2WYXA

Neutron structure of a class a beta-lactamase toho-1 e166a r274n r276n triple mutant
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
256
structure length
256
Chain Sequence
VQQQLEALEKSSGGRLGVALINTADNSQILYRADERFAMCSTSKVMAAAAVLKQSESDKHLLNQRVEIKKSDLVNYNPIAEKHVNGTMTLAELGAAALQYSDNTAMNKLIAHLGGPDKVTAFARSLGDETFRLDRTAPTLNTAIPGDPRDTTTPLAMAQTLKNLTLGKALAETQRAQLVTWLKGNTTGSASIRAGLPKSWVVGDKTGSGDYGTTNDIAVIWPENHAPLVLVTYFTQPEQKAENRNDILAAAAKIVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Neutron Diffraction Studies of a Class a Beta-Lactamase Toho-1 E166A R274N R276N Triple Mutant
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords BETA-LACTAMSE TOHO-1
total genus 90
structure length 256
sequence length 256
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2009-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2wyxA00
4KZ8A 1MWSA 1BLPA 3DWZA 4KQQA 3FKVA 1ES2A 4MNRA 5HX9A 3SH7A 5F1GA 4KZAA 1PW8A 5F1FA 4EWFA 2WGVA 4JKTA 3HLCA 4QD4A 3P98A 1PIOA 1ONHA 1E25A 1YLYA 3BRMA 2G2UA 2EXAA 5CTNA 3UDXA 1PI4A 4R3BA 4R1GA 1RCJA 2DRWA 4XUXA 3UNWA 5AQ7A 4JF6A 2H10A 4C3QA 1ERMA 1PWDA 2WKEA 3BFEA 4NK3A 1K55C 4OPZA 3N4IA 4DXCA 4LV2A 4DDSA 1G6AA 4Z9QA 1NY0A 4JLFA 4U0TA 3UO9A 4Y0TA 3VP2A 4CPKA 5EE8A 2XH9A 1QMEA 3OC2A 4IVIA 5I94A 3MXRA 4KQRA 1LHYA 4MBHA 3HBRA 4R4RA 1GHIA 2ZQCA 4R4SA 1Y54A 2ZQDA 5CHUA 5HAQA 4OP5A 3FV7A 4X68A 1KGFA 1FR1A 4WZ5C 3M6BA 1W8YA 1BLCA 4HBTA 5FI2A 1IYQA 3WRTA 4EBPA 1EWZA 5FATA 3ZG5A 1PYYA 3BLSA 2WGIA 5FQIA 1FCNA 5JYPA 5M18A 3VSLA 4HESA 2OLUA 2XQZA 2Y2IA 2XLNA 3N8RA 1XXMA 5DF8A 3IXBA 4H8RA 1W5DA 4LV1A 3GRJA 1H8YA 1BT5A 3SOIA 3G35A 4QHCA 4FH4A 1C3BA 3NDEA 4PM8A 1Z6FA 3HUNA 1ES5A 3OPLA 1YLZA 1NXYA 1KGEA 3BFDA 4OOLA 3VP1A 5IHVA 2OLVA 1BULA 3IWIA 3OPPA 3BM6A 1MWUA 3JYIA 1Q2QA 1GA9A 5JYOA 1FQGA 5EPHA 3LO7A 2ZLYA 3SS4A 4BQMA 1RGYA 3QNBA 5GHXA 4B88A 3LEZA 5HFOA 4ZJ1A 4WEJA 1PI5A 5M19A 1PWGA 4P6BA 1CEFA 3LY3A 1DJCA 3BFCA 4PM7A 3ZNYA 5CECA 2ZQ7A 1FCMA 2Q9MA 4QY6A 5E43A 1AXBA 4LCLA 5AQAA 2XEPA 5GL9A 4ZDXA 3C4PA 5FAQA 3ZCZA 3AGDA 4LV0A 5E2FA 1I2SA 3ZDJA 2Y2OA 1J9MA 1GHPA 4GDBA 1BZAA 2Z2LB 1SDEA 4WM9A 4KZBA 3ZG7B 3PAEA 2WUQA 4R0QA 3UY6A 2H5SA 2OSUA 2WAFA 1O7EA 2Y2PA 3UDFA 2DNSA 4E3OA 3UN7A 3G30A 5CTMA 1CI8A 2XFTA 4LV3A 2OV5A 3WS0A 5CEDA 4K91A 1LL9A 4S2PA 5FDHA 1RP5A 4S2OA 5HAPA 3EQVA 2QMIA 2WYXA 5E2GA 5CEBA 1ZKJA 3MKFA 1YLJA 3BYDA 4ID4A 5KSHA 3ZG9B 2DCFA 3IF6B 4FSFA 5EUAA 1YLWA 5DTKA 3ITAA 1YMXA 3MBZA 2HDSA 1IKIA 1N9BA 3UDIA 3FWLA 5L2FA 4EV4A 2FFYA 1ZC2A 4U0XA 4R3JA 5GLDA 4WMCD 4MBFA 3V3SA 3LY4A 1N4OA 4DE0A 1ALQA 4OPRA 2E8IA 3S1YA 3ISGA 3NC8A 3M2KA 1MXOA 3BECA 1L0EA 3HL9A 3A3DA 1KE4A 3CMZA 3SS3A 4XXRA 3NY4A 3O86A 2P9VB 2ZC5B 5KZHA 4UAAA 4YFMA 4FD8A 1EROA 4CJNA 3C7UA 3GQZA 4JBFA 2UWXA 4JXVA 3E2LA 4P85A 3DTMA 4DE1A 1HTZA 2ZQAA 3IH9A 3G2ZA 5E2EA 3GTCA 1SDNA 3BFFA 1ESUA 1WE4A 2JC7A 3G34A 1NJ4A 4RVAA 5DTSA 3V50A 1NRFA 4E3LA 3ZGAB 2QZ6A 2EFXA 1K38A 3OCNA 3FYZA 3UPNA 4E6XA 3HLDA 1TDGA 1HZOA 1K25A 1Q2PA 2Y59A 5HAIA 1IELA 2ZC4B 4Y7PA 2Y2MA 3BFGA 4P87A 3VP3A 2WAEA 3M2JA 4WMCA 4DXBA 5GHYA 2C5WB 1VQQA 1YM1A 3WS5A 1DY6A 2X01A 1KE3A 2WGWA 4ZJ2A 4EBLA 1KE0A 3FZCA 1L0DA 4QB8A 1YQSA 2Y2HA 4RA7A 3NDGA 1ERQA 2ZMAA 2HP9A 4OPYA 3IF6C 4L0LA 4OP8A 4BD0A 1MBLA 1I5QA 2Y2QA 3CZDA 1K56A 5M1AA 5DTTA 1PWCA 1TVFA 2HDQA 4E3IA 3G31A 3IF5A 5DF9A 3HLWA 3UE1A 3B3XA 2J8YA 4RYEA 4GKUA 3AGFA 4WBGA 4RX2A 4OLGA 4JF4A 4N1HA 3V3RA 4OLDA 2EX8A 1ONGA 2ZC7A 3C4OA 2H0YA 4KG6A 4S2LA 1S0WA 3VSKA 3OZHA 5U47A 1GA0A 3PTEA 4K0WA 5EVIC 4S2IA 5TGFA 1HVBA 1NZOA 1W7FA 4Y0OA 3W4QA 1GCEA 1XP4A 2VGKA 2WADA 4OQIA 4QU3A 3S22A 5HW3A 1DJBA 2X71A 4KZ5A 2B5RA 2WZXA 4A5RA 3UPOA 3IWOA 1H5XA 4PM9A 3VFFA 4E6WA 4LENA 4KZ7A 3PAGA 4MBKA 3MXSA 3W4OA 1BUEA 2XF3A 1NYMA 3S4XA 5GLAA 1K54C 3EQUA 3BEBA 4QJGA 4C75A 2EFUA 4K0XA 4IEDA 1SHVA 3Q7VB 3Q1FA 4DKIA 2GDNA 4D2OA 1I2WA 1PZPA 2EX6A 4KZ6A 1LLBA 2ZD8A 4X56A 3WRZA 1K56D 4KG2A 1KDSA 3E2KA 2HP5A 4OVDA 4WELA 4YINA 5EVLA 4UA6A 5HARA 1JTDA 2P74A 1DJAA 4Q8IA 4JF5A 4EUZA 4HBUA 4ZTKA 2JBFA 2P9VA 4KENB 3IHAA 1W79A 5FA7A 4UHUA 1ES3A 4EQIA 4JPMA 3ZG8B 3W4PA 2Y2GA 3ZVTA 2Y2KA 5FAPA 2XD5A 2R9WA 1JWPA 4IBRA 4OPQA 1MPLA 3G32A 4S2KA 1KVLA 4WYYA 1LI9A 1YMSA 1KGGA 4N9KA 4GD8A 5GLBA 2XD1A 4UA9A 3SH8A 2WK0A 5KSCA 4N1XA 3M6HA 1W8QA 1K6RA 3LCEA 4DE2A 1FCOA 2IWDA 3WS2A 4Y0UA 1KVMA 2EX2A 3ZVWA 3HLEA 5GLCA 4IBXA 1IYSA 3MZDA 2XR0A 4OQ0A 4JXSA 5FSRA 1BLSA 3HLBA 4KG5A 1PW1A 2PU4A 3PBOA 5EVID 5F83A 5CHMA 1SCWA 4DF6A 4ZJ3A 5AQBA 1L0GA 1XA7A 2ZJ9A 4E3KA 1JVJA 1K6SA 3Q7VA 1BTLA 1U60A 1O07A 3OPRA 3CJMA 3Q7ZA 4BENA 3MFDA 3CG5A 4E3NA 5EOEA 4N9LA 5E2HA 3NI9A 4HEFA 4PM6A 1IKGA 5CGWA 4WZ5A 2Y2JA 2IWBA 1IEMA 1JTGA 3ZNTA 1WYBA 3A3EA 4KZ3A 1NYYA 4S2JA 5J8XA 1BSGA 3IWQA 3VFHA 3MZFA 3A3IA 5CERA 5EVIB 5A90A 3D4FA 2ZM2A 4N92A 2Y91A 4BLMA 2JCHA 2XFSA 4X55A 4MEZA 5FQ9A 1PZOA 3WWXA 2H0TA 4OONA 3ZHHA 1CK3A 4DDYA 5KMWA 2RL3A 1ZG6A 2Y2NA 5G18A 3WS1A 2WZZA 3FKWA 2Q9NA 3G2YA 4WZ4A 4XUZA 1FOFA 4OOMA 2PBYA 4B4XA 3HLGA 3TSGA 4OH0A 4PM5A 2R9XA 3GVBA 3RXXA 4FCFA 5CRFA 2ZM8A 3IT9A 4LCMA 1YT4A 2A49A 5CGXA 5A91A 4JXWA 2Z2MB 3NBLA 2J9PA 5FQMA 1KDWA 3IXDA 4O7DA 3OCLA 4OQGA 3SH9A 5HL1A 3IXHA 4FH2A 2BG1A 3A3FA 4KQOA 5TR7A 1L2SA 5DF7A 4DE3A 2VGJA 2PU2A 1MKIA 2HPBA 2V2FF 3UPPA 2BLSA 3ITBA 3N8LA 4P0MA 3ZG0A 1JWZA 1LL5A 5F82A 5A92A 3VP0A 3Q82A 3PBSA 3O3VA 1K4FA 1ZG4A 3OPHA 1M40A 2HP6A 3IH8A 3Q07A 3TOIA 2Y4AA 3GR2A 3QHYA 4B4ZA 5FQJA 3QNCA 4OOYA 4PMAA 3UE0A 3C7VA 1H8ZA 1LI0A 4KZ9A 1RGZA 3GSGA 5EVIA 5TFQA 4C6YA 3GMWA 4JXGA 4BL2A 1IYPA 2C6WB 1XPBA 5DVAA 4X6TA 5D3OA 4WEKA 2QPNA 5BOHA 3BLMA 2JE5A 2IWCA 4S2MA 1M6KA 1XGIA 4BJPA 4OKPA 3V39A 4E3MA 2EXBA 5GHZA 2G2WA 2V1ZA 3TG9A 1K57C 4BD1A 4S2NA 3IXGA 3N6IA 4M3KA 3W8KA 5AQ9A 4RX3A 1JWVA 4R23A 1MWRA 3RJUA 4EBNA 1E3UA 4E3JA 3PBQA 3VOYA 1K4EA 4GDNA 1G68A 3DWKA 2CC1A 4DRTA 4OQHA 1BLHA 3N8SA 4X53A 3A3JA 1NZUA 1OMEA 3IHBA 4GN2A 2RCXA 2J7VA 5CHJA 1FR6A 3HUMA 2X02A 3MKEA 4QY5A 1TEMA 1E4DA 3WS4A 1WYCA 5FQQA 1ES4A 3V5MA 1XGJA 1SKFA 1YLTA 2XK1A 3SS5A 1IYOA 4GNUA 3DW0A 5EECA 2ZM0A 2WKIA 5CXWA 2Y55A 3PBNA 3PBRA 2XGNA 2Y2LA 4UA7A 1K57A 4ZAMA 5FQKA 4F94A 2ZQ8A 4ZBEA 2WGWB 2V20A 3VMAA 4GB7A 2FFFB 1VM1A 1MWTA 1YLPA 4U3TA 1HD8A 2A3UA 4GOGA 2HDRA 1S6RA 5CGSA 5A93A 2EX9A 2I72A 3ZFZA 2J9OA 2ZC6B 1K54A 3GV9A 2HDUA 3Q81A 2ZC3B 3NIAA 4IVKA 3HLFA 5EOOA 2WKHA 5FI7A 1CEGA 5FAOA 1MY8A 3HVFA 3N7WA 3UE3A 3C5AA 4PPRA 4X69A 3NCKA 1K55A 1XX2A 3HUOA 3O88A 1FSWA 3VOZA 1ESIA 4GD6A 4BL3A 1E3UD 1GHMA 1QMFA 3P09A 5FI6A 5FASA 1EI5A 1XKZA 4GZBA 3RXWA 3VP4A 3MZEA 4NETA 4KZ4A 3PBTA 3AGEA 1L0FA 2XDMA 1CI9A 3O87A 1TDLA 2ZQ9A 1FSYA 3HREA 3G4PA 3IF6A 3I7JA 3IQAA 1XA1A 4MLLA 4S2NC
chains in the Genus database with same CATH superfamily
3DWZA 1BLPA 4MNRA 3FKVA 1N9LA 1PW8A 4O01A 5DKLA 3T4KA 3P98A 3KYEA 1STZA 2G2UA 2EXAA 2ZL1B 5CTNA 1RCJA 2DRWA 2ZBBA 2H10A 1ACFA 3BFEA 4LRZE 4LV2A 1G6AA 4Z9QA 4JLFA 4U0TA 5FDSA 3EWKA 4CPKA 1QMEA 4IVIA 2M7VA 4KQRA 1P9WA 4KUKA 1KGFA 2JKGA 1IYQA 3NULA 4GLQA 5HL6A 1EWZA 3MR0A 1PYYA 3BLSA 1FCNA 5M18A 2OLUA 5IT5A 4NXEA 2XSSA 3GRJA 1H8YA 1OJ5A 1BT5A 3UMDA 1TF1A 3G35A 4PM8A 1PNEA 1NXYA 5HD3A 2OLVA 1D1JA 3BM6A 3JYIA 1Q2QA 5EVEA 2ZLYA 3LEZA 1PI5A 2PRFA 1PWGA 2P7JA 2GZAA 5CECA 3LIAA 1AXBA 4ZDXA 3ZCZA 1XFQA 3AGDA 4LV0A 4CLCA 2Y2OA 1GHPA 1GSVA 1BZAA 2OOLA 2Z2LB 4WM9A 1S1YA 4KZBA 3DBAA 4YNRA 5HZHA 5DFXA 1T1CA 5HWWA 2OSUA 3UDFA 2K7SA 5IS1A 5CTMA 4BWIA 3E4PA 5CEBA 1YLJA 5KSHA 3L9KA 3NOUC 1LSWA 1T18A 3IF6B 1G5UA 1YLWA 4R38A 3LR5A 2O9BA 1YMXA 2HDSA 3EEAA 3UDIA 4X1LA 3E0YA 2FFYA 4U0XA 3C8CA 4GCZA 4MBFA 3V3SA 2PHYA 4DE0A 4OPRA 4LRXC 3ISGA 3NC8A 4JGOA 2XROA 3BECA 5MC7A 3A3DA 4XXRA 3A0VA 2ZC5B 4FD8A 4JBFA 4BBVA 3LR3A 4R3AA 1AWIA 5E2EA 2JC7A 3IS2A 3NHQA 1NJ4A 3V50A 2JKTI 2BTFP 2QZ6A 2EFXA 4G3KA 5F5YA 1K38A 3OCNA 4E6XA 3HLDA 4GJ4A 1HZOA 1K25A 1DRMA 5HAIA 5L8MA 1ODVA 4IHQA 3E4OA 4ARZB 2WAEA 1Y28A 2C5WB 3QP5A 4KQDA 3EGDC 1YM1A 1DY6A 2Y79A 4RA7A 5C5KA 3LUQA 4OP8A 4GW9A 4P6ZM 4P6ZS 3LIDA 2VLGA 4N1HA 4OLDA 2D02A 4KG6A 1S0WA 3VSKA 1GA0A 2XA7S 1W7FA 1NLZA 3RH8B 3S22A 3IWOA 1H5XA 3VFFA 4LENA 1G6OA 4KZ7A 4MBKA 3MXSA 2XF3A 5GLAA 3B47A 3MXQA 4X56A 1S67L 1KDSA 3T1QB 4OVDA 3T1SA 4YINA 3QP6A 4PHTA 1DJAA 4EUZA 2JBFA 3F1OA 4UHUA 4EQIA 2W3DA 2ZMFA 3H7WA 5FAPA 2Y2KA 2GJ3A 4ME4A 1JWPA 4IBRA 4S2KA 4WYYA 1KGGA 3TJZC 5GLBA 2XD1A 5KSCA 4KUOA 3WS2A 1KVMA 5F69A 3ZVWA 5AVEA 3HLEA 2KX6A 2XR0A 5FSRA 1TS8A 5EVID 1VETA 5AQBA 2ZJ9A 2ZOIA 3Q7VA 3DAVA 1U60A 3OPRA 1GSWA 3NOTC 1OTEA 3CJMA 3Q7ZA 4BENA 3MFDA 3CG5A 5E2HA 3C38A 4YWZA 5CGWA 3CUEC 1WA9A 2QJ5A 1S4RA 2DMWA 1BSGA 4G3WA 3D4FA 2Y91A 4I3IA 4X55A 4MEZA 1PZOA 3ZHHA 1CK3A 3NECA 5G18A 2WZZA 4LGWA 4X1MA 4FCFA 2PYPA 1OTIA 4JXWA 4NXFA 4LRYC 1KDWA 4O7DA 2VV7A 2J3WA 3OCLA 4OQGA 1V9ZA 3IXHA 4FH2A 2BLSA 4P0MA 3ZG0A 3BQ8A 3H82B 3O3VA 4HP9A 2OAQ1 3JVUA 5L09A 4KZ9A 4I38A 1OPXA 4C6YA 4BL2A 2C6WB 4X6TA 5BOHA 2JE5A 4S2MA 3HCYA 4BJPA 5GHZA 2O99A 2V1ZA 3W8KA 4RX3A 2I9VA 4R23A 4JGPA 2YKFA 5DJUA 4GN2A 3IHBA 2RCXA 2EA9A 1GSXA 3ULFA 3HUMA 1ES4A 3DTKA 4WN5A 1LT0A 4GNUA 2ZM0A 3BW6A 5CXWA 3PBRA 2XGNA 2W1TB 3T12B 2WGWB 3F1NB 1VM1A 4U3TA 4CLCB 2HDRA 5A93A 2I72A 3ZFZA 5TJJA 2K2NA 3GV9A 3NIAA 1MY8A 3HVFA 3UE3A 4PPRA 3NCKA 3DTIA 1K0KA 3VOZA 2JHEA 1ESIA 1Z09A 1GHMA 5FI6A 2EWVA 1XKZA 3RXWA 3VP4A 3AGEA 1T19A 3IX3A 3FG8A 1CI9A 1FSYA 4Q0JA 4KZ8A 2WGVA 4JKTA 1PIOA 3BRMA 4MN5A 3UDXA 2H28A 3UNWA 2VK3A 4JF6A 1H0MA 3VE3A 1PWDA 4OPZA 4NK3A 1K55C 4HQAA 2XH9A 5I94A 3MXRA 2PAVP 4R4RA 4R70A 4II7A 3CAXA 1MZUA 4LLOB 1BLCA 3KYQA 2OAP1 3WRTA 4G3VA 3P7NA 2Y2IA 3N8RA 3IXBA 1W5DA 4E04A 3UB6A 5F68A 2W27A 4FH4A 4HIAA 3OPLA 1G28A 3BY8A 4OOLA 3VP1A 3R7WB 3C30A 3QP4A 5JYOA 1FQGA 4BQMA 5GHXA 4B88A 4EW7A 4QWOA 1F9IA 2ZQ7A 4PKYA 5E43A 5AQAA 4LCLA 5GL9A 3C4PA 2V0WA 3ZDJA 4GDBA 1F98A 4WL9A 1HLUP 2WAFA 5HSQA 2Y2PA 4UEYA 3KX0X 1F5MA 1CI8A 2OV5A 5AJGA 4K91A 4H6JA 5FDHA 1RP5A 2QMIA 5E2GA 3MKFA 3BYDA 4ID4A 3ZG9B 2DCFA 4FSFA 5EUAA 2JKRI 3V67A 2HF6A 1IKIA 1N9BA 5L2FA 1ZC2A 4R3JA 2VV8A 3PHYA 4WMCD 5HWVA 4IUHA 2J3TC 2V0UA 3LY4A 2E8IA 4NXBA 1L0EA 5AVFA 3HJIA 4L9GA 5HD5A 3H9WA 3NY4A 3O5YA 3S7QA 3KSFA 3DTMA 2ZQAA 4HH3A 3BFFA 1WE4A 3G34A 2W1TA 5EM1A 1OTDA 3B33A 4HHDA 1UWNX 3FYZA 1TDGA 4XT2B 1Q2PA 4NG2A 1IELA 2ZC4B 4Y7PA 2Y2MA 4DXBA 3RTYA 3WS5A 1KE3A 4ZJ2A 5L10A 1CJFA 3LICA 2ZMAA 2HP9A 4OPYA 3W2ZA 3DTEA 1MBLA 1I5QA 3CZDA 4BD0A 3T4SA 3G31A 3H7WB 4LPZA 3T4TA 3B3XA 4RYEA 4GKUA 3AGFA 4RX2A 3KO6A 4JF4A 3V3RA 2P04A 1ONGA 2KDKA 2H0YA 1F2KA 4NEED 5EVIC 4S2IA 2D01A 3FPWA 1TS7A 3CLOA 3W4QA 2VX8A 4OQIA 1DJBA 4KZ5A 4A5RA 1XJ4A 2W3FA 1NYMA 3MFXA 5J4EA 3EQUA 3MQ0A 4C75A 2EFUA 1UWPX 2QKPA 3Q1FA 2Y8HA 2GDNA 5DFYA 4D2OA 4DKIA 4KZ6A 2VV6A 4WELA 4UA6A 2B95A 2P74A 3MJQA 2P9VA 3IHAA 5FA7A 3W4PA 2Y2GA 3ZVTA 2XD5A 2PYRA 3EGXC 1MPLA 1DP8A 4UA9A 3SH8A 1W63M 3M6HA 3LI9A 4Y0UA 2V8CA 2MJ6A 5GLCA 2V8FA 4JXSA 2OWHA 3HLBA 4R6LA 4KG5A 1PW1A 2PU4A 1SCWA 4ARZA 4E3KA 1JVJA 1K6SA 3FC7A 1UGUA 1YKDA 5EOEA 3NI9A 2W3GA 2IWBA 1JTGA 3IS2B 4KZ3A 3ZNTA 1NYYA 1W63Q 3MZFA 5CERA 4BLMA 2K31A 4DJ3A 4DDYA 1FIKA 2E8JA 5KMWA 3F1OB 3G2YA 4WZ4A 1FOFA 4OOMA 1YSQA 3HLGA 4Q0IA 2R9XA 3IT9A 4O0PA 2YKHA 5FQMA 4HJ3A 3CHWP 4MN7A 3RFBA 2BG1A 3A3FA 5DF7A 1YPRA 2PU2A 2VGJA 2V2FF 3UPPA 3PYPA 1LL5A 5HDSA 5K5BA 1ZG4A 3OPHA 2HP6A 3IH8A 2Q0OA 4OOYA 4FTXA 3UE0A 1H8ZA 3GSGA 1IYPA 4Y15A 5D3OA 4WEKA 3BLMA 2IWCA 3C2WA 3V39A 3IBJA 3TG9A 4GDNA 4B93A 1CF0A 2A24A 5FL3A 4WUJA 3A3JA 1OMEA 3LYXA 1YSPA 1TEMA 1E4DA 1WYCA 1JNUA 1CQAA 1SKFA 1OTAA 3MS6A 4HNBA 3T4JA 2WKIA 2Y55A 3F1PA 3P01A 2ZQ8A 4ZBEA 4Z1WA 3UB7A 2V9AA 4HY8A 2J9OA 4EERA 1K54A 3Q81A 3HLFA 5FAOA 3N7WA 3C5AA 2JKTM 5EFWA 1FSWA 3IX4A 3MZEA 4NETA 2HV1A 2BASA 1L0FA 3U2AA 1X0OA 3HREA 3IQAA 4KG2A 4L9EA 1XA1A 4MLLA 1MWSA 4BMWA 4KQQA 4KZAA 5HPIA 1OJGA 3HLCA 1E25A 1YLYA 1DP9A 4R1GA 3VE4A 4XUXA 3VV4A 5AQ7A 4DXCA 2WKEA 2KLIA 4DDSA 4X25A 4XT2A 1V9YA 3T1XA 1ZHHB 3OC2A 4MBHA 3HBRA 1GHIA 2ZQCA 1D06A 3OBFA 4OP5A 2JN7A 2HJEA 4X68A 1FR1A 4WZ5C 3PXPA 3ICYA 2GX5A 4EESA 2WGIA 5FQIA 3VSLA 3ZYTA 2XQZA 4F3LA 1XXMA 5DF8A 4H8RA 3LR4A 1OT6A 4LV1A 3SOIA 2L0WA 4QHCA 2J3TD 1Z6FA 3HUNA 1ES5A 2VKSA 3BFDA 5IHVA 3VOLA 4HP4A 3LO7A 3QNBA 5HFOA 4WEJA 2QWSA 1SZVA 4P6BA 1CEFA 1DJCA 5FAQA 2O0YA 2INWA 4ZRRA 1PFLA 3KYZA 4WF0A 4PKYG 4CLCE 1SDEA 3ZG7B 3PAEA 3UY6A 4E3OA 3L7HA 3WS0A 5CEDA 1TS6A 4S2PA 1FILA 4S2OA 5HAPA 3EQVA 4UQIM 1ZKJA 2LB5A 5DTKA 3MBZA 4WLAA 3CWFA 1N4OA 3S1YA 3M2KA 3G6OA 2JKFA 3SS3A 2R78A 4L9FA 5KZHA 3O86A 2P9VB 4YFMA 1SKOB 1EROA 4CJNA 3C7UA 3GQZA 2UWXA 2L4RA 4P85A 4DE1A 1Y4OA 1HTZA 3F1PB 2FH5A 3G2ZA 1SDNA 4HJ6A 3T1RA 1ESUA 2VGLS 1NRFA 4E3LA 4O8GA 3ZGAB 3UPNA 4JGRA 3FPVA 4GS9A 4P87A 4WMCA 5GHYA 5J7EA 2LB9A 1L0DA 2W3HA 3NDGA 3MQOA 1ERQA 4L0LA 1K56A 5DTTA 1PWCA 2OWJA 2HDQA 3LIFA 5DF9A 3UE1A 4WBGA 4OLGA 5TBMB 2O9AA 2ZC7A 2QHKA 4S2LA 1LL8A 2NUTC 3OZHA 1VB6A 4K0WA 5L07A 1NZOA 4IUKA 4Y0OA 3HJKA 2VGKA 4QU3A 2NUPC 3F1NA 5HW3A 1TD5A 2WZXA 3UPOA 4PM9A 4E6WA 1LSXA 3PAGA 3W4OA 1XJ6A 4QPRA 1IFQA 3S4XA 1K54C 3BEBA 4NXGA 3NOPC 3Q7VB 5CX7A 4I5SA 3WRZA 1K56D 3E2KA 2HP5A 5HARA 4Q8IA 4HBUA 4KENB 1W79A 2VZWA 3ZG8B 3GECA 2R9WA 1KVLA 5J3WA 2WK0A 1XJ2A 5FEGA 1W8QA 1K6RA 3LCEA 1FCOA 1IYSA 3MZDA 4GHIB 1XA7A 1S4SA 2L1MA 3JVVA 1BTLA 2KOIA 3H82A 1OT9A 4E3NA 2B02A 4PM6A 1P0ZA 4WZ5A 1NRJA 1WYBA 3A3EA 4S2JA 3A3IA 5EVIB 3R4KA 5A90A 1BYWA 3UB8A 5FQ9A 2XFSA 2H0TA 4OONA 3IBRA 4K08A 1ZG6A 3D3OA 2Y2NA 2ZMVA 4XUZA 3K3DA 2PBYA 3BWLA 3TSGA 4OH0A 1SKOA 3GVBA 2UV0E 4LFUA 1YT4A 3E4QA 2VJWA 3KSHA 3T4QA 5TR7A 4EUVA 1MKIA 3N8LA 3QP2A 5A92A 3VP0A 3EEHA 1YAXA 3Q07A 2Y4AA 4I3JA 3LGOA 1S66L 3QHYA 4B4ZA 3QNCA 4PMAA 1S1ZA 3C7VA 5G4ZA 4D60A 5EVIA 5TFQA 4MN6A 4JXGA 5DVAA 1XPBA 2QPNA 3ZQ5A 1M6KA 1XGIA 4FUWA 4OKPA 2W3EA 2EXBA 1D7EA 2G2WA 4BD1A 1K57C 4S2NA 4M3KA 5AQ9A 1MWRA 3RJUA 4E3JA 3PBQA 1G68A 3UB9A 2CC1A 4RQ9A 2XA7M 3EOIA 1H3QA 4OQHA 4X53A 4DN0A 2J7VA 4BBUA 2X02A 3MKEA 3WS4A 1XGJA 1YLTA 2XK1A 3SS5A 3MMHA 1IYOA 4EEPA 3UE6A 3DW0A 4Y2FA 5EECA 3PBNA 2Y2LA 4ZAMA 3VMAA 2FFFB 1YLPA 3A0RA 5CGSA 2A24B 2EX9A 2PD7A 2ZC6B 3BQAA 2HGVA 4IVKA 1ZTUA 1A0KA 1T1BA 1K55A 4B9OA 3LIEA 1P9RA 3UMEA 4GD6A 1E3UD 1QMFA 3P09A 4HOIA 1EI5A 4EU0A 4GZBA 2PBDP 5HDDA 3O87A 3I7JA 3CPTB 4CLCC 1ES2A 5HX9A 3SH7A 5F1GA 5F1FA 4EWFA 3TRCA 3LEQA 4QD4A 1ONHA 5TBMA 3LR0A 1PI4A 4R3BA 4C3QA 1ERMA 3N4IA 1NY0A 3UO9A 4Y0TA 5HPFA 3VP2A 5EE8A 1LHYA 4R4SA 1Y54A 2ZQDA 5CHUA 5HAQA 4BBTA 3FV7A 3MF0A 3M6BA 1W8YA 4Q0HA 4HBTA 5FI2A 5A8BA 4EBPA 3ZG5A 5FATA 3D72A 5JYPA 3SW1A 4HESA 2XLNA 1C3BA 1XJ3A 3NDEA 1YLZA 1KGEA 1DP6A 2WKQA 3IWIA 1BULA 3OPPA 1MWUA 1GA9A 5EPHA 3SS4A 3NJAA 1RGYA 4ZJ1A 5M19A 3LY3A 3BFCA 4PM7A 3ZNYA 1FCMA 2Q9MA 4QY6A 2XEPA 5E2FA 1I2SA 5I5LA 1J9MA 3CI6A 3S7OA 2PD8A 4MDZA 2HJ9C 3U4LP 2WUQA 4R0QA 2H5SA 3T4LA 1O7EA 4AFIA 2DNSA 1PRQA 2QYBA 3UN7A 3G30A 2XFTA 4LV3A 1LL9A 2WYXA 2JKRM 3KSGA 3CPTA 3ITAA 1MKMA 3K2NA 3FWLA 4MMNA 4EV4A 2GNXA 5GLDA 1ALQA 1EW0A 2XRNA 2J80A 3E98A 1VEUA 1MXOA 3BY9A 3HL9A 1KE4A 3CMZA 4I3AA 4CLCD 2A2LA 4UAAA 1NLYA 4JXVA 3E2LA 4ETXA 3IH9A 3B42A 3GTCA 4RVAA 1L3LA 5DTSA 3JPUA 2O9CA 5LBRA 2Y59A 1OTBA 3BFGA 3VP3A 3M2JA 2ZL1A 2P08A 4UQIS 1KOUA 1VQQA 2X01A 2WGWA 3KSIA 4EBLA 1KE0A 3FZCA 1TS0A 2M1CA 4QB8A 1YQSA 2Y2HA 3IF6C 3MSHA 4ESPA 2PDRA 2Y2QA 4EXOA 5M1AA 1TVFA 4E3IA 2Z6CA 1IOUA 3IF5A 3HLWA 1H8MA 2J8YA 3QP1A 5HWTA 2EX8A 3C4OA 3D9YA 5U47A 3PTEA 5TGFA 1HVBA 1GCEA 1XP4A 2WADA 3T4OA 1NWZA 2X71A 4EQ1A 2B5RA 4Y13A 1BUEA 5G4YA 3OOVA 3QP8A 4QJGA 4K0XA 4IEDA 1SHVA 1I2WA 1PZPA 2EX6A 5DJTA 1LLBA 2ZD8A 3PR6A 5EVLA 1JTDA 4GHIA 4JF5A 2M7UA 4ZTKA 5IU1A 3IX8A 1ES3A 3K3CA 4JPMA 3CUEA 1LSVA 4OPQA 3G32A 1LI9A 1YMSA 4N9KA 4CQHA 4GD8A 2FZ0A 1N9OA 4N1XA 4DE2A 2IWDA 2EX2A 5EM0A 2VEAA 4IBXA 3TW8A 4OQ0A 1BLSA 1XFNA 5DKKA 5F83A 3PBOA 5CHMA 4DF6A 3LFVA 4PAUA 4ZJ3A 1L0GA 2AVXA 1O07A 4N9LA 4HEFA 1IKGA 2Y2JA 3LIBA 1IEMA 5J8XA 3IWQA 2IA2A 3VFHA 2VA0A 2ZM2A 4N92A 4MCWA 2JCHA 2PR5A 3WWXA 4NKPA 1VETB 2RL3A 4IJGA 3WS1A 3FKWA 2Q9NA 2Z6DA 3GDIA 4ETZA 4B4XA 4PM5A 3MQQA 3RXXA 1MC0A 4HJ4A 5CRFA 2ZM8A 4LCMA 2A49A 5CGXA 5A91A 2Z2MB 3NBLA 2J9PA 3IXDA 3SH9A 5HL1A 4EETB 4KQOA 4M4XA 1L2SA 4DE3A 5FEFA 2HPBA 3ITBA 1JWZA 5F82A 4Y3IA 3Q82A 3PBSA 1K4FA 1M40A 3TOIA 2EWWA 3GR2A 5FQJA 1LI0A 1RGZA 2B18A 4HI4A 2G7UA 1VEUB 3GMWA 4H6JB 4GS9B 3A0SA 1J3WA 2V1AA 5EV0A 4E3MA 2W1RA 3TE8A 3IXGA 3N6IA 4I39A 1JWVA 4EBNA 4F3LB 1E3UA 3VOYA 1K4EA 2WKRA 2ZOHA 3S7NA 3DWKA 5HDCA 4DRTA 1VHMA 3UB5P 1BLHA 3N8SA 1NZUA 5CHJA 1N9NA 1FR6A 5KIZA 4QY5A 2CMNA 4YOFA 4DJ2A 2PR6A 5FQQA 3V5MA 3OLOA 1T1AA 3BJNA 3R7WA 3S7PA 4FOFA 4UA7A 2PT7A 1K57A 5FQKA 4F94A 3LI8A 2HZ5A 2V20A 4GB7A 1MWTA 1HD8A 2A3UA 4GOGA 1S6RA 2W0NA 3CITA 4JGQA 4Y5FA 3T50A 2HDUA 2ZC3B 5EOOA 2WKHA 5FI7A 1CEGA 4X69A 2V1BA 2QJ7A 1XX2A 3HUOA 3O88A 2ACGA 4BL3A 2VGLM 5FASA 3SZTA 4KZ4A 4DMZA 3PBTA 2XDMA 2WKPA 1TDLA 2ZQ9A 1P97A 3G4PA 3IF6A 4Y17A 4HH2A 4EEUA 5F6AA 4S2NC
chains in the Genus database with same CATH topology
4KZ8A 1MWSA 1BLPA 3DWZA 4KQQA 3FKVA 1ES2A 4MNRA 5HX9A 3SH7A 5F1GA 4KZAA 1PW8A 5F1FA 4EWFA 2WGVA 4JKTA 3HLCA 4QD4A 3P98A 1PIOA 1ONHA 1E25A 1YLYA 3BRMA 2G2UA 2EXAA 5CTNA 3UDXA 1PI4A 4R3BA 4R1GA 1RCJA 2DRWA 4XUXA 3UNWA 5AQ7A 4JF6A 2H10A 4C3QA 1ERMA 1PWDA 2WKEA 3BFEA 4NK3A 1K55C 4OPZA 3N4IA 4DXCA 4LV2A 4DDSA 1G6AA 4Z9QA 1NY0A 4JLFA 4U0TA 3UO9A 4Y0TA 3VP2A 4CPKA 5EE8A 2XH9A 1QMEA 3OC2A 4IVIA 5I94A 3MXRA 4KQRA 1LHYA 4MBHA 3HBRA 4R4RA 1GHIA 2ZQCA 4R4SA 1Y54A 2ZQDA 5CHUA 5HAQA 4OP5A 3FV7A 4X68A 1KGFA 1FR1A 4WZ5C 3M6BA 1W8YA 1BLCA 4HBTA 5FI2A 1IYQA 3WRTA 4EBPA 1EWZA 5FATA 3ZG5A 1PYYA 3BLSA 2WGIA 5FQIA 1FCNA 5JYPA 5M18A 3VSLA 4HESA 2OLUA 2XQZA 2Y2IA 2XLNA 3N8RA 1XXMA 5DF8A 3IXBA 4H8RA 1W5DA 4LV1A 3GRJA 1H8YA 1BT5A 3SOIA 3G35A 4QHCA 4FH4A 1C3BA 3NDEA 4PM8A 1Z6FA 3HUNA 1ES5A 3OPLA 1YLZA 1NXYA 1KGEA 3BFDA 4OOLA 3VP1A 5IHVA 2OLVA 1BULA 3IWIA 3OPPA 3BM6A 1MWUA 3JYIA 1Q2QA 1GA9A 5JYOA 1FQGA 5EPHA 3LO7A 2ZLYA 3SS4A 4BQMA 1RGYA 3QNBA 5GHXA 4B88A 3LEZA 5HFOA 4ZJ1A 4WEJA 1PI5A 5M19A 1PWGA 4P6BA 1CEFA 3LY3A 1DJCA 3BFCA 4PM7A 3ZNYA 5CECA 2ZQ7A 1FCMA 2Q9MA 4QY6A 5E43A 1AXBA 4LCLA 5AQAA 2XEPA 5GL9A 4ZDXA 3C4PA 5FAQA 3ZCZA 3AGDA 4LV0A 5E2FA 1I2SA 3ZDJA 2Y2OA 1J9MA 1GHPA 4GDBA 1BZAA 2Z2LB 1SDEA 4WM9A 4KZBA 3ZG7B 3PAEA 2WUQA 4R0QA 3UY6A 2H5SA 2OSUA 2WAFA 1O7EA 2Y2PA 3UDFA 2DNSA 4E3OA 3UN7A 3G30A 5CTMA 1CI8A 2XFTA 4LV3A 2OV5A 3WS0A 5CEDA 4K91A 1LL9A 4S2PA 5FDHA 1RP5A 4S2OA 5HAPA 3EQVA 2QMIA 2WYXA 5E2GA 5CEBA 1ZKJA 3MKFA 1YLJA 3BYDA 4ID4A 5KSHA 3ZG9B 2DCFA 3IF6B 4FSFA 5EUAA 1YLWA 5DTKA 3ITAA 1YMXA 3MBZA 2HDSA 1IKIA 1N9BA 3UDIA 3FWLA 5L2FA 4EV4A 2FFYA 1ZC2A 4U0XA 4R3JA 5GLDA 4WMCD 4MBFA 3V3SA 3LY4A 1N4OA 4DE0A 1ALQA 4OPRA 2E8IA 3S1YA 3ISGA 3NC8A 3M2KA 1MXOA 3BECA 1L0EA 3HL9A 3A3DA 1KE4A 3CMZA 3SS3A 4XXRA 3NY4A 3O86A 2P9VB 2ZC5B 5KZHA 4UAAA 4YFMA 4FD8A 1EROA 4CJNA 3C7UA 3GQZA 4JBFA 2UWXA 4JXVA 3E2LA 4P85A 3DTMA 4DE1A 1HTZA 2ZQAA 3IH9A 3G2ZA 5E2EA 3GTCA 1SDNA 3BFFA 1ESUA 1WE4A 2JC7A 3G34A 1NJ4A 4RVAA 5DTSA 3V50A 1NRFA 4E3LA 3ZGAB 2QZ6A 2EFXA 1K38A 3OCNA 3FYZA 3UPNA 4E6XA 3HLDA 1TDGA 1HZOA 1K25A 1Q2PA 2Y59A 5HAIA 1IELA 2ZC4B 4Y7PA 2Y2MA 3BFGA 4P87A 3VP3A 2WAEA 3M2JA 4WMCA 4DXBA 5GHYA 2C5WB 1VQQA 1YM1A 3WS5A 1DY6A 2X01A 1KE3A 2WGWA 4ZJ2A 4EBLA 1KE0A 3FZCA 1L0DA 4QB8A 1YQSA 2Y2HA 4RA7A 3NDGA 1ERQA 2ZMAA 2HP9A 4OPYA 3IF6C 4L0LA 4OP8A 4BD0A 1MBLA 1I5QA 2Y2QA 3CZDA 1K56A 5M1AA 5DTTA 1PWCA 1TVFA 2HDQA 4E3IA 3G31A 3IF5A 5DF9A 3HLWA 3UE1A 3B3XA 2J8YA 4RYEA 4GKUA 3AGFA 4WBGA 4RX2A 4OLGA 4JF4A 4N1HA 3V3RA 4OLDA 2EX8A 1ONGA 2ZC7A 3C4OA 2H0YA 4KG6A 4S2LA 1S0WA 3VSKA 3OZHA 5U47A 1GA0A 3PTEA 4K0WA 5EVIC 4S2IA 5TGFA 1HVBA 1NZOA 1W7FA 4Y0OA 3W4QA 1GCEA 1XP4A 2VGKA 2WADA 4OQIA 4QU3A 3S22A 5HW3A 1DJBA 2X71A 4KZ5A 2B5RA 2WZXA 4A5RA 3UPOA 3IWOA 1H5XA 4PM9A 3VFFA 4E6WA 4LENA 4KZ7A 3PAGA 4MBKA 3MXSA 3W4OA 1BUEA 2XF3A 1NYMA 3S4XA 5GLAA 1K54C 3EQUA 3BEBA 4QJGA 4C75A 2EFUA 4K0XA 4IEDA 1SHVA 3Q7VB 3Q1FA 4DKIA 2GDNA 4D2OA 1I2WA 1PZPA 2EX6A 4KZ6A 1LLBA 2ZD8A 4X56A 3WRZA 1K56D 4KG2A 1KDSA 3E2KA 2HP5A 4OVDA 4WELA 4YINA 5EVLA 4UA6A 5HARA 1JTDA 2P74A 1DJAA 4Q8IA 4JF5A 4EUZA 4HBUA 4ZTKA 2JBFA 2P9VA 4KENB 3IHAA 1W79A 5FA7A 4UHUA 1ES3A 4EQIA 4JPMA 3ZG8B 3W4PA 2Y2GA 3ZVTA 2Y2KA 5FAPA 2XD5A 2R9WA 1JWPA 4IBRA 4OPQA 1MPLA 3G32A 4S2KA 1KVLA 4WYYA 1LI9A 1YMSA 1KGGA 4N9KA 4GD8A 5GLBA 2XD1A 4UA9A 3SH8A 2WK0A 5KSCA 4N1XA 3M6HA 1W8QA 1K6RA 3LCEA 4DE2A 1FCOA 2IWDA 3WS2A 4Y0UA 1KVMA 2EX2A 3ZVWA 3HLEA 5GLCA 4IBXA 1IYSA 3MZDA 2XR0A 4OQ0A 4JXSA 5FSRA 1BLSA 3HLBA 4KG5A 1PW1A 2PU4A 3PBOA 5EVID 5F83A 5CHMA 1SCWA 4DF6A 4ZJ3A 5AQBA 1L0GA 1XA7A 2ZJ9A 4E3KA 1JVJA 1K6SA 3Q7VA 1BTLA 1U60A 1O07A 3OPRA 3CJMA 3Q7ZA 4BENA 3MFDA 3CG5A 4E3NA 5EOEA 4N9LA 5E2HA 3NI9A 4HEFA 4PM6A 1IKGA 5CGWA 4WZ5A 2Y2JA 2IWBA 1IEMA 1JTGA 3ZNTA 1WYBA 3A3EA 4KZ3A 1NYYA 4S2JA 5J8XA 1BSGA 3IWQA 3VFHA 3MZFA 3A3IA 5CERA 5EVIB 5A90A 3D4FA 2ZM2A 4N92A 2Y91A 4BLMA 2JCHA 2XFSA 4X55A 4MEZA 5FQ9A 1PZOA 3WWXA 2H0TA 4OONA 3ZHHA 1CK3A 4DDYA 5KMWA 2RL3A 1ZG6A 2Y2NA 5G18A 3WS1A 2WZZA 3FKWA 2Q9NA 3G2YA 4WZ4A 4XUZA 1FOFA 4OOMA 2PBYA 4B4XA 3HLGA 3TSGA 4OH0A 4PM5A 2R9XA 3GVBA 3RXXA 4FCFA 5CRFA 2ZM8A 3IT9A 4LCMA 1YT4A 2A49A 5CGXA 5A91A 4JXWA 2Z2MB 3NBLA 2J9PA 5FQMA 1KDWA 3IXDA 4O7DA 3OCLA 4OQGA 3SH9A 5HL1A 3IXHA 4FH2A 2BG1A 3A3FA 4KQOA 5TR7A 1L2SA 5DF7A 4DE3A 2VGJA 2PU2A 1MKIA 2HPBA 2V2FF 3UPPA 2BLSA 3ITBA 3N8LA 4P0MA 3ZG0A 1JWZA 1LL5A 5F82A 5A92A 3VP0A 3Q82A 3PBSA 3O3VA 1K4FA 1ZG4A 3OPHA 1M40A 2HP6A 3IH8A 3Q07A 3TOIA 2Y4AA 3GR2A 3QHYA 4B4ZA 5FQJA 3QNCA 4OOYA 4PMAA 3UE0A 3C7VA 1H8ZA 1LI0A 4KZ9A 1RGZA 3GSGA 5EVIA 5TFQA 4C6YA 3GMWA 4JXGA 4BL2A 1IYPA 2C6WB 1XPBA 5DVAA 4X6TA 5D3OA 4WEKA 2QPNA 5BOHA 3BLMA 2JE5A 2IWCA 4S2MA 1M6KA 1XGIA 4BJPA 4OKPA 3V39A 4E3MA 2EXBA 5GHZA 2G2WA 2V1ZA 3TG9A 1K57C 4BD1A 4S2NA 3IXGA 3N6IA 4M3KA 3W8KA 5AQ9A 4RX3A 1JWVA 4R23A 1MWRA 3RJUA 4EBNA 1E3UA 4E3JA 3PBQA 3VOYA 1K4EA 4GDNA 1G68A 3DWKA 2CC1A 4DRTA 4OQHA 1BLHA 3N8SA 4X53A 3A3JA 1NZUA 1OMEA 3IHBA 4GN2A 2RCXA 2J7VA 5CHJA 1FR6A 3HUMA 2X02A 3MKEA 4QY5A 1TEMA 1E4DA 3WS4A 1WYCA 5FQQA 1ES4A 3V5MA 1XGJA 1SKFA 1YLTA 2XK1A 3SS5A 1IYOA 4GNUA 3DW0A 5EECA 2ZM0A 2WKIA 5CXWA 2Y55A 3PBNA 3PBRA 2XGNA 2Y2LA 4UA7A 1K57A 4ZAMA 5FQKA 4F94A 2ZQ8A 4ZBEA 2WGWB 2V20A 3VMAA 4GB7A 2FFFB 1VM1A 1MWTA 1YLPA 4U3TA 1HD8A 2A3UA 4GOGA 2HDRA 1S6RA 5CGSA 5A93A 2EX9A 2I72A 3ZFZA 2J9OA 2ZC6B 1K54A 3GV9A 2HDUA 3Q81A 2ZC3B 3NIAA 4IVKA 3HLFA 5EOOA 2WKHA 5FI7A 1CEGA 5FAOA 1MY8A 3HVFA 3N7WA 3UE3A 3C5AA 4PPRA 4X69A 3NCKA 1K55A 1XX2A 3HUOA 3O88A 1FSWA 3VOZA 1ESIA 4GD6A 4BL3A 1E3UD 1GHMA 1QMFA 3P09A 5FI6A 5FASA 1EI5A 1XKZA 4GZBA 3RXWA 3VP4A 3MZEA 4NETA 4KZ4A 3PBTA 3AGEA 1L0FA 2XDMA 1CI9A 3O87A 1TDLA 2ZQ9A 1FSYA 3HREA 3G4PA 3IF6A 3I7JA 3IQAA 1XA1A 4MLLA 4S2NC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KZ8 A;  1MWS A;  1BLP A;  3DWZ A;  4KQQ A;  3FKV A;  1ES2 A;  4MNR A;  5HX9 A;  3SH7 A;  5F1G A;  4KZA A;  1PW8 A;  5F1F A;  4EWF A;  2WGV A;  4JKT A;  3HLC A;  4QD4 A;  3P98 A;  1PIO A;  1ONH A;  1E25 A;  1YLY A;  3BRM A;  2G2U A;  2EXA A;  5CTN A;  3UDX A;  1PI4 A;  4R3B A;  4R1G A;  1RCJ A;  2DRW A;  4XUX A;  3UNW A;  5AQ7 A;  4JF6 A;  2H10 A;  4C3Q A;  1ERM A;  1PWD A;  2WKE A;  3BFE A;  4NK3 A;  1K55 C;  4OPZ A;  3N4I A;  4DXC A;  4LV2 A;  4DDS A;  1G6A A;  4Z9Q A;  1NY0 A;  4JLF A;  4U0T A;  3UO9 A;  4Y0T A;  3VP2 A;  4CPK A;  5EE8 A;  2XH9 A;  1QME A;  3OC2 A;  4IVI A;  5I94 A;  3MXR A;  4KQR A;  1LHY A;  4MBH A;  3HBR A;  4R4R A;  1GHI A;  2ZQC A;  4R4S A;  1Y54 A;  2ZQD A;  5CHU A;  5HAQ A;  4OP5 A;  3FV7 A;  4X68 A;  1KGF A;  1FR1 A;  4WZ5 C;  3M6B A;  1W8Y A;  1BLC A;  4HBT A;  5FI2 A;  1IYQ A;  3WRT A;  4EBP A;  1EWZ A;  5FAT A;  3ZG5 A;  1PYY A;  3BLS A;  2WGI A;  5FQI A;  1FCN A;  5JYP A;  5M18 A;  3VSL A;  4HES A;  2OLU A;  2XQZ A;  2Y2I A;  2XLN A;  3N8R A;  1XXM A;  5DF8 A;  3IXB A;  4H8R A;  1W5D A;  4LV1 A;  3GRJ A;  1H8Y A;  1BT5 A;  3SOI A;  3G35 A;  4QHC A;  4FH4 A;  1C3B A;  3NDE A;  4PM8 A;  1Z6F A;  3HUN A;  1ES5 A;  3OPL A;  1YLZ A;  1NXY A;  1KGE A;  3BFD A;  4OOL A;  3VP1 A;  5IHV A;  2OLV A;  1BUL A;  3IWI A;  3OPP A;  3BM6 A;  1MWU A;  3JYI A;  1Q2Q A;  1GA9 A;  5JYO A;  1FQG A;  5EPH A;  3LO7 A;  2ZLY A;  3SS4 A;  4BQM A;  1RGY A;  3QNB A;  5GHX A;  4B88 A;  3LEZ A;  5HFO A;  4ZJ1 A;  4WEJ A;  1PI5 A;  5M19 A;  1PWG A;  4P6B A;  1CEF A;  3LY3 A;  1DJC A;  3BFC A;  4PM7 A;  3ZNY A;  5CEC A;  2ZQ7 A;  1FCM A;  2Q9M A;  4QY6 A;  5E43 A;  1AXB A;  4LCL A;  5AQA A;  2XEP A;  5GL9 A;  4ZDX A;  3C4P A;  5FAQ A;  3ZCZ A;  3AGD A;  4LV0 A;  5E2F A;  1I2S A;  3ZDJ A;  2Y2O A;  1J9M A;  1GHP A;  4GDB A;  1BZA A;  2Z2L B;  1SDE A;  4WM9 A;  4KZB A;  3ZG7 B;  3PAE A;  2WUQ A;  4R0Q A;  3UY6 A;  2H5S A;  2OSU A;  2WAF A;  1O7E A;  2Y2P A;  3UDF A;  2DNS A;  4E3O A;  3UN7 A;  3G30 A;  5CTM A;  1CI8 A;  2XFT A;  4LV3 A;  2OV5 A;  3WS0 A;  5CED A;  4K91 A;  1LL9 A;  4S2P A;  5FDH A;  1RP5 A;  4S2O A;  5HAP A;  3EQV A;  2QMI A;  2WYX A;  5E2G A;  5CEB A;  1ZKJ A;  3MKF A;  1YLJ A;  3BYD A;  4ID4 A;  5KSH A;  3ZG9 B;  2DCF A;  3IF6 B;  4FSF A;  5EUA A;  1YLW A;  5DTK A;  3ITA A;  1YMX A;  3MBZ A;  2HDS A;  1IKI A;  1N9B A;  3UDI A;  3FWL A;  5L2F A;  4EV4 A;  2FFY A;  1ZC2 A;  4U0X A;  4R3J A;  5GLD A;  4WMC D;  4MBF A;  3V3S A;  3LY4 A;  1N4O A;  4DE0 A;  1ALQ A;  4OPR A;  2E8I A;  3S1Y A;  3ISG A;  3NC8 A;  3M2K A;  1MXO A;  3BEC A;  1L0E A;  3HL9 A;  3A3D A;  1KE4 A;  3CMZ A;  3SS3 A;  4XXR A;  3NY4 A;  3O86 A;  2P9V B;  2ZC5 B;  5KZH A;  4UAA A;  4YFM A;  4FD8 A;  1ERO A;  4CJN A;  3C7U A;  3GQZ A;  4JBF A;  2UWX A;  4JXV A;  3E2L A;  4P85 A;  3DTM A;  4DE1 A;  1HTZ A;  2ZQA A;  3IH9 A;  3G2Z A;  5E2E A;  3GTC A;  1SDN A;  3BFF A;  1ESU A;  1WE4 A;  2JC7 A;  3G34 A;  1NJ4 A;  4RVA A;  5DTS A;  3V50 A;  1NRF A;  4E3L A;  3ZGA B;  2QZ6 A;  2EFX A;  1K38 A;  3OCN A;  3FYZ A;  3UPN A;  4E6X A;  3HLD A;  1TDG A;  1HZO A;  1K25 A;  1Q2P A;  2Y59 A;  5HAI A;  1IEL A;  2ZC4 B;  4Y7P A;  2Y2M A;  3BFG A;  4P87 A;  3VP3 A;  2WAE A;  3M2J A;  4WMC A;  4DXB A;  5GHY A;  2C5W B;  1VQQ A;  1YM1 A;  3WS5 A;  1DY6 A;  2X01 A;  1KE3 A;  2WGW A;  4ZJ2 A;  4EBL A;  1KE0 A;  3FZC A;  1L0D A;  4QB8 A;  1YQS A;  2Y2H A;  4RA7 A;  3NDG A;  1ERQ A;  2ZMA A;  2HP9 A;  4OPY A;  3IF6 C;  4L0L A;  4OP8 A;  4BD0 A;  1MBL A;  1I5Q A;  2Y2Q A;  3CZD A;  1K56 A;  5M1A A;  5DTT A;  1PWC A;  1TVF A;  2HDQ A;  4E3I A;  3G31 A;  3IF5 A;  5DF9 A;  3HLW A;  3UE1 A;  3B3X A;  2J8Y A;  4RYE A;  4GKU A;  3AGF A;  4WBG A;  4RX2 A;  4OLG A;  4JF4 A;  4N1H A;  3V3R A;  4OLD A;  2EX8 A;  1ONG A;  2ZC7 A;  3C4O A;  2H0Y A;  4KG6 A;  4S2L A;  1S0W A;  3VSK A;  3OZH A;  5U47 A;  1GA0 A;  3PTE A;  4K0W A;  5EVI C;  4S2I A;  5TGF A;  1HVB A;  1NZO A;  1W7F A;  4Y0O A;  3W4Q A;  1GCE A;  1XP4 A;  2VGK A;  2WAD A;  4OQI A;  4QU3 A;  3S22 A;  5HW3 A;  1DJB A;  2X71 A;  4KZ5 A;  2B5R A;  2WZX A;  4A5R A;  3UPO A;  3IWO A;  1H5X A;  4PM9 A;  3VFF A;  4E6W A;  4LEN A;  4KZ7 A;  3PAG A;  4MBK A;  3MXS A;  3W4O A;  1BUE A;  2XF3 A;  1NYM A;  3S4X A;  5GLA A;  1K54 C;  3EQU A;  3BEB A;  4QJG A;  4C75 A;  2EFU A;  4K0X A;  4IED A;  1SHV A;  3Q7V B;  3Q1F A;  4DKI A;  2GDN A;  4D2O A;  1I2W A;  1PZP A;  2EX6 A;  4KZ6 A;  1LLB A;  2ZD8 A;  4X56 A;  3WRZ A;  1K56 D;  4KG2 A;  1KDS A;  3E2K A;  2HP5 A;  4OVD A;  4WEL A;  4YIN A;  5EVL A;  4UA6 A;  5HAR A;  1JTD A;  2P74 A;  1DJA A;  4Q8I A;  4JF5 A;  4EUZ A;  4HBU A;  4ZTK A;  2JBF A;  2P9V A;  4KEN B;  3IHA A;  1W79 A;  5FA7 A;  4UHU A;  1ES3 A;  4EQI A;  4JPM A;  3ZG8 B;  3W4P A;  2Y2G A;  3ZVT A;  2Y2K A;  5FAP A;  2XD5 A;  2R9W A;  1JWP A;  4IBR A;  4OPQ A;  1MPL A;  3G32 A;  4S2K A;  1KVL A;  4WYY A;  1LI9 A;  1YMS A;  1KGG A;  4N9K A;  4GD8 A;  5GLB A;  2XD1 A;  4UA9 A;  3SH8 A;  2WK0 A;  5KSC A;  4N1X A;  3M6H A;  1W8Q A;  1K6R A;  3LCE A;  4DE2 A;  1FCO A;  2IWD A;  3WS2 A;  4Y0U A;  1KVM A;  2EX2 A;  3ZVW A;  3HLE A;  5GLC A;  4IBX A;  1IYS A;  3MZD A;  2XR0 A;  4OQ0 A;  4JXS A;  5FSR A;  1BLS A;  3HLB A;  4KG5 A;  1PW1 A;  2PU4 A;  3PBO A;  5EVI D;  5F83 A;  5CHM A;  1SCW A;  4DF6 A;  4ZJ3 A;  5AQB A;  1L0G A;  1XA7 A;  2ZJ9 A;  4E3K A;  1JVJ A;  1K6S A;  3Q7V A;  1BTL A;  1U60 A;  1O07 A;  3OPR A;  3CJM A;  3Q7Z A;  4BEN A;  3MFD A;  3CG5 A;  4E3N A;  5EOE A;  4N9L A;  5E2H A;  3NI9 A;  4HEF A;  4PM6 A;  1IKG A;  5CGW A;  4WZ5 A;  2Y2J A;  2IWB A;  1IEM A;  1JTG A;  3ZNT A;  1WYB A;  3A3E A;  4KZ3 A;  1NYY A;  4S2J A;  5J8X A;  1BSG A;  3IWQ A;  3VFH A;  3MZF A;  3A3I A;  5CER A;  5EVI B;  5A90 A;  3D4F A;  2ZM2 A;  4N92 A;  2Y91 A;  4BLM A;  2JCH A;  2XFS A;  4X55 A;  4MEZ A;  5FQ9 A;  1PZO A;  3WWX A;  2H0T A;  4OON A;  3ZHH A;  1CK3 A;  4DDY A;  5KMW A;  2RL3 A;  1ZG6 A;  2Y2N A;  5G18 A;  3WS1 A;  2WZZ A;  3FKW A;  2Q9N A;  3G2Y A;  4WZ4 A;  4XUZ A;  1FOF A;  4OOM A;  2PBY A;  4B4X A;  3HLG A;  3TSG A;  4OH0 A;  4PM5 A;  2R9X A;  3GVB A;  3RXX A;  4FCF A;  5CRF A;  2ZM8 A;  3IT9 A;  4LCM A;  1YT4 A;  2A49 A;  5CGX A;  5A91 A;  4JXW A;  2Z2M B;  3NBL A;  2J9P A;  5FQM A;  1KDW A;  3IXD A;  4O7D A;  3OCL A;  4OQG A;  3SH9 A;  5HL1 A;  3IXH A;  4FH2 A;  2BG1 A;  3A3F A;  4KQO A;  5TR7 A;  1L2S A;  5DF7 A;  4DE3 A;  2VGJ A;  2PU2 A;  1MKI A;  2HPB A;  2V2F F;  3UPP A;  2BLS A;  3ITB A;  3N8L A;  4P0M A;  3ZG0 A;  1JWZ A;  1LL5 A;  5F82 A;  5A92 A;  3VP0 A;  3Q82 A;  3PBS A;  3O3V A;  1K4F A;  1ZG4 A;  3OPH A;  1M40 A;  2HP6 A;  3IH8 A;  3Q07 A;  3TOI A;  2Y4A A;  3GR2 A;  3QHY A;  4B4Z A;  5FQJ A;  3QNC A;  4OOY A;  4PMA A;  3UE0 A;  3C7V A;  1H8Z A;  1LI0 A;  4KZ9 A;  1RGZ A;  3GSG A;  5EVI A;  5TFQ A;  4C6Y A;  3GMW A;  4JXG A;  4BL2 A;  1IYP A;  2C6W B;  1XPB A;  5DVA A;  4X6T A;  5D3O A;  4WEK A;  2QPN A;  5BOH A;  3BLM A;  2JE5 A;  2IWC A;  4S2M A;  1M6K A;  1XGI A;  4BJP A;  4OKP A;  3V39 A;  4E3M A;  2EXB A;  5GHZ A;  2G2W A;  2V1Z A;  3TG9 A;  1K57 C;  4BD1 A;  4S2N A;  3IXG A;  3N6I A;  4M3K A;  3W8K A;  5AQ9 A;  4RX3 A;  1JWV A;  4R23 A;  1MWR A;  3RJU A;  4EBN A;  1E3U A;  4E3J A;  3PBQ A;  3VOY A;  1K4E A;  4GDN A;  1G68 A;  3DWK A;  2CC1 A;  4DRT A;  4OQH A;  1BLH A;  3N8S A;  4X53 A;  3A3J A;  1NZU A;  1OME A;  3IHB A;  4GN2 A;  2RCX A;  2J7V A;  5CHJ A;  1FR6 A;  3HUM A;  2X02 A;  3MKE A;  4QY5 A;  1TEM A;  1E4D A;  3WS4 A;  1WYC A;  5FQQ A;  1ES4 A;  3V5M A;  1XGJ A;  1SKF A;  1YLT A;  2XK1 A;  3SS5 A;  1IYO A;  4GNU A;  3DW0 A;  5EEC A;  2ZM0 A;  2WKI A;  5CXW A;  2Y55 A;  3PBN A;  3PBR A;  2XGN A;  2Y2L A;  4UA7 A;  1K57 A;  4ZAM A;  5FQK A;  4F94 A;  2ZQ8 A;  4ZBE A;  2WGW B;  2V20 A;  3VMA A;  4GB7 A;  2FFF B;  1VM1 A;  1MWT A;  1YLP A;  4U3T A;  1HD8 A;  2A3U A;  4GOG A;  2HDR A;  1S6R A;  5CGS A;  5A93 A;  2EX9 A;  2I72 A;  3ZFZ A;  2J9O A;  2ZC6 B;  1K54 A;  3GV9 A;  2HDU A;  3Q81 A;  2ZC3 B;  3NIA A;  4IVK A;  3HLF A;  5EOO A;  2WKH A;  5FI7 A;  1CEG A;  5FAO A;  1MY8 A;  3HVF A;  3N7W A;  3UE3 A;  3C5A A;  4PPR A;  4X69 A;  3NCK A;  1K55 A;  1XX2 A;  3HUO A;  3O88 A;  1FSW A;  3VOZ A;  1ESI A;  4GD6 A;  4BL3 A;  1E3U D;  1GHM A;  1QMF A;  3P09 A;  5FI6 A;  5FAS A;  1EI5 A;  1XKZ A;  4GZB A;  3RXW A;  3VP4 A;  3MZE A;  4NET A;  4KZ4 A;  3PBT A;  3AGE A;  1L0F A;  2XDM A;  1CI9 A;  3O87 A;  1TDL A;  2ZQ9 A;  1FSY A;  3HRE A;  3G4P A;  3IF6 A;  3I7J A;  3IQA A;  1XA1 A;  4MLL A;  4S2N C; 
#chains in the Genus database with same CATH topology
 3DWZ A;  1BLP A;  4MNR A;  3FKV A;  1N9L A;  1PW8 A;  4O01 A;  5DKL A;  3T4K A;  3P98 A;  3KYE A;  1STZ A;  2G2U A;  2EXA A;  2ZL1 B;  5CTN A;  1RCJ A;  2DRW A;  2ZBB A;  2H10 A;  1ACF A;  3BFE A;  4LRZ E;  4LV2 A;  1G6A A;  4Z9Q A;  4JLF A;  4U0T A;  5FDS A;  3EWK A;  4CPK A;  1QME A;  4IVI A;  2M7V A;  4KQR A;  1P9W A;  4KUK A;  1KGF A;  2JKG A;  1IYQ A;  3NUL A;  4GLQ A;  5HL6 A;  1EWZ A;  3MR0 A;  1PYY A;  3BLS A;  1FCN A;  5M18 A;  2OLU A;  5IT5 A;  4NXE A;  2XSS A;  3GRJ A;  1H8Y A;  1OJ5 A;  1BT5 A;  3UMD A;  1TF1 A;  3G35 A;  4PM8 A;  1PNE A;  1NXY A;  5HD3 A;  2OLV A;  1D1J A;  3BM6 A;  3JYI A;  1Q2Q A;  5EVE A;  2ZLY A;  3LEZ A;  1PI5 A;  2PRF A;  1PWG A;  2P7J A;  2GZA A;  5CEC A;  3LIA A;  1AXB A;  4ZDX A;  3ZCZ A;  1XFQ A;  3AGD A;  4LV0 A;  4CLC A;  2Y2O A;  1GHP A;  1GSV A;  1BZA A;  2OOL A;  2Z2L B;  4WM9 A;  1S1Y A;  4KZB A;  3DBA A;  4YNR A;  5HZH A;  5DFX A;  1T1C A;  5HWW A;  2OSU A;  3UDF A;  2K7S A;  5IS1 A;  5CTM A;  4BWI A;  3E4P A;  5CEB A;  1YLJ A;  5KSH A;  3L9K A;  3NOU C;  1LSW A;  1T18 A;  3IF6 B;  1G5U A;  1YLW A;  4R38 A;  3LR5 A;  2O9B A;  1YMX A;  2HDS A;  3EEA A;  3UDI A;  4X1L A;  3E0Y A;  2FFY A;  4U0X A;  3C8C A;  4GCZ A;  4MBF A;  3V3S A;  2PHY A;  4DE0 A;  4OPR A;  4LRX C;  3ISG A;  3NC8 A;  4JGO A;  2XRO A;  3BEC A;  5MC7 A;  3A3D A;  4XXR A;  3A0V A;  2ZC5 B;  4FD8 A;  4JBF A;  4BBV A;  3LR3 A;  4R3A A;  1AWI A;  5E2E A;  2JC7 A;  3IS2 A;  3NHQ A;  1NJ4 A;  3V50 A;  2JKT I;  2BTF P;  2QZ6 A;  2EFX A;  4G3K A;  5F5Y A;  1K38 A;  3OCN A;  4E6X A;  3HLD A;  4GJ4 A;  1HZO A;  1K25 A;  1DRM A;  5HAI A;  5L8M A;  1ODV A;  4IHQ A;  3E4O A;  4ARZ B;  2WAE A;  1Y28 A;  2C5W B;  3QP5 A;  4KQD A;  3EGD C;  1YM1 A;  1DY6 A;  2Y79 A;  4RA7 A;  5C5K A;  3LUQ A;  4OP8 A;  4GW9 A;  4P6Z M;  4P6Z S;  3LID A;  2VLG A;  4N1H A;  4OLD A;  2D02 A;  4KG6 A;  1S0W A;  3VSK A;  1GA0 A;  2XA7 S;  1W7F A;  1NLZ A;  3RH8 B;  3S22 A;  3IWO A;  1H5X A;  3VFF A;  4LEN A;  1G6O A;  4KZ7 A;  4MBK A;  3MXS A;  2XF3 A;  5GLA A;  3B47 A;  3MXQ A;  4X56 A;  1S67 L;  1KDS A;  3T1Q B;  4OVD A;  3T1S A;  4YIN A;  3QP6 A;  4PHT A;  1DJA A;  4EUZ A;  2JBF A;  3F1O A;  4UHU A;  4EQI A;  2W3D A;  2ZMF A;  3H7W A;  5FAP A;  2Y2K A;  2GJ3 A;  4ME4 A;  1JWP A;  4IBR A;  4S2K A;  4WYY A;  1KGG A;  3TJZ C;  5GLB A;  2XD1 A;  5KSC A;  4KUO A;  3WS2 A;  1KVM A;  5F69 A;  3ZVW A;  5AVE A;  3HLE A;  2KX6 A;  2XR0 A;  5FSR A;  1TS8 A;  5EVI D;  1VET A;  5AQB A;  2ZJ9 A;  2ZOI A;  3Q7V A;  3DAV A;  1U60 A;  3OPR A;  1GSW A;  3NOT C;  1OTE A;  3CJM A;  3Q7Z A;  4BEN A;  3MFD A;  3CG5 A;  5E2H A;  3C38 A;  4YWZ A;  5CGW A;  3CUE C;  1WA9 A;  2QJ5 A;  1S4R A;  2DMW A;  1BSG A;  4G3W A;  3D4F A;  2Y91 A;  4I3I A;  4X55 A;  4MEZ A;  1PZO A;  3ZHH A;  1CK3 A;  3NEC A;  5G18 A;  2WZZ A;  4LGW A;  4X1M A;  4FCF A;  2PYP A;  1OTI A;  4JXW A;  4NXF A;  4LRY C;  1KDW A;  4O7D A;  2VV7 A;  2J3W A;  3OCL A;  4OQG A;  1V9Z A;  3IXH A;  4FH2 A;  2BLS A;  4P0M A;  3ZG0 A;  3BQ8 A;  3H82 B;  3O3V A;  4HP9 A;  2OAQ 1;  3JVU A;  5L09 A;  4KZ9 A;  4I38 A;  1OPX A;  4C6Y A;  4BL2 A;  2C6W B;  4X6T A;  5BOH A;  2JE5 A;  4S2M A;  3HCY A;  4BJP A;  5GHZ A;  2O99 A;  2V1Z A;  3W8K A;  4RX3 A;  2I9V A;  4R23 A;  4JGP A;  2YKF A;  5DJU A;  4GN2 A;  3IHB A;  2RCX A;  2EA9 A;  1GSX A;  3ULF A;  3HUM A;  1ES4 A;  3DTK A;  4WN5 A;  1LT0 A;  4GNU A;  2ZM0 A;  3BW6 A;  5CXW A;  3PBR A;  2XGN A;  2W1T B;  3T12 B;  2WGW B;  3F1N B;  1VM1 A;  4U3T A;  4CLC B;  2HDR A;  5A93 A;  2I72 A;  3ZFZ A;  5TJJ A;  2K2N A;  3GV9 A;  3NIA A;  1MY8 A;  3HVF A;  3UE3 A;  4PPR A;  3NCK A;  3DTI A;  1K0K A;  3VOZ A;  2JHE A;  1ESI A;  1Z09 A;  1GHM A;  5FI6 A;  2EWV A;  1XKZ A;  3RXW A;  3VP4 A;  3AGE A;  1T19 A;  3IX3 A;  3FG8 A;  1CI9 A;  1FSY A;  4Q0J A;  4KZ8 A;  2WGV A;  4JKT A;  1PIO A;  3BRM A;  4MN5 A;  3UDX A;  2H28 A;  3UNW A;  2VK3 A;  4JF6 A;  1H0M A;  3VE3 A;  1PWD A;  4OPZ A;  4NK3 A;  1K55 C;  4HQA A;  2XH9 A;  5I94 A;  3MXR A;  2PAV P;  4R4R A;  4R70 A;  4II7 A;  3CAX A;  1MZU A;  4LLO B;  1BLC A;  3KYQ A;  2OAP 1;  3WRT A;  4G3V A;  3P7N A;  2Y2I A;  3N8R A;  3IXB A;  1W5D A;  4E04 A;  3UB6 A;  5F68 A;  2W27 A;  4FH4 A;  4HIA A;  3OPL A;  1G28 A;  3BY8 A;  4OOL A;  3VP1 A;  3R7W B;  3C30 A;  3QP4 A;  5JYO A;  1FQG A;  4BQM A;  5GHX A;  4B88 A;  4EW7 A;  4QWO A;  1F9I A;  2ZQ7 A;  4PKY A;  5E43 A;  5AQA A;  4LCL A;  5GL9 A;  3C4P A;  2V0W A;  3ZDJ A;  4GDB A;  1F98 A;  4WL9 A;  1HLU P;  2WAF A;  5HSQ A;  2Y2P A;  4UEY A;  3KX0 X;  1F5M A;  1CI8 A;  2OV5 A;  5AJG A;  4K91 A;  4H6J A;  5FDH A;  1RP5 A;  2QMI A;  5E2G A;  3MKF A;  3BYD A;  4ID4 A;  3ZG9 B;  2DCF A;  4FSF A;  5EUA A;  2JKR I;  3V67 A;  2HF6 A;  1IKI A;  1N9B A;  5L2F A;  1ZC2 A;  4R3J A;  2VV8 A;  3PHY A;  4WMC D;  5HWV A;  4IUH A;  2J3T C;  2V0U A;  3LY4 A;  2E8I A;  4NXB A;  1L0E A;  5AVF A;  3HJI A;  4L9G A;  5HD5 A;  3H9W A;  3NY4 A;  3O5Y A;  3S7Q A;  3KSF A;  3DTM A;  2ZQA A;  4HH3 A;  3BFF A;  1WE4 A;  3G34 A;  2W1T A;  5EM1 A;  1OTD A;  3B33 A;  4HHD A;  1UWN X;  3FYZ A;  1TDG A;  4XT2 B;  1Q2P A;  4NG2 A;  1IEL A;  2ZC4 B;  4Y7P A;  2Y2M A;  4DXB A;  3RTY A;  3WS5 A;  1KE3 A;  4ZJ2 A;  5L10 A;  1CJF A;  3LIC A;  2ZMA A;  2HP9 A;  4OPY A;  3W2Z A;  3DTE A;  1MBL A;  1I5Q A;  3CZD A;  4BD0 A;  3T4S A;  3G31 A;  3H7W B;  4LPZ A;  3T4T A;  3B3X A;  4RYE A;  4GKU A;  3AGF A;  4RX2 A;  3KO6 A;  4JF4 A;  3V3R A;  2P04 A;  1ONG A;  2KDK A;  2H0Y A;  1F2K A;  4NEE D;  5EVI C;  4S2I A;  2D01 A;  3FPW A;  1TS7 A;  3CLO A;  3W4Q A;  2VX8 A;  4OQI A;  1DJB A;  4KZ5 A;  4A5R A;  1XJ4 A;  2W3F A;  1NYM A;  3MFX A;  5J4E A;  3EQU A;  3MQ0 A;  4C75 A;  2EFU A;  1UWP X;  2QKP A;  3Q1F A;  2Y8H A;  2GDN A;  5DFY A;  4D2O A;  4DKI A;  4KZ6 A;  2VV6 A;  4WEL A;  4UA6 A;  2B95 A;  2P74 A;  3MJQ A;  2P9V A;  3IHA A;  5FA7 A;  3W4P A;  2Y2G A;  3ZVT A;  2XD5 A;  2PYR A;  3EGX C;  1MPL A;  1DP8 A;  4UA9 A;  3SH8 A;  1W63 M;  3M6H A;  3LI9 A;  4Y0U A;  2V8C A;  2MJ6 A;  5GLC A;  2V8F A;  4JXS A;  2OWH A;  3HLB A;  4R6L A;  4KG5 A;  1PW1 A;  2PU4 A;  1SCW A;  4ARZ A;  4E3K A;  1JVJ A;  1K6S A;  3FC7 A;  1UGU A;  1YKD A;  5EOE A;  3NI9 A;  2W3G A;  2IWB A;  1JTG A;  3IS2 B;  4KZ3 A;  3ZNT A;  1NYY A;  1W63 Q;  3MZF A;  5CER A;  4BLM A;  2K31 A;  4DJ3 A;  4DDY A;  1FIK A;  2E8J A;  5KMW A;  3F1O B;  3G2Y A;  4WZ4 A;  1FOF A;  4OOM A;  1YSQ A;  3HLG A;  4Q0I A;  2R9X A;  3IT9 A;  4O0P A;  2YKH A;  5FQM A;  4HJ3 A;  3CHW P;  4MN7 A;  3RFB A;  2BG1 A;  3A3F A;  5DF7 A;  1YPR A;  2PU2 A;  2VGJ A;  2V2F F;  3UPP A;  3PYP A;  1LL5 A;  5HDS A;  5K5B A;  1ZG4 A;  3OPH A;  2HP6 A;  3IH8 A;  2Q0O A;  4OOY A;  4FTX A;  3UE0 A;  1H8Z A;  3GSG A;  1IYP A;  4Y15 A;  5D3O A;  4WEK A;  3BLM A;  2IWC A;  3C2W A;  3V39 A;  3IBJ A;  3TG9 A;  4GDN A;  4B93 A;  1CF0 A;  2A24 A;  5FL3 A;  4WUJ A;  3A3J A;  1OME A;  3LYX A;  1YSP A;  1TEM A;  1E4D A;  1WYC A;  1JNU A;  1CQA A;  1SKF A;  1OTA A;  3MS6 A;  4HNB A;  3T4J A;  2WKI A;  2Y55 A;  3F1P A;  3P01 A;  2ZQ8 A;  4ZBE A;  4Z1W A;  3UB7 A;  2V9A A;  4HY8 A;  2J9O A;  4EER A;  1K54 A;  3Q81 A;  3HLF A;  5FAO A;  3N7W A;  3C5A A;  2JKT M;  5EFW A;  1FSW A;  3IX4 A;  3MZE A;  4NET A;  2HV1 A;  2BAS A;  1L0F A;  3U2A A;  1X0O A;  3HRE A;  3IQA A;  4KG2 A;  4L9E A;  1XA1 A;  4MLL A;  1MWS A;  4BMW A;  4KQQ A;  4KZA A;  5HPI A;  1OJG A;  3HLC A;  1E25 A;  1YLY A;  1DP9 A;  4R1G A;  3VE4 A;  4XUX A;  3VV4 A;  5AQ7 A;  4DXC A;  2WKE A;  2KLI A;  4DDS A;  4X25 A;  4XT2 A;  1V9Y A;  3T1X A;  1ZHH B;  3OC2 A;  4MBH A;  3HBR A;  1GHI A;  2ZQC A;  1D06 A;  3OBF A;  4OP5 A;  2JN7 A;  2HJE A;  4X68 A;  1FR1 A;  4WZ5 C;  3PXP A;  3ICY A;  2GX5 A;  4EES A;  2WGI A;  5FQI A;  3VSL A;  3ZYT A;  2XQZ A;  4F3L A;  1XXM A;  5DF8 A;  4H8R A;  3LR4 A;  1OT6 A;  4LV1 A;  3SOI A;  2L0W A;  4QHC A;  2J3T D;  1Z6F A;  3HUN A;  1ES5 A;  2VKS A;  3BFD A;  5IHV A;  3VOL A;  4HP4 A;  3LO7 A;  3QNB A;  5HFO A;  4WEJ A;  2QWS A;  1SZV A;  4P6B A;  1CEF A;  1DJC A;  5FAQ A;  2O0Y A;  2INW A;  4ZRR A;  1PFL A;  3KYZ A;  4WF0 A;  4PKY G;  4CLC E;  1SDE A;  3ZG7 B;  3PAE A;  3UY6 A;  4E3O A;  3L7H A;  3WS0 A;  5CED A;  1TS6 A;  4S2P A;  1FIL A;  4S2O A;  5HAP A;  3EQV A;  4UQI M;  1ZKJ A;  2LB5 A;  5DTK A;  3MBZ A;  4WLA A;  3CWF A;  1N4O A;  3S1Y A;  3M2K A;  3G6O A;  2JKF A;  3SS3 A;  2R78 A;  4L9F A;  5KZH A;  3O86 A;  2P9V B;  4YFM A;  1SKO B;  1ERO A;  4CJN A;  3C7U A;  3GQZ A;  2UWX A;  2L4R A;  4P85 A;  4DE1 A;  1Y4O A;  1HTZ A;  3F1P B;  2FH5 A;  3G2Z A;  1SDN A;  4HJ6 A;  3T1R A;  1ESU A;  2VGL S;  1NRF A;  4E3L A;  4O8G A;  3ZGA B;  3UPN A;  4JGR A;  3FPV A;  4GS9 A;  4P87 A;  4WMC A;  5GHY A;  5J7E A;  2LB9 A;  1L0D A;  2W3H A;  3NDG A;  3MQO A;  1ERQ A;  4L0L A;  1K56 A;  5DTT A;  1PWC A;  2OWJ A;  2HDQ A;  3LIF A;  5DF9 A;  3UE1 A;  4WBG A;  4OLG A;  5TBM B;  2O9A A;  2ZC7 A;  2QHK A;  4S2L A;  1LL8 A;  2NUT C;  3OZH A;  1VB6 A;  4K0W A;  5L07 A;  1NZO A;  4IUK A;  4Y0O A;  3HJK A;  2VGK A;  4QU3 A;  2NUP C;  3F1N A;  5HW3 A;  1TD5 A;  2WZX A;  3UPO A;  4PM9 A;  4E6W A;  1LSX A;  3PAG A;  3W4O A;  1XJ6 A;  4QPR A;  1IFQ A;  3S4X A;  1K54 C;  3BEB A;  4NXG A;  3NOP C;  3Q7V B;  5CX7 A;  4I5S A;  3WRZ A;  1K56 D;  3E2K A;  2HP5 A;  5HAR A;  4Q8I A;  4HBU A;  4KEN B;  1W79 A;  2VZW A;  3ZG8 B;  3GEC A;  2R9W A;  1KVL A;  5J3W A;  2WK0 A;  1XJ2 A;  5FEG A;  1W8Q A;  1K6R A;  3LCE A;  1FCO A;  1IYS A;  3MZD A;  4GHI B;  1XA7 A;  1S4S A;  2L1M A;  3JVV A;  1BTL A;  2KOI A;  3H82 A;  1OT9 A;  4E3N A;  2B02 A;  4PM6 A;  1P0Z A;  4WZ5 A;  1NRJ A;  1WYB A;  3A3E A;  4S2J A;  3A3I A;  5EVI B;  3R4K A;  5A90 A;  1BYW A;  3UB8 A;  5FQ9 A;  2XFS A;  2H0T A;  4OON A;  3IBR A;  4K08 A;  1ZG6 A;  3D3O A;  2Y2N A;  2ZMV A;  4XUZ A;  3K3D A;  2PBY A;  3BWL A;  3TSG A;  4OH0 A;  1SKO A;  3GVB A;  2UV0 E;  4LFU A;  1YT4 A;  3E4Q A;  2VJW A;  3KSH A;  3T4Q A;  5TR7 A;  4EUV A;  1MKI A;  3N8L A;  3QP2 A;  5A92 A;  3VP0 A;  3EEH A;  1YAX A;  3Q07 A;  2Y4A A;  4I3J A;  3LGO A;  1S66 L;  3QHY A;  4B4Z A;  3QNC A;  4PMA A;  1S1Z A;  3C7V A;  5G4Z A;  4D60 A;  5EVI A;  5TFQ A;  4MN6 A;  4JXG A;  5DVA A;  1XPB A;  2QPN A;  3ZQ5 A;  1M6K A;  1XGI A;  4FUW A;  4OKP A;  2W3E A;  2EXB A;  1D7E A;  2G2W A;  4BD1 A;  1K57 C;  4S2N A;  4M3K A;  5AQ9 A;  1MWR A;  3RJU A;  4E3J A;  3PBQ A;  1G68 A;  3UB9 A;  2CC1 A;  4RQ9 A;  2XA7 M;  3EOI A;  1H3Q A;  4OQH A;  4X53 A;  4DN0 A;  2J7V A;  4BBU A;  2X02 A;  3MKE A;  3WS4 A;  1XGJ A;  1YLT A;  2XK1 A;  3SS5 A;  3MMH A;  1IYO A;  4EEP A;  3UE6 A;  3DW0 A;  4Y2F A;  5EEC A;  3PBN A;  2Y2L A;  4ZAM A;  3VMA A;  2FFF B;  1YLP A;  3A0R A;  5CGS A;  2A24 B;  2EX9 A;  2PD7 A;  2ZC6 B;  3BQA A;  2HGV A;  4IVK A;  1ZTU A;  1A0K A;  1T1B A;  1K55 A;  4B9O A;  3LIE A;  1P9R A;  3UME A;  4GD6 A;  1E3U D;  1QMF A;  3P09 A;  4HOI A;  1EI5 A;  4EU0 A;  4GZB A;  2PBD P;  5HDD A;  3O87 A;  3I7J A;  3CPT B;  4CLC C;  1ES2 A;  5HX9 A;  3SH7 A;  5F1G A;  5F1F A;  4EWF A;  3TRC A;  3LEQ A;  4QD4 A;  1ONH A;  5TBM A;  3LR0 A;  1PI4 A;  4R3B A;  4C3Q A;  1ERM A;  3N4I A;  1NY0 A;  3UO9 A;  4Y0T A;  5HPF A;  3VP2 A;  5EE8 A;  1LHY A;  4R4S A;  1Y54 A;  2ZQD A;  5CHU A;  5HAQ A;  4BBT A;  3FV7 A;  3MF0 A;  3M6B A;  1W8Y A;  4Q0H A;  4HBT A;  5FI2 A;  5A8B A;  4EBP A;  3ZG5 A;  5FAT A;  3D72 A;  5JYP A;  3SW1 A;  4HES A;  2XLN A;  1C3B A;  1XJ3 A;  3NDE A;  1YLZ A;  1KGE A;  1DP6 A;  2WKQ A;  3IWI A;  1BUL A;  3OPP A;  1MWU A;  1GA9 A;  5EPH A;  3SS4 A;  3NJA A;  1RGY A;  4ZJ1 A;  5M19 A;  3LY3 A;  3BFC A;  4PM7 A;  3ZNY A;  1FCM A;  2Q9M A;  4QY6 A;  2XEP A;  5E2F A;  1I2S A;  5I5L A;  1J9M A;  3CI6 A;  3S7O A;  2PD8 A;  4MDZ A;  2HJ9 C;  3U4L P;  2WUQ A;  4R0Q A;  2H5S A;  3T4L A;  1O7E A;  4AFI A;  2DNS A;  1PRQ A;  2QYB A;  3UN7 A;  3G30 A;  2XFT A;  4LV3 A;  1LL9 A;  2WYX A;  2JKR M;  3KSG A;  3CPT A;  3ITA A;  1MKM A;  3K2N A;  3FWL A;  4MMN A;  4EV4 A;  2GNX A;  5GLD A;  1ALQ A;  1EW0 A;  2XRN A;  2J80 A;  3E98 A;  1VEU A;  1MXO A;  3BY9 A;  3HL9 A;  1KE4 A;  3CMZ A;  4I3A A;  4CLC D;  2A2L A;  4UAA A;  1NLY A;  4JXV A;  3E2L A;  4ETX A;  3IH9 A;  3B42 A;  3GTC A;  4RVA A;  1L3L A;  5DTS A;  3JPU A;  2O9C A;  5LBR A;  2Y59 A;  1OTB A;  3BFG A;  3VP3 A;  3M2J A;  2ZL1 A;  2P08 A;  4UQI S;  1KOU A;  1VQQ A;  2X01 A;  2WGW A;  3KSI A;  4EBL A;  1KE0 A;  3FZC A;  1TS0 A;  2M1C A;  4QB8 A;  1YQS A;  2Y2H A;  3IF6 C;  3MSH A;  4ESP A;  2PDR A;  2Y2Q A;  4EXO A;  5M1A A;  1TVF A;  4E3I A;  2Z6C A;  1IOU A;  3IF5 A;  3HLW A;  1H8M A;  2J8Y A;  3QP1 A;  5HWT A;  2EX8 A;  3C4O A;  3D9Y A;  5U47 A;  3PTE A;  5TGF A;  1HVB A;  1GCE A;  1XP4 A;  2WAD A;  3T4O A;  1NWZ A;  2X71 A;  4EQ1 A;  2B5R A;  4Y13 A;  1BUE A;  5G4Y A;  3OOV A;  3QP8 A;  4QJG A;  4K0X A;  4IED A;  1SHV A;  1I2W A;  1PZP A;  2EX6 A;  5DJT A;  1LLB A;  2ZD8 A;  3PR6 A;  5EVL A;  1JTD A;  4GHI A;  4JF5 A;  2M7U A;  4ZTK A;  5IU1 A;  3IX8 A;  1ES3 A;  3K3C A;  4JPM A;  3CUE A;  1LSV A;  4OPQ A;  3G32 A;  1LI9 A;  1YMS A;  4N9K A;  4CQH A;  4GD8 A;  2FZ0 A;  1N9O A;  4N1X A;  4DE2 A;  2IWD A;  2EX2 A;  5EM0 A;  2VEA A;  4IBX A;  3TW8 A;  4OQ0 A;  1BLS A;  1XFN A;  5DKK A;  5F83 A;  3PBO A;  5CHM A;  4DF6 A;  3LFV A;  4PAU A;  4ZJ3 A;  1L0G A;  2AVX A;  1O07 A;  4N9L A;  4HEF A;  1IKG A;  2Y2J A;  3LIB A;  1IEM A;  5J8X A;  3IWQ A;  2IA2 A;  3VFH A;  2VA0 A;  2ZM2 A;  4N92 A;  4MCW A;  2JCH A;  2PR5 A;  3WWX A;  4NKP A;  1VET B;  2RL3 A;  4IJG A;  3WS1 A;  3FKW A;  2Q9N A;  2Z6D A;  3GDI A;  4ETZ A;  4B4X A;  4PM5 A;  3MQQ A;  3RXX A;  1MC0 A;  4HJ4 A;  5CRF A;  2ZM8 A;  4LCM A;  2A49 A;  5CGX A;  5A91 A;  2Z2M B;  3NBL A;  2J9P A;  3IXD A;  3SH9 A;  5HL1 A;  4EET B;  4KQO A;  4M4X A;  1L2S A;  4DE3 A;  5FEF A;  2HPB A;  3ITB A;  1JWZ A;  5F82 A;  4Y3I A;  3Q82 A;  3PBS A;  1K4F A;  1M40 A;  3TOI A;  2EWW A;  3GR2 A;  5FQJ A;  1LI0 A;  1RGZ A;  2B18 A;  4HI4 A;  2G7U A;  1VEU B;  3GMW A;  4H6J B;  4GS9 B;  3A0S A;  1J3W A;  2V1A A;  5EV0 A;  4E3M A;  2W1R A;  3TE8 A;  3IXG A;  3N6I A;  4I39 A;  1JWV A;  4EBN A;  4F3L B;  1E3U A;  3VOY A;  1K4E A;  2WKR A;  2ZOH A;  3S7N A;  3DWK A;  5HDC A;  4DRT A;  1VHM A;  3UB5 P;  1BLH A;  3N8S A;  1NZU A;  5CHJ A;  1N9N A;  1FR6 A;  5KIZ A;  4QY5 A;  2CMN A;  4YOF A;  4DJ2 A;  2PR6 A;  5FQQ A;  3V5M A;  3OLO A;  1T1A A;  3BJN A;  3R7W A;  3S7P A;  4FOF A;  4UA7 A;  2PT7 A;  1K57 A;  5FQK A;  4F94 A;  3LI8 A;  2HZ5 A;  2V20 A;  4GB7 A;  1MWT A;  1HD8 A;  2A3U A;  4GOG A;  1S6R A;  2W0N A;  3CIT A;  4JGQ A;  4Y5F A;  3T50 A;  2HDU A;  2ZC3 B;  5EOO A;  2WKH A;  5FI7 A;  1CEG A;  4X69 A;  2V1B A;  2QJ7 A;  1XX2 A;  3HUO A;  3O88 A;  2ACG A;  4BL3 A;  2VGL M;  5FAS A;  3SZT A;  4KZ4 A;  4DMZ A;  3PBT A;  2XDM A;  2WKP A;  1TDL A;  2ZQ9 A;  1P97 A;  3G4P A;  3IF6 A;  4Y17 A;  4HH2 A;  4EEU A;  5F6A A;  4S2N C; 
#chains in the Genus database with same CATH homology
 4KZ8 A;  1MWS A;  1BLP A;  3DWZ A;  4KQQ A;  3FKV A;  1ES2 A;  4MNR A;  5HX9 A;  3SH7 A;  5F1G A;  4KZA A;  1PW8 A;  5F1F A;  4EWF A;  2WGV A;  4JKT A;  3HLC A;  4QD4 A;  3P98 A;  1PIO A;  1ONH A;  1E25 A;  1YLY A;  3BRM A;  2G2U A;  2EXA A;  5CTN A;  3UDX A;  1PI4 A;  4R3B A;  4R1G A;  1RCJ A;  2DRW A;  4XUX A;  3UNW A;  5AQ7 A;  4JF6 A;  2H10 A;  4C3Q A;  1ERM A;  1PWD A;  2WKE A;  3BFE A;  4NK3 A;  1K55 C;  4OPZ A;  3N4I A;  4DXC A;  4LV2 A;  4DDS A;  1G6A A;  4Z9Q A;  1NY0 A;  4JLF A;  4U0T A;  3UO9 A;  4Y0T A;  3VP2 A;  4CPK A;  5EE8 A;  2XH9 A;  1QME A;  3OC2 A;  4IVI A;  5I94 A;  3MXR A;  4KQR A;  1LHY A;  4MBH A;  3HBR A;  4R4R A;  1GHI A;  2ZQC A;  4R4S A;  1Y54 A;  2ZQD A;  5CHU A;  5HAQ A;  4OP5 A;  3FV7 A;  4X68 A;  1KGF A;  1FR1 A;  4WZ5 C;  3M6B A;  1W8Y A;  1BLC A;  4HBT A;  5FI2 A;  1IYQ A;  3WRT A;  4EBP A;  1EWZ A;  5FAT A;  3ZG5 A;  1PYY A;  3BLS A;  2WGI A;  5FQI A;  1FCN A;  5JYP A;  5M18 A;  3VSL A;  4HES A;  2OLU A;  2XQZ A;  2Y2I A;  2XLN A;  3N8R A;  1XXM A;  5DF8 A;  3IXB A;  4H8R A;  1W5D A;  4LV1 A;  3GRJ A;  1H8Y A;  1BT5 A;  3SOI A;  3G35 A;  4QHC A;  4FH4 A;  1C3B A;  3NDE A;  4PM8 A;  1Z6F A;  3HUN A;  1ES5 A;  3OPL A;  1YLZ A;  1NXY A;  1KGE A;  3BFD A;  4OOL A;  3VP1 A;  5IHV A;  2OLV A;  1BUL A;  3IWI A;  3OPP A;  3BM6 A;  1MWU A;  3JYI A;  1Q2Q A;  1GA9 A;  5JYO A;  1FQG A;  5EPH A;  3LO7 A;  2ZLY A;  3SS4 A;  4BQM A;  1RGY A;  3QNB A;  5GHX A;  4B88 A;  3LEZ A;  5HFO A;  4ZJ1 A;  4WEJ A;  1PI5 A;  5M19 A;  1PWG A;  4P6B A;  1CEF A;  3LY3 A;  1DJC A;  3BFC A;  4PM7 A;  3ZNY A;  5CEC A;  2ZQ7 A;  1FCM A;  2Q9M A;  4QY6 A;  5E43 A;  1AXB A;  4LCL A;  5AQA A;  2XEP A;  5GL9 A;  4ZDX A;  3C4P A;  5FAQ A;  3ZCZ A;  3AGD A;  4LV0 A;  5E2F A;  1I2S A;  3ZDJ A;  2Y2O A;  1J9M A;  1GHP A;  4GDB A;  1BZA A;  2Z2L B;  1SDE A;  4WM9 A;  4KZB A;  3ZG7 B;  3PAE A;  2WUQ A;  4R0Q A;  3UY6 A;  2H5S A;  2OSU A;  2WAF A;  1O7E A;  2Y2P A;  3UDF A;  2DNS A;  4E3O A;  3UN7 A;  3G30 A;  5CTM A;  1CI8 A;  2XFT A;  4LV3 A;  2OV5 A;  3WS0 A;  5CED A;  4K91 A;  1LL9 A;  4S2P A;  5FDH A;  1RP5 A;  4S2O A;  5HAP A;  3EQV A;  2QMI A;  2WYX A;  5E2G A;  5CEB A;  1ZKJ A;  3MKF A;  1YLJ A;  3BYD A;  4ID4 A;  5KSH A;  3ZG9 B;  2DCF A;  3IF6 B;  4FSF A;  5EUA A;  1YLW A;  5DTK A;  3ITA A;  1YMX A;  3MBZ A;  2HDS A;  1IKI A;  1N9B A;  3UDI A;  3FWL A;  5L2F A;  4EV4 A;  2FFY A;  1ZC2 A;  4U0X A;  4R3J A;  5GLD A;  4WMC D;  4MBF A;  3V3S A;  3LY4 A;  1N4O A;  4DE0 A;  1ALQ A;  4OPR A;  2E8I A;  3S1Y A;  3ISG A;  3NC8 A;  3M2K A;  1MXO A;  3BEC A;  1L0E A;  3HL9 A;  3A3D A;  1KE4 A;  3CMZ A;  3SS3 A;  4XXR A;  3NY4 A;  3O86 A;  2P9V B;  2ZC5 B;  5KZH A;  4UAA A;  4YFM A;  4FD8 A;  1ERO A;  4CJN A;  3C7U A;  3GQZ A;  4JBF A;  2UWX A;  4JXV A;  3E2L A;  4P85 A;  3DTM A;  4DE1 A;  1HTZ A;  2ZQA A;  3IH9 A;  3G2Z A;  5E2E A;  3GTC A;  1SDN A;  3BFF A;  1ESU A;  1WE4 A;  2JC7 A;  3G34 A;  1NJ4 A;  4RVA A;  5DTS A;  3V50 A;  1NRF A;  4E3L A;  3ZGA B;  2QZ6 A;  2EFX A;  1K38 A;  3OCN A;  3FYZ A;  3UPN A;  4E6X A;  3HLD A;  1TDG A;  1HZO A;  1K25 A;  1Q2P A;  2Y59 A;  5HAI A;  1IEL A;  2ZC4 B;  4Y7P A;  2Y2M A;  3BFG A;  4P87 A;  3VP3 A;  2WAE A;  3M2J A;  4WMC A;  4DXB A;  5GHY A;  2C5W B;  1VQQ A;  1YM1 A;  3WS5 A;  1DY6 A;  2X01 A;  1KE3 A;  2WGW A;  4ZJ2 A;  4EBL A;  1KE0 A;  3FZC A;  1L0D A;  4QB8 A;  1YQS A;  2Y2H A;  4RA7 A;  3NDG A;  1ERQ A;  2ZMA A;  2HP9 A;  4OPY A;  3IF6 C;  4L0L A;  4OP8 A;  4BD0 A;  1MBL A;  1I5Q A;  2Y2Q A;  3CZD A;  1K56 A;  5M1A A;  5DTT A;  1PWC A;  1TVF A;  2HDQ A;  4E3I A;  3G31 A;  3IF5 A;  5DF9 A;  3HLW A;  3UE1 A;  3B3X A;  2J8Y A;  4RYE A;  4GKU A;  3AGF A;  4WBG A;  4RX2 A;  4OLG A;  4JF4 A;  4N1H A;  3V3R A;  4OLD A;  2EX8 A;  1ONG A;  2ZC7 A;  3C4O A;  2H0Y A;  4KG6 A;  4S2L A;  1S0W A;  3VSK A;  3OZH A;  5U47 A;  1GA0 A;  3PTE A;  4K0W A;  5EVI C;  4S2I A;  5TGF A;  1HVB A;  1NZO A;  1W7F A;  4Y0O A;  3W4Q A;  1GCE A;  1XP4 A;  2VGK A;  2WAD A;  4OQI A;  4QU3 A;  3S22 A;  5HW3 A;  1DJB A;  2X71 A;  4KZ5 A;  2B5R A;  2WZX A;  4A5R A;  3UPO A;  3IWO A;  1H5X A;  4PM9 A;  3VFF A;  4E6W A;  4LEN A;  4KZ7 A;  3PAG A;  4MBK A;  3MXS A;  3W4O A;  1BUE A;  2XF3 A;  1NYM A;  3S4X A;  5GLA A;  1K54 C;  3EQU A;  3BEB A;  4QJG A;  4C75 A;  2EFU A;  4K0X A;  4IED A;  1SHV A;  3Q7V B;  3Q1F A;  4DKI A;  2GDN A;  4D2O A;  1I2W A;  1PZP A;  2EX6 A;  4KZ6 A;  1LLB A;  2ZD8 A;  4X56 A;  3WRZ A;  1K56 D;  4KG2 A;  1KDS A;  3E2K A;  2HP5 A;  4OVD A;  4WEL A;  4YIN A;  5EVL A;  4UA6 A;  5HAR A;  1JTD A;  2P74 A;  1DJA A;  4Q8I A;  4JF5 A;  4EUZ A;  4HBU A;  4ZTK A;  2JBF A;  2P9V A;  4KEN B;  3IHA A;  1W79 A;  5FA7 A;  4UHU A;  1ES3 A;  4EQI A;  4JPM A;  3ZG8 B;  3W4P A;  2Y2G A;  3ZVT A;  2Y2K A;  5FAP A;  2XD5 A;  2R9W A;  1JWP A;  4IBR A;  4OPQ A;  1MPL A;  3G32 A;  4S2K A;  1KVL A;  4WYY A;  1LI9 A;  1YMS A;  1KGG A;  4N9K A;  4GD8 A;  5GLB A;  2XD1 A;  4UA9 A;  3SH8 A;  2WK0 A;  5KSC A;  4N1X A;  3M6H A;  1W8Q A;  1K6R A;  3LCE A;  4DE2 A;  1FCO A;  2IWD A;  3WS2 A;  4Y0U A;  1KVM A;  2EX2 A;  3ZVW A;  3HLE A;  5GLC A;  4IBX A;  1IYS A;  3MZD A;  2XR0 A;  4OQ0 A;  4JXS A;  5FSR A;  1BLS A;  3HLB A;  4KG5 A;  1PW1 A;  2PU4 A;  3PBO A;  5EVI D;  5F83 A;  5CHM A;  1SCW A;  4DF6 A;  4ZJ3 A;  5AQB A;  1L0G A;  1XA7 A;  2ZJ9 A;  4E3K A;  1JVJ A;  1K6S A;  3Q7V A;  1BTL A;  1U60 A;  1O07 A;  3OPR A;  3CJM A;  3Q7Z A;  4BEN A;  3MFD A;  3CG5 A;  4E3N A;  5EOE A;  4N9L A;  5E2H A;  3NI9 A;  4HEF A;  4PM6 A;  1IKG A;  5CGW A;  4WZ5 A;  2Y2J A;  2IWB A;  1IEM A;  1JTG A;  3ZNT A;  1WYB A;  3A3E A;  4KZ3 A;  1NYY A;  4S2J A;  5J8X A;  1BSG A;  3IWQ A;  3VFH A;  3MZF A;  3A3I A;  5CER A;  5EVI B;  5A90 A;  3D4F A;  2ZM2 A;  4N92 A;  2Y91 A;  4BLM A;  2JCH A;  2XFS A;  4X55 A;  4MEZ A;  5FQ9 A;  1PZO A;  3WWX A;  2H0T A;  4OON A;  3ZHH A;  1CK3 A;  4DDY A;  5KMW A;  2RL3 A;  1ZG6 A;  2Y2N A;  5G18 A;  3WS1 A;  2WZZ A;  3FKW A;  2Q9N A;  3G2Y A;  4WZ4 A;  4XUZ A;  1FOF A;  4OOM A;  2PBY A;  4B4X A;  3HLG A;  3TSG A;  4OH0 A;  4PM5 A;  2R9X A;  3GVB A;  3RXX A;  4FCF A;  5CRF A;  2ZM8 A;  3IT9 A;  4LCM A;  1YT4 A;  2A49 A;  5CGX A;  5A91 A;  4JXW A;  2Z2M B;  3NBL A;  2J9P A;  5FQM A;  1KDW A;  3IXD A;  4O7D A;  3OCL A;  4OQG A;  3SH9 A;  5HL1 A;  3IXH A;  4FH2 A;  2BG1 A;  3A3F A;  4KQO A;  5TR7 A;  1L2S A;  5DF7 A;  4DE3 A;  2VGJ A;  2PU2 A;  1MKI A;  2HPB A;  2V2F F;  3UPP A;  2BLS A;  3ITB A;  3N8L A;  4P0M A;  3ZG0 A;  1JWZ A;  1LL5 A;  5F82 A;  5A92 A;  3VP0 A;  3Q82 A;  3PBS A;  3O3V A;  1K4F A;  1ZG4 A;  3OPH A;  1M40 A;  2HP6 A;  3IH8 A;  3Q07 A;  3TOI A;  2Y4A A;  3GR2 A;  3QHY A;  4B4Z A;  5FQJ A;  3QNC A;  4OOY A;  4PMA A;  3UE0 A;  3C7V A;  1H8Z A;  1LI0 A;  4KZ9 A;  1RGZ A;  3GSG A;  5EVI A;  5TFQ A;  4C6Y A;  3GMW A;  4JXG A;  4BL2 A;  1IYP A;  2C6W B;  1XPB A;  5DVA A;  4X6T A;  5D3O A;  4WEK A;  2QPN A;  5BOH A;  3BLM A;  2JE5 A;  2IWC A;  4S2M A;  1M6K A;  1XGI A;  4BJP A;  4OKP A;  3V39 A;  4E3M A;  2EXB A;  5GHZ A;  2G2W A;  2V1Z A;  3TG9 A;  1K57 C;  4BD1 A;  4S2N A;  3IXG A;  3N6I A;  4M3K A;  3W8K A;  5AQ9 A;  4RX3 A;  1JWV A;  4R23 A;  1MWR A;  3RJU A;  4EBN A;  1E3U A;  4E3J A;  3PBQ A;  3VOY A;  1K4E A;  4GDN A;  1G68 A;  3DWK A;  2CC1 A;  4DRT A;  4OQH A;  1BLH A;  3N8S A;  4X53 A;  3A3J A;  1NZU A;  1OME A;  3IHB A;  4GN2 A;  2RCX A;  2J7V A;  5CHJ A;  1FR6 A;  3HUM A;  2X02 A;  3MKE A;  4QY5 A;  1TEM A;  1E4D A;  3WS4 A;  1WYC A;  5FQQ A;  1ES4 A;  3V5M A;  1XGJ A;  1SKF A;  1YLT A;  2XK1 A;  3SS5 A;  1IYO A;  4GNU A;  3DW0 A;  5EEC A;  2ZM0 A;  2WKI A;  5CXW A;  2Y55 A;  3PBN A;  3PBR A;  2XGN A;  2Y2L A;  4UA7 A;  1K57 A;  4ZAM A;  5FQK A;  4F94 A;  2ZQ8 A;  4ZBE A;  2WGW B;  2V20 A;  3VMA A;  4GB7 A;  2FFF B;  1VM1 A;  1MWT A;  1YLP A;  4U3T A;  1HD8 A;  2A3U A;  4GOG A;  2HDR A;  1S6R A;  5CGS A;  5A93 A;  2EX9 A;  2I72 A;  3ZFZ A;  2J9O A;  2ZC6 B;  1K54 A;  3GV9 A;  2HDU A;  3Q81 A;  2ZC3 B;  3NIA A;  4IVK A;  3HLF A;  5EOO A;  2WKH A;  5FI7 A;  1CEG A;  5FAO A;  1MY8 A;  3HVF A;  3N7W A;  3UE3 A;  3C5A A;  4PPR A;  4X69 A;  3NCK A;  1K55 A;  1XX2 A;  3HUO A;  3O88 A;  1FSW A;  3VOZ A;  1ESI A;  4GD6 A;  4BL3 A;  1E3U D;  1GHM A;  1QMF A;  3P09 A;  5FI6 A;  5FAS A;  1EI5 A;  1XKZ A;  4GZB A;  3RXW A;  3VP4 A;  3MZE A;  4NET A;  4KZ4 A;  3PBT A;  3AGE A;  1L0F A;  2XDM A;  1CI9 A;  3O87 A;  1TDL A;  2ZQ9 A;  1FSY A;  3HRE A;  3G4P A;  3IF6 A;  3I7J A;  3IQA A;  1XA1 A;  4MLL A;  4S2N C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...