2WYXA

Neutron structure of a class a beta-lactamase toho-1 e166a r274n r276n triple mutant
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
256
structure length
256
Chain Sequence
VQQQLEALEKSSGGRLGVALINTADNSQILYRADERFAMCSTSKVMAAAAVLKQSESDKHLLNQRVEIKKSDLVNYNPIAEKHVNGTMTLAELGAAALQYSDNTAMNKLIAHLGGPDKVTAFARSLGDETFRLDRTAPTLNTAIPGDPRDTTTPLAMAQTLKNLTLGKALAETQRAQLVTWLKGNTTGSASIRAGLPKSWVVGDKTGSGDYGTTNDIAVIWPENHAPLVLVTYFTQPEQKAENRNDILAAAAKIVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-LACTAMSE TOHO-1
publication title Neutron Diffraction Studies of a Class a Beta-Lactamase Toho-1 E166A R274N R276N Triple Mutant
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 90
structure length 256
sequence length 256
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2009-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2wyxA00
5EECA 4EBPA 1Z6FA 1IYOA 2WGVA 1BUEA 5FQ9A 2WADA 3BFFA 3ZG8B 2EX2A 3IF6B 4X6TA 2ZQ9A 4QJGA 4NK3A 3VP4A 2XEPA 1LI0A 5DTSA 1E25A 5DTKA 1EROA 5J8XA 2XGNA 1RGZA 1SCWA 2XDMA 4JF4A 3BFEA 4R23A 1KVMA 1CEGA 3UO9A 3ISGA 5EPHA 3PBTA 3UDFA 2C6WB 3AGFA 3I7JA 3NY4A 2A49A 1TDLA 3SH9A 3IH8A 1BT5A 1FSYA 3BFGA 2DNSA 5FAPA 2P9VB 4P0MA 3M6BA 2WKEA 4LCMA 2Y2HA 3MKFA 4PM8A 5DF7A 4OQHA 2J9OA 5JYPA 2ZQAA 4PM7A 1ZG6A 4H8RA 1W8YA 2EXAA 2V1ZA 1N9BA 1G6AA 4KZ7A 1GA0A 1PI5A 2Q9MA 4PPRA 3IF6C 2R9WA 4EV4A 3NCKA 1BLHA 4HEFA 4E6WA 1K6RA 4KZAA 4BL2A 2Y4AA 2ZQ7A 2XD5A 4DDSA 2Y55A 4KG2A 4S2OA 1FQGA 3G32A 4U0TA 2EXBA 3BLMA 3FZCA 2Z2LB 1KE4A 4KZ9A 2JCHA 2B5RA 2XK1A 3N7WA 3M2JA 3CMZA 5EVIB 5HAPA 3MXSA 1DJBA 4E3KA 3N4IA 1IEMA 1IKIA 4JBFA 4WEKA 4E3NA 1IYPA 1K56A 3UNWA 1O07A 1XKZA 1YLTA 3HL9A 4WEJA 1IKGA 5EOOA 5GLAA 3SS4A 2Y2JA 4JXVA 3FWLA 1ERMA 4RYEA 3IXBA 3ZVWA 4ZBEA 1KDSA 5HFOA 3IXDA 4GD8A 2ZJ9A 2I72A 5AQ9A 2Y2OA 1JWPA 3OC2A 3ZFZA 4E3IA 4OP8A 3PBQA 2QZ6A 2Y59A 4X53A 4OOYA 1YLJA 5EVIC 5A92A 3ZG9B 3GVBA 3HVFA 3DWKA 5DVAA 2RL3A 4GKUA 4QY6A 1S6RA 5EOEA 2XLNA 1K4EA 1KGGA 3IXGA 3VMAA 3ZNTA 2E8IA 2WK0A 1EWZA 4UA7A 1Q2QA 1YMSA 4P87A 4S2PA 4Y0TA 3BM6A 3RJUA 2Y2GA 3MFDA 3Q07A 2Y91A 3VP1A 1ES2A 3GMWA 4MLLA 4OQIA 5D3OA 5FAOA 1PZPA 3HLDA 4NETA 4R3BA 5E43A 5FASA 5FQMA 1PWGA 4WZ5C 3SOIA 4FD8A 5G18A 2HDSA 4JPMA 4OLGA 5EE8A 2ZQDA 1K56D 2WAEA 3NDEA 3WS1A 1BLSA 1E3UA 3JYIA 2ZC3B 2JC7A 3E2LA 3G35A 3NBLA 4U3TA 1LHYA 1ES5A 1PI4A 2OLUA 3VFHA 2WYXA 4BL3A 5FI6A 1IYSA 4KENB 4R0QA 3FV7A 3WWXA 2DRWA 3W8KA 1MKIA 5IHVA 3ZDJA 5GLBA 4FSFA 4OPYA 4C3QA 4HBUA 4KG5A 3OPLA 1GHPA 2EFXA 2XF3A 3O3VA 4CPKA 4N9KA 2JE5A 4PMAA 3RXXA 2DCFA 2WUQA 3VSKA 1JWZA 1JVJA 4P85A 3BRMA 1KDWA 1PW1A 4N92A 3A3EA 3PAGA 1NYYA 4OQGA 1XA7A 2ZM2A 4X68A 3OZHA 5GLDA 5HX9A 3IQAA 1XX2A 4RX2A 2PU4A 4WZ5A 1RCJA 3N8SA 4PM5A 4IEDA 1H8YA 1QMEA 2WKIA 3LCEA 1MY8A 4OQ0A 5CECA 1L0EA 1YM1A 3Q7ZA 1YLPA 1DY6A 3UDIA 3C7UA 4BENA 3UPOA 5CHMA 3ZHHA 1BLPA 2QPNA 3IH9A 1K54C 4EUZA 2IWBA 2EX8A 1M6KA 1HVBA 1S0WA 5CHUA 3NI9A 4C6YA 1E3UD 2ZQ8A 1JTGA 1PWCA 4ZDXA 3M2KA 5EVID 5L2FA 3AGDA 4WMCA 3BEBA 3DTMA 4OPRA 3CJMA 3BECA 1XPBA 3IHBA 1C3BA 3MZFA 4DRTA 3HUOA 1K57A 5I94A 2OSUA 3VP0A 4A5RA 2XFSA 2G2UA 4EQIA 2UWXA 2PU2A 4DXCA 1XGIA 4UHUA 3Q7VA 4UA9A 5HARA 3OPHA 5U47A 3SH7A 5A91A 4E3OA 1YQSA 4QHCA 1CI8A 4B88A 3EQUA 3WS2A 4XXRA 5KSCA 5M18A 1I2SA 4S2IA 4DE0A 1MWTA 4F94A 3LEZA 4KZ4A 1ESIA 4CJNA 1NXYA 1ES3A 4R4SA 3EQVA 3WS0A 1W5DA 4JF6A 1K54A 5FQKA 1L2SA 3S22A 3V5MA 2ZC4B 4JXWA 3HBRA 3OCNA 2V2FF 4IBXA 2Q9NA 1YT4A 1NZOA 4D2OA 4QU3A 2Y2KA 1FCOA 4E6XA 2JBFA 4EWFA 5FA7A 2EFUA 3QNBA 1K38A 1W7FA 4KQOA 1FCMA 2Z2MB 2C5WB 1SDNA 1CK3A 3MXRA 5F83A 2H0YA 2ZD8A 2HP5A 4K0WA 1TDGA 1MWUA 1LL5A 2Y2LA 4GOGA 2Y2PA 4K91A 4KZ5A 4RA7A 5FATA 5FQIA 5DF9A 4WBGA 3N8LA 4XUZA 1ZC2A 5FSRA 4X69A 3GRJA 4JF5A 3WRZA 1XA1A 5AQ7A 4DXBA 5CRFA 3DW0A 2P74A 3WS4A 4PM9A 1CEFA 5EVLA 3TG9A 5EUAA 3W4OA 2RCXA 3CG5A 3O86A 2HP9A 1QMFA 1GCEA 5FQQA 4OP5A 5DF8A 3QNCA 4JXGA 3MZEA 4DE2A 3PBNA 3NDGA 4OOLA 3V3RA 5BOHA 1ZG4A 2J9PA 1VQQA 2XD1A 4Y0UA 3ZVTA 2WZZA 4WZ4A 5FAQA 3G4PA 3ZG5A 2Y2QA 1MBLA 3P98A 4OONA 2OV5A 3HLCA 4E3JA 3A3JA 3BFDA 5AQAA 4UAAA 5FQJA 1HD8A 2BG1A 4K0XA 3UE3A 4WELA 1K25A 1XP4A 5TGFA 3SS5A 4B4XA 1HTZA 1I5QA 1RGYA 1KGFA 1NYMA 2WZXA 3B3XA 3GQZA 2WAFA 5E2EA 4Y7PA 3Q7VB 3IWIA 2H10A 3ITBA 4FH2A 3Q81A 3W4PA 1PW8A 1FSWA 2HDUA 5GHZA 1KVLA 3QHYA 4MBHA 4HESA 4BLMA 4LV2A 4PM6A 4OOMA 3IHAA 2ZM0A 4IVKA 4S2NC 5CERA 1BZAA 1H8ZA 1NY0A 3OPRA 4KZ6A 3ZG7B 4N1XA 3G30A 4R4RA 4BD0A 5GLCA 2J7VA 5HAIA 4KZ3A 1MXOA 4OPZA 1FOFA 4YINA 1OMEA 5GHXA 3VOYA 1ESUA 5E2HA 5F1FA 4L0LA 5CTMA 1K57C 5KMWA 3ZG0A 1XXMA 4ZJ2A 5KSHA 2G2WA 5CGXA 1YLYA 2WGWB 1XGJA 3GV9A 3HLEA 3TSGA 3A3DA 3BFCA 1MWSA 4ZTKA 2ZLYA 2WKHA 3VP3A 5CEDA 2HDRA 1LL9A 4OVDA 4DF6A 4BD1A 1FR1A 3PAEA 3UPNA 1L0DA 1PWDA 4R3JA 3NC8A 3GSGA 5F1GA 4S2LA 1SKFA 4EBNA 5CHJA 1O7EA 4S2NA 1IYQA 3W4QA 4HBTA 3VFFA 3BYDA 4QD4A 2J8YA 2VGKA 2X01A 3WS5A 1K55A 1PIOA 4E3LA 2XH9A 1G68A 4IBRA 2PBYA 3CZDA 4X55A 4O7DA 5M1AA 4ID4A 1AXBA 1WYCA 2EX9A 1L0FA 2QMIA 4MBFA 4OH0A 4YFMA 3HLWA 1ZKJA 4LCLA 3HLBA 4QY5A 3UPPA 3S4XA 3OCLA 1BSGA 1H5XA 1DJCA 2H0TA 3IXHA 4EBLA 1JWVA 1LI9A 5GL9A 3WRTA 5CEBA 3V3SA 5KZHA 4MBKA 5HL1A 1Q2PA 4JXSA 3SH8A 1E4DA 1SHVA 4XUXA 4WYYA 5FI2A 1BULA 4LV1A 2IWCA 3G2YA 1KE0A 3ZCZA 4JLFA 5TR7A 4GNUA 3G34A 3GR2A 4MNRA 1ONHA 4GDBA 1ONGA 4B4ZA 4OLDA 2XR0A 2X71A 3D4FA 3MZDA 1YLZA 4P6BA 4N1HA 2XFTA 1MWRA 4DE1A 5A93A 4GZBA 1L0GA 3BLSA 2WGWA 2GDNA 3GTCA 2ZMAA 2Y2MA 1TEMA 3IWQA 3NIAA 2HP6A 1K6SA 1JTDA 4FCFA 1U60A 4LV3A 4UA6A 1PYYA 2HPBA 4S2KA 1PZOA 1Y54A 4FH4A 1IELA 1GHIA 2FFYA 4MEZA 1LLBA 2OLVA 4M3KA 3Q82A 3ZGAB 1ES4A 4GDNA 1WYBA 5FDHA 1BLCA 3N6IA 1EI5A 4JKTA 4WMCD 3O88A 1W8QA 4X56A 3MBZA 2H5SA 3DWZA 2FFFB 3PBOA 3V39A 4GD6A 3VOZA 4Q8IA 3HLFA 2CC1A 3SS3A 4KZBA 1NZUA 3A3IA 3M6HA 3UE0A 3OPPA 3IT9A 3FKWA 3VP2A 4RVAA 5E2FA 4DE3A 3IF6A 4KQQA 2BLSA 5CGSA 4Z9QA 1NJ4A 4N9LA 3LO7A 3C5AA 1J9MA 2X02A 3PTEA 4RX3A 4E3MA 1WE4A 4OKPA 1CI9A 1ERQA 4Y0OA 3HUMA 4KQRA 5HW3A 4KZ8A 1GHMA 3ZNYA 3UN7A 1M40A 2A3UA 1I2WA 1KGEA 3AGEA 2P9VA 3PBRA 4ZJ1A 1HZOA 4GB7A 5CTNA 3S1YA 3IF5A 3N8RA 5FI7A 3Q1FA 3V50A 1FCNA 4C75A 1VM1A 4OPQA 5HAQA 1DJAA 3PBSA 3LY4A 1YLWA 2XQZA 2ZC5B 2ZC6B 4U0XA 4ZJ3A 2HDQA 1K4FA 3UY6A 3IWOA 4BQMA 5TFQA 1W79A 1K55C 2R9XA 1NRFA 4S2JA 2Y2IA 1YMXA 4S2MA 3HREA 1GA9A 4R1GA 4IVIA 2V20A 2ZQCA 3FYZA 3VSLA 1SDEA 3HUNA 5DTTA 3E2KA 2VGJA 4GN2A 5CGWA 5EVIA 5F82A 1MPLA 4DKIA 2ZM8A 3C4OA 5JYOA 1ALQA 3O87A 1FR6A 2WGIA 3FKVA 3HLGA 1BTLA 2Y2NA 3G31A 5AQBA 3MKEA 1N4OA 4LENA 3ITAA 3C4PA 5CXWA 3RXWA 1RP5A 5A90A 3UDXA 5GHYA 4WM9A 3TOIA 3UE1A 4QB8A 3C7VA 5E2GA 4KG6A 4DDYA 2IWDA 1TVFA 5M19A 4LV0A 3LY3A 1KE3A 2EX6A 3G2ZA 2ZC7A 3A3FA 4ZAMA 4BJPA 3P09A
chains in the Genus database with same CATH superfamily
4EBPA 4HNBA 3EGDC 3H82A 2EX2A 4HJ3A 1N9LA 5J8XA 4HJ6A 2Y8HA 4QPRA 1GSVA 2B18A 1KVMA 2I9VA 4MN5A 3ISGA 3UO9A 2VV8A 3I7JA 1BT5A 1FSYA 2DNSA 3T4OA 2P9VB 5J7EA 3M6BA 2ZQAA 4EEUA 1ZG6A 2XROA 1W8YA 2V1ZA 5EVEA 4EV4A 4PPRA 2R9WA 2NUPC 3NCKA 4F3LA 2OWHA 3MR0A 1FQGA 2NUTC 2Z2LB 4KZ9A 3T1SA 4EXOA 3N7WA 5HAPA 3MXSA 1IEMA 1VETB 1P9RA 3VV4A 1O07A 3FPVA 2QWSA 4WEJA 2Y2JA 4RYEA 5HFOA 4LPZA 1JWPA 5G4ZA 3W2ZA 4HP4A 3QP6A 2V8FA 1UWNX 2V0WA 3HVFA 1H3QA 2PR5A 3E4OA 4WL9A 5EOEA 1K4EA 4UA7A 4Y0TA 2Y91A 3GMWA 4OQIA 5D3OA 1PZPA 3ZQ5A 3DTEA 2MJ6A 4WZ5C 3VE3A 3B42A 2ZQDA 3L7HA 1BLSA 1E3UA 3JYIA 3G35A 3VFHA 2WYXA 5FI6A 3LGOA 3TJZC 4MN7A 2DRWA 3W8KA 5IHVA 1T1AA 4FSFA 4HBUA 4KG5A 2EFXA 4N9KA 2D02A 3BW6A 4N92A 4X68A 5GLDA 1XX2A 2PU4A 4WZ5A 3N8SA 4FUWA 5CECA 3Q7ZA 1DY6A 4BENA 3LEQA 3UPOA 4O8GA 2IWBA 4DMZA 5AVEA 1VEUB 3NI9A 1JTGA 3E4PA 5L2FA 3VE4A 4WMCA 3BEBA 4OPRA 3BECA 1N9OA 1XPBA 3O5YA 1C3BA 4DRTA 3LIBA 3VP0A 2OAP1 3MS6A 2G2UA 5L10A 4EQIA 2UWXA 2PU2A 5HARA 4I3AA 1CI8A 3WS2A 4R4SA 3WS0A 3V5MA 4JXWA 2YKFA 2V2FF 2JBFA 2EFUA 3QNBA 1W7FA 1NLZA 2YKHA 3OBFA 2ZOIA 3VOLA 1W63Q 3MFXA 4K0WA 1LL5A 2V1BA 4HHDA 3N8LA 4BJPA 5FSRA 4X69A 3GRJA 4JF5A 4B93A 5AQ7A 1S4RA 2K7SA 3W4OA 5EUAA 2VA0A 5HD5A 3BJNA 3FPWA 4XT2A 2PRFA 4G3WA 3V3RA 3LR4A 3ZVTA 2WZZA 1MBLA 3P98A 4OONA 2IA2A 3IX4A 5TJJA 1Y4OA 2WZXA 3GQZA 3B3XA 4Y5FA 3Q7VB 1P9WA 3IWIA 5L8MA 3K3DA 2LB5A 1FSWA 1KVLA 4DJ2A 4HESA 3CWFA 2ZM0A 4IVKA 5CERA 1NY0A 4BD0A 5GLCA 4KZ3A 1FOFA 2W3DA 3QP4A 3UB6A 5F1FA 5CTMA 5CGXA 1XGJA 3HLEA 3A3DA 2ZLYA 2WKHA 5CEDA 4OVDA 1OPXA 3UPNA 1LSWA 5F1GA 4S2LA 1O7EA 4GJ4A 1PIOA 1T18A 4E3LA 2XH9A 2PBYA 4CLCB 1WYCA 2QMIA 5F69A 1ZKJA 3UPPA 4P6ZS 4NXGA 1BSGA 4G3VA 3OOVA 1DJCA 4NEED 1G28A 5KZHA 1YSPA 5HPFA 4JXSA 3SH8A 2J3WA 3H7WA 1P97A 1LSXA 1BULA 4IHQA 2IWCA 2ZMFA 4QWOA 4JLFA 5TR7A 3KYEA 1DP9A 4GDBA 2XR0A 3D4FA 5A93A 3BLSA 2WGWA 3CUEC 1PYYA 4FH4A 1GHIA 1D1JA 1ES4A 1WYBA 4GDNA 5AJGA 1EI5A 3IS2B 3NJAA 2H5SA 3F1OA 4L9FA 3T4JA 2FFFB 3SS3A 4EEPA 3ULFA 2PAVP 3RTYA 4BWIA 2K31A 3KSGA 2W3FA 3JVVA 4BBUA 3C5AA 4E3MA 2GJ3A 3HUMA 1VB6A 1OT9A 3ZNYA 2KLIA 4O01A 2A3UA 1I2WA 1KGEA 2WKQA 2P9VA 3LR3A 1T19A 3N8RA 1SZVA 3V50A 1LL8A 1FCNA 5IU1A 3LY4A 1YKDA 2XQZA 4ZJ3A 1K4FA 4NXFA 4BQMA 5TFQA 1W79A 3BY8A 3HREA 2V20A 2ZQCA 5DTTA 2VGJA 2PT7A 4Y17A 1VETA 3K3CA 3G31A 1N9NA 4LENA 3KYQA 5GHYA 3TOIA 1TVFA 5DFXA 3G2ZA 2ZC7A 4B4ZA 1IYOA 3BFFA 3IF6B 4QJGA 4HQAA 3VP4A 1EROA 2XGNA 2LB9A 2XDMA 3BFEA 5HWWA 3AGFA 4KUOA 1TDLA 1YPRA 4P0MA 4PM8A 5DF7A 4OQHA 2W27A 4PM7A 4H8RA 1N9BA 3KO6A 1G6AA 2Q9MA 5FEGA 1L3LA 4R3AA 1BLHA 3FC7A 4HH3A 4KZAA 5KIZA 2Y4AA 2VV7A 2ZQ7A 3MF0A 3T4KA 4KG2A 3UE6A 3G32A 4HJ4A 4ESPA 2JCHA 2B5RA 2XK1A 3IBRA 2PD8A 5FEFA 4WEKA 1K56A 1YLTA 4R6LA 3HL9A 4I3IA 5EOOA 4JXVA 4ETZA 4GD8A 4E3IA 5TBMB 2Y59A 4NG2A 4OOYA 5EVIC 1S66L 3F1NA 1VEUA 3DWKA 5DVAA 2E8IA 2M7VA 2WK0A 5F6AA 2Y2GA 1PNEA 3MFDA 3Q07A 5LBRA 3HLDA 3NOPC 4PAUA 1PWGA 2HDSA 2WAEA 5EFWA 3C30A 4PM5A 3LIDA 1LHYA 1PI4A 2OLUA 4U3TA 3FV7A 1MKIA 3U4LP 3ZDJA 4OPYA 5EV0A 1D06A 5DFYA 2JE5A 1P0ZA 4PMAA 2VK3A 2DCFA 3CPTB 3CHWP 4K08A 5HSQA 1JWZA 4WF0A 2A24A 3PAGA 2VGLM 4YNRA 4OQGA 5HX9A 3UMDA 3IQAA 4FOFA 4RX2A 1RCJA 1MZUA 2ZL1B 4IEDA 1QMEA 4OQ0A 1MY8A 2J80A 2FZ0A 4I39A 5L09A 3IH9A 4EUZA 1HVBA 5F5YA 2EWVA 4GLQA 1E3UD 2ZQ8A 3B47A 3QP8A 3M2KA 2R78A 1K57A 2JKTM 4A5RA 2XFSA 3T1XA 4CQHA 5C5KA 4DXCA 3Q7VA 2JKTI 3OPHA 5U47A 3SH7A 5A91A 4E3OA 1YQSA 5KSCA 3EQUA 4XXRA 1I2SA 2ZBBA 4CJNA 1NXYA 3EQVA 4JF6A 1TS8A 2XA7M 1NZOA 2GNXA 5EM0A 1TDGA 1MWUA 4GOGA 4RA7A 5FATA 3T4LA 4KQDA 1T1CA 2QYBA 1XA1A 4DXBA 5CRFA 3DW0A 3WS4A 5AVFA 2INWA 1CEFA 5EVLA 3FG8A 3O86A 2HP9A 1GCEA 4EUVA 5DF8A 4CLCA 3QNCA 1XJ4A 5L07A 1ZG4A 2XD1A 4ETXA 3ZG5A 2OV5A 3HLCA 4BMWA 3BFDA 5AQAA 5FQJA 1HD8A 4K0XA 3UE3A 4WELA 3SS5A 2E8JA 1I5QA 4L9GA 4PHTA 4Y7PA 1D7EA 1DRMA 3RH8B 3Q81A 1PW8A 1BZAA 4KZ6A 3ZG7B 3OPRA 3ZYTA 4GHIA 2J7VA 4RQ9A 4GW9A 4HI4A 1GSWA 1ESUA 5E2HA 5KMWA 1YLYA 1V9ZA 3TSGA 4ZTKA 3VP3A 3MMHA 1LL9A 5HL6A 3HJKA 3PAEA 4G3KA 3LIEA 3NC8A 4EBNA 1OT6A 3CLOA 4HH2A 5CHJA 4MCWA 4HBTA 2J8YA 3WS5A 1G68A 4IBRA 4X55A 1AXBA 4OH0A 3H9WA 3HLWA 4QY5A 3JPUA 2Y79A 3S7OA 3OCLA 2EWWA 1H5XA 1OTIA 4EBLA 5GL9A 3TW8A 3V3SA 4MBKA 1Q2PA 3LIAA 1SHVA 4XUXA 5FI2A 1MKMA 1WA9A 4IUKA 3ZCZA 3GR2A 4MNRA 1NLYA 1X0OA 1ONGA 4OLDA 4P6BA 1OTAA 4DE1A 1MWRA 4GZBA 2J3TC 1L0GA 1OJGA 3QP1A 4EW7A 4LRZE 2L1MA 4FCFA 1JTDA 2HPBA 1PZOA 1IELA 1LLBA 3ZGAB 3O88A 1W8QA 4EERA 2P04A 4GD6A 1NZUA 3A3IA 3M6HA 3UE0A 3IT9A 3EEHA 4DE3A 5E2FA 3IF6A 5HDSA 5CGSA 3LO7A 5HWTA 2HJ9C 4RX3A 4O0PA 4OKPA 1CI9A 3H82B 4GS9B 2M7UA 1K0KA 4KZ8A 1OTBA 2HF6A 1OTEA 4Q0HA 4Z1WA 4ZJ1A 3IF5A 2D01A 2O0YA 5HAQA 3PBSA 2Z6DA 3KSFA 3SZTA 2HDQA 1MC0A 2FH5A 1TS7A 3FYZA 1AWIA 1SDEA 5CGWA 4DKIA 2ZM8A 3O87A 3HLGA 4Y2FA 3ITAA 3C4PA 3UB7A 3V67A 4ARZA 4WM9A 2IWDA 2VX8A 2EX6A 1F5MA 4ZAMA 2WGVA 1BUEA 4HY8A 5FQ9A 2WADA 3DBAA 2ZQ9A 4X6TA 4NK3A 5DTSA 1E25A 2XSSA 1SCWA 4R23A 4JF4A 1EW0A 1SKOA 3PBTA 3UDFA 2C6WB 3NY4A 3SH9A 3IH8A 3BFGA 1STZA 2Y2HA 3MKFA 5JYPA 2UV0E 2EXAA 2VV6A 3R7WA 4KZ7A 1ZTUA 1PI5A 4JGQA 2W3EA 4E6WA 1K6RA 4BL2A 4DDSA 2Y55A 3LIFA 4EESA 3FZCA 3CPTA 4LRYC 4UQIM 3M2JA 3CMZA 1S67L 3S7QA 4E3KA 3N4IA 4E3NA 3UNWA 1XKZA 2Q0OA 3SS4A 1KDSA 5AQ9A 3ZFZA 1YSQA 3OC2A 4OP8A 3PBQA 5HZHA 3F1PB 3TRCA 3ZG9B 3GVBA 2AVXA 2RL3A 4QY6A 1S6RA 2XLNA 3ZNTA 3NULA 2PDRA 3RJUA 1VHMA 3VP1A 1ES2A 4MN6A 5FAOA 4R3BA 5E43A 3S7NA 5FQMA 4FD8A 5G18A 4JPMA 1K56D 3WS1A 3E2LA 4D60A 3NBLA 3A0SA 5HL1A 1ES5A 4BL3A 1IYSA 4KENB 4LGWA 3WWXA 3LYXA 2XF3A 4Q0IA 4CPKA 3RXXA 2WUQA 3VSKA 1JVJA 3BRMA 1KDWA 1PW1A 3A3EA 2W1TB 1XA7A 2ZM2A 3OZHA 2W3HA 4YWZA 1XJ3A 3MQOA 1H8YA 1L0EA 1YM1A 1NWZA 1YLPA 3UDIA 4JGOA 1BLPA 2QPNA 4I5SA 1K54C 3NOTC 2WKPA 1M6KA 5CHUA 3EOIA 3QP5A 2L0WA 2HZ5A 4ZDXA 5EVID 3AGDA 1FIKA 3IHBA 1TS0A 3MZFA 4LFUA 4CLCE 3KYZA 4QHCA 3B33A 3E0YA 4B88A 1OTDA 4BBTA 3UB9A 4S2IA 1MWTA 4KZ4A 3E4QA 3S22A 1K54A 2O9AA 3IX3A 5A8BA 4IBXA 2Q9NA 4D2OA 4YOFA 4QU3A 2VJWA 1FCOA 1BYWA 4E6XA 1FILA 5FA7A 4EWFA 4II7A 3SW1A 1K38A 4HOIA 1OJ5A 2JKFA 4KQOA 1FCMA 4ME4A 3MXRA 1CK3A 5F83A 2H0YA 2HP5A 3E98A 1TF1A 2VZWA 2Y2LA 4KZ5A 5DKLA 2DMWA 1ZC2A 3U2AA 4BBVA 3WRZA 5IS1A 1W63M 2P08A 2P74A 2KDKA 4PM9A 3TG9A 2RCXA 5FQQA 4OP5A 1CJFA 4JXGA 3MZEA 4DE2A 1ACFA 4OOLA 4WLAA 1VQQA 4Y0UA 5FAQA 4IUHA 2BG1A 4LRXC 1XP4A 5TGFA 4B4XA 1HTZA 1RGYA 1KGFA 1NYMA 2WAFA 2H10A 3ITBA 3T50A 1TD5A 4FH2A 2HDUA 5GHZA 3QHYA 4MBHA 4OOMA 3H7WB 2VKSA 3LI8A 4N1XA 3G30A 3T1QB 1GSXA 3MQ0A 1MXOA 4YINA 1OMEA 5GHXA 3VOYA 3T4TA 4L0LA 1K57C 1XXMA 2G2WA 2WGWB 1MWSA 2HDRA 4BD1A 1CQAA 1PWDA 2ACGA 4I3JA 4R3JA 3GSGA 3F1OB 5G4YA 1H0MA 3VFFA 3BYDA 4QD4A 2VGKA 1ODVA 1K55A 2EA9A 2W1RA 4GS9A 5M1AA 2EX9A 1L0FA 5FDSA 3R4KA 1Y28A 3HLBA 4DN0A 2BTFP 3GECA 1G6OA 5DJUA 2H0TA 3IXHA 1JWVA 3WRTA 5CEBA 4WUJA 1T1BA 4WYYA 1S1ZA 4B9OA 3UMEA 4Y15A 4CLCC 3P01A 4N1HA 4X1MA 2QJ5A 1XJ2A 3GTCA 2ZMAA 2Y2MA 2ZOHA 3IWQA 3NIAA 1K6SA 2PBDP 4LV3A 4UA6A 2XRNA 4S2KA 4LLOB 2FFYA 4EQ1A 4M3KA 3N6IA 4WMCD 3MBZA 3JVUA 3PBOA 3MXQA 3VOZA 4IJGA 4Q8IA 2M1CA 2CC1A 4E04A 4KZBA 3BQAA 3OPPA 4NKPA 3FKWA 4KQQA 4Z9QA 2PYPA 5F68A 1NRJA 2X02A 3PTEA 2V1AA 5J4EA 1WE4A 3UN7A 3BY9A 1HZOA 2G7UA 3S1YA 3OLOA 3PYPA 5FI7A 4C75A 4OPQA 1DJAA 1YLWA 4U0XA 5MC7A 3UY6A 5HD3A 3D9YA 3C8CA 2HJEA 2R9XA 1NRFA 1YMXA 1XFQA 4S2MA 1GA9A 4R1GA 4IVIA 1XJ6A 3HUNA 3BWLA 5FL3A 4I38A 5F82A 3IS2A 3CI6A 1FR6A 3FKVA 5I5LA 2Y2NA 3MKEA 2J3TD 3RXWA 2VGLS 1RP5A 5IT5A 3PR6A 5A90A 2WKRA 1LT0A 3UDXA 3UE1A 4QB8A 3C7VA 1ZHHB 5E2GA 4KG6A 4DDYA 5M19A 3MJQA 3NECA 1XFNA 1KE3A 2Z6CA 3A3FA 5EECA 1Z6FA 3F1PA 3ZG8B 1Z09A 2XEPA 1LI0A 4DJ3A 4GCZA 5DTKA 1RGZA 3DTKA 2CMNA 1CEGA 5EPHA 2V0UA 3F1NB 2A49A 4NXBA 2PHYA 3MSHA 4P6ZM 5FAPA 3KSIA 2P7JA 2WKEA 4LCMA 1TS6A 2J9OA 1DP6A 1GA0A 3IF6C 4ZRRA 4HEFA 1JNUA 2OAQ1 2JKGA 3G6OA 2XD5A 4L9EA 5EM1A 2XA7S 4S2OA 2GZAA 4U0TA 2EXBA 3BLMA 1KE4A 4X1LA 1PRQA 2PD7A 5EVIB 3QP2A 1DJBA 3MQQA 5DKKA 1IKIA 2W1TA 4JBFA 1IYPA 4R70A 1F98A 1IKGA 5HPIA 2L4RA 5GLAA 2A2LA 1ERMA 3FWLA 3IXBA 3ZVWA 4ZBEA 3NOUC 2A24B 3IXDA 2ZJ9A 2I72A 4H6JB 2Y2OA 3LUQA 2HGVA 4PKYA 1HLUP 2QZ6A 4X53A 3D3OA 3A0VA 5A92A 1YLJA 4GKUA 1KGGA 3VMAA 3IXGA 1EWZA 1Q2QA 1YMSA 4P87A 4S2PA 3BM6A 3HJIA 3IX8A 3EWKA 4MLLA 4NETA 3T1RA 5FASA 3SOIA 1IFQA 5EE8A 4OLGA 4Y13A 1PFLA 5J3WA 3NDEA 1J3WA 4F3LB 2ZC3B 2JC7A 4R0QA 3T12B 5GLBA 4C3QA 3OPLA 1GHPA 3O3VA 1S1YA 4P85A 3UB5P 3DAVA 1NYYA 3HCYA 1YAXA 5TBMA 4WN5A 1IOUA 2WKIA 3LCEA 3C7UA 5CHMA 3ZHHA 2KOIA 4UEYA 3PHYA 2EX8A 1S0WA 4MDZA 4C6YA 1PWCA 3RFBA 3DTMA 3CJMA 1UGUA 3HUOA 4EU0A 5I94A 2OSUA 4R38A 3GDIA 2H28A 1F2KA 1XGIA 2VEAA 4UHUA 4UA9A 5M18A 4F94A 4DE0A 3LEZA 1ESIA 1ES3A 2W0NA 1W5DA 5FQKA 1L2SA 5HDDA 2ZC4B 3PXPA 3HBRA 3OCNA 1YT4A 2Y2KA 3T4SA 2PR6A 4GHIB 3L9KA 2JKRM 2Z2MB 2C5WB 1SDNA 2ZMVA 2ZD8A 2JKRI 2ZL1A 1V9YA 4NXEA 2OOLA 2Y2PA 4K91A 5FQIA 5DF9A 4WBGA 4XUZA 2O9BA 4Y3IA 2BASA 5CX7A 3CG5A 1QMFA 3CITA 3PBNA 3NDGA 2W3GA 5BOHA 2J9PA 1DP8A 4WZ4A 3CUEA 3G4PA 2Y2QA 2V8CA 4E3JA 3A3JA 4UAAA 2K2NA 1K25A 3LR0A 2GX5A 5E2EA 5DJTA 3W4PA 4BLMA 4LV2A 4PM6A 3IHAA 5HDCA 4S2NC 1H8ZA 1LSVA 5HAIA 4OPZA 2OWJA 1UWPX 3T4QA 3DTIA 4Q0JA 3ZG0A 5KSHA 4ZJ2A 1CF0A 3GV9A 3D72A 3BFCA 3TE8A 2V9AA 4DF6A 1FR1A 1F9IA 1L0DA 5K5BA 1SKFA 2QKPA 4HP9A 4HIAA 4S2NA 1IYQA 3W4QA 4AFIA 3LI9A 2X01A 3C2WA 4XT2B 1G5UA 3CZDA 4O7DA 4ID4A 4MBFA 4YFMA 4LCLA 4M4XA 3S4XA 1LI9A 2JN7A 1E4DA 1A0KA 2QJ7A 4LV1A 3G2YA 1KE0A 4PKYG 4GNUA 3G34A 3A0RA 1ONHA 3S7PA 1KOUA 2X71A 3MZDA 1YLZA 2XFTA 2GDNA 4UQIS 1TEMA 2HV1A 2HP6A 1U60A 3LICA 1Y54A 2O9CA 4MEZA 2KX6A 2OLVA 3LFVA 3Q82A 5FDHA 1BLCA 4JKTA 4JGPA 4X56A 2B02A 3DWZA 3V39A 3HLFA 4ARZB 3K2NA 3VP2A 3KX0X 4RVAA 2PYRA 2BLSA 1NJ4A 4N9LA 2QHKA 1J9MA 1H8MA 3ICYA 3KSHA 1ERQA 3CAXA 4Y0OA 4KQRA 5HW3A 2VLGA 2JHEA 1GHMA 1M40A 3AGEA 3PBRA 4KUKA 4GB7A 5CTNA 1SKOB 2O99A 2B95A 3Q1FA 4X25A 1VM1A 3P7NA 2ZC5B 2ZC6B 3UB8A 3IWOA 3R7WB 1K55C 4S2JA 5HWVA 2Y2IA 3C38A 4EETB 3NHQA 3BQ8A 4FTXA 3VSLA 3E2KA 4GN2A 5EVIA 3EEAA 1MPLA 4CLCD 3C4OA 5JYOA 1ALQA 3LR5A 2WGIA 1BTLA 5AQBA 1N4OA 3IBJA 5CXWA 1S4SA 4MMNA 4LV0A 3LY3A 4H6JA 4R4RA 4JGRA 3EGXC 3P09A
chains in the Genus database with same CATH topology
5EECA 4EBPA 1Z6FA 1IYOA 2WGVA 1BUEA 5FQ9A 2WADA 3BFFA 3ZG8B 2EX2A 3IF6B 4X6TA 2ZQ9A 4QJGA 4NK3A 3VP4A 2XEPA 1LI0A 5DTSA 1E25A 5DTKA 1EROA 5J8XA 2XGNA 1RGZA 1SCWA 2XDMA 4JF4A 3BFEA 4R23A 1KVMA 1CEGA 3UO9A 3ISGA 5EPHA 3PBTA 3UDFA 2C6WB 3AGFA 3I7JA 3NY4A 2A49A 1TDLA 3SH9A 3IH8A 1BT5A 1FSYA 3BFGA 2DNSA 5FAPA 2P9VB 4P0MA 3M6BA 2WKEA 4LCMA 2Y2HA 3MKFA 4PM8A 5DF7A 4OQHA 2J9OA 5JYPA 2ZQAA 4PM7A 1ZG6A 4H8RA 1W8YA 2EXAA 2V1ZA 1N9BA 1G6AA 4KZ7A 1GA0A 1PI5A 2Q9MA 4PPRA 3IF6C 2R9WA 4EV4A 3NCKA 1BLHA 4HEFA 4E6WA 1K6RA 4KZAA 4BL2A 2Y4AA 2ZQ7A 2XD5A 4DDSA 2Y55A 4KG2A 4S2OA 1FQGA 3G32A 4U0TA 2EXBA 3BLMA 3FZCA 2Z2LB 1KE4A 4KZ9A 2JCHA 2B5RA 2XK1A 3N7WA 3M2JA 3CMZA 5EVIB 5HAPA 3MXSA 1DJBA 4E3KA 3N4IA 1IEMA 1IKIA 4JBFA 4WEKA 4E3NA 1IYPA 1K56A 3UNWA 1O07A 1XKZA 1YLTA 3HL9A 4WEJA 1IKGA 5EOOA 5GLAA 3SS4A 2Y2JA 4JXVA 3FWLA 1ERMA 4RYEA 3IXBA 3ZVWA 4ZBEA 1KDSA 5HFOA 3IXDA 4GD8A 2ZJ9A 2I72A 5AQ9A 2Y2OA 1JWPA 3OC2A 3ZFZA 4E3IA 4OP8A 3PBQA 2QZ6A 2Y59A 4X53A 4OOYA 1YLJA 5EVIC 5A92A 3ZG9B 3GVBA 3HVFA 3DWKA 5DVAA 2RL3A 4GKUA 4QY6A 1S6RA 5EOEA 2XLNA 1K4EA 1KGGA 3IXGA 3VMAA 3ZNTA 2E8IA 2WK0A 1EWZA 4UA7A 1Q2QA 1YMSA 4P87A 4S2PA 4Y0TA 3BM6A 3RJUA 2Y2GA 3MFDA 3Q07A 2Y91A 3VP1A 1ES2A 3GMWA 4MLLA 4OQIA 5D3OA 5FAOA 1PZPA 3HLDA 4NETA 4R3BA 5E43A 5FASA 5FQMA 1PWGA 4WZ5C 3SOIA 4FD8A 5G18A 2HDSA 4JPMA 4OLGA 5EE8A 2ZQDA 1K56D 2WAEA 3NDEA 3WS1A 1BLSA 1E3UA 3JYIA 2ZC3B 2JC7A 3E2LA 3G35A 3NBLA 4U3TA 1LHYA 1ES5A 1PI4A 2OLUA 3VFHA 2WYXA 4BL3A 5FI6A 1IYSA 4KENB 4R0QA 3FV7A 3WWXA 2DRWA 3W8KA 1MKIA 5IHVA 3ZDJA 5GLBA 4FSFA 4OPYA 4C3QA 4HBUA 4KG5A 3OPLA 1GHPA 2EFXA 2XF3A 3O3VA 4CPKA 4N9KA 2JE5A 4PMAA 3RXXA 2DCFA 2WUQA 3VSKA 1JWZA 1JVJA 4P85A 3BRMA 1KDWA 1PW1A 4N92A 3A3EA 3PAGA 1NYYA 4OQGA 1XA7A 2ZM2A 4X68A 3OZHA 5GLDA 5HX9A 3IQAA 1XX2A 4RX2A 2PU4A 4WZ5A 1RCJA 3N8SA 4PM5A 4IEDA 1H8YA 1QMEA 2WKIA 3LCEA 1MY8A 4OQ0A 5CECA 1L0EA 1YM1A 3Q7ZA 1YLPA 1DY6A 3UDIA 3C7UA 4BENA 3UPOA 5CHMA 3ZHHA 1BLPA 2QPNA 3IH9A 1K54C 4EUZA 2IWBA 2EX8A 1M6KA 1HVBA 1S0WA 5CHUA 3NI9A 4C6YA 1E3UD 2ZQ8A 1JTGA 1PWCA 4ZDXA 3M2KA 5EVID 5L2FA 3AGDA 4WMCA 3BEBA 3DTMA 4OPRA 3CJMA 3BECA 1XPBA 3IHBA 1C3BA 3MZFA 4DRTA 3HUOA 1K57A 5I94A 2OSUA 3VP0A 4A5RA 2XFSA 2G2UA 4EQIA 2UWXA 2PU2A 4DXCA 1XGIA 4UHUA 3Q7VA 4UA9A 5HARA 3OPHA 5U47A 3SH7A 5A91A 4E3OA 1YQSA 4QHCA 1CI8A 4B88A 3EQUA 3WS2A 4XXRA 5KSCA 5M18A 1I2SA 4S2IA 4DE0A 1MWTA 4F94A 3LEZA 4KZ4A 1ESIA 4CJNA 1NXYA 1ES3A 4R4SA 3EQVA 3WS0A 1W5DA 4JF6A 1K54A 5FQKA 1L2SA 3S22A 3V5MA 2ZC4B 4JXWA 3HBRA 3OCNA 2V2FF 4IBXA 2Q9NA 1YT4A 1NZOA 4D2OA 4QU3A 2Y2KA 1FCOA 4E6XA 2JBFA 4EWFA 5FA7A 2EFUA 3QNBA 1K38A 1W7FA 4KQOA 1FCMA 2Z2MB 2C5WB 1SDNA 1CK3A 3MXRA 5F83A 2H0YA 2ZD8A 2HP5A 4K0WA 1TDGA 1MWUA 1LL5A 2Y2LA 4GOGA 2Y2PA 4K91A 4KZ5A 4RA7A 5FATA 5FQIA 5DF9A 4WBGA 3N8LA 4XUZA 1ZC2A 5FSRA 4X69A 3GRJA 4JF5A 3WRZA 1XA1A 5AQ7A 4DXBA 5CRFA 3DW0A 2P74A 3WS4A 4PM9A 1CEFA 5EVLA 3TG9A 5EUAA 3W4OA 2RCXA 3CG5A 3O86A 2HP9A 1QMFA 1GCEA 5FQQA 4OP5A 5DF8A 3QNCA 4JXGA 3MZEA 4DE2A 3PBNA 3NDGA 4OOLA 3V3RA 5BOHA 1ZG4A 2J9PA 1VQQA 2XD1A 4Y0UA 3ZVTA 2WZZA 4WZ4A 5FAQA 3G4PA 3ZG5A 2Y2QA 1MBLA 3P98A 4OONA 2OV5A 3HLCA 4E3JA 3A3JA 3BFDA 5AQAA 4UAAA 5FQJA 1HD8A 2BG1A 4K0XA 3UE3A 4WELA 1K25A 1XP4A 5TGFA 3SS5A 4B4XA 1HTZA 1I5QA 1RGYA 1KGFA 1NYMA 2WZXA 3B3XA 3GQZA 2WAFA 5E2EA 4Y7PA 3Q7VB 3IWIA 2H10A 3ITBA 4FH2A 3Q81A 3W4PA 1PW8A 1FSWA 2HDUA 5GHZA 1KVLA 3QHYA 4MBHA 4HESA 4BLMA 4LV2A 4PM6A 4OOMA 3IHAA 2ZM0A 4IVKA 4S2NC 5CERA 1BZAA 1H8ZA 1NY0A 3OPRA 4KZ6A 3ZG7B 4N1XA 3G30A 4R4RA 4BD0A 5GLCA 2J7VA 5HAIA 4KZ3A 1MXOA 4OPZA 1FOFA 4YINA 1OMEA 5GHXA 3VOYA 1ESUA 5E2HA 5F1FA 4L0LA 5CTMA 1K57C 5KMWA 3ZG0A 1XXMA 4ZJ2A 5KSHA 2G2WA 5CGXA 1YLYA 2WGWB 1XGJA 3GV9A 3HLEA 3TSGA 3A3DA 3BFCA 1MWSA 4ZTKA 2ZLYA 2WKHA 3VP3A 5CEDA 2HDRA 1LL9A 4OVDA 4DF6A 4BD1A 1FR1A 3PAEA 3UPNA 1L0DA 1PWDA 4R3JA 3NC8A 3GSGA 5F1GA 4S2LA 1SKFA 4EBNA 5CHJA 1O7EA 4S2NA 1IYQA 3W4QA 4HBTA 3VFFA 3BYDA 4QD4A 2J8YA 2VGKA 2X01A 3WS5A 1K55A 1PIOA 4E3LA 2XH9A 1G68A 4IBRA 2PBYA 3CZDA 4X55A 4O7DA 5M1AA 4ID4A 1AXBA 1WYCA 2EX9A 1L0FA 2QMIA 4MBFA 4OH0A 4YFMA 3HLWA 1ZKJA 4LCLA 3HLBA 4QY5A 3UPPA 3S4XA 3OCLA 1BSGA 1H5XA 1DJCA 2H0TA 3IXHA 4EBLA 1JWVA 1LI9A 5GL9A 3WRTA 5CEBA 3V3SA 5KZHA 4MBKA 5HL1A 1Q2PA 4JXSA 3SH8A 1E4DA 1SHVA 4XUXA 4WYYA 5FI2A 1BULA 4LV1A 2IWCA 3G2YA 1KE0A 3ZCZA 4JLFA 5TR7A 4GNUA 3G34A 3GR2A 4MNRA 1ONHA 4GDBA 1ONGA 4B4ZA 4OLDA 2XR0A 2X71A 3D4FA 3MZDA 1YLZA 4P6BA 4N1HA 2XFTA 1MWRA 4DE1A 5A93A 4GZBA 1L0GA 3BLSA 2WGWA 2GDNA 3GTCA 2ZMAA 2Y2MA 1TEMA 3IWQA 3NIAA 2HP6A 1K6SA 1JTDA 4FCFA 1U60A 4LV3A 4UA6A 1PYYA 2HPBA 4S2KA 1PZOA 1Y54A 4FH4A 1IELA 1GHIA 2FFYA 4MEZA 1LLBA 2OLVA 4M3KA 3Q82A 3ZGAB 1ES4A 4GDNA 1WYBA 5FDHA 1BLCA 3N6IA 1EI5A 4JKTA 4WMCD 3O88A 1W8QA 4X56A 3MBZA 2H5SA 3DWZA 2FFFB 3PBOA 3V39A 4GD6A 3VOZA 4Q8IA 3HLFA 2CC1A 3SS3A 4KZBA 1NZUA 3A3IA 3M6HA 3UE0A 3OPPA 3IT9A 3FKWA 3VP2A 4RVAA 5E2FA 4DE3A 3IF6A 4KQQA 2BLSA 5CGSA 4Z9QA 1NJ4A 4N9LA 3LO7A 3C5AA 1J9MA 2X02A 3PTEA 4RX3A 4E3MA 1WE4A 4OKPA 1CI9A 1ERQA 4Y0OA 3HUMA 4KQRA 5HW3A 4KZ8A 1GHMA 3ZNYA 3UN7A 1M40A 2A3UA 1I2WA 1KGEA 3AGEA 2P9VA 3PBRA 4ZJ1A 1HZOA 4GB7A 5CTNA 3S1YA 3IF5A 3N8RA 5FI7A 3Q1FA 3V50A 1FCNA 4C75A 1VM1A 4OPQA 5HAQA 1DJAA 3PBSA 3LY4A 1YLWA 2XQZA 2ZC5B 2ZC6B 4U0XA 4ZJ3A 2HDQA 1K4FA 3UY6A 3IWOA 4BQMA 5TFQA 1W79A 1K55C 2R9XA 1NRFA 4S2JA 2Y2IA 1YMXA 4S2MA 3HREA 1GA9A 4R1GA 4IVIA 2V20A 2ZQCA 3FYZA 3VSLA 1SDEA 3HUNA 5DTTA 3E2KA 2VGJA 4GN2A 5CGWA 5EVIA 5F82A 1MPLA 4DKIA 2ZM8A 3C4OA 5JYOA 1ALQA 3O87A 1FR6A 2WGIA 3FKVA 3HLGA 1BTLA 2Y2NA 3G31A 5AQBA 3MKEA 1N4OA 4LENA 3ITAA 3C4PA 5CXWA 3RXWA 1RP5A 5A90A 3UDXA 5GHYA 4WM9A 3TOIA 3UE1A 4QB8A 3C7VA 5E2GA 4KG6A 4DDYA 2IWDA 1TVFA 5M19A 4LV0A 3LY3A 1KE3A 2EX6A 3G2ZA 2ZC7A 3A3FA 4ZAMA 4BJPA 3P09A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EEC A;  4EBP A;  1Z6F A;  1IYO A;  2WGV A;  1BUE A;  5FQ9 A;  2WAD A;  3BFF A;  3ZG8 B;  2EX2 A;  3IF6 B;  4X6T A;  2ZQ9 A;  4QJG A;  4NK3 A;  3VP4 A;  2XEP A;  1LI0 A;  5DTS A;  1E25 A;  5DTK A;  1ERO A;  5J8X A;  2XGN A;  1RGZ A;  1SCW A;  2XDM A;  4JF4 A;  3BFE A;  4R23 A;  1KVM A;  1CEG A;  3UO9 A;  3ISG A;  5EPH A;  3PBT A;  3UDF A;  2C6W B;  3AGF A;  3I7J A;  3NY4 A;  2A49 A;  1TDL A;  3SH9 A;  3IH8 A;  1BT5 A;  1FSY A;  3BFG A;  2DNS A;  5FAP A;  2P9V B;  4P0M A;  3M6B A;  2WKE A;  4LCM A;  2Y2H A;  3MKF A;  4PM8 A;  5DF7 A;  4OQH A;  2J9O A;  5JYP A;  2ZQA A;  4PM7 A;  1ZG6 A;  4H8R A;  1W8Y A;  2EXA A;  2V1Z A;  1N9B A;  1G6A A;  4KZ7 A;  1GA0 A;  1PI5 A;  2Q9M A;  4PPR A;  3IF6 C;  2R9W A;  4EV4 A;  3NCK A;  1BLH A;  4HEF A;  4E6W A;  1K6R A;  4KZA A;  4BL2 A;  2Y4A A;  2ZQ7 A;  2XD5 A;  4DDS A;  2Y55 A;  4KG2 A;  4S2O A;  1FQG A;  3G32 A;  4U0T A;  2EXB A;  3BLM A;  3FZC A;  2Z2L B;  1KE4 A;  4KZ9 A;  2JCH A;  2B5R A;  2XK1 A;  3N7W A;  3M2J A;  3CMZ A;  5EVI B;  5HAP A;  3MXS A;  1DJB A;  4E3K A;  3N4I A;  1IEM A;  1IKI A;  4JBF A;  4WEK A;  4E3N A;  1IYP A;  1K56 A;  3UNW A;  1O07 A;  1XKZ A;  1YLT A;  3HL9 A;  4WEJ A;  1IKG A;  5EOO A;  5GLA A;  3SS4 A;  2Y2J A;  4JXV A;  3FWL A;  1ERM A;  4RYE A;  3IXB A;  3ZVW A;  4ZBE A;  1KDS A;  5HFO A;  3IXD A;  4GD8 A;  2ZJ9 A;  2I72 A;  5AQ9 A;  2Y2O A;  1JWP A;  3OC2 A;  3ZFZ A;  4E3I A;  4OP8 A;  3PBQ A;  2QZ6 A;  2Y59 A;  4X53 A;  4OOY A;  1YLJ A;  5EVI C;  5A92 A;  3ZG9 B;  3GVB A;  3HVF A;  3DWK A;  5DVA A;  2RL3 A;  4GKU A;  4QY6 A;  1S6R A;  5EOE A;  2XLN A;  1K4E A;  1KGG A;  3IXG A;  3VMA A;  3ZNT A;  2E8I A;  2WK0 A;  1EWZ A;  4UA7 A;  1Q2Q A;  1YMS A;  4P87 A;  4S2P A;  4Y0T A;  3BM6 A;  3RJU A;  2Y2G A;  3MFD A;  3Q07 A;  2Y91 A;  3VP1 A;  1ES2 A;  3GMW A;  4MLL A;  4OQI A;  5D3O A;  5FAO A;  1PZP A;  3HLD A;  4NET A;  4R3B A;  5E43 A;  5FAS A;  5FQM A;  1PWG A;  4WZ5 C;  3SOI A;  4FD8 A;  5G18 A;  2HDS A;  4JPM A;  4OLG A;  5EE8 A;  2ZQD A;  1K56 D;  2WAE A;  3NDE A;  3WS1 A;  1BLS A;  1E3U A;  3JYI A;  2ZC3 B;  2JC7 A;  3E2L A;  3G35 A;  3NBL A;  4U3T A;  1LHY A;  1ES5 A;  1PI4 A;  2OLU A;  3VFH A;  2WYX A;  4BL3 A;  5FI6 A;  1IYS A;  4KEN B;  4R0Q A;  3FV7 A;  3WWX A;  2DRW A;  3W8K A;  1MKI A;  5IHV A;  3ZDJ A;  5GLB A;  4FSF A;  4OPY A;  4C3Q A;  4HBU A;  4KG5 A;  3OPL A;  1GHP A;  2EFX A;  2XF3 A;  3O3V A;  4CPK A;  4N9K A;  2JE5 A;  4PMA A;  3RXX A;  2DCF A;  2WUQ A;  3VSK A;  1JWZ A;  1JVJ A;  4P85 A;  3BRM A;  1KDW A;  1PW1 A;  4N92 A;  3A3E A;  3PAG A;  1NYY A;  4OQG A;  1XA7 A;  2ZM2 A;  4X68 A;  3OZH A;  5GLD A;  5HX9 A;  3IQA A;  1XX2 A;  4RX2 A;  2PU4 A;  4WZ5 A;  1RCJ A;  3N8S A;  4PM5 A;  4IED A;  1H8Y A;  1QME A;  2WKI A;  3LCE A;  1MY8 A;  4OQ0 A;  5CEC A;  1L0E A;  1YM1 A;  3Q7Z A;  1YLP A;  1DY6 A;  3UDI A;  3C7U A;  4BEN A;  3UPO A;  5CHM A;  3ZHH A;  1BLP A;  2QPN A;  3IH9 A;  1K54 C;  4EUZ A;  2IWB A;  2EX8 A;  1M6K A;  1HVB A;  1S0W A;  5CHU A;  3NI9 A;  4C6Y A;  1E3U D;  2ZQ8 A;  1JTG A;  1PWC A;  4ZDX A;  3M2K A;  5EVI D;  5L2F A;  3AGD A;  4WMC A;  3BEB A;  3DTM A;  4OPR A;  3CJM A;  3BEC A;  1XPB A;  3IHB A;  1C3B A;  3MZF A;  4DRT A;  3HUO A;  1K57 A;  5I94 A;  2OSU A;  3VP0 A;  4A5R A;  2XFS A;  2G2U A;  4EQI A;  2UWX A;  2PU2 A;  4DXC A;  1XGI A;  4UHU A;  3Q7V A;  4UA9 A;  5HAR A;  3OPH A;  5U47 A;  3SH7 A;  5A91 A;  4E3O A;  1YQS A;  4QHC A;  1CI8 A;  4B88 A;  3EQU A;  3WS2 A;  4XXR A;  5KSC A;  5M18 A;  1I2S A;  4S2I A;  4DE0 A;  1MWT A;  4F94 A;  3LEZ A;  4KZ4 A;  1ESI A;  4CJN A;  1NXY A;  1ES3 A;  4R4S A;  3EQV A;  3WS0 A;  1W5D A;  4JF6 A;  1K54 A;  5FQK A;  1L2S A;  3S22 A;  3V5M A;  2ZC4 B;  4JXW A;  3HBR A;  3OCN A;  2V2F F;  4IBX A;  2Q9N A;  1YT4 A;  1NZO A;  4D2O A;  4QU3 A;  2Y2K A;  1FCO A;  4E6X A;  2JBF A;  4EWF A;  5FA7 A;  2EFU A;  3QNB A;  1K38 A;  1W7F A;  4KQO A;  1FCM A;  2Z2M B;  2C5W B;  1SDN A;  1CK3 A;  3MXR A;  5F83 A;  2H0Y A;  2ZD8 A;  2HP5 A;  4K0W A;  1TDG A;  1MWU A;  1LL5 A;  2Y2L A;  4GOG A;  2Y2P A;  4K91 A;  4KZ5 A;  4RA7 A;  5FAT A;  5FQI A;  5DF9 A;  4WBG A;  3N8L A;  4XUZ A;  1ZC2 A;  5FSR A;  4X69 A;  3GRJ A;  4JF5 A;  3WRZ A;  1XA1 A;  5AQ7 A;  4DXB A;  5CRF A;  3DW0 A;  2P74 A;  3WS4 A;  4PM9 A;  1CEF A;  5EVL A;  3TG9 A;  5EUA A;  3W4O A;  2RCX A;  3CG5 A;  3O86 A;  2HP9 A;  1QMF A;  1GCE A;  5FQQ A;  4OP5 A;  5DF8 A;  3QNC A;  4JXG A;  3MZE A;  4DE2 A;  3PBN A;  3NDG A;  4OOL A;  3V3R A;  5BOH A;  1ZG4 A;  2J9P A;  1VQQ A;  2XD1 A;  4Y0U A;  3ZVT A;  2WZZ A;  4WZ4 A;  5FAQ A;  3G4P A;  3ZG5 A;  2Y2Q A;  1MBL A;  3P98 A;  4OON A;  2OV5 A;  3HLC A;  4E3J A;  3A3J A;  3BFD A;  5AQA A;  4UAA A;  5FQJ A;  1HD8 A;  2BG1 A;  4K0X A;  3UE3 A;  4WEL A;  1K25 A;  1XP4 A;  5TGF A;  3SS5 A;  4B4X A;  1HTZ A;  1I5Q A;  1RGY A;  1KGF A;  1NYM A;  2WZX A;  3B3X A;  3GQZ A;  2WAF A;  5E2E A;  4Y7P A;  3Q7V B;  3IWI A;  2H10 A;  3ITB A;  4FH2 A;  3Q81 A;  3W4P A;  1PW8 A;  1FSW A;  2HDU A;  5GHZ A;  1KVL A;  3QHY A;  4MBH A;  4HES A;  4BLM A;  4LV2 A;  4PM6 A;  4OOM A;  3IHA A;  2ZM0 A;  4IVK A;  4S2N C;  5CER A;  1BZA A;  1H8Z A;  1NY0 A;  3OPR A;  4KZ6 A;  3ZG7 B;  4N1X A;  3G30 A;  4R4R A;  4BD0 A;  5GLC A;  2J7V A;  5HAI A;  4KZ3 A;  1MXO A;  4OPZ A;  1FOF A;  4YIN A;  1OME A;  5GHX A;  3VOY A;  1ESU A;  5E2H A;  5F1F A;  4L0L A;  5CTM A;  1K57 C;  5KMW A;  3ZG0 A;  1XXM A;  4ZJ2 A;  5KSH A;  2G2W A;  5CGX A;  1YLY A;  2WGW B;  1XGJ A;  3GV9 A;  3HLE A;  3TSG A;  3A3D A;  3BFC A;  1MWS A;  4ZTK A;  2ZLY A;  2WKH A;  3VP3 A;  5CED A;  2HDR A;  1LL9 A;  4OVD A;  4DF6 A;  4BD1 A;  1FR1 A;  3PAE A;  3UPN A;  1L0D A;  1PWD A;  4R3J A;  3NC8 A;  3GSG A;  5F1G A;  4S2L A;  1SKF A;  4EBN A;  5CHJ A;  1O7E A;  4S2N A;  1IYQ A;  3W4Q A;  4HBT A;  3VFF A;  3BYD A;  4QD4 A;  2J8Y A;  2VGK A;  2X01 A;  3WS5 A;  1K55 A;  1PIO A;  4E3L A;  2XH9 A;  1G68 A;  4IBR A;  2PBY A;  3CZD A;  4X55 A;  4O7D A;  5M1A A;  4ID4 A;  1AXB A;  1WYC A;  2EX9 A;  1L0F A;  2QMI A;  4MBF A;  4OH0 A;  4YFM A;  3HLW A;  1ZKJ A;  4LCL A;  3HLB A;  4QY5 A;  3UPP A;  3S4X A;  3OCL A;  1BSG A;  1H5X A;  1DJC A;  2H0T A;  3IXH A;  4EBL A;  1JWV A;  1LI9 A;  5GL9 A;  3WRT A;  5CEB A;  3V3S A;  5KZH A;  4MBK A;  5HL1 A;  1Q2P A;  4JXS A;  3SH8 A;  1E4D A;  1SHV A;  4XUX A;  4WYY A;  5FI2 A;  1BUL A;  4LV1 A;  2IWC A;  3G2Y A;  1KE0 A;  3ZCZ A;  4JLF A;  5TR7 A;  4GNU A;  3G34 A;  3GR2 A;  4MNR A;  1ONH A;  4GDB A;  1ONG A;  4B4Z A;  4OLD A;  2XR0 A;  2X71 A;  3D4F A;  3MZD A;  1YLZ A;  4P6B A;  4N1H A;  2XFT A;  1MWR A;  4DE1 A;  5A93 A;  4GZB A;  1L0G A;  3BLS A;  2WGW A;  2GDN A;  3GTC A;  2ZMA A;  2Y2M A;  1TEM A;  3IWQ A;  3NIA A;  2HP6 A;  1K6S A;  1JTD A;  4FCF A;  1U60 A;  4LV3 A;  4UA6 A;  1PYY A;  2HPB A;  4S2K A;  1PZO A;  1Y54 A;  4FH4 A;  1IEL A;  1GHI A;  2FFY A;  4MEZ A;  1LLB A;  2OLV A;  4M3K A;  3Q82 A;  3ZGA B;  1ES4 A;  4GDN A;  1WYB A;  5FDH A;  1BLC A;  3N6I A;  1EI5 A;  4JKT A;  4WMC D;  3O88 A;  1W8Q A;  4X56 A;  3MBZ A;  2H5S A;  3DWZ A;  2FFF B;  3PBO A;  3V39 A;  4GD6 A;  3VOZ A;  4Q8I A;  3HLF A;  2CC1 A;  3SS3 A;  4KZB A;  1NZU A;  3A3I A;  3M6H A;  3UE0 A;  3OPP A;  3IT9 A;  3FKW A;  3VP2 A;  4RVA A;  5E2F A;  4DE3 A;  3IF6 A;  4KQQ A;  2BLS A;  5CGS A;  4Z9Q A;  1NJ4 A;  4N9L A;  3LO7 A;  3C5A A;  1J9M A;  2X02 A;  3PTE A;  4RX3 A;  4E3M A;  1WE4 A;  4OKP A;  1CI9 A;  1ERQ A;  4Y0O A;  3HUM A;  4KQR A;  5HW3 A;  4KZ8 A;  1GHM A;  3ZNY A;  3UN7 A;  1M40 A;  2A3U A;  1I2W A;  1KGE A;  3AGE A;  2P9V A;  3PBR A;  4ZJ1 A;  1HZO A;  4GB7 A;  5CTN A;  3S1Y A;  3IF5 A;  3N8R A;  5FI7 A;  3Q1F A;  3V50 A;  1FCN A;  4C75 A;  1VM1 A;  4OPQ A;  5HAQ A;  1DJA A;  3PBS A;  3LY4 A;  1YLW A;  2XQZ A;  2ZC5 B;  2ZC6 B;  4U0X A;  4ZJ3 A;  2HDQ A;  1K4F A;  3UY6 A;  3IWO A;  4BQM A;  5TFQ A;  1W79 A;  1K55 C;  2R9X A;  1NRF A;  4S2J A;  2Y2I A;  1YMX A;  4S2M A;  3HRE A;  1GA9 A;  4R1G A;  4IVI A;  2V20 A;  2ZQC A;  3FYZ A;  3VSL A;  1SDE A;  3HUN A;  5DTT A;  3E2K A;  2VGJ A;  4GN2 A;  5CGW A;  5EVI A;  5F82 A;  1MPL A;  4DKI A;  2ZM8 A;  3C4O A;  5JYO A;  1ALQ A;  3O87 A;  1FR6 A;  2WGI A;  3FKV A;  3HLG A;  1BTL A;  2Y2N A;  3G31 A;  5AQB A;  3MKE A;  1N4O A;  4LEN A;  3ITA A;  3C4P A;  5CXW A;  3RXW A;  1RP5 A;  5A90 A;  3UDX A;  5GHY A;  4WM9 A;  3TOI A;  3UE1 A;  4QB8 A;  3C7V A;  5E2G A;  4KG6 A;  4DDY A;  2IWD A;  1TVF A;  5M19 A;  4LV0 A;  3LY3 A;  1KE3 A;  2EX6 A;  3G2Z A;  2ZC7 A;  3A3F A;  4ZAM A;  4BJP A;  3P09 A; 
#chains in the Genus database with same CATH topology
 4EBP A;  4HNB A;  3EGD C;  3H82 A;  2EX2 A;  4HJ3 A;  1N9L A;  5J8X A;  4HJ6 A;  2Y8H A;  4QPR A;  1GSV A;  2B18 A;  1KVM A;  2I9V A;  4MN5 A;  3ISG A;  3UO9 A;  2VV8 A;  3I7J A;  1BT5 A;  1FSY A;  2DNS A;  3T4O A;  2P9V B;  5J7E A;  3M6B A;  2ZQA A;  4EEU A;  1ZG6 A;  2XRO A;  1W8Y A;  2V1Z A;  5EVE A;  4EV4 A;  4PPR A;  2R9W A;  2NUP C;  3NCK A;  4F3L A;  2OWH A;  3MR0 A;  1FQG A;  2NUT C;  2Z2L B;  4KZ9 A;  3T1S A;  4EXO A;  3N7W A;  5HAP A;  3MXS A;  1IEM A;  1VET B;  1P9R A;  3VV4 A;  1O07 A;  3FPV A;  2QWS A;  4WEJ A;  2Y2J A;  4RYE A;  5HFO A;  4LPZ A;  1JWP A;  5G4Z A;  3W2Z A;  4HP4 A;  3QP6 A;  2V8F A;  1UWN X;  2V0W A;  3HVF A;  1H3Q A;  2PR5 A;  3E4O A;  4WL9 A;  5EOE A;  1K4E A;  4UA7 A;  4Y0T A;  2Y91 A;  3GMW A;  4OQI A;  5D3O A;  1PZP A;  3ZQ5 A;  3DTE A;  2MJ6 A;  4WZ5 C;  3VE3 A;  3B42 A;  2ZQD A;  3L7H A;  1BLS A;  1E3U A;  3JYI A;  3G35 A;  3VFH A;  2WYX A;  5FI6 A;  3LGO A;  3TJZ C;  4MN7 A;  2DRW A;  3W8K A;  5IHV A;  1T1A A;  4FSF A;  4HBU A;  4KG5 A;  2EFX A;  4N9K A;  2D02 A;  3BW6 A;  4N92 A;  4X68 A;  5GLD A;  1XX2 A;  2PU4 A;  4WZ5 A;  3N8S A;  4FUW A;  5CEC A;  3Q7Z A;  1DY6 A;  4BEN A;  3LEQ A;  3UPO A;  4O8G A;  2IWB A;  4DMZ A;  5AVE A;  1VEU B;  3NI9 A;  1JTG A;  3E4P A;  5L2F A;  3VE4 A;  4WMC A;  3BEB A;  4OPR A;  3BEC A;  1N9O A;  1XPB A;  3O5Y A;  1C3B A;  4DRT A;  3LIB A;  3VP0 A;  2OAP 1;  3MS6 A;  2G2U A;  5L10 A;  4EQI A;  2UWX A;  2PU2 A;  5HAR A;  4I3A A;  1CI8 A;  3WS2 A;  4R4S A;  3WS0 A;  3V5M A;  4JXW A;  2YKF A;  2V2F F;  2JBF A;  2EFU A;  3QNB A;  1W7F A;  1NLZ A;  2YKH A;  3OBF A;  2ZOI A;  3VOL A;  1W63 Q;  3MFX A;  4K0W A;  1LL5 A;  2V1B A;  4HHD A;  3N8L A;  4BJP A;  5FSR A;  4X69 A;  3GRJ A;  4JF5 A;  4B93 A;  5AQ7 A;  1S4R A;  2K7S A;  3W4O A;  5EUA A;  2VA0 A;  5HD5 A;  3BJN A;  3FPW A;  4XT2 A;  2PRF A;  4G3W A;  3V3R A;  3LR4 A;  3ZVT A;  2WZZ A;  1MBL A;  3P98 A;  4OON A;  2IA2 A;  3IX4 A;  5TJJ A;  1Y4O A;  2WZX A;  3GQZ A;  3B3X A;  4Y5F A;  3Q7V B;  1P9W A;  3IWI A;  5L8M A;  3K3D A;  2LB5 A;  1FSW A;  1KVL A;  4DJ2 A;  4HES A;  3CWF A;  2ZM0 A;  4IVK A;  5CER A;  1NY0 A;  4BD0 A;  5GLC A;  4KZ3 A;  1FOF A;  2W3D A;  3QP4 A;  3UB6 A;  5F1F A;  5CTM A;  5CGX A;  1XGJ A;  3HLE A;  3A3D A;  2ZLY A;  2WKH A;  5CED A;  4OVD A;  1OPX A;  3UPN A;  1LSW A;  5F1G A;  4S2L A;  1O7E A;  4GJ4 A;  1PIO A;  1T18 A;  4E3L A;  2XH9 A;  2PBY A;  4CLC B;  1WYC A;  2QMI A;  5F69 A;  1ZKJ A;  3UPP A;  4P6Z S;  4NXG A;  1BSG A;  4G3V A;  3OOV A;  1DJC A;  4NEE D;  1G28 A;  5KZH A;  1YSP A;  5HPF A;  4JXS A;  3SH8 A;  2J3W A;  3H7W A;  1P97 A;  1LSX A;  1BUL A;  4IHQ A;  2IWC A;  2ZMF A;  4QWO A;  4JLF A;  5TR7 A;  3KYE A;  1DP9 A;  4GDB A;  2XR0 A;  3D4F A;  5A93 A;  3BLS A;  2WGW A;  3CUE C;  1PYY A;  4FH4 A;  1GHI A;  1D1J A;  1ES4 A;  1WYB A;  4GDN A;  5AJG A;  1EI5 A;  3IS2 B;  3NJA A;  2H5S A;  3F1O A;  4L9F A;  3T4J A;  2FFF B;  3SS3 A;  4EEP A;  3ULF A;  2PAV P;  3RTY A;  4BWI A;  2K31 A;  3KSG A;  2W3F A;  3JVV A;  4BBU A;  3C5A A;  4E3M A;  2GJ3 A;  3HUM A;  1VB6 A;  1OT9 A;  3ZNY A;  2KLI A;  4O01 A;  2A3U A;  1I2W A;  1KGE A;  2WKQ A;  2P9V A;  3LR3 A;  1T19 A;  3N8R A;  1SZV A;  3V50 A;  1LL8 A;  1FCN A;  5IU1 A;  3LY4 A;  1YKD A;  2XQZ A;  4ZJ3 A;  1K4F A;  4NXF A;  4BQM A;  5TFQ A;  1W79 A;  3BY8 A;  3HRE A;  2V20 A;  2ZQC A;  5DTT A;  2VGJ A;  2PT7 A;  4Y17 A;  1VET A;  3K3C A;  3G31 A;  1N9N A;  4LEN A;  3KYQ A;  5GHY A;  3TOI A;  1TVF A;  5DFX A;  3G2Z A;  2ZC7 A;  4B4Z A;  1IYO A;  3BFF A;  3IF6 B;  4QJG A;  4HQA A;  3VP4 A;  1ERO A;  2XGN A;  2LB9 A;  2XDM A;  3BFE A;  5HWW A;  3AGF A;  4KUO A;  1TDL A;  1YPR A;  4P0M A;  4PM8 A;  5DF7 A;  4OQH A;  2W27 A;  4PM7 A;  4H8R A;  1N9B A;  3KO6 A;  1G6A A;  2Q9M A;  5FEG A;  1L3L A;  4R3A A;  1BLH A;  3FC7 A;  4HH3 A;  4KZA A;  5KIZ A;  2Y4A A;  2VV7 A;  2ZQ7 A;  3MF0 A;  3T4K A;  4KG2 A;  3UE6 A;  3G32 A;  4HJ4 A;  4ESP A;  2JCH A;  2B5R A;  2XK1 A;  3IBR A;  2PD8 A;  5FEF A;  4WEK A;  1K56 A;  1YLT A;  4R6L A;  3HL9 A;  4I3I A;  5EOO A;  4JXV A;  4ETZ A;  4GD8 A;  4E3I A;  5TBM B;  2Y59 A;  4NG2 A;  4OOY A;  5EVI C;  1S66 L;  3F1N A;  1VEU A;  3DWK A;  5DVA A;  2E8I A;  2M7V A;  2WK0 A;  5F6A A;  2Y2G A;  1PNE A;  3MFD A;  3Q07 A;  5LBR A;  3HLD A;  3NOP C;  4PAU A;  1PWG A;  2HDS A;  2WAE A;  5EFW A;  3C30 A;  4PM5 A;  3LID A;  1LHY A;  1PI4 A;  2OLU A;  4U3T A;  3FV7 A;  1MKI A;  3U4L P;  3ZDJ A;  4OPY A;  5EV0 A;  1D06 A;  5DFY A;  2JE5 A;  1P0Z A;  4PMA A;  2VK3 A;  2DCF A;  3CPT B;  3CHW P;  4K08 A;  5HSQ A;  1JWZ A;  4WF0 A;  2A24 A;  3PAG A;  2VGL M;  4YNR A;  4OQG A;  5HX9 A;  3UMD A;  3IQA A;  4FOF A;  4RX2 A;  1RCJ A;  1MZU A;  2ZL1 B;  4IED A;  1QME A;  4OQ0 A;  1MY8 A;  2J80 A;  2FZ0 A;  4I39 A;  5L09 A;  3IH9 A;  4EUZ A;  1HVB A;  5F5Y A;  2EWV A;  4GLQ A;  1E3U D;  2ZQ8 A;  3B47 A;  3QP8 A;  3M2K A;  2R78 A;  1K57 A;  2JKT M;  4A5R A;  2XFS A;  3T1X A;  4CQH A;  5C5K A;  4DXC A;  3Q7V A;  2JKT I;  3OPH A;  5U47 A;  3SH7 A;  5A91 A;  4E3O A;  1YQS A;  5KSC A;  3EQU A;  4XXR A;  1I2S A;  2ZBB A;  4CJN A;  1NXY A;  3EQV A;  4JF6 A;  1TS8 A;  2XA7 M;  1NZO A;  2GNX A;  5EM0 A;  1TDG A;  1MWU A;  4GOG A;  4RA7 A;  5FAT A;  3T4L A;  4KQD A;  1T1C A;  2QYB A;  1XA1 A;  4DXB A;  5CRF A;  3DW0 A;  3WS4 A;  5AVF A;  2INW A;  1CEF A;  5EVL A;  3FG8 A;  3O86 A;  2HP9 A;  1GCE A;  4EUV A;  5DF8 A;  4CLC A;  3QNC A;  1XJ4 A;  5L07 A;  1ZG4 A;  2XD1 A;  4ETX A;  3ZG5 A;  2OV5 A;  3HLC A;  4BMW A;  3BFD A;  5AQA A;  5FQJ A;  1HD8 A;  4K0X A;  3UE3 A;  4WEL A;  3SS5 A;  2E8J A;  1I5Q A;  4L9G A;  4PHT A;  4Y7P A;  1D7E A;  1DRM A;  3RH8 B;  3Q81 A;  1PW8 A;  1BZA A;  4KZ6 A;  3ZG7 B;  3OPR A;  3ZYT A;  4GHI A;  2J7V A;  4RQ9 A;  4GW9 A;  4HI4 A;  1GSW A;  1ESU A;  5E2H A;  5KMW A;  1YLY A;  1V9Z A;  3TSG A;  4ZTK A;  3VP3 A;  3MMH A;  1LL9 A;  5HL6 A;  3HJK A;  3PAE A;  4G3K A;  3LIE A;  3NC8 A;  4EBN A;  1OT6 A;  3CLO A;  4HH2 A;  5CHJ A;  4MCW A;  4HBT A;  2J8Y A;  3WS5 A;  1G68 A;  4IBR A;  4X55 A;  1AXB A;  4OH0 A;  3H9W A;  3HLW A;  4QY5 A;  3JPU A;  2Y79 A;  3S7O A;  3OCL A;  2EWW A;  1H5X A;  1OTI A;  4EBL A;  5GL9 A;  3TW8 A;  3V3S A;  4MBK A;  1Q2P A;  3LIA A;  1SHV A;  4XUX A;  5FI2 A;  1MKM A;  1WA9 A;  4IUK A;  3ZCZ A;  3GR2 A;  4MNR A;  1NLY A;  1X0O A;  1ONG A;  4OLD A;  4P6B A;  1OTA A;  4DE1 A;  1MWR A;  4GZB A;  2J3T C;  1L0G A;  1OJG A;  3QP1 A;  4EW7 A;  4LRZ E;  2L1M A;  4FCF A;  1JTD A;  2HPB A;  1PZO A;  1IEL A;  1LLB A;  3ZGA B;  3O88 A;  1W8Q A;  4EER A;  2P04 A;  4GD6 A;  1NZU A;  3A3I A;  3M6H A;  3UE0 A;  3IT9 A;  3EEH A;  4DE3 A;  5E2F A;  3IF6 A;  5HDS A;  5CGS A;  3LO7 A;  5HWT A;  2HJ9 C;  4RX3 A;  4O0P A;  4OKP A;  1CI9 A;  3H82 B;  4GS9 B;  2M7U A;  1K0K A;  4KZ8 A;  1OTB A;  2HF6 A;  1OTE A;  4Q0H A;  4Z1W A;  4ZJ1 A;  3IF5 A;  2D01 A;  2O0Y A;  5HAQ A;  3PBS A;  2Z6D A;  3KSF A;  3SZT A;  2HDQ A;  1MC0 A;  2FH5 A;  1TS7 A;  3FYZ A;  1AWI A;  1SDE A;  5CGW A;  4DKI A;  2ZM8 A;  3O87 A;  3HLG A;  4Y2F A;  3ITA A;  3C4P A;  3UB7 A;  3V67 A;  4ARZ A;  4WM9 A;  2IWD A;  2VX8 A;  2EX6 A;  1F5M A;  4ZAM A;  2WGV A;  1BUE A;  4HY8 A;  5FQ9 A;  2WAD A;  3DBA A;  2ZQ9 A;  4X6T A;  4NK3 A;  5DTS A;  1E25 A;  2XSS A;  1SCW A;  4R23 A;  4JF4 A;  1EW0 A;  1SKO A;  3PBT A;  3UDF A;  2C6W B;  3NY4 A;  3SH9 A;  3IH8 A;  3BFG A;  1STZ A;  2Y2H A;  3MKF A;  5JYP A;  2UV0 E;  2EXA A;  2VV6 A;  3R7W A;  4KZ7 A;  1ZTU A;  1PI5 A;  4JGQ A;  2W3E A;  4E6W A;  1K6R A;  4BL2 A;  4DDS A;  2Y55 A;  3LIF A;  4EES A;  3FZC A;  3CPT A;  4LRY C;  4UQI M;  3M2J A;  3CMZ A;  1S67 L;  3S7Q A;  4E3K A;  3N4I A;  4E3N A;  3UNW A;  1XKZ A;  2Q0O A;  3SS4 A;  1KDS A;  5AQ9 A;  3ZFZ A;  1YSQ A;  3OC2 A;  4OP8 A;  3PBQ A;  5HZH A;  3F1P B;  3TRC A;  3ZG9 B;  3GVB A;  2AVX A;  2RL3 A;  4QY6 A;  1S6R A;  2XLN A;  3ZNT A;  3NUL A;  2PDR A;  3RJU A;  1VHM A;  3VP1 A;  1ES2 A;  4MN6 A;  5FAO A;  4R3B A;  5E43 A;  3S7N A;  5FQM A;  4FD8 A;  5G18 A;  4JPM A;  1K56 D;  3WS1 A;  3E2L A;  4D60 A;  3NBL A;  3A0S A;  5HL1 A;  1ES5 A;  4BL3 A;  1IYS A;  4KEN B;  4LGW A;  3WWX A;  3LYX A;  2XF3 A;  4Q0I A;  4CPK A;  3RXX A;  2WUQ A;  3VSK A;  1JVJ A;  3BRM A;  1KDW A;  1PW1 A;  3A3E A;  2W1T B;  1XA7 A;  2ZM2 A;  3OZH A;  2W3H A;  4YWZ A;  1XJ3 A;  3MQO A;  1H8Y A;  1L0E A;  1YM1 A;  1NWZ A;  1YLP A;  3UDI A;  4JGO A;  1BLP A;  2QPN A;  4I5S A;  1K54 C;  3NOT C;  2WKP A;  1M6K A;  5CHU A;  3EOI A;  3QP5 A;  2L0W A;  2HZ5 A;  4ZDX A;  5EVI D;  3AGD A;  1FIK A;  3IHB A;  1TS0 A;  3MZF A;  4LFU A;  4CLC E;  3KYZ A;  4QHC A;  3B33 A;  3E0Y A;  4B88 A;  1OTD A;  4BBT A;  3UB9 A;  4S2I A;  1MWT A;  4KZ4 A;  3E4Q A;  3S22 A;  1K54 A;  2O9A A;  3IX3 A;  5A8B A;  4IBX A;  2Q9N A;  4D2O A;  4YOF A;  4QU3 A;  2VJW A;  1FCO A;  1BYW A;  4E6X A;  1FIL A;  5FA7 A;  4EWF A;  4II7 A;  3SW1 A;  1K38 A;  4HOI A;  1OJ5 A;  2JKF A;  4KQO A;  1FCM A;  4ME4 A;  3MXR A;  1CK3 A;  5F83 A;  2H0Y A;  2HP5 A;  3E98 A;  1TF1 A;  2VZW A;  2Y2L A;  4KZ5 A;  5DKL A;  2DMW A;  1ZC2 A;  3U2A A;  4BBV A;  3WRZ A;  5IS1 A;  1W63 M;  2P08 A;  2P74 A;  2KDK A;  4PM9 A;  3TG9 A;  2RCX A;  5FQQ A;  4OP5 A;  1CJF A;  4JXG A;  3MZE A;  4DE2 A;  1ACF A;  4OOL A;  4WLA A;  1VQQ A;  4Y0U A;  5FAQ A;  4IUH A;  2BG1 A;  4LRX C;  1XP4 A;  5TGF A;  4B4X A;  1HTZ A;  1RGY A;  1KGF A;  1NYM A;  2WAF A;  2H10 A;  3ITB A;  3T50 A;  1TD5 A;  4FH2 A;  2HDU A;  5GHZ A;  3QHY A;  4MBH A;  4OOM A;  3H7W B;  2VKS A;  3LI8 A;  4N1X A;  3G30 A;  3T1Q B;  1GSX A;  3MQ0 A;  1MXO A;  4YIN A;  1OME A;  5GHX A;  3VOY A;  3T4T A;  4L0L A;  1K57 C;  1XXM A;  2G2W A;  2WGW B;  1MWS A;  2HDR A;  4BD1 A;  1CQA A;  1PWD A;  2ACG A;  4I3J A;  4R3J A;  3GSG A;  3F1O B;  5G4Y A;  1H0M A;  3VFF A;  3BYD A;  4QD4 A;  2VGK A;  1ODV A;  1K55 A;  2EA9 A;  2W1R A;  4GS9 A;  5M1A A;  2EX9 A;  1L0F A;  5FDS A;  3R4K A;  1Y28 A;  3HLB A;  4DN0 A;  2BTF P;  3GEC A;  1G6O A;  5DJU A;  2H0T A;  3IXH A;  1JWV A;  3WRT A;  5CEB A;  4WUJ A;  1T1B A;  4WYY A;  1S1Z A;  4B9O A;  3UME A;  4Y15 A;  4CLC C;  3P01 A;  4N1H A;  4X1M A;  2QJ5 A;  1XJ2 A;  3GTC A;  2ZMA A;  2Y2M A;  2ZOH A;  3IWQ A;  3NIA A;  1K6S A;  2PBD P;  4LV3 A;  4UA6 A;  2XRN A;  4S2K A;  4LLO B;  2FFY A;  4EQ1 A;  4M3K A;  3N6I A;  4WMC D;  3MBZ A;  3JVU A;  3PBO A;  3MXQ A;  3VOZ A;  4IJG A;  4Q8I A;  2M1C A;  2CC1 A;  4E04 A;  4KZB A;  3BQA A;  3OPP A;  4NKP A;  3FKW A;  4KQQ A;  4Z9Q A;  2PYP A;  5F68 A;  1NRJ A;  2X02 A;  3PTE A;  2V1A A;  5J4E A;  1WE4 A;  3UN7 A;  3BY9 A;  1HZO A;  2G7U A;  3S1Y A;  3OLO A;  3PYP A;  5FI7 A;  4C75 A;  4OPQ A;  1DJA A;  1YLW A;  4U0X A;  5MC7 A;  3UY6 A;  5HD3 A;  3D9Y A;  3C8C A;  2HJE A;  2R9X A;  1NRF A;  1YMX A;  1XFQ A;  4S2M A;  1GA9 A;  4R1G A;  4IVI A;  1XJ6 A;  3HUN A;  3BWL A;  5FL3 A;  4I38 A;  5F82 A;  3IS2 A;  3CI6 A;  1FR6 A;  3FKV A;  5I5L A;  2Y2N A;  3MKE A;  2J3T D;  3RXW A;  2VGL S;  1RP5 A;  5IT5 A;  3PR6 A;  5A90 A;  2WKR A;  1LT0 A;  3UDX A;  3UE1 A;  4QB8 A;  3C7V A;  1ZHH B;  5E2G A;  4KG6 A;  4DDY A;  5M19 A;  3MJQ A;  3NEC A;  1XFN A;  1KE3 A;  2Z6C A;  3A3F A;  5EEC A;  1Z6F A;  3F1P A;  3ZG8 B;  1Z09 A;  2XEP A;  1LI0 A;  4DJ3 A;  4GCZ A;  5DTK A;  1RGZ A;  3DTK A;  2CMN A;  1CEG A;  5EPH A;  2V0U A;  3F1N B;  2A49 A;  4NXB A;  2PHY A;  3MSH A;  4P6Z M;  5FAP A;  3KSI A;  2P7J A;  2WKE A;  4LCM A;  1TS6 A;  2J9O A;  1DP6 A;  1GA0 A;  3IF6 C;  4ZRR A;  4HEF A;  1JNU A;  2OAQ 1;  2JKG A;  3G6O A;  2XD5 A;  4L9E A;  5EM1 A;  2XA7 S;  4S2O A;  2GZA A;  4U0T A;  2EXB A;  3BLM A;  1KE4 A;  4X1L A;  1PRQ A;  2PD7 A;  5EVI B;  3QP2 A;  1DJB A;  3MQQ A;  5DKK A;  1IKI A;  2W1T A;  4JBF A;  1IYP A;  4R70 A;  1F98 A;  1IKG A;  5HPI A;  2L4R A;  5GLA A;  2A2L A;  1ERM A;  3FWL A;  3IXB A;  3ZVW A;  4ZBE A;  3NOU C;  2A24 B;  3IXD A;  2ZJ9 A;  2I72 A;  4H6J B;  2Y2O A;  3LUQ A;  2HGV A;  4PKY A;  1HLU P;  2QZ6 A;  4X53 A;  3D3O A;  3A0V A;  5A92 A;  1YLJ A;  4GKU A;  1KGG A;  3VMA A;  3IXG A;  1EWZ A;  1Q2Q A;  1YMS A;  4P87 A;  4S2P A;  3BM6 A;  3HJI A;  3IX8 A;  3EWK A;  4MLL A;  4NET A;  3T1R A;  5FAS A;  3SOI A;  1IFQ A;  5EE8 A;  4OLG A;  4Y13 A;  1PFL A;  5J3W A;  3NDE A;  1J3W A;  4F3L B;  2ZC3 B;  2JC7 A;  4R0Q A;  3T12 B;  5GLB A;  4C3Q A;  3OPL A;  1GHP A;  3O3V A;  1S1Y A;  4P85 A;  3UB5 P;  3DAV A;  1NYY A;  3HCY A;  1YAX A;  5TBM A;  4WN5 A;  1IOU A;  2WKI A;  3LCE A;  3C7U A;  5CHM A;  3ZHH A;  2KOI A;  4UEY A;  3PHY A;  2EX8 A;  1S0W A;  4MDZ A;  4C6Y A;  1PWC A;  3RFB A;  3DTM A;  3CJM A;  1UGU A;  3HUO A;  4EU0 A;  5I94 A;  2OSU A;  4R38 A;  3GDI A;  2H28 A;  1F2K A;  1XGI A;  2VEA A;  4UHU A;  4UA9 A;  5M18 A;  4F94 A;  4DE0 A;  3LEZ A;  1ESI A;  1ES3 A;  2W0N A;  1W5D A;  5FQK A;  1L2S A;  5HDD A;  2ZC4 B;  3PXP A;  3HBR A;  3OCN A;  1YT4 A;  2Y2K A;  3T4S A;  2PR6 A;  4GHI B;  3L9K A;  2JKR M;  2Z2M B;  2C5W B;  1SDN A;  2ZMV A;  2ZD8 A;  2JKR I;  2ZL1 A;  1V9Y A;  4NXE A;  2OOL A;  2Y2P A;  4K91 A;  5FQI A;  5DF9 A;  4WBG A;  4XUZ A;  2O9B A;  4Y3I A;  2BAS A;  5CX7 A;  3CG5 A;  1QMF A;  3CIT A;  3PBN A;  3NDG A;  2W3G A;  5BOH A;  2J9P A;  1DP8 A;  4WZ4 A;  3CUE A;  3G4P A;  2Y2Q A;  2V8C A;  4E3J A;  3A3J A;  4UAA A;  2K2N A;  1K25 A;  3LR0 A;  2GX5 A;  5E2E A;  5DJT A;  3W4P A;  4BLM A;  4LV2 A;  4PM6 A;  3IHA A;  5HDC A;  4S2N C;  1H8Z A;  1LSV A;  5HAI A;  4OPZ A;  2OWJ A;  1UWP X;  3T4Q A;  3DTI A;  4Q0J A;  3ZG0 A;  5KSH A;  4ZJ2 A;  1CF0 A;  3GV9 A;  3D72 A;  3BFC A;  3TE8 A;  2V9A A;  4DF6 A;  1FR1 A;  1F9I A;  1L0D A;  5K5B A;  1SKF A;  2QKP A;  4HP9 A;  4HIA A;  4S2N A;  1IYQ A;  3W4Q A;  4AFI A;  3LI9 A;  2X01 A;  3C2W A;  4XT2 B;  1G5U A;  3CZD A;  4O7D A;  4ID4 A;  4MBF A;  4YFM A;  4LCL A;  4M4X A;  3S4X A;  1LI9 A;  2JN7 A;  1E4D A;  1A0K A;  2QJ7 A;  4LV1 A;  3G2Y A;  1KE0 A;  4PKY G;  4GNU A;  3G34 A;  3A0R A;  1ONH A;  3S7P A;  1KOU A;  2X71 A;  3MZD A;  1YLZ A;  2XFT A;  2GDN A;  4UQI S;  1TEM A;  2HV1 A;  2HP6 A;  1U60 A;  3LIC A;  1Y54 A;  2O9C A;  4MEZ A;  2KX6 A;  2OLV A;  3LFV A;  3Q82 A;  5FDH A;  1BLC A;  4JKT A;  4JGP A;  4X56 A;  2B02 A;  3DWZ A;  3V39 A;  3HLF A;  4ARZ B;  3K2N A;  3VP2 A;  3KX0 X;  4RVA A;  2PYR A;  2BLS A;  1NJ4 A;  4N9L A;  2QHK A;  1J9M A;  1H8M A;  3ICY A;  3KSH A;  1ERQ A;  3CAX A;  4Y0O A;  4KQR A;  5HW3 A;  2VLG A;  2JHE A;  1GHM A;  1M40 A;  3AGE A;  3PBR A;  4KUK A;  4GB7 A;  5CTN A;  1SKO B;  2O99 A;  2B95 A;  3Q1F A;  4X25 A;  1VM1 A;  3P7N A;  2ZC5 B;  2ZC6 B;  3UB8 A;  3IWO A;  3R7W B;  1K55 C;  4S2J A;  5HWV A;  2Y2I A;  3C38 A;  4EET B;  3NHQ A;  3BQ8 A;  4FTX A;  3VSL A;  3E2K A;  4GN2 A;  5EVI A;  3EEA A;  1MPL A;  4CLC D;  3C4O A;  5JYO A;  1ALQ A;  3LR5 A;  2WGI A;  1BTL A;  5AQB A;  1N4O A;  3IBJ A;  5CXW A;  1S4S A;  4MMN A;  4LV0 A;  3LY3 A;  4H6J A;  4R4R A;  4JGR A;  3EGX C;  3P09 A; 
#chains in the Genus database with same CATH homology
 5EEC A;  4EBP A;  1Z6F A;  1IYO A;  2WGV A;  1BUE A;  5FQ9 A;  2WAD A;  3BFF A;  3ZG8 B;  2EX2 A;  3IF6 B;  4X6T A;  2ZQ9 A;  4QJG A;  4NK3 A;  3VP4 A;  2XEP A;  1LI0 A;  5DTS A;  1E25 A;  5DTK A;  1ERO A;  5J8X A;  2XGN A;  1RGZ A;  1SCW A;  2XDM A;  4JF4 A;  3BFE A;  4R23 A;  1KVM A;  1CEG A;  3UO9 A;  3ISG A;  5EPH A;  3PBT A;  3UDF A;  2C6W B;  3AGF A;  3I7J A;  3NY4 A;  2A49 A;  1TDL A;  3SH9 A;  3IH8 A;  1BT5 A;  1FSY A;  3BFG A;  2DNS A;  5FAP A;  2P9V B;  4P0M A;  3M6B A;  2WKE A;  4LCM A;  2Y2H A;  3MKF A;  4PM8 A;  5DF7 A;  4OQH A;  2J9O A;  5JYP A;  2ZQA A;  4PM7 A;  1ZG6 A;  4H8R A;  1W8Y A;  2EXA A;  2V1Z A;  1N9B A;  1G6A A;  4KZ7 A;  1GA0 A;  1PI5 A;  2Q9M A;  4PPR A;  3IF6 C;  2R9W A;  4EV4 A;  3NCK A;  1BLH A;  4HEF A;  4E6W A;  1K6R A;  4KZA A;  4BL2 A;  2Y4A A;  2ZQ7 A;  2XD5 A;  4DDS A;  2Y55 A;  4KG2 A;  4S2O A;  1FQG A;  3G32 A;  4U0T A;  2EXB A;  3BLM A;  3FZC A;  2Z2L B;  1KE4 A;  4KZ9 A;  2JCH A;  2B5R A;  2XK1 A;  3N7W A;  3M2J A;  3CMZ A;  5EVI B;  5HAP A;  3MXS A;  1DJB A;  4E3K A;  3N4I A;  1IEM A;  1IKI A;  4JBF A;  4WEK A;  4E3N A;  1IYP A;  1K56 A;  3UNW A;  1O07 A;  1XKZ A;  1YLT A;  3HL9 A;  4WEJ A;  1IKG A;  5EOO A;  5GLA A;  3SS4 A;  2Y2J A;  4JXV A;  3FWL A;  1ERM A;  4RYE A;  3IXB A;  3ZVW A;  4ZBE A;  1KDS A;  5HFO A;  3IXD A;  4GD8 A;  2ZJ9 A;  2I72 A;  5AQ9 A;  2Y2O A;  1JWP A;  3OC2 A;  3ZFZ A;  4E3I A;  4OP8 A;  3PBQ A;  2QZ6 A;  2Y59 A;  4X53 A;  4OOY A;  1YLJ A;  5EVI C;  5A92 A;  3ZG9 B;  3GVB A;  3HVF A;  3DWK A;  5DVA A;  2RL3 A;  4GKU A;  4QY6 A;  1S6R A;  5EOE A;  2XLN A;  1K4E A;  1KGG A;  3IXG A;  3VMA A;  3ZNT A;  2E8I A;  2WK0 A;  1EWZ A;  4UA7 A;  1Q2Q A;  1YMS A;  4P87 A;  4S2P A;  4Y0T A;  3BM6 A;  3RJU A;  2Y2G A;  3MFD A;  3Q07 A;  2Y91 A;  3VP1 A;  1ES2 A;  3GMW A;  4MLL A;  4OQI A;  5D3O A;  5FAO A;  1PZP A;  3HLD A;  4NET A;  4R3B A;  5E43 A;  5FAS A;  5FQM A;  1PWG A;  4WZ5 C;  3SOI A;  4FD8 A;  5G18 A;  2HDS A;  4JPM A;  4OLG A;  5EE8 A;  2ZQD A;  1K56 D;  2WAE A;  3NDE A;  3WS1 A;  1BLS A;  1E3U A;  3JYI A;  2ZC3 B;  2JC7 A;  3E2L A;  3G35 A;  3NBL A;  4U3T A;  1LHY A;  1ES5 A;  1PI4 A;  2OLU A;  3VFH A;  2WYX A;  4BL3 A;  5FI6 A;  1IYS A;  4KEN B;  4R0Q A;  3FV7 A;  3WWX A;  2DRW A;  3W8K A;  1MKI A;  5IHV A;  3ZDJ A;  5GLB A;  4FSF A;  4OPY A;  4C3Q A;  4HBU A;  4KG5 A;  3OPL A;  1GHP A;  2EFX A;  2XF3 A;  3O3V A;  4CPK A;  4N9K A;  2JE5 A;  4PMA A;  3RXX A;  2DCF A;  2WUQ A;  3VSK A;  1JWZ A;  1JVJ A;  4P85 A;  3BRM A;  1KDW A;  1PW1 A;  4N92 A;  3A3E A;  3PAG A;  1NYY A;  4OQG A;  1XA7 A;  2ZM2 A;  4X68 A;  3OZH A;  5GLD A;  5HX9 A;  3IQA A;  1XX2 A;  4RX2 A;  2PU4 A;  4WZ5 A;  1RCJ A;  3N8S A;  4PM5 A;  4IED A;  1H8Y A;  1QME A;  2WKI A;  3LCE A;  1MY8 A;  4OQ0 A;  5CEC A;  1L0E A;  1YM1 A;  3Q7Z A;  1YLP A;  1DY6 A;  3UDI A;  3C7U A;  4BEN A;  3UPO A;  5CHM A;  3ZHH A;  1BLP A;  2QPN A;  3IH9 A;  1K54 C;  4EUZ A;  2IWB A;  2EX8 A;  1M6K A;  1HVB A;  1S0W A;  5CHU A;  3NI9 A;  4C6Y A;  1E3U D;  2ZQ8 A;  1JTG A;  1PWC A;  4ZDX A;  3M2K A;  5EVI D;  5L2F A;  3AGD A;  4WMC A;  3BEB A;  3DTM A;  4OPR A;  3CJM A;  3BEC A;  1XPB A;  3IHB A;  1C3B A;  3MZF A;  4DRT A;  3HUO A;  1K57 A;  5I94 A;  2OSU A;  3VP0 A;  4A5R A;  2XFS A;  2G2U A;  4EQI A;  2UWX A;  2PU2 A;  4DXC A;  1XGI A;  4UHU A;  3Q7V A;  4UA9 A;  5HAR A;  3OPH A;  5U47 A;  3SH7 A;  5A91 A;  4E3O A;  1YQS A;  4QHC A;  1CI8 A;  4B88 A;  3EQU A;  3WS2 A;  4XXR A;  5KSC A;  5M18 A;  1I2S A;  4S2I A;  4DE0 A;  1MWT A;  4F94 A;  3LEZ A;  4KZ4 A;  1ESI A;  4CJN A;  1NXY A;  1ES3 A;  4R4S A;  3EQV A;  3WS0 A;  1W5D A;  4JF6 A;  1K54 A;  5FQK A;  1L2S A;  3S22 A;  3V5M A;  2ZC4 B;  4JXW A;  3HBR A;  3OCN A;  2V2F F;  4IBX A;  2Q9N A;  1YT4 A;  1NZO A;  4D2O A;  4QU3 A;  2Y2K A;  1FCO A;  4E6X A;  2JBF A;  4EWF A;  5FA7 A;  2EFU A;  3QNB A;  1K38 A;  1W7F A;  4KQO A;  1FCM A;  2Z2M B;  2C5W B;  1SDN A;  1CK3 A;  3MXR A;  5F83 A;  2H0Y A;  2ZD8 A;  2HP5 A;  4K0W A;  1TDG A;  1MWU A;  1LL5 A;  2Y2L A;  4GOG A;  2Y2P A;  4K91 A;  4KZ5 A;  4RA7 A;  5FAT A;  5FQI A;  5DF9 A;  4WBG A;  3N8L A;  4XUZ A;  1ZC2 A;  5FSR A;  4X69 A;  3GRJ A;  4JF5 A;  3WRZ A;  1XA1 A;  5AQ7 A;  4DXB A;  5CRF A;  3DW0 A;  2P74 A;  3WS4 A;  4PM9 A;  1CEF A;  5EVL A;  3TG9 A;  5EUA A;  3W4O A;  2RCX A;  3CG5 A;  3O86 A;  2HP9 A;  1QMF A;  1GCE A;  5FQQ A;  4OP5 A;  5DF8 A;  3QNC A;  4JXG A;  3MZE A;  4DE2 A;  3PBN A;  3NDG A;  4OOL A;  3V3R A;  5BOH A;  1ZG4 A;  2J9P A;  1VQQ A;  2XD1 A;  4Y0U A;  3ZVT A;  2WZZ A;  4WZ4 A;  5FAQ A;  3G4P A;  3ZG5 A;  2Y2Q A;  1MBL A;  3P98 A;  4OON A;  2OV5 A;  3HLC A;  4E3J A;  3A3J A;  3BFD A;  5AQA A;  4UAA A;  5FQJ A;  1HD8 A;  2BG1 A;  4K0X A;  3UE3 A;  4WEL A;  1K25 A;  1XP4 A;  5TGF A;  3SS5 A;  4B4X A;  1HTZ A;  1I5Q A;  1RGY A;  1KGF A;  1NYM A;  2WZX A;  3B3X A;  3GQZ A;  2WAF A;  5E2E A;  4Y7P A;  3Q7V B;  3IWI A;  2H10 A;  3ITB A;  4FH2 A;  3Q81 A;  3W4P A;  1PW8 A;  1FSW A;  2HDU A;  5GHZ A;  1KVL A;  3QHY A;  4MBH A;  4HES A;  4BLM A;  4LV2 A;  4PM6 A;  4OOM A;  3IHA A;  2ZM0 A;  4IVK A;  4S2N C;  5CER A;  1BZA A;  1H8Z A;  1NY0 A;  3OPR A;  4KZ6 A;  3ZG7 B;  4N1X A;  3G30 A;  4R4R A;  4BD0 A;  5GLC A;  2J7V A;  5HAI A;  4KZ3 A;  1MXO A;  4OPZ A;  1FOF A;  4YIN A;  1OME A;  5GHX A;  3VOY A;  1ESU A;  5E2H A;  5F1F A;  4L0L A;  5CTM A;  1K57 C;  5KMW A;  3ZG0 A;  1XXM A;  4ZJ2 A;  5KSH A;  2G2W A;  5CGX A;  1YLY A;  2WGW B;  1XGJ A;  3GV9 A;  3HLE A;  3TSG A;  3A3D A;  3BFC A;  1MWS A;  4ZTK A;  2ZLY A;  2WKH A;  3VP3 A;  5CED A;  2HDR A;  1LL9 A;  4OVD A;  4DF6 A;  4BD1 A;  1FR1 A;  3PAE A;  3UPN A;  1L0D A;  1PWD A;  4R3J A;  3NC8 A;  3GSG A;  5F1G A;  4S2L A;  1SKF A;  4EBN A;  5CHJ A;  1O7E A;  4S2N A;  1IYQ A;  3W4Q A;  4HBT A;  3VFF A;  3BYD A;  4QD4 A;  2J8Y A;  2VGK A;  2X01 A;  3WS5 A;  1K55 A;  1PIO A;  4E3L A;  2XH9 A;  1G68 A;  4IBR A;  2PBY A;  3CZD A;  4X55 A;  4O7D A;  5M1A A;  4ID4 A;  1AXB A;  1WYC A;  2EX9 A;  1L0F A;  2QMI A;  4MBF A;  4OH0 A;  4YFM A;  3HLW A;  1ZKJ A;  4LCL A;  3HLB A;  4QY5 A;  3UPP A;  3S4X A;  3OCL A;  1BSG A;  1H5X A;  1DJC A;  2H0T A;  3IXH A;  4EBL A;  1JWV A;  1LI9 A;  5GL9 A;  3WRT A;  5CEB A;  3V3S A;  5KZH A;  4MBK A;  5HL1 A;  1Q2P A;  4JXS A;  3SH8 A;  1E4D A;  1SHV A;  4XUX A;  4WYY A;  5FI2 A;  1BUL A;  4LV1 A;  2IWC A;  3G2Y A;  1KE0 A;  3ZCZ A;  4JLF A;  5TR7 A;  4GNU A;  3G34 A;  3GR2 A;  4MNR A;  1ONH A;  4GDB A;  1ONG A;  4B4Z A;  4OLD A;  2XR0 A;  2X71 A;  3D4F A;  3MZD A;  1YLZ A;  4P6B A;  4N1H A;  2XFT A;  1MWR A;  4DE1 A;  5A93 A;  4GZB A;  1L0G A;  3BLS A;  2WGW A;  2GDN A;  3GTC A;  2ZMA A;  2Y2M A;  1TEM A;  3IWQ A;  3NIA A;  2HP6 A;  1K6S A;  1JTD A;  4FCF A;  1U60 A;  4LV3 A;  4UA6 A;  1PYY A;  2HPB A;  4S2K A;  1PZO A;  1Y54 A;  4FH4 A;  1IEL A;  1GHI A;  2FFY A;  4MEZ A;  1LLB A;  2OLV A;  4M3K A;  3Q82 A;  3ZGA B;  1ES4 A;  4GDN A;  1WYB A;  5FDH A;  1BLC A;  3N6I A;  1EI5 A;  4JKT A;  4WMC D;  3O88 A;  1W8Q A;  4X56 A;  3MBZ A;  2H5S A;  3DWZ A;  2FFF B;  3PBO A;  3V39 A;  4GD6 A;  3VOZ A;  4Q8I A;  3HLF A;  2CC1 A;  3SS3 A;  4KZB A;  1NZU A;  3A3I A;  3M6H A;  3UE0 A;  3OPP A;  3IT9 A;  3FKW A;  3VP2 A;  4RVA A;  5E2F A;  4DE3 A;  3IF6 A;  4KQQ A;  2BLS A;  5CGS A;  4Z9Q A;  1NJ4 A;  4N9L A;  3LO7 A;  3C5A A;  1J9M A;  2X02 A;  3PTE A;  4RX3 A;  4E3M A;  1WE4 A;  4OKP A;  1CI9 A;  1ERQ A;  4Y0O A;  3HUM A;  4KQR A;  5HW3 A;  4KZ8 A;  1GHM A;  3ZNY A;  3UN7 A;  1M40 A;  2A3U A;  1I2W A;  1KGE A;  3AGE A;  2P9V A;  3PBR A;  4ZJ1 A;  1HZO A;  4GB7 A;  5CTN A;  3S1Y A;  3IF5 A;  3N8R A;  5FI7 A;  3Q1F A;  3V50 A;  1FCN A;  4C75 A;  1VM1 A;  4OPQ A;  5HAQ A;  1DJA A;  3PBS A;  3LY4 A;  1YLW A;  2XQZ A;  2ZC5 B;  2ZC6 B;  4U0X A;  4ZJ3 A;  2HDQ A;  1K4F A;  3UY6 A;  3IWO A;  4BQM A;  5TFQ A;  1W79 A;  1K55 C;  2R9X A;  1NRF A;  4S2J A;  2Y2I A;  1YMX A;  4S2M A;  3HRE A;  1GA9 A;  4R1G A;  4IVI A;  2V20 A;  2ZQC A;  3FYZ A;  3VSL A;  1SDE A;  3HUN A;  5DTT A;  3E2K A;  2VGJ A;  4GN2 A;  5CGW A;  5EVI A;  5F82 A;  1MPL A;  4DKI A;  2ZM8 A;  3C4O A;  5JYO A;  1ALQ A;  3O87 A;  1FR6 A;  2WGI A;  3FKV A;  3HLG A;  1BTL A;  2Y2N A;  3G31 A;  5AQB A;  3MKE A;  1N4O A;  4LEN A;  3ITA A;  3C4P A;  5CXW A;  3RXW A;  1RP5 A;  5A90 A;  3UDX A;  5GHY A;  4WM9 A;  3TOI A;  3UE1 A;  4QB8 A;  3C7V A;  5E2G A;  4KG6 A;  4DDY A;  2IWD A;  1TVF A;  5M19 A;  4LV0 A;  3LY3 A;  1KE3 A;  2EX6 A;  3G2Z A;  2ZC7 A;  3A3F A;  4ZAM A;  4BJP A;  3P09 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...