2WYXA

Neutron structure of a class a beta-lactamase toho-1 e166a r274n r276n triple mutant
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
256
structure length
256
Chain Sequence
b'VQQQLEALEKSSGGRLGVALINTADNSQILYRADERFAMCSTSKVMAAAAVLKQSESDKHLLNQRVEIKKSDLVNYNPIAEKHVNGTMTLAELGAAALQYSDNTAMNKLIAHLGGPDKVTAFARSLGDETFRLDRTAPTLNTAIPGDPRDTTTPLAMAQTLKNLTLGKALAETQRAQLVTWLKGNTTGSASIRAGLPKSWVVGDKTGSGDYGTTNDIAVIWPENHAPLVLVTYFTQPEQKAENRNDILAAAAKIVT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-LACTAMSE TOHO-1
publication title Neutron Diffraction Studies of a Class a Beta-Lactamase Toho-1 E166A R274N R276N Triple Mutant
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 90
structure length 256
sequence length 256
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2009-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2wyxA00
4RX2A 2VGKA 3ZVWA 2RL3A 1E3UD 5EECA 3IF5A 3NIAA 4OOYA 2QZ6A 4OKPA 4E3OA 3JYIA 3GV9A 3UPNA 1WYBA 2GDNA 5EOOA 4R0QA 2HP5A 2X71A 2R9XA 3GQZA 3ZG7B 4ZBEA 4N92A 1FCNA 1KE0A 5HAIA 4KQRA 1W79A 1K57A 1XPBA 2JE5A 1K54C 3CZDA 3PBOA 3Q1FA 4ID4A 3ZG8B 3E2LA 1LL5A 2C5WB 2Y2GA 3Q82A 4XXRA 4K0WA 1FCMA 1E3UA 2Y2MA 2UWXA 1RP5A 2PU4A 1ZG6A 1ZG4A 4OQGA 3ZG0A 3ZVTA 1W8YA 3N8RA 3RJUA 3OPPA 4GDBA 4LCMA 5GLCA 3ZCZA 3DTMA 4C3QA 1LI9A 1SDNA 1MWUA 3WS2A 5FI7A 3DW0A 4HBTA 1PZOA 1Y54A 3IXBA 4ZAMA 4WZ5A 4U0XA 1JWVA 4LV3A 1KVMA 4S2KA 1CI8A 3SS5A 5D3OA 1NZUA 1FR1A 2H10A 5FQKA 5GHYA 5TFQA 3V50A 1MPLA 3C7UA 4B4ZA 2X02A 4A5RA 5EVIB 2ZQDA 1VQQA 1BTLA 4KG2A 3V39A 1G68A 2HP6A 4KENB 4RVAA 2XFSA 1LHYA 1GHMA 2Y55A 2ZC4B 1FOFA 4WMCA 3UPPA 2FFFB 3O87A 3QHYA 1VM1A 1FCOA 1YLWA 2WK0A 1I5QA 4DF6A 2JC7A 4GN2A 4R4RA 5EVIC 4OQIA 3FV7A 1K6RA 3MKFA 3Q81A 5CGXA 4GOGA 4R3BA 5DVAA 3OCNA 4R1GA 1RGZA 3C4PA 3HLBA 1JVJA 4Y0TA 3MKEA 4P6BA 4E3NA 2WKHA 4EV4A 1WYCA 1BLHA 1DY6A 3NBLA 1ES4A 1LI0A 1W7FA 2V20A 5F1GA 1ONGA 1IKGA 2ZQ8A 1S0WA 4ZJ3A 4F94A 3LY3A 5DF8A 5IHVA 3NCKA 3BFCA 2XH9A 4JF4A 2EFXA 1PW1A 3UE0A 4BD1A 3Q7ZA 3W8KA 1IYSA 2H5SA 4OP5A 1GHPA 3PAEA 3IF6A 1GA9A 1PZPA 4ZJ2A 3M2JA 4PM8A 4NK3A 3VP4A 1GHIA 4GNUA 1BUEA 1MY8A 1TEMA 2V1ZA 2ZC3B 3N4IA 2DCFA 3ZG5A 4DKIA 1M40A 3MZFA 2JCHA 4GZBA 5U47A 4C75A 1GCEA 2WZXA 3D4FA 3OCLA 1EI5A 4QY6A 5CEBA 1SHVA 2RCXA 3BEBA 2EX8A 2G2UA 3HLCA 4LENA 2A49A 3EQUA 4LV0A 1IKIA 4NETA 1K56D 2A3UA 4JF6A 3VFHA 1ES3A 1BLSA 1TDLA 4OOLA 3S4XA 1QMFA 5M1AA 4RX3A 4X53A 2WAEA 2XD5A 5CHMA 3C5AA 4B88A 1S6RA 3O88A 1YM1A 3PBQA 1H8YA 4PM9A 3QNBA 4QJGA 3RXXA 4WELA 2WADA 5HFOA 4WEJA 4WBGA 4DRTA 3UDXA 4OONA 5HARA 2PU2A 2X01A 2Z2LB 3SS3A 4EQIA 4E3IA 3HLGA 1Q2PA 4S2JA 1K56A 2Y4AA 4KZ9A 5KSCA 1L0DA 1BT5A 4HBUA 5E43A 2XLNA 1IYQA 3LEZA 1ES5A 3SH9A 5A90A 3OC2A 3WRTA 4UA6A 5HAPA 4PM5A 4KQQA 4QD4A 1K6SA 3SOIA 4IEDA 5FQQA 3DWKA 4M3KA 3UNWA 3MZDA 4BLMA 1MWRA 2WGVA 2FFYA 1K4EA 5F83A 4E3LA 1MBLA 1MWTA 3BLMA 5EE8A 1YQSA 4UHUA 5AQAA 5EVLA 1I2WA 4OLDA 4RA7A 2HP9A 1LLBA 1WE4A 3Q7VA 4FD8A 1SCWA 4XUZA 1FQGA 1KE3A 1ZKJA 2XDMA 3B3XA 3A3EA 4PMAA 1YLPA 5AQ9A 5FSRA 1HTZA 1G6AA 1IEMA 4X69A 5GLDA 3WWXA 3UPOA 2XFTA 4N1XA 3FKWA 3ZNTA 1YLZA 2H0YA 4KZ7A 1PWDA 2Y2OA 2H0TA 1K25A 3V3RA 5FI2A 1XXMA 4JBFA 5DF7A 3IQAA 3AGDA 5CGSA 4Y0UA 5FATA 2Y2NA 4H8RA 3IF6B 1NZOA 5CEDA 4EUZA 4HEFA 4WMCD 5A91A 4WZ4A 4S2MA 4JXWA 1RCJA 4D2OA 3M6HA 4E6XA 3W4PA 1ESIA 5J8XA 3VMAA 5HAQA 5FQ9A 4Q8IA 2HDQA 5HW3A 3HUOA 1TVFA 3Q07A 4QB8A 1BSGA 1O7EA 3MZEA 2R9WA 3PBNA 3LY4A 5TR7A 1HD8A 3IH9A 3IWOA 3HLEA 2WUQA 4PPRA 1MKIA 2ZM8A 1C3BA 1JWZA 3OPHA 5JYPA 2JBFA 4GD6A 4KG6A 4BD0A 3EQVA 2BG1A 1XKZA 1NRFA 1XGJA 1K4FA 5KSHA 3HVFA 5TGFA 5GL9A 3VSLA 3A3FA 5E2GA 2ZQAA 3G30A 3N8LA 4JXGA 3P98A 4OH0A 3S22A 1KDWA 2WZZA 3IWQA 3A3JA 3ZDJA 2EX6A 5A92A 1PI5A 1K55A 4CJNA 4KZ3A 1KVLA 3BFFA 3GMWA 3FWLA 4WM9A 1TDGA 1DJAA 2XGNA 3LO7A 4IVKA 1ES2A 1KGFA 2WGWA 3MBZA 3UE1A 4LCLA 2XEPA 5E2EA 2Y59A 2WKIA 4U0TA 4DXBA 5FQMA 3O3VA 1LL9A 1K54A 5GHZA 4EWFA 3VOZA 3SH8A 4DDSA 2EX2A 2P9VA 4S2IA 3Q7VB 4KZ8A 4O7DA 1ERMA 4CPKA 4OLGA 1FSYA 4OPZA 5CHUA 3BFGA 3PTEA 1JTDA 2Z2MB 5DTSA 5CERA 3V3SA 4IVIA 1DJBA 3E2KA 1BZAA 2C6WB 3IWIA 5EVID 3UY6A 4DE2A 1K38A 1KGEA 1PYYA 3CJMA 3G2ZA 1E4DA 3G31A 3HUMA 5FASA 2J9OA 2WYXA 3W4QA 3PBSA 3VP3A 1PWCA 5GLBA 3WS1A 4EBPA 4UAAA 1ZC2A 1K57C 3BECA 3FYZA 1ONHA 4MBKA 2CC1A 5I94A 1IELA 1XA7A 1BULA 1JWPA 3IHBA 4IBRA 2Q9MA 2WGIA 5GHXA 5F1FA 3NY4A 1E25A 4MBHA 4KQOA 5E2HA 2DNSA 4YINA 1YLTA 1CEGA 5EVIA 2WAFA 5E2FA 2OLUA 2V2FF 4JF5A 5CHJA 5HL1A 1J9MA 3HLFA 2OSUA 4WYYA 3GTCA 3WS4A 1IYOA 4WZ5C 2EX9A 5FDHA 3N7WA 3PAGA 3SH7A 3M6BA 4R3JA 3BFDA 2Y2HA 2ZD8A 4S2OA 3G34A 3ZGAB 3BFEA 3BLSA 4PM7A 3ZNYA 4BJPA 1Z6FA 1SDEA 2QMIA 1BLPA 3HREA 3TSGA 4GDNA 5KZHA 1HVBA 1MWSA 1XA1A 2ZM2A 4S2PA 4P0MA 2HDSA 5EUAA 5A93A 2ZC6B 4QY5A 1HZOA 3IXDA 4KZBA 5DF9A 4S2NA 4B4XA 2IWDA 3IHAA 3GSGA 2Y2QA 3ITAA 3MFDA 2WKEA 1YLYA 3C7VA 2ZM0A 5AQBA 3FKVA 5L2FA 4JKTA 1IYPA 2I72A 4GB7A 4BL2A 2EXAA 1H8ZA 4JPMA 3M2KA 2Y91A 5GLAA 3HUNA 2OV5A 3A3IA 1NYMA 4GKUA 3ZG9B 3UN7A 1CI9A 3C4OA 1PIOA 4N9KA 5AQ7A 3ZFZA 3NI9A 5CTNA 2WGWB 4OQ0A 3SS4A 1L2SA 4BENA 5HX9A 5KMWA 3N8SA 5FA7A 1XGIA 2XF3A 3IH8A 1DJCA 3S1YA 3UE3A 5BOHA 2E8IA 1K55C 3G35A 3ISGA 5FAPA 2BLSA 4UA7A 3IXGA 5FAQA 1Q2QA 2P9VB 1L0GA 2Y2IA 3IF6C 4EBLA 3VSKA 5CTMA 1NY0A 4BL3A 1XX2A 2Y2JA 1NJ4A 2J7VA 2B5RA 3NDEA 1BLCA 5FQJA 1YLJA 4S2LA 4FH4A 4MLLA 2EFUA 4E3JA 1GA0A 4KZAA 3G32A 1CK3A 3BRMA 1XP4A 3FZCA 3G2YA 3UO9A 3ZHHA 2ZQCA 3HL9A 4MEZA 1L0EA 3P09A 3BM6A 5EOEA 1FR6A 1NXYA 2XR0A 5FI6A 2EXBA 1I2SA 5FAOA 2G2WA 1RGYA 3OPLA 4OPQA 3I7JA 1AXBA 5DTKA 3G4PA 3RXWA 1KDSA 1N4OA 3GR2A 1NYYA 4HESA 4P87A 1W8QA 1W5DA 4KG5A 2ZJ9A 4FCFA 4L0LA 3PBRA 3CG5A 1PWGA 2ZQ9A 2Q9NA 3NDGA 5FQIA 4P85A 5M18A 4IBXA 4Y7PA 1FSWA 4XUXA 3MXSA 4QHCA 2IWCA 4X56A 2Y2LA 4KZ4A 4UA9A 4EBNA 1EWZA 3HLWA 4R4SA 3VP1A 5M19A 4Y0OA 2Y2PA 3NC8A 1M6KA 1U60A 3ITBA 3O86A 1PI4A 3QNCA 1O07A 2P74A 5CECA 3MXRA 3VP0A 1OMEA 4X6TA 3TG9A 4DXCA 3BYDA 2HDUA 5DTTA 3W4OA 3WS5A 4LV2A 3OPRA 4YFMA 4ZTKA 5F82A 3AGEA 2OLVA 4S2NC 4U3TA 4RYEA 1YMXA 3DWZA 4KZ6A 4E6WA 1MXOA 3GRJA 4K0XA 1CEFA 4KZ5A 4N9LA 4OPRA 2XQZA 2DRWA 3OZHA 1ALQA 4OPYA 5EPHA 2XK1A 2PBYA 1N9BA 1H5XA 4PM6A 1ERQA 4OOMA 4R23A 1QMEA 2XD1A 4JXVA 3GVBA 4K91A 3VP2A 4ZJ1A 1EROA 1ESUA 2ZC5B 4DDYA 4DE0A 3UDIA 4OQHA 4OVDA 3LCEA 3PBTA 3N6IA 5G18A 3WS0A 3UDFA 1JTGA 2ZC7A 4QU3A 4FH2A 1YMSA 1KE4A 1SKFA 2HPBA 3AGFA 4Z9QA 4MBFA 2HDRA 3V5MA 3IXHA 4OP8A 4JLFA 2ZLYA 4N1HA 5CGWA 2QPNA 5JYOA 1PW8A 2J9PA 3CMZA 4GD8A 4WEKA 4MNRA 4DE3A 4E3MA 4DE1A 3IT9A 2Y2KA 3HBRA 2J8YA 4E3KA 4ZDXA 1KGGA 2VGJA 3VFFA 5CRFA 4JXSA 3VOYA 2ZMAA 2ZQ7A 1YT4A 2IWBA 3TOIA 4X55A 4C6YA 4BQMA 5CXWA 4LV1A 3WRZA 1L0FA 4FSFA 4X68A 3A3DA 3HLDA
chains in the Genus database with same CATH superfamily
2VGKA 3ZVWA 3IF5A 3NIAA 3LIAA 3EEAA 2VJWA 3ULFA 2WKPA 2XROA 2X71A 2PR5A 3GDIA 1YSQA 1XPBA 3ZG8B 3CZDA 4LLOB 2FH5A 1FCMA 2Y2MA 4R70A 2UWXA 1X0OA 2OAQ1 4MN6A 3RJUA 2W3GA 4LCMA 5GLCA 3ZCZA 5IT5A 3WS2A 3DW0A 1PZOA 1Y54A 4U0XA 3E4QA 3SS5A 1NZUA 5FQKA 5GHYA 5TFQA 2X02A 1VQQA 4KG2A 3V39A 1G68A 2HP6A 2VKSA 4WMCA 3O87A 1FCOA 2WK0A 3G6OA 1UWPX 1YPRA 2JC7A 4GN2A 1K6RA 2PYPA 5DVAA 4R1GA 4I3AA 4YWZA 3BQ8A 3HLBA 4Y0TA 3MKEA 4E3NA 2WKHA 1WYCA 1BLHA 1UWNX 4ZJ3A 2ZQ8A 2VV6A 3OBFA 1PW1A 3B33A 3IF6A 4Y5FA 5HWVA 2JKRM 3IS2A 3K2NA 3VP4A 3NULA 1TEMA 2ZL1A 2V1ZA 5HPIA 2ZC3B 3CLOA 4DKIA 4GZBA 4C75A 3OCLA 5CEBA 4HY8A 4LENA 4UEYA 2A49A 1ES3A 2HF6A 4OOLA 3S4XA 5CHMA 4MN7A 4B88A 3PBQA 2EWVA 3RXXA 4HJ6A 2D02A 4EESA 5HARA 3SS3A 4I3IA 4S2JA 1K56A 2O99A 2A24A 3LR3A 3K3DA 1W63Q 5E43A 1ES5A 5A90A 3MQ0A 3SOIA 2ZMFA 4BLMA 2WGVA 1MBLA 3CUEC 4UHUA 2O0YA 4BMWA 1I2WA 3Q7VA 3PHYA 4XUZA 3B3XA 1XFNA 5GLDA 4X69A 3WWXA 2XFTA 3LR0A 1SKOA 3P01A 2Y2OA 2V8FA 1K25A 1P0ZA 1XXMA 5DKLA 5CGSA 3RH8B 4H8RA 1W63M 3EGDC 2J3TD 3PXPA 3T4TA 4JXWA 2OOLA 1RCJA 4D2OA 2V0WA 4GW9A 4G3WA 2L0WA 1NLYA 2GJ3A 3SW1A 4QB8A 5HL6A 2R9WA 2Y79A 2WUQA 1H0MA 1WA9A 4GD6A 4WLAA 2BG1A 4HIAA 5KSHA 2K7SA 4L9FA 3A3FA 3P7NA 2JKTI 2WZZA 2KLIA 2OWJA 4HOIA 2EX6A 3A0VA 3GMWA 3FWLA 1TDGA 1ES2A 1KGFA 2WGWA 3MBZA 4LCLA 4ETXA 2XEPA 5E2EA 4U0TA 3O3VA 1F2KA 5K5BA 4DDSA 5F69A 3SH8A 2EX2A 4S2IA 1ERMA 4K08A 2PYRA 1KOUA 5CERA 3V3SA 3E2KA 3C38A 3H82B 1PYYA 3FPWA 2J9OA 2WYXA 3PYPA 4UAAA 3BECA 2CC1A 5I94A 4NKPA 3NY4A 2W3DA 2V2FF 5HL1A 2IA2A 3EEHA 3HLFA 4WYYA 3N7WA 3PAGA 1T1AA 3MFXA 5HDSA 3BFDA 5HSQA 3G34A 3BLSA 1J3WA 3HREA 1HVBA 4S2PA 4P0MA 5EUAA 2ZC6B 4QY5A 4I3JA 4KZBA 2Z6CA 3IHAA 3GSGA 1OTIA 5AQBA 2WKEA 4FOFA 3FKVA 4BL2A 2I72A 4GB7A 2EXAA 1ZHHB 1H8ZA 3HJKA 2OV5A 4LGWA 4GKUA 3UN7A 4G3KA 1CI9A 3C4OA 3ZFZA 4QWOA 4IUKA 2NUTC 3SS4A 2BASA 3N8SA 1P97A 2XF3A 1DJCA 4Y2FA 2E8IA 3IS2B 3ISGA 2BLSA 4B9OA 3IXGA 5FAQA 2VV8A 1LSWA 2Y2IA 1L0GA 3IF6C 3VSKA 1DP9A 2Y2JA 1NJ4A 2J7VA 3NDEA 5FQJA 3G32A 3FZCA 1OPXA 2YKFA 5AJGA 4NXEA 5EOEA 3VE4A 1FR6A 2XR0A 2EXBA 4Z1WA 2B95A 5FAOA 1RGYA 1AXBA 3RXWA 2W1TA 1KDSA 3GR2A 4HESA 3F1PA 1YAXA 4L0LA 4MN5A 3PBRA 3CG5A 2VLGA 1PWGA 1XJ3A 4P85A 4IBXA 4JGQA 3SZTA 4DMZA 1DP8A 4KZ4A 2Y2PA 5A8BA 3ITBA 3MXRA 4X6TA 4LV2A 3RTYA 5EM0A 4ZTKA 5F82A 3AGEA 4U3TA 2HJ9C 3DWZA 2DRWA 1Y4OA 4ETZA 4OPYA 5EPHA 1N9BA 4IJGA 3GVBA 4K91A 3MSHA 1ESUA 2JKRI 4DE0A 1G28A 4OQHA 3PBTA 3N6IA 5G18A 2PAVP 2V8CA 1YMSA 4LRXC 2HPBA 4X25A 5CGWA 2VX8A 5JYOA 3VE3A 2J8YA 1IOUA 3V67A 3IX4A 4GCZA 4JXSA 3VOYA 1YT4A 4X55A 4C6YA 3MF0A 1L0FA 4X68A 3IX3A 5G4YA 4OKPA 3RFBA 3MJQA 4GS9A 2HP5A 3GQZA 4Y17A 4N92A 5F5YA 5TBMB 3PBOA 3Q1FA 4PKYA 3E2LA 1LL5A 3Q82A 1ZG6A 3OPPA 4GDBA 1MWUA 5FI7A 3IXBA 4HI4A 3KYQA 4WZ5A 2VV7A 3E98A 4LV3A 4S2KA 3T1RA 5D3OA 3FG8A 1FR1A 1MPLA 1BTLA 4EERA 4KENB 1GHMA 2Y55A 3UPPA 1I5QA 4OQIA 4P6ZS 2XA7S 3FV7A 3MKFA 3BW6A 3OCNA 1DRMA 3CHWP 3NBLA 1YKDA 4WN5A 4JF4A 3T1XA 2H28A 3UE0A 4XT2A 4BD1A 2VGLM 3M2JA 4PM8A 2W27A 4GNUA 1MY8A 3N4IA 2DCFA 2WZXA 4QY6A 1EI5A 4OOYA 2EX8A 2G2UA 1IKIA 1K56D 1BLSA 1TDLA 4RX3A 2WAEA 4Q0HA 2MJ6A 2Y8HA 2ZOHA 3C5AA 3A0RA 2PD7A 3O88A 1H8YA 3LIFA 4R6LA 4PM9A 3QNBA 4HH3A 5HFOA 4DRTA 4WEJA 2PU2A 2X01A 2Z2LB 2ZBBA 4EQIA 4KZ9A 3T4JA 1L0DA 3S7NA 2XLNA 4EUVA 1IYQA 3LEZA 5J3WA 4X1MA 3WRTA 2W1TB 4QD4A 4IEDA 4M3KA 3UNWA 3MZDA 3EOIA 3NECA 5F83A 2V1BA 4EEPA 4OLDA 4FD8A 5MC7A 1FQGA 1KE3A 1ZKJA 2XDMA 2M7VA 2YKHA 1YLPA 4LRYC 1G6AA 4FUWA 1MZUA 4N1XA 3ZNTA 1YLZA 3T4LA 2H0YA 4KZ7A 1PWDA 3H82A 5EV0A 3V3RA 2UV0E 3KYZA 5DF7A 3IQAA 3LFVA 5FATA 5A91A 1Y28A 4S2MA 3UB7A 1TVFA 1BSGA 1O7EA 3PBNA 1TD5A 3IWOA 3LIDA 1LSXA 3HLEA 1MKIA 4EW7A 1F5MA 2JBFA 4KG6A 1XGJA 3B47A 2VA0A 3VSLA 2E8JA 3BY9A 3JPUA 3G30A 3N8LA 4MCWA 5A92A 1S1YA 5J7EA 1KVLA 2VK3A 4IVKA 1HLUP 2Q0OA 4HNBA 2Y59A 5FQMA 5HD5A 3D3OA 1K54A 3LI8A 1LT0A 4KZ8A 5L07A 1FSYA 4OPZA 2ACGA 1OT9A 4GS9B 1P9WA 5DTSA 2QJ5A 2D01A 3CJMA 4LPZA 3G2ZA 1H3QA 5FASA 4UQIS 3VP3A 1PWCA 3WS1A 4EBPA 1ONHA 1IELA 1JWPA 2WGIA 4D60A 3E4OA 3TRCA 5GHXA 4KQOA 1H8MA 5E2HA 2B02A 2DNSA 1CEGA 5EVIA 2WAFA 3T12B 1J9MA 3GTCA 4WZ5C 2EX9A 3SH7A 2Y2HA 2W1RA 5HWTA 3ZGAB 1BLPA 4CLCB 5KZHA 1MWSA 3NHQA 4NXFA 3IXDA 3C8CA 3ITAA 4CLCC 1EW0A 3NOPC 3M2KA 3QP8A 5GLAA 3HUNA 1BYWA 2HJEA 3S7OA 1NWZA 4XT2B 5CTNA 5CX7A 4OQ0A 5HX9A 4CQHA 5KMWA 3UE3A 3S1YA 5BOHA 1S4RA 2ZOIA 4UA7A 5TJJA 2P9VB 1NY0A 4BL3A 3MQOA 2EFUA 1GA0A 4KZAA 3BRMA 1XP4A 3G2YA 2LB9A 3HL9A 4PKYG 3BM6A 4CLCE 2A2LA 3D9YA 1NXYA 3I7JA 3T50A 1YSPA 1D1JA 2O9BA 4LRZE 1NYYA 2K2NA 1V9YA 2Q9NA 4WF0A 4XUXA 3MXSA 4QHCA 4X56A 2Y2LA 1EWZA 3LGOA 5F6AA 2GX5A 4Y0OA 2WKQA 3UMDA 3NC8A 1U60A 5TBMA 4DXCA 2KX6A 3CWFA 2HDUA 3FPVA 3W4OA 3WS5A 4YFMA 1MXOA 1G6OA 4ARZA 2XQZA 1L3LA 3BJNA 3U4LP 4HH2A 3R7WB 4PM6A 2PBYA 2PD8A 3NOUC 4ZJ1A 3LIEA 3UDFA 2ZC7A 4QU3A 3AGFA 5KIZA 1N9LA 4MBFA 1T1CA 2HDRA 3JVVA 1F98A 3IXHA 2ZLYA 4N1HA 2QPNA 2J9PA 1S4SA 4GD8A 4WEKA 5HD3A 4E3MA 4DE1A 5L10A 3HBRA 4E3KA 4ZDXA 1KGGA 1FILA 2VGJA 4L9GA 1NRJA 5CRFA 2IWBA 3WRZA 4RX2A 5EECA 2QZ6A 3T1QB 4E3OA 3JYIA 3GV9A 2GDNA 2R9XA 3ZG7B 1S67L 5HDDA 1FCNA 3U2AA 1KE0A 5HAIA 4KQRA 1W79A 1K54C 1E3UA 1FIKA 4OQGA 2PHYA 3ZG0A 1ZG4A 3ZVTA 5DFXA 1W8YA 4O0PA 2QYBA 1LI9A 1SDNA 3DAVA 2L4RA 2H10A 3BWLA 3CPTB 3MS6A 3C7UA 5EVIB 2ZQDA 3D72A 2EA9A 2JN7A 4O01A 2V0UA 1FOFA 2GNXA 3QHYA 1OTBA 3KSHA 1YLWA 4DF6A 5EVIC 2I9VA 4R3BA 1N9NA 1XFQA 3C4PA 1JVJA 4P6BA 4EV4A 1DY6A 1W7FA 2V20A 1ONGA 1IKGA 5DF8A 5IHVA 1ODVA 4Q0IA 2EFXA 3W8KA 3PAEA 2W3HA 4BBUA 1GA9A 3QP1A 1M40A 3MZFA 5U47A 4R38A 3D4FA 5AVFA 4MDZA 1SHVA 2RCXA 3BEBA 1GSXA 3EQUA 1MKMA 2A3UA 1QMFA 5M1AA 4X53A 3CAXA 3FC7A 4Q0JA 1S6RA 1YM1A 3QP6A 4Y3IA 4II7A 4WELA 4OONA 4MMNA 1S66L 4E3IA 4KUKA 5KSCA 4HBUA 2PBDP 3UE6A 1ACFA 3OC2A 1K6SA 2QKPA 3DWKA 2P04A 4EU0A 1MWRA 1K4EA 4E3LA 1MWTA 5EVLA 4RA7A 2HP9A 1LLBA 5FEGA 5AVEA 1SCWA 4IHQA 4GJ4A 4PMAA 4H6JB 1IEMA 3ZYTA 3QP2A 5FI2A 3KSFA 4F3LA 4HJ4A 3R4KA 2FZ0A 5CEDA 4EUZA 3T4OA 1T18A 4WMCD 5L8MA 4WZ4A 4ARZB 2OAP1 3M6HA 3W4PA 5J8XA 3VMAA 3KO6A 4Q8IA 2HV1A 5HW3A 2XRNA 3LY4A 5TR7A 1HD8A 5EM1A 4PPRA 2ZM8A 4ZRRA 1F9IA 5EFWA 5JYPA 3C30A 2J3WA 4CLCA 5EVEA 4BD0A 3EQVA 1XKZA 1NRFA 1K4FA 4B93A 5TGFA 3F1NA 5GL9A 4YOFA 1UGUA 2ZQAA 4ESPA 4KQDA 4JXGA 2GZAA 3A3JA 3ZDJA 1PI5A 3BFFA 1TS8A 1DJAA 2XGNA 3UE1A 3T1SA 1LL9A 1LL8A 2P9VA 3E0YA 4CPKA 4OLGA 4AFIA 5CHUA 3O5YA 1LSVA 4YNRA 1PRQA 1BZAA 3IWIA 5EVID 3UY6A 4DE2A 1K38A 1E4DA 3HUMA 5GLBA 1TS6A 4NXBA 2B18A 3FYZA 5FDSA 4MBKA 1XA7A 4IBRA 5FEFA 5F1FA 1CQAA 4YINA 1MC0A 3KSIA 4JF5A 2W3FA 3TE8A 3UB9A 5FDHA 3LYXA 1T19A 4R3AA 4WUJA 3M6BA 4R3JA 3B42A 2QMIA 1SDEA 3TSGA 1D7EA 4GDNA 1XA1A 2ZM2A 2HDSA 2J3TC 5DF9A 3JVUA 4B4XA 2IWDA 3LIBA 3MFDA 2Y2QA 4HJ3A 3C7VA 2ZM0A 4JKTA 1IYPA 3UB6A 4JPMA 1GSVA 3A3IA 3ZG9B 1PIOA 4E04A 1L2SA 2INWA 4BENA 5FA7A 1XGIA 4EEUA 5FAPA 1K55C 3R7WA 3MXQA 3DTIA 3PR6A 4EBLA 2JKFA 5CTMA 1XX2A 1VB6A 1BLCA 2VEAA 1YLJA 2DMWA 4S2LA 5DKKA 3W2ZA 3UO9A 3ZHHA 3QP5A 1L0EA 2QJ7A 4HQAA 2KOIA 5DTKA 3G4PA 1N4OA 3H7WA 3CI6A 1W8QA 4FCFA 2ZQ9A 4GHIB 4Y7PA 1FSWA 4NG2A 4UQIM 4EBNA 3VP1A 3O86A 1O07A 4L9EA 3VP0A 3TG9A 3BYDA 3LR4A 2OLVA 5HPFA 4S2NC 1YMXA 4KZ6A 3GRJA 4K0XA 4F3LB 4N9LA 4OPRA 3GECA 1ZTUA 3OZHA 3ICYA 3KX0X 4NXGA 2KDKA 1ERQA 4OOMA 3CPTA 1TS0A 4DJ2A 3VP2A 1EROA 2J80A 2K31A 1XJ4A 4DDYA 3WS0A 4FH2A 1SKFA 4GLQA 3V5MA 4PHTA 3BY8A 1PFLA 4JLFA 1XJ6A 4JGPA 5IU1A 3F1NB 1Z09A 4ME4A 3IT9A 5HDCA 2Y2KA 4BQMA 1CF0A 2Z6DA 4LV1A 3HLDA 2RL3A 1E3UD 4LFUA 3VV4A 1VEUB 4Y15A 3LEQA 4G3VA 4HHDA 2HGVA 3UPNA 1WYBA 5EOOA 4R0QA 4JGRA 4ZBEA 3DBAA 1K57A 2JE5A 4ID4A 2C5WB 2Y2GA 4XXRA 2M7UA 4K0WA 1RP5A 2PU4A 2ZMVA 4IUHA 1VETB 3N8RA 4C3QA 3DTMA 4HBTA 4ZAMA 1JWVA 4PAUA 1KVMA 1CI8A 3EWKA 2WKRA 3V50A 1V9ZA 4B4ZA 4A5RA 4RQ9A 3C2WA 2BTFP 4RVAA 2XFSA 1LHYA 2ZC4B 3HCYA 2FFFB 3A3DA 1VM1A 1STZA 4R4RA 3S7QA 3Q81A 5CGXA 4GOGA 1RGZA 1D06A 4H6JA 2XSSA 1ES4A 1LI0A 5F1GA 1S0WA 2W0NA 3UB8A 3LY3A 4F94A 1SZVA 3NCKA 3BFCA 2XH9A 3Q7ZA 1IYSA 2H5SA 4OP5A 1GHPA 4EXOA 1PZPA 4ZJ2A 2QHKA 1TF1A 4NK3A 1GHIA 1BUEA 3H9WA 4HP4A 3LUQA 3S7PA 3ZG5A 2JCHA 1GCEA 4LV0A 3HLCA 4NETA 2EWWA 4JF6A 3VFHA 3CITA 3UMEA 2XD5A 3IBJA 3LICA 4BWIA 4QJGA 2WADA 4WBGA 3UDXA 5IS1A 3OOVA 3HLGA 1Q2PA 2Y4AA 5F68A 1BT5A 3SH9A 5G4ZA 4UA6A 5HAPA 5FL3A 4PM5A 4KQQA 5FQQA 1N9OA 3H7WB 1GSWA 2FFYA 3BLMA 5EE8A 1YQSA 3A0SA 5AQAA 1A0KA 1WE4A 4BBVA 2JHEA 2PR6A 3LI9A 3A3EA 5AQ9A 1T1BA 5FSRA 1HTZA 3MMHA 3UPOA 4Y13A 3FKWA 2H0TA 2QWSA 2W3EA 4JBFA 3AGDA 4Y0UA 1PNEA 2Y2NA 3IF6B 1NZOA 4HP9A 4HEFA 5C5KA 4M4XA 4CLCD 2ZL1B 4E6XA 1ESIA 5HAQA 5FQ9A 2HDQA 1VHMA 2L1MA 3HUOA 3Q07A 3T4SA 3E4PA 3MZEA 3ZQ5A 5DFYA 1DP6A 3IH9A 3TW8A 5I5LA 1C3BA 4I38A 3NOTC 1JWZA 3OPHA 1TS7A 4KUOA 3HVFA 5HWWA 5E2GA 2LB5A 1OJGA 2A24B 3F1OA 4OH0A 3P98A 4BBTA 3S22A 1KDWA 3IWQA 4DJ3A 3MQQA 1K55A 4CJNA 4KZ3A 4WM9A 3L7HA 3LO7A 3OLOA 2PDRA 2WKIA 4DXBA 2O9CA 5GHZA 4EWFA 3VOZA 3Q7VB 4O7DA 5J4EA 1K0KA 3BFGA 3EGXC 3PTEA 3K3CA 1JTDA 2Z2MB 2NUPC 3T4KA 4IVIA 1DJBA 3QP4A 2C6WB 1SKOB 1KGEA 4I39A 3G31A 3UB5P 3W4QA 3PBSA 1ZC2A 1K57C 1OT6A 1BULA 3IHBA 2Q9MA 1E25A 4MBHA 1YLTA 5E2FA 2OLUA 5CHJA 2OSUA 1JNUA 3NJAA 3WS4A 1IYOA 1OJ5A 4GHIA 3T4QA 2ZD8A 3IX8A 3BFEA 4PM7A 3ZNYA 4BJPA 1Z6FA 1P9RA 4WL9A 5A93A 1HZOA 4S2NA 4I5SA 1YLYA 4QPRA 2P08A 5L2FA 2Y91A 1NYMA 1CJFA 5AQ7A 4N9KA 2PRFA 3NI9A 2WGWB 3IH8A 4P6ZM 3G35A 2XA7M 1OTDA 1S1ZA 3KYEA 3VOLA 1Q2QA 2OWHA 3MR0A 2V9AA 2B5RA 2R78A 4FH4A 4MLLA 4E3JA 2JKTM 5HZHA 4EQ1A 1CK3A 2ZQCA 2O9AA 4MEZA 5DJTA 3L9KA 3P09A 5FI6A 1I2SA 2G2WA 3OPLA 4OPQA 5DJUA 3CUEA 3DTKA 1AWIA 4P87A 1W5DA 4KG5A 2ZJ9A 2P7JA 3NDGA 5FQIA 5M18A 1VEUA 2IWCA 2HZ5A 2VZWA 4UA9A 4DN0A 3HLWA 2M1CA 4R4SA 3TJZC 5M19A 5LBRA 2AVXA 3BQAA 1M6KA 1OTAA 3QNCA 1PI4A 2P74A 5CECA 1OMEA 2V1AA 5DTTA 3OPRA 3DTEA 1VETA 4RYEA 4E6WA 1CEFA 4KZ5A 1ALQA 4X1LA 1OTEA 2XK1A 1H5XA 4FTXA 4R23A 1QMEA 2XD1A 4JGOA 4JXVA 2ZC5B 1G5UA 3KSGA 2JKGA 3UDIA 1IFQA 2VGLS 4OVDA 3LCEA 4NEED 1JTGA 1NLZA 2CMNA 2PT7A 1KE4A 4Z9QA 3HJIA 2G7UA 1XJ2A 4OP8A 5L09A 4EETB 3LR5A 1PW8A 3CMZA 4MNRA 4DE3A 4O8GA 3IBRA 3F1OB 3VFFA 2ZMAA 2ZQ7A 3F1PB 3TOIA 5CXWA 4FSFA 4S2OA
chains in the Genus database with same CATH topology
4RX2A 2VGKA 3ZVWA 2RL3A 1E3UD 5EECA 3IF5A 3NIAA 4OOYA 2QZ6A 4OKPA 4E3OA 3JYIA 3GV9A 3UPNA 1WYBA 2GDNA 5EOOA 4R0QA 2HP5A 2X71A 2R9XA 3GQZA 3ZG7B 4ZBEA 4N92A 1FCNA 1KE0A 5HAIA 4KQRA 1W79A 1K57A 1XPBA 2JE5A 1K54C 3CZDA 3PBOA 3Q1FA 4ID4A 3ZG8B 3E2LA 1LL5A 2C5WB 2Y2GA 3Q82A 4XXRA 4K0WA 1FCMA 1E3UA 2Y2MA 2UWXA 1RP5A 2PU4A 1ZG6A 1ZG4A 4OQGA 3ZG0A 3ZVTA 1W8YA 3N8RA 3RJUA 3OPPA 4GDBA 4LCMA 5GLCA 3ZCZA 3DTMA 4C3QA 1LI9A 1SDNA 1MWUA 3WS2A 5FI7A 3DW0A 4HBTA 1PZOA 1Y54A 3IXBA 4ZAMA 4WZ5A 4U0XA 1JWVA 4LV3A 1KVMA 4S2KA 1CI8A 3SS5A 5D3OA 1NZUA 1FR1A 2H10A 5FQKA 5GHYA 5TFQA 3V50A 1MPLA 3C7UA 4B4ZA 2X02A 4A5RA 5EVIB 2ZQDA 1VQQA 1BTLA 4KG2A 3V39A 1G68A 2HP6A 4KENB 4RVAA 2XFSA 1LHYA 1GHMA 2Y55A 2ZC4B 1FOFA 4WMCA 3UPPA 2FFFB 3O87A 3QHYA 1VM1A 1FCOA 1YLWA 2WK0A 1I5QA 4DF6A 2JC7A 4GN2A 4R4RA 5EVIC 4OQIA 3FV7A 1K6RA 3MKFA 3Q81A 5CGXA 4GOGA 4R3BA 5DVAA 3OCNA 4R1GA 1RGZA 3C4PA 3HLBA 1JVJA 4Y0TA 3MKEA 4P6BA 4E3NA 2WKHA 4EV4A 1WYCA 1BLHA 1DY6A 3NBLA 1ES4A 1LI0A 1W7FA 2V20A 5F1GA 1ONGA 1IKGA 2ZQ8A 1S0WA 4ZJ3A 4F94A 3LY3A 5DF8A 5IHVA 3NCKA 3BFCA 2XH9A 4JF4A 2EFXA 1PW1A 3UE0A 4BD1A 3Q7ZA 3W8KA 1IYSA 2H5SA 4OP5A 1GHPA 3PAEA 3IF6A 1GA9A 1PZPA 4ZJ2A 3M2JA 4PM8A 4NK3A 3VP4A 1GHIA 4GNUA 1BUEA 1MY8A 1TEMA 2V1ZA 2ZC3B 3N4IA 2DCFA 3ZG5A 4DKIA 1M40A 3MZFA 2JCHA 4GZBA 5U47A 4C75A 1GCEA 2WZXA 3D4FA 3OCLA 1EI5A 4QY6A 5CEBA 1SHVA 2RCXA 3BEBA 2EX8A 2G2UA 3HLCA 4LENA 2A49A 3EQUA 4LV0A 1IKIA 4NETA 1K56D 2A3UA 4JF6A 3VFHA 1ES3A 1BLSA 1TDLA 4OOLA 3S4XA 1QMFA 5M1AA 4RX3A 4X53A 2WAEA 2XD5A 5CHMA 3C5AA 4B88A 1S6RA 3O88A 1YM1A 3PBQA 1H8YA 4PM9A 3QNBA 4QJGA 3RXXA 4WELA 2WADA 5HFOA 4WEJA 4WBGA 4DRTA 3UDXA 4OONA 5HARA 2PU2A 2X01A 2Z2LB 3SS3A 4EQIA 4E3IA 3HLGA 1Q2PA 4S2JA 1K56A 2Y4AA 4KZ9A 5KSCA 1L0DA 1BT5A 4HBUA 5E43A 2XLNA 1IYQA 3LEZA 1ES5A 3SH9A 5A90A 3OC2A 3WRTA 4UA6A 5HAPA 4PM5A 4KQQA 4QD4A 1K6SA 3SOIA 4IEDA 5FQQA 3DWKA 4M3KA 3UNWA 3MZDA 4BLMA 1MWRA 2WGVA 2FFYA 1K4EA 5F83A 4E3LA 1MBLA 1MWTA 3BLMA 5EE8A 1YQSA 4UHUA 5AQAA 5EVLA 1I2WA 4OLDA 4RA7A 2HP9A 1LLBA 1WE4A 3Q7VA 4FD8A 1SCWA 4XUZA 1FQGA 1KE3A 1ZKJA 2XDMA 3B3XA 3A3EA 4PMAA 1YLPA 5AQ9A 5FSRA 1HTZA 1G6AA 1IEMA 4X69A 5GLDA 3WWXA 3UPOA 2XFTA 4N1XA 3FKWA 3ZNTA 1YLZA 2H0YA 4KZ7A 1PWDA 2Y2OA 2H0TA 1K25A 3V3RA 5FI2A 1XXMA 4JBFA 5DF7A 3IQAA 3AGDA 5CGSA 4Y0UA 5FATA 2Y2NA 4H8RA 3IF6B 1NZOA 5CEDA 4EUZA 4HEFA 4WMCD 5A91A 4WZ4A 4S2MA 4JXWA 1RCJA 4D2OA 3M6HA 4E6XA 3W4PA 1ESIA 5J8XA 3VMAA 5HAQA 5FQ9A 4Q8IA 2HDQA 5HW3A 3HUOA 1TVFA 3Q07A 4QB8A 1BSGA 1O7EA 3MZEA 2R9WA 3PBNA 3LY4A 5TR7A 1HD8A 3IH9A 3IWOA 3HLEA 2WUQA 4PPRA 1MKIA 2ZM8A 1C3BA 1JWZA 3OPHA 5JYPA 2JBFA 4GD6A 4KG6A 4BD0A 3EQVA 2BG1A 1XKZA 1NRFA 1XGJA 1K4FA 5KSHA 3HVFA 5TGFA 5GL9A 3VSLA 3A3FA 5E2GA 2ZQAA 3G30A 3N8LA 4JXGA 3P98A 4OH0A 3S22A 1KDWA 2WZZA 3IWQA 3A3JA 3ZDJA 2EX6A 5A92A 1PI5A 1K55A 4CJNA 4KZ3A 1KVLA 3BFFA 3GMWA 3FWLA 4WM9A 1TDGA 1DJAA 2XGNA 3LO7A 4IVKA 1ES2A 1KGFA 2WGWA 3MBZA 3UE1A 4LCLA 2XEPA 5E2EA 2Y59A 2WKIA 4U0TA 4DXBA 5FQMA 3O3VA 1LL9A 1K54A 5GHZA 4EWFA 3VOZA 3SH8A 4DDSA 2EX2A 2P9VA 4S2IA 3Q7VB 4KZ8A 4O7DA 1ERMA 4CPKA 4OLGA 1FSYA 4OPZA 5CHUA 3BFGA 3PTEA 1JTDA 2Z2MB 5DTSA 5CERA 3V3SA 4IVIA 1DJBA 3E2KA 1BZAA 2C6WB 3IWIA 5EVID 3UY6A 4DE2A 1K38A 1KGEA 1PYYA 3CJMA 3G2ZA 1E4DA 3G31A 3HUMA 5FASA 2J9OA 2WYXA 3W4QA 3PBSA 3VP3A 1PWCA 5GLBA 3WS1A 4EBPA 4UAAA 1ZC2A 1K57C 3BECA 3FYZA 1ONHA 4MBKA 2CC1A 5I94A 1IELA 1XA7A 1BULA 1JWPA 3IHBA 4IBRA 2Q9MA 2WGIA 5GHXA 5F1FA 3NY4A 1E25A 4MBHA 4KQOA 5E2HA 2DNSA 4YINA 1YLTA 1CEGA 5EVIA 2WAFA 5E2FA 2OLUA 2V2FF 4JF5A 5CHJA 5HL1A 1J9MA 3HLFA 2OSUA 4WYYA 3GTCA 3WS4A 1IYOA 4WZ5C 2EX9A 5FDHA 3N7WA 3PAGA 3SH7A 3M6BA 4R3JA 3BFDA 2Y2HA 2ZD8A 4S2OA 3G34A 3ZGAB 3BFEA 3BLSA 4PM7A 3ZNYA 4BJPA 1Z6FA 1SDEA 2QMIA 1BLPA 3HREA 3TSGA 4GDNA 5KZHA 1HVBA 1MWSA 1XA1A 2ZM2A 4S2PA 4P0MA 2HDSA 5EUAA 5A93A 2ZC6B 4QY5A 1HZOA 3IXDA 4KZBA 5DF9A 4S2NA 4B4XA 2IWDA 3IHAA 3GSGA 2Y2QA 3ITAA 3MFDA 2WKEA 1YLYA 3C7VA 2ZM0A 5AQBA 3FKVA 5L2FA 4JKTA 1IYPA 2I72A 4GB7A 4BL2A 2EXAA 1H8ZA 4JPMA 3M2KA 2Y91A 5GLAA 3HUNA 2OV5A 3A3IA 1NYMA 4GKUA 3ZG9B 3UN7A 1CI9A 3C4OA 1PIOA 4N9KA 5AQ7A 3ZFZA 3NI9A 5CTNA 2WGWB 4OQ0A 3SS4A 1L2SA 4BENA 5HX9A 5KMWA 3N8SA 5FA7A 1XGIA 2XF3A 3IH8A 1DJCA 3S1YA 3UE3A 5BOHA 2E8IA 1K55C 3G35A 3ISGA 5FAPA 2BLSA 4UA7A 3IXGA 5FAQA 1Q2QA 2P9VB 1L0GA 2Y2IA 3IF6C 4EBLA 3VSKA 5CTMA 1NY0A 4BL3A 1XX2A 2Y2JA 1NJ4A 2J7VA 2B5RA 3NDEA 1BLCA 5FQJA 1YLJA 4S2LA 4FH4A 4MLLA 2EFUA 4E3JA 1GA0A 4KZAA 3G32A 1CK3A 3BRMA 1XP4A 3FZCA 3G2YA 3UO9A 3ZHHA 2ZQCA 3HL9A 4MEZA 1L0EA 3P09A 3BM6A 5EOEA 1FR6A 1NXYA 2XR0A 5FI6A 2EXBA 1I2SA 5FAOA 2G2WA 1RGYA 3OPLA 4OPQA 3I7JA 1AXBA 5DTKA 3G4PA 3RXWA 1KDSA 1N4OA 3GR2A 1NYYA 4HESA 4P87A 1W8QA 1W5DA 4KG5A 2ZJ9A 4FCFA 4L0LA 3PBRA 3CG5A 1PWGA 2ZQ9A 2Q9NA 3NDGA 5FQIA 4P85A 5M18A 4IBXA 4Y7PA 1FSWA 4XUXA 3MXSA 4QHCA 2IWCA 4X56A 2Y2LA 4KZ4A 4UA9A 4EBNA 1EWZA 3HLWA 4R4SA 3VP1A 5M19A 4Y0OA 2Y2PA 3NC8A 1M6KA 1U60A 3ITBA 3O86A 1PI4A 3QNCA 1O07A 2P74A 5CECA 3MXRA 3VP0A 1OMEA 4X6TA 3TG9A 4DXCA 3BYDA 2HDUA 5DTTA 3W4OA 3WS5A 4LV2A 3OPRA 4YFMA 4ZTKA 5F82A 3AGEA 2OLVA 4S2NC 4U3TA 4RYEA 1YMXA 3DWZA 4KZ6A 4E6WA 1MXOA 3GRJA 4K0XA 1CEFA 4KZ5A 4N9LA 4OPRA 2XQZA 2DRWA 3OZHA 1ALQA 4OPYA 5EPHA 2XK1A 2PBYA 1N9BA 1H5XA 4PM6A 1ERQA 4OOMA 4R23A 1QMEA 2XD1A 4JXVA 3GVBA 4K91A 3VP2A 4ZJ1A 1EROA 1ESUA 2ZC5B 4DDYA 4DE0A 3UDIA 4OQHA 4OVDA 3LCEA 3PBTA 3N6IA 5G18A 3WS0A 3UDFA 1JTGA 2ZC7A 4QU3A 4FH2A 1YMSA 1KE4A 1SKFA 2HPBA 3AGFA 4Z9QA 4MBFA 2HDRA 3V5MA 3IXHA 4OP8A 4JLFA 2ZLYA 4N1HA 5CGWA 2QPNA 5JYOA 1PW8A 2J9PA 3CMZA 4GD8A 4WEKA 4MNRA 4DE3A 4E3MA 4DE1A 3IT9A 2Y2KA 3HBRA 2J8YA 4E3KA 4ZDXA 1KGGA 2VGJA 3VFFA 5CRFA 4JXSA 3VOYA 2ZMAA 2ZQ7A 1YT4A 2IWBA 3TOIA 4X55A 4C6YA 4BQMA 5CXWA 4LV1A 3WRZA 1L0FA 4FSFA 4X68A 3A3DA 3HLDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RX2 A;  2VGK A;  3ZVW A;  2RL3 A;  1E3U D;  5EEC A;  3IF5 A;  3NIA A;  4OOY A;  2QZ6 A;  4OKP A;  4E3O A;  3JYI A;  3GV9 A;  3UPN A;  1WYB A;  2GDN A;  5EOO A;  4R0Q A;  2HP5 A;  2X71 A;  2R9X A;  3GQZ A;  3ZG7 B;  4ZBE A;  4N92 A;  1FCN A;  1KE0 A;  5HAI A;  4KQR A;  1W79 A;  1K57 A;  1XPB A;  2JE5 A;  1K54 C;  3CZD A;  3PBO A;  3Q1F A;  4ID4 A;  3ZG8 B;  3E2L A;  1LL5 A;  2C5W B;  2Y2G A;  3Q82 A;  4XXR A;  4K0W A;  1FCM A;  1E3U A;  2Y2M A;  2UWX A;  1RP5 A;  2PU4 A;  1ZG6 A;  1ZG4 A;  4OQG A;  3ZG0 A;  3ZVT A;  1W8Y A;  3N8R A;  3RJU A;  3OPP A;  4GDB A;  4LCM A;  5GLC A;  3ZCZ A;  3DTM A;  4C3Q A;  1LI9 A;  1SDN A;  1MWU A;  3WS2 A;  5FI7 A;  3DW0 A;  4HBT A;  1PZO A;  1Y54 A;  3IXB A;  4ZAM A;  4WZ5 A;  4U0X A;  1JWV A;  4LV3 A;  1KVM A;  4S2K A;  1CI8 A;  3SS5 A;  5D3O A;  1NZU A;  1FR1 A;  2H10 A;  5FQK A;  5GHY A;  5TFQ A;  3V50 A;  1MPL A;  3C7U A;  4B4Z A;  2X02 A;  4A5R A;  5EVI B;  2ZQD A;  1VQQ A;  1BTL A;  4KG2 A;  3V39 A;  1G68 A;  2HP6 A;  4KEN B;  4RVA A;  2XFS A;  1LHY A;  1GHM A;  2Y55 A;  2ZC4 B;  1FOF A;  4WMC A;  3UPP A;  2FFF B;  3O87 A;  3QHY A;  1VM1 A;  1FCO A;  1YLW A;  2WK0 A;  1I5Q A;  4DF6 A;  2JC7 A;  4GN2 A;  4R4R A;  5EVI C;  4OQI A;  3FV7 A;  1K6R A;  3MKF A;  3Q81 A;  5CGX A;  4GOG A;  4R3B A;  5DVA A;  3OCN A;  4R1G A;  1RGZ A;  3C4P A;  3HLB A;  1JVJ A;  4Y0T A;  3MKE A;  4P6B A;  4E3N A;  2WKH A;  4EV4 A;  1WYC A;  1BLH A;  1DY6 A;  3NBL A;  1ES4 A;  1LI0 A;  1W7F A;  2V20 A;  5F1G A;  1ONG A;  1IKG A;  2ZQ8 A;  1S0W A;  4ZJ3 A;  4F94 A;  3LY3 A;  5DF8 A;  5IHV A;  3NCK A;  3BFC A;  2XH9 A;  4JF4 A;  2EFX A;  1PW1 A;  3UE0 A;  4BD1 A;  3Q7Z A;  3W8K A;  1IYS A;  2H5S A;  4OP5 A;  1GHP A;  3PAE A;  3IF6 A;  1GA9 A;  1PZP A;  4ZJ2 A;  3M2J A;  4PM8 A;  4NK3 A;  3VP4 A;  1GHI A;  4GNU A;  1BUE A;  1MY8 A;  1TEM A;  2V1Z A;  2ZC3 B;  3N4I A;  2DCF A;  3ZG5 A;  4DKI A;  1M40 A;  3MZF A;  2JCH A;  4GZB A;  5U47 A;  4C75 A;  1GCE A;  2WZX A;  3D4F A;  3OCL A;  1EI5 A;  4QY6 A;  5CEB A;  1SHV A;  2RCX A;  3BEB A;  2EX8 A;  2G2U A;  3HLC A;  4LEN A;  2A49 A;  3EQU A;  4LV0 A;  1IKI A;  4NET A;  1K56 D;  2A3U A;  4JF6 A;  3VFH A;  1ES3 A;  1BLS A;  1TDL A;  4OOL A;  3S4X A;  1QMF A;  5M1A A;  4RX3 A;  4X53 A;  2WAE A;  2XD5 A;  5CHM A;  3C5A A;  4B88 A;  1S6R A;  3O88 A;  1YM1 A;  3PBQ A;  1H8Y A;  4PM9 A;  3QNB A;  4QJG A;  3RXX A;  4WEL A;  2WAD A;  5HFO A;  4WEJ A;  4WBG A;  4DRT A;  3UDX A;  4OON A;  5HAR A;  2PU2 A;  2X01 A;  2Z2L B;  3SS3 A;  4EQI A;  4E3I A;  3HLG A;  1Q2P A;  4S2J A;  1K56 A;  2Y4A A;  4KZ9 A;  5KSC A;  1L0D A;  1BT5 A;  4HBU A;  5E43 A;  2XLN A;  1IYQ A;  3LEZ A;  1ES5 A;  3SH9 A;  5A90 A;  3OC2 A;  3WRT A;  4UA6 A;  5HAP A;  4PM5 A;  4KQQ A;  4QD4 A;  1K6S A;  3SOI A;  4IED A;  5FQQ A;  3DWK A;  4M3K A;  3UNW A;  3MZD A;  4BLM A;  1MWR A;  2WGV A;  2FFY A;  1K4E A;  5F83 A;  4E3L A;  1MBL A;  1MWT A;  3BLM A;  5EE8 A;  1YQS A;  4UHU A;  5AQA A;  5EVL A;  1I2W A;  4OLD A;  4RA7 A;  2HP9 A;  1LLB A;  1WE4 A;  3Q7V A;  4FD8 A;  1SCW A;  4XUZ A;  1FQG A;  1KE3 A;  1ZKJ A;  2XDM A;  3B3X A;  3A3E A;  4PMA A;  1YLP A;  5AQ9 A;  5FSR A;  1HTZ A;  1G6A A;  1IEM A;  4X69 A;  5GLD A;  3WWX A;  3UPO A;  2XFT A;  4N1X A;  3FKW A;  3ZNT A;  1YLZ A;  2H0Y A;  4KZ7 A;  1PWD A;  2Y2O A;  2H0T A;  1K25 A;  3V3R A;  5FI2 A;  1XXM A;  4JBF A;  5DF7 A;  3IQA A;  3AGD A;  5CGS A;  4Y0U A;  5FAT A;  2Y2N A;  4H8R A;  3IF6 B;  1NZO A;  5CED A;  4EUZ A;  4HEF A;  4WMC D;  5A91 A;  4WZ4 A;  4S2M A;  4JXW A;  1RCJ A;  4D2O A;  3M6H A;  4E6X A;  3W4P A;  1ESI A;  5J8X A;  3VMA A;  5HAQ A;  5FQ9 A;  4Q8I A;  2HDQ A;  5HW3 A;  3HUO A;  1TVF A;  3Q07 A;  4QB8 A;  1BSG A;  1O7E A;  3MZE A;  2R9W A;  3PBN A;  3LY4 A;  5TR7 A;  1HD8 A;  3IH9 A;  3IWO A;  3HLE A;  2WUQ A;  4PPR A;  1MKI A;  2ZM8 A;  1C3B A;  1JWZ A;  3OPH A;  5JYP A;  2JBF A;  4GD6 A;  4KG6 A;  4BD0 A;  3EQV A;  2BG1 A;  1XKZ A;  1NRF A;  1XGJ A;  1K4F A;  5KSH A;  3HVF A;  5TGF A;  5GL9 A;  3VSL A;  3A3F A;  5E2G A;  2ZQA A;  3G30 A;  3N8L A;  4JXG A;  3P98 A;  4OH0 A;  3S22 A;  1KDW A;  2WZZ A;  3IWQ A;  3A3J A;  3ZDJ A;  2EX6 A;  5A92 A;  1PI5 A;  1K55 A;  4CJN A;  4KZ3 A;  1KVL A;  3BFF A;  3GMW A;  3FWL A;  4WM9 A;  1TDG A;  1DJA A;  2XGN A;  3LO7 A;  4IVK A;  1ES2 A;  1KGF A;  2WGW A;  3MBZ A;  3UE1 A;  4LCL A;  2XEP A;  5E2E A;  2Y59 A;  2WKI A;  4U0T A;  4DXB A;  5FQM A;  3O3V A;  1LL9 A;  1K54 A;  5GHZ A;  4EWF A;  3VOZ A;  3SH8 A;  4DDS A;  2EX2 A;  2P9V A;  4S2I A;  3Q7V B;  4KZ8 A;  4O7D A;  1ERM A;  4CPK A;  4OLG A;  1FSY A;  4OPZ A;  5CHU A;  3BFG A;  3PTE A;  1JTD A;  2Z2M B;  5DTS A;  5CER A;  3V3S A;  4IVI A;  1DJB A;  3E2K A;  1BZA A;  2C6W B;  3IWI A;  5EVI D;  3UY6 A;  4DE2 A;  1K38 A;  1KGE A;  1PYY A;  3CJM A;  3G2Z A;  1E4D A;  3G31 A;  3HUM A;  5FAS A;  2J9O A;  2WYX A;  3W4Q A;  3PBS A;  3VP3 A;  1PWC A;  5GLB A;  3WS1 A;  4EBP A;  4UAA A;  1ZC2 A;  1K57 C;  3BEC A;  3FYZ A;  1ONH A;  4MBK A;  2CC1 A;  5I94 A;  1IEL A;  1XA7 A;  1BUL A;  1JWP A;  3IHB A;  4IBR A;  2Q9M A;  2WGI A;  5GHX A;  5F1F A;  3NY4 A;  1E25 A;  4MBH A;  4KQO A;  5E2H A;  2DNS A;  4YIN A;  1YLT A;  1CEG A;  5EVI A;  2WAF A;  5E2F A;  2OLU A;  2V2F F;  4JF5 A;  5CHJ A;  5HL1 A;  1J9M A;  3HLF A;  2OSU A;  4WYY A;  3GTC A;  3WS4 A;  1IYO A;  4WZ5 C;  2EX9 A;  5FDH A;  3N7W A;  3PAG A;  3SH7 A;  3M6B A;  4R3J A;  3BFD A;  2Y2H A;  2ZD8 A;  4S2O A;  3G34 A;  3ZGA B;  3BFE A;  3BLS A;  4PM7 A;  3ZNY A;  4BJP A;  1Z6F A;  1SDE A;  2QMI A;  1BLP A;  3HRE A;  3TSG A;  4GDN A;  5KZH A;  1HVB A;  1MWS A;  1XA1 A;  2ZM2 A;  4S2P A;  4P0M A;  2HDS A;  5EUA A;  5A93 A;  2ZC6 B;  4QY5 A;  1HZO A;  3IXD A;  4KZB A;  5DF9 A;  4S2N A;  4B4X A;  2IWD A;  3IHA A;  3GSG A;  2Y2Q A;  3ITA A;  3MFD A;  2WKE A;  1YLY A;  3C7V A;  2ZM0 A;  5AQB A;  3FKV A;  5L2F A;  4JKT A;  1IYP A;  2I72 A;  4GB7 A;  4BL2 A;  2EXA A;  1H8Z A;  4JPM A;  3M2K A;  2Y91 A;  5GLA A;  3HUN A;  2OV5 A;  3A3I A;  1NYM A;  4GKU A;  3ZG9 B;  3UN7 A;  1CI9 A;  3C4O A;  1PIO A;  4N9K A;  5AQ7 A;  3ZFZ A;  3NI9 A;  5CTN A;  2WGW B;  4OQ0 A;  3SS4 A;  1L2S A;  4BEN A;  5HX9 A;  5KMW A;  3N8S A;  5FA7 A;  1XGI A;  2XF3 A;  3IH8 A;  1DJC A;  3S1Y A;  3UE3 A;  5BOH A;  2E8I A;  1K55 C;  3G35 A;  3ISG A;  5FAP A;  2BLS A;  4UA7 A;  3IXG A;  5FAQ A;  1Q2Q A;  2P9V B;  1L0G A;  2Y2I A;  3IF6 C;  4EBL A;  3VSK A;  5CTM A;  1NY0 A;  4BL3 A;  1XX2 A;  2Y2J A;  1NJ4 A;  2J7V A;  2B5R A;  3NDE A;  1BLC A;  5FQJ A;  1YLJ A;  4S2L A;  4FH4 A;  4MLL A;  2EFU A;  4E3J A;  1GA0 A;  4KZA A;  3G32 A;  1CK3 A;  3BRM A;  1XP4 A;  3FZC A;  3G2Y A;  3UO9 A;  3ZHH A;  2ZQC A;  3HL9 A;  4MEZ A;  1L0E A;  3P09 A;  3BM6 A;  5EOE A;  1FR6 A;  1NXY A;  2XR0 A;  5FI6 A;  2EXB A;  1I2S A;  5FAO A;  2G2W A;  1RGY A;  3OPL A;  4OPQ A;  3I7J A;  1AXB A;  5DTK A;  3G4P A;  3RXW A;  1KDS A;  1N4O A;  3GR2 A;  1NYY A;  4HES A;  4P87 A;  1W8Q A;  1W5D A;  4KG5 A;  2ZJ9 A;  4FCF A;  4L0L A;  3PBR A;  3CG5 A;  1PWG A;  2ZQ9 A;  2Q9N A;  3NDG A;  5FQI A;  4P85 A;  5M18 A;  4IBX A;  4Y7P A;  1FSW A;  4XUX A;  3MXS A;  4QHC A;  2IWC A;  4X56 A;  2Y2L A;  4KZ4 A;  4UA9 A;  4EBN A;  1EWZ A;  3HLW A;  4R4S A;  3VP1 A;  5M19 A;  4Y0O A;  2Y2P A;  3NC8 A;  1M6K A;  1U60 A;  3ITB A;  3O86 A;  1PI4 A;  3QNC A;  1O07 A;  2P74 A;  5CEC A;  3MXR A;  3VP0 A;  1OME A;  4X6T A;  3TG9 A;  4DXC A;  3BYD A;  2HDU A;  5DTT A;  3W4O A;  3WS5 A;  4LV2 A;  3OPR A;  4YFM A;  4ZTK A;  5F82 A;  3AGE A;  2OLV A;  4S2N C;  4U3T A;  4RYE A;  1YMX A;  3DWZ A;  4KZ6 A;  4E6W A;  1MXO A;  3GRJ A;  4K0X A;  1CEF A;  4KZ5 A;  4N9L A;  4OPR A;  2XQZ A;  2DRW A;  3OZH A;  1ALQ A;  4OPY A;  5EPH A;  2XK1 A;  2PBY A;  1N9B A;  1H5X A;  4PM6 A;  1ERQ A;  4OOM A;  4R23 A;  1QME A;  2XD1 A;  4JXV A;  3GVB A;  4K91 A;  3VP2 A;  4ZJ1 A;  1ERO A;  1ESU A;  2ZC5 B;  4DDY A;  4DE0 A;  3UDI A;  4OQH A;  4OVD A;  3LCE A;  3PBT A;  3N6I A;  5G18 A;  3WS0 A;  3UDF A;  1JTG A;  2ZC7 A;  4QU3 A;  4FH2 A;  1YMS A;  1KE4 A;  1SKF A;  2HPB A;  3AGF A;  4Z9Q A;  4MBF A;  2HDR A;  3V5M A;  3IXH A;  4OP8 A;  4JLF A;  2ZLY A;  4N1H A;  5CGW A;  2QPN A;  5JYO A;  1PW8 A;  2J9P A;  3CMZ A;  4GD8 A;  4WEK A;  4MNR A;  4DE3 A;  4E3M A;  4DE1 A;  3IT9 A;  2Y2K A;  3HBR A;  2J8Y A;  4E3K A;  4ZDX A;  1KGG A;  2VGJ A;  3VFF A;  5CRF A;  4JXS A;  3VOY A;  2ZMA A;  2ZQ7 A;  1YT4 A;  2IWB A;  3TOI A;  4X55 A;  4C6Y A;  4BQM A;  5CXW A;  4LV1 A;  3WRZ A;  1L0F A;  4FSF A;  4X68 A;  3A3D A;  3HLD A; 
#chains in the Genus database with same CATH topology
 2VGK A;  3ZVW A;  3IF5 A;  3NIA A;  3LIA A;  3EEA A;  2VJW A;  3ULF A;  2WKP A;  2XRO A;  2X71 A;  2PR5 A;  3GDI A;  1YSQ A;  1XPB A;  3ZG8 B;  3CZD A;  4LLO B;  2FH5 A;  1FCM A;  2Y2M A;  4R70 A;  2UWX A;  1X0O A;  2OAQ 1;  4MN6 A;  3RJU A;  2W3G A;  4LCM A;  5GLC A;  3ZCZ A;  5IT5 A;  3WS2 A;  3DW0 A;  1PZO A;  1Y54 A;  4U0X A;  3E4Q A;  3SS5 A;  1NZU A;  5FQK A;  5GHY A;  5TFQ A;  2X02 A;  1VQQ A;  4KG2 A;  3V39 A;  1G68 A;  2HP6 A;  2VKS A;  4WMC A;  3O87 A;  1FCO A;  2WK0 A;  3G6O A;  1UWP X;  1YPR A;  2JC7 A;  4GN2 A;  1K6R A;  2PYP A;  5DVA A;  4R1G A;  4I3A A;  4YWZ A;  3BQ8 A;  3HLB A;  4Y0T A;  3MKE A;  4E3N A;  2WKH A;  1WYC A;  1BLH A;  1UWN X;  4ZJ3 A;  2ZQ8 A;  2VV6 A;  3OBF A;  1PW1 A;  3B33 A;  3IF6 A;  4Y5F A;  5HWV A;  2JKR M;  3IS2 A;  3K2N A;  3VP4 A;  3NUL A;  1TEM A;  2ZL1 A;  2V1Z A;  5HPI A;  2ZC3 B;  3CLO A;  4DKI A;  4GZB A;  4C75 A;  3OCL A;  5CEB A;  4HY8 A;  4LEN A;  4UEY A;  2A49 A;  1ES3 A;  2HF6 A;  4OOL A;  3S4X A;  5CHM A;  4MN7 A;  4B88 A;  3PBQ A;  2EWV A;  3RXX A;  4HJ6 A;  2D02 A;  4EES A;  5HAR A;  3SS3 A;  4I3I A;  4S2J A;  1K56 A;  2O99 A;  2A24 A;  3LR3 A;  3K3D A;  1W63 Q;  5E43 A;  1ES5 A;  5A90 A;  3MQ0 A;  3SOI A;  2ZMF A;  4BLM A;  2WGV A;  1MBL A;  3CUE C;  4UHU A;  2O0Y A;  4BMW A;  1I2W A;  3Q7V A;  3PHY A;  4XUZ A;  3B3X A;  1XFN A;  5GLD A;  4X69 A;  3WWX A;  2XFT A;  3LR0 A;  1SKO A;  3P01 A;  2Y2O A;  2V8F A;  1K25 A;  1P0Z A;  1XXM A;  5DKL A;  5CGS A;  3RH8 B;  4H8R A;  1W63 M;  3EGD C;  2J3T D;  3PXP A;  3T4T A;  4JXW A;  2OOL A;  1RCJ A;  4D2O A;  2V0W A;  4GW9 A;  4G3W A;  2L0W A;  1NLY A;  2GJ3 A;  3SW1 A;  4QB8 A;  5HL6 A;  2R9W A;  2Y79 A;  2WUQ A;  1H0M A;  1WA9 A;  4GD6 A;  4WLA A;  2BG1 A;  4HIA A;  5KSH A;  2K7S A;  4L9F A;  3A3F A;  3P7N A;  2JKT I;  2WZZ A;  2KLI A;  2OWJ A;  4HOI A;  2EX6 A;  3A0V A;  3GMW A;  3FWL A;  1TDG A;  1ES2 A;  1KGF A;  2WGW A;  3MBZ A;  4LCL A;  4ETX A;  2XEP A;  5E2E A;  4U0T A;  3O3V A;  1F2K A;  5K5B A;  4DDS A;  5F69 A;  3SH8 A;  2EX2 A;  4S2I A;  1ERM A;  4K08 A;  2PYR A;  1KOU A;  5CER A;  3V3S A;  3E2K A;  3C38 A;  3H82 B;  1PYY A;  3FPW A;  2J9O A;  2WYX A;  3PYP A;  4UAA A;  3BEC A;  2CC1 A;  5I94 A;  4NKP A;  3NY4 A;  2W3D A;  2V2F F;  5HL1 A;  2IA2 A;  3EEH A;  3HLF A;  4WYY A;  3N7W A;  3PAG A;  1T1A A;  3MFX A;  5HDS A;  3BFD A;  5HSQ A;  3G34 A;  3BLS A;  1J3W A;  3HRE A;  1HVB A;  4S2P A;  4P0M A;  5EUA A;  2ZC6 B;  4QY5 A;  4I3J A;  4KZB A;  2Z6C A;  3IHA A;  3GSG A;  1OTI A;  5AQB A;  2WKE A;  4FOF A;  3FKV A;  4BL2 A;  2I72 A;  4GB7 A;  2EXA A;  1ZHH B;  1H8Z A;  3HJK A;  2OV5 A;  4LGW A;  4GKU A;  3UN7 A;  4G3K A;  1CI9 A;  3C4O A;  3ZFZ A;  4QWO A;  4IUK A;  2NUT C;  3SS4 A;  2BAS A;  3N8S A;  1P97 A;  2XF3 A;  1DJC A;  4Y2F A;  2E8I A;  3IS2 B;  3ISG A;  2BLS A;  4B9O A;  3IXG A;  5FAQ A;  2VV8 A;  1LSW A;  2Y2I A;  1L0G A;  3IF6 C;  3VSK A;  1DP9 A;  2Y2J A;  1NJ4 A;  2J7V A;  3NDE A;  5FQJ A;  3G32 A;  3FZC A;  1OPX A;  2YKF A;  5AJG A;  4NXE A;  5EOE A;  3VE4 A;  1FR6 A;  2XR0 A;  2EXB A;  4Z1W A;  2B95 A;  5FAO A;  1RGY A;  1AXB A;  3RXW A;  2W1T A;  1KDS A;  3GR2 A;  4HES A;  3F1P A;  1YAX A;  4L0L A;  4MN5 A;  3PBR A;  3CG5 A;  2VLG A;  1PWG A;  1XJ3 A;  4P85 A;  4IBX A;  4JGQ A;  3SZT A;  4DMZ A;  1DP8 A;  4KZ4 A;  2Y2P A;  5A8B A;  3ITB A;  3MXR A;  4X6T A;  4LV2 A;  3RTY A;  5EM0 A;  4ZTK A;  5F82 A;  3AGE A;  4U3T A;  2HJ9 C;  3DWZ A;  2DRW A;  1Y4O A;  4ETZ A;  4OPY A;  5EPH A;  1N9B A;  4IJG A;  3GVB A;  4K91 A;  3MSH A;  1ESU A;  2JKR I;  4DE0 A;  1G28 A;  4OQH A;  3PBT A;  3N6I A;  5G18 A;  2PAV P;  2V8C A;  1YMS A;  4LRX C;  2HPB A;  4X25 A;  5CGW A;  2VX8 A;  5JYO A;  3VE3 A;  2J8Y A;  1IOU A;  3V67 A;  3IX4 A;  4GCZ A;  4JXS A;  3VOY A;  1YT4 A;  4X55 A;  4C6Y A;  3MF0 A;  1L0F A;  4X68 A;  3IX3 A;  5G4Y A;  4OKP A;  3RFB A;  3MJQ A;  4GS9 A;  2HP5 A;  3GQZ A;  4Y17 A;  4N92 A;  5F5Y A;  5TBM B;  3PBO A;  3Q1F A;  4PKY A;  3E2L A;  1LL5 A;  3Q82 A;  1ZG6 A;  3OPP A;  4GDB A;  1MWU A;  5FI7 A;  3IXB A;  4HI4 A;  3KYQ A;  4WZ5 A;  2VV7 A;  3E98 A;  4LV3 A;  4S2K A;  3T1R A;  5D3O A;  3FG8 A;  1FR1 A;  1MPL A;  1BTL A;  4EER A;  4KEN B;  1GHM A;  2Y55 A;  3UPP A;  1I5Q A;  4OQI A;  4P6Z S;  2XA7 S;  3FV7 A;  3MKF A;  3BW6 A;  3OCN A;  1DRM A;  3CHW P;  3NBL A;  1YKD A;  4WN5 A;  4JF4 A;  3T1X A;  2H28 A;  3UE0 A;  4XT2 A;  4BD1 A;  2VGL M;  3M2J A;  4PM8 A;  2W27 A;  4GNU A;  1MY8 A;  3N4I A;  2DCF A;  2WZX A;  4QY6 A;  1EI5 A;  4OOY A;  2EX8 A;  2G2U A;  1IKI A;  1K56 D;  1BLS A;  1TDL A;  4RX3 A;  2WAE A;  4Q0H A;  2MJ6 A;  2Y8H A;  2ZOH A;  3C5A A;  3A0R A;  2PD7 A;  3O88 A;  1H8Y A;  3LIF A;  4R6L A;  4PM9 A;  3QNB A;  4HH3 A;  5HFO A;  4DRT A;  4WEJ A;  2PU2 A;  2X01 A;  2Z2L B;  2ZBB A;  4EQI A;  4KZ9 A;  3T4J A;  1L0D A;  3S7N A;  2XLN A;  4EUV A;  1IYQ A;  3LEZ A;  5J3W A;  4X1M A;  3WRT A;  2W1T B;  4QD4 A;  4IED A;  4M3K A;  3UNW A;  3MZD A;  3EOI A;  3NEC A;  5F83 A;  2V1B A;  4EEP A;  4OLD A;  4FD8 A;  5MC7 A;  1FQG A;  1KE3 A;  1ZKJ A;  2XDM A;  2M7V A;  2YKH A;  1YLP A;  4LRY C;  1G6A A;  4FUW A;  1MZU A;  4N1X A;  3ZNT A;  1YLZ A;  3T4L A;  2H0Y A;  4KZ7 A;  1PWD A;  3H82 A;  5EV0 A;  3V3R A;  2UV0 E;  3KYZ A;  5DF7 A;  3IQA A;  3LFV A;  5FAT A;  5A91 A;  1Y28 A;  4S2M A;  3UB7 A;  1TVF A;  1BSG A;  1O7E A;  3PBN A;  1TD5 A;  3IWO A;  3LID A;  1LSX A;  3HLE A;  1MKI A;  4EW7 A;  1F5M A;  2JBF A;  4KG6 A;  1XGJ A;  3B47 A;  2VA0 A;  3VSL A;  2E8J A;  3BY9 A;  3JPU A;  3G30 A;  3N8L A;  4MCW A;  5A92 A;  1S1Y A;  5J7E A;  1KVL A;  2VK3 A;  4IVK A;  1HLU P;  2Q0O A;  4HNB A;  2Y59 A;  5FQM A;  5HD5 A;  3D3O A;  1K54 A;  3LI8 A;  1LT0 A;  4KZ8 A;  5L07 A;  1FSY A;  4OPZ A;  2ACG A;  1OT9 A;  4GS9 B;  1P9W A;  5DTS A;  2QJ5 A;  2D01 A;  3CJM A;  4LPZ A;  3G2Z A;  1H3Q A;  5FAS A;  4UQI S;  3VP3 A;  1PWC A;  3WS1 A;  4EBP A;  1ONH A;  1IEL A;  1JWP A;  2WGI A;  4D60 A;  3E4O A;  3TRC A;  5GHX A;  4KQO A;  1H8M A;  5E2H A;  2B02 A;  2DNS A;  1CEG A;  5EVI A;  2WAF A;  3T12 B;  1J9M A;  3GTC A;  4WZ5 C;  2EX9 A;  3SH7 A;  2Y2H A;  2W1R A;  5HWT A;  3ZGA B;  1BLP A;  4CLC B;  5KZH A;  1MWS A;  3NHQ A;  4NXF A;  3IXD A;  3C8C A;  3ITA A;  4CLC C;  1EW0 A;  3NOP C;  3M2K A;  3QP8 A;  5GLA A;  3HUN A;  1BYW A;  2HJE A;  3S7O A;  1NWZ A;  4XT2 B;  5CTN A;  5CX7 A;  4OQ0 A;  5HX9 A;  4CQH A;  5KMW A;  3UE3 A;  3S1Y A;  5BOH A;  1S4R A;  2ZOI A;  4UA7 A;  5TJJ A;  2P9V B;  1NY0 A;  4BL3 A;  3MQO A;  2EFU A;  1GA0 A;  4KZA A;  3BRM A;  1XP4 A;  3G2Y A;  2LB9 A;  3HL9 A;  4PKY G;  3BM6 A;  4CLC E;  2A2L A;  3D9Y A;  1NXY A;  3I7J A;  3T50 A;  1YSP A;  1D1J A;  2O9B A;  4LRZ E;  1NYY A;  2K2N A;  1V9Y A;  2Q9N A;  4WF0 A;  4XUX A;  3MXS A;  4QHC A;  4X56 A;  2Y2L A;  1EWZ A;  3LGO A;  5F6A A;  2GX5 A;  4Y0O A;  2WKQ A;  3UMD A;  3NC8 A;  1U60 A;  5TBM A;  4DXC A;  2KX6 A;  3CWF A;  2HDU A;  3FPV A;  3W4O A;  3WS5 A;  4YFM A;  1MXO A;  1G6O A;  4ARZ A;  2XQZ A;  1L3L A;  3BJN A;  3U4L P;  4HH2 A;  3R7W B;  4PM6 A;  2PBY A;  2PD8 A;  3NOU C;  4ZJ1 A;  3LIE A;  3UDF A;  2ZC7 A;  4QU3 A;  3AGF A;  5KIZ A;  1N9L A;  4MBF A;  1T1C A;  2HDR A;  3JVV A;  1F98 A;  3IXH A;  2ZLY A;  4N1H A;  2QPN A;  2J9P A;  1S4S A;  4GD8 A;  4WEK A;  5HD3 A;  4E3M A;  4DE1 A;  5L10 A;  3HBR A;  4E3K A;  4ZDX A;  1KGG A;  1FIL A;  2VGJ A;  4L9G A;  1NRJ A;  5CRF A;  2IWB A;  3WRZ A;  4RX2 A;  5EEC A;  2QZ6 A;  3T1Q B;  4E3O A;  3JYI A;  3GV9 A;  2GDN A;  2R9X A;  3ZG7 B;  1S67 L;  5HDD A;  1FCN A;  3U2A A;  1KE0 A;  5HAI A;  4KQR A;  1W79 A;  1K54 C;  1E3U A;  1FIK A;  4OQG A;  2PHY A;  3ZG0 A;  1ZG4 A;  3ZVT A;  5DFX A;  1W8Y A;  4O0P A;  2QYB A;  1LI9 A;  1SDN A;  3DAV A;  2L4R A;  2H10 A;  3BWL A;  3CPT B;  3MS6 A;  3C7U A;  5EVI B;  2ZQD A;  3D72 A;  2EA9 A;  2JN7 A;  4O01 A;  2V0U A;  1FOF A;  2GNX A;  3QHY A;  1OTB A;  3KSH A;  1YLW A;  4DF6 A;  5EVI C;  2I9V A;  4R3B A;  1N9N A;  1XFQ A;  3C4P A;  1JVJ A;  4P6B A;  4EV4 A;  1DY6 A;  1W7F A;  2V20 A;  1ONG A;  1IKG A;  5DF8 A;  5IHV A;  1ODV A;  4Q0I A;  2EFX A;  3W8K A;  3PAE A;  2W3H A;  4BBU A;  1GA9 A;  3QP1 A;  1M40 A;  3MZF A;  5U47 A;  4R38 A;  3D4F A;  5AVF A;  4MDZ A;  1SHV A;  2RCX A;  3BEB A;  1GSX A;  3EQU A;  1MKM A;  2A3U A;  1QMF A;  5M1A A;  4X53 A;  3CAX A;  3FC7 A;  4Q0J A;  1S6R A;  1YM1 A;  3QP6 A;  4Y3I A;  4II7 A;  4WEL A;  4OON A;  4MMN A;  1S66 L;  4E3I A;  4KUK A;  5KSC A;  4HBU A;  2PBD P;  3UE6 A;  1ACF A;  3OC2 A;  1K6S A;  2QKP A;  3DWK A;  2P04 A;  4EU0 A;  1MWR A;  1K4E A;  4E3L A;  1MWT A;  5EVL A;  4RA7 A;  2HP9 A;  1LLB A;  5FEG A;  5AVE A;  1SCW A;  4IHQ A;  4GJ4 A;  4PMA A;  4H6J B;  1IEM A;  3ZYT A;  3QP2 A;  5FI2 A;  3KSF A;  4F3L A;  4HJ4 A;  3R4K A;  2FZ0 A;  5CED A;  4EUZ A;  3T4O A;  1T18 A;  4WMC D;  5L8M A;  4WZ4 A;  4ARZ B;  2OAP 1;  3M6H A;  3W4P A;  5J8X A;  3VMA A;  3KO6 A;  4Q8I A;  2HV1 A;  5HW3 A;  2XRN A;  3LY4 A;  5TR7 A;  1HD8 A;  5EM1 A;  4PPR A;  2ZM8 A;  4ZRR A;  1F9I A;  5EFW A;  5JYP A;  3C30 A;  2J3W A;  4CLC A;  5EVE A;  4BD0 A;  3EQV A;  1XKZ A;  1NRF A;  1K4F A;  4B93 A;  5TGF A;  3F1N A;  5GL9 A;  4YOF A;  1UGU A;  2ZQA A;  4ESP A;  4KQD A;  4JXG A;  2GZA A;  3A3J A;  3ZDJ A;  1PI5 A;  3BFF A;  1TS8 A;  1DJA A;  2XGN A;  3UE1 A;  3T1S A;  1LL9 A;  1LL8 A;  2P9V A;  3E0Y A;  4CPK A;  4OLG A;  4AFI A;  5CHU A;  3O5Y A;  1LSV A;  4YNR A;  1PRQ A;  1BZA A;  3IWI A;  5EVI D;  3UY6 A;  4DE2 A;  1K38 A;  1E4D A;  3HUM A;  5GLB A;  1TS6 A;  4NXB A;  2B18 A;  3FYZ A;  5FDS A;  4MBK A;  1XA7 A;  4IBR A;  5FEF A;  5F1F A;  1CQA A;  4YIN A;  1MC0 A;  3KSI A;  4JF5 A;  2W3F A;  3TE8 A;  3UB9 A;  5FDH A;  3LYX A;  1T19 A;  4R3A A;  4WUJ A;  3M6B A;  4R3J A;  3B42 A;  2QMI A;  1SDE A;  3TSG A;  1D7E A;  4GDN A;  1XA1 A;  2ZM2 A;  2HDS A;  2J3T C;  5DF9 A;  3JVU A;  4B4X A;  2IWD A;  3LIB A;  3MFD A;  2Y2Q A;  4HJ3 A;  3C7V A;  2ZM0 A;  4JKT A;  1IYP A;  3UB6 A;  4JPM A;  1GSV A;  3A3I A;  3ZG9 B;  1PIO A;  4E04 A;  1L2S A;  2INW A;  4BEN A;  5FA7 A;  1XGI A;  4EEU A;  5FAP A;  1K55 C;  3R7W A;  3MXQ A;  3DTI A;  3PR6 A;  4EBL A;  2JKF A;  5CTM A;  1XX2 A;  1VB6 A;  1BLC A;  2VEA A;  1YLJ A;  2DMW A;  4S2L A;  5DKK A;  3W2Z A;  3UO9 A;  3ZHH A;  3QP5 A;  1L0E A;  2QJ7 A;  4HQA A;  2KOI A;  5DTK A;  3G4P A;  1N4O A;  3H7W A;  3CI6 A;  1W8Q A;  4FCF A;  2ZQ9 A;  4GHI B;  4Y7P A;  1FSW A;  4NG2 A;  4UQI M;  4EBN A;  3VP1 A;  3O86 A;  1O07 A;  4L9E A;  3VP0 A;  3TG9 A;  3BYD A;  3LR4 A;  2OLV A;  5HPF A;  4S2N C;  1YMX A;  4KZ6 A;  3GRJ A;  4K0X A;  4F3L B;  4N9L A;  4OPR A;  3GEC A;  1ZTU A;  3OZH A;  3ICY A;  3KX0 X;  4NXG A;  2KDK A;  1ERQ A;  4OOM A;  3CPT A;  1TS0 A;  4DJ2 A;  3VP2 A;  1ERO A;  2J80 A;  2K31 A;  1XJ4 A;  4DDY A;  3WS0 A;  4FH2 A;  1SKF A;  4GLQ A;  3V5M A;  4PHT A;  3BY8 A;  1PFL A;  4JLF A;  1XJ6 A;  4JGP A;  5IU1 A;  3F1N B;  1Z09 A;  4ME4 A;  3IT9 A;  5HDC A;  2Y2K A;  4BQM A;  1CF0 A;  2Z6D A;  4LV1 A;  3HLD A;  2RL3 A;  1E3U D;  4LFU A;  3VV4 A;  1VEU B;  4Y15 A;  3LEQ A;  4G3V A;  4HHD A;  2HGV A;  3UPN A;  1WYB A;  5EOO A;  4R0Q A;  4JGR A;  4ZBE A;  3DBA A;  1K57 A;  2JE5 A;  4ID4 A;  2C5W B;  2Y2G A;  4XXR A;  2M7U A;  4K0W A;  1RP5 A;  2PU4 A;  2ZMV A;  4IUH A;  1VET B;  3N8R A;  4C3Q A;  3DTM A;  4HBT A;  4ZAM A;  1JWV A;  4PAU A;  1KVM A;  1CI8 A;  3EWK A;  2WKR A;  3V50 A;  1V9Z A;  4B4Z A;  4A5R A;  4RQ9 A;  3C2W A;  2BTF P;  4RVA A;  2XFS A;  1LHY A;  2ZC4 B;  3HCY A;  2FFF B;  3A3D A;  1VM1 A;  1STZ A;  4R4R A;  3S7Q A;  3Q81 A;  5CGX A;  4GOG A;  1RGZ A;  1D06 A;  4H6J A;  2XSS A;  1ES4 A;  1LI0 A;  5F1G A;  1S0W A;  2W0N A;  3UB8 A;  3LY3 A;  4F94 A;  1SZV A;  3NCK A;  3BFC A;  2XH9 A;  3Q7Z A;  1IYS A;  2H5S A;  4OP5 A;  1GHP A;  4EXO A;  1PZP A;  4ZJ2 A;  2QHK A;  1TF1 A;  4NK3 A;  1GHI A;  1BUE A;  3H9W A;  4HP4 A;  3LUQ A;  3S7P A;  3ZG5 A;  2JCH A;  1GCE A;  4LV0 A;  3HLC A;  4NET A;  2EWW A;  4JF6 A;  3VFH A;  3CIT A;  3UME A;  2XD5 A;  3IBJ A;  3LIC A;  4BWI A;  4QJG A;  2WAD A;  4WBG A;  3UDX A;  5IS1 A;  3OOV A;  3HLG A;  1Q2P A;  2Y4A A;  5F68 A;  1BT5 A;  3SH9 A;  5G4Z A;  4UA6 A;  5HAP A;  5FL3 A;  4PM5 A;  4KQQ A;  5FQQ A;  1N9O A;  3H7W B;  1GSW A;  2FFY A;  3BLM A;  5EE8 A;  1YQS A;  3A0S A;  5AQA A;  1A0K A;  1WE4 A;  4BBV A;  2JHE A;  2PR6 A;  3LI9 A;  3A3E A;  5AQ9 A;  1T1B A;  5FSR A;  1HTZ A;  3MMH A;  3UPO A;  4Y13 A;  3FKW A;  2H0T A;  2QWS A;  2W3E A;  4JBF A;  3AGD A;  4Y0U A;  1PNE A;  2Y2N A;  3IF6 B;  1NZO A;  4HP9 A;  4HEF A;  5C5K A;  4M4X A;  4CLC D;  2ZL1 B;  4E6X A;  1ESI A;  5HAQ A;  5FQ9 A;  2HDQ A;  1VHM A;  2L1M A;  3HUO A;  3Q07 A;  3T4S A;  3E4P A;  3MZE A;  3ZQ5 A;  5DFY A;  1DP6 A;  3IH9 A;  3TW8 A;  5I5L A;  1C3B A;  4I38 A;  3NOT C;  1JWZ A;  3OPH A;  1TS7 A;  4KUO A;  3HVF A;  5HWW A;  5E2G A;  2LB5 A;  1OJG A;  2A24 B;  3F1O A;  4OH0 A;  3P98 A;  4BBT A;  3S22 A;  1KDW A;  3IWQ A;  4DJ3 A;  3MQQ A;  1K55 A;  4CJN A;  4KZ3 A;  4WM9 A;  3L7H A;  3LO7 A;  3OLO A;  2PDR A;  2WKI A;  4DXB A;  2O9C A;  5GHZ A;  4EWF A;  3VOZ A;  3Q7V B;  4O7D A;  5J4E A;  1K0K A;  3BFG A;  3EGX C;  3PTE A;  3K3C A;  1JTD A;  2Z2M B;  2NUP C;  3T4K A;  4IVI A;  1DJB A;  3QP4 A;  2C6W B;  1SKO B;  1KGE A;  4I39 A;  3G31 A;  3UB5 P;  3W4Q A;  3PBS A;  1ZC2 A;  1K57 C;  1OT6 A;  1BUL A;  3IHB A;  2Q9M A;  1E25 A;  4MBH A;  1YLT A;  5E2F A;  2OLU A;  5CHJ A;  2OSU A;  1JNU A;  3NJA A;  3WS4 A;  1IYO A;  1OJ5 A;  4GHI A;  3T4Q A;  2ZD8 A;  3IX8 A;  3BFE A;  4PM7 A;  3ZNY A;  4BJP A;  1Z6F A;  1P9R A;  4WL9 A;  5A93 A;  1HZO A;  4S2N A;  4I5S A;  1YLY A;  4QPR A;  2P08 A;  5L2F A;  2Y91 A;  1NYM A;  1CJF A;  5AQ7 A;  4N9K A;  2PRF A;  3NI9 A;  2WGW B;  3IH8 A;  4P6Z M;  3G35 A;  2XA7 M;  1OTD A;  1S1Z A;  3KYE A;  3VOL A;  1Q2Q A;  2OWH A;  3MR0 A;  2V9A A;  2B5R A;  2R78 A;  4FH4 A;  4MLL A;  4E3J A;  2JKT M;  5HZH A;  4EQ1 A;  1CK3 A;  2ZQC A;  2O9A A;  4MEZ A;  5DJT A;  3L9K A;  3P09 A;  5FI6 A;  1I2S A;  2G2W A;  3OPL A;  4OPQ A;  5DJU A;  3CUE A;  3DTK A;  1AWI A;  4P87 A;  1W5D A;  4KG5 A;  2ZJ9 A;  2P7J A;  3NDG A;  5FQI A;  5M18 A;  1VEU A;  2IWC A;  2HZ5 A;  2VZW A;  4UA9 A;  4DN0 A;  3HLW A;  2M1C A;  4R4S A;  3TJZ C;  5M19 A;  5LBR A;  2AVX A;  3BQA A;  1M6K A;  1OTA A;  3QNC A;  1PI4 A;  2P74 A;  5CEC A;  1OME A;  2V1A A;  5DTT A;  3OPR A;  3DTE A;  1VET A;  4RYE A;  4E6W A;  1CEF A;  4KZ5 A;  1ALQ A;  4X1L A;  1OTE A;  2XK1 A;  1H5X A;  4FTX A;  4R23 A;  1QME A;  2XD1 A;  4JGO A;  4JXV A;  2ZC5 B;  1G5U A;  3KSG A;  2JKG A;  3UDI A;  1IFQ A;  2VGL S;  4OVD A;  3LCE A;  4NEE D;  1JTG A;  1NLZ A;  2CMN A;  2PT7 A;  1KE4 A;  4Z9Q A;  3HJI A;  2G7U A;  1XJ2 A;  4OP8 A;  5L09 A;  4EET B;  3LR5 A;  1PW8 A;  3CMZ A;  4MNR A;  4DE3 A;  4O8G A;  3IBR A;  3F1O B;  3VFF A;  2ZMA A;  2ZQ7 A;  3F1P B;  3TOI A;  5CXW A;  4FSF A;  4S2O A; 
#chains in the Genus database with same CATH homology
 4RX2 A;  2VGK A;  3ZVW A;  2RL3 A;  1E3U D;  5EEC A;  3IF5 A;  3NIA A;  4OOY A;  2QZ6 A;  4OKP A;  4E3O A;  3JYI A;  3GV9 A;  3UPN A;  1WYB A;  2GDN A;  5EOO A;  4R0Q A;  2HP5 A;  2X71 A;  2R9X A;  3GQZ A;  3ZG7 B;  4ZBE A;  4N92 A;  1FCN A;  1KE0 A;  5HAI A;  4KQR A;  1W79 A;  1K57 A;  1XPB A;  2JE5 A;  1K54 C;  3CZD A;  3PBO A;  3Q1F A;  4ID4 A;  3ZG8 B;  3E2L A;  1LL5 A;  2C5W B;  2Y2G A;  3Q82 A;  4XXR A;  4K0W A;  1FCM A;  1E3U A;  2Y2M A;  2UWX A;  1RP5 A;  2PU4 A;  1ZG6 A;  1ZG4 A;  4OQG A;  3ZG0 A;  3ZVT A;  1W8Y A;  3N8R A;  3RJU A;  3OPP A;  4GDB A;  4LCM A;  5GLC A;  3ZCZ A;  3DTM A;  4C3Q A;  1LI9 A;  1SDN A;  1MWU A;  3WS2 A;  5FI7 A;  3DW0 A;  4HBT A;  1PZO A;  1Y54 A;  3IXB A;  4ZAM A;  4WZ5 A;  4U0X A;  1JWV A;  4LV3 A;  1KVM A;  4S2K A;  1CI8 A;  3SS5 A;  5D3O A;  1NZU A;  1FR1 A;  2H10 A;  5FQK A;  5GHY A;  5TFQ A;  3V50 A;  1MPL A;  3C7U A;  4B4Z A;  2X02 A;  4A5R A;  5EVI B;  2ZQD A;  1VQQ A;  1BTL A;  4KG2 A;  3V39 A;  1G68 A;  2HP6 A;  4KEN B;  4RVA A;  2XFS A;  1LHY A;  1GHM A;  2Y55 A;  2ZC4 B;  1FOF A;  4WMC A;  3UPP A;  2FFF B;  3O87 A;  3QHY A;  1VM1 A;  1FCO A;  1YLW A;  2WK0 A;  1I5Q A;  4DF6 A;  2JC7 A;  4GN2 A;  4R4R A;  5EVI C;  4OQI A;  3FV7 A;  1K6R A;  3MKF A;  3Q81 A;  5CGX A;  4GOG A;  4R3B A;  5DVA A;  3OCN A;  4R1G A;  1RGZ A;  3C4P A;  3HLB A;  1JVJ A;  4Y0T A;  3MKE A;  4P6B A;  4E3N A;  2WKH A;  4EV4 A;  1WYC A;  1BLH A;  1DY6 A;  3NBL A;  1ES4 A;  1LI0 A;  1W7F A;  2V20 A;  5F1G A;  1ONG A;  1IKG A;  2ZQ8 A;  1S0W A;  4ZJ3 A;  4F94 A;  3LY3 A;  5DF8 A;  5IHV A;  3NCK A;  3BFC A;  2XH9 A;  4JF4 A;  2EFX A;  1PW1 A;  3UE0 A;  4BD1 A;  3Q7Z A;  3W8K A;  1IYS A;  2H5S A;  4OP5 A;  1GHP A;  3PAE A;  3IF6 A;  1GA9 A;  1PZP A;  4ZJ2 A;  3M2J A;  4PM8 A;  4NK3 A;  3VP4 A;  1GHI A;  4GNU A;  1BUE A;  1MY8 A;  1TEM A;  2V1Z A;  2ZC3 B;  3N4I A;  2DCF A;  3ZG5 A;  4DKI A;  1M40 A;  3MZF A;  2JCH A;  4GZB A;  5U47 A;  4C75 A;  1GCE A;  2WZX A;  3D4F A;  3OCL A;  1EI5 A;  4QY6 A;  5CEB A;  1SHV A;  2RCX A;  3BEB A;  2EX8 A;  2G2U A;  3HLC A;  4LEN A;  2A49 A;  3EQU A;  4LV0 A;  1IKI A;  4NET A;  1K56 D;  2A3U A;  4JF6 A;  3VFH A;  1ES3 A;  1BLS A;  1TDL A;  4OOL A;  3S4X A;  1QMF A;  5M1A A;  4RX3 A;  4X53 A;  2WAE A;  2XD5 A;  5CHM A;  3C5A A;  4B88 A;  1S6R A;  3O88 A;  1YM1 A;  3PBQ A;  1H8Y A;  4PM9 A;  3QNB A;  4QJG A;  3RXX A;  4WEL A;  2WAD A;  5HFO A;  4WEJ A;  4WBG A;  4DRT A;  3UDX A;  4OON A;  5HAR A;  2PU2 A;  2X01 A;  2Z2L B;  3SS3 A;  4EQI A;  4E3I A;  3HLG A;  1Q2P A;  4S2J A;  1K56 A;  2Y4A A;  4KZ9 A;  5KSC A;  1L0D A;  1BT5 A;  4HBU A;  5E43 A;  2XLN A;  1IYQ A;  3LEZ A;  1ES5 A;  3SH9 A;  5A90 A;  3OC2 A;  3WRT A;  4UA6 A;  5HAP A;  4PM5 A;  4KQQ A;  4QD4 A;  1K6S A;  3SOI A;  4IED A;  5FQQ A;  3DWK A;  4M3K A;  3UNW A;  3MZD A;  4BLM A;  1MWR A;  2WGV A;  2FFY A;  1K4E A;  5F83 A;  4E3L A;  1MBL A;  1MWT A;  3BLM A;  5EE8 A;  1YQS A;  4UHU A;  5AQA A;  5EVL A;  1I2W A;  4OLD A;  4RA7 A;  2HP9 A;  1LLB A;  1WE4 A;  3Q7V A;  4FD8 A;  1SCW A;  4XUZ A;  1FQG A;  1KE3 A;  1ZKJ A;  2XDM A;  3B3X A;  3A3E A;  4PMA A;  1YLP A;  5AQ9 A;  5FSR A;  1HTZ A;  1G6A A;  1IEM A;  4X69 A;  5GLD A;  3WWX A;  3UPO A;  2XFT A;  4N1X A;  3FKW A;  3ZNT A;  1YLZ A;  2H0Y A;  4KZ7 A;  1PWD A;  2Y2O A;  2H0T A;  1K25 A;  3V3R A;  5FI2 A;  1XXM A;  4JBF A;  5DF7 A;  3IQA A;  3AGD A;  5CGS A;  4Y0U A;  5FAT A;  2Y2N A;  4H8R A;  3IF6 B;  1NZO A;  5CED A;  4EUZ A;  4HEF A;  4WMC D;  5A91 A;  4WZ4 A;  4S2M A;  4JXW A;  1RCJ A;  4D2O A;  3M6H A;  4E6X A;  3W4P A;  1ESI A;  5J8X A;  3VMA A;  5HAQ A;  5FQ9 A;  4Q8I A;  2HDQ A;  5HW3 A;  3HUO A;  1TVF A;  3Q07 A;  4QB8 A;  1BSG A;  1O7E A;  3MZE A;  2R9W A;  3PBN A;  3LY4 A;  5TR7 A;  1HD8 A;  3IH9 A;  3IWO A;  3HLE A;  2WUQ A;  4PPR A;  1MKI A;  2ZM8 A;  1C3B A;  1JWZ A;  3OPH A;  5JYP A;  2JBF A;  4GD6 A;  4KG6 A;  4BD0 A;  3EQV A;  2BG1 A;  1XKZ A;  1NRF A;  1XGJ A;  1K4F A;  5KSH A;  3HVF A;  5TGF A;  5GL9 A;  3VSL A;  3A3F A;  5E2G A;  2ZQA A;  3G30 A;  3N8L A;  4JXG A;  3P98 A;  4OH0 A;  3S22 A;  1KDW A;  2WZZ A;  3IWQ A;  3A3J A;  3ZDJ A;  2EX6 A;  5A92 A;  1PI5 A;  1K55 A;  4CJN A;  4KZ3 A;  1KVL A;  3BFF A;  3GMW A;  3FWL A;  4WM9 A;  1TDG A;  1DJA A;  2XGN A;  3LO7 A;  4IVK A;  1ES2 A;  1KGF A;  2WGW A;  3MBZ A;  3UE1 A;  4LCL A;  2XEP A;  5E2E A;  2Y59 A;  2WKI A;  4U0T A;  4DXB A;  5FQM A;  3O3V A;  1LL9 A;  1K54 A;  5GHZ A;  4EWF A;  3VOZ A;  3SH8 A;  4DDS A;  2EX2 A;  2P9V A;  4S2I A;  3Q7V B;  4KZ8 A;  4O7D A;  1ERM A;  4CPK A;  4OLG A;  1FSY A;  4OPZ A;  5CHU A;  3BFG A;  3PTE A;  1JTD A;  2Z2M B;  5DTS A;  5CER A;  3V3S A;  4IVI A;  1DJB A;  3E2K A;  1BZA A;  2C6W B;  3IWI A;  5EVI D;  3UY6 A;  4DE2 A;  1K38 A;  1KGE A;  1PYY A;  3CJM A;  3G2Z A;  1E4D A;  3G31 A;  3HUM A;  5FAS A;  2J9O A;  2WYX A;  3W4Q A;  3PBS A;  3VP3 A;  1PWC A;  5GLB A;  3WS1 A;  4EBP A;  4UAA A;  1ZC2 A;  1K57 C;  3BEC A;  3FYZ A;  1ONH A;  4MBK A;  2CC1 A;  5I94 A;  1IEL A;  1XA7 A;  1BUL A;  1JWP A;  3IHB A;  4IBR A;  2Q9M A;  2WGI A;  5GHX A;  5F1F A;  3NY4 A;  1E25 A;  4MBH A;  4KQO A;  5E2H A;  2DNS A;  4YIN A;  1YLT A;  1CEG A;  5EVI A;  2WAF A;  5E2F A;  2OLU A;  2V2F F;  4JF5 A;  5CHJ A;  5HL1 A;  1J9M A;  3HLF A;  2OSU A;  4WYY A;  3GTC A;  3WS4 A;  1IYO A;  4WZ5 C;  2EX9 A;  5FDH A;  3N7W A;  3PAG A;  3SH7 A;  3M6B A;  4R3J A;  3BFD A;  2Y2H A;  2ZD8 A;  4S2O A;  3G34 A;  3ZGA B;  3BFE A;  3BLS A;  4PM7 A;  3ZNY A;  4BJP A;  1Z6F A;  1SDE A;  2QMI A;  1BLP A;  3HRE A;  3TSG A;  4GDN A;  5KZH A;  1HVB A;  1MWS A;  1XA1 A;  2ZM2 A;  4S2P A;  4P0M A;  2HDS A;  5EUA A;  5A93 A;  2ZC6 B;  4QY5 A;  1HZO A;  3IXD A;  4KZB A;  5DF9 A;  4S2N A;  4B4X A;  2IWD A;  3IHA A;  3GSG A;  2Y2Q A;  3ITA A;  3MFD A;  2WKE A;  1YLY A;  3C7V A;  2ZM0 A;  5AQB A;  3FKV A;  5L2F A;  4JKT A;  1IYP A;  2I72 A;  4GB7 A;  4BL2 A;  2EXA A;  1H8Z A;  4JPM A;  3M2K A;  2Y91 A;  5GLA A;  3HUN A;  2OV5 A;  3A3I A;  1NYM A;  4GKU A;  3ZG9 B;  3UN7 A;  1CI9 A;  3C4O A;  1PIO A;  4N9K A;  5AQ7 A;  3ZFZ A;  3NI9 A;  5CTN A;  2WGW B;  4OQ0 A;  3SS4 A;  1L2S A;  4BEN A;  5HX9 A;  5KMW A;  3N8S A;  5FA7 A;  1XGI A;  2XF3 A;  3IH8 A;  1DJC A;  3S1Y A;  3UE3 A;  5BOH A;  2E8I A;  1K55 C;  3G35 A;  3ISG A;  5FAP A;  2BLS A;  4UA7 A;  3IXG A;  5FAQ A;  1Q2Q A;  2P9V B;  1L0G A;  2Y2I A;  3IF6 C;  4EBL A;  3VSK A;  5CTM A;  1NY0 A;  4BL3 A;  1XX2 A;  2Y2J A;  1NJ4 A;  2J7V A;  2B5R A;  3NDE A;  1BLC A;  5FQJ A;  1YLJ A;  4S2L A;  4FH4 A;  4MLL A;  2EFU A;  4E3J A;  1GA0 A;  4KZA A;  3G32 A;  1CK3 A;  3BRM A;  1XP4 A;  3FZC A;  3G2Y A;  3UO9 A;  3ZHH A;  2ZQC A;  3HL9 A;  4MEZ A;  1L0E A;  3P09 A;  3BM6 A;  5EOE A;  1FR6 A;  1NXY A;  2XR0 A;  5FI6 A;  2EXB A;  1I2S A;  5FAO A;  2G2W A;  1RGY A;  3OPL A;  4OPQ A;  3I7J A;  1AXB A;  5DTK A;  3G4P A;  3RXW A;  1KDS A;  1N4O A;  3GR2 A;  1NYY A;  4HES A;  4P87 A;  1W8Q A;  1W5D A;  4KG5 A;  2ZJ9 A;  4FCF A;  4L0L A;  3PBR A;  3CG5 A;  1PWG A;  2ZQ9 A;  2Q9N A;  3NDG A;  5FQI A;  4P85 A;  5M18 A;  4IBX A;  4Y7P A;  1FSW A;  4XUX A;  3MXS A;  4QHC A;  2IWC A;  4X56 A;  2Y2L A;  4KZ4 A;  4UA9 A;  4EBN A;  1EWZ A;  3HLW A;  4R4S A;  3VP1 A;  5M19 A;  4Y0O A;  2Y2P A;  3NC8 A;  1M6K A;  1U60 A;  3ITB A;  3O86 A;  1PI4 A;  3QNC A;  1O07 A;  2P74 A;  5CEC A;  3MXR A;  3VP0 A;  1OME A;  4X6T A;  3TG9 A;  4DXC A;  3BYD A;  2HDU A;  5DTT A;  3W4O A;  3WS5 A;  4LV2 A;  3OPR A;  4YFM A;  4ZTK A;  5F82 A;  3AGE A;  2OLV A;  4S2N C;  4U3T A;  4RYE A;  1YMX A;  3DWZ A;  4KZ6 A;  4E6W A;  1MXO A;  3GRJ A;  4K0X A;  1CEF A;  4KZ5 A;  4N9L A;  4OPR A;  2XQZ A;  2DRW A;  3OZH A;  1ALQ A;  4OPY A;  5EPH A;  2XK1 A;  2PBY A;  1N9B A;  1H5X A;  4PM6 A;  1ERQ A;  4OOM A;  4R23 A;  1QME A;  2XD1 A;  4JXV A;  3GVB A;  4K91 A;  3VP2 A;  4ZJ1 A;  1ERO A;  1ESU A;  2ZC5 B;  4DDY A;  4DE0 A;  3UDI A;  4OQH A;  4OVD A;  3LCE A;  3PBT A;  3N6I A;  5G18 A;  3WS0 A;  3UDF A;  1JTG A;  2ZC7 A;  4QU3 A;  4FH2 A;  1YMS A;  1KE4 A;  1SKF A;  2HPB A;  3AGF A;  4Z9Q A;  4MBF A;  2HDR A;  3V5M A;  3IXH A;  4OP8 A;  4JLF A;  2ZLY A;  4N1H A;  5CGW A;  2QPN A;  5JYO A;  1PW8 A;  2J9P A;  3CMZ A;  4GD8 A;  4WEK A;  4MNR A;  4DE3 A;  4E3M A;  4DE1 A;  3IT9 A;  2Y2K A;  3HBR A;  2J8Y A;  4E3K A;  4ZDX A;  1KGG A;  2VGJ A;  3VFF A;  5CRF A;  4JXS A;  3VOY A;  2ZMA A;  2ZQ7 A;  1YT4 A;  2IWB A;  3TOI A;  4X55 A;  4C6Y A;  4BQM A;  5CXW A;  4LV1 A;  3WRZ A;  1L0F A;  4FSF A;  4X68 A;  3A3D A;  3HLD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...