2WYXA

Neutron structure of a class a beta-lactamase toho-1 e166a r274n r276n triple mutant
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
256
structure length
256
Chain Sequence
VQQQLEALEKSSGGRLGVALINTADNSQILYRADERFAMCSTSKVMAAAAVLKQSESDKHLLNQRVEIKKSDLVNYNPIAEKHVNGTMTLAELGAAALQYSDNTAMNKLIAHLGGPDKVTAFARSLGDETFRLDRTAPTLNTAIPGDPRDTTTPLAMAQTLKNLTLGKALAETQRAQLVTWLKGNTTGSASIRAGLPKSWVVGDKTGSGDYGTTNDIAVIWPENHAPLVLVTYFTQPEQKAENRNDILAAAAKIVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords BETA-LACTAMSE TOHO-1
publication title Neutron Diffraction Studies of a Class a Beta-Lactamase Toho-1 E166A R274N R276N Triple Mutant
pubmed doi rcsb
source organism Escherichia coli
total genus 90
structure length 256
sequence length 256
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2009-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2wyxA00
1K6RA 2VGKA 5HAIA 4U0TA 5EUAA 3MXRA 4B88A 2WKEA 3Q07A 3IH9A 4IBRA 1HTZA 3I7JA 3NBLA 4KG6A 3TOIA 5JYPA 3MZEA 4OKPA 4MBKA 2J9PA 4DE0A 1BTLA 2WADA 3UPOA 2ZC5B 4E3IA 1G6AA 1DJCA 2WAFA 3LY4A 4KZAA 5FQ9A 2OV5A 4CPKA 1BUEA 2ZC4B 3WS2A 4LV1A 3IXDA 3IXHA 3NDEA 3WS1A 4PM5A 3UO9A 1JWZA 4OP5A 3UDIA 1K57A 1ES3A 2XR0A 1ERMA 3VFHA 2V20A 3S22A 4KZ4A 3DWKA 4GKUA 1O07A 3ZNYA 1K56A 5F82A 4B4XA 4WMCA 1NJ4A 4S2KA 4S2MA 4F94A 3WRTA 3C4PA 1AXBA 2RL3A 2C6WB 5KSHA 1FR1A 4JPMA 1C3BA 3UN7A 5IHVA 1IYSA 4KZ6A 4X53A 2Y2IA 4UAAA 1BLHA 3BRMA 3ITAA 5EOEA 1K57C 3ZCZA 1XXMA 4N92A 4X6TA 5HX9A 2Y2OA 4R3JA 1LL5A 2X71A 4PM8A 3SS3A 4DDYA 1MBLA 1CI8A 1LL9A 3N8LA 1KGEA 5DF7A 4PMAA 4Y0UA 1WYBA 1YLTA 2Q9NA 2DRWA 5DTTA 5E2GA 4GDNA 2Y55A 5GLDA 3D4FA 3ZHHA 1QMFA 4E3MA 2ZC7A 2CC1A 5EVID 2OLUA 4HESA 3A3EA 1K6SA 3CZDA 3A3DA 2Y91A 5D3OA 1U60A 4HBUA 4OONA 4OLDA 4KQQA 4M3KA 2RCXA 1LLBA 1H5XA 4FD8A 4XUXA 1L0EA 3HLGA 3HLWA 4X55A 2DCFA 3IF6A 5CEBA 4IBXA 1KE4A 4ZBEA 2R9WA 2DNSA 3PBSA 4LV3A 1YLPA 5AQ7A 1KVMA 3SH7A 1N4OA 1I2SA 3W4OA 2B5RA 1PYYA 3FWLA 3UY6A 2HP6A 3ZDJA 3P98A 1MY8A 1K55A 1HVBA 1KE3A 2JCHA 3AGFA 2P74A 2WK0A 3CJMA 3P09A 4KZBA 4N1HA 1SHVA 5HAPA 2WKIA 4RYEA 1CI9A 4OPYA 4DXBA 1YLJA 4P87A 1EWZA 3O3VA 4Y0OA 1LI9A 5DTKA 2R9XA 3OCNA 1H8YA 2J7VA 4DE3A 2HP5A 3IF6C 3UE0A 3IHAA 4RVAA 1DJAA 3GTCA 3HUOA 1CK3A 2HPBA 2QMIA 3BEBA 2Y2JA 1KVLA 5EVIA 3MXSA 1IKIA 1YMSA 1KDWA 2XD1A 5AQAA 3VP4A 4D2OA 4EBLA 1N9BA 4N1XA 3RXWA 1XX2A 1K55C 2ZQAA 1E3UD 3HUMA 4R4RA 4WEKA 3HLFA 1IYPA 2JE5A 5TFQA 2WGWA 5E2HA 5FI7A 5M18A 4BL2A 5FQIA 4UHUA 2ZQCA 1ALQA 1FR6A 3UE3A 1YT4A 2PU4A 3ZG0A 5L2FA 1ZC2A 5DF8A 3E2LA 5EVIC 3W8KA 4KQOA 3LEZA 3UNWA 5CGWA 3V3RA 5AQBA 4UA6A 3Q82A 1K54A 3LO7A 3PBRA 3BM6A 1ZKJA 4P0MA 5FAOA 4L0LA 1XGIA 5F1GA 2ZQ9A 3SS5A 4WZ4A 3G35A 1XPBA 3OPLA 4OOYA 5CHMA 3ZVTA 1KGFA 4K0XA 3N8RA 4KENB 3BFEA 3NY4A 1Y54A 1K25A 1PIOA 1RP5A 1RGZA 2UWXA 2Y2QA 3O87A 2ZM8A 4R4SA 5EOOA 4E6WA 4OQ0A 4BJPA 4FH4A 2ZD8A 1E3UA 1K54C 1W8YA 1YQSA 2JBFA 3GVBA 3OZHA 3CG5A 4X68A 3W4PA 1IYQA 1BLSA 3B3XA 1QMEA 1IKGA 2J9OA 3VP1A 2H0YA 2Y4AA 2ZQ7A 3G32A 3QHYA 4EBPA 1M6KA 2HDQA 5GHYA 3VOYA 2G2UA 5EPHA 4WYYA 3G4PA 5DTSA 1L0DA 2XH9A 3ISGA 3IT9A 5CTMA 4YINA 3EQUA 3PBOA 2EX6A 3V50A 5M19A 1TEMA 5AQ9A 2EXBA 5HAQA 1JTDA 3FZCA 1FOFA 1BULA 4LV0A 3IF5A 5CHUA 5DF9A 1J9MA 3ZG5A 3M2JA 4BENA 5KSCA 1ONHA 1TDGA 4FCFA 1MWRA 4UA7A 3FV7A 1MWUA 4X56A 1MKIA 4OLGA 3C7VA 3ZNTA 3MBZA 4WEJA 4OQHA 2WGIA 4LCMA 2HP9A 3IXGA 3IWQA 2I72A 3GRJA 2EX8A 3MFDA 4FSFA 4OOMA 4S2OA 4FH2A 2XLNA 3Q7ZA 1FCOA 1ONGA 4OPQA 4RX2A 1K38A 4E3OA 4JF4A 4JF5A 3AGDA 3V3SA 3VP3A 1MWSA 2ZQDA 3C7UA 4DKIA 4MBHA 4KG2A 1SDNA 3G2YA 4U3TA 5CTNA 1K4EA 2Y2PA 3TSGA 4ZJ2A 3BFDA 3PBTA 4C3QA 3Q7VB 3FKWA 4ZJ3A 5FASA 1XKZA 4MEZA 5CGXA 5E43A 5FSRA 3IF6B 4JXGA 3VFFA 1SKFA 5E2EA 1L0GA 3VMAA 3V39A 2QPNA 4UA9A 2QZ6A 1NZOA 3HVFA 3EQVA 2G2WA 1GA9A 3TG9A 4GOGA 5EECA 1K4FA 2IWDA 5A90A 1Z6FA 5FQJA 2XQZA 1FQGA 4PM6A 3O88A 1FCMA 2BLSA 2Y2NA 3PAEA 1BLPA 1KGGA 1YLZA 3ZVWA 1NXYA 3GR2A 3VOZA 1ES2A 2HDUA 1TVFA 2Y2GA 2ZJ9A 3LY3A 4OPZA 4CJNA 2IWCA 1MPLA 2ZMAA 1S6RA 1W5DA 3G2ZA 3HLEA 4QJGA 4RA7A 3V5MA 5GLCA 5KZHA 4S2JA 4ZJ1A 1DY6A 4KZ3A 4S2IA 3QNCA 3BYDA 4QY5A 3MKFA 5HW3A 3MZFA 4KZ5A 4EUZA 5TGFA 1DJBA 1NY0A 3A3IA 1GHPA 2EX9A 1L2SA 4JXWA 3N7WA 4OH0A 4U0XA 3SH8A 2WGWB 4KZ8A 1FSWA 3GSGA 1PI4A 1ES4A 4GB7A 5GL9A 2XGNA 1O7EA 1PW1A 2Q9MA 4MLLA 3HUNA 4E3KA 1GHIA 4Q8IA 4HBTA 4GNUA 5FAPA 1WE4A 1I2WA 1W79A 4S2LA 1BT5A 5GLBA 1XGJA 3PAGA 3IQAA 1IYOA 1LHYA 3GV9A 2VGJA 3PBNA 4RX3A 3UPPA 3ZG9B 3N4IA 3IWIA 2XD5A 4WBGA 5CGSA 4P6BA 5CRFA 2XFTA 1NRFA 3PBQA 2EXAA 5J8XA 3VP0A 4HEFA 1RGYA 2Y2LA 3VSLA 2H0TA 3IH8A 1VQQA 1CEGA 1S0WA 1WYCA 2WYXA 3OCLA 4KQRA 4OOLA 4IVIA 1H8ZA 3UE1A 2P9VA 4IVKA 2PBYA 2Y2MA 5G18A 5U47A 1YM1A 3NC8A 3PTEA 4DXCA 4WM9A 5F83A 3Q1FA 1NYMA 2EFUA 2XF3A 1BSGA 4OQIA 2ZQ8A 4WMCD 1GCEA 4Y7PA 3HLBA 1ZG4A 3Q81A 1LI0A 5GHXA 2XEPA 2WKHA 3AGEA 1EROA 1RCJA 3ZFZA 3IXBA 1BZAA 3DW0A 2ZC6B 3FKVA 5CXWA 4C75A 2JC7A 4E3JA 2Y59A 3FYZA 4C6YA 2WZZA 5FDHA 4N9KA 4DRTA 3HLDA 3M6BA 2Z2MB 3UDFA 4MBFA 4WZ5A 1L0FA 1HZOA 2XK1A 3G34A 3NIAA 1TDLA 2FFFB 3N6IA 4EQIA 1NYYA 1BLCA 3SH9A 4QU3A 4NK3A 3CMZA 5FQMA 3GMWA 4LCLA 2V1ZA 4BD0A 1XP4A 4QHCA 2Y2HA 5EE8A 1SDEA 1PWCA 5CHJA 2OSUA 1SCWA 4WZ5C 1ESUA 5FQQA 4JBFA 4OVDA 5CERA 4PM9A 3C4OA 3BLSA 3WWXA 2BG1A 5HL1A 5GHZA 4PM7A 3OPRA 4JXSA 3G30A 3HREA 4WELA 2OLVA 4JLFA 4LENA 4JF6A 2V2FF 5BOHA 4K0WA 5CECA 1FSYA 2A3UA 2FFYA 2H10A 4GZBA 3ITBA 3ZGAB 4N9LA 1JWVA 1XA7A 1E4DA 3HLCA 1PWGA 4EV4A 4ZAMA 2A49A 5GLAA 2X01A 1IELA 1XA1A 5M1AA 3W4QA 5FAQA 3E2KA 3HBRA 4P85A 3JYIA 3NCKA 3IHBA 2H5SA 5A92A 1YLYA 4JKTA 4X69A 2C5WB 1GA0A 5I94A 1PZOA 3DTMA 2ZM0A 4OQGA 3ZG8B 1PW8A 1GHMA 3BFGA 1MWTA 3S1YA 4NETA 4ZTKA 1IEMA 3SS4A 4S2NA 4DDSA 1CEFA 3HL9A 3MZDA 3Q7VA 4BD1A 5DVAA 2EX2A 2XFSA 2WGVA 2GDNA 1KE0A 3BFFA 1JTGA 1OMEA 1EI5A 1FCNA 2Y2KA 2ZLYA 1PWDA 4GDBA 4KZ7A 5EVIB 4XXRA 5FATA 4OPRA 3G31A 5FI2A 3IWOA 2J8YA 3N8SA 3RJUA 2ZM2A 5TR7A 4E6XA 4O7DA 1ZG6A 5FA7A 1M40A 4S2NC 1Q2PA 5EVLA 3S4XA 2HDSA 2Z2LB 3VP2A 4PPRA 2WUQA 4KZ9A 3WRZA 2WAEA 4S2PA 2WZXA 3LCEA 4EWFA 5A93A 1I5QA 2EFXA 1JWPA 4OP8A 3A3JA 1YMXA 4E3LA 3C5AA 4GD8A 3OPHA 3M2KA 5FQKA 5HARA 5F1FA 1G68A 4R1GA 4GN2A 5E2FA 1ERQA 4QB8A 3DWZA 2PU2A 4K91A 4LV2A 1KDSA 4JXVA 4MNRA 4QD4A 4R0QA 2IWBA 3UPNA 3VSKA 4BLMA 4EBNA 4IEDA 4H8RA 4Y0TA 5HFOA 1HD8A 3BLMA 3M6HA 2ZC3B 4DF6A 1Q2QA 1W8QA 4YFMA 5A91A 3RXXA 2X02A 3WS0A 4ZDXA 3MKEA 1YLWA 4DE2A 4DE1A 4E3NA 3GQZA 2XDMA 4BQMA 5KMWA 1PZPA 2E8IA 2P9VB 4GD6A 4B4ZA 3NDGA 4ID4A 3OPPA 4Z9QA 3SOIA 4R3BA 3ZG7B 2HDRA 3WS5A 1VM1A 4R23A 4KG5A 5CEDA 5JYOA 1ESIA 1MXOA 3OC2A 3WS4A 1K56D 1ES5A 1NZUA 5FI6A 3QNBA 4XUZA 3BECA 3UDXA 3O86A 3A3FA 4BL3A 4A5RA 4QY6A 1E25A 1JVJA 3BFCA 3NI9A 1W7FA 1PI5A
chains in the Genus database with same CATH superfamily
5EUAA 1T18A 3LI8A 1HTZA 4MBKA 4E3IA 3UMEA 2ZC4B 3IXHA 3IX3A 4MN7A 1ERMA 3VE3A 5DKKA 4S2KA 3C4PA 2C6WB 3UN7A 1NLYA 2OAP1 4X53A 2Y2IA 3BJNA 1XXMA 4N92A 4X6TA 4EEUA 2B95A 4F3LB 2Y2OA 2X71A 3RH8B 4DDYA 1MBLA 3N8LA 1H0MA 1KGEA 1YLTA 5E2GA 2HJ9C 1P0ZA 2OOLA 3ZHHA 3MJQA 1MKMA 4E3MA 2ZC7A 3A3EA 4R6LA 4OLDA 3NJAA 1LLBA 3F1NA 1L0EA 3EEAA 4X55A 2DCFA 1KE4A 2HZ5A 2R9WA 3PBSA 5AQ7A 1I2SA 3UY6A 2ZOIA 5HAPA 4RYEA 1EWZA 2L4RA 3IHAA 1SKOA 5TJJA 1Y28A 2QMIA 4EBLA 3MXSA 1KDWA 2JN7A 3VP4A 1N9BA 3T4JA 4R4RA 4E04A 2JE5A 4GLQA 5FI7A 5M18A 5FQIA 4BMWA 1OJ5A 3OLOA 1YT4A 5L2FA 3LEZA 2ZMFA 5AQBA 5EVEA 3LO7A 1J3WA 2QWSA 2ZBBA 1Y4OA 3SS5A 4WZ4A 2HF6A 2H28A 3N8RA 4KENB 4DE0A 1RGZA 2Y2QA 4R4SA 2O99A 2ZD8A 1E3UA 4X68A 3B42A 3CG5A 2VV8A 3VP1A 5L07A 3QHYA 4EBPA 4WYYA 5DTSA 2XH9A 3ISGA 5CTMA 3PBOA 3V50A 2EXBA 4LV0A 2EA9A 2L0WA 4UA7A 1T1AA 1TDGA 1MWRA 3LR4A 4HI4A 3EOIA 4DMZA 2VA0A 3C7VA 2UV0E 3MBZA 4LCMA 3IXGA 4R70A 3MFDA 4FSFA 5HL6A 5A8BA 3L7HA 2XLNA 4I3JA 4ETZA 4MMNA 5AJGA 3V3SA 3VP3A 3C7UA 3CAXA 2OAQ1 3K2NA 3FKWA 4ZJ3A 5FASA 4LRYC 1T1BA 3VMAA 1OPXA 3V39A 1NZOA 3EQVA 1OTAA 5HWVA 2IWDA 1FQGA 3T1RA 3PAEA 2Y2NA 3A0RA 1ES2A 1MPLA 1S6RA 1W5DA 3F1OA 3G2ZA 1MC0A 3V5MA 3R4KA 4S2JA 4ZJ1A 4KZ3A 4S2IA 3QNCA 2QKPA 5TGFA 1K0KA 4U0XA 1FSWA 1ES4A 5FDSA 1CQAA 3PAGA 2VGJA 1OTBA 3KYEA 5FL3A 3PBQA 4L9GA 3VP0A 1RGYA 3KYZA 1VEUA 1TS7A 4Z1WA 3OCLA 4OOLA 2O9AA 3ULFA 4IVKA 2LB9A 2Y2MA 1YM1A 3NC8A 4WM9A 5F83A 1BSGA 2PAVP 4WMCD 4Y7PA 3HLBA 3Q81A 3FPVA 1NRJA 2WKHA 3AGEA 1EROA 1RCJA 4NXEA 1LSVA 3DW0A 4DN0A 3VE4A 2J80A 2BASA 3BY9A 4LRZE 3HLDA 1F9IA 1TS6A 4GW9A 5G4YA 3N6IA 3SH9A 4QU3A 4NK3A 4O8GA 4BD0A 5CX7A 5EM0A 5L10A 2Y2HA 1YKDA 5CHJA 4NXGA 2OSUA 1IOUA 5CERA 1FIKA 3KSIA 5HL1A 3HREA 2JKRI 4WELA 4EXOA 4Y3IA 3W2ZA 2KX6A 4K0WA 2H10A 2PRFA 1XA1A 4AFIA 5FAQA 3HBRA 3LIAA 4HH2A 4P85A 3NCKA 2H5SA 1YLYA 2C5WB 1GA0A 2J3TC 1PZOA 5I94A 3ZG8B 3S1YA 4DDSA 3D3OA 1CEFA 2G7UA 3Q7VA 4BD1A 3F1OB 2WGVA 1KE0A 1JTGA 2PYRA 5I5LA 1EI5A 2ZLYA 5EVIB 5FI2A 3RJUA 4O7DA 2NUTC 1M40A 5EVLA 2HDSA 3C2WA 2VKSA 3WRZA 2DMWA 2W3EA 2PD7A 1JWPA 4OP8A 3A3JA 4IUKA 3VV4A 5L09A 3M2KA 5FQKA 3A0SA 4DJ3A 3NOPC 4L9EA 4MNRA 4K91A 4EBNA 1H8MA 2YKFA 2PR5A 5HFOA 3LICA 3BLMA 1W8QA 1VEUB 1XFQA 2XA7M 3RXXA 1YLWA 4DE2A 4ID4A 4Q0JA 1S1YA 2Z6DA 3WS5A 1OTEA 5CEDA 5HPIA 3IBRA 4CLCA 3QNBA 4XUZA 3T4TA 3EEHA 2GNXA 3A3FA 4A5RA 4EESA 1W7FA 3T4KA 5HAIA 2Y79A 3IH9A 4MDZA 5F5YA 3I7JA 3TOIA 2ZMVA 1BTLA 2WADA 4CLCC 2ZC5B 4Q0IA 3UPOA 1DJCA 2WAFA 2OV5A 4CPKA 4PKYA 1BUEA 3UO9A 2XR0A 4GHIA 3LUQA 4NKPA 3VFHA 3S22A 5HD3A 4GKUA 1O07A 3TRCA 2BTFP 2JKTI 4F94A 5KSHA 4JPMA 1C3BA 5LBRA 1N9NA 1BLHA 2V9AA 5HX9A 3LI9A 1OTDA 1CI8A 1LL9A 4PMAA 4Y0UA 1WYBA 4JGRA 2DRWA 4HIAA 5GLDA 3O5YA 5DJTA 4Y2FA 2CC1A 1CJFA 2PYPA 3A3DA 1U60A 4HBUA 4FD8A 4HQAA 5L8MA 5CEBA 4ZBEA 2DNSA 4LV3A 3K3DA 2KDKA 1PYYA 3FWLA 3C30A 3EWKA 2W3FA 1SHVA 2WKIA 1CI9A 4OPYA 1YLJA 1PRQA 5DTKA 3OCNA 4RVAA 2HGVA 2HPBA 2WKPA 4D2OA 2XD1A 1XX2A 3HUMA 4WEKA 3HLFA 5TFQA 2WGWA 1ALQA 1FR6A 3ZG0A 5MC7A 3QP5A 5DF8A 3E2LA 3W8KA 2V0WA 4KQOA 1YSQA 4UA6A 3Q82A 5FAOA 5F1GA 3G35A 1XPBA 3OPLA 3ZVTA 4K0XA 4OH0A 1Y54A 1K25A 1RP5A 2UWXA 3LEQA 2ZM8A 4E6WA 2NUPC 4FH4A 4G3WA 1W8YA 2JBFA 3GVBA 3W4PA 3B3XA 1QMEA 4I5SA 2J9OA 3CWFA 3G32A 2PBDP 5KIZA 2HDQA 3DTKA 3H82B 3VOYA 5EPHA 3G4PA 1L0DA 3IT9A 4YINA 5M19A 1TEMA 5HAQA 1JTDA 5CHUA 3E4PA 4BENA 5EM1A 1ONHA 4FCFA 3FV7A 1MZUA 1MWUA 4II7A 4OLGA 3ZNTA 2I9VA 2WGIA 3T4OA 2W0NA 3IWQA 4FH2A 1TD5A 3JVVA 3Q7ZA 1FCOA 3C8CA 3BWLA 1ONGA 4RX2A 5HDCA 2VGLS 4HOIA 4JF5A 1G28A 3GECA 3PHYA 1D06A 1MWSA 3TSGA 4ZRRA 3PBTA 1OJGA 4MEZA 3VFFA 3PYPA 5FSRA 3UB5P 4EW7A 4UA9A 2W27A 4ESPA 4BBVA 4KQDA 2Y8HA 1K4FA 2BLSA 1BLPA 1KGGA 3TE8A 1EW0A 1NXYA 3GR2A 2ZJ9A 4OPZA 1TVFA 2ZMAA 2A24A 3HLEA 3MKFA 4KZ5A 4EUZA 2O9CA 1DJBA 2ZL1A 4ARZB 4G3VA 3SH8A 2WGWB 1PI4A 2JKTM 2XGNA 2L1MA 2VV7A 1GHIA 4HBTA 3MSHA 1WE4A 5HDDA 2WKQA 3NOTC 4S2LA 5GLBA 1IYOA 3GV9A 3UPPA 4ME4A 5CGSA 2EXAA 3MR0A 3A0VA 5J8XA 2Y2LA 3MF0A 4KQRA 4IVIA 2P9VA 5G18A 5U47A 4HH3A 4DXCA 3E4OA 2B18A 5HWTA 1NYMA 2EFUA 2XF3A 4JGPA 1DP8A 2ZQ8A 4WL9A 3IXBA 1BZAA 5CXWA 2JC7A 1STZA 1OT9A 5FDHA 4DRTA 4WZ5A 1HZOA 3NULA 3G34A 3SW1A 4EQIA 2JKGA 1BLCA 3CMZA 3H7WA 3QP6A 3UB9A 2V1ZA 1XP4A 4QHCA 5EE8A 1SCWA 1TS8A 4WZ5C 4PAUA 4JBFA 3BLSA 4LENA 4JF6A 5BOHA 3F1NB 1A0KA 3HLCA 5J7EA 4ZAMA 1YSPA 5GLAA 2X01A 3E2KA 1X0OA 2K2NA 2ZM0A 4OQGA 1PW8A 1YAXA 1MWTA 2VZWA 4NXBA 2HJEA 1SKOB 1F98A 2XFSA 2A24B 5DFYA 3BFFA 4KZ7A 2Y2KA 1PWDA 4OPRA 3G31A 3BQAA 3IWOA 3T1SA 2J8YA 2ZL1B 2ZM2A 4FOFA 4Y13A 4EETB 3KSGA 3DAVA 3HCYA 3VP2A 2WZXA 4BWIA 4GD8A 2GX5A 1DRMA 5F1FA 2ZOHA 1TS0A 4QB8A 3DWZA 2PU2A 1KDSA 2IWBA 3KSHA 4IEDA 2V8CA 1HD8A 4YNRA 2ZC3B 4DF6A 5AVFA 3WS0A 4ZDXA 1XJ4A 3MKEA 3MS6A 4DE1A 5KMWA 3GQZA 2XDMA 4BQMA 2E8IA 2P9VB 3NDGA 4IJGA 3OPPA 4R3BA 5FEGA 4R23A 2A2LA 1LSWA 3WS4A 1K56D 1ES5A 3BECA 4BL3A 3T12B 3LR5A 1JVJA 2Z6CA 4GZBA 3BFCA 4HHDA 1K6RA 3IX4A 4U0TA 3MXRA 5J3WA 2GJ3A 3Q07A 3NBLA 4KG6A 1G6AA 2PR6A 3LY4A 5FQ9A 4KZAA 3PR6A 3E98A 3WS1A 4PM5A 3UDIA 3H7WB 1K57A 2HV1A 3QP2A 2V20A 4KZ4A 1XJ3A 3DWKA 4HJ3A 4B4XA 3KSFA 2M7VA 3KX0X 1AXBA 1XFNA 1FR1A 1VB6A 5IHVA 4KZ6A 2QJ7A 5EOEA 4UAAA 2YKHA 1K57C 3ZCZA 2W1TA 3QP8A 5TBMA 3LYXA 4R3JA 1LL5A 3SS3A 4PM8A 4O0PA 4Y5FA 4EUVA 3U4LP 3JPUA 2VK3A 5DTTA 2Y55A 2IA2A 5EVID 4HESA 4EQ1A 4OONA 4M3KA 4GS9A 1ODVA 2WKRA 4XUXA 3R7WA 3IF6A 4IBXA 1KVMA 3MXQA 1W63M 3ZDJA 3P98A 2W3DA 1MY8A 4N1HA 3AGFA 3TW8A 3P09A 1ZTUA 2P08A 4O01A 4EERA 4Y0OA 3O3VA 4NEED 2R9XA 4DE3A 2J7VA 2HP5A 3IF6C 3UE0A 2K7SA 1OTIA 4XT2A 1S4RA 3BEBA 3F1PA 2Y2JA 1KVLA 4N1XA 2ZQAA 1IYPA 1NWZA 5E2HA 4UHUA 1DP9A 2ZQCA 3UE3A 2PU4A 1ZC2A 2QHKA 2FZ0A 1K54A 4LPZA 3PBRA 3S7NA 1ZKJA 4L0LA 1XGIA 2PHYA 4OOYA 3LGOA 5CHMA 1KGFA 3BFEA 3NY4A 3O87A 1PIOA 3T1XA 1G5UA 4OQ0A 4BJPA 3OZHA 1K54C 4MN5A 3OBFA 1IYQA 1BLSA 3LR3A 1IKGA 2Y4AA 2ZQ7A 2MJ6A 1M6KA 5GHYA 2G2UA 3MQOA 5IU1A 5AQ9A 4M4XA 3IF5A 3MMHA 5DF9A 3B47A 1J9MA 3T4LA 3ZG5A 1SZVA 5KSCA 1N9LA 1PNEA 1MKIA 1F2KA 4WEJA 4OQHA 3S7QA 2I72A 3GRJA 2EX8A 2W1TB 5TBMB 1L3LA 3E0YA 2VX8A 2V8FA 4EEPA 4DKIA 2ZQDA 4MBHA 2M1CA 4KG2A 1XJ2A 1GSVA 3G2YA 4HP4A 4U3TA 2Y2PA 4HJ4A 5EFWA 4C3QA 3Q7VB 4PKYG 3R7WB 1XKZA 5CGXA 5E43A 4I39A 3IF6B 4JXGA 1SKFA 5E2EA 1L0GA 2QPNA 4HNBA 2QZ6A 3LIDA 1DP6A 2G2WA 5DJUA 5EECA 3T1QB 5FQJA 2XQZA 4PM6A 1LSXA 3ZVWA 3ZQ5A 4NXFA 1YLZA 4WF0A 2HDUA 2K31A 2IWCA 5HDSA 4XT2B 4QJGA 4RA7A 1S67L 3F1PB 5GLCA 3MQQA 5KZHA 2V1AA 5HW3A 3MZFA 1NY0A 5AVEA 3DBAA 2EWWA 1L2SA 4JXWA 2W1RA 3GSGA 4GB7A 1S4SA 4X1LA 1PW1A 2Q9MA 4MLLA 2W3HA 1D1JA 3HUNA 1N9OA 1PFLA 4BBTA 4KUOA 4E3KA 4GNUA 4NG2A 4QPRA 2QYBA 1BT5A 4Q0HA 3BQ8A 3PBNA 4RX3A 4CLCB 4WBGA 5CRFA 4RQ9A 2H0TA 1BYWA 3IH8A 1CEGA 2WYXA 3UE1A 3UB8A 2PBYA 1LL8A 3PTEA 5J4EA 3Q1FA 5G4ZA 4OQIA 1GCEA 1LI0A 5GHXA 2XEPA 4GHIB 3EGXC 4G3KA 2J3WA 4C75A 3H9WA 1HLUP 2Y59A 3FPWA 3P01A 2WZZA 4N9KA 3ZYTA 2XK1A 2M7UA 3NIAA 4HJ6A 1NYYA 3IBJA 3GMWA 4LFUA 3BY8A 3IS2A 4MCWA 3K3CA 1SDEA 4I38A 2VGLM 2PD8A 1KOUA 4IUHA 1ESUA 5FQQA 4OVDA 4PM9A 2PT7A 5GHZA 3OPRA 4JXSA 2OLVA 4JLFA 2V2FF 5IS1A 2V0UA 3BW6A 3ZGAB 3ITBA 1JWVA 1XA7A 4GJ4A 4ETXA 1T1CA 2A49A 3HJKA 5M1AA 3W4QA 1S66L 3JYIA 4JKTA 1S1ZA 4YOFA 3DTMA 1GHMA 2EWVA 2VEAA 1IEMA 3SS4A 4S2NA 3HL9A 2GDNA 1FCNA 5JYOA 4GDBA 3D72A 2O9BA 4E6XA 1ZG6A 1UGUA 5FA7A 2D01A 4S2NC 2Z2LB 2WUQA 2WAEA 4S2PA 5A93A 1I5QA 2EFXA 3C38A 3FC7A 1YMXA 4E3LA 4GN2A 4I3AA 4QD4A 4LV2A 4R0QA 4EU0A 4H8RA 4Y0TA 3M6HA 5F6AA 1ZHHB 5A91A 2XSSA 3QP1A 3T50A 3S7PA 2JHEA 4E3NA 1PZPA 4B4ZA 4Z9QA 3SOIA 1JNUA 3ZG7B 2HDRA 2LB5A 1ESIA 1MXOA 1NZUA 5FI6A 1YPRA 3O86A 4R3AA 4FTXA 1E25A 3E4QA 3NI9A 4Q8IA 2E8JA 2Q0OA 2VGKA 3CPTA 4B88A 2WKEA 4IBRA 3CHWP 2D02A 5JYPA 3MZEA 4OKPA 4DJ2A 2J9PA 5F69A 2V1BA 3WS2A 4LV1A 3IXDA 5C5KA 3GDIA 3NDEA 1JWZA 4OP5A 1ES3A 3KO6A 1VETA 3IS2B 3ZNYA 1K56A 5DKLA 5F82A 4WMCA 1NJ4A 4S2MA 3WRTA 2RL3A 4LLOB 1IYSA 5F68A 3BRMA 3ITAA 1P9WA 1VHMA 4MN6A 4WLAA 5DF7A 2Q9NA 3RTYA 2XROA 4GDNA 3LIEA 3D4FA 5IT5A 3L9KA 1QMFA 2OLUA 1K6SA 3CZDA 5D3OA 2Y91A 3MFXA 4KQQA 2RCXA 1H5XA 3LFVA 1IFQA 3HLGA 3HLWA 1Z09A 1CF0A 4CLCE 1YLPA 3SH7A 1N4OA 3W4OA 2B5RA 2HP6A 5DFXA 1K55A 1HVBA 1KE3A 1F5MA 2JCHA 2P74A 2WK0A 3CJMA 4KZBA 4DXBA 4P87A 1LI9A 2VJWA 1H8YA 1DJAA 3GTCA 3HUOA 2R78A 1CK3A 3CITA 3DTEA 5EVIA 1IKIA 1YMSA 3FG8A 5AQAA 3RXWA 1K55C 1E3UD 4HY8A 3KYQA 4BL2A 4L9FA 5EVIC 3U2AA 5FEFA 3UNWA 5CGWA 3V3RA 4JGOA 3BM6A 3DTIA 4WUJA 4P0MA 3UB6A 2ZQ9A 4WN5A 3UE6A 4B9OA 5EOOA 3CPTB 1YQSA 1P9RA 2GZAA 2H0YA 1UWNX 2OWJA 3P7NA 4QWOA 2AVXA 4H6JA 3EQUA 2EX6A 2XRNA 2KOIA 3FZCA 1FOFA 1BULA 1VETB 3SZTA 4LGWA 3M2JA 4X56A 4I3IA 1TF1A 2HP9A 4HP9A 4OOMA 4S2OA 2KLIA 3D9YA 4BBUA 1W63Q 4OPQA 1K38A 2VV6A 4JF4A 4E3OA 3AGDA 5HSQA 1SDNA 3QP4A 3PXPA 5CTNA 1K4EA 3VOLA 4ZJ2A 3BFDA 2JKFA 2W3GA 3HVFA 4LRXC 3B33A 1GA9A 5EV0A 3TG9A 1GSWA 4GOGA 3TJZC 1Z6FA 5A90A 3O88A 1FCMA 3VOZA 2Y2GA 3LY3A 4CJNA 1DY6A 3BYDA 4QY5A 3A3IA 2OWHA 1GHPA 2EX9A 1GSXA 3N7WA 3CI6A 4KZ8A 4K08A 5GL9A 1O7EA 1G6OA 1AWIA 1P97A 2FH5A 3NECA 3CLOA 5FAPA 1I2WA 1W79A 1XGJA 3RFBA 3IQAA 2B02A 1LHYA 3OOVA 3ZG9B 3N4IA 3IWIA 2XD5A 1D7EA 4P6BA 2XFTA 1NRFA 1T19A 2INWA 4HEFA 2XA7S 3VSLA 1LT0A 3NHQA 1VQQA 1S0WA 1WYCA 1H8ZA 4Y17A 4H6JB 4X25A 5HZHA 1ZG4A 3ZFZA 2ZC6B 2J3TD 3FKVA 5K5BA 4E3JA 4C6YA 3FYZA 3JVUA 1XJ6A 4UEYA 3H82A 4YWZA 3M6BA 2VLGA 2Z2MB 3UDFA 4MBFA 1ACFA 2P04A 1L0FA 1V9YA 1TDLA 2FFFB 4GCZA 3LIBA 3G6OA 5FQMA 5HD5A 4LCLA 3CUEA 1OT6A 4FUWA 3UMDA 1PWCA 4JGQA 3S7OA 2ACGA 3T4QA 1NLZA 3C4OA 3WWXA 2BG1A 4PM7A 4R38A 3G30A 4KUKA 4PHTA 4GS9B 3CUEC 5CECA 1FSYA 2A3UA 2FFYA 4F3LA 4N9LA 1E4DA 3ICYA 1PWGA 4D60A 4EV4A 1IELA 4X1MA 5A92A 3IHBA 4X69A 2PDRA 3EGDC 3LR0A 3BFGA 4IHQA 4NETA 4ZTKA 2QJ5A 4Y15A 3MZDA 4CQHA 5HWWA 5DVAA 2EX2A 1OMEA 4XXRA 5FATA 3NOUC 3N8SA 1V9ZA 5TR7A 1Q2PA 3S4XA 5HPFA 4B93A 4PPRA 4KZ9A 4P6ZS 3LCEA 4P6ZM 4EWFA 4CLCD 3T4SA 3C5AA 3OPHA 5HARA 1G68A 4UQIS 1H3QA 1WA9A 2CMNA 4UQIM 4R1GA 5E2FA 1ERQA 4ARZA 1FILA 2P7JA 3UPNA 3IX8A 4BLMA 4JXVA 3VSKA 3UB7A 3MQ0A 1Q2QA 4YFMA 3V67A 1UWPX 2X02A 4GD6A 2JKRM 3HJIA 1VM1A 4KG5A 3OC2A 3UDXA 3LIFA 4QY6A 2O0YA 1PI5A
chains in the Genus database with same CATH topology
1K6RA 2VGKA 5HAIA 4U0TA 5EUAA 3MXRA 4B88A 2WKEA 3Q07A 3IH9A 4IBRA 1HTZA 3I7JA 3NBLA 4KG6A 3TOIA 5JYPA 3MZEA 4OKPA 4MBKA 2J9PA 4DE0A 1BTLA 2WADA 3UPOA 2ZC5B 4E3IA 1G6AA 1DJCA 2WAFA 3LY4A 4KZAA 5FQ9A 2OV5A 4CPKA 1BUEA 2ZC4B 3WS2A 4LV1A 3IXDA 3IXHA 3NDEA 3WS1A 4PM5A 3UO9A 1JWZA 4OP5A 3UDIA 1K57A 1ES3A 2XR0A 1ERMA 3VFHA 2V20A 3S22A 4KZ4A 3DWKA 4GKUA 1O07A 3ZNYA 1K56A 5F82A 4B4XA 4WMCA 1NJ4A 4S2KA 4S2MA 4F94A 3WRTA 3C4PA 1AXBA 2RL3A 2C6WB 5KSHA 1FR1A 4JPMA 1C3BA 3UN7A 5IHVA 1IYSA 4KZ6A 4X53A 2Y2IA 4UAAA 1BLHA 3BRMA 3ITAA 5EOEA 1K57C 3ZCZA 1XXMA 4N92A 4X6TA 5HX9A 2Y2OA 4R3JA 1LL5A 2X71A 4PM8A 3SS3A 4DDYA 1MBLA 1CI8A 1LL9A 3N8LA 1KGEA 5DF7A 4PMAA 4Y0UA 1WYBA 1YLTA 2Q9NA 2DRWA 5DTTA 5E2GA 4GDNA 2Y55A 5GLDA 3D4FA 3ZHHA 1QMFA 4E3MA 2ZC7A 2CC1A 5EVID 2OLUA 4HESA 3A3EA 1K6SA 3CZDA 3A3DA 2Y91A 5D3OA 1U60A 4HBUA 4OONA 4OLDA 4KQQA 4M3KA 2RCXA 1LLBA 1H5XA 4FD8A 4XUXA 1L0EA 3HLGA 3HLWA 4X55A 2DCFA 3IF6A 5CEBA 4IBXA 1KE4A 4ZBEA 2R9WA 2DNSA 3PBSA 4LV3A 1YLPA 5AQ7A 1KVMA 3SH7A 1N4OA 1I2SA 3W4OA 2B5RA 1PYYA 3FWLA 3UY6A 2HP6A 3ZDJA 3P98A 1MY8A 1K55A 1HVBA 1KE3A 2JCHA 3AGFA 2P74A 2WK0A 3CJMA 3P09A 4KZBA 4N1HA 1SHVA 5HAPA 2WKIA 4RYEA 1CI9A 4OPYA 4DXBA 1YLJA 4P87A 1EWZA 3O3VA 4Y0OA 1LI9A 5DTKA 2R9XA 3OCNA 1H8YA 2J7VA 4DE3A 2HP5A 3IF6C 3UE0A 3IHAA 4RVAA 1DJAA 3GTCA 3HUOA 1CK3A 2HPBA 2QMIA 3BEBA 2Y2JA 1KVLA 5EVIA 3MXSA 1IKIA 1YMSA 1KDWA 2XD1A 5AQAA 3VP4A 4D2OA 4EBLA 1N9BA 4N1XA 3RXWA 1XX2A 1K55C 2ZQAA 1E3UD 3HUMA 4R4RA 4WEKA 3HLFA 1IYPA 2JE5A 5TFQA 2WGWA 5E2HA 5FI7A 5M18A 4BL2A 5FQIA 4UHUA 2ZQCA 1ALQA 1FR6A 3UE3A 1YT4A 2PU4A 3ZG0A 5L2FA 1ZC2A 5DF8A 3E2LA 5EVIC 3W8KA 4KQOA 3LEZA 3UNWA 5CGWA 3V3RA 5AQBA 4UA6A 3Q82A 1K54A 3LO7A 3PBRA 3BM6A 1ZKJA 4P0MA 5FAOA 4L0LA 1XGIA 5F1GA 2ZQ9A 3SS5A 4WZ4A 3G35A 1XPBA 3OPLA 4OOYA 5CHMA 3ZVTA 1KGFA 4K0XA 3N8RA 4KENB 3BFEA 3NY4A 1Y54A 1K25A 1PIOA 1RP5A 1RGZA 2UWXA 2Y2QA 3O87A 2ZM8A 4R4SA 5EOOA 4E6WA 4OQ0A 4BJPA 4FH4A 2ZD8A 1E3UA 1K54C 1W8YA 1YQSA 2JBFA 3GVBA 3OZHA 3CG5A 4X68A 3W4PA 1IYQA 1BLSA 3B3XA 1QMEA 1IKGA 2J9OA 3VP1A 2H0YA 2Y4AA 2ZQ7A 3G32A 3QHYA 4EBPA 1M6KA 2HDQA 5GHYA 3VOYA 2G2UA 5EPHA 4WYYA 3G4PA 5DTSA 1L0DA 2XH9A 3ISGA 3IT9A 5CTMA 4YINA 3EQUA 3PBOA 2EX6A 3V50A 5M19A 1TEMA 5AQ9A 2EXBA 5HAQA 1JTDA 3FZCA 1FOFA 1BULA 4LV0A 3IF5A 5CHUA 5DF9A 1J9MA 3ZG5A 3M2JA 4BENA 5KSCA 1ONHA 1TDGA 4FCFA 1MWRA 4UA7A 3FV7A 1MWUA 4X56A 1MKIA 4OLGA 3C7VA 3ZNTA 3MBZA 4WEJA 4OQHA 2WGIA 4LCMA 2HP9A 3IXGA 3IWQA 2I72A 3GRJA 2EX8A 3MFDA 4FSFA 4OOMA 4S2OA 4FH2A 2XLNA 3Q7ZA 1FCOA 1ONGA 4OPQA 4RX2A 1K38A 4E3OA 4JF4A 4JF5A 3AGDA 3V3SA 3VP3A 1MWSA 2ZQDA 3C7UA 4DKIA 4MBHA 4KG2A 1SDNA 3G2YA 4U3TA 5CTNA 1K4EA 2Y2PA 3TSGA 4ZJ2A 3BFDA 3PBTA 4C3QA 3Q7VB 3FKWA 4ZJ3A 5FASA 1XKZA 4MEZA 5CGXA 5E43A 5FSRA 3IF6B 4JXGA 3VFFA 1SKFA 5E2EA 1L0GA 3VMAA 3V39A 2QPNA 4UA9A 2QZ6A 1NZOA 3HVFA 3EQVA 2G2WA 1GA9A 3TG9A 4GOGA 5EECA 1K4FA 2IWDA 5A90A 1Z6FA 5FQJA 2XQZA 1FQGA 4PM6A 3O88A 1FCMA 2BLSA 2Y2NA 3PAEA 1BLPA 1KGGA 1YLZA 3ZVWA 1NXYA 3GR2A 3VOZA 1ES2A 2HDUA 1TVFA 2Y2GA 2ZJ9A 3LY3A 4OPZA 4CJNA 2IWCA 1MPLA 2ZMAA 1S6RA 1W5DA 3G2ZA 3HLEA 4QJGA 4RA7A 3V5MA 5GLCA 5KZHA 4S2JA 4ZJ1A 1DY6A 4KZ3A 4S2IA 3QNCA 3BYDA 4QY5A 3MKFA 5HW3A 3MZFA 4KZ5A 4EUZA 5TGFA 1DJBA 1NY0A 3A3IA 1GHPA 2EX9A 1L2SA 4JXWA 3N7WA 4OH0A 4U0XA 3SH8A 2WGWB 4KZ8A 1FSWA 3GSGA 1PI4A 1ES4A 4GB7A 5GL9A 2XGNA 1O7EA 1PW1A 2Q9MA 4MLLA 3HUNA 4E3KA 1GHIA 4Q8IA 4HBTA 4GNUA 5FAPA 1WE4A 1I2WA 1W79A 4S2LA 1BT5A 5GLBA 1XGJA 3PAGA 3IQAA 1IYOA 1LHYA 3GV9A 2VGJA 3PBNA 4RX3A 3UPPA 3ZG9B 3N4IA 3IWIA 2XD5A 4WBGA 5CGSA 4P6BA 5CRFA 2XFTA 1NRFA 3PBQA 2EXAA 5J8XA 3VP0A 4HEFA 1RGYA 2Y2LA 3VSLA 2H0TA 3IH8A 1VQQA 1CEGA 1S0WA 1WYCA 2WYXA 3OCLA 4KQRA 4OOLA 4IVIA 1H8ZA 3UE1A 2P9VA 4IVKA 2PBYA 2Y2MA 5G18A 5U47A 1YM1A 3NC8A 3PTEA 4DXCA 4WM9A 5F83A 3Q1FA 1NYMA 2EFUA 2XF3A 1BSGA 4OQIA 2ZQ8A 4WMCD 1GCEA 4Y7PA 3HLBA 1ZG4A 3Q81A 1LI0A 5GHXA 2XEPA 2WKHA 3AGEA 1EROA 1RCJA 3ZFZA 3IXBA 1BZAA 3DW0A 2ZC6B 3FKVA 5CXWA 4C75A 2JC7A 4E3JA 2Y59A 3FYZA 4C6YA 2WZZA 5FDHA 4N9KA 4DRTA 3HLDA 3M6BA 2Z2MB 3UDFA 4MBFA 4WZ5A 1L0FA 1HZOA 2XK1A 3G34A 3NIAA 1TDLA 2FFFB 3N6IA 4EQIA 1NYYA 1BLCA 3SH9A 4QU3A 4NK3A 3CMZA 5FQMA 3GMWA 4LCLA 2V1ZA 4BD0A 1XP4A 4QHCA 2Y2HA 5EE8A 1SDEA 1PWCA 5CHJA 2OSUA 1SCWA 4WZ5C 1ESUA 5FQQA 4JBFA 4OVDA 5CERA 4PM9A 3C4OA 3BLSA 3WWXA 2BG1A 5HL1A 5GHZA 4PM7A 3OPRA 4JXSA 3G30A 3HREA 4WELA 2OLVA 4JLFA 4LENA 4JF6A 2V2FF 5BOHA 4K0WA 5CECA 1FSYA 2A3UA 2FFYA 2H10A 4GZBA 3ITBA 3ZGAB 4N9LA 1JWVA 1XA7A 1E4DA 3HLCA 1PWGA 4EV4A 4ZAMA 2A49A 5GLAA 2X01A 1IELA 1XA1A 5M1AA 3W4QA 5FAQA 3E2KA 3HBRA 4P85A 3JYIA 3NCKA 3IHBA 2H5SA 5A92A 1YLYA 4JKTA 4X69A 2C5WB 1GA0A 5I94A 1PZOA 3DTMA 2ZM0A 4OQGA 3ZG8B 1PW8A 1GHMA 3BFGA 1MWTA 3S1YA 4NETA 4ZTKA 1IEMA 3SS4A 4S2NA 4DDSA 1CEFA 3HL9A 3MZDA 3Q7VA 4BD1A 5DVAA 2EX2A 2XFSA 2WGVA 2GDNA 1KE0A 3BFFA 1JTGA 1OMEA 1EI5A 1FCNA 2Y2KA 2ZLYA 1PWDA 4GDBA 4KZ7A 5EVIB 4XXRA 5FATA 4OPRA 3G31A 5FI2A 3IWOA 2J8YA 3N8SA 3RJUA 2ZM2A 5TR7A 4E6XA 4O7DA 1ZG6A 5FA7A 1M40A 4S2NC 1Q2PA 5EVLA 3S4XA 2HDSA 2Z2LB 3VP2A 4PPRA 2WUQA 4KZ9A 3WRZA 2WAEA 4S2PA 2WZXA 3LCEA 4EWFA 5A93A 1I5QA 2EFXA 1JWPA 4OP8A 3A3JA 1YMXA 4E3LA 3C5AA 4GD8A 3OPHA 3M2KA 5FQKA 5HARA 5F1FA 1G68A 4R1GA 4GN2A 5E2FA 1ERQA 4QB8A 3DWZA 2PU2A 4K91A 4LV2A 1KDSA 4JXVA 4MNRA 4QD4A 4R0QA 2IWBA 3UPNA 3VSKA 4BLMA 4EBNA 4IEDA 4H8RA 4Y0TA 5HFOA 1HD8A 3BLMA 3M6HA 2ZC3B 4DF6A 1Q2QA 1W8QA 4YFMA 5A91A 3RXXA 2X02A 3WS0A 4ZDXA 3MKEA 1YLWA 4DE2A 4DE1A 4E3NA 3GQZA 2XDMA 4BQMA 5KMWA 1PZPA 2E8IA 2P9VB 4GD6A 4B4ZA 3NDGA 4ID4A 3OPPA 4Z9QA 3SOIA 4R3BA 3ZG7B 2HDRA 3WS5A 1VM1A 4R23A 4KG5A 5CEDA 5JYOA 1ESIA 1MXOA 3OC2A 3WS4A 1K56D 1ES5A 1NZUA 5FI6A 3QNBA 4XUZA 3BECA 3UDXA 3O86A 3A3FA 4BL3A 4A5RA 4QY6A 1E25A 1JVJA 3BFCA 3NI9A 1W7FA 1PI5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K6R A;  2VGK A;  5HAI A;  4U0T A;  5EUA A;  3MXR A;  4B88 A;  2WKE A;  3Q07 A;  3IH9 A;  4IBR A;  1HTZ A;  3I7J A;  3NBL A;  4KG6 A;  3TOI A;  5JYP A;  3MZE A;  4OKP A;  4MBK A;  2J9P A;  4DE0 A;  1BTL A;  2WAD A;  3UPO A;  2ZC5 B;  4E3I A;  1G6A A;  1DJC A;  2WAF A;  3LY4 A;  4KZA A;  5FQ9 A;  2OV5 A;  4CPK A;  1BUE A;  2ZC4 B;  3WS2 A;  4LV1 A;  3IXD A;  3IXH A;  3NDE A;  3WS1 A;  4PM5 A;  3UO9 A;  1JWZ A;  4OP5 A;  3UDI A;  1K57 A;  1ES3 A;  2XR0 A;  1ERM A;  3VFH A;  2V20 A;  3S22 A;  4KZ4 A;  3DWK A;  4GKU A;  1O07 A;  3ZNY A;  1K56 A;  5F82 A;  4B4X A;  4WMC A;  1NJ4 A;  4S2K A;  4S2M A;  4F94 A;  3WRT A;  3C4P A;  1AXB A;  2RL3 A;  2C6W B;  5KSH A;  1FR1 A;  4JPM A;  1C3B A;  3UN7 A;  5IHV A;  1IYS A;  4KZ6 A;  4X53 A;  2Y2I A;  4UAA A;  1BLH A;  3BRM A;  3ITA A;  5EOE A;  1K57 C;  3ZCZ A;  1XXM A;  4N92 A;  4X6T A;  5HX9 A;  2Y2O A;  4R3J A;  1LL5 A;  2X71 A;  4PM8 A;  3SS3 A;  4DDY A;  1MBL A;  1CI8 A;  1LL9 A;  3N8L A;  1KGE A;  5DF7 A;  4PMA A;  4Y0U A;  1WYB A;  1YLT A;  2Q9N A;  2DRW A;  5DTT A;  5E2G A;  4GDN A;  2Y55 A;  5GLD A;  3D4F A;  3ZHH A;  1QMF A;  4E3M A;  2ZC7 A;  2CC1 A;  5EVI D;  2OLU A;  4HES A;  3A3E A;  1K6S A;  3CZD A;  3A3D A;  2Y91 A;  5D3O A;  1U60 A;  4HBU A;  4OON A;  4OLD A;  4KQQ A;  4M3K A;  2RCX A;  1LLB A;  1H5X A;  4FD8 A;  4XUX A;  1L0E A;  3HLG A;  3HLW A;  4X55 A;  2DCF A;  3IF6 A;  5CEB A;  4IBX A;  1KE4 A;  4ZBE A;  2R9W A;  2DNS A;  3PBS A;  4LV3 A;  1YLP A;  5AQ7 A;  1KVM A;  3SH7 A;  1N4O A;  1I2S A;  3W4O A;  2B5R A;  1PYY A;  3FWL A;  3UY6 A;  2HP6 A;  3ZDJ A;  3P98 A;  1MY8 A;  1K55 A;  1HVB A;  1KE3 A;  2JCH A;  3AGF A;  2P74 A;  2WK0 A;  3CJM A;  3P09 A;  4KZB A;  4N1H A;  1SHV A;  5HAP A;  2WKI A;  4RYE A;  1CI9 A;  4OPY A;  4DXB A;  1YLJ A;  4P87 A;  1EWZ A;  3O3V A;  4Y0O A;  1LI9 A;  5DTK A;  2R9X A;  3OCN A;  1H8Y A;  2J7V A;  4DE3 A;  2HP5 A;  3IF6 C;  3UE0 A;  3IHA A;  4RVA A;  1DJA A;  3GTC A;  3HUO A;  1CK3 A;  2HPB A;  2QMI A;  3BEB A;  2Y2J A;  1KVL A;  5EVI A;  3MXS A;  1IKI A;  1YMS A;  1KDW A;  2XD1 A;  5AQA A;  3VP4 A;  4D2O A;  4EBL A;  1N9B A;  4N1X A;  3RXW A;  1XX2 A;  1K55 C;  2ZQA A;  1E3U D;  3HUM A;  4R4R A;  4WEK A;  3HLF A;  1IYP A;  2JE5 A;  5TFQ A;  2WGW A;  5E2H A;  5FI7 A;  5M18 A;  4BL2 A;  5FQI A;  4UHU A;  2ZQC A;  1ALQ A;  1FR6 A;  3UE3 A;  1YT4 A;  2PU4 A;  3ZG0 A;  5L2F A;  1ZC2 A;  5DF8 A;  3E2L A;  5EVI C;  3W8K A;  4KQO A;  3LEZ A;  3UNW A;  5CGW A;  3V3R A;  5AQB A;  4UA6 A;  3Q82 A;  1K54 A;  3LO7 A;  3PBR A;  3BM6 A;  1ZKJ A;  4P0M A;  5FAO A;  4L0L A;  1XGI A;  5F1G A;  2ZQ9 A;  3SS5 A;  4WZ4 A;  3G35 A;  1XPB A;  3OPL A;  4OOY A;  5CHM A;  3ZVT A;  1KGF A;  4K0X A;  3N8R A;  4KEN B;  3BFE A;  3NY4 A;  1Y54 A;  1K25 A;  1PIO A;  1RP5 A;  1RGZ A;  2UWX A;  2Y2Q A;  3O87 A;  2ZM8 A;  4R4S A;  5EOO A;  4E6W A;  4OQ0 A;  4BJP A;  4FH4 A;  2ZD8 A;  1E3U A;  1K54 C;  1W8Y A;  1YQS A;  2JBF A;  3GVB A;  3OZH A;  3CG5 A;  4X68 A;  3W4P A;  1IYQ A;  1BLS A;  3B3X A;  1QME A;  1IKG A;  2J9O A;  3VP1 A;  2H0Y A;  2Y4A A;  2ZQ7 A;  3G32 A;  3QHY A;  4EBP A;  1M6K A;  2HDQ A;  5GHY A;  3VOY A;  2G2U A;  5EPH A;  4WYY A;  3G4P A;  5DTS A;  1L0D A;  2XH9 A;  3ISG A;  3IT9 A;  5CTM A;  4YIN A;  3EQU A;  3PBO A;  2EX6 A;  3V50 A;  5M19 A;  1TEM A;  5AQ9 A;  2EXB A;  5HAQ A;  1JTD A;  3FZC A;  1FOF A;  1BUL A;  4LV0 A;  3IF5 A;  5CHU A;  5DF9 A;  1J9M A;  3ZG5 A;  3M2J A;  4BEN A;  5KSC A;  1ONH A;  1TDG A;  4FCF A;  1MWR A;  4UA7 A;  3FV7 A;  1MWU A;  4X56 A;  1MKI A;  4OLG A;  3C7V A;  3ZNT A;  3MBZ A;  4WEJ A;  4OQH A;  2WGI A;  4LCM A;  2HP9 A;  3IXG A;  3IWQ A;  2I72 A;  3GRJ A;  2EX8 A;  3MFD A;  4FSF A;  4OOM A;  4S2O A;  4FH2 A;  2XLN A;  3Q7Z A;  1FCO A;  1ONG A;  4OPQ A;  4RX2 A;  1K38 A;  4E3O A;  4JF4 A;  4JF5 A;  3AGD A;  3V3S A;  3VP3 A;  1MWS A;  2ZQD A;  3C7U A;  4DKI A;  4MBH A;  4KG2 A;  1SDN A;  3G2Y A;  4U3T A;  5CTN A;  1K4E A;  2Y2P A;  3TSG A;  4ZJ2 A;  3BFD A;  3PBT A;  4C3Q A;  3Q7V B;  3FKW A;  4ZJ3 A;  5FAS A;  1XKZ A;  4MEZ A;  5CGX A;  5E43 A;  5FSR A;  3IF6 B;  4JXG A;  3VFF A;  1SKF A;  5E2E A;  1L0G A;  3VMA A;  3V39 A;  2QPN A;  4UA9 A;  2QZ6 A;  1NZO A;  3HVF A;  3EQV A;  2G2W A;  1GA9 A;  3TG9 A;  4GOG A;  5EEC A;  1K4F A;  2IWD A;  5A90 A;  1Z6F A;  5FQJ A;  2XQZ A;  1FQG A;  4PM6 A;  3O88 A;  1FCM A;  2BLS A;  2Y2N A;  3PAE A;  1BLP A;  1KGG A;  1YLZ A;  3ZVW A;  1NXY A;  3GR2 A;  3VOZ A;  1ES2 A;  2HDU A;  1TVF A;  2Y2G A;  2ZJ9 A;  3LY3 A;  4OPZ A;  4CJN A;  2IWC A;  1MPL A;  2ZMA A;  1S6R A;  1W5D A;  3G2Z A;  3HLE A;  4QJG A;  4RA7 A;  3V5M A;  5GLC A;  5KZH A;  4S2J A;  4ZJ1 A;  1DY6 A;  4KZ3 A;  4S2I A;  3QNC A;  3BYD A;  4QY5 A;  3MKF A;  5HW3 A;  3MZF A;  4KZ5 A;  4EUZ A;  5TGF A;  1DJB A;  1NY0 A;  3A3I A;  1GHP A;  2EX9 A;  1L2S A;  4JXW A;  3N7W A;  4OH0 A;  4U0X A;  3SH8 A;  2WGW B;  4KZ8 A;  1FSW A;  3GSG A;  1PI4 A;  1ES4 A;  4GB7 A;  5GL9 A;  2XGN A;  1O7E A;  1PW1 A;  2Q9M A;  4MLL A;  3HUN A;  4E3K A;  1GHI A;  4Q8I A;  4HBT A;  4GNU A;  5FAP A;  1WE4 A;  1I2W A;  1W79 A;  4S2L A;  1BT5 A;  5GLB A;  1XGJ A;  3PAG A;  3IQA A;  1IYO A;  1LHY A;  3GV9 A;  2VGJ A;  3PBN A;  4RX3 A;  3UPP A;  3ZG9 B;  3N4I A;  3IWI A;  2XD5 A;  4WBG A;  5CGS A;  4P6B A;  5CRF A;  2XFT A;  1NRF A;  3PBQ A;  2EXA A;  5J8X A;  3VP0 A;  4HEF A;  1RGY A;  2Y2L A;  3VSL A;  2H0T A;  3IH8 A;  1VQQ A;  1CEG A;  1S0W A;  1WYC A;  2WYX A;  3OCL A;  4KQR A;  4OOL A;  4IVI A;  1H8Z A;  3UE1 A;  2P9V A;  4IVK A;  2PBY A;  2Y2M A;  5G18 A;  5U47 A;  1YM1 A;  3NC8 A;  3PTE A;  4DXC A;  4WM9 A;  5F83 A;  3Q1F A;  1NYM A;  2EFU A;  2XF3 A;  1BSG A;  4OQI A;  2ZQ8 A;  4WMC D;  1GCE A;  4Y7P A;  3HLB A;  1ZG4 A;  3Q81 A;  1LI0 A;  5GHX A;  2XEP A;  2WKH A;  3AGE A;  1ERO A;  1RCJ A;  3ZFZ A;  3IXB A;  1BZA A;  3DW0 A;  2ZC6 B;  3FKV A;  5CXW A;  4C75 A;  2JC7 A;  4E3J A;  2Y59 A;  3FYZ A;  4C6Y A;  2WZZ A;  5FDH A;  4N9K A;  4DRT A;  3HLD A;  3M6B A;  2Z2M B;  3UDF A;  4MBF A;  4WZ5 A;  1L0F A;  1HZO A;  2XK1 A;  3G34 A;  3NIA A;  1TDL A;  2FFF B;  3N6I A;  4EQI A;  1NYY A;  1BLC A;  3SH9 A;  4QU3 A;  4NK3 A;  3CMZ A;  5FQM A;  3GMW A;  4LCL A;  2V1Z A;  4BD0 A;  1XP4 A;  4QHC A;  2Y2H A;  5EE8 A;  1SDE A;  1PWC A;  5CHJ A;  2OSU A;  1SCW A;  4WZ5 C;  1ESU A;  5FQQ A;  4JBF A;  4OVD A;  5CER A;  4PM9 A;  3C4O A;  3BLS A;  3WWX A;  2BG1 A;  5HL1 A;  5GHZ A;  4PM7 A;  3OPR A;  4JXS A;  3G30 A;  3HRE A;  4WEL A;  2OLV A;  4JLF A;  4LEN A;  4JF6 A;  2V2F F;  5BOH A;  4K0W A;  5CEC A;  1FSY A;  2A3U A;  2FFY A;  2H10 A;  4GZB A;  3ITB A;  3ZGA B;  4N9L A;  1JWV A;  1XA7 A;  1E4D A;  3HLC A;  1PWG A;  4EV4 A;  4ZAM A;  2A49 A;  5GLA A;  2X01 A;  1IEL A;  1XA1 A;  5M1A A;  3W4Q A;  5FAQ A;  3E2K A;  3HBR A;  4P85 A;  3JYI A;  3NCK A;  3IHB A;  2H5S A;  5A92 A;  1YLY A;  4JKT A;  4X69 A;  2C5W B;  1GA0 A;  5I94 A;  1PZO A;  3DTM A;  2ZM0 A;  4OQG A;  3ZG8 B;  1PW8 A;  1GHM A;  3BFG A;  1MWT A;  3S1Y A;  4NET A;  4ZTK A;  1IEM A;  3SS4 A;  4S2N A;  4DDS A;  1CEF A;  3HL9 A;  3MZD A;  3Q7V A;  4BD1 A;  5DVA A;  2EX2 A;  2XFS A;  2WGV A;  2GDN A;  1KE0 A;  3BFF A;  1JTG A;  1OME A;  1EI5 A;  1FCN A;  2Y2K A;  2ZLY A;  1PWD A;  4GDB A;  4KZ7 A;  5EVI B;  4XXR A;  5FAT A;  4OPR A;  3G31 A;  5FI2 A;  3IWO A;  2J8Y A;  3N8S A;  3RJU A;  2ZM2 A;  5TR7 A;  4E6X A;  4O7D A;  1ZG6 A;  5FA7 A;  1M40 A;  4S2N C;  1Q2P A;  5EVL A;  3S4X A;  2HDS A;  2Z2L B;  3VP2 A;  4PPR A;  2WUQ A;  4KZ9 A;  3WRZ A;  2WAE A;  4S2P A;  2WZX A;  3LCE A;  4EWF A;  5A93 A;  1I5Q A;  2EFX A;  1JWP A;  4OP8 A;  3A3J A;  1YMX A;  4E3L A;  3C5A A;  4GD8 A;  3OPH A;  3M2K A;  5FQK A;  5HAR A;  5F1F A;  1G68 A;  4R1G A;  4GN2 A;  5E2F A;  1ERQ A;  4QB8 A;  3DWZ A;  2PU2 A;  4K91 A;  4LV2 A;  1KDS A;  4JXV A;  4MNR A;  4QD4 A;  4R0Q A;  2IWB A;  3UPN A;  3VSK A;  4BLM A;  4EBN A;  4IED A;  4H8R A;  4Y0T A;  5HFO A;  1HD8 A;  3BLM A;  3M6H A;  2ZC3 B;  4DF6 A;  1Q2Q A;  1W8Q A;  4YFM A;  5A91 A;  3RXX A;  2X02 A;  3WS0 A;  4ZDX A;  3MKE A;  1YLW A;  4DE2 A;  4DE1 A;  4E3N A;  3GQZ A;  2XDM A;  4BQM A;  5KMW A;  1PZP A;  2E8I A;  2P9V B;  4GD6 A;  4B4Z A;  3NDG A;  4ID4 A;  3OPP A;  4Z9Q A;  3SOI A;  4R3B A;  3ZG7 B;  2HDR A;  3WS5 A;  1VM1 A;  4R23 A;  4KG5 A;  5CED A;  5JYO A;  1ESI A;  1MXO A;  3OC2 A;  3WS4 A;  1K56 D;  1ES5 A;  1NZU A;  5FI6 A;  3QNB A;  4XUZ A;  3BEC A;  3UDX A;  3O86 A;  3A3F A;  4BL3 A;  4A5R A;  4QY6 A;  1E25 A;  1JVJ A;  3BFC A;  3NI9 A;  1W7F A;  1PI5 A; 
#chains in the Genus database with same CATH topology
 5EUA A;  1T18 A;  3LI8 A;  1HTZ A;  4MBK A;  4E3I A;  3UME A;  2ZC4 B;  3IXH A;  3IX3 A;  4MN7 A;  1ERM A;  3VE3 A;  5DKK A;  4S2K A;  3C4P A;  2C6W B;  3UN7 A;  1NLY A;  2OAP 1;  4X53 A;  2Y2I A;  3BJN A;  1XXM A;  4N92 A;  4X6T A;  4EEU A;  2B95 A;  4F3L B;  2Y2O A;  2X71 A;  3RH8 B;  4DDY A;  1MBL A;  3N8L A;  1H0M A;  1KGE A;  1YLT A;  5E2G A;  2HJ9 C;  1P0Z A;  2OOL A;  3ZHH A;  3MJQ A;  1MKM A;  4E3M A;  2ZC7 A;  3A3E A;  4R6L A;  4OLD A;  3NJA A;  1LLB A;  3F1N A;  1L0E A;  3EEA A;  4X55 A;  2DCF A;  1KE4 A;  2HZ5 A;  2R9W A;  3PBS A;  5AQ7 A;  1I2S A;  3UY6 A;  2ZOI A;  5HAP A;  4RYE A;  1EWZ A;  2L4R A;  3IHA A;  1SKO A;  5TJJ A;  1Y28 A;  2QMI A;  4EBL A;  3MXS A;  1KDW A;  2JN7 A;  3VP4 A;  1N9B A;  3T4J A;  4R4R A;  4E04 A;  2JE5 A;  4GLQ A;  5FI7 A;  5M18 A;  5FQI A;  4BMW A;  1OJ5 A;  3OLO A;  1YT4 A;  5L2F A;  3LEZ A;  2ZMF A;  5AQB A;  5EVE A;  3LO7 A;  1J3W A;  2QWS A;  2ZBB A;  1Y4O A;  3SS5 A;  4WZ4 A;  2HF6 A;  2H28 A;  3N8R A;  4KEN B;  4DE0 A;  1RGZ A;  2Y2Q A;  4R4S A;  2O99 A;  2ZD8 A;  1E3U A;  4X68 A;  3B42 A;  3CG5 A;  2VV8 A;  3VP1 A;  5L07 A;  3QHY A;  4EBP A;  4WYY A;  5DTS A;  2XH9 A;  3ISG A;  5CTM A;  3PBO A;  3V50 A;  2EXB A;  4LV0 A;  2EA9 A;  2L0W A;  4UA7 A;  1T1A A;  1TDG A;  1MWR A;  3LR4 A;  4HI4 A;  3EOI A;  4DMZ A;  2VA0 A;  3C7V A;  2UV0 E;  3MBZ A;  4LCM A;  3IXG A;  4R70 A;  3MFD A;  4FSF A;  5HL6 A;  5A8B A;  3L7H A;  2XLN A;  4I3J A;  4ETZ A;  4MMN A;  5AJG A;  3V3S A;  3VP3 A;  3C7U A;  3CAX A;  2OAQ 1;  3K2N A;  3FKW A;  4ZJ3 A;  5FAS A;  4LRY C;  1T1B A;  3VMA A;  1OPX A;  3V39 A;  1NZO A;  3EQV A;  1OTA A;  5HWV A;  2IWD A;  1FQG A;  3T1R A;  3PAE A;  2Y2N A;  3A0R A;  1ES2 A;  1MPL A;  1S6R A;  1W5D A;  3F1O A;  3G2Z A;  1MC0 A;  3V5M A;  3R4K A;  4S2J A;  4ZJ1 A;  4KZ3 A;  4S2I A;  3QNC A;  2QKP A;  5TGF A;  1K0K A;  4U0X A;  1FSW A;  1ES4 A;  5FDS A;  1CQA A;  3PAG A;  2VGJ A;  1OTB A;  3KYE A;  5FL3 A;  3PBQ A;  4L9G A;  3VP0 A;  1RGY A;  3KYZ A;  1VEU A;  1TS7 A;  4Z1W A;  3OCL A;  4OOL A;  2O9A A;  3ULF A;  4IVK A;  2LB9 A;  2Y2M A;  1YM1 A;  3NC8 A;  4WM9 A;  5F83 A;  1BSG A;  2PAV P;  4WMC D;  4Y7P A;  3HLB A;  3Q81 A;  3FPV A;  1NRJ A;  2WKH A;  3AGE A;  1ERO A;  1RCJ A;  4NXE A;  1LSV A;  3DW0 A;  4DN0 A;  3VE4 A;  2J80 A;  2BAS A;  3BY9 A;  4LRZ E;  3HLD A;  1F9I A;  1TS6 A;  4GW9 A;  5G4Y A;  3N6I A;  3SH9 A;  4QU3 A;  4NK3 A;  4O8G A;  4BD0 A;  5CX7 A;  5EM0 A;  5L10 A;  2Y2H A;  1YKD A;  5CHJ A;  4NXG A;  2OSU A;  1IOU A;  5CER A;  1FIK A;  3KSI A;  5HL1 A;  3HRE A;  2JKR I;  4WEL A;  4EXO A;  4Y3I A;  3W2Z A;  2KX6 A;  4K0W A;  2H10 A;  2PRF A;  1XA1 A;  4AFI A;  5FAQ A;  3HBR A;  3LIA A;  4HH2 A;  4P85 A;  3NCK A;  2H5S A;  1YLY A;  2C5W B;  1GA0 A;  2J3T C;  1PZO A;  5I94 A;  3ZG8 B;  3S1Y A;  4DDS A;  3D3O A;  1CEF A;  2G7U A;  3Q7V A;  4BD1 A;  3F1O B;  2WGV A;  1KE0 A;  1JTG A;  2PYR A;  5I5L A;  1EI5 A;  2ZLY A;  5EVI B;  5FI2 A;  3RJU A;  4O7D A;  2NUT C;  1M40 A;  5EVL A;  2HDS A;  3C2W A;  2VKS A;  3WRZ A;  2DMW A;  2W3E A;  2PD7 A;  1JWP A;  4OP8 A;  3A3J A;  4IUK A;  3VV4 A;  5L09 A;  3M2K A;  5FQK A;  3A0S A;  4DJ3 A;  3NOP C;  4L9E A;  4MNR A;  4K91 A;  4EBN A;  1H8M A;  2YKF A;  2PR5 A;  5HFO A;  3LIC A;  3BLM A;  1W8Q A;  1VEU B;  1XFQ A;  2XA7 M;  3RXX A;  1YLW A;  4DE2 A;  4ID4 A;  4Q0J A;  1S1Y A;  2Z6D A;  3WS5 A;  1OTE A;  5CED A;  5HPI A;  3IBR A;  4CLC A;  3QNB A;  4XUZ A;  3T4T A;  3EEH A;  2GNX A;  3A3F A;  4A5R A;  4EES A;  1W7F A;  3T4K A;  5HAI A;  2Y79 A;  3IH9 A;  4MDZ A;  5F5Y A;  3I7J A;  3TOI A;  2ZMV A;  1BTL A;  2WAD A;  4CLC C;  2ZC5 B;  4Q0I A;  3UPO A;  1DJC A;  2WAF A;  2OV5 A;  4CPK A;  4PKY A;  1BUE A;  3UO9 A;  2XR0 A;  4GHI A;  3LUQ A;  4NKP A;  3VFH A;  3S22 A;  5HD3 A;  4GKU A;  1O07 A;  3TRC A;  2BTF P;  2JKT I;  4F94 A;  5KSH A;  4JPM A;  1C3B A;  5LBR A;  1N9N A;  1BLH A;  2V9A A;  5HX9 A;  3LI9 A;  1OTD A;  1CI8 A;  1LL9 A;  4PMA A;  4Y0U A;  1WYB A;  4JGR A;  2DRW A;  4HIA A;  5GLD A;  3O5Y A;  5DJT A;  4Y2F A;  2CC1 A;  1CJF A;  2PYP A;  3A3D A;  1U60 A;  4HBU A;  4FD8 A;  4HQA A;  5L8M A;  5CEB A;  4ZBE A;  2DNS A;  4LV3 A;  3K3D A;  2KDK A;  1PYY A;  3FWL A;  3C30 A;  3EWK A;  2W3F A;  1SHV A;  2WKI A;  1CI9 A;  4OPY A;  1YLJ A;  1PRQ A;  5DTK A;  3OCN A;  4RVA A;  2HGV A;  2HPB A;  2WKP A;  4D2O A;  2XD1 A;  1XX2 A;  3HUM A;  4WEK A;  3HLF A;  5TFQ A;  2WGW A;  1ALQ A;  1FR6 A;  3ZG0 A;  5MC7 A;  3QP5 A;  5DF8 A;  3E2L A;  3W8K A;  2V0W A;  4KQO A;  1YSQ A;  4UA6 A;  3Q82 A;  5FAO A;  5F1G A;  3G35 A;  1XPB A;  3OPL A;  3ZVT A;  4K0X A;  4OH0 A;  1Y54 A;  1K25 A;  1RP5 A;  2UWX A;  3LEQ A;  2ZM8 A;  4E6W A;  2NUP C;  4FH4 A;  4G3W A;  1W8Y A;  2JBF A;  3GVB A;  3W4P A;  3B3X A;  1QME A;  4I5S A;  2J9O A;  3CWF A;  3G32 A;  2PBD P;  5KIZ A;  2HDQ A;  3DTK A;  3H82 B;  3VOY A;  5EPH A;  3G4P A;  1L0D A;  3IT9 A;  4YIN A;  5M19 A;  1TEM A;  5HAQ A;  1JTD A;  5CHU A;  3E4P A;  4BEN A;  5EM1 A;  1ONH A;  4FCF A;  3FV7 A;  1MZU A;  1MWU A;  4II7 A;  4OLG A;  3ZNT A;  2I9V A;  2WGI A;  3T4O A;  2W0N A;  3IWQ A;  4FH2 A;  1TD5 A;  3JVV A;  3Q7Z A;  1FCO A;  3C8C A;  3BWL A;  1ONG A;  4RX2 A;  5HDC A;  2VGL S;  4HOI A;  4JF5 A;  1G28 A;  3GEC A;  3PHY A;  1D06 A;  1MWS A;  3TSG A;  4ZRR A;  3PBT A;  1OJG A;  4MEZ A;  3VFF A;  3PYP A;  5FSR A;  3UB5 P;  4EW7 A;  4UA9 A;  2W27 A;  4ESP A;  4BBV A;  4KQD A;  2Y8H A;  1K4F A;  2BLS A;  1BLP A;  1KGG A;  3TE8 A;  1EW0 A;  1NXY A;  3GR2 A;  2ZJ9 A;  4OPZ A;  1TVF A;  2ZMA A;  2A24 A;  3HLE A;  3MKF A;  4KZ5 A;  4EUZ A;  2O9C A;  1DJB A;  2ZL1 A;  4ARZ B;  4G3V A;  3SH8 A;  2WGW B;  1PI4 A;  2JKT M;  2XGN A;  2L1M A;  2VV7 A;  1GHI A;  4HBT A;  3MSH A;  1WE4 A;  5HDD A;  2WKQ A;  3NOT C;  4S2L A;  5GLB A;  1IYO A;  3GV9 A;  3UPP A;  4ME4 A;  5CGS A;  2EXA A;  3MR0 A;  3A0V A;  5J8X A;  2Y2L A;  3MF0 A;  4KQR A;  4IVI A;  2P9V A;  5G18 A;  5U47 A;  4HH3 A;  4DXC A;  3E4O A;  2B18 A;  5HWT A;  1NYM A;  2EFU A;  2XF3 A;  4JGP A;  1DP8 A;  2ZQ8 A;  4WL9 A;  3IXB A;  1BZA A;  5CXW A;  2JC7 A;  1STZ A;  1OT9 A;  5FDH A;  4DRT A;  4WZ5 A;  1HZO A;  3NUL A;  3G34 A;  3SW1 A;  4EQI A;  2JKG A;  1BLC A;  3CMZ A;  3H7W A;  3QP6 A;  3UB9 A;  2V1Z A;  1XP4 A;  4QHC A;  5EE8 A;  1SCW A;  1TS8 A;  4WZ5 C;  4PAU A;  4JBF A;  3BLS A;  4LEN A;  4JF6 A;  5BOH A;  3F1N B;  1A0K A;  3HLC A;  5J7E A;  4ZAM A;  1YSP A;  5GLA A;  2X01 A;  3E2K A;  1X0O A;  2K2N A;  2ZM0 A;  4OQG A;  1PW8 A;  1YAX A;  1MWT A;  2VZW A;  4NXB A;  2HJE A;  1SKO B;  1F98 A;  2XFS A;  2A24 B;  5DFY A;  3BFF A;  4KZ7 A;  2Y2K A;  1PWD A;  4OPR A;  3G31 A;  3BQA A;  3IWO A;  3T1S A;  2J8Y A;  2ZL1 B;  2ZM2 A;  4FOF A;  4Y13 A;  4EET B;  3KSG A;  3DAV A;  3HCY A;  3VP2 A;  2WZX A;  4BWI A;  4GD8 A;  2GX5 A;  1DRM A;  5F1F A;  2ZOH A;  1TS0 A;  4QB8 A;  3DWZ A;  2PU2 A;  1KDS A;  2IWB A;  3KSH A;  4IED A;  2V8C A;  1HD8 A;  4YNR A;  2ZC3 B;  4DF6 A;  5AVF A;  3WS0 A;  4ZDX A;  1XJ4 A;  3MKE A;  3MS6 A;  4DE1 A;  5KMW A;  3GQZ A;  2XDM A;  4BQM A;  2E8I A;  2P9V B;  3NDG A;  4IJG A;  3OPP A;  4R3B A;  5FEG A;  4R23 A;  2A2L A;  1LSW A;  3WS4 A;  1K56 D;  1ES5 A;  3BEC A;  4BL3 A;  3T12 B;  3LR5 A;  1JVJ A;  2Z6C A;  4GZB A;  3BFC A;  4HHD A;  1K6R A;  3IX4 A;  4U0T A;  3MXR A;  5J3W A;  2GJ3 A;  3Q07 A;  3NBL A;  4KG6 A;  1G6A A;  2PR6 A;  3LY4 A;  5FQ9 A;  4KZA A;  3PR6 A;  3E98 A;  3WS1 A;  4PM5 A;  3UDI A;  3H7W B;  1K57 A;  2HV1 A;  3QP2 A;  2V20 A;  4KZ4 A;  1XJ3 A;  3DWK A;  4HJ3 A;  4B4X A;  3KSF A;  2M7V A;  3KX0 X;  1AXB A;  1XFN A;  1FR1 A;  1VB6 A;  5IHV A;  4KZ6 A;  2QJ7 A;  5EOE A;  4UAA A;  2YKH A;  1K57 C;  3ZCZ A;  2W1T A;  3QP8 A;  5TBM A;  3LYX A;  4R3J A;  1LL5 A;  3SS3 A;  4PM8 A;  4O0P A;  4Y5F A;  4EUV A;  3U4L P;  3JPU A;  2VK3 A;  5DTT A;  2Y55 A;  2IA2 A;  5EVI D;  4HES A;  4EQ1 A;  4OON A;  4M3K A;  4GS9 A;  1ODV A;  2WKR A;  4XUX A;  3R7W A;  3IF6 A;  4IBX A;  1KVM A;  3MXQ A;  1W63 M;  3ZDJ A;  3P98 A;  2W3D A;  1MY8 A;  4N1H A;  3AGF A;  3TW8 A;  3P09 A;  1ZTU A;  2P08 A;  4O01 A;  4EER A;  4Y0O A;  3O3V A;  4NEE D;  2R9X A;  4DE3 A;  2J7V A;  2HP5 A;  3IF6 C;  3UE0 A;  2K7S A;  1OTI A;  4XT2 A;  1S4R A;  3BEB A;  3F1P A;  2Y2J A;  1KVL A;  4N1X A;  2ZQA A;  1IYP A;  1NWZ A;  5E2H A;  4UHU A;  1DP9 A;  2ZQC A;  3UE3 A;  2PU4 A;  1ZC2 A;  2QHK A;  2FZ0 A;  1K54 A;  4LPZ A;  3PBR A;  3S7N A;  1ZKJ A;  4L0L A;  1XGI A;  2PHY A;  4OOY A;  3LGO A;  5CHM A;  1KGF A;  3BFE A;  3NY4 A;  3O87 A;  1PIO A;  3T1X A;  1G5U A;  4OQ0 A;  4BJP A;  3OZH A;  1K54 C;  4MN5 A;  3OBF A;  1IYQ A;  1BLS A;  3LR3 A;  1IKG A;  2Y4A A;  2ZQ7 A;  2MJ6 A;  1M6K A;  5GHY A;  2G2U A;  3MQO A;  5IU1 A;  5AQ9 A;  4M4X A;  3IF5 A;  3MMH A;  5DF9 A;  3B47 A;  1J9M A;  3T4L A;  3ZG5 A;  1SZV A;  5KSC A;  1N9L A;  1PNE A;  1MKI A;  1F2K A;  4WEJ A;  4OQH A;  3S7Q A;  2I72 A;  3GRJ A;  2EX8 A;  2W1T B;  5TBM B;  1L3L A;  3E0Y A;  2VX8 A;  2V8F A;  4EEP A;  4DKI A;  2ZQD A;  4MBH A;  2M1C A;  4KG2 A;  1XJ2 A;  1GSV A;  3G2Y A;  4HP4 A;  4U3T A;  2Y2P A;  4HJ4 A;  5EFW A;  4C3Q A;  3Q7V B;  4PKY G;  3R7W B;  1XKZ A;  5CGX A;  5E43 A;  4I39 A;  3IF6 B;  4JXG A;  1SKF A;  5E2E A;  1L0G A;  2QPN A;  4HNB A;  2QZ6 A;  3LID A;  1DP6 A;  2G2W A;  5DJU A;  5EEC A;  3T1Q B;  5FQJ A;  2XQZ A;  4PM6 A;  1LSX A;  3ZVW A;  3ZQ5 A;  4NXF A;  1YLZ A;  4WF0 A;  2HDU A;  2K31 A;  2IWC A;  5HDS A;  4XT2 B;  4QJG A;  4RA7 A;  1S67 L;  3F1P B;  5GLC A;  3MQQ A;  5KZH A;  2V1A A;  5HW3 A;  3MZF A;  1NY0 A;  5AVE A;  3DBA A;  2EWW A;  1L2S A;  4JXW A;  2W1R A;  3GSG A;  4GB7 A;  1S4S A;  4X1L A;  1PW1 A;  2Q9M A;  4MLL A;  2W3H A;  1D1J A;  3HUN A;  1N9O A;  1PFL A;  4BBT A;  4KUO A;  4E3K A;  4GNU A;  4NG2 A;  4QPR A;  2QYB A;  1BT5 A;  4Q0H A;  3BQ8 A;  3PBN A;  4RX3 A;  4CLC B;  4WBG A;  5CRF A;  4RQ9 A;  2H0T A;  1BYW A;  3IH8 A;  1CEG A;  2WYX A;  3UE1 A;  3UB8 A;  2PBY A;  1LL8 A;  3PTE A;  5J4E A;  3Q1F A;  5G4Z A;  4OQI A;  1GCE A;  1LI0 A;  5GHX A;  2XEP A;  4GHI B;  3EGX C;  4G3K A;  2J3W A;  4C75 A;  3H9W A;  1HLU P;  2Y59 A;  3FPW A;  3P01 A;  2WZZ A;  4N9K A;  3ZYT A;  2XK1 A;  2M7U A;  3NIA A;  4HJ6 A;  1NYY A;  3IBJ A;  3GMW A;  4LFU A;  3BY8 A;  3IS2 A;  4MCW A;  3K3C A;  1SDE A;  4I38 A;  2VGL M;  2PD8 A;  1KOU A;  4IUH A;  1ESU A;  5FQQ A;  4OVD A;  4PM9 A;  2PT7 A;  5GHZ A;  3OPR A;  4JXS A;  2OLV A;  4JLF A;  2V2F F;  5IS1 A;  2V0U A;  3BW6 A;  3ZGA B;  3ITB A;  1JWV A;  1XA7 A;  4GJ4 A;  4ETX A;  1T1C A;  2A49 A;  3HJK A;  5M1A A;  3W4Q A;  1S66 L;  3JYI A;  4JKT A;  1S1Z A;  4YOF A;  3DTM A;  1GHM A;  2EWV A;  2VEA A;  1IEM A;  3SS4 A;  4S2N A;  3HL9 A;  2GDN A;  1FCN A;  5JYO A;  4GDB A;  3D72 A;  2O9B A;  4E6X A;  1ZG6 A;  1UGU A;  5FA7 A;  2D01 A;  4S2N C;  2Z2L B;  2WUQ A;  2WAE A;  4S2P A;  5A93 A;  1I5Q A;  2EFX A;  3C38 A;  3FC7 A;  1YMX A;  4E3L A;  4GN2 A;  4I3A A;  4QD4 A;  4LV2 A;  4R0Q A;  4EU0 A;  4H8R A;  4Y0T A;  3M6H A;  5F6A A;  1ZHH B;  5A91 A;  2XSS A;  3QP1 A;  3T50 A;  3S7P A;  2JHE A;  4E3N A;  1PZP A;  4B4Z A;  4Z9Q A;  3SOI A;  1JNU A;  3ZG7 B;  2HDR A;  2LB5 A;  1ESI A;  1MXO A;  1NZU A;  5FI6 A;  1YPR A;  3O86 A;  4R3A A;  4FTX A;  1E25 A;  3E4Q A;  3NI9 A;  4Q8I A;  2E8J A;  2Q0O A;  2VGK A;  3CPT A;  4B88 A;  2WKE A;  4IBR A;  3CHW P;  2D02 A;  5JYP A;  3MZE A;  4OKP A;  4DJ2 A;  2J9P A;  5F69 A;  2V1B A;  3WS2 A;  4LV1 A;  3IXD A;  5C5K A;  3GDI A;  3NDE A;  1JWZ A;  4OP5 A;  1ES3 A;  3KO6 A;  1VET A;  3IS2 B;  3ZNY A;  1K56 A;  5DKL A;  5F82 A;  4WMC A;  1NJ4 A;  4S2M A;  3WRT A;  2RL3 A;  4LLO B;  1IYS A;  5F68 A;  3BRM A;  3ITA A;  1P9W A;  1VHM A;  4MN6 A;  4WLA A;  5DF7 A;  2Q9N A;  3RTY A;  2XRO A;  4GDN A;  3LIE A;  3D4F A;  5IT5 A;  3L9K A;  1QMF A;  2OLU A;  1K6S A;  3CZD A;  5D3O A;  2Y91 A;  3MFX A;  4KQQ A;  2RCX A;  1H5X A;  3LFV A;  1IFQ A;  3HLG A;  3HLW A;  1Z09 A;  1CF0 A;  4CLC E;  1YLP A;  3SH7 A;  1N4O A;  3W4O A;  2B5R A;  2HP6 A;  5DFX A;  1K55 A;  1HVB A;  1KE3 A;  1F5M A;  2JCH A;  2P74 A;  2WK0 A;  3CJM A;  4KZB A;  4DXB A;  4P87 A;  1LI9 A;  2VJW A;  1H8Y A;  1DJA A;  3GTC A;  3HUO A;  2R78 A;  1CK3 A;  3CIT A;  3DTE A;  5EVI A;  1IKI A;  1YMS A;  3FG8 A;  5AQA A;  3RXW A;  1K55 C;  1E3U D;  4HY8 A;  3KYQ A;  4BL2 A;  4L9F A;  5EVI C;  3U2A A;  5FEF A;  3UNW A;  5CGW A;  3V3R A;  4JGO A;  3BM6 A;  3DTI A;  4WUJ A;  4P0M A;  3UB6 A;  2ZQ9 A;  4WN5 A;  3UE6 A;  4B9O A;  5EOO A;  3CPT B;  1YQS A;  1P9R A;  2GZA A;  2H0Y A;  1UWN X;  2OWJ A;  3P7N A;  4QWO A;  2AVX A;  4H6J A;  3EQU A;  2EX6 A;  2XRN A;  2KOI A;  3FZC A;  1FOF A;  1BUL A;  1VET B;  3SZT A;  4LGW A;  3M2J A;  4X56 A;  4I3I A;  1TF1 A;  2HP9 A;  4HP9 A;  4OOM A;  4S2O A;  2KLI A;  3D9Y A;  4BBU A;  1W63 Q;  4OPQ A;  1K38 A;  2VV6 A;  4JF4 A;  4E3O A;  3AGD A;  5HSQ A;  1SDN A;  3QP4 A;  3PXP A;  5CTN A;  1K4E A;  3VOL A;  4ZJ2 A;  3BFD A;  2JKF A;  2W3G A;  3HVF A;  4LRX C;  3B33 A;  1GA9 A;  5EV0 A;  3TG9 A;  1GSW A;  4GOG A;  3TJZ C;  1Z6F A;  5A90 A;  3O88 A;  1FCM A;  3VOZ A;  2Y2G A;  3LY3 A;  4CJN A;  1DY6 A;  3BYD A;  4QY5 A;  3A3I A;  2OWH A;  1GHP A;  2EX9 A;  1GSX A;  3N7W A;  3CI6 A;  4KZ8 A;  4K08 A;  5GL9 A;  1O7E A;  1G6O A;  1AWI A;  1P97 A;  2FH5 A;  3NEC A;  3CLO A;  5FAP A;  1I2W A;  1W79 A;  1XGJ A;  3RFB A;  3IQA A;  2B02 A;  1LHY A;  3OOV A;  3ZG9 B;  3N4I A;  3IWI A;  2XD5 A;  1D7E A;  4P6B A;  2XFT A;  1NRF A;  1T19 A;  2INW A;  4HEF A;  2XA7 S;  3VSL A;  1LT0 A;  3NHQ A;  1VQQ A;  1S0W A;  1WYC A;  1H8Z A;  4Y17 A;  4H6J B;  4X25 A;  5HZH A;  1ZG4 A;  3ZFZ A;  2ZC6 B;  2J3T D;  3FKV A;  5K5B A;  4E3J A;  4C6Y A;  3FYZ A;  3JVU A;  1XJ6 A;  4UEY A;  3H82 A;  4YWZ A;  3M6B A;  2VLG A;  2Z2M B;  3UDF A;  4MBF A;  1ACF A;  2P04 A;  1L0F A;  1V9Y A;  1TDL A;  2FFF B;  4GCZ A;  3LIB A;  3G6O A;  5FQM A;  5HD5 A;  4LCL A;  3CUE A;  1OT6 A;  4FUW A;  3UMD A;  1PWC A;  4JGQ A;  3S7O A;  2ACG A;  3T4Q A;  1NLZ A;  3C4O A;  3WWX A;  2BG1 A;  4PM7 A;  4R38 A;  3G30 A;  4KUK A;  4PHT A;  4GS9 B;  3CUE C;  5CEC A;  1FSY A;  2A3U A;  2FFY A;  4F3L A;  4N9L A;  1E4D A;  3ICY A;  1PWG A;  4D60 A;  4EV4 A;  1IEL A;  4X1M A;  5A92 A;  3IHB A;  4X69 A;  2PDR A;  3EGD C;  3LR0 A;  3BFG A;  4IHQ A;  4NET A;  4ZTK A;  2QJ5 A;  4Y15 A;  3MZD A;  4CQH A;  5HWW A;  5DVA A;  2EX2 A;  1OME A;  4XXR A;  5FAT A;  3NOU C;  3N8S A;  1V9Z A;  5TR7 A;  1Q2P A;  3S4X A;  5HPF A;  4B93 A;  4PPR A;  4KZ9 A;  4P6Z S;  3LCE A;  4P6Z M;  4EWF A;  4CLC D;  3T4S A;  3C5A A;  3OPH A;  5HAR A;  1G68 A;  4UQI S;  1H3Q A;  1WA9 A;  2CMN A;  4UQI M;  4R1G A;  5E2F A;  1ERQ A;  4ARZ A;  1FIL A;  2P7J A;  3UPN A;  3IX8 A;  4BLM A;  4JXV A;  3VSK A;  3UB7 A;  3MQ0 A;  1Q2Q A;  4YFM A;  3V67 A;  1UWP X;  2X02 A;  4GD6 A;  2JKR M;  3HJI A;  1VM1 A;  4KG5 A;  3OC2 A;  3UDX A;  3LIF A;  4QY6 A;  2O0Y A;  1PI5 A; 
#chains in the Genus database with same CATH homology
 1K6R A;  2VGK A;  5HAI A;  4U0T A;  5EUA A;  3MXR A;  4B88 A;  2WKE A;  3Q07 A;  3IH9 A;  4IBR A;  1HTZ A;  3I7J A;  3NBL A;  4KG6 A;  3TOI A;  5JYP A;  3MZE A;  4OKP A;  4MBK A;  2J9P A;  4DE0 A;  1BTL A;  2WAD A;  3UPO A;  2ZC5 B;  4E3I A;  1G6A A;  1DJC A;  2WAF A;  3LY4 A;  4KZA A;  5FQ9 A;  2OV5 A;  4CPK A;  1BUE A;  2ZC4 B;  3WS2 A;  4LV1 A;  3IXD A;  3IXH A;  3NDE A;  3WS1 A;  4PM5 A;  3UO9 A;  1JWZ A;  4OP5 A;  3UDI A;  1K57 A;  1ES3 A;  2XR0 A;  1ERM A;  3VFH A;  2V20 A;  3S22 A;  4KZ4 A;  3DWK A;  4GKU A;  1O07 A;  3ZNY A;  1K56 A;  5F82 A;  4B4X A;  4WMC A;  1NJ4 A;  4S2K A;  4S2M A;  4F94 A;  3WRT A;  3C4P A;  1AXB A;  2RL3 A;  2C6W B;  5KSH A;  1FR1 A;  4JPM A;  1C3B A;  3UN7 A;  5IHV A;  1IYS A;  4KZ6 A;  4X53 A;  2Y2I A;  4UAA A;  1BLH A;  3BRM A;  3ITA A;  5EOE A;  1K57 C;  3ZCZ A;  1XXM A;  4N92 A;  4X6T A;  5HX9 A;  2Y2O A;  4R3J A;  1LL5 A;  2X71 A;  4PM8 A;  3SS3 A;  4DDY A;  1MBL A;  1CI8 A;  1LL9 A;  3N8L A;  1KGE A;  5DF7 A;  4PMA A;  4Y0U A;  1WYB A;  1YLT A;  2Q9N A;  2DRW A;  5DTT A;  5E2G A;  4GDN A;  2Y55 A;  5GLD A;  3D4F A;  3ZHH A;  1QMF A;  4E3M A;  2ZC7 A;  2CC1 A;  5EVI D;  2OLU A;  4HES A;  3A3E A;  1K6S A;  3CZD A;  3A3D A;  2Y91 A;  5D3O A;  1U60 A;  4HBU A;  4OON A;  4OLD A;  4KQQ A;  4M3K A;  2RCX A;  1LLB A;  1H5X A;  4FD8 A;  4XUX A;  1L0E A;  3HLG A;  3HLW A;  4X55 A;  2DCF A;  3IF6 A;  5CEB A;  4IBX A;  1KE4 A;  4ZBE A;  2R9W A;  2DNS A;  3PBS A;  4LV3 A;  1YLP A;  5AQ7 A;  1KVM A;  3SH7 A;  1N4O A;  1I2S A;  3W4O A;  2B5R A;  1PYY A;  3FWL A;  3UY6 A;  2HP6 A;  3ZDJ A;  3P98 A;  1MY8 A;  1K55 A;  1HVB A;  1KE3 A;  2JCH A;  3AGF A;  2P74 A;  2WK0 A;  3CJM A;  3P09 A;  4KZB A;  4N1H A;  1SHV A;  5HAP A;  2WKI A;  4RYE A;  1CI9 A;  4OPY A;  4DXB A;  1YLJ A;  4P87 A;  1EWZ A;  3O3V A;  4Y0O A;  1LI9 A;  5DTK A;  2R9X A;  3OCN A;  1H8Y A;  2J7V A;  4DE3 A;  2HP5 A;  3IF6 C;  3UE0 A;  3IHA A;  4RVA A;  1DJA A;  3GTC A;  3HUO A;  1CK3 A;  2HPB A;  2QMI A;  3BEB A;  2Y2J A;  1KVL A;  5EVI A;  3MXS A;  1IKI A;  1YMS A;  1KDW A;  2XD1 A;  5AQA A;  3VP4 A;  4D2O A;  4EBL A;  1N9B A;  4N1X A;  3RXW A;  1XX2 A;  1K55 C;  2ZQA A;  1E3U D;  3HUM A;  4R4R A;  4WEK A;  3HLF A;  1IYP A;  2JE5 A;  5TFQ A;  2WGW A;  5E2H A;  5FI7 A;  5M18 A;  4BL2 A;  5FQI A;  4UHU A;  2ZQC A;  1ALQ A;  1FR6 A;  3UE3 A;  1YT4 A;  2PU4 A;  3ZG0 A;  5L2F A;  1ZC2 A;  5DF8 A;  3E2L A;  5EVI C;  3W8K A;  4KQO A;  3LEZ A;  3UNW A;  5CGW A;  3V3R A;  5AQB A;  4UA6 A;  3Q82 A;  1K54 A;  3LO7 A;  3PBR A;  3BM6 A;  1ZKJ A;  4P0M A;  5FAO A;  4L0L A;  1XGI A;  5F1G A;  2ZQ9 A;  3SS5 A;  4WZ4 A;  3G35 A;  1XPB A;  3OPL A;  4OOY A;  5CHM A;  3ZVT A;  1KGF A;  4K0X A;  3N8R A;  4KEN B;  3BFE A;  3NY4 A;  1Y54 A;  1K25 A;  1PIO A;  1RP5 A;  1RGZ A;  2UWX A;  2Y2Q A;  3O87 A;  2ZM8 A;  4R4S A;  5EOO A;  4E6W A;  4OQ0 A;  4BJP A;  4FH4 A;  2ZD8 A;  1E3U A;  1K54 C;  1W8Y A;  1YQS A;  2JBF A;  3GVB A;  3OZH A;  3CG5 A;  4X68 A;  3W4P A;  1IYQ A;  1BLS A;  3B3X A;  1QME A;  1IKG A;  2J9O A;  3VP1 A;  2H0Y A;  2Y4A A;  2ZQ7 A;  3G32 A;  3QHY A;  4EBP A;  1M6K A;  2HDQ A;  5GHY A;  3VOY A;  2G2U A;  5EPH A;  4WYY A;  3G4P A;  5DTS A;  1L0D A;  2XH9 A;  3ISG A;  3IT9 A;  5CTM A;  4YIN A;  3EQU A;  3PBO A;  2EX6 A;  3V50 A;  5M19 A;  1TEM A;  5AQ9 A;  2EXB A;  5HAQ A;  1JTD A;  3FZC A;  1FOF A;  1BUL A;  4LV0 A;  3IF5 A;  5CHU A;  5DF9 A;  1J9M A;  3ZG5 A;  3M2J A;  4BEN A;  5KSC A;  1ONH A;  1TDG A;  4FCF A;  1MWR A;  4UA7 A;  3FV7 A;  1MWU A;  4X56 A;  1MKI A;  4OLG A;  3C7V A;  3ZNT A;  3MBZ A;  4WEJ A;  4OQH A;  2WGI A;  4LCM A;  2HP9 A;  3IXG A;  3IWQ A;  2I72 A;  3GRJ A;  2EX8 A;  3MFD A;  4FSF A;  4OOM A;  4S2O A;  4FH2 A;  2XLN A;  3Q7Z A;  1FCO A;  1ONG A;  4OPQ A;  4RX2 A;  1K38 A;  4E3O A;  4JF4 A;  4JF5 A;  3AGD A;  3V3S A;  3VP3 A;  1MWS A;  2ZQD A;  3C7U A;  4DKI A;  4MBH A;  4KG2 A;  1SDN A;  3G2Y A;  4U3T A;  5CTN A;  1K4E A;  2Y2P A;  3TSG A;  4ZJ2 A;  3BFD A;  3PBT A;  4C3Q A;  3Q7V B;  3FKW A;  4ZJ3 A;  5FAS A;  1XKZ A;  4MEZ A;  5CGX A;  5E43 A;  5FSR A;  3IF6 B;  4JXG A;  3VFF A;  1SKF A;  5E2E A;  1L0G A;  3VMA A;  3V39 A;  2QPN A;  4UA9 A;  2QZ6 A;  1NZO A;  3HVF A;  3EQV A;  2G2W A;  1GA9 A;  3TG9 A;  4GOG A;  5EEC A;  1K4F A;  2IWD A;  5A90 A;  1Z6F A;  5FQJ A;  2XQZ A;  1FQG A;  4PM6 A;  3O88 A;  1FCM A;  2BLS A;  2Y2N A;  3PAE A;  1BLP A;  1KGG A;  1YLZ A;  3ZVW A;  1NXY A;  3GR2 A;  3VOZ A;  1ES2 A;  2HDU A;  1TVF A;  2Y2G A;  2ZJ9 A;  3LY3 A;  4OPZ A;  4CJN A;  2IWC A;  1MPL A;  2ZMA A;  1S6R A;  1W5D A;  3G2Z A;  3HLE A;  4QJG A;  4RA7 A;  3V5M A;  5GLC A;  5KZH A;  4S2J A;  4ZJ1 A;  1DY6 A;  4KZ3 A;  4S2I A;  3QNC A;  3BYD A;  4QY5 A;  3MKF A;  5HW3 A;  3MZF A;  4KZ5 A;  4EUZ A;  5TGF A;  1DJB A;  1NY0 A;  3A3I A;  1GHP A;  2EX9 A;  1L2S A;  4JXW A;  3N7W A;  4OH0 A;  4U0X A;  3SH8 A;  2WGW B;  4KZ8 A;  1FSW A;  3GSG A;  1PI4 A;  1ES4 A;  4GB7 A;  5GL9 A;  2XGN A;  1O7E A;  1PW1 A;  2Q9M A;  4MLL A;  3HUN A;  4E3K A;  1GHI A;  4Q8I A;  4HBT A;  4GNU A;  5FAP A;  1WE4 A;  1I2W A;  1W79 A;  4S2L A;  1BT5 A;  5GLB A;  1XGJ A;  3PAG A;  3IQA A;  1IYO A;  1LHY A;  3GV9 A;  2VGJ A;  3PBN A;  4RX3 A;  3UPP A;  3ZG9 B;  3N4I A;  3IWI A;  2XD5 A;  4WBG A;  5CGS A;  4P6B A;  5CRF A;  2XFT A;  1NRF A;  3PBQ A;  2EXA A;  5J8X A;  3VP0 A;  4HEF A;  1RGY A;  2Y2L A;  3VSL A;  2H0T A;  3IH8 A;  1VQQ A;  1CEG A;  1S0W A;  1WYC A;  2WYX A;  3OCL A;  4KQR A;  4OOL A;  4IVI A;  1H8Z A;  3UE1 A;  2P9V A;  4IVK A;  2PBY A;  2Y2M A;  5G18 A;  5U47 A;  1YM1 A;  3NC8 A;  3PTE A;  4DXC A;  4WM9 A;  5F83 A;  3Q1F A;  1NYM A;  2EFU A;  2XF3 A;  1BSG A;  4OQI A;  2ZQ8 A;  4WMC D;  1GCE A;  4Y7P A;  3HLB A;  1ZG4 A;  3Q81 A;  1LI0 A;  5GHX A;  2XEP A;  2WKH A;  3AGE A;  1ERO A;  1RCJ A;  3ZFZ A;  3IXB A;  1BZA A;  3DW0 A;  2ZC6 B;  3FKV A;  5CXW A;  4C75 A;  2JC7 A;  4E3J A;  2Y59 A;  3FYZ A;  4C6Y A;  2WZZ A;  5FDH A;  4N9K A;  4DRT A;  3HLD A;  3M6B A;  2Z2M B;  3UDF A;  4MBF A;  4WZ5 A;  1L0F A;  1HZO A;  2XK1 A;  3G34 A;  3NIA A;  1TDL A;  2FFF B;  3N6I A;  4EQI A;  1NYY A;  1BLC A;  3SH9 A;  4QU3 A;  4NK3 A;  3CMZ A;  5FQM A;  3GMW A;  4LCL A;  2V1Z A;  4BD0 A;  1XP4 A;  4QHC A;  2Y2H A;  5EE8 A;  1SDE A;  1PWC A;  5CHJ A;  2OSU A;  1SCW A;  4WZ5 C;  1ESU A;  5FQQ A;  4JBF A;  4OVD A;  5CER A;  4PM9 A;  3C4O A;  3BLS A;  3WWX A;  2BG1 A;  5HL1 A;  5GHZ A;  4PM7 A;  3OPR A;  4JXS A;  3G30 A;  3HRE A;  4WEL A;  2OLV A;  4JLF A;  4LEN A;  4JF6 A;  2V2F F;  5BOH A;  4K0W A;  5CEC A;  1FSY A;  2A3U A;  2FFY A;  2H10 A;  4GZB A;  3ITB A;  3ZGA B;  4N9L A;  1JWV A;  1XA7 A;  1E4D A;  3HLC A;  1PWG A;  4EV4 A;  4ZAM A;  2A49 A;  5GLA A;  2X01 A;  1IEL A;  1XA1 A;  5M1A A;  3W4Q A;  5FAQ A;  3E2K A;  3HBR A;  4P85 A;  3JYI A;  3NCK A;  3IHB A;  2H5S A;  5A92 A;  1YLY A;  4JKT A;  4X69 A;  2C5W B;  1GA0 A;  5I94 A;  1PZO A;  3DTM A;  2ZM0 A;  4OQG A;  3ZG8 B;  1PW8 A;  1GHM A;  3BFG A;  1MWT A;  3S1Y A;  4NET A;  4ZTK A;  1IEM A;  3SS4 A;  4S2N A;  4DDS A;  1CEF A;  3HL9 A;  3MZD A;  3Q7V A;  4BD1 A;  5DVA A;  2EX2 A;  2XFS A;  2WGV A;  2GDN A;  1KE0 A;  3BFF A;  1JTG A;  1OME A;  1EI5 A;  1FCN A;  2Y2K A;  2ZLY A;  1PWD A;  4GDB A;  4KZ7 A;  5EVI B;  4XXR A;  5FAT A;  4OPR A;  3G31 A;  5FI2 A;  3IWO A;  2J8Y A;  3N8S A;  3RJU A;  2ZM2 A;  5TR7 A;  4E6X A;  4O7D A;  1ZG6 A;  5FA7 A;  1M40 A;  4S2N C;  1Q2P A;  5EVL A;  3S4X A;  2HDS A;  2Z2L B;  3VP2 A;  4PPR A;  2WUQ A;  4KZ9 A;  3WRZ A;  2WAE A;  4S2P A;  2WZX A;  3LCE A;  4EWF A;  5A93 A;  1I5Q A;  2EFX A;  1JWP A;  4OP8 A;  3A3J A;  1YMX A;  4E3L A;  3C5A A;  4GD8 A;  3OPH A;  3M2K A;  5FQK A;  5HAR A;  5F1F A;  1G68 A;  4R1G A;  4GN2 A;  5E2F A;  1ERQ A;  4QB8 A;  3DWZ A;  2PU2 A;  4K91 A;  4LV2 A;  1KDS A;  4JXV A;  4MNR A;  4QD4 A;  4R0Q A;  2IWB A;  3UPN A;  3VSK A;  4BLM A;  4EBN A;  4IED A;  4H8R A;  4Y0T A;  5HFO A;  1HD8 A;  3BLM A;  3M6H A;  2ZC3 B;  4DF6 A;  1Q2Q A;  1W8Q A;  4YFM A;  5A91 A;  3RXX A;  2X02 A;  3WS0 A;  4ZDX A;  3MKE A;  1YLW A;  4DE2 A;  4DE1 A;  4E3N A;  3GQZ A;  2XDM A;  4BQM A;  5KMW A;  1PZP A;  2E8I A;  2P9V B;  4GD6 A;  4B4Z A;  3NDG A;  4ID4 A;  3OPP A;  4Z9Q A;  3SOI A;  4R3B A;  3ZG7 B;  2HDR A;  3WS5 A;  1VM1 A;  4R23 A;  4KG5 A;  5CED A;  5JYO A;  1ESI A;  1MXO A;  3OC2 A;  3WS4 A;  1K56 D;  1ES5 A;  1NZU A;  5FI6 A;  3QNB A;  4XUZ A;  3BEC A;  3UDX A;  3O86 A;  3A3F A;  4BL3 A;  4A5R A;  4QY6 A;  1E25 A;  1JVJ A;  3BFC A;  3NI9 A;  1W7F A;  1PI5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...