2WYXA

Neutron structure of a class a beta-lactamase toho-1 e166a r274n r276n triple mutant
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
256
structure length
256
Chain Sequence
VQQQLEALEKSSGGRLGVALINTADNSQILYRADERFAMCSTSKVMAAAAVLKQSESDKHLLNQRVEIKKSDLVNYNPIAEKHVNGTMTLAELGAAALQYSDNTAMNKLIAHLGGPDKVTAFARSLGDETFRLDRTAPTLNTAIPGDPRDTTTPLAMAQTLKNLTLGKALAETQRAQLVTWLKGNTTGSASIRAGLPKSWVVGDKTGSGDYGTTNDIAVIWPENHAPLVLVTYFTQPEQKAENRNDILAAAAKIVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-LACTAMSE TOHO-1
publication title Neutron Diffraction Studies of a Class a Beta-Lactamase Toho-1 E166A R274N R276N Triple Mutant
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 90
structure length 256
sequence length 256
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2009-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2wyxA00
2ZMAA 5EVIB 3LO7A 4OOLA 1JWVA 1EI5A 4KG2A 2WKHA 2ZM0A 3UY6A 4KZAA 4RYEA 2ZC5B 4PM9A 2BLSA 3C7VA 4C75A 3O87A 5GLDA 3EQUA 2H5SA 2ZQ8A 1WYCA 1XX2A 4QU3A 2I72A 5FQJA 1K6RA 4OVDA 4D2OA 3HLBA 4Y7PA 1L0FA 4GZBA 3VOYA 3G31A 5J8XA 2Z2MB 1JVJA 2ZM2A 4P6BA 5KSHA 1PYYA 1YLZA 3M2JA 3AGFA 5EOOA 4K91A 5FQ9A 5GL9A 4DF6A 5CEDA 2WKEA 3S4XA 4XUXA 3BLMA 3S22A 1LL9A 4JKTA 2C5WB 4S2JA 3UE1A 4YINA 3BLSA 4ID4A 3MKFA 2ZQDA 1MXOA 3UDIA 5DF8A 5EE8A 3C7UA 3PBNA 1LL5A 4KZ8A 3PBQA 1E4DA 4KQRA 1BTLA 4RVAA 1YLJA 2XH9A 2HDRA 1PZOA 4R0QA 4QY6A 3ZCZA 1K4EA 4B4XA 3MBZA 4WZ5A 5CXWA 2WGWA 4M3KA 3OPLA 2P74A 4HESA 4S2MA 2ZQCA 5F82A 1GHPA 2V1ZA 2Y55A 2XGNA 1IYOA 3MZEA 4KZ9A 3C4PA 3G32A 5DF9A 1BT5A 1ZG6A 4RX2A 5HAIA 1GHIA 4FCFA 3VP2A 4WELA 3BFGA 3ISGA 2DCFA 1GHMA 1VM1A 1FCOA 5EVLA 4HBTA 4JXSA 1C3BA 4JF5A 4OPZA 5M18A 4DXCA 4GDBA 4B88A 4KG6A 1GA0A 1W5DA 2PU4A 3GVBA 1L2SA 3SH7A 2CC1A 3IF5A 2ZC7A 5F1FA 2ZC4B 2QMIA 3SS5A 3SS3A 3N8LA 3PBTA 5FI6A 3VOZA 1ESUA 3G4PA 5CECA 3BM6A 2XF3A 3PAGA 2ZC6B 5EECA 1HD8A 3E2LA 1YLWA 3W4PA 1XPBA 4GB7A 1K38A 2A3UA 3N8RA 3G2YA 4S2IA 1WE4A 1DJBA 4PM5A 3UPOA 2XD1A 5FASA 4IBXA 1MPLA 1ZG4A 2DNSA 1QMEA 4X69A 1OMEA 2J8YA 3DWKA 3N4IA 1ZC2A 5GHXA 1ES2A 4E3NA 5FATA 3VSKA 4JLFA 1I5QA 4XUZA 3BEBA 4OKPA 2JBFA 4Y0UA 4FSFA 1BUEA 4JF6A 3WS5A 2OLUA 1JWZA 5KSCA 2EXAA 1E25A 3AGEA 2OLVA 3IWOA 1DY6A 3QNBA 5IHVA 4DKIA 3OCLA 2XR0A 2Y2GA 3SOIA 4Z9QA 1YMXA 1H8YA 1WYBA 3A3IA 3GMWA 3ZG0A 4Q8IA 5A92A 4P87A 3EQVA 2WGWB 2PU2A 1S0WA 3IXDA 3PBSA 1ESIA 5A90A 4L0LA 3VP4A 4JBFA 1MY8A 5F83A 5FAQA 3V3SA 3WWXA 3UN7A 5KZHA 4GD6A 3UDXA 1GCEA 1HVBA 5FDHA 1FR6A 3IWQA 1SCWA 1BLSA 2P9VA 3GRJA 3Q81A 4KQQA 3IQAA 3HLGA 3A3JA 3TSGA 4N9KA 3W4OA 2WZXA 1EROA 1N4OA 4QY5A 1TDLA 1Y54A 2ZQAA 4MBHA 3VP1A 4KZBA 1KGFA 4ZDXA 4EV4A 1IKGA 1G68A 4R4SA 3GV9A 1PZPA 3AGDA 2WGIA 2XFSA 3FKWA 3LY4A 3FWLA 5DTSA 5I94A 2ZQ9A 5CGSA 4U3TA 3CJMA 2FFFB 4F94A 1I2SA 3FV7A 3FYZA 2J9PA 3HL9A 1PI4A 1K55A 3IXBA 3NC8A 1HTZA 2ZC3B 2EX6A 1W79A 3E2KA 5JYOA 3C5AA 3OPHA 4LV1A 1KE0A 2Y2OA 3W8KA 4PM8A 2XDMA 2Y59A 1NY0A 4WZ4A 4Y0OA 1LHYA 3A3DA 1ES4A 3UO9A 4WM9A 4OQIA 4IVIA 1CK3A 2Y2JA 4BD1A 1XGIA 2R9WA 1PW8A 1BLCA 4KZ4A 4R23A 4BL3A 1MWRA 1ONGA 1G6AA 2ZD8A 5GLAA 5HAQA 3ZHHA 2WKIA 3G34A 2V20A 1LI9A 1PWCA 3Q7VB 1MWSA 5EUAA 4S2NA 3MZDA 5CGWA 4OOMA 4OQGA 3S1YA 1JTDA 3V5MA 1M40A 1LLBA 3QHYA 1K54A 4S2LA 2FFYA 3UE0A 4FH4A 1E3UA 3BFFA 3O86A 1FSYA 3GSGA 3CZDA 5HX9A 4KG5A 1FR1A 4PM7A 3M6HA 2EX8A 2QZ6A 2X01A 4X56A 1S6RA 1ES5A 1KVMA 3DW0A 5FAOA 2P9VB 3O88A 1N9BA 2G2UA 4E6WA 4BD0A 4LV0A 2ZLYA 1K56D 1ONHA 4PMAA 4DE1A 1CEGA 4OQ0A 5HARA 3ZG5A 4E3MA 3NCKA 5L2FA 4S2PA 2WAFA 3IF6C 1Z6FA 1NYYA 1YQSA 2Y2MA 1RP5A 4S2KA 3IF6B 4OOYA 1L0GA 4E6XA 3IXHA 1U60A 2XK1A 3A3EA 3N8SA 3I7JA 4RA7A 3HVFA 1IEMA 3G2ZA 3O3VA 1NRFA 3ZG7B 4N1HA 3UE3A 4PM6A 2WZZA 3TOIA 3HLCA 3VSLA 2EFXA 1IKIA 4FD8A 5E2EA 1XGJA 3MKEA 4KZ6A 1PW1A 3BECA 1LI0A 2EX2A 2Q9MA 4Y0TA 3BRMA 3RJUA 3OZHA 1M6KA 2EFUA 2Y91A 1NJ4A 4DE0A 2Y2KA 3D4FA 1W8YA 4LCMA 1BULA 2J9OA 5TR7A 5A93A 5GHYA 4DDYA 2X71A 4E3JA 4EWFA 3FKVA 5DTKA 5EVIA 3PTEA 1XA1A 2WUQA 1XA7A 3BYDA 1FQGA 1K56A 4KENB 4MBFA 4UA6A 5FI7A 3IHAA 3VMAA 5A91A 4EQIA 1K54C 1RGZA 4P0MA 5AQ9A 4XXRA 5FI2A 5CHUA 5EOEA 4HEFA 1QMFA 2HPBA 5KMWA 4N9LA 1IELA 5HW3A 4WZ5C 3Q7ZA 3NBLA 1YT4A 4KZ3A 4N92A 5FQMA 1PI5A 2Y2HA 3NDEA 3NY4A 1CI8A 4R4RA 3Q07A 4WEJA 4C6YA 4DE3A 4H8RA 3SS4A 3RXXA 4BL2A 2WADA 2WK0A 5E2GA 1DJCA 4R1GA 5CTNA 4HBUA 5EPHA 3OC2A 1XP4A 1PWDA 2EXBA 3GTCA 1FOFA 4GD8A 1HZOA 2XQZA 4IBRA 4OONA 4U0XA 1YLTA 2HDSA 3P98A 5FQIA 1FSWA 2EX9A 4C3QA 4X55A 4WBGA 4NETA 5GLCA 3NDGA 1XKZA 3V39A 3LCEA 1NXYA 1RCJA 4UA7A 2HP6A 1E3UD 3PBRA 1VQQA 2JCHA 3BFEA 3HUMA 5M1AA 4MLLA 3ZVTA 4GNUA 1IYPA 3N6IA 3Q1FA 3ZGAB 2HP9A 2WGVA 3TG9A 3HLDA 4BLMA 3HLWA 3ZDJA 2XD5A 3B3XA 3DTMA 4E3LA 4BQMA 1ERMA 2G2WA 1L0DA 5F1GA 2HP5A 2OSUA 1XXMA 1NYMA 2H10A 3IWIA 3P09A 2Q9NA 2IWBA 3VFFA 3G30A 2PBYA 5DF7A 1O7EA 2JE5A 3M6BA 4QB8A 3WS0A 3BFCA 3HREA 3IXGA 3OPPA 2X02A 3MZFA 4S2OA 4UA9A 2WAEA 4QHCA 2HDUA 2UWXA 5FA7A 2WYXA 4NK3A 5HAPA 1EWZA 4JPMA 1NZOA 4JXVA 4KZ7A 2Y2NA 1H5XA 2ZM8A 3WRZA 3SH8A 2A49A 3VP3A 4B4ZA 4K0XA 4JXGA 4WMCA 5HL1A 1MBLA 5U47A 4WEKA 5E2FA 4LCLA 3OPRA 4FH2A 1ES3A 3RXWA 1MWTA 5TFQA 4GDNA 4LENA 4OH0A 4A5RA 1RGYA 2GDNA 4JF4A 4ZBEA 3WS1A 3ZNTA 1CI9A 3ZNYA 1KDWA 3SH9A 4ZJ1A 3ZFZA 2ZQ7A 1AXBA 5E2HA 5BOHA 2Y4AA 3QNCA 1SDEA 4QD4A 3VP0A 2J7VA 3G35A 1I2WA 4GN2A 5EVID 2HDQA 4OLDA 4OPYA 3ZG9B 1YM1A 4WYYA 5CEBA 4KZ5A 1FCNA 2IWDA 4EBLA 1ALQA 4U0TA 1JTGA 2DRWA 2IWCA 4ZJ3A 3V3RA 4YFMA 5CRFA 1GA9A 3ITAA 5FQQA 3UPPA 3WS4A 4OLGA 5AQ7A 5G18A 2R9XA 4OPQA 1K57A 2ZJ9A 1SHVA 3HUNA 1K55C 3MXRA 4X6TA 5CHMA 5FAPA 1KDSA 1SDNA 1K4FA 5AQAA 3NIAA 3UNWA 4CPKA 3BFDA 1FCMA 1KVLA 2H0TA 4P85A 1ERQA 1K6SA 3GQZA 1KE3A 1L0EA 2E8IA 1CEFA 4EUZA 1J9MA 3ZG8B 4R3JA 2Z2LB 3HBRA 1MKIA 3IH8A 2H0YA 5FQKA 5TGFA 1IYQA 3WRTA 2RCXA 3UPNA 2XEPA 1BLHA 4ZAMA 2BG1A 4GOGA 3Q82A 1SKFA 4N1XA 1BSGA 2VGKA 1MWUA 4JXWA 2RL3A 1YLYA 4S2NC 3V50A 4OP5A 1H8ZA 4OQHA 2XFTA 4IEDA 3CG5A 1W7FA 3N7WA 4BJPA 3IHBA 5CTMA 5JYPA 1PWGA 3IH9A 2V2FF 4DRTA 1IYSA 1DJAA 1KGGA 2Y2PA 2B5RA 4PPRA 1NZUA 5DTTA 3C4OA 3PBOA 5HFOA 5GLBA 3WS2A 4QJGA 4BENA 3HLEA 1Q2QA 3IT9A 2XLNA 3A3FA 4E3KA 1W8QA 3CMZA 3MXSA 4UAAA 3MFDA 1YMSA 4ZTKA 2OV5A 3VFHA 4E3IA 2Y2LA 3LY3A 4KQOA 4UHUA 4ZJ2A 3OCNA 4X53A 1BLPA 3FZCA 3Q7VA 2QPNA 4K0WA 4MEZA 3HLFA 1O07A 4LV2A 1YLPA 3JYIA 5FSRA 3UDFA 4LV3A 4WMCD 4CJNA 5AQBA 5CHJA 1TDGA 3GR2A 3DWZA 1K57C 1ZKJA 3PAEA 4EBPA 5CERA 3LEZA 5GHZA 2JC7A 4DDSA 3NI9A 3HUOA 4OPRA 3W4QA 4DE2A 2C6WB 1K25A 4RX3A 2VGJA 1PIOA 1Q2PA 1JWPA 4X68A 3ITBA 4OP8A 4R3BA 4O7DA 2Y2QA 4MBKA 1TVFA 3M2KA 4E3OA 5CGXA 4EBNA 1KE4A 1TEMA 1BZAA 3ZVWA 4MNRA 5M19A 4IVKA 1KGEA 5DVAA 5EVIC 4GKUA 5D3OA 5E43A 4DXBA 2Y2IA 3IF6A
chains in the Genus database with same CATH superfamily
1EI5A 3UY6A 4KZAA 4RYEA 2ZC5B 4M4XA 4C75A 4LRZE 2ZL1A 2H5SA 1WYCA 1K6RA 4OVDA 4D2OA 3DTEA 1WA9A 3VOYA 4HNBA 3MFXA 5KSHA 2ZM2A 1PYYA 5GL9A 2BASA 2WKEA 2C5WB 4YINA 4ID4A 4H6JA 3MKFA 1MXOA 1LL5A 5C5KA 3QP6A 1E4DA 1YKDA 1BTLA 4RVAA 1YLJA 2HDRA 4QY6A 3MBZA 3UB6A 4M3KA 2PD7A 5F82A 5J4EA 3KYZA 1ZG6A 3VP2A 1GHIA 3ISGA 1GHMA 3UB9A 1FCOA 4NXFA 3PHYA 1C3BA 1VB6A 4JF5A 4OPZA 4DN0A 4GDBA 1VHMA 1GA0A 4F3LA 3SH7A 2PU4A 2CC1A 4WLAA 3EGDC 3PBTA 3VOZA 1ESUA 5EECA 4LLOB 3W4PA 4GB7A 1DJBA 4PM5A 3UPOA 4IBXA 2PRFA 4X69A 3DWKA 2PAVP 1DP9A 5GHXA 3R7WB 5F6AA 5FATA 4X25A 5AJGA 2JBFA 1GSVA 3P7NA 4Y0UA 4JF6A 2OLUA 1DY6A 1TS0A 2XR0A 2Y2GA 3SOIA 2Q0OA 1H8YA 1WYBA 3A3IA 3ZG0A 3LIBA 2V8CA 2WGWB 3QP5A 4R38A 5KZHA 2NUPC 1CF0A 1T1AA 3W4OA 4I3IA 2WZXA 4QY5A 3T1RA 4WN5A 4KZBA 1TS7A 3QP2A 4K08A 1PZPA 2XFSA 5I94A 2FFFB 3FYZA 3IXBA 1W79A 3OPHA 4LV1A 2Y2OA 4XT2A 4PM8A 2Y59A 4WZ4A 1YSQA 1ES4A 1YAXA 4WM9A 4IVIA 1CK3A 1PW8A 3D9YA 4R23A 5HAQA 1D1JA 3D3OA 4MN5A 1F9IA 3Q7VB 5EUAA 4S2NA 4OQGA 4S2LA 2FFYA 1S4SA 3K3CA 4EEUA 1FSYA 3GSGA 2HGVA 1V9ZA 2QZ6A 4X56A 3DW0A 1KVMA 5FAOA 2P9VB 3O88A 2M1CA 1N9BA 2G2UA 4E3MA 4LPZA 4S2PA 3HJKA 1Z6FA 2PR5A 4S2KA 3IF6B 4OOYA 3LR3A 3SW1A 3LR5A 3N8SA 3O3VA 4EERA 3UE3A 2W3EA 2EFXA 1IKIA 5FEGA 1XGJA 4KZ6A 1PW1A 3BECA 1LI0A 3LIAA 3S7PA 4HJ3A 2Y2KA 3D4FA 2J9OA 5GHYA 4DDYA 4EWFA 4MBFA 4EQIA 3IHAA 3CUEA 4CLCD 4P0MA 5FI2A 2W1RA 3MQOA 5CHUA 4HEFA 2HPBA 3NBLA 3F1NA 5EM1A 3JPUA 3NY4A 1CI8A 3Q07A 4WEJA 3CPTA 2JKGA 2WADA 3T1QB 5CTNA 3DTKA 1GSXA 2XQZA 4C3QA 1FSWA 1N9LA 3FPWA 5GLCA 2Y8HA 2EWVA 4Q0IA 1Z09A 3JVUA 1VQQA 3HUMA 3W2ZA 2HP9A 2WGVA 3TG9A 3HLDA 3ZDJA 1ERMA 2B02A 5F1GA 2H10A 3VFFA 2OAP1 3CUEC 3M6BA 3WS0A 4S2OA 2HDUA 2UWXA 2WYXA 4NK3A 5G4ZA 2Y2NA 3SH8A 3KYEA 4WMCA 3QP8A 5HL1A 4LCLA 1ES3A 5CX7A 3RXWA 5A93A 1SZVA 4GDNA 3C30A 2GDNA 4ZBEA 1CI9A 5HZHA 2VZWA 2Y4AA 4NKPA 1SDEA 1OJGA 3PXPA 1I2WA 4OLDA 4QWOA 3UB5P 3ZYTA 5CEBA 4KZ5A 1FCNA 3E4QA 4EBLA 1N9NA 2J3TC 4ZJ3A 1GA9A 5HSQA 5AQ7A 2ZJ9A 3HUNA 3MXRA 3T50A 1OTBA 4DJ3A 3NIAA 4CPKA 1F5MA 1KVLA 1L0EA 3ZG8B 4GCZA 1MKIA 2H0YA 2NUTC 2RCXA 3Q82A 1SKFA 1S1YA 2VGKA 4Y17A 1MWUA 3CWFA 4Y15A 2ZBBA 3DAVA 4OQHA 3E4PA 3FC7A 5HD3A 2XSSA 4FUWA 3IHBA 1TF1A 2V2FF 1IYSA 4UEYA 4PPRA 3C4OA 4JGPA 1LSXA 3A3FA 1W8QA 4LRXC 3A0VA 4X53A 3Q7VA 2PHYA 4WMCD 2XA7M 5HWTA 3T1SA 4DDSA 4RX3A 1Q2PA 4OP8A 2XA7S 1TVFA 3TE8A 1TEMA 1GSWA 4EW7A 4MNRA 1TD5A 4DXBA 3IF6A 5HWWA 3LO7A 3F1PA 1JWVA 5TBMB 2WKHA 5EV0A 1HLUP 3EEAA 3C7VA 3O87A 3EQUA 4QU3A 2QJ7A 5DJTA 4R70A 2YKHA 4GZBA 3G31A 2O9BA 1S4RA 2Z2MB 1JVJA 3KSGA 1YLZA 3AGFA 5FQ9A 4DF6A 5CEDA 1FIKA 4PKYA 4L9EA 4S2JA 3K2NA 3BLSA 3C7UA 3PBNA 3EGXC 5J3WA 4WZ5A 2J80A 3ZQ5A 3OPLA 2P74A 5A92A 1GHPA 5HDSA 1MZUA 2CMNA 3G32A 1BT5A 5FEFA 5IS1A 4I3AA 2DCFA 1LSVA 1VM1A 5F69A 5EVLA 1CQAA 3DTIA 3UE6A 3GVBA 4B9OA 3SS5A 3SS3A 3N8LA 5CECA 2XF3A 3PAGA 4IJGA 3KSHA 5DKLA 1XPBA 1K38A 2A3UA 5HL6A 4KUOA 2DNSA 1QMEA 2J8YA 2W3HA 4E3NA 2JKFA 2PR6A 4XUZA 4OKPA 2K7SA 3BWLA 1BUEA 3MSHA 3WS5A 4B93A 1JWZA 1MKMA 2VEAA 3AGEA 3QNBA 3LUQA 4E04A 1ESIA 2IA2A 3VP4A 1MY8A 5FAQA 3V3SA 3WWXA 1HVBA 3EWKA 2GX5A 1SCWA 1BLSA 3Q81A 4D60A 3HLGA 3TSGA 3KO6A 4G3WA 4JGQA 3IS2B 4KQDA 1Y28A 4EV4A 2W0NA 3LY4A 5HPIA 5DTSA 1S1ZA 5CGSA 4U3TA 2PYRA 3FV7A 4G3KA 2ZC3B 1MC0A 1TS6A 3E2KA 3A0SA 4ZRRA 4MCWA 4R3AA 3W8KA 1NY0A 1LHYA 3A3DA 4OQIA 2EWWA 2R9WA 4KZ4A 3ZHHA 1DP6A 2A2LA 1PWCA 3RH8B 4HH3A 1JTDA 4ETXA 3V5MA 1LLBA 2ZMFA 1E3UA 3BFFA 3O86A 3S7OA 1VEUA 3CZDA 1FR1A 2EX8A 4BBVA 3UMDA 1ES5A 4O01A 4E6WA 4BD0A 3B47A 2ZLYA 4PMAA 1P97A 4OQ0A 3NCKA 3F1OB 2WAFA 1XJ6A 3IXHA 4HP4A 2VX8A 3H9WA 3S7NA 3FG8A 2I9VA 4CLCE 3VSLA 4FD8A 2XROA 3MKEA 1T1BA 3LIEA 2EX2A 4Y0TA 3BRMA 3RJUA 1K0KA 2Y91A 1NJ4A 4DE0A 2W1TA 3CHWP 1W8YA 1BULA 3LFVA 3FKVA 5DTKA 3PTEA 1XA1A 3BYDA 3VMAA 5TBMA 4KENB 5FI7A 3ICYA 1RGZA 4DMZA 1QMFA 5KMWA 5HW3A 3Q7ZA 2Y2HA 3MQ0A 3IX8A 3NDEA 4R4RA 4P6ZM 4H8RA 4G3VA 2O9CA 4EETB 4BL2A 2WK0A 4LRYC 1UGUA 3LEQA 2EXBA 1FOFA 1HZOA 1YLTA 4P6ZS 3BQ8A 1S66L 2LB9A 4Y3IA 2VV7A 2P04A 5G4YA 1XKZA 1E3UD 3PBRA 3BFEA 4NG2A 5M1AA 4MLLA 4CLCA 1IYPA 3N6IA 2JKTI 3MJQA 4BLMA 3B3XA 3DTMA 1OT9A 2O9AA 1L0DA 2HP5A 3LIDA 1NYMA 2Q9NA 4BBUA 1XFQA 2Z6CA 3G30A 2PBYA 3NULA 1P9RA 3A0RA 3MZFA 4UA9A 2P7JA 4R6LA 5FA7A 5HAPA 4JPMA 1NZOA 4KZ7A 3LICA 1H5XA 2K2NA 3WRZA 4K0XA 4JXGA 1MBLA 5E2FA 4WEKA 1F2KA 4FH2A 4A5RA 3ZNTA 1KDWA 4MMNA 4ZJ1A 1X0OA 5E2HA 5BOHA 1YSPA 2ZOIA 4I38A 2HJEA 4GN2A 1D06A 2HDQA 1G6OA 4OPYA 1YM1A 3MR0A 4HHDA 1JTGA 3DBAA 2IWCA 4YFMA 5FQQA 3MXQA 4MN7A 4CLCC 1T19A 2EA9A 2W3DA 4X6TA 5J7EA 1SKOB 2VJWA 2MJ6A 5AQAA 5A8BA 4ARZB 2D01A 3IX4A 3EEHA 2H0TA 4P85A 5HDCA 1K6SA 3GQZA 1KE3A 2E8IA 1IYQA 3T4LA 3WRTA 2XEPA 5LBRA 4L9FA 4N1XA 1BSGA 5FDSA 3H82B 2J3WA 1OPXA 4JXWA 4NEED 2V0UA 4S2NC 2B18A 1H8ZA 4GHIB 4YWZA 1UWPX 5CTMA 1PWGA 3IH9A 4DRTA 2JN7A 3H7WB 3LI8A 5DTTA 3KX0X 2V1AA 3IT9A 4Z1WA 4YOFA 2PDRA 3LIFA 4ZTKA 3MXSA 5L09A 3VFHA 2OV5A 1DP8A 4I39A 3LY3A 4UHUA 4ZJ2A 4O8GA 2ZMVA 5FSRA 3GECA 4LV2A 4GS9B 3JYIA 4LV3A 4CJNA 1TDGA 3GR2A 1ZKJA 4PAUA 3PAEA 3U2AA 3HUOA 3MQQA 2C6WB 2VGJA 1PIOA 4X68A 1JWPA 3ITBA 2O0YA 3C38A 4O7DA 2Y2QA 3T4JA 4LFUA 3M2KA 4EBNA 5CGXA 4HY8A 1IFQA 2Y2IA 2JKRM 5EVIB 3LYXA 4KG2A 2ZM0A 3BJNA 2BLSA 1XX2A 5FQJA 3HLBA 5HD5A 5J8XA 4P6BA 3D72A 4K91A 4IHQA 2FH5A 3BLMA 5DFYA 3UE1A 3R7WA 2YKFA 3BQAA 3UDIA 1ZHHB 3PR6A 4R0QA 1OT6A 5CXWA 2WGWA 1XFNA 3UE0A 2ZQCA 2V1ZA 3C4PA 5DF9A 5HAIA 4WELA 4GW9A 3T4QA 3B42A 2QKPA 4HBTA 4DXCA 4KG6A 1XJ2A 1W5DA 4WL9A 1L2SA 4L9GA 4ME4A 2BTFP 5F1FA 2ZC4B 5FI6A 3NOTC 3BM6A 2ZC6B 4HP9A 3N8RA 3G2YA 1WE4A 1OTEA 2W27A 2XD1A 1ZG4A 3N4IA 5EFWA 1ES2A 2PBDP 3VSKA 4JLFA 1ZTUA 4FSFA 1OTIA 2KOIA 1E25A 2OLVA 4DKIA 3OCLA 4PHTA 2V8FA 4Z9QA 1YMXA 4Q8IA 4P87A 3EQVA 2PU2A 1S0WA 2Y79A 3IXDA 3PBSA 2VV8A 4GJ4A 5A90A 4L0LA 5F83A 3UDXA 1FR6A 4RQ9A 2P9VA 2O99A 3A3JA 1PFLA 1KOUA 3VOLA 4EXOA 1EROA 1N4OA 2WKRA 1Y54A 2ZQAA 3VP1A 1KGFA 4ZDXA 3NOPC 3AGDA 2WGIA 3FWLA 4HIAA 3CJMA 1SKOA 4F94A 1I2SA 2L1MA 1K55A 3NC8A 2EX6A 3QP1A 2B95A 3C5AA 1KE0A 2E8JA 1XGIA 4JGOA 1BLCA 1MWRA 2ZD8A 2L0WA 3H82A 2WKIA 3IBJA 3G34A 2K31A 2V20A 3T4SA 3UMEA 1LI9A 5AVFA 2OAQ1 5CGWA 4OOMA 3TRCA 3QHYA 1K54A 5L07A 4FH4A 1T1CA 5I5LA 4KUKA 2UV0E 3H7WA 4KG5A 4PM7A 2X01A 3VV4A 1S6RA 2QYBA 3KSFA 4LV0A 1K56D 4DE1A 1CEGA 5HARA 3ZG5A 4WF0A 3IF6C 2M7UA 1NYYA 3HCYA 4O0PA 3C2WA 4E6XA 1L0GA 4GS9A 1L3LA 1U60A 5DJUA 2XK1A 4NXEA 3U4LP 2VLGA 1NRFA 3ZG7B 1LT0A 4N1HA 4Q0JA 4HOIA 5E2EA 1XJ3A 2QJ5A 1XJ4A 2Q9MA 4XT2B 3OZHA 2HJ9C 1M6KA 1LL8A 2EFUA 2X71A 4E3JA 3KSIA 3EOIA 5EVIA 2WUQA 1XA7A 1FQGA 2GJ3A 5A91A 3UB7A 1K54C 4XXRA 5EOEA 4WZ5C 2AVXA 1PI5A 3KYQA 4DE3A 4C6YA 4X1LA 5E2GA 1LSWA 5EPHA 4OONA 1FILA 4GD8A 4IBRA 4U0XA 2EX9A 3VE4A 4X55A 4WBGA 4UQIM 4NETA 3NDGA 3V39A 3LCEA 1RCJA 4UA7A 2HP6A 2DMWA 3ZVTA 4UQIS 4Q0HA 3Q1FA 3HLWA 3IBRA 1UWNX 5DFXA 4E3LA 2XD5A 4BQMA 3LR4A 2OSUA 3P09A 1PRQA 5F68A 2IWBA 5HWVA 3QP4A 4Y13A 3BFCA 3HREA 3IXGA 3OPPA 4QHCA 5L10A 3CITA 1EWZA 4JXVA 1W63Q 2QWSA 2ZM8A 3VP3A 4B4ZA 5U47A 3P01A 3F1NB 1NLZA 4OH0A 1RGYA 4JF4A 3WS1A 3CPTB 3SH9A 3QNCA 2G7UA 3VP0A 5EVID 3NHQA 4WYYA 2XRNA 4EESA 5HDDA 2KLIA 3TW8A 3V3RA 5CRFA 3ITAA 5AVEA 3NOUC 4OPQA 3W4QA 2M7VA 1SHVA 5IT5A 3FPVA 5FAPA 1KDSA 1SDNA 2FZ0A 1ERQA 4EUZA 1J9MA 4R3JA 3HBRA 3IH8A 5TGFA 5DKKA 3UPNA 4ZAMA 3GDIA 4GOGA 1YLYA 4OP5A 4GLQA 4IEDA 3CG5A 3MF0A 4ETZA 3N7WA 1J3WA 4BJPA 5JYPA 3JVVA 1DJAA 4X1MA 2H28A 2Y2PA 2B5RA 3PBOA 5GLBA 3CAXA 4QJGA 2XLNA 3CMZA 4UAAA 4E3IA 1YMSA 2Y2LA 4KQOA 1BLPA 3FZCA 5L8MA 4K0WA 4MEZA 2QPNA 1O07A 5AQBA 5CHJA 2JKRI 3DWZA 3LEZA 3NI9A 1K25A 4EEPA 4R3BA 1F98A 1BZAA 3T4OA 3K3DA 3ZVWA 4IVKA 3OOVA 5D3OA 5E43A 2HF6A 2ZMAA 4OOLA 2V1BA 2VK3A 4PM9A 1D7EA 4FTXA 5GLDA 2ZQ8A 4HI4A 2I72A 4Y7PA 1L0FA 1H0MA 3R4KA 1N9OA 1W63M 3M2JA 4MN6A 5EOOA 5IU1A 3S4XA 4XUXA 3S22A 1LL9A 4JKTA 1AWIA 2ZQDA 4I3JA 4DJ2A 5DF8A 5EE8A 3BY9A 4KZ8A 3PBQA 1OJ5A 4KQRA 3RFBA 2PD8A 1STZA 2XH9A 3ZCZA 1PZOA 4B4XA 1K4EA 2GZAA 2VGLM 2A24B 5MC7A 3OLOA 4HESA 4S2MA 3MZEA 2Y55A 2XGNA 1IYOA 3BW6A 4KZ9A 2PT7A 4RX2A 4FCFA 2VGLS 3BFGA 2V0WA 3G6OA 3IS2A 3L7HA 1ODVA 4II7A 3F1PB 4JXSA 5M18A 5HPFA 4B88A 3V67A 2VV6A 3IF5A 2ZC7A 2QMIA 3G4PA 1IOUA 1HD8A 4CQHA 3E2LA 1YLWA 4S2IA 5FASA 1MPLA 1OMEA 1OTAA 1ZC2A 1I5QA 3BEBA 3BY8A 3E98A 5KSCA 2EXAA 5TJJA 5IHVA 3IWOA 2W3GA 3NJAA 4BWIA 3GMWA 2HZ5A 3O5YA 4EUVA 3LI9A 3CLOA 4JBFA 3UN7A 3T1XA 4GD6A 1GCEA 5FDHA 5KIZA 3IWQA 3GRJA 4KQQA 1P9WA 3IQAA 4WUJA 4N9KA 1NWZA 3F1OA 1TDLA 1NRJA 4MBHA 4IUKA 1VETB 4NXBA 1IKGA 4QPRA 1G68A 4R4SA 3GV9A 3FKWA 2ZQ9A 3MS6A 2QHKA 4IUHA 2J9PA 3HL9A 1PI4A 1HTZA 5JYOA 4HJ4A 2XDMA 4Y0OA 3UO9A 2Y2JA 4BD1A 4EQ1A 3ULFA 4BL3A 1ONGA 3LR0A 1G6AA 3OBFA 5GLAA 5K5BA 4I5SA 2JHEA 3IX3A 1MWSA 2JKTM 3MZDA 1ACFA 1CJFA 3S1YA 4MDZA 1M40A 5HX9A 3M6HA 3CI6A 2ACGA 3LGOA 1ONHA 4BMWA 5L2FA 1H3QA 1YQSA 2Y2MA 1RP5A 1BYWA 3A3EA 4RA7A 3I7JA 3HVFA 1IEMA 3G2ZA 2LB5A 2ZL1B 4PM6A 2ZOHA 2WZZA 5F5YA 3TOIA 3HLCA 1A0KA 3L9KA 3UB8A 3SZTA 4LCMA 5TR7A 4UA6A 2J3TD 4H6JB 1K56A 2GNXA 1PNEA 1T18A 2KDKA 5AQ9A 4N9LA 1IELA 1YT4A 4KZ3A 4N92A 1VEUB 5FQMA 2OOLA 3SS4A 3RXXA 1DJCA 4R1GA 4Y2FA 4HBUA 3OC2A 1XP4A 1PWDA 3GTCA 2HDSA 3P98A 5FQIA 4HH2A 1S67L 1H8MA 1NXYA 2VA0A 2OWJA 4F3LB 4JGRA 3T4TA 3C8CA 3E0YA 2JCHA 2A24A 1JNUA 4GNUA 4HJ6A 2WKQA 3RTYA 2OWHA 3ZGAB 4ARZA 2R78A 4LGWA 2G2WA 2W1TB 1XXMA 3IWIA 5FL3A 5DF7A 2HV1A 1O7EA 2JE5A 4QB8A 2X02A 2WAEA 2V9AA 4GHIA 4BBTA 2A49A 2D02A 2INWA 2PYPA 1YPRA 1V9YA 3OPRA 1MWTA 2W3FA 5TFQA 4LENA 4EU0A 3ZNYA 3ZFZA 2ZQ7A 1AXBA 4NXGA 1G28A 4QD4A 2J7VA 3G35A 2P08A 3ZG9B 2WKPA 2IWDA 1ALQA 4U0TA 2DRWA 4AFIA 3UPPA 3WS4A 4OLGA 4CLCB 5G18A 1Y4OA 2R9XA 1K57A 5CHMA 1K55C 3B33A 1K4FA 5EVEA 3UNWA 3BFDA 1FCMA 1G5UA 1CEFA 3PYPA 5EM0A 2Z2LB 5FQKA 4HQAA 1BLHA 2BG1A 4YNRA 3S7QA 3NECA 1VETA 2RL3A 3V50A 2XFTA 2Z6DA 2VKSA 1W7FA 4Y5FA 2KX6A 4FOFA 1TS8A 1KGGA 1OTDA 1NZUA 5HFOA 3WS2A 4BENA 3HLEA 1Q2QA 3E4OA 4E3KA 3MFDA 3T12B 3OCNA 3VE3A 3HLFA 1YLPA 3UDFA 1K57C 4EBPA 5CERA 5GHZA 4DE2A 2JC7A 4OPRA 1EW0A 4PKYG 4MBKA 3HJIA 4E3OA 1P0ZA 1KE4A 4ESPA 5M19A 1KGEA 3MMHA 5DVAA 5EVIC 1DRMA 1NLYA 2L4RA 4GKUA 3T4KA 3TJZC
chains in the Genus database with same CATH topology
2ZMAA 5EVIB 3LO7A 4OOLA 1JWVA 1EI5A 4KG2A 2WKHA 2ZM0A 3UY6A 4KZAA 4RYEA 2ZC5B 4PM9A 2BLSA 3C7VA 4C75A 3O87A 5GLDA 3EQUA 2H5SA 2ZQ8A 1WYCA 1XX2A 4QU3A 2I72A 5FQJA 1K6RA 4OVDA 4D2OA 3HLBA 4Y7PA 1L0FA 4GZBA 3VOYA 3G31A 5J8XA 2Z2MB 1JVJA 2ZM2A 4P6BA 5KSHA 1PYYA 1YLZA 3M2JA 3AGFA 5EOOA 4K91A 5FQ9A 5GL9A 4DF6A 5CEDA 2WKEA 3S4XA 4XUXA 3BLMA 3S22A 1LL9A 4JKTA 2C5WB 4S2JA 3UE1A 4YINA 3BLSA 4ID4A 3MKFA 2ZQDA 1MXOA 3UDIA 5DF8A 5EE8A 3C7UA 3PBNA 1LL5A 4KZ8A 3PBQA 1E4DA 4KQRA 1BTLA 4RVAA 1YLJA 2XH9A 2HDRA 1PZOA 4R0QA 4QY6A 3ZCZA 1K4EA 4B4XA 3MBZA 4WZ5A 5CXWA 2WGWA 4M3KA 3OPLA 2P74A 4HESA 4S2MA 2ZQCA 5F82A 1GHPA 2V1ZA 2Y55A 2XGNA 1IYOA 3MZEA 4KZ9A 3C4PA 3G32A 5DF9A 1BT5A 1ZG6A 4RX2A 5HAIA 1GHIA 4FCFA 3VP2A 4WELA 3BFGA 3ISGA 2DCFA 1GHMA 1VM1A 1FCOA 5EVLA 4HBTA 4JXSA 1C3BA 4JF5A 4OPZA 5M18A 4DXCA 4GDBA 4B88A 4KG6A 1GA0A 1W5DA 2PU4A 3GVBA 1L2SA 3SH7A 2CC1A 3IF5A 2ZC7A 5F1FA 2ZC4B 2QMIA 3SS5A 3SS3A 3N8LA 3PBTA 5FI6A 3VOZA 1ESUA 3G4PA 5CECA 3BM6A 2XF3A 3PAGA 2ZC6B 5EECA 1HD8A 3E2LA 1YLWA 3W4PA 1XPBA 4GB7A 1K38A 2A3UA 3N8RA 3G2YA 4S2IA 1WE4A 1DJBA 4PM5A 3UPOA 2XD1A 5FASA 4IBXA 1MPLA 1ZG4A 2DNSA 1QMEA 4X69A 1OMEA 2J8YA 3DWKA 3N4IA 1ZC2A 5GHXA 1ES2A 4E3NA 5FATA 3VSKA 4JLFA 1I5QA 4XUZA 3BEBA 4OKPA 2JBFA 4Y0UA 4FSFA 1BUEA 4JF6A 3WS5A 2OLUA 1JWZA 5KSCA 2EXAA 1E25A 3AGEA 2OLVA 3IWOA 1DY6A 3QNBA 5IHVA 4DKIA 3OCLA 2XR0A 2Y2GA 3SOIA 4Z9QA 1YMXA 1H8YA 1WYBA 3A3IA 3GMWA 3ZG0A 4Q8IA 5A92A 4P87A 3EQVA 2WGWB 2PU2A 1S0WA 3IXDA 3PBSA 1ESIA 5A90A 4L0LA 3VP4A 4JBFA 1MY8A 5F83A 5FAQA 3V3SA 3WWXA 3UN7A 5KZHA 4GD6A 3UDXA 1GCEA 1HVBA 5FDHA 1FR6A 3IWQA 1SCWA 1BLSA 2P9VA 3GRJA 3Q81A 4KQQA 3IQAA 3HLGA 3A3JA 3TSGA 4N9KA 3W4OA 2WZXA 1EROA 1N4OA 4QY5A 1TDLA 1Y54A 2ZQAA 4MBHA 3VP1A 4KZBA 1KGFA 4ZDXA 4EV4A 1IKGA 1G68A 4R4SA 3GV9A 1PZPA 3AGDA 2WGIA 2XFSA 3FKWA 3LY4A 3FWLA 5DTSA 5I94A 2ZQ9A 5CGSA 4U3TA 3CJMA 2FFFB 4F94A 1I2SA 3FV7A 3FYZA 2J9PA 3HL9A 1PI4A 1K55A 3IXBA 3NC8A 1HTZA 2ZC3B 2EX6A 1W79A 3E2KA 5JYOA 3C5AA 3OPHA 4LV1A 1KE0A 2Y2OA 3W8KA 4PM8A 2XDMA 2Y59A 1NY0A 4WZ4A 4Y0OA 1LHYA 3A3DA 1ES4A 3UO9A 4WM9A 4OQIA 4IVIA 1CK3A 2Y2JA 4BD1A 1XGIA 2R9WA 1PW8A 1BLCA 4KZ4A 4R23A 4BL3A 1MWRA 1ONGA 1G6AA 2ZD8A 5GLAA 5HAQA 3ZHHA 2WKIA 3G34A 2V20A 1LI9A 1PWCA 3Q7VB 1MWSA 5EUAA 4S2NA 3MZDA 5CGWA 4OOMA 4OQGA 3S1YA 1JTDA 3V5MA 1M40A 1LLBA 3QHYA 1K54A 4S2LA 2FFYA 3UE0A 4FH4A 1E3UA 3BFFA 3O86A 1FSYA 3GSGA 3CZDA 5HX9A 4KG5A 1FR1A 4PM7A 3M6HA 2EX8A 2QZ6A 2X01A 4X56A 1S6RA 1ES5A 1KVMA 3DW0A 5FAOA 2P9VB 3O88A 1N9BA 2G2UA 4E6WA 4BD0A 4LV0A 2ZLYA 1K56D 1ONHA 4PMAA 4DE1A 1CEGA 4OQ0A 5HARA 3ZG5A 4E3MA 3NCKA 5L2FA 4S2PA 2WAFA 3IF6C 1Z6FA 1NYYA 1YQSA 2Y2MA 1RP5A 4S2KA 3IF6B 4OOYA 1L0GA 4E6XA 3IXHA 1U60A 2XK1A 3A3EA 3N8SA 3I7JA 4RA7A 3HVFA 1IEMA 3G2ZA 3O3VA 1NRFA 3ZG7B 4N1HA 3UE3A 4PM6A 2WZZA 3TOIA 3HLCA 3VSLA 2EFXA 1IKIA 4FD8A 5E2EA 1XGJA 3MKEA 4KZ6A 1PW1A 3BECA 1LI0A 2EX2A 2Q9MA 4Y0TA 3BRMA 3RJUA 3OZHA 1M6KA 2EFUA 2Y91A 1NJ4A 4DE0A 2Y2KA 3D4FA 1W8YA 4LCMA 1BULA 2J9OA 5TR7A 5A93A 5GHYA 4DDYA 2X71A 4E3JA 4EWFA 3FKVA 5DTKA 5EVIA 3PTEA 1XA1A 2WUQA 1XA7A 3BYDA 1FQGA 1K56A 4KENB 4MBFA 4UA6A 5FI7A 3IHAA 3VMAA 5A91A 4EQIA 1K54C 1RGZA 4P0MA 5AQ9A 4XXRA 5FI2A 5CHUA 5EOEA 4HEFA 1QMFA 2HPBA 5KMWA 4N9LA 1IELA 5HW3A 4WZ5C 3Q7ZA 3NBLA 1YT4A 4KZ3A 4N92A 5FQMA 1PI5A 2Y2HA 3NDEA 3NY4A 1CI8A 4R4RA 3Q07A 4WEJA 4C6YA 4DE3A 4H8RA 3SS4A 3RXXA 4BL2A 2WADA 2WK0A 5E2GA 1DJCA 4R1GA 5CTNA 4HBUA 5EPHA 3OC2A 1XP4A 1PWDA 2EXBA 3GTCA 1FOFA 4GD8A 1HZOA 2XQZA 4IBRA 4OONA 4U0XA 1YLTA 2HDSA 3P98A 5FQIA 1FSWA 2EX9A 4C3QA 4X55A 4WBGA 4NETA 5GLCA 3NDGA 1XKZA 3V39A 3LCEA 1NXYA 1RCJA 4UA7A 2HP6A 1E3UD 3PBRA 1VQQA 2JCHA 3BFEA 3HUMA 5M1AA 4MLLA 3ZVTA 4GNUA 1IYPA 3N6IA 3Q1FA 3ZGAB 2HP9A 2WGVA 3TG9A 3HLDA 4BLMA 3HLWA 3ZDJA 2XD5A 3B3XA 3DTMA 4E3LA 4BQMA 1ERMA 2G2WA 1L0DA 5F1GA 2HP5A 2OSUA 1XXMA 1NYMA 2H10A 3IWIA 3P09A 2Q9NA 2IWBA 3VFFA 3G30A 2PBYA 5DF7A 1O7EA 2JE5A 3M6BA 4QB8A 3WS0A 3BFCA 3HREA 3IXGA 3OPPA 2X02A 3MZFA 4S2OA 4UA9A 2WAEA 4QHCA 2HDUA 2UWXA 5FA7A 2WYXA 4NK3A 5HAPA 1EWZA 4JPMA 1NZOA 4JXVA 4KZ7A 2Y2NA 1H5XA 2ZM8A 3WRZA 3SH8A 2A49A 3VP3A 4B4ZA 4K0XA 4JXGA 4WMCA 5HL1A 1MBLA 5U47A 4WEKA 5E2FA 4LCLA 3OPRA 4FH2A 1ES3A 3RXWA 1MWTA 5TFQA 4GDNA 4LENA 4OH0A 4A5RA 1RGYA 2GDNA 4JF4A 4ZBEA 3WS1A 3ZNTA 1CI9A 3ZNYA 1KDWA 3SH9A 4ZJ1A 3ZFZA 2ZQ7A 1AXBA 5E2HA 5BOHA 2Y4AA 3QNCA 1SDEA 4QD4A 3VP0A 2J7VA 3G35A 1I2WA 4GN2A 5EVID 2HDQA 4OLDA 4OPYA 3ZG9B 1YM1A 4WYYA 5CEBA 4KZ5A 1FCNA 2IWDA 4EBLA 1ALQA 4U0TA 1JTGA 2DRWA 2IWCA 4ZJ3A 3V3RA 4YFMA 5CRFA 1GA9A 3ITAA 5FQQA 3UPPA 3WS4A 4OLGA 5AQ7A 5G18A 2R9XA 4OPQA 1K57A 2ZJ9A 1SHVA 3HUNA 1K55C 3MXRA 4X6TA 5CHMA 5FAPA 1KDSA 1SDNA 1K4FA 5AQAA 3NIAA 3UNWA 4CPKA 3BFDA 1FCMA 1KVLA 2H0TA 4P85A 1ERQA 1K6SA 3GQZA 1KE3A 1L0EA 2E8IA 1CEFA 4EUZA 1J9MA 3ZG8B 4R3JA 2Z2LB 3HBRA 1MKIA 3IH8A 2H0YA 5FQKA 5TGFA 1IYQA 3WRTA 2RCXA 3UPNA 2XEPA 1BLHA 4ZAMA 2BG1A 4GOGA 3Q82A 1SKFA 4N1XA 1BSGA 2VGKA 1MWUA 4JXWA 2RL3A 1YLYA 4S2NC 3V50A 4OP5A 1H8ZA 4OQHA 2XFTA 4IEDA 3CG5A 1W7FA 3N7WA 4BJPA 3IHBA 5CTMA 5JYPA 1PWGA 3IH9A 2V2FF 4DRTA 1IYSA 1DJAA 1KGGA 2Y2PA 2B5RA 4PPRA 1NZUA 5DTTA 3C4OA 3PBOA 5HFOA 5GLBA 3WS2A 4QJGA 4BENA 3HLEA 1Q2QA 3IT9A 2XLNA 3A3FA 4E3KA 1W8QA 3CMZA 3MXSA 4UAAA 3MFDA 1YMSA 4ZTKA 2OV5A 3VFHA 4E3IA 2Y2LA 3LY3A 4KQOA 4UHUA 4ZJ2A 3OCNA 4X53A 1BLPA 3FZCA 3Q7VA 2QPNA 4K0WA 4MEZA 3HLFA 1O07A 4LV2A 1YLPA 3JYIA 5FSRA 3UDFA 4LV3A 4WMCD 4CJNA 5AQBA 5CHJA 1TDGA 3GR2A 3DWZA 1K57C 1ZKJA 3PAEA 4EBPA 5CERA 3LEZA 5GHZA 2JC7A 4DDSA 3NI9A 3HUOA 4OPRA 3W4QA 4DE2A 2C6WB 1K25A 4RX3A 2VGJA 1PIOA 1Q2PA 1JWPA 4X68A 3ITBA 4OP8A 4R3BA 4O7DA 2Y2QA 4MBKA 1TVFA 3M2KA 4E3OA 5CGXA 4EBNA 1KE4A 1TEMA 1BZAA 3ZVWA 4MNRA 5M19A 4IVKA 1KGEA 5DVAA 5EVIC 4GKUA 5D3OA 5E43A 4DXBA 2Y2IA 3IF6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZMA A;  5EVI B;  3LO7 A;  4OOL A;  1JWV A;  1EI5 A;  4KG2 A;  2WKH A;  2ZM0 A;  3UY6 A;  4KZA A;  4RYE A;  2ZC5 B;  4PM9 A;  2BLS A;  3C7V A;  4C75 A;  3O87 A;  5GLD A;  3EQU A;  2H5S A;  2ZQ8 A;  1WYC A;  1XX2 A;  4QU3 A;  2I72 A;  5FQJ A;  1K6R A;  4OVD A;  4D2O A;  3HLB A;  4Y7P A;  1L0F A;  4GZB A;  3VOY A;  3G31 A;  5J8X A;  2Z2M B;  1JVJ A;  2ZM2 A;  4P6B A;  5KSH A;  1PYY A;  1YLZ A;  3M2J A;  3AGF A;  5EOO A;  4K91 A;  5FQ9 A;  5GL9 A;  4DF6 A;  5CED A;  2WKE A;  3S4X A;  4XUX A;  3BLM A;  3S22 A;  1LL9 A;  4JKT A;  2C5W B;  4S2J A;  3UE1 A;  4YIN A;  3BLS A;  4ID4 A;  3MKF A;  2ZQD A;  1MXO A;  3UDI A;  5DF8 A;  5EE8 A;  3C7U A;  3PBN A;  1LL5 A;  4KZ8 A;  3PBQ A;  1E4D A;  4KQR A;  1BTL A;  4RVA A;  1YLJ A;  2XH9 A;  2HDR A;  1PZO A;  4R0Q A;  4QY6 A;  3ZCZ A;  1K4E A;  4B4X A;  3MBZ A;  4WZ5 A;  5CXW A;  2WGW A;  4M3K A;  3OPL A;  2P74 A;  4HES A;  4S2M A;  2ZQC A;  5F82 A;  1GHP A;  2V1Z A;  2Y55 A;  2XGN A;  1IYO A;  3MZE A;  4KZ9 A;  3C4P A;  3G32 A;  5DF9 A;  1BT5 A;  1ZG6 A;  4RX2 A;  5HAI A;  1GHI A;  4FCF A;  3VP2 A;  4WEL A;  3BFG A;  3ISG A;  2DCF A;  1GHM A;  1VM1 A;  1FCO A;  5EVL A;  4HBT A;  4JXS A;  1C3B A;  4JF5 A;  4OPZ A;  5M18 A;  4DXC A;  4GDB A;  4B88 A;  4KG6 A;  1GA0 A;  1W5D A;  2PU4 A;  3GVB A;  1L2S A;  3SH7 A;  2CC1 A;  3IF5 A;  2ZC7 A;  5F1F A;  2ZC4 B;  2QMI A;  3SS5 A;  3SS3 A;  3N8L A;  3PBT A;  5FI6 A;  3VOZ A;  1ESU A;  3G4P A;  5CEC A;  3BM6 A;  2XF3 A;  3PAG A;  2ZC6 B;  5EEC A;  1HD8 A;  3E2L A;  1YLW A;  3W4P A;  1XPB A;  4GB7 A;  1K38 A;  2A3U A;  3N8R A;  3G2Y A;  4S2I A;  1WE4 A;  1DJB A;  4PM5 A;  3UPO A;  2XD1 A;  5FAS A;  4IBX A;  1MPL A;  1ZG4 A;  2DNS A;  1QME A;  4X69 A;  1OME A;  2J8Y A;  3DWK A;  3N4I A;  1ZC2 A;  5GHX A;  1ES2 A;  4E3N A;  5FAT A;  3VSK A;  4JLF A;  1I5Q A;  4XUZ A;  3BEB A;  4OKP A;  2JBF A;  4Y0U A;  4FSF A;  1BUE A;  4JF6 A;  3WS5 A;  2OLU A;  1JWZ A;  5KSC A;  2EXA A;  1E25 A;  3AGE A;  2OLV A;  3IWO A;  1DY6 A;  3QNB A;  5IHV A;  4DKI A;  3OCL A;  2XR0 A;  2Y2G A;  3SOI A;  4Z9Q A;  1YMX A;  1H8Y A;  1WYB A;  3A3I A;  3GMW A;  3ZG0 A;  4Q8I A;  5A92 A;  4P87 A;  3EQV A;  2WGW B;  2PU2 A;  1S0W A;  3IXD A;  3PBS A;  1ESI A;  5A90 A;  4L0L A;  3VP4 A;  4JBF A;  1MY8 A;  5F83 A;  5FAQ A;  3V3S A;  3WWX A;  3UN7 A;  5KZH A;  4GD6 A;  3UDX A;  1GCE A;  1HVB A;  5FDH A;  1FR6 A;  3IWQ A;  1SCW A;  1BLS A;  2P9V A;  3GRJ A;  3Q81 A;  4KQQ A;  3IQA A;  3HLG A;  3A3J A;  3TSG A;  4N9K A;  3W4O A;  2WZX A;  1ERO A;  1N4O A;  4QY5 A;  1TDL A;  1Y54 A;  2ZQA A;  4MBH A;  3VP1 A;  4KZB A;  1KGF A;  4ZDX A;  4EV4 A;  1IKG A;  1G68 A;  4R4S A;  3GV9 A;  1PZP A;  3AGD A;  2WGI A;  2XFS A;  3FKW A;  3LY4 A;  3FWL A;  5DTS A;  5I94 A;  2ZQ9 A;  5CGS A;  4U3T A;  3CJM A;  2FFF B;  4F94 A;  1I2S A;  3FV7 A;  3FYZ A;  2J9P A;  3HL9 A;  1PI4 A;  1K55 A;  3IXB A;  3NC8 A;  1HTZ A;  2ZC3 B;  2EX6 A;  1W79 A;  3E2K A;  5JYO A;  3C5A A;  3OPH A;  4LV1 A;  1KE0 A;  2Y2O A;  3W8K A;  4PM8 A;  2XDM A;  2Y59 A;  1NY0 A;  4WZ4 A;  4Y0O A;  1LHY A;  3A3D A;  1ES4 A;  3UO9 A;  4WM9 A;  4OQI A;  4IVI A;  1CK3 A;  2Y2J A;  4BD1 A;  1XGI A;  2R9W A;  1PW8 A;  1BLC A;  4KZ4 A;  4R23 A;  4BL3 A;  1MWR A;  1ONG A;  1G6A A;  2ZD8 A;  5GLA A;  5HAQ A;  3ZHH A;  2WKI A;  3G34 A;  2V20 A;  1LI9 A;  1PWC A;  3Q7V B;  1MWS A;  5EUA A;  4S2N A;  3MZD A;  5CGW A;  4OOM A;  4OQG A;  3S1Y A;  1JTD A;  3V5M A;  1M40 A;  1LLB A;  3QHY A;  1K54 A;  4S2L A;  2FFY A;  3UE0 A;  4FH4 A;  1E3U A;  3BFF A;  3O86 A;  1FSY A;  3GSG A;  3CZD A;  5HX9 A;  4KG5 A;  1FR1 A;  4PM7 A;  3M6H A;  2EX8 A;  2QZ6 A;  2X01 A;  4X56 A;  1S6R A;  1ES5 A;  1KVM A;  3DW0 A;  5FAO A;  2P9V B;  3O88 A;  1N9B A;  2G2U A;  4E6W A;  4BD0 A;  4LV0 A;  2ZLY A;  1K56 D;  1ONH A;  4PMA A;  4DE1 A;  1CEG A;  4OQ0 A;  5HAR A;  3ZG5 A;  4E3M A;  3NCK A;  5L2F A;  4S2P A;  2WAF A;  3IF6 C;  1Z6F A;  1NYY A;  1YQS A;  2Y2M A;  1RP5 A;  4S2K A;  3IF6 B;  4OOY A;  1L0G A;  4E6X A;  3IXH A;  1U60 A;  2XK1 A;  3A3E A;  3N8S A;  3I7J A;  4RA7 A;  3HVF A;  1IEM A;  3G2Z A;  3O3V A;  1NRF A;  3ZG7 B;  4N1H A;  3UE3 A;  4PM6 A;  2WZZ A;  3TOI A;  3HLC A;  3VSL A;  2EFX A;  1IKI A;  4FD8 A;  5E2E A;  1XGJ A;  3MKE A;  4KZ6 A;  1PW1 A;  3BEC A;  1LI0 A;  2EX2 A;  2Q9M A;  4Y0T A;  3BRM A;  3RJU A;  3OZH A;  1M6K A;  2EFU A;  2Y91 A;  1NJ4 A;  4DE0 A;  2Y2K A;  3D4F A;  1W8Y A;  4LCM A;  1BUL A;  2J9O A;  5TR7 A;  5A93 A;  5GHY A;  4DDY A;  2X71 A;  4E3J A;  4EWF A;  3FKV A;  5DTK A;  5EVI A;  3PTE A;  1XA1 A;  2WUQ A;  1XA7 A;  3BYD A;  1FQG A;  1K56 A;  4KEN B;  4MBF A;  4UA6 A;  5FI7 A;  3IHA A;  3VMA A;  5A91 A;  4EQI A;  1K54 C;  1RGZ A;  4P0M A;  5AQ9 A;  4XXR A;  5FI2 A;  5CHU A;  5EOE A;  4HEF A;  1QMF A;  2HPB A;  5KMW A;  4N9L A;  1IEL A;  5HW3 A;  4WZ5 C;  3Q7Z A;  3NBL A;  1YT4 A;  4KZ3 A;  4N92 A;  5FQM A;  1PI5 A;  2Y2H A;  3NDE A;  3NY4 A;  1CI8 A;  4R4R A;  3Q07 A;  4WEJ A;  4C6Y A;  4DE3 A;  4H8R A;  3SS4 A;  3RXX A;  4BL2 A;  2WAD A;  2WK0 A;  5E2G A;  1DJC A;  4R1G A;  5CTN A;  4HBU A;  5EPH A;  3OC2 A;  1XP4 A;  1PWD A;  2EXB A;  3GTC A;  1FOF A;  4GD8 A;  1HZO A;  2XQZ A;  4IBR A;  4OON A;  4U0X A;  1YLT A;  2HDS A;  3P98 A;  5FQI A;  1FSW A;  2EX9 A;  4C3Q A;  4X55 A;  4WBG A;  4NET A;  5GLC A;  3NDG A;  1XKZ A;  3V39 A;  3LCE A;  1NXY A;  1RCJ A;  4UA7 A;  2HP6 A;  1E3U D;  3PBR A;  1VQQ A;  2JCH A;  3BFE A;  3HUM A;  5M1A A;  4MLL A;  3ZVT A;  4GNU A;  1IYP A;  3N6I A;  3Q1F A;  3ZGA B;  2HP9 A;  2WGV A;  3TG9 A;  3HLD A;  4BLM A;  3HLW A;  3ZDJ A;  2XD5 A;  3B3X A;  3DTM A;  4E3L A;  4BQM A;  1ERM A;  2G2W A;  1L0D A;  5F1G A;  2HP5 A;  2OSU A;  1XXM A;  1NYM A;  2H10 A;  3IWI A;  3P09 A;  2Q9N A;  2IWB A;  3VFF A;  3G30 A;  2PBY A;  5DF7 A;  1O7E A;  2JE5 A;  3M6B A;  4QB8 A;  3WS0 A;  3BFC A;  3HRE A;  3IXG A;  3OPP A;  2X02 A;  3MZF A;  4S2O A;  4UA9 A;  2WAE A;  4QHC A;  2HDU A;  2UWX A;  5FA7 A;  2WYX A;  4NK3 A;  5HAP A;  1EWZ A;  4JPM A;  1NZO A;  4JXV A;  4KZ7 A;  2Y2N A;  1H5X A;  2ZM8 A;  3WRZ A;  3SH8 A;  2A49 A;  3VP3 A;  4B4Z A;  4K0X A;  4JXG A;  4WMC A;  5HL1 A;  1MBL A;  5U47 A;  4WEK A;  5E2F A;  4LCL A;  3OPR A;  4FH2 A;  1ES3 A;  3RXW A;  1MWT A;  5TFQ A;  4GDN A;  4LEN A;  4OH0 A;  4A5R A;  1RGY A;  2GDN A;  4JF4 A;  4ZBE A;  3WS1 A;  3ZNT A;  1CI9 A;  3ZNY A;  1KDW A;  3SH9 A;  4ZJ1 A;  3ZFZ A;  2ZQ7 A;  1AXB A;  5E2H A;  5BOH A;  2Y4A A;  3QNC A;  1SDE A;  4QD4 A;  3VP0 A;  2J7V A;  3G35 A;  1I2W A;  4GN2 A;  5EVI D;  2HDQ A;  4OLD A;  4OPY A;  3ZG9 B;  1YM1 A;  4WYY A;  5CEB A;  4KZ5 A;  1FCN A;  2IWD A;  4EBL A;  1ALQ A;  4U0T A;  1JTG A;  2DRW A;  2IWC A;  4ZJ3 A;  3V3R A;  4YFM A;  5CRF A;  1GA9 A;  3ITA A;  5FQQ A;  3UPP A;  3WS4 A;  4OLG A;  5AQ7 A;  5G18 A;  2R9X A;  4OPQ A;  1K57 A;  2ZJ9 A;  1SHV A;  3HUN A;  1K55 C;  3MXR A;  4X6T A;  5CHM A;  5FAP A;  1KDS A;  1SDN A;  1K4F A;  5AQA A;  3NIA A;  3UNW A;  4CPK A;  3BFD A;  1FCM A;  1KVL A;  2H0T A;  4P85 A;  1ERQ A;  1K6S A;  3GQZ A;  1KE3 A;  1L0E A;  2E8I A;  1CEF A;  4EUZ A;  1J9M A;  3ZG8 B;  4R3J A;  2Z2L B;  3HBR A;  1MKI A;  3IH8 A;  2H0Y A;  5FQK A;  5TGF A;  1IYQ A;  3WRT A;  2RCX A;  3UPN A;  2XEP A;  1BLH A;  4ZAM A;  2BG1 A;  4GOG A;  3Q82 A;  1SKF A;  4N1X A;  1BSG A;  2VGK A;  1MWU A;  4JXW A;  2RL3 A;  1YLY A;  4S2N C;  3V50 A;  4OP5 A;  1H8Z A;  4OQH A;  2XFT A;  4IED A;  3CG5 A;  1W7F A;  3N7W A;  4BJP A;  3IHB A;  5CTM A;  5JYP A;  1PWG A;  3IH9 A;  2V2F F;  4DRT A;  1IYS A;  1DJA A;  1KGG A;  2Y2P A;  2B5R A;  4PPR A;  1NZU A;  5DTT A;  3C4O A;  3PBO A;  5HFO A;  5GLB A;  3WS2 A;  4QJG A;  4BEN A;  3HLE A;  1Q2Q A;  3IT9 A;  2XLN A;  3A3F A;  4E3K A;  1W8Q A;  3CMZ A;  3MXS A;  4UAA A;  3MFD A;  1YMS A;  4ZTK A;  2OV5 A;  3VFH A;  4E3I A;  2Y2L A;  3LY3 A;  4KQO A;  4UHU A;  4ZJ2 A;  3OCN A;  4X53 A;  1BLP A;  3FZC A;  3Q7V A;  2QPN A;  4K0W A;  4MEZ A;  3HLF A;  1O07 A;  4LV2 A;  1YLP A;  3JYI A;  5FSR A;  3UDF A;  4LV3 A;  4WMC D;  4CJN A;  5AQB A;  5CHJ A;  1TDG A;  3GR2 A;  3DWZ A;  1K57 C;  1ZKJ A;  3PAE A;  4EBP A;  5CER A;  3LEZ A;  5GHZ A;  2JC7 A;  4DDS A;  3NI9 A;  3HUO A;  4OPR A;  3W4Q A;  4DE2 A;  2C6W B;  1K25 A;  4RX3 A;  2VGJ A;  1PIO A;  1Q2P A;  1JWP A;  4X68 A;  3ITB A;  4OP8 A;  4R3B A;  4O7D A;  2Y2Q A;  4MBK A;  1TVF A;  3M2K A;  4E3O A;  5CGX A;  4EBN A;  1KE4 A;  1TEM A;  1BZA A;  3ZVW A;  4MNR A;  5M19 A;  4IVK A;  1KGE A;  5DVA A;  5EVI C;  4GKU A;  5D3O A;  5E43 A;  4DXB A;  2Y2I A;  3IF6 A; 
#chains in the Genus database with same CATH topology
 1EI5 A;  3UY6 A;  4KZA A;  4RYE A;  2ZC5 B;  4M4X A;  4C75 A;  4LRZ E;  2ZL1 A;  2H5S A;  1WYC A;  1K6R A;  4OVD A;  4D2O A;  3DTE A;  1WA9 A;  3VOY A;  4HNB A;  3MFX A;  5KSH A;  2ZM2 A;  1PYY A;  5GL9 A;  2BAS A;  2WKE A;  2C5W B;  4YIN A;  4ID4 A;  4H6J A;  3MKF A;  1MXO A;  1LL5 A;  5C5K A;  3QP6 A;  1E4D A;  1YKD A;  1BTL A;  4RVA A;  1YLJ A;  2HDR A;  4QY6 A;  3MBZ A;  3UB6 A;  4M3K A;  2PD7 A;  5F82 A;  5J4E A;  3KYZ A;  1ZG6 A;  3VP2 A;  1GHI A;  3ISG A;  1GHM A;  3UB9 A;  1FCO A;  4NXF A;  3PHY A;  1C3B A;  1VB6 A;  4JF5 A;  4OPZ A;  4DN0 A;  4GDB A;  1VHM A;  1GA0 A;  4F3L A;  3SH7 A;  2PU4 A;  2CC1 A;  4WLA A;  3EGD C;  3PBT A;  3VOZ A;  1ESU A;  5EEC A;  4LLO B;  3W4P A;  4GB7 A;  1DJB A;  4PM5 A;  3UPO A;  4IBX A;  2PRF A;  4X69 A;  3DWK A;  2PAV P;  1DP9 A;  5GHX A;  3R7W B;  5F6A A;  5FAT A;  4X25 A;  5AJG A;  2JBF A;  1GSV A;  3P7N A;  4Y0U A;  4JF6 A;  2OLU A;  1DY6 A;  1TS0 A;  2XR0 A;  2Y2G A;  3SOI A;  2Q0O A;  1H8Y A;  1WYB A;  3A3I A;  3ZG0 A;  3LIB A;  2V8C A;  2WGW B;  3QP5 A;  4R38 A;  5KZH A;  2NUP C;  1CF0 A;  1T1A A;  3W4O A;  4I3I A;  2WZX A;  4QY5 A;  3T1R A;  4WN5 A;  4KZB A;  1TS7 A;  3QP2 A;  4K08 A;  1PZP A;  2XFS A;  5I94 A;  2FFF B;  3FYZ A;  3IXB A;  1W79 A;  3OPH A;  4LV1 A;  2Y2O A;  4XT2 A;  4PM8 A;  2Y59 A;  4WZ4 A;  1YSQ A;  1ES4 A;  1YAX A;  4WM9 A;  4IVI A;  1CK3 A;  1PW8 A;  3D9Y A;  4R23 A;  5HAQ A;  1D1J A;  3D3O A;  4MN5 A;  1F9I A;  3Q7V B;  5EUA A;  4S2N A;  4OQG A;  4S2L A;  2FFY A;  1S4S A;  3K3C A;  4EEU A;  1FSY A;  3GSG A;  2HGV A;  1V9Z A;  2QZ6 A;  4X56 A;  3DW0 A;  1KVM A;  5FAO A;  2P9V B;  3O88 A;  2M1C A;  1N9B A;  2G2U A;  4E3M A;  4LPZ A;  4S2P A;  3HJK A;  1Z6F A;  2PR5 A;  4S2K A;  3IF6 B;  4OOY A;  3LR3 A;  3SW1 A;  3LR5 A;  3N8S A;  3O3V A;  4EER A;  3UE3 A;  2W3E A;  2EFX A;  1IKI A;  5FEG A;  1XGJ A;  4KZ6 A;  1PW1 A;  3BEC A;  1LI0 A;  3LIA A;  3S7P A;  4HJ3 A;  2Y2K A;  3D4F A;  2J9O A;  5GHY A;  4DDY A;  4EWF A;  4MBF A;  4EQI A;  3IHA A;  3CUE A;  4CLC D;  4P0M A;  5FI2 A;  2W1R A;  3MQO A;  5CHU A;  4HEF A;  2HPB A;  3NBL A;  3F1N A;  5EM1 A;  3JPU A;  3NY4 A;  1CI8 A;  3Q07 A;  4WEJ A;  3CPT A;  2JKG A;  2WAD A;  3T1Q B;  5CTN A;  3DTK A;  1GSX A;  2XQZ A;  4C3Q A;  1FSW A;  1N9L A;  3FPW A;  5GLC A;  2Y8H A;  2EWV A;  4Q0I A;  1Z09 A;  3JVU A;  1VQQ A;  3HUM A;  3W2Z A;  2HP9 A;  2WGV A;  3TG9 A;  3HLD A;  3ZDJ A;  1ERM A;  2B02 A;  5F1G A;  2H10 A;  3VFF A;  2OAP 1;  3CUE C;  3M6B A;  3WS0 A;  4S2O A;  2HDU A;  2UWX A;  2WYX A;  4NK3 A;  5G4Z A;  2Y2N A;  3SH8 A;  3KYE A;  4WMC A;  3QP8 A;  5HL1 A;  4LCL A;  1ES3 A;  5CX7 A;  3RXW A;  5A93 A;  1SZV A;  4GDN A;  3C30 A;  2GDN A;  4ZBE A;  1CI9 A;  5HZH A;  2VZW A;  2Y4A A;  4NKP A;  1SDE A;  1OJG A;  3PXP A;  1I2W A;  4OLD A;  4QWO A;  3UB5 P;  3ZYT A;  5CEB A;  4KZ5 A;  1FCN A;  3E4Q A;  4EBL A;  1N9N A;  2J3T C;  4ZJ3 A;  1GA9 A;  5HSQ A;  5AQ7 A;  2ZJ9 A;  3HUN A;  3MXR A;  3T50 A;  1OTB A;  4DJ3 A;  3NIA A;  4CPK A;  1F5M A;  1KVL A;  1L0E A;  3ZG8 B;  4GCZ A;  1MKI A;  2H0Y A;  2NUT C;  2RCX A;  3Q82 A;  1SKF A;  1S1Y A;  2VGK A;  4Y17 A;  1MWU A;  3CWF A;  4Y15 A;  2ZBB A;  3DAV A;  4OQH A;  3E4P A;  3FC7 A;  5HD3 A;  2XSS A;  4FUW A;  3IHB A;  1TF1 A;  2V2F F;  1IYS A;  4UEY A;  4PPR A;  3C4O A;  4JGP A;  1LSX A;  3A3F A;  1W8Q A;  4LRX C;  3A0V A;  4X53 A;  3Q7V A;  2PHY A;  4WMC D;  2XA7 M;  5HWT A;  3T1S A;  4DDS A;  4RX3 A;  1Q2P A;  4OP8 A;  2XA7 S;  1TVF A;  3TE8 A;  1TEM A;  1GSW A;  4EW7 A;  4MNR A;  1TD5 A;  4DXB A;  3IF6 A;  5HWW A;  3LO7 A;  3F1P A;  1JWV A;  5TBM B;  2WKH A;  5EV0 A;  1HLU P;  3EEA A;  3C7V A;  3O87 A;  3EQU A;  4QU3 A;  2QJ7 A;  5DJT A;  4R70 A;  2YKH A;  4GZB A;  3G31 A;  2O9B A;  1S4R A;  2Z2M B;  1JVJ A;  3KSG A;  1YLZ A;  3AGF A;  5FQ9 A;  4DF6 A;  5CED A;  1FIK A;  4PKY A;  4L9E A;  4S2J A;  3K2N A;  3BLS A;  3C7U A;  3PBN A;  3EGX C;  5J3W A;  4WZ5 A;  2J80 A;  3ZQ5 A;  3OPL A;  2P74 A;  5A92 A;  1GHP A;  5HDS A;  1MZU A;  2CMN A;  3G32 A;  1BT5 A;  5FEF A;  5IS1 A;  4I3A A;  2DCF A;  1LSV A;  1VM1 A;  5F69 A;  5EVL A;  1CQA A;  3DTI A;  3UE6 A;  3GVB A;  4B9O A;  3SS5 A;  3SS3 A;  3N8L A;  5CEC A;  2XF3 A;  3PAG A;  4IJG A;  3KSH A;  5DKL A;  1XPB A;  1K38 A;  2A3U A;  5HL6 A;  4KUO A;  2DNS A;  1QME A;  2J8Y A;  2W3H A;  4E3N A;  2JKF A;  2PR6 A;  4XUZ A;  4OKP A;  2K7S A;  3BWL A;  1BUE A;  3MSH A;  3WS5 A;  4B93 A;  1JWZ A;  1MKM A;  2VEA A;  3AGE A;  3QNB A;  3LUQ A;  4E04 A;  1ESI A;  2IA2 A;  3VP4 A;  1MY8 A;  5FAQ A;  3V3S A;  3WWX A;  1HVB A;  3EWK A;  2GX5 A;  1SCW A;  1BLS A;  3Q81 A;  4D60 A;  3HLG A;  3TSG A;  3KO6 A;  4G3W A;  4JGQ A;  3IS2 B;  4KQD A;  1Y28 A;  4EV4 A;  2W0N A;  3LY4 A;  5HPI A;  5DTS A;  1S1Z A;  5CGS A;  4U3T A;  2PYR A;  3FV7 A;  4G3K A;  2ZC3 B;  1MC0 A;  1TS6 A;  3E2K A;  3A0S A;  4ZRR A;  4MCW A;  4R3A A;  3W8K A;  1NY0 A;  1LHY A;  3A3D A;  4OQI A;  2EWW A;  2R9W A;  4KZ4 A;  3ZHH A;  1DP6 A;  2A2L A;  1PWC A;  3RH8 B;  4HH3 A;  1JTD A;  4ETX A;  3V5M A;  1LLB A;  2ZMF A;  1E3U A;  3BFF A;  3O86 A;  3S7O A;  1VEU A;  3CZD A;  1FR1 A;  2EX8 A;  4BBV A;  3UMD A;  1ES5 A;  4O01 A;  4E6W A;  4BD0 A;  3B47 A;  2ZLY A;  4PMA A;  1P97 A;  4OQ0 A;  3NCK A;  3F1O B;  2WAF A;  1XJ6 A;  3IXH A;  4HP4 A;  2VX8 A;  3H9W A;  3S7N A;  3FG8 A;  2I9V A;  4CLC E;  3VSL A;  4FD8 A;  2XRO A;  3MKE A;  1T1B A;  3LIE A;  2EX2 A;  4Y0T A;  3BRM A;  3RJU A;  1K0K A;  2Y91 A;  1NJ4 A;  4DE0 A;  2W1T A;  3CHW P;  1W8Y A;  1BUL A;  3LFV A;  3FKV A;  5DTK A;  3PTE A;  1XA1 A;  3BYD A;  3VMA A;  5TBM A;  4KEN B;  5FI7 A;  3ICY A;  1RGZ A;  4DMZ A;  1QMF A;  5KMW A;  5HW3 A;  3Q7Z A;  2Y2H A;  3MQ0 A;  3IX8 A;  3NDE A;  4R4R A;  4P6Z M;  4H8R A;  4G3V A;  2O9C A;  4EET B;  4BL2 A;  2WK0 A;  4LRY C;  1UGU A;  3LEQ A;  2EXB A;  1FOF A;  1HZO A;  1YLT A;  4P6Z S;  3BQ8 A;  1S66 L;  2LB9 A;  4Y3I A;  2VV7 A;  2P04 A;  5G4Y A;  1XKZ A;  1E3U D;  3PBR A;  3BFE A;  4NG2 A;  5M1A A;  4MLL A;  4CLC A;  1IYP A;  3N6I A;  2JKT I;  3MJQ A;  4BLM A;  3B3X A;  3DTM A;  1OT9 A;  2O9A A;  1L0D A;  2HP5 A;  3LID A;  1NYM A;  2Q9N A;  4BBU A;  1XFQ A;  2Z6C A;  3G30 A;  2PBY A;  3NUL A;  1P9R A;  3A0R A;  3MZF A;  4UA9 A;  2P7J A;  4R6L A;  5FA7 A;  5HAP A;  4JPM A;  1NZO A;  4KZ7 A;  3LIC A;  1H5X A;  2K2N A;  3WRZ A;  4K0X A;  4JXG A;  1MBL A;  5E2F A;  4WEK A;  1F2K A;  4FH2 A;  4A5R A;  3ZNT A;  1KDW A;  4MMN A;  4ZJ1 A;  1X0O A;  5E2H A;  5BOH A;  1YSP A;  2ZOI A;  4I38 A;  2HJE A;  4GN2 A;  1D06 A;  2HDQ A;  1G6O A;  4OPY A;  1YM1 A;  3MR0 A;  4HHD A;  1JTG A;  3DBA A;  2IWC A;  4YFM A;  5FQQ A;  3MXQ A;  4MN7 A;  4CLC C;  1T19 A;  2EA9 A;  2W3D A;  4X6T A;  5J7E A;  1SKO B;  2VJW A;  2MJ6 A;  5AQA A;  5A8B A;  4ARZ B;  2D01 A;  3IX4 A;  3EEH A;  2H0T A;  4P85 A;  5HDC A;  1K6S A;  3GQZ A;  1KE3 A;  2E8I A;  1IYQ A;  3T4L A;  3WRT A;  2XEP A;  5LBR A;  4L9F A;  4N1X A;  1BSG A;  5FDS A;  3H82 B;  2J3W A;  1OPX A;  4JXW A;  4NEE D;  2V0U A;  4S2N C;  2B18 A;  1H8Z A;  4GHI B;  4YWZ A;  1UWP X;  5CTM A;  1PWG A;  3IH9 A;  4DRT A;  2JN7 A;  3H7W B;  3LI8 A;  5DTT A;  3KX0 X;  2V1A A;  3IT9 A;  4Z1W A;  4YOF A;  2PDR A;  3LIF A;  4ZTK A;  3MXS A;  5L09 A;  3VFH A;  2OV5 A;  1DP8 A;  4I39 A;  3LY3 A;  4UHU A;  4ZJ2 A;  4O8G A;  2ZMV A;  5FSR A;  3GEC A;  4LV2 A;  4GS9 B;  3JYI A;  4LV3 A;  4CJN A;  1TDG A;  3GR2 A;  1ZKJ A;  4PAU A;  3PAE A;  3U2A A;  3HUO A;  3MQQ A;  2C6W B;  2VGJ A;  1PIO A;  4X68 A;  1JWP A;  3ITB A;  2O0Y A;  3C38 A;  4O7D A;  2Y2Q A;  3T4J A;  4LFU A;  3M2K A;  4EBN A;  5CGX A;  4HY8 A;  1IFQ A;  2Y2I A;  2JKR M;  5EVI B;  3LYX A;  4KG2 A;  2ZM0 A;  3BJN A;  2BLS A;  1XX2 A;  5FQJ A;  3HLB A;  5HD5 A;  5J8X A;  4P6B A;  3D72 A;  4K91 A;  4IHQ A;  2FH5 A;  3BLM A;  5DFY A;  3UE1 A;  3R7W A;  2YKF A;  3BQA A;  3UDI A;  1ZHH B;  3PR6 A;  4R0Q A;  1OT6 A;  5CXW A;  2WGW A;  1XFN A;  3UE0 A;  2ZQC A;  2V1Z A;  3C4P A;  5DF9 A;  5HAI A;  4WEL A;  4GW9 A;  3T4Q A;  3B42 A;  2QKP A;  4HBT A;  4DXC A;  4KG6 A;  1XJ2 A;  1W5D A;  4WL9 A;  1L2S A;  4L9G A;  4ME4 A;  2BTF P;  5F1F A;  2ZC4 B;  5FI6 A;  3NOT C;  3BM6 A;  2ZC6 B;  4HP9 A;  3N8R A;  3G2Y A;  1WE4 A;  1OTE A;  2W27 A;  2XD1 A;  1ZG4 A;  3N4I A;  5EFW A;  1ES2 A;  2PBD P;  3VSK A;  4JLF A;  1ZTU A;  4FSF A;  1OTI A;  2KOI A;  1E25 A;  2OLV A;  4DKI A;  3OCL A;  4PHT A;  2V8F A;  4Z9Q A;  1YMX A;  4Q8I A;  4P87 A;  3EQV A;  2PU2 A;  1S0W A;  2Y79 A;  3IXD A;  3PBS A;  2VV8 A;  4GJ4 A;  5A90 A;  4L0L A;  5F83 A;  3UDX A;  1FR6 A;  4RQ9 A;  2P9V A;  2O99 A;  3A3J A;  1PFL A;  1KOU A;  3VOL A;  4EXO A;  1ERO A;  1N4O A;  2WKR A;  1Y54 A;  2ZQA A;  3VP1 A;  1KGF A;  4ZDX A;  3NOP C;  3AGD A;  2WGI A;  3FWL A;  4HIA A;  3CJM A;  1SKO A;  4F94 A;  1I2S A;  2L1M A;  1K55 A;  3NC8 A;  2EX6 A;  3QP1 A;  2B95 A;  3C5A A;  1KE0 A;  2E8J A;  1XGI A;  4JGO A;  1BLC A;  1MWR A;  2ZD8 A;  2L0W A;  3H82 A;  2WKI A;  3IBJ A;  3G34 A;  2K31 A;  2V20 A;  3T4S A;  3UME A;  1LI9 A;  5AVF A;  2OAQ 1;  5CGW A;  4OOM A;  3TRC A;  3QHY A;  1K54 A;  5L07 A;  4FH4 A;  1T1C A;  5I5L A;  4KUK A;  2UV0 E;  3H7W A;  4KG5 A;  4PM7 A;  2X01 A;  3VV4 A;  1S6R A;  2QYB A;  3KSF A;  4LV0 A;  1K56 D;  4DE1 A;  1CEG A;  5HAR A;  3ZG5 A;  4WF0 A;  3IF6 C;  2M7U A;  1NYY A;  3HCY A;  4O0P A;  3C2W A;  4E6X A;  1L0G A;  4GS9 A;  1L3L A;  1U60 A;  5DJU A;  2XK1 A;  4NXE A;  3U4L P;  2VLG A;  1NRF A;  3ZG7 B;  1LT0 A;  4N1H A;  4Q0J A;  4HOI A;  5E2E A;  1XJ3 A;  2QJ5 A;  1XJ4 A;  2Q9M A;  4XT2 B;  3OZH A;  2HJ9 C;  1M6K A;  1LL8 A;  2EFU A;  2X71 A;  4E3J A;  3KSI A;  3EOI A;  5EVI A;  2WUQ A;  1XA7 A;  1FQG A;  2GJ3 A;  5A91 A;  3UB7 A;  1K54 C;  4XXR A;  5EOE A;  4WZ5 C;  2AVX A;  1PI5 A;  3KYQ A;  4DE3 A;  4C6Y A;  4X1L A;  5E2G A;  1LSW A;  5EPH A;  4OON A;  1FIL A;  4GD8 A;  4IBR A;  4U0X A;  2EX9 A;  3VE4 A;  4X55 A;  4WBG A;  4UQI M;  4NET A;  3NDG A;  3V39 A;  3LCE A;  1RCJ A;  4UA7 A;  2HP6 A;  2DMW A;  3ZVT A;  4UQI S;  4Q0H A;  3Q1F A;  3HLW A;  3IBR A;  1UWN X;  5DFX A;  4E3L A;  2XD5 A;  4BQM A;  3LR4 A;  2OSU A;  3P09 A;  1PRQ A;  5F68 A;  2IWB A;  5HWV A;  3QP4 A;  4Y13 A;  3BFC A;  3HRE A;  3IXG A;  3OPP A;  4QHC A;  5L10 A;  3CIT A;  1EWZ A;  4JXV A;  1W63 Q;  2QWS A;  2ZM8 A;  3VP3 A;  4B4Z A;  5U47 A;  3P01 A;  3F1N B;  1NLZ A;  4OH0 A;  1RGY A;  4JF4 A;  3WS1 A;  3CPT B;  3SH9 A;  3QNC A;  2G7U A;  3VP0 A;  5EVI D;  3NHQ A;  4WYY A;  2XRN A;  4EES A;  5HDD A;  2KLI A;  3TW8 A;  3V3R A;  5CRF A;  3ITA A;  5AVE A;  3NOU C;  4OPQ A;  3W4Q A;  2M7V A;  1SHV A;  5IT5 A;  3FPV A;  5FAP A;  1KDS A;  1SDN A;  2FZ0 A;  1ERQ A;  4EUZ A;  1J9M A;  4R3J A;  3HBR A;  3IH8 A;  5TGF A;  5DKK A;  3UPN A;  4ZAM A;  3GDI A;  4GOG A;  1YLY A;  4OP5 A;  4GLQ A;  4IED A;  3CG5 A;  3MF0 A;  4ETZ A;  3N7W A;  1J3W A;  4BJP A;  5JYP A;  3JVV A;  1DJA A;  4X1M A;  2H28 A;  2Y2P A;  2B5R A;  3PBO A;  5GLB A;  3CAX A;  4QJG A;  2XLN A;  3CMZ A;  4UAA A;  4E3I A;  1YMS A;  2Y2L A;  4KQO A;  1BLP A;  3FZC A;  5L8M A;  4K0W A;  4MEZ A;  2QPN A;  1O07 A;  5AQB A;  5CHJ A;  2JKR I;  3DWZ A;  3LEZ A;  3NI9 A;  1K25 A;  4EEP A;  4R3B A;  1F98 A;  1BZA A;  3T4O A;  3K3D A;  3ZVW A;  4IVK A;  3OOV A;  5D3O A;  5E43 A;  2HF6 A;  2ZMA A;  4OOL A;  2V1B A;  2VK3 A;  4PM9 A;  1D7E A;  4FTX A;  5GLD A;  2ZQ8 A;  4HI4 A;  2I72 A;  4Y7P A;  1L0F A;  1H0M A;  3R4K A;  1N9O A;  1W63 M;  3M2J A;  4MN6 A;  5EOO A;  5IU1 A;  3S4X A;  4XUX A;  3S22 A;  1LL9 A;  4JKT A;  1AWI A;  2ZQD A;  4I3J A;  4DJ2 A;  5DF8 A;  5EE8 A;  3BY9 A;  4KZ8 A;  3PBQ A;  1OJ5 A;  4KQR A;  3RFB A;  2PD8 A;  1STZ A;  2XH9 A;  3ZCZ A;  1PZO A;  4B4X A;  1K4E A;  2GZA A;  2VGL M;  2A24 B;  5MC7 A;  3OLO A;  4HES A;  4S2M A;  3MZE A;  2Y55 A;  2XGN A;  1IYO A;  3BW6 A;  4KZ9 A;  2PT7 A;  4RX2 A;  4FCF A;  2VGL S;  3BFG A;  2V0W A;  3G6O A;  3IS2 A;  3L7H A;  1ODV A;  4II7 A;  3F1P B;  4JXS A;  5M18 A;  5HPF A;  4B88 A;  3V67 A;  2VV6 A;  3IF5 A;  2ZC7 A;  2QMI A;  3G4P A;  1IOU A;  1HD8 A;  4CQH A;  3E2L A;  1YLW A;  4S2I A;  5FAS A;  1MPL A;  1OME A;  1OTA A;  1ZC2 A;  1I5Q A;  3BEB A;  3BY8 A;  3E98 A;  5KSC A;  2EXA A;  5TJJ A;  5IHV A;  3IWO A;  2W3G A;  3NJA A;  4BWI A;  3GMW A;  2HZ5 A;  3O5Y A;  4EUV A;  3LI9 A;  3CLO A;  4JBF A;  3UN7 A;  3T1X A;  4GD6 A;  1GCE A;  5FDH A;  5KIZ A;  3IWQ A;  3GRJ A;  4KQQ A;  1P9W A;  3IQA A;  4WUJ A;  4N9K A;  1NWZ A;  3F1O A;  1TDL A;  1NRJ A;  4MBH A;  4IUK A;  1VET B;  4NXB A;  1IKG A;  4QPR A;  1G68 A;  4R4S A;  3GV9 A;  3FKW A;  2ZQ9 A;  3MS6 A;  2QHK A;  4IUH A;  2J9P A;  3HL9 A;  1PI4 A;  1HTZ A;  5JYO A;  4HJ4 A;  2XDM A;  4Y0O A;  3UO9 A;  2Y2J A;  4BD1 A;  4EQ1 A;  3ULF A;  4BL3 A;  1ONG A;  3LR0 A;  1G6A A;  3OBF A;  5GLA A;  5K5B A;  4I5S A;  2JHE A;  3IX3 A;  1MWS A;  2JKT M;  3MZD A;  1ACF A;  1CJF A;  3S1Y A;  4MDZ A;  1M40 A;  5HX9 A;  3M6H A;  3CI6 A;  2ACG A;  3LGO A;  1ONH A;  4BMW A;  5L2F A;  1H3Q A;  1YQS A;  2Y2M A;  1RP5 A;  1BYW A;  3A3E A;  4RA7 A;  3I7J A;  3HVF A;  1IEM A;  3G2Z A;  2LB5 A;  2ZL1 B;  4PM6 A;  2ZOH A;  2WZZ A;  5F5Y A;  3TOI A;  3HLC A;  1A0K A;  3L9K A;  3UB8 A;  3SZT A;  4LCM A;  5TR7 A;  4UA6 A;  2J3T D;  4H6J B;  1K56 A;  2GNX A;  1PNE A;  1T18 A;  2KDK A;  5AQ9 A;  4N9L A;  1IEL A;  1YT4 A;  4KZ3 A;  4N92 A;  1VEU B;  5FQM A;  2OOL A;  3SS4 A;  3RXX A;  1DJC A;  4R1G A;  4Y2F A;  4HBU A;  3OC2 A;  1XP4 A;  1PWD A;  3GTC A;  2HDS A;  3P98 A;  5FQI A;  4HH2 A;  1S67 L;  1H8M A;  1NXY A;  2VA0 A;  2OWJ A;  4F3L B;  4JGR A;  3T4T A;  3C8C A;  3E0Y A;  2JCH A;  2A24 A;  1JNU A;  4GNU A;  4HJ6 A;  2WKQ A;  3RTY A;  2OWH A;  3ZGA B;  4ARZ A;  2R78 A;  4LGW A;  2G2W A;  2W1T B;  1XXM A;  3IWI A;  5FL3 A;  5DF7 A;  2HV1 A;  1O7E A;  2JE5 A;  4QB8 A;  2X02 A;  2WAE A;  2V9A A;  4GHI A;  4BBT A;  2A49 A;  2D02 A;  2INW A;  2PYP A;  1YPR A;  1V9Y A;  3OPR A;  1MWT A;  2W3F A;  5TFQ A;  4LEN A;  4EU0 A;  3ZNY A;  3ZFZ A;  2ZQ7 A;  1AXB A;  4NXG A;  1G28 A;  4QD4 A;  2J7V A;  3G35 A;  2P08 A;  3ZG9 B;  2WKP A;  2IWD A;  1ALQ A;  4U0T A;  2DRW A;  4AFI A;  3UPP A;  3WS4 A;  4OLG A;  4CLC B;  5G18 A;  1Y4O A;  2R9X A;  1K57 A;  5CHM A;  1K55 C;  3B33 A;  1K4F A;  5EVE A;  3UNW A;  3BFD A;  1FCM A;  1G5U A;  1CEF A;  3PYP A;  5EM0 A;  2Z2L B;  5FQK A;  4HQA A;  1BLH A;  2BG1 A;  4YNR A;  3S7Q A;  3NEC A;  1VET A;  2RL3 A;  3V50 A;  2XFT A;  2Z6D A;  2VKS A;  1W7F A;  4Y5F A;  2KX6 A;  4FOF A;  1TS8 A;  1KGG A;  1OTD A;  1NZU A;  5HFO A;  3WS2 A;  4BEN A;  3HLE A;  1Q2Q A;  3E4O A;  4E3K A;  3MFD A;  3T12 B;  3OCN A;  3VE3 A;  3HLF A;  1YLP A;  3UDF A;  1K57 C;  4EBP A;  5CER A;  5GHZ A;  4DE2 A;  2JC7 A;  4OPR A;  1EW0 A;  4PKY G;  4MBK A;  3HJI A;  4E3O A;  1P0Z A;  1KE4 A;  4ESP A;  5M19 A;  1KGE A;  3MMH A;  5DVA A;  5EVI C;  1DRM A;  1NLY A;  2L4R A;  4GKU A;  3T4K A;  3TJZ C; 
#chains in the Genus database with same CATH homology
 2ZMA A;  5EVI B;  3LO7 A;  4OOL A;  1JWV A;  1EI5 A;  4KG2 A;  2WKH A;  2ZM0 A;  3UY6 A;  4KZA A;  4RYE A;  2ZC5 B;  4PM9 A;  2BLS A;  3C7V A;  4C75 A;  3O87 A;  5GLD A;  3EQU A;  2H5S A;  2ZQ8 A;  1WYC A;  1XX2 A;  4QU3 A;  2I72 A;  5FQJ A;  1K6R A;  4OVD A;  4D2O A;  3HLB A;  4Y7P A;  1L0F A;  4GZB A;  3VOY A;  3G31 A;  5J8X A;  2Z2M B;  1JVJ A;  2ZM2 A;  4P6B A;  5KSH A;  1PYY A;  1YLZ A;  3M2J A;  3AGF A;  5EOO A;  4K91 A;  5FQ9 A;  5GL9 A;  4DF6 A;  5CED A;  2WKE A;  3S4X A;  4XUX A;  3BLM A;  3S22 A;  1LL9 A;  4JKT A;  2C5W B;  4S2J A;  3UE1 A;  4YIN A;  3BLS A;  4ID4 A;  3MKF A;  2ZQD A;  1MXO A;  3UDI A;  5DF8 A;  5EE8 A;  3C7U A;  3PBN A;  1LL5 A;  4KZ8 A;  3PBQ A;  1E4D A;  4KQR A;  1BTL A;  4RVA A;  1YLJ A;  2XH9 A;  2HDR A;  1PZO A;  4R0Q A;  4QY6 A;  3ZCZ A;  1K4E A;  4B4X A;  3MBZ A;  4WZ5 A;  5CXW A;  2WGW A;  4M3K A;  3OPL A;  2P74 A;  4HES A;  4S2M A;  2ZQC A;  5F82 A;  1GHP A;  2V1Z A;  2Y55 A;  2XGN A;  1IYO A;  3MZE A;  4KZ9 A;  3C4P A;  3G32 A;  5DF9 A;  1BT5 A;  1ZG6 A;  4RX2 A;  5HAI A;  1GHI A;  4FCF A;  3VP2 A;  4WEL A;  3BFG A;  3ISG A;  2DCF A;  1GHM A;  1VM1 A;  1FCO A;  5EVL A;  4HBT A;  4JXS A;  1C3B A;  4JF5 A;  4OPZ A;  5M18 A;  4DXC A;  4GDB A;  4B88 A;  4KG6 A;  1GA0 A;  1W5D A;  2PU4 A;  3GVB A;  1L2S A;  3SH7 A;  2CC1 A;  3IF5 A;  2ZC7 A;  5F1F A;  2ZC4 B;  2QMI A;  3SS5 A;  3SS3 A;  3N8L A;  3PBT A;  5FI6 A;  3VOZ A;  1ESU A;  3G4P A;  5CEC A;  3BM6 A;  2XF3 A;  3PAG A;  2ZC6 B;  5EEC A;  1HD8 A;  3E2L A;  1YLW A;  3W4P A;  1XPB A;  4GB7 A;  1K38 A;  2A3U A;  3N8R A;  3G2Y A;  4S2I A;  1WE4 A;  1DJB A;  4PM5 A;  3UPO A;  2XD1 A;  5FAS A;  4IBX A;  1MPL A;  1ZG4 A;  2DNS A;  1QME A;  4X69 A;  1OME A;  2J8Y A;  3DWK A;  3N4I A;  1ZC2 A;  5GHX A;  1ES2 A;  4E3N A;  5FAT A;  3VSK A;  4JLF A;  1I5Q A;  4XUZ A;  3BEB A;  4OKP A;  2JBF A;  4Y0U A;  4FSF A;  1BUE A;  4JF6 A;  3WS5 A;  2OLU A;  1JWZ A;  5KSC A;  2EXA A;  1E25 A;  3AGE A;  2OLV A;  3IWO A;  1DY6 A;  3QNB A;  5IHV A;  4DKI A;  3OCL A;  2XR0 A;  2Y2G A;  3SOI A;  4Z9Q A;  1YMX A;  1H8Y A;  1WYB A;  3A3I A;  3GMW A;  3ZG0 A;  4Q8I A;  5A92 A;  4P87 A;  3EQV A;  2WGW B;  2PU2 A;  1S0W A;  3IXD A;  3PBS A;  1ESI A;  5A90 A;  4L0L A;  3VP4 A;  4JBF A;  1MY8 A;  5F83 A;  5FAQ A;  3V3S A;  3WWX A;  3UN7 A;  5KZH A;  4GD6 A;  3UDX A;  1GCE A;  1HVB A;  5FDH A;  1FR6 A;  3IWQ A;  1SCW A;  1BLS A;  2P9V A;  3GRJ A;  3Q81 A;  4KQQ A;  3IQA A;  3HLG A;  3A3J A;  3TSG A;  4N9K A;  3W4O A;  2WZX A;  1ERO A;  1N4O A;  4QY5 A;  1TDL A;  1Y54 A;  2ZQA A;  4MBH A;  3VP1 A;  4KZB A;  1KGF A;  4ZDX A;  4EV4 A;  1IKG A;  1G68 A;  4R4S A;  3GV9 A;  1PZP A;  3AGD A;  2WGI A;  2XFS A;  3FKW A;  3LY4 A;  3FWL A;  5DTS A;  5I94 A;  2ZQ9 A;  5CGS A;  4U3T A;  3CJM A;  2FFF B;  4F94 A;  1I2S A;  3FV7 A;  3FYZ A;  2J9P A;  3HL9 A;  1PI4 A;  1K55 A;  3IXB A;  3NC8 A;  1HTZ A;  2ZC3 B;  2EX6 A;  1W79 A;  3E2K A;  5JYO A;  3C5A A;  3OPH A;  4LV1 A;  1KE0 A;  2Y2O A;  3W8K A;  4PM8 A;  2XDM A;  2Y59 A;  1NY0 A;  4WZ4 A;  4Y0O A;  1LHY A;  3A3D A;  1ES4 A;  3UO9 A;  4WM9 A;  4OQI A;  4IVI A;  1CK3 A;  2Y2J A;  4BD1 A;  1XGI A;  2R9W A;  1PW8 A;  1BLC A;  4KZ4 A;  4R23 A;  4BL3 A;  1MWR A;  1ONG A;  1G6A A;  2ZD8 A;  5GLA A;  5HAQ A;  3ZHH A;  2WKI A;  3G34 A;  2V20 A;  1LI9 A;  1PWC A;  3Q7V B;  1MWS A;  5EUA A;  4S2N A;  3MZD A;  5CGW A;  4OOM A;  4OQG A;  3S1Y A;  1JTD A;  3V5M A;  1M40 A;  1LLB A;  3QHY A;  1K54 A;  4S2L A;  2FFY A;  3UE0 A;  4FH4 A;  1E3U A;  3BFF A;  3O86 A;  1FSY A;  3GSG A;  3CZD A;  5HX9 A;  4KG5 A;  1FR1 A;  4PM7 A;  3M6H A;  2EX8 A;  2QZ6 A;  2X01 A;  4X56 A;  1S6R A;  1ES5 A;  1KVM A;  3DW0 A;  5FAO A;  2P9V B;  3O88 A;  1N9B A;  2G2U A;  4E6W A;  4BD0 A;  4LV0 A;  2ZLY A;  1K56 D;  1ONH A;  4PMA A;  4DE1 A;  1CEG A;  4OQ0 A;  5HAR A;  3ZG5 A;  4E3M A;  3NCK A;  5L2F A;  4S2P A;  2WAF A;  3IF6 C;  1Z6F A;  1NYY A;  1YQS A;  2Y2M A;  1RP5 A;  4S2K A;  3IF6 B;  4OOY A;  1L0G A;  4E6X A;  3IXH A;  1U60 A;  2XK1 A;  3A3E A;  3N8S A;  3I7J A;  4RA7 A;  3HVF A;  1IEM A;  3G2Z A;  3O3V A;  1NRF A;  3ZG7 B;  4N1H A;  3UE3 A;  4PM6 A;  2WZZ A;  3TOI A;  3HLC A;  3VSL A;  2EFX A;  1IKI A;  4FD8 A;  5E2E A;  1XGJ A;  3MKE A;  4KZ6 A;  1PW1 A;  3BEC A;  1LI0 A;  2EX2 A;  2Q9M A;  4Y0T A;  3BRM A;  3RJU A;  3OZH A;  1M6K A;  2EFU A;  2Y91 A;  1NJ4 A;  4DE0 A;  2Y2K A;  3D4F A;  1W8Y A;  4LCM A;  1BUL A;  2J9O A;  5TR7 A;  5A93 A;  5GHY A;  4DDY A;  2X71 A;  4E3J A;  4EWF A;  3FKV A;  5DTK A;  5EVI A;  3PTE A;  1XA1 A;  2WUQ A;  1XA7 A;  3BYD A;  1FQG A;  1K56 A;  4KEN B;  4MBF A;  4UA6 A;  5FI7 A;  3IHA A;  3VMA A;  5A91 A;  4EQI A;  1K54 C;  1RGZ A;  4P0M A;  5AQ9 A;  4XXR A;  5FI2 A;  5CHU A;  5EOE A;  4HEF A;  1QMF A;  2HPB A;  5KMW A;  4N9L A;  1IEL A;  5HW3 A;  4WZ5 C;  3Q7Z A;  3NBL A;  1YT4 A;  4KZ3 A;  4N92 A;  5FQM A;  1PI5 A;  2Y2H A;  3NDE A;  3NY4 A;  1CI8 A;  4R4R A;  3Q07 A;  4WEJ A;  4C6Y A;  4DE3 A;  4H8R A;  3SS4 A;  3RXX A;  4BL2 A;  2WAD A;  2WK0 A;  5E2G A;  1DJC A;  4R1G A;  5CTN A;  4HBU A;  5EPH A;  3OC2 A;  1XP4 A;  1PWD A;  2EXB A;  3GTC A;  1FOF A;  4GD8 A;  1HZO A;  2XQZ A;  4IBR A;  4OON A;  4U0X A;  1YLT A;  2HDS A;  3P98 A;  5FQI A;  1FSW A;  2EX9 A;  4C3Q A;  4X55 A;  4WBG A;  4NET A;  5GLC A;  3NDG A;  1XKZ A;  3V39 A;  3LCE A;  1NXY A;  1RCJ A;  4UA7 A;  2HP6 A;  1E3U D;  3PBR A;  1VQQ A;  2JCH A;  3BFE A;  3HUM A;  5M1A A;  4MLL A;  3ZVT A;  4GNU A;  1IYP A;  3N6I A;  3Q1F A;  3ZGA B;  2HP9 A;  2WGV A;  3TG9 A;  3HLD A;  4BLM A;  3HLW A;  3ZDJ A;  2XD5 A;  3B3X A;  3DTM A;  4E3L A;  4BQM A;  1ERM A;  2G2W A;  1L0D A;  5F1G A;  2HP5 A;  2OSU A;  1XXM A;  1NYM A;  2H10 A;  3IWI A;  3P09 A;  2Q9N A;  2IWB A;  3VFF A;  3G30 A;  2PBY A;  5DF7 A;  1O7E A;  2JE5 A;  3M6B A;  4QB8 A;  3WS0 A;  3BFC A;  3HRE A;  3IXG A;  3OPP A;  2X02 A;  3MZF A;  4S2O A;  4UA9 A;  2WAE A;  4QHC A;  2HDU A;  2UWX A;  5FA7 A;  2WYX A;  4NK3 A;  5HAP A;  1EWZ A;  4JPM A;  1NZO A;  4JXV A;  4KZ7 A;  2Y2N A;  1H5X A;  2ZM8 A;  3WRZ A;  3SH8 A;  2A49 A;  3VP3 A;  4B4Z A;  4K0X A;  4JXG A;  4WMC A;  5HL1 A;  1MBL A;  5U47 A;  4WEK A;  5E2F A;  4LCL A;  3OPR A;  4FH2 A;  1ES3 A;  3RXW A;  1MWT A;  5TFQ A;  4GDN A;  4LEN A;  4OH0 A;  4A5R A;  1RGY A;  2GDN A;  4JF4 A;  4ZBE A;  3WS1 A;  3ZNT A;  1CI9 A;  3ZNY A;  1KDW A;  3SH9 A;  4ZJ1 A;  3ZFZ A;  2ZQ7 A;  1AXB A;  5E2H A;  5BOH A;  2Y4A A;  3QNC A;  1SDE A;  4QD4 A;  3VP0 A;  2J7V A;  3G35 A;  1I2W A;  4GN2 A;  5EVI D;  2HDQ A;  4OLD A;  4OPY A;  3ZG9 B;  1YM1 A;  4WYY A;  5CEB A;  4KZ5 A;  1FCN A;  2IWD A;  4EBL A;  1ALQ A;  4U0T A;  1JTG A;  2DRW A;  2IWC A;  4ZJ3 A;  3V3R A;  4YFM A;  5CRF A;  1GA9 A;  3ITA A;  5FQQ A;  3UPP A;  3WS4 A;  4OLG A;  5AQ7 A;  5G18 A;  2R9X A;  4OPQ A;  1K57 A;  2ZJ9 A;  1SHV A;  3HUN A;  1K55 C;  3MXR A;  4X6T A;  5CHM A;  5FAP A;  1KDS A;  1SDN A;  1K4F A;  5AQA A;  3NIA A;  3UNW A;  4CPK A;  3BFD A;  1FCM A;  1KVL A;  2H0T A;  4P85 A;  1ERQ A;  1K6S A;  3GQZ A;  1KE3 A;  1L0E A;  2E8I A;  1CEF A;  4EUZ A;  1J9M A;  3ZG8 B;  4R3J A;  2Z2L B;  3HBR A;  1MKI A;  3IH8 A;  2H0Y A;  5FQK A;  5TGF A;  1IYQ A;  3WRT A;  2RCX A;  3UPN A;  2XEP A;  1BLH A;  4ZAM A;  2BG1 A;  4GOG A;  3Q82 A;  1SKF A;  4N1X A;  1BSG A;  2VGK A;  1MWU A;  4JXW A;  2RL3 A;  1YLY A;  4S2N C;  3V50 A;  4OP5 A;  1H8Z A;  4OQH A;  2XFT A;  4IED A;  3CG5 A;  1W7F A;  3N7W A;  4BJP A;  3IHB A;  5CTM A;  5JYP A;  1PWG A;  3IH9 A;  2V2F F;  4DRT A;  1IYS A;  1DJA A;  1KGG A;  2Y2P A;  2B5R A;  4PPR A;  1NZU A;  5DTT A;  3C4O A;  3PBO A;  5HFO A;  5GLB A;  3WS2 A;  4QJG A;  4BEN A;  3HLE A;  1Q2Q A;  3IT9 A;  2XLN A;  3A3F A;  4E3K A;  1W8Q A;  3CMZ A;  3MXS A;  4UAA A;  3MFD A;  1YMS A;  4ZTK A;  2OV5 A;  3VFH A;  4E3I A;  2Y2L A;  3LY3 A;  4KQO A;  4UHU A;  4ZJ2 A;  3OCN A;  4X53 A;  1BLP A;  3FZC A;  3Q7V A;  2QPN A;  4K0W A;  4MEZ A;  3HLF A;  1O07 A;  4LV2 A;  1YLP A;  3JYI A;  5FSR A;  3UDF A;  4LV3 A;  4WMC D;  4CJN A;  5AQB A;  5CHJ A;  1TDG A;  3GR2 A;  3DWZ A;  1K57 C;  1ZKJ A;  3PAE A;  4EBP A;  5CER A;  3LEZ A;  5GHZ A;  2JC7 A;  4DDS A;  3NI9 A;  3HUO A;  4OPR A;  3W4Q A;  4DE2 A;  2C6W B;  1K25 A;  4RX3 A;  2VGJ A;  1PIO A;  1Q2P A;  1JWP A;  4X68 A;  3ITB A;  4OP8 A;  4R3B A;  4O7D A;  2Y2Q A;  4MBK A;  1TVF A;  3M2K A;  4E3O A;  5CGX A;  4EBN A;  1KE4 A;  1TEM A;  1BZA A;  3ZVW A;  4MNR A;  5M19 A;  4IVK A;  1KGE A;  5DVA A;  5EVI C;  4GKU A;  5D3O A;  5E43 A;  4DXB A;  2Y2I A;  3IF6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...