKT M;  2HF6 A;  4HP4 A;  3DBA A;  3OCN A;  4WEK A;  3TRC A;  1F98 A;  3CI6 A;  1LSX A;  2PD8 A;  4EEP A;  2W0N A;  4G3K A;  1N9O A;  1YKD A;  4KQD A;  1S4R A;  1MKM A;  2JHE A;  4P6Z M;  3OOV A;  4PAU A;  3VE3 A;  3ZQ5 A;  3OCL A;  3S7O A;  3UMD A;  3LYX A;  2EWV A;  2L0W A;  3UB8 A;  1P9W A;  1OT9 A;  2PR6 A;  1OPX A;  4HI4 A;  3EEA A;  3F1P A;  3H7W A;  2G7U A;  1TD5 A;  1N9N A;  4EW7 A;  2WKR A;  1DRM A;  3BQA A;  4HNB A;  5CX7 A;  5DJT A;  2PYR A;  3CWF A;  1P0Z A;  1OTA A;  4EET B;  3EEH A;  3TE8 A;  5HD5 A;  3S7P A;  4LRZ E;  2VV8 A;  3UE6 A;  5HDD A;  2L1M A;  5DKK A;  2VV6 A;  4EU0 A;  4H6J A;  3H7W B;  3LIA A;  1WA9 A;  1UWP X;  2W3G A;  2PD7 A;  1S1Y A;  3LI8 A;  2ZBB A;  3OLO A;  4LLO B;  4Q0H A;  3R7W B;  4BBV A;  5K5B A;  3PBS A;  2J3T D;  5HDC A;  4LPZ A;  4HQA A;  5LBR A;  2QWS A;  3EOI A;  5F68 A;  4ARZ A;  4JGR A;  1NRJ A;  3FC7 A;  3JVU A;  2OWJ A;  3MR0 A;  3LIF A;  4RQ9 A;  4Z1W A;  3NHQ A;  5TJJ A;  4DN0 A;  2W3E A;  3NOT C;  1IOU A;  2OAQ 1;  1LL8 A;  3C2W A;  2V1A A;  3KSH A;  3S7Q A;  2V9A A;  2W3D A;  3RH8 B;  1GSX A;  1ODV A;  5F5Y A;  1TS6 A;  2XA7 S;  2PDR A;  4Y2F A;  4R3A A;  2A2L A;  2M7V A;  1GSW A;  5G4Z A;  4NXF A;  4ARZ B;  3NOU C;  4DJ3 A;  2JN7 A;  2FH5 A;  4E04 A;  2BAS A;  3E4Q A;  4YOF A;  3CAX A;  3S7N A;  4MN6 A;  4MDZ A;  4CLC E;  2O9A A;  4BJP A;  5HZH A;  3MQO A;  4YWZ A;  3UB6 A;  4KUK A;  3KO6 A;  3NJA A;  3A0R A;  1LT0 A;  3LR4 A;  3T4L A;  2O9C A;  4XT2 B;  1ZTU A;  1UGU A;  3A0S A;  3T4J A;  4R70 A;  2HV1 A;  1W63 M;  2KOI A;  3KSG A;  3EGX C;  2J80 A;  1YAX A;  5I5L A;  2P04 A;  1ZHH B;  5C5K A;  4PKY G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...