1YSQA

The crystal structure of transcriptional regulator yaij
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
187
structure length
181
Chain Sequence
SLNIIHIAAPHLEALNIATGETINFSSREDDHAILIYKLEPTTGMLRTRAYIGQHMPLYCSAMGKIYMAFGHPDYVKSYWESHQHEIQPLTRNTITELPAMFDELAHIRESGAAMDREENELGVSCIAVPVFDIHGRVPYAVSISLSTSRLKQVGEKNLLKPLRETAQAISNELGFTAITG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Gene regulation
molecule keywords HTH-type transcriptional regulator yiaJ
publication title Structural study of effector binding specificity in IclR transcriptional regulators
rcsb
source organism Escherichia coli
total genus 64
structure length 181
sequence length 187
ec nomenclature
pdb deposition date 2005-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01614 IclR Bacterial transcriptional regulator
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1ysqA00
1ZTUA 5HSQA 4MN7A 2W1RA 1STZA 2O9CA 3LFVA 5HPFA 2K2NA 3TRCA 4IJGA 4PAUA 2KOIA 1MKMA 3MMHA 5LBRA 2O99A 3NOUC 3NOPC 3C2WA 4O01A 3IBRA 3NHQA 2XSSA 4Y5FA 2ZMFA 5HPIA 4ZRRA 4FOFA 4EUVA 1YKDA 1YSQA 4RQ9A 3CI6A 4MCWA 3RFBA 2O0YA 3S7NA 5TJJA 3S7OA 3D3OA 5DFXA 3IBJA 4ETXA 5DFYA 2OOLA 3DBAA 4ME4A 4Q0HA 2LB5A 3EEAA 4LRXC 5I5LA 2HGVA 3HCYA 2W3HA 2IA2A 3KO6A 4LRZE 4G3KA 2O9BA 2B18A 1MC0A 4O0PA 4YNRA 3S7QA 4O8GA 4BWIA 2VEAA 1TD5A 2W3GA 3OOVA 4LRYC 2W3FA 3MF0A 1YSPA 2W1TB 3E98A 2W3EA 1VHMA 2KLIA 2LB9A 2G7UA 3E0YA 2M7VA 5C5KA 3CITA 4Y2FA 4IUHA 3KSIA 2VZWA 4Q0JA 4MDZA 2Y8HA 5AJGA 4CQHA 5L8MA 3K2NA 1TF1A 4EU0A 3OBFA 2VKSA 2Y79A 4R6LA 2W1TA 4E04A 3BJNA 3R4KA 4IUKA 3O5YA 4GW9A 4R70A 4YOFA 5K5BA 2VJWA 1F5MA 2O9AA 4Y3IA 4MMNA 4QPRA 3MQ0A 3VV4A 3KSGA 4Z1WA 3ZQ5A 2GX5A 2XROA 5HL6A 2M7UA 4DN0A 3S7PA 3KSHA 4G3WA 4DMZA 2W3DA 4ETZA 4G3VA 4Q0IA 4GLQA 3KSFA 2QYBA 2K31A 3W2ZA 3G6OA 3NOTC 2XRNA
chains in the Genus database with same CATH superfamily
4WZ5A 3LICA 2W1RA 3BEBA 2O9CA 3CAXA 1FSWA 2K2NA 3BY8A 5TR7A 1TS0A 3RTYA 1FR1A 1KE3A 3IS2B 4P6ZM 3TSGA 3IXBA 4Y5FA 3CPTB 3BFCA 1YSQA 2L1MA 2OWJA 4I3JA 2C5WB 4JGRA 3SZTA 2JKTI 1SCWA 2H28A 3EEAA 5AQ9A 4F94A 4S2JA 1OJGA 3CMZA 5EFWA 1AWIA 4YNRA 2VV7A 2JBFA 5I94A 4Y0OA 5J3WA 4B93A 4P87A 3UN7A 3VP4A 2WKQA 1S6RA 4D60A 3CLOA 1XJ4A 3BM6A 4OPZA 3ZG8B 3P01A 4EESA 2V0WA 2J8YA 2WK0A 1K57C 1OTEA 4EETB 1JTGA 3CUEA 4GW9A 1LI0A 3T1RA 4BENA 4R70A 4YOFA 4JKTA 1NXYA 1L0GA 3LIDA 4RX2A 1L0DA 2Y2NA 2P08A 3NDGA 4Z1WA 1GA9A 5DF8A 4LV3A 1PW1A 4Z9QA 3VOZA 1HVBA 4I39A 2PYRA 4X56A 2NUPC 2H5SA 3BFEA 5FQMA 2D02A 1STZA 4C6YA 5HPFA 4XT2B 1S67L 1TS7A 1K0KA 2L0WA 1WA9A 3UO9A 1CJFA 4ZTKA 1CF0A 4BLMA 1X0OA 3GTCA 3GVBA 4LV2A 4F3LB 1Y54A 3GRJA 5FI7A 4JBFA 3BFGA 5GHXA 2EFXA 3ZYTA 1OMEA 1ONGA 1N9LA 3AGFA 3FYZA 4WEKA 3C8CA 2VEAA 3O86A 4HESA 5JYOA 3E98A 5L09A 3EGDC 4N9LA 5IHVA 5J8XA 1D1JA 2G7UA 3V39A 3LUQA 4Y17A 2FH5A 5E2GA 3KSIA 4OPYA 1NRFA 2QJ7A 1LSWA 1SHVA 3UY6A 5AJGA 2Y2GA 2Y2IA 4K08A 4P85A 5GLAA 3BJNA 2P04A 2EX8A 3O5YA 3ZG0A 3UPPA 4CLCE 3A3FA 5A90A 3IXHA 4MMNA 3BWLA 4Q8IA 1K57A 1N9NA 5M19A 1XA7A 4EW7A 2GX5A 1H8MA 4RVAA 5AVFA 2B02A 3FV7A 3LIAA 3C5AA 4Y13A 1ESIA 4Y0TA 2OAQ1 4DMZA 2WADA 4WEJA 3ZVWA 2XFTA 5KSHA 1MWTA 4X1MA 1DJBA 1PI5A 2PAVP 4OQIA 2FFFB 2AVXA 5FQ9A 1AXBA 1YPRA 1T1BA 3L7HA 3UPNA 5DKKA 2JCHA 3E4OA 4IEDA 4PAUA 3MMHA 5LBRA 3OCLA 4AFIA 4LCMA 5HPIA 2PHYA 3FC7A 1LLBA 3EGXC 3N6IA 3UB9A 3A3EA 3HJKA 3D3OA 3D9YA 4R3JA 3VFHA 3LI8A 4S2NC 3H9WA 4PPRA 3N7WA 1MKIA 5CGSA 3K3CA 1ZC2A 4LRZE 4D2OA 4G3KA 2O9BA 2VGLM 3LR0A 4B4ZA 3S7QA 1NLZA 4K91A 2I72A 3LIEA 1S1YA 1ZHHB 3HVFA 3BQAA 3SH8A 2HPBA 3MQQA 1YT4A 2DMWA 4K0WA 1M6KA 3BLMA 5CEBA 5FQJA 3CITA 4FH2A 4IUHA 1N9OA 3VE4A 5GHZA 3MZEA 3AGDA 3B3XA 3IHAA 2Y79A 3TG9A 2W1TA 3KX0X 1K25A 3VOYA 2X01A 4OKPA 5EVIC 4KUKA 1N4OA 4PM7A 3FG8A 2G2WA 2R78A 2PBDP 5KSCA 4Q0IA 5G4ZA 3Q1FA 4S2IA 3F1OA 5FAOA 3G30A 3OC2A 3C4OA 4BD0A 1BLPA 1XPBA 5A93A 1L0EA 3RXWA 1YLTA 1FOFA 2JE5A 2Y59A 4X1LA 1YMXA 1RP5A 4MLLA 4XUXA 2O99A 4B9OA 3A0SA 3IBRA 3T1QB 5FI2A 5HWWA 1Q2QA 1IOUA 4HOIA 4FOFA 3OZHA 2HP6A 1LSVA 4YINA 2J3TD 2J7VA 4JXGA 3MJQA 4L9GA 4JF4A 1NRJA 1ZG6A 1PNEA 4OQGA 5I5LA 1MWRA 2W3HA 3D4FA 3FKWA 4JLFA 5EPHA 4S2NA 4OOYA 5FQQA 4ZAMA 4PM8A 5HDCA 1PRQA 3UE3A 3H7WA 2VGLS 3C38A 5C5KA 3BY9A 3UDFA 1TDLA 2OWHA 2EX6A 3V3SA 4KG2A 5FDSA 4YWZA 3N8SA 1MZUA 3B47A 3LEZA 3IQAA 2VV8A 1PYYA 4I5SA 1ACFA 4S2MA 3QP6A 1E3UA 4HNBA 5EM0A 3ICYA 1PWGA 2L4RA 5FDHA 1IFQA 1NWZA 4NEED 2VA0A 3IH8A 3W8KA 5EVIA 2HP9A 3K3DA 1EROA 4ZJ3A 1WYCA 2KDKA 2P74A 3ZG7B 3WWXA 3I7JA 1M40A 3H82B 2JN7A 1FQGA 1KDSA 1GA0A 3PBRA 1ZTUA 2G2UA 3UMEA 4GDBA 4HI4A 1K38A 2H0TA 2QMIA 3TRCA 1PIOA 4MBHA 4GZBA 2Z2LB 4OPQA 4WMCA 2PU4A 5CGXA 2ZC4B 3G2YA 2QJ5A 5M1AA 1KOUA 2Y55A 4KZBA 2PYPA 4EXOA 3PBNA 4ETXA 2XD5A 1ODVA 3T1XA 4EUZA 3PBQA 3MXQA 2A2LA 1YLWA 3LIFA 3OPLA 5CXWA 2IA2A 3BFDA 1H8YA 3MZDA 2HF6A 4MN5A 2Y2QA 3IH9A 1E4DA 4EBLA 3A0RA 3DTKA 4WLAA 1OTIA 3HLBA 2W1TB 4WZ4A 4DF6A 4HY8A 1BULA 1LL5A 3LEQA 4PHTA 4WYYA 4U0XA 5AQAA 3JYIA 1Y28A 1MY8A 2J3WA 4DXCA 4UHUA 1TF1A 3UE1A 2W0NA 3OBFA 5KZHA 4OP5A 3N8LA 3S1YA 3VFFA 4E04A 2XD1A 5FASA 3HLCA 1ESUA 3Q81A 1K56A 3F1OB 2BLSA 4JGQA 2A24A 2XFSA 1JTDA 4R3BA 4N1HA 1S4RA 2WAEA 2WZXA 1F2KA 1CEFA 1XGJA 3S22A 3UB5P 3WRZA 2EX2A 5HWTA 3MXRA 3QP5A 5CTMA 5HSQA 4WM9A 5GLBA 5BOHA 3G2ZA 3TW8A 1ONHA 4EV4A 4GCZA 4S2PA 4FD8A 2V1ZA 4LV0A 2ZL1A 5HAPA 1SDNA 4E3OA 3S7OA 3T4JA 5KMWA 1Z09A 2OOLA 3DTMA 4PM5A 3H7WB 3NC8A 4ME4A 1NYMA 2HP5A 4P0MA 3HJIA 1UGUA 2RCXA 3L9KA 2VK3A 4LPZA 3HUOA 4OONA 4PM9A 2CMNA 4L0LA 1KE0A 1D7EA 3HUMA 4QD4A 1IYOA 1NY0A 3WS2A 3NECA 4B4XA 2GDNA 2J9OA 4CLCC 5HARA 1XFQA 3ZGAB 3SW1A 4MDZA 2PR6A 1K54C 3EOIA 4CQHA 3LGOA 5EVIB 4IVIA 2VKSA 2ZQCA 1MWUA 2WKRA 3C7VA 4XXRA 3IXGA 1G5UA 4KENB 2ACGA 5TBMA 4EEPA 3ZQ5A 5DTTA 4HP9A 2OLUA 2EXBA 2Y2KA 2HZ5A 4IBXA 1IYSA 3UB7A 3BQ8A 2WGIA 1H0MA 1FCNA 1HD8A 1LHYA 2XRNA 4Y0UA 2OV5A 3O88A 2QZ6A 2HDUA 5HW3A 4KUOA 2XK1A 5E2EA 1H5XA 3SOIA 3IF5A 1OTAA 3NHQA 4BL2A 1K55C 2C6WB 1Q2PA 1I2WA 3MKFA 2VLGA 4QY5A 4EUVA 4MCWA 3UB8A 4UEYA 2DRWA 5JYPA 4IHQA 3T4KA 4JXVA 3IHBA 5HFOA 1CI9A 4X6TA 2ZM2A 2EA9A 3T4TA 4KG5A 2GJ3A 1SDEA 1ES4A 5E2FA 4O8GA 1KVLA 2Y4AA 2WGWB 2XEPA 3MF0A 1TEMA 1FILA 1FCMA 1XKZA 1PWCA 3SS5A 4E3LA 5FSRA 4BD1A 1VEUA 2BTFP 3G32A 1OTDA 3VP2A 2A24B 1P9WA 1WYBA 2WGVA 2XF3A 2Y8HA 1A0KA 4CLCA 5F68A 4EU0A 3JVUA 3OLOA 1T1AA 3R4KA 3OPPA 2NUTC 4NETA 1K54A 4X53A 4HP4A 3LR5A 5F6AA 2Y2MA 4OP8A 4DXBA 1F9IA 3P7NA 4ESPA 3HREA 2J3TC 5EUAA 3FKVA 3KSHA 4R1GA 2YKFA 4ETZA 4G3VA 1IYQA 4K0XA 2ZL1B 3VP0A 1PI4A 3UDXA 1J3WA 4GD6A 4I38A 5GLDA 4OLGA 3ZDJA 1JVJA 4UA9A 1S0WA 2Z2MB 1C3BA 1G6AA 4KQDA 4I3AA 4ZRRA 4PKYA 5J7EA 3S7NA 1XJ6A 5TJJA 5A92A 2XQZA 3GV9A 2EXAA 3DBAA 2R9XA 4GOGA 1K55A 3F1NA 5FEFA 3S4XA 4NXGA 2B18A 1LT0A 3W4QA 3CHWP 4BWIA 1FIKA 4E3MA 5IU1A 3T12B 3CWFA 4KQQA 3H82A 5FQKA 1QMFA 2Y2LA 1W63M 1S4SA 5IT5A 5TBMB 1RGYA 1K4EA 3T1SA 2YKHA 3K2NA 3MQOA 3ITBA 1MBLA 1TVFA 4DJ2A 3LY3A 4IVKA 2XA7S 2A49A 4R4RA 3MSHA 4PKYG 2XGNA 2I9VA 4M3KA 2Z6DA 5G4YA 3KSGA 2EFUA 3BECA 5DJUA 1NLYA 4XUZA 1LSXA 1ES2A 4X69A 4OOMA 1IKGA 2GZAA 4UAAA 1XJ2A 4HQAA 2ZLYA 3JPUA 4OOLA 3UMDA 3WS0A 2PDRA 3G6OA 5L2FA 4BMWA 3FPWA 2HDRA 3HBRA 3LFVA 4OPRA 1O07A 4HEFA 3OPHA 3WRTA 3SH7A 4EWFA 4OH0A 4C3QA 3E2KA 3IX4A 1BYWA 3VE3A 1BUEA 1V9ZA 3PYPA 1OTBA 1VEUB 3CJMA 5CERA 1L3LA 4NKPA 5F1FA 3NDEA 4WUJA 3VMAA 3JVVA 1BSGA 4CLCB 5GHYA 2W3EA 5HD5A 4ZJ2A 3E0YA 1XFNA 2PRFA 4EQ1A 3T4OA 5CHUA 1VM1A 2H0YA 3A3DA 1GSVA 2HV1A 1ES5A 3UB6A 4GKUA 2DNSA 2ZMAA 1S1ZA 4NXFA 1OT9A 1GHIA 4LFUA 3R7WA 3BYDA 3KYZA 5KIZA 1SKOB 3MS6A 1ES3A 1OPXA 2XLNA 1YLZA 4IBRA 4I3IA 4L9FA 3GMWA 3T4LA 1XGIA 3S7PA 3FZCA 3V67A 4GLQA 5U47A 5HAIA 4H6JB 1ERQA 2K31A 3NOTC 1MXOA 3G31A 2ZMVA 4S2KA 3RXXA 4EQIA 5FI6A 2IWBA 4O7DA 2V8FA 3ZFZA 3F1NB 4DE0A 3N8RA 2IWDA 2KOIA 3P98A 3VP3A 3NOUC 3C2WA 1YAXA 5AQ7A 3D72A 4MN6A 3ZG9B 1YKDA 5FATA 1KGEA 1EWZA 1ZKJA 4BBVA 2ZJ9A 3E2LA 1YLPA 1IYPA 4MNRA 2HGVA 4ID4A 3KO6A 3W4PA 4O0PA 3QP1A 4JXWA 1UWPX 2Y2HA 3M6HA 1TD5A 1HTZA 2QWSA 2W3FA 1BLSA 3DWKA 1ALQA 4HJ4A 3Q82A 5EOOA 2JKRI 3PAGA 2WZZA 2FZ0A 3QP4A 4Y2FA 3IF6C 1PFLA 1OJ5A 3CZDA 4LCLA 3E4QA 4WZ5C 3GSGA 3HLWA 4PMAA 5EE8A 3ZVTA 1F98A 4GD8A 4KZ8A 3ZHHA 3GDIA 1E3UD 2VJWA 3DTEA 5HAQA 4HIAA 4DE1A 3C30A 3GQZA 3LYXA 4E6WA 2XROA 1PW8A 3PBOA 2Y2JA 3MKEA 4R0QA 5EVID 2X02A 3LCEA 2WGWA 5DJTA 4KG6A 2PD8A 3NI9A 2ZQAA 3B42A 3U2AA 3W2ZA 2JKFA 2QHKA 2XR0A 2WKEA 1S66L 1XA1A 1HLUP 1YLYA 4IJGA 3ISGA 1T1CA 4WMCD 1JNUA 1YQSA 4L9EA 3ITAA 5CECA 3ZNTA 3MFDA 4X25A 1FCOA 5FAPA 3CUEC 1U60A 4LRXC 1DJAA 4MBFA 1CEGA 3IWQA 5AQBA 2ZD8A 5F82A 2HDSA 3NCKA 2HJ9C 1P0ZA 3R7WB 2ZC6B 4QJGA 4E3JA 3M2KA 4B88A 4BBUA 2J9PA 1VETA 1NYYA 3C4PA 1CK3A 2ZQ8A 3TJZC 4QY6A 3IX8A 3N4IA 3PBTA 4WN5A 2EWWA 4HJ6A 3B33A 4U0TA 4FSFA 2V20A 4QPRA 3TOIA 5L10A 1K56D 1HZOA 4GJ4A 2W27A 3SS4A 1W63Q 5D3OA 1W8YA 1YMSA 3V3RA 1IKIA 1NJ4A 1GHPA 3C7UA 4GHIA 3V50A 3PTEA 3FPVA 2W3DA 3GECA 4WBGA 4Y15A 5CTNA 2V0UA 1IEMA 4EBNA 4U3TA 3GR2A 4HH3A 3PR6A 1XXMA 3AGEA 2JHEA 2BG1A 1LL9A 4RA7A 4HHDA 1JWPA 1GSXA 2UWXA 1SKFA 3IXDA 2WKHA 4DE3A 5MC7A 4KZ9A 4FCFA 2WYXA 3DWZA 3M2JA 4QHCA 2Z6CA 4S2OA 4RQ9A 3IBJA 1O7EA 4UQIM 2Q9NA 2LB5A 5CGWA 4P6BA 4PM6A 4YFMA 4KZ4A 1MC0A 4HBTA 4KZ7A 3UPOA 2B5RA 4E3NA 4LV1A 1YSPA 3A3IA 1BLCA 2RL3A 3VOLA 5HX9A 3QHYA 1WE4A 2ZC5B 5L07A 1ERMA 4E3IA 4KQRA 4CJNA 2HJEA 5CRFA 1VQQA 2FFYA 3TE8A 3O87A 4EEUA 5K5BA 1F5MA 2V8CA 4Y3IA 1L0FA 1RCJA 4OQHA 5F5YA 5GLCA 1TS6A 1G28A 3MFXA 2XA7M 5HL6A 5J4EA 4N9KA 5EECA 2B95A 1N9BA 3EWKA 4S2LA 3PAEA 2ZQ7A 4HH2A 3FWLA 4N92A 3BW6A 2H10A 1XP4A 3PHYA 3IWOA 2VGKA 4NG2A 4E3KA 3Q7VA 4GN2A 1E25A 4UA6A 2JKGA 2V1AA 4P6ZS 2WUQA 3E4PA 1ZG4A 2WAFA 5F1GA 2HDQA 5FAQA 5EV0A 3KYEA 5HDDA 1H8ZA 4RYEA 2A3UA 3G34A 4X55A 4KZ5A 1RGZA 4KZ6A 5DVAA 1EI5A 4JXSA 1SZVA 3SS3A 2ZOIA 1SKOA 3Q7ZA 5FA7A 1K6SA 5DFYA 4Q0HA 3SH9A 1VETB 3HUNA 3OCNA 3NULA 4N1XA 1QMEA 3OOVA 4H6JA 4UQIS 4DE2A 3NY4A 5CHMA 3IF6B 3WS4A 1KGFA 3HLDA 1DRMA 3U4LP 1XX2A 4JGPA 4JPMA 2PR5A 2VZWA 4E6XA 3HLGA 3P09A 2ZQDA 1FR6A 4LENA 4GHIB 4EBPA 5L8MA 1LL8A 3VP1A 4CLCD 5HD3A 4R23A 4R6LA 1G6OA 2ZM0A 4WL9A 3T4SA 1Y4OA 3MQ0A 3RH8B 4DRTA 4UA7A 1TS8A 1LI9A 3NIAA 3VV4A 2E8JA 1PZPA 2Y2PA 5F69A 3HLEA 5M18A 3LI9A 2R9WA 4DN0A 1CQAA 2M1CA 4X68A 3LR3A 1MPLA 4A5RA 2PU2A 1NZOA 3DW0A 3A0VA 4FUWA 4KQOA 5A8BA 2VX8A 3PBSA 4DDYA 3BRMA 3HLFA 5CX7A 1GCEA 4NK3A 4QB8A 3QNCA 4O01A 3MXSA 1I2SA 3WS5A 2XDMA 2KX6A 4GS9A 3UDIA 1PZOA 3Q07A 3ZNYA 3VSKA 5AVEA 3G4PA 2ZC7A 2V9AA 1BLHA 1BZAA 1Z6FA 4HBUA 4ZBEA 2V2FF 4NXEA 1GSWA 3ULFA 3O3VA 4KZAA 3EEHA 3VSLA 1V9YA 2JKRM 1G68A 1BT5A 3LY4A 1UWNX 2P7JA 2P9VA 1P9RA 2KLIA 4BJPA 1KGGA 3ZG5A 1KE4A 2GNXA 2QKPA 4Q0JA 2WKPA 2PT7A 4QWOA 3NBLA 1JWZA 2VV6A 4JGOA 4QU3A 5IS1A 2INWA 4IUKA 5HL1A 2Q9MA 3F1PA 1W7FA 2VGJA 5E2HA 3Q7VB 3DTIA 5EOEA 2Y91A 4H8RA 4NXBA 3BFFA 3W4OA 1I5QA 5A91A 5E43A 3KSFA 4DJ3A 5FQIA 1J9MA 4MBKA 2OAP1 3A3JA 4MN7A 4BQMA 5CEDA 2ZC3B 3LO7A 1K4FA 1BTLA 4ARZA 4II7A 2J80A 5FEGA 2CC1A 2ZBBA 5DTSA 2O0YA 1FSYA 2IWCA 1W8QA 5DKLA 2XH9A 1JWVA 2PBYA 1XJ3A 3HCYA 1H3QA 3IS2A 2MJ6A 3M6BA 4HJ3A 3CPTA 2W3GA 1CI8A 2ZQ9A 3EQVA 4DKIA 4R4SA 2M7VA 1IELA 4GDNA 2QPNA 2JC7A 2BASA 4BL3A 4LLOB 3QP2A 5TGFA 4R38A 1DY6A 4JF5A 2D01A 2PD7A 4CPKA 5EVEA 3WS1A 3T4QA 1TDGA 3QP8A 2ZM8A 4OLDA 1W5DA 2K7SA 2ZOHA 3LR4A 3LIBA 3IX3A 3QNBA 2M7UA 5DTKA 1T18A 1GHMA 4G3WA 4M4XA 5HWVA 3V5MA 3MR0A 1PWDA 3KYQA 2JKTM 4GS9B 3UNWA 3ZCZA 4FTXA 3IT9A 4KZ3A 1KDWA 2Q0OA 1T19A 1P97A 2OSUA 4C75A 1MKMA 4RX3A 4JF6A 3NOPC 2XSSA 4BBTA 1YLJA 5CHJA 2ZMFA 3BLSA 3OPRA 2Y2OA 4FH4A 4R3AA 3RFBA 3CI6A 3MBZA 2EWVA 5DFXA 2P9VB 5TFQA 1KVMA 3EQUA 1L2SA 4EERA 3HL9A 1DP6A 4XT2A 3G35A 1NZUA 3PXPA 2UV0E 3IWIA 5GL9A 2EX9A 1W79A 4LRYC 3NJAA 4F3LA 3UE0A 3CG5A 1DP8A 1VHMA 2LB9A 4ZDXA 1DJCA 3F1PB 1EW0A 1VB6A 3MZFA 1YM1A 2X71A 5G18A 5EVLA 5HZHA 1D06A 2DCFA 4ZJ1A 5HDSA 4OQ0A 5FL3A 5EM1A 4WF0A 4Y7PA 4OVDA 1DP9A 3UE6A 2O9AA 4MEZA 1OT6A 3DAVA 4GB7A 3RJUA 1K6RA 2WKIA 4DDSA 2OLVA 4ARZB 4LGWA 5F83A 3T50A 5DF9A 2V1BA 4WELA 2E8IA 5DF7A 2QYBA 3IF6A 1MWSA 4GNUA
chains in the Genus database with same CATH topology
3PBRA 1ZTUA 4BMWA 3UMEA 3LICA 2W1RA 2V1AA 4HI4A 4P6ZS 3E4PA 2O9CA 3CAXA 3FPWA 3LFVA 2K2NA 3TRCA 3BY8A 5HDDA 1TS0A 3RTYA 4P6ZM 3IS2B 4Y5FA 2QJ5A 2ZOIA 1YSQA 1BYWA 2L1MA 1KOUA 3VE3A 1V9ZA 4EXOA 2PYPA 3PBNA 2OWJA 4I3JA 3PYPA 4ETXA 5DFYA 4JGRA 4Q0HA 1ODVA 2JKTI 2H28A 3PBQA 1OTBA 3MXQA 3EEAA 2A2LA 3LIFA 1OJGA 2IA2A 5EFWA 4NKPA 2HF6A 4MN5A 4YNRA 2VV7A 3OCNA 4WUJA 3JVVA 5J3WA 4CLCB 3A0RA 3OOVA 4H6JA 4B93A 4UQIS 4WLAA 1OTIA 2W1TB 2W3EA 2WKQA 5HD5A 1DRMA 3CLOA 4HY8A 1XJ4A 3E0YA 1XFNA 4PHTA 4EQ1A 3T4OA 4JGPA 1GSVA 2HV1A 2PR5A 2VZWA 3UB6A 1Y28A 2J3WA 3P01A 4GHIB 4EESA 2V0WA 1S1ZA 5L8MA 4NXFA 1LL8A 1OT9A 4CLCD 1TF1A 2W0NA 5HD3A 1OTEA 3OBFA 3R7WA 4EETB 4R6LA 4E04A 3CUEA 1G6OA 3KYZA 5KIZA 4WL9A 4GW9A 4R70A 4YOFA 3T4SA 3LIDA 1OPXA 3MQ0A 3RH8B 3F1OB 1TS8A 2P08A 4I3IA 4JGQA 3VV4A 2A24A 4Z1WA 4L9FA 3T4LA 5F69A 1S4RA 3LI9A 4DN0A 3S7PA 2M1CA 3LR3A 3V67A 4GLQA 3A0VA 4H6JB 4KQOA 5HWTA 5A8BA 4I39A 2VX8A 2K31A 2PYRA 3PBSA 2NUPC 3NOTC 5HSQA 2ZMVA 2D02A 5CX7A 3TW8A 1STZA 5HPFA 3F1NB 4XT2B 1S67L 2KOIA 1TS7A 2L0WA 3NOUC 3C2WA 1WA9A 1YAXA 4O01A 4GCZA 3D72A 4MN6A 1X0OA 2KX6A 4GS9A 1YKDA 4F3LB 5AVEA 3S7OA 3T4JA 4BBVA 2OOLA 2V9AA 3ZYTA 3H7WB 4ME4A 3HJIA 1UGUA 4NXEA 1GSWA 2HGVA 1N9LA 3KO6A 3ULFA 4LPZA 4O0PA 4WEKA 1UWPX 3EEHA 3C8CA 2VEAA 2CMNA 1V9YA 1TD5A 4L0LA 2QWSA 2W3FA 1D7EA 2JKRM 3E98A 1UWNX 2P7JA 3EGDC 4HJ4A 1P9RA 2KLIA 4BJPA 2G7UA 2JKRI 3LUQA 4CLCC 2GNXA 2FZ0A 2FH5A 1XFQA 2QKPA 4Y2FA 3KSIA 4Q0JA 3SW1A 1OJ5A 4MDZA 2QJ7A 2PR6A 1LSWA 3E4QA 2WKPA 2PT7A 3EOIA 5AJGA 4CQHA 2VV6A 4K08A 1F98A 2VKSA 4JGOA 5IS1A 3BJNA 2INWA 2P04A 4IUKA 3O5YA 2WKRA 3F1PA 3GDIA 4CLCE 2VJWA 4MMNA 3BWLA 4HIAA 1N9NA 5TBMA 4EEPA 3C30A 3ZQ5A 4EW7A 2GX5A 3LYXA 4HP9A 1H8MA 2XROA 3PBOA 5AVFA 2B02A 3LIAA 4NXBA 2OAQ1 4DMZA 5DJTA 4WEJA 3UB7A 5KSHA 3BQ8A 2PD8A 3KSFA 4DJ3A 3B42A 3U2AA 3W2ZA 2XRNA 2OAP1 4MN7A 2QHKA 1T1BA 5DKKA 1S66L 4KUOA 3E4OA 4IJGA 4PAUA 3MMHA 4ARZA 5LBRA 3OCLA 1T1CA 4II7A 2J80A 4AFIA 1JNUA 1OTAA 4L9EA 3NHQA 5HPIA 2PHYA 2VLGA 2ZBBA 3FC7A 4EUVA 3EGXC 4MCWA 2O0YA 3UB8A 3UB9A 4UEYA 3HJKA 3D3OA 4IHQA 3T4KA 5DKLA 3LI8A 3H9WA 3CUEC 2EA9A 1XJ3A 4LRXC 3K3CA 3T4TA 3HCYA 2GJ3A 4LRZE 1H3QA 4G3KA 2O9BA 2VGLM 3LR0A 3IS2A 2MJ6A 3S7QA 4HJ3A 4O8GA 1NLZA 2HJ9C 2W3GA 3MF0A 1P0ZA 3LIEA 1S1YA 3R7WB 1ZHHB 3EQVA 3BQAA 3MQQA 2DMWA 2M7VA 3CITA 4IUHA 1OTDA 1N9OA 2A24B 2BASA 3VE4A 4BBUA 1P9WA 4LLOB 2Y8HA 4CLCA 4R38A 5F68A 4EU0A 3JVUA 2D01A 2PD7A 2Y79A 3OLOA 3TJZC 2W1TA 1T1AA 3R4KA 3KX0X 2NUTC 3PBTA 4WN5A 3T4QA 2EWWA 4HJ6A 3B33A 4FSFA 4QPRA 4HP4A 4KUKA 3LR5A 4GJ4A 2W27A 2K7SA 1W63Q 2ZOHA 3LR4A 5F6AA 3LIBA 1F9IA 3P7NA 3FG8A 4GHIA 2J3TC 2M7UA 2R78A 1T18A 3KSHA 4G3WA 4M4XA 3FPVA 2W3DA 2YKFA 4ETZA 4G3VA 4Q0IA 3GECA 3MR0A 5HWVA 5G4ZA 3KYQA 2JKTM 4GS9B 2V0UA 3F1OA 4HH3A 4I38A 3PR6A 3OC2A 2JHEA 1T19A 1P97A 4HHDA 1GSXA 1MKMA 2O99A 4B9OA 3NOPC 5MC7A 4KQDA 4I3AA 3A0SA 3IBRA 5HWWA 2XSSA 4BBTA 2Z6CA 2ZMFA 1IOUA 4ZRRA 4HOIA 4FOFA 4PKYA 4R3AA 1LSVA 3CI6A 4RQ9A 3RFBA 3S7NA 5J7EA 1XJ6A 5TJJA 2EWVA 2J3TD 5DFXA 3IBJA 3MJQA 3EQUA 4L9GA 3DBAA 4UQIM 4EERA 3F1NA 1DP6A 1NRJA 4XT2A 2LB5A 5I5LA 3PXPA 4NXGA 2W3HA 2B18A 1LT0A 1MC0A 4BWIA 5IU1A 4LRYC 3NJAA 3CWFA 4F3LA 1YSPA 3H82A 1DP8A 1VHMA 5HDCA 3UE3A 2LB9A 3F1PB 3VOLA 3H7WA 2VGLS 3C38A 1EW0A 5C5KA 1W63M 1S4SA 5IT5A 1VB6A 3BY9A 5TBMB 2OWHA 5HZHA 1D06A 5HDSA 4YWZA 1MZUA 2YKHA 3B47A 3K2NA 3MQOA 2HJEA 5FL3A 2VV8A 4DJ2A 4WF0A 4I5SA 3TE8A 2XA7S 1DP9A 3UE6A 4EEUA 5K5BA 1F5MA 2O9AA 4HNBA 4Y3IA 4PKYG 1OT6A 2I9VA 2Z6DA 5F5YA 3ICYA 5G4YA 3KSGA 1TS6A 2L4RA 1G28A 3MFXA 2XA7M 5HL6A 5DJUA 1IFQA 1NLYA 1NWZA 4NEED 2VA0A 5J4EA 4ARZB 1LSXA 3EWKA 3T50A 5DF9A 2V1BA 4WELA 3K3DA 4HH2A 4OOMA 2KDKA 2GZAA 3BW6A 1XJ2A 4HQAA 2QYBA 4OOLA 3UMDA 3H82B 2JN7A 3PHYA 2PDRA 3G6OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZTU A;  5HSQ A;  4MN7 A;  2W1R A;  1STZ A;  2O9C A;  3LFV A;  5HPF A;  2K2N A;  3TRC A;  4IJG A;  4PAU A;  2KOI A;  1MKM A;  3MMH A;  5LBR A;  2O99 A;  3NOU C;  3NOP C;  3C2W A;  4O01 A;  3IBR A;  3NHQ A;  2XSS A;  4Y5F A;  2ZMF A;  5HPI A;  4ZRR A;  4FOF A;  4EUV A;  1YKD A;  1YSQ A;  4RQ9 A;  3CI6 A;  4MCW A;  3RFB A;  2O0Y A;  3S7N A;  5TJJ A;  3S7O A;  3D3O A;  5DFX A;  3IBJ A;  4ETX A;  5DFY A;  2OOL A;  3DBA A;  4ME4 A;  4Q0H A;  2LB5 A;  3EEA A;  4LRX C;  5I5L A;  2HGV A;  3HCY A;  2W3H A;  2IA2 A;  3KO6 A;  4LRZ E;  4G3K A;  2O9B A;  2B18 A;  1MC0 A;  4O0P A;  4YNR A;  3S7Q A;  4O8G A;  4BWI A;  2VEA A;  1TD5 A;  2W3G A;  3OOV A;  4LRY C;  2W3F A;  3MF0 A;  1YSP A;  2W1T B;  3E98 A;  2W3E A;  1VHM A;  2KLI A;  2LB9 A;  2G7U A;  3E0Y A;  2M7V A;  5C5K A;  3CIT A;  4Y2F A;  4IUH A;  3KSI A;  2VZW A;  4Q0J A;  4MDZ A;  2Y8H A;  5AJG A;  4CQH A;  5L8M A;  3K2N A;  1TF1 A;  4EU0 A;  3OBF A;  2VKS A;  2Y79 A;  4R6L A;  2W1T A;  4E04 A;  3BJN A;  3R4K A;  4IUK A;  3O5Y A;  4GW9 A;  4R70 A;  4YOF A;  5K5B A;  2VJW A;  1F5M A;  2O9A A;  4Y3I A;  4MMN A;  4QPR A;  3MQ0 A;  3VV4 A;  3KSG A;  4Z1W A;  3ZQ5 A;  2GX5 A;  2XRO A;  5HL6 A;  2M7U A;  4DN0 A;  3S7P A;  3KSH A;  4G3W A;  4DMZ A;  2W3D A;  4ETZ A;  4G3V A;  4Q0I A;  4GLQ A;  3KSF A;  2QYB A;  2K31 A;  3W2Z A;  3G6O A;  3NOT C;  2XRN A; 
#chains in the Genus database with same CATH topology
 4WZ5 A;  3LIC A;  2W1R A;  3BEB A;  2O9C A;  3CAX A;  1FSW A;  2K2N A;  3BY8 A;  5TR7 A;  1TS0 A;  3RTY A;  1FR1 A;  1KE3 A;  3IS2 B;  4P6Z M;  3TSG A;  3IXB A;  4Y5F A;  3CPT B;  3BFC A;  1YSQ A;  2L1M A;  2OWJ A;  4I3J A;  2C5W B;  4JGR A;  3SZT A;  2JKT I;  1SCW A;  2H28 A;  3EEA A;  5AQ9 A;  4F94 A;  4S2J A;  1OJG A;  3CMZ A;  5EFW A;  1AWI A;  4YNR A;  2VV7 A;  2JBF A;  5I94 A;  4Y0O A;  5J3W A;  4B93 A;  4P87 A;  3UN7 A;  3VP4 A;  2WKQ A;  1S6R A;  4D60 A;  3CLO A;  1XJ4 A;  3BM6 A;  4OPZ A;  3ZG8 B;  3P01 A;  4EES A;  2V0W A;  2J8Y A;  2WK0 A;  1K57 C;  1OTE A;  4EET B;  1JTG A;  3CUE A;  4GW9 A;  1LI0 A;  3T1R A;  4BEN A;  4R70 A;  4YOF A;  4JKT A;  1NXY A;  1L0G A;  3LID A;  4RX2 A;  1L0D A;  2Y2N A;  2P08 A;  3NDG A;  4Z1W A;  1GA9 A;  5DF8 A;  4LV3 A;  1PW1 A;  4Z9Q A;  3VOZ A;  1HVB A;  4I39 A;  2PYR A;  4X56 A;  2NUP C;  2H5S A;  3BFE A;  5FQM A;  2D02 A;  1STZ A;  4C6Y A;  5HPF A;  4XT2 B;  1S67 L;  1TS7 A;  1K0K A;  2L0W A;  1WA9 A;  3UO9 A;  1CJF A;  4ZTK A;  1CF0 A;  4BLM A;  1X0O A;  3GTC A;  3GVB A;  4LV2 A;  4F3L B;  1Y54 A;  3GRJ A;  5FI7 A;  4JBF A;  3BFG A;  5GHX A;  2EFX A;  3ZYT A;  1OME A;  1ONG A;  1N9L A;  3AGF A;  3FYZ A;  4WEK A;  3C8C A;  2VEA A;  3O86 A;  4HES A;  5JYO A;  3E98 A;  5L09 A;  3EGD C;  4N9L A;  5IHV A;  5J8X A;  1D1J A;  2G7U A;  3V39 A;  3LUQ A;  4Y17 A;  2FH5 A;  5E2G A;  3KSI A;  4OPY A;  1NRF A;  2QJ7 A;  1LSW A;  1SHV A;  3UY6 A;  5AJG A;  2Y2G A;  2Y2I A;  4K08 A;  4P85 A;  5GLA A;  3BJN A;  2P04 A;  2EX8 A;  3O5Y A;  3ZG0 A;  3UPP A;  4CLC E;  3A3F A;  5A90 A;  3IXH A;  4MMN A;  3BWL A;  4Q8I A;  1K57 A;  1N9N A;  5M19 A;  1XA7 A;  4EW7 A;  2GX5 A;  1H8M A;  4RVA A;  5AVF A;  2B02 A;  3FV7 A;  3LIA A;  3C5A A;  4Y13 A;  1ESI A;  4Y0T A;  2OAQ 1;  4DMZ A;  2WAD A;  4WEJ A;  3ZVW A;  2XFT A;  5KSH A;  1MWT A;  4X1M A;  1DJB A;  1PI5 A;  2PAV P;  4OQI A;  2FFF B;  2AVX A;  5FQ9 A;  1AXB A;  1YPR A;  1T1B A;  3L7H A;  3UPN A;  5DKK A;  2JCH A;  3E4O A;  4IED A;  4PAU A;  3MMH A;  5LBR A;  3OCL A;  4AFI A;  4LCM A;  5HPI A;  2PHY A;  3FC7 A;  1LLB A;  3EGX C;  3N6I A;  3UB9 A;  3A3E A;  3HJK A;  3D3O A;  3D9Y A;  4R3J A;  3VFH A;  3LI8 A;  4S2N C;  3H9W A;  4PPR A;  3N7W A;  1MKI A;  5CGS A;  3K3C A;  1ZC2 A;  4LRZ E;  4D2O A;  4G3K A;  2O9B A;  2VGL M;  3LR0 A;  4B4Z A;  3S7Q A;  1NLZ A;  4K91 A;  2I72 A;  3LIE A;  1S1Y A;  1ZHH B;  3HVF A;  3BQA A;  3SH8 A;  2HPB A;  3MQQ A;  1YT4 A;  2DMW A;  4K0W A;  1M6K A;  3BLM A;  5CEB A;  5FQJ A;  3CIT A;  4FH2 A;  4IUH A;  1N9O A;  3VE4 A;  5GHZ A;  3MZE A;  3AGD A;  3B3X A;  3IHA A;  2Y79 A;  3TG9 A;  2W1T A;  3KX0 X;  1K25 A;  3VOY A;  2X01 A;  4OKP A;  5EVI C;  4KUK A;  1N4O A;  4PM7 A;  3FG8 A;  2G2W A;  2R78 A;  2PBD P;  5KSC A;  4Q0I A;  5G4Z A;  3Q1F A;  4S2I A;  3F1O A;  5FAO A;  3G30 A;  3OC2 A;  3C4O A;  4BD0 A;  1BLP A;  1XPB A;  5A93 A;  1L0E A;  3RXW A;  1YLT A;  1FOF A;  2JE5 A;  2Y59 A;  4X1L A;  1YMX A;  1RP5 A;  4MLL A;  4XUX A;  2O99 A;  4B9O A;  3A0S A;  3IBR A;  3T1Q B;  5FI2 A;  5HWW A;  1Q2Q A;  1IOU A;  4HOI A;  4FOF A;  3OZH A;  2HP6 A;  1LSV A;  4YIN A;  2J3T D;  2J7V A;  4JXG A;  3MJQ A;  4L9G A;  4JF4 A;  1NRJ A;  1ZG6 A;  1PNE A;  4OQG A;  5I5L A;  1MWR A;  2W3H A;  3D4F A;  3FKW A;  4JLF A;  5EPH A;  4S2N A;  4OOY A;  5FQQ A;  4ZAM A;  4PM8 A;  5HDC A;  1PRQ A;  3UE3 A;  3H7W A;  2VGL S;  3C38 A;  5C5K A;  3BY9 A;  3UDF A;  1TDL A;  2OWH A;  2EX6 A;  3V3S A;  4KG2 A;  5FDS A;  4YWZ A;  3N8S A;  1MZU A;  3B47 A;  3LEZ A;  3IQA A;  2VV8 A;  1PYY A;  4I5S A;  1ACF A;  4S2M A;  3QP6 A;  1E3U A;  4HNB A;  5EM0 A;  3ICY A;  1PWG A;  2L4R A;  5FDH A;  1IFQ A;  1NWZ A;  4NEE D;  2VA0 A;  3IH8 A;  3W8K A;  5EVI A;  2HP9 A;  3K3D A;  1ERO A;  4ZJ3 A;  1WYC A;  2KDK A;  2P74 A;  3ZG7 B;  3WWX A;  3I7J A;  1M40 A;  3H82 B;  2JN7 A;  1FQG A;  1KDS A;  1GA0 A;  3PBR A;  1ZTU A;  2G2U A;  3UME A;  4GDB A;  4HI4 A;  1K38 A;  2H0T A;  2QMI A;  3TRC A;  1PIO A;  4MBH A;  4GZB A;  2Z2L B;  4OPQ A;  4WMC A;  2PU4 A;  5CGX A;  2ZC4 B;  3G2Y A;  2QJ5 A;  5M1A A;  1KOU A;  2Y55 A;  4KZB A;  2PYP A;  4EXO A;  3PBN A;  4ETX A;  2XD5 A;  1ODV A;  3T1X A;  4EUZ A;  3PBQ A;  3MXQ A;  2A2L A;  1YLW A;  3LIF A;  3OPL A;  5CXW A;  2IA2 A;  3BFD A;  1H8Y A;  3MZD A;  2HF6 A;  4MN5 A;  2Y2Q A;  3IH9 A;  1E4D A;  4EBL A;  3A0R A;  3DTK A;  4WLA A;  1OTI A;  3HLB A;  2W1T B;  4WZ4 A;  4DF6 A;  4HY8 A;  1BUL A;  1LL5 A;  3LEQ A;  4PHT A;  4WYY A;  4U0X A;  5AQA A;  3JYI A;  1Y28 A;  1MY8 A;  2J3W A;  4DXC A;  4UHU A;  1TF1 A;  3UE1 A;  2W0N A;  3OBF A;  5KZH A;  4OP5 A;  3N8L A;  3S1Y A;  3VFF A;  4E04 A;  2XD1 A;  5FAS A;  3HLC A;  1ESU A;  3Q81 A;  1K56 A;  3F1O B;  2BLS A;  4JGQ A;  2A24 A;  2XFS A;  1JTD A;  4R3B A;  4N1H A;  1S4R A;  2WAE A;  2WZX A;  1F2K A;  1CEF A;  1XGJ A;  3S22 A;  3UB5 P;  3WRZ A;  2EX2 A;  5HWT A;  3MXR A;  3QP5 A;  5CTM A;  5HSQ A;  4WM9 A;  5GLB A;  5BOH A;  3G2Z A;  3TW8 A;  1ONH A;  4EV4 A;  4GCZ A;  4S2P A;  4FD8 A;  2V1Z A;  4LV0 A;  2ZL1 A;  5HAP A;  1SDN A;  4E3O A;  3S7O A;  3T4J A;  5KMW A;  1Z09 A;  2OOL A;  3DTM A;  4PM5 A;  3H7W B;  3NC8 A;  4ME4 A;  1NYM A;  2HP5 A;  4P0M A;  3HJI A;  1UGU A;  2RCX A;  3L9K A;  2VK3 A;  4LPZ A;  3HUO A;  4OON A;  4PM9 A;  2CMN A;  4L0L A;  1KE0 A;  1D7E A;  3HUM A;  4QD4 A;  1IYO A;  1NY0 A;  3WS2 A;  3NEC A;  4B4X A;  2GDN A;  2J9O A;  4CLC C;  5HAR A;  1XFQ A;  3ZGA B;  3SW1 A;  4MDZ A;  2PR6 A;  1K54 C;  3EOI A;  4CQH A;  3LGO A;  5EVI B;  4IVI A;  2VKS A;  2ZQC A;  1MWU A;  2WKR A;  3C7V A;  4XXR A;  3IXG A;  1G5U A;  4KEN B;  2ACG A;  5TBM A;  4EEP A;  3ZQ5 A;  5DTT A;  4HP9 A;  2OLU A;  2EXB A;  2Y2K A;  2HZ5 A;  4IBX A;  1IYS A;  3UB7 A;  3BQ8 A;  2WGI A;  1H0M A;  1FCN A;  1HD8 A;  1LHY A;  2XRN A;  4Y0U A;  2OV5 A;  3O88 A;  2QZ6 A;  2HDU A;  5HW3 A;  4KUO A;  2XK1 A;  5E2E A;  1H5X A;  3SOI A;  3IF5 A;  1OTA A;  3NHQ A;  4BL2 A;  1K55 C;  2C6W B;  1Q2P A;  1I2W A;  3MKF A;  2VLG A;  4QY5 A;  4EUV A;  4MCW A;  3UB8 A;  4UEY A;  2DRW A;  5JYP A;  4IHQ A;  3T4K A;  4JXV A;  3IHB A;  5HFO A;  1CI9 A;  4X6T A;  2ZM2 A;  2EA9 A;  3T4T A;  4KG5 A;  2GJ3 A;  1SDE A;  1ES4 A;  5E2F A;  4O8G A;  1KVL A;  2Y4A A;  2WGW B;  2XEP A;  3MF0 A;  1TEM A;  1FIL A;  1FCM A;  1XKZ A;  1PWC A;  3SS5 A;  4E3L A;  5FSR A;  4BD1 A;  1VEU A;  2BTF P;  3G32 A;  1OTD A;  3VP2 A;  2A24 B;  1P9W A;  1WYB A;  2WGV A;  2XF3 A;  2Y8H A;  1A0K A;  4CLC A;  5F68 A;  4EU0 A;  3JVU A;  3OLO A;  1T1A A;  3R4K A;  3OPP A;  2NUT C;  4NET A;  1K54 A;  4X53 A;  4HP4 A;  3LR5 A;  5F6A A;  2Y2M A;  4OP8 A;  4DXB A;  1F9I A;  3P7N A;  4ESP A;  3HRE A;  2J3T C;  5EUA A;  3FKV A;  3KSH A;  4R1G A;  2YKF A;  4ETZ A;  4G3V A;  1IYQ A;  4K0X A;  2ZL1 B;  3VP0 A;  1PI4 A;  3UDX A;  1J3W A;  4GD6 A;  4I38 A;  5GLD A;  4OLG A;  3ZDJ A;  1JVJ A;  4UA9 A;  1S0W A;  2Z2M B;  1C3B A;  1G6A A;  4KQD A;  4I3A A;  4ZRR A;  4PKY A;  5J7E A;  3S7N A;  1XJ6 A;  5TJJ A;  5A92 A;  2XQZ A;  3GV9 A;  2EXA A;  3DBA A;  2R9X A;  4GOG A;  1K55 A;  3F1N A;  5FEF A;  3S4X A;  4NXG A;  2B18 A;  1LT0 A;  3W4Q A;  3CHW P;  4BWI A;  1FIK A;  4E3M A;  5IU1 A;  3T12 B;  3CWF A;  4KQQ A;  3H82 A;  5FQK A;  1QMF A;  2Y2L A;  1W63 M;  1S4S A;  5IT5 A;  5TBM B;  1RGY A;  1K4E A;  3T1S A;  2YKH A;  3K2N A;  3MQO A;  3ITB A;  1MBL A;  1TVF A;  4DJ2 A;  3LY3 A;  4IVK A;  2XA7 S;  2A49 A;  4R4R A;  3MSH A;  4PKY G;  2XGN A;  2I9V A;  4M3K A;  2Z6D A;  5G4Y A;  3KSG A;  2EFU A;  3BEC A;  5DJU A;  1NLY A;  4XUZ A;  1LSX A;  1ES2 A;  4X69 A;  4OOM A;  1IKG A;  2GZA A;  4UAA A;  1XJ2 A;  4HQA A;  2ZLY A;  3JPU A;  4OOL A;  3UMD A;  3WS0 A;  2PDR A;  3G6O A;  5L2F A;  4BMW A;  3FPW A;  2HDR A;  3HBR A;  3LFV A;  4OPR A;  1O07 A;  4HEF A;  3OPH A;  3WRT A;  3SH7 A;  4EWF A;  4OH0 A;  4C3Q A;  3E2K A;  3IX4 A;  1BYW A;  3VE3 A;  1BUE A;  1V9Z A;  3PYP A;  1OTB A;  1VEU B;  3CJM A;  5CER A;  1L3L A;  4NKP A;  5F1F A;  3NDE A;  4WUJ A;  3VMA A;  3JVV A;  1BSG A;  4CLC B;  5GHY A;  2W3E A;  5HD5 A;  4ZJ2 A;  3E0Y A;  1XFN A;  2PRF A;  4EQ1 A;  3T4O A;  5CHU A;  1VM1 A;  2H0Y A;  3A3D A;  1GSV A;  2HV1 A;  1ES5 A;  3UB6 A;  4GKU A;  2DNS A;  2ZMA A;  1S1Z A;  4NXF A;  1OT9 A;  1GHI A;  4LFU A;  3R7W A;  3BYD A;  3KYZ A;  5KIZ A;  1SKO B;  3MS6 A;  1ES3 A;  1OPX A;  2XLN A;  1YLZ A;  4IBR A;  4I3I A;  4L9F A;  3GMW A;  3T4L A;  1XGI A;  3S7P A;  3FZC A;  3V67 A;  4GLQ A;  5U47 A;  5HAI A;  4H6J B;  1ERQ A;  2K31 A;  3NOT C;  1MXO A;  3G31 A;  2ZMV A;  4S2K A;  3RXX A;  4EQI A;  5FI6 A;  2IWB A;  4O7D A;  2V8F A;  3ZFZ A;  3F1N B;  4DE0 A;  3N8R A;  2IWD A;  2KOI A;  3P98 A;  3VP3 A;  3NOU C;  3C2W A;  1YAX A;  5AQ7 A;  3D72 A;  4MN6 A;  3ZG9 B;  1YKD A;  5FAT A;  1KGE A;  1EWZ A;  1ZKJ A;  4BBV A;  2ZJ9 A;  3E2L A;  1YLP A;  1IYP A;  4MNR A;  2HGV A;  4ID4 A;  3KO6 A;  3W4P A;  4O0P A;  3QP1 A;  4JXW A;  1UWP X;  2Y2H A;  3M6H A;  1TD5 A;  1HTZ A;  2QWS A;  2W3F A;  1BLS A;  3DWK A;  1ALQ A;  4HJ4 A;  3Q82 A;  5EOO A;  2JKR I;  3PAG A;  2WZZ A;  2FZ0 A;  3QP4 A;  4Y2F A;  3IF6 C;  1PFL A;  1OJ5 A;  3CZD A;  4LCL A;  3E4Q A;  4WZ5 C;  3GSG A;  3HLW A;  4PMA A;  5EE8 A;  3ZVT A;  1F98 A;  4GD8 A;  4KZ8 A;  3ZHH A;  3GDI A;  1E3U D;  2VJW A;  3DTE A;  5HAQ A;  4HIA A;  4DE1 A;  3C30 A;  3GQZ A;  3LYX A;  4E6W A;  2XRO A;  1PW8 A;  3PBO A;  2Y2J A;  3MKE A;  4R0Q A;  5EVI D;  2X02 A;  3LCE A;  2WGW A;  5DJT A;  4KG6 A;  2PD8 A;  3NI9 A;  2ZQA A;  3B42 A;  3U2A A;  3W2Z A;  2JKF A;  2QHK A;  2XR0 A;  2WKE A;  1S66 L;  1XA1 A;  1HLU P;  1YLY A;  4IJG A;  3ISG A;  1T1C A;  4WMC D;  1JNU A;  1YQS A;  4L9E A;  3ITA A;  5CEC A;  3ZNT A;  3MFD A;  4X25 A;  1FCO A;  5FAP A;  3CUE C;  1U60 A;  4LRX C;  1DJA A;  4MBF A;  1CEG A;  3IWQ A;  5AQB A;  2ZD8 A;  5F82 A;  2HDS A;  3NCK A;  2HJ9 C;  1P0Z A;  3R7W B;  2ZC6 B;  4QJG A;  4E3J A;  3M2K A;  4B88 A;  4BBU A;  2J9P A;  1VET A;  1NYY A;  3C4P A;  1CK3 A;  2ZQ8 A;  3TJZ C;  4QY6 A;  3IX8 A;  3N4I A;  3PBT A;  4WN5 A;  2EWW A;  4HJ6 A;  3B33 A;  4U0T A;  4FSF A;  2V20 A;  4QPR A;  3TOI A;  5L10 A;  1K56 D;  1HZO A;  4GJ4 A;  2W27 A;  3SS4 A;  1W63 Q;  5D3O A;  1W8Y A;  1YMS A;  3V3R A;  1IKI A;  1NJ4 A;  1GHP A;  3C7U A;  4GHI A;  3V50 A;  3PTE A;  3FPV A;  2W3D A;  3GEC A;  4WBG A;  4Y15 A;  5CTN A;  2V0U A;  1IEM A;  4EBN A;  4U3T A;  3GR2 A;  4HH3 A;  3PR6 A;  1XXM A;  3AGE A;  2JHE A;  2BG1 A;  1LL9 A;  4RA7 A;  4HHD A;  1JWP A;  1GSX A;  2UWX A;  1SKF A;  3IXD A;  2WKH A;  4DE3 A;  5MC7 A;  4KZ9 A;  4FCF A;  2WYX A;  3DWZ A;  3M2J A;  4QHC A;  2Z6C A;  4S2O A;  4RQ9 A;  3IBJ A;  1O7E A;  4UQI M;  2Q9N A;  2LB5 A;  5CGW A;  4P6B A;  4PM6 A;  4YFM A;  4KZ4 A;  1MC0 A;  4HBT A;  4KZ7 A;  3UPO A;  2B5R A;  4E3N A;  4LV1 A;  1YSP A;  3A3I A;  1BLC A;  2RL3 A;  3VOL A;  5HX9 A;  3QHY A;  1WE4 A;  2ZC5 B;  5L07 A;  1ERM A;  4E3I A;  4KQR A;  4CJN A;  2HJE A;  5CRF A;  1VQQ A;  2FFY A;  3TE8 A;  3O87 A;  4EEU A;  5K5B A;  1F5M A;  2V8C A;  4Y3I A;  1L0F A;  1RCJ A;  4OQH A;  5F5Y A;  5GLC A;  1TS6 A;  1G28 A;  3MFX A;  2XA7 M;  5HL6 A;  5J4E A;  4N9K A;  5EEC A;  2B95 A;  1N9B A;  3EWK A;  4S2L A;  3PAE A;  2ZQ7 A;  4HH2 A;  3FWL A;  4N92 A;  3BW6 A;  2H10 A;  1XP4 A;  3PHY A;  3IWO A;  2VGK A;  4NG2 A;  4E3K A;  3Q7V A;  4GN2 A;  1E25 A;  4UA6 A;  2JKG A;  2V1A A;  4P6Z S;  2WUQ A;  3E4P A;  1ZG4 A;  2WAF A;  5F1G A;  2HDQ A;  5FAQ A;  5EV0 A;  3KYE A;  5HDD A;  1H8Z A;  4RYE A;  2A3U A;  3G34 A;  4X55 A;  4KZ5 A;  1RGZ A;  4KZ6 A;  5DVA A;  1EI5 A;  4JXS A;  1SZV A;  3SS3 A;  2ZOI A;  1SKO A;  3Q7Z A;  5FA7 A;  1K6S A;  5DFY A;  4Q0H A;  3SH9 A;  1VET B;  3HUN A;  3OCN A;  3NUL A;  4N1X A;  1QME A;  3OOV A;  4H6J A;  4UQI S;  4DE2 A;  3NY4 A;  5CHM A;  3IF6 B;  3WS4 A;  1KGF A;  3HLD A;  1DRM A;  3U4L P;  1XX2 A;  4JGP A;  4JPM A;  2PR5 A;  2VZW A;  4E6X A;  3HLG A;  3P09 A;  2ZQD A;  1FR6 A;  4LEN A;  4GHI B;  4EBP A;  5L8M A;  1LL8 A;  3VP1 A;  4CLC D;  5HD3 A;  4R23 A;  4R6L A;  1G6O A;  2ZM0 A;  4WL9 A;  3T4S A;  1Y4O A;  3MQ0 A;  3RH8 B;  4DRT A;  4UA7 A;  1TS8 A;  1LI9 A;  3NIA A;  3VV4 A;  2E8J A;  1PZP A;  2Y2P A;  5F69 A;  3HLE A;  5M18 A;  3LI9 A;  2R9W A;  4DN0 A;  1CQA A;  2M1C A;  4X68 A;  3LR3 A;  1MPL A;  4A5R A;  2PU2 A;  1NZO A;  3DW0 A;  3A0V A;  4FUW A;  4KQO A;  5A8B A;  2VX8 A;  3PBS A;  4DDY A;  3BRM A;  3HLF A;  5CX7 A;  1GCE A;  4NK3 A;  4QB8 A;  3QNC A;  4O01 A;  3MXS A;  1I2S A;  3WS5 A;  2XDM A;  2KX6 A;  4GS9 A;  3UDI A;  1PZO A;  3Q07 A;  3ZNY A;  3VSK A;  5AVE A;  3G4P A;  2ZC7 A;  2V9A A;  1BLH A;  1BZA A;  1Z6F A;  4HBU A;  4ZBE A;  2V2F F;  4NXE A;  1GSW A;  3ULF A;  3O3V A;  4KZA A;  3EEH A;  3VSL A;  1V9Y A;  2JKR M;  1G68 A;  1BT5 A;  3LY4 A;  1UWN X;  2P7J A;  2P9V A;  1P9R A;  2KLI A;  4BJP A;  1KGG A;  3ZG5 A;  1KE4 A;  2GNX A;  2QKP A;  4Q0J A;  2WKP A;  2PT7 A;  4QWO A;  3NBL A;  1JWZ A;  2VV6 A;  4JGO A;  4QU3 A;  5IS1 A;  2INW A;  4IUK A;  5HL1 A;  2Q9M A;  3F1P A;  1W7F A;  2VGJ A;  5E2H A;  3Q7V B;  3DTI A;  5EOE A;  2Y91 A;  4H8R A;  4NXB A;  3BFF A;  3W4O A;  1I5Q A;  5A91 A;  5E43 A;  3KSF A;  4DJ3 A;  5FQI A;  1J9M A;  4MBK A;  2OAP 1;  3A3J A;  4MN7 A;  4BQM A;  5CED A;  2ZC3 B;  3LO7 A;  1K4F A;  1BTL A;  4ARZ A;  4II7 A;  2J80 A;  5FEG A;  2CC1 A;  2ZBB A;  5DTS A;  2O0Y A;  1FSY A;  2IWC A;  1W8Q A;  5DKL A;  2XH9 A;  1JWV A;  2PBY A;  1XJ3 A;  3HCY A;  1H3Q A;  3IS2 A;  2MJ6 A;  3M6B A;  4HJ3 A;  3CPT A;  2W3G A;  1CI8 A;  2ZQ9 A;  3EQV A;  4DKI A;  4R4S A;  2M7V A;  1IEL A;  4GDN A;  2QPN A;  2JC7 A;  2BAS A;  4BL3 A;  4LLO B;  3QP2 A;  5TGF A;  4R38 A;  1DY6 A;  4JF5 A;  2D01 A;  2PD7 A;  4CPK A;  5EVE A;  3WS1 A;  3T4Q A;  1TDG A;  3QP8 A;  2ZM8 A;  4OLD A;  1W5D A;  2K7S A;  2ZOH A;  3LR4 A;  3LIB A;  3IX3 A;  3QNB A;  2M7U A;  5DTK A;  1T18 A;  1GHM A;  4G3W A;  4M4X A;  5HWV A;  3V5M A;  3MR0 A;  1PWD A;  3KYQ A;  2JKT M;  4GS9 B;  3UNW A;  3ZCZ A;  4FTX A;  3IT9 A;  4KZ3 A;  1KDW A;  2Q0O A;  1T19 A;  1P97 A;  2OSU A;  4C75 A;  1MKM A;  4RX3 A;  4JF6 A;  3NOP C;  2XSS A;  4BBT A;  1YLJ A;  5CHJ A;  2ZMF A;  3BLS A;  3OPR A;  2Y2O A;  4FH4 A;  4R3A A;  3RFB A;  3CI6 A;  3MBZ A;  2EWV A;  5DFX A;  2P9V B;  5TFQ A;  1KVM A;  3EQU A;  1L2S A;  4EER A;  3HL9 A;  1DP6 A;  4XT2 A;  3G35 A;  1NZU A;  3PXP A;  2UV0 E;  3IWI A;  5GL9 A;  2EX9 A;  1W79 A;  4LRY C;  3NJA A;  4F3L A;  3UE0 A;  3CG5 A;  1DP8 A;  1VHM A;  2LB9 A;  4ZDX A;  1DJC A;  3F1P B;  1EW0 A;  1VB6 A;  3MZF A;  1YM1 A;  2X71 A;  5G18 A;  5EVL A;  5HZH A;  1D06 A;  2DCF A;  4ZJ1 A;  5HDS A;  4OQ0 A;  5FL3 A;  5EM1 A;  4WF0 A;  4Y7P A;  4OVD A;  1DP9 A;  3UE6 A;  2O9A A;  4MEZ A;  1OT6 A;  3DAV A;  4GB7 A;  3RJU A;  1K6R A;  2WKI A;  4DDS A;  2OLV A;  4ARZ B;  4LGW A;  5F83 A;  3T50 A;  5DF9 A;  2V1B A;  4WEL A;  2E8I A;  5DF7 A;  2QYB A;  3IF6 A;  1MWS A;  4GNU A; 
#chains in the Genus database with same CATH homology
 3PBR A;  1ZTU A;  4BMW A;  3UME A;  3LIC A;  2W1R A;  2V1A A;  4HI4 A;  4P6Z S;  3E4P A;  2O9C A;  3CAX A;  3FPW A;  3LFV A;  2K2N A;  3TRC A;  3BY8 A;  5HDD A;  1TS0 A;  3RTY A;  4P6Z M;  3IS2 B;  4Y5F A;  2QJ5 A;  2ZOI A;  1YSQ A;  1BYW A;  2L1M A;  1KOU A;  3VE3 A;  1V9Z A;  4EXO A;  2PYP A;  3PBN A;  2OWJ A;  4I3J A;  3PYP A;  4ETX A;  5DFY A;  4JGR A;  4Q0H A;  1ODV A;  2JKT I;  2H28 A;  3PBQ A;  1OTB A;  3MXQ A;  3EEA A;  2A2L A;  3LIF A;  1OJG A;  2IA2 A;  5EFW A;  4NKP A;  2HF6 A;  4MN5 A;  4YNR A;  2VV7 A;  3OCN A;  4WUJ A;  3JVV A;  5J3W A;  4CLC B;  3A0R A;  3OOV A;  4H6J A;  4B93 A;  4UQI S;  4WLA A;  1OTI A;  2W1T B;  2W3E A;  2WKQ A;  5HD5 A;  1DRM A;  3CLO A;  4HY8 A;  1XJ4 A;  3E0Y A;  1XFN A;  4PHT A;  4EQ1 A;  3T4O A;  4JGP A;  1GSV A;  2HV1 A;  2PR5 A;  2VZW A;  3UB6 A;  1Y28 A;  2J3W A;  3P01 A;  4GHI B;  4EES A;  2V0W A;  1S1Z A;  5L8M A;  4NXF A;  1LL8 A;  1OT9 A;  4CLC D;  1TF1 A;  2W0N A;  5HD3 A;  1OTE A;  3OBF A;  3R7W A;  4EET B;  4R6L A;  4E04 A;  3CUE A;  1G6O A;  3KYZ A;  5KIZ A;  4WL9 A;  4GW9 A;  4R70 A;  4YOF A;  3T4S A;  3LID A;  1OPX A;  3MQ0 A;  3RH8 B;  3F1O B;  1TS8 A;  2P08 A;  4I3I A;  4JGQ A;  3VV4 A;  2A24 A;  4Z1W A;  4L9F A;  3T4L A;  5F69 A;  1S4R A;  3LI9 A;  4DN0 A;  3S7P A;  2M1C A;  3LR3 A;  3V67 A;  4GLQ A;  3A0V A;  4H6J B;  4KQO A;  5HWT A;  5A8B A;  4I39 A;  2VX8 A;  2K31 A;  2PYR A;  3PBS A;  2NUP C;  3NOT C;  5HSQ A;  2ZMV A;  2D02 A;  5CX7 A;  3TW8 A;  1STZ A;  5HPF A;  3F1N B;  4XT2 B;  1S67 L;  2KOI A;  1TS7 A;  2L0W A;  3NOU C;  3C2W A;  1WA9 A;  1YAX A;  4O01 A;  4GCZ A;  3D72 A;  4MN6 A;  1X0O A;  2KX6 A;  4GS9 A;  1YKD A;  4F3L B;  5AVE A;  3S7O A;  3T4J A;  4BBV A;  2OOL A;  2V9A A;  3ZYT A;  3H7W B;  4ME4 A;  3HJI A;  1UGU A;  4NXE A;  1GSW A;  2HGV A;  1N9L A;  3KO6 A;  3ULF A;  4LPZ A;  4O0P A;  4WEK A;  1UWP X;  3EEH A;  3C8C A;  2VEA A;  2CMN A;  1V9Y A;  1TD5 A;  4L0L A;  2QWS A;  2W3F A;  1D7E A;  2JKR M;  3E98 A;  1UWN X;  2P7J A;  3EGD C;  4HJ4 A;  1P9R A;  2KLI A;  4BJP A;  2G7U A;  2JKR I;  3LUQ A;  4CLC C;  2GNX A;  2FZ0 A;  2FH5 A;  1XFQ A;  2QKP A;  4Y2F A;  3KSI A;  4Q0J A;  3SW1 A;  1OJ5 A;  4MDZ A;  2QJ7 A;  2PR6 A;  1LSW A;  3E4Q A;  2WKP A;  2PT7 A;  3EOI A;  5AJG A;  4CQH A;  2VV6 A;  4K08 A;  1F98 A;  2VKS A;  4JGO A;  5IS1 A;  3BJN A;  2INW A;  2P04 A;  4IUK A;  3O5Y A;  2WKR A;  3F1P A;  3GDI A;  4CLC E;  2VJW A;  4MMN A;  3BWL A;  4HIA A;  1N9N A;  5TBM A;  4EEP A;  3C30 A;  3ZQ5 A;  4EW7 A;  2GX5 A;  3LYX A;  4HP9 A;  1H8M A;  2XRO A;  3PBO A;  5AVF A;  2B02 A;  3LIA A;  4NXB A;  2OAQ 1;  4DMZ A;  5DJT A;  4WEJ A;  3UB7 A;  5KSH A;  3BQ8 A;  2PD8 A;  3KSF A;  4DJ3 A;  3B42 A;  3U2A A;  3W2Z A;  2XRN A;  2OAP 1;  4MN7 A;  2QHK A;  1T1B A;  5DKK A;  1S66 L;  4KUO A;  3E4O A;  4IJG A;  4PAU A;  3MMH A;  4ARZ A;  5LBR A;  3OCL A;  1T1C A;  4II7 A;  2J80 A;  4AFI A;  1JNU A;  1OTA A;  4L9E A;  3NHQ A;  5HPI A;  2PHY A;  2VLG A;  2ZBB A;  3FC7 A;  4EUV A;  3EGX C;  4MCW A;  2O0Y A;  3UB8 A;  3UB9 A;  4UEY A;  3HJK A;  3D3O A;  4IHQ A;  3T4K A;  5DKL A;  3LI8 A;  3H9W A;  3CUE C;  2EA9 A;  1XJ3 A;  4LRX C;  3K3C A;  3T4T A;  3HCY A;  2GJ3 A;  4LRZ E;  1H3Q A;  4G3K A;  2O9B A;  2VGL M;  3LR0 A;  3IS2 A;  2MJ6 A;  3S7Q A;  4HJ3 A;  4O8G A;  1NLZ A;  2HJ9 C;  2W3G A;  3MF0 A;  1P0Z A;  3LIE A;  1S1Y A;  3R7W B;  1ZHH B;  3EQV A;  3BQA A;  3MQQ A;  2DMW A;  2M7V A;  3CIT A;  4IUH A;  1OTD A;  1N9O A;  2A24 B;  2BAS A;  3VE4 A;  4BBU A;  1P9W A;  4LLO B;  2Y8H A;  4CLC A;  4R38 A;  5F68 A;  4EU0 A;  3JVU A;  2D01 A;  2PD7 A;  2Y79 A;  3OLO A;  3TJZ C;  2W1T A;  1T1A A;  3R4K A;  3KX0 X;  2NUT C;  3PBT A;  4WN5 A;  3T4Q A;  2EWW A;  4HJ6 A;  3B33 A;  4FSF A;  4QPR A;  4HP4 A;  4KUK A;  3LR5 A;  4GJ4 A;  2W27 A;  2K7S A;  1W63 Q;  2ZOH A;  3LR4 A;  5F6A A;  3LIB A;  1F9I A;  3P7N A;  3FG8 A;  4GHI A;  2J3T C;  2M7U A;  2R78 A;  1T18 A;  3KSH A;  4G3W A;  4M4X A;  3FPV A;  2W3D A;  2YKF A;  4ETZ A;  4G3V A;  4Q0I A;  3GEC A;  3MR0 A;  5HWV A;  5G4Z A;  3KYQ A;  2JKT M;  4GS9 B;  2V0U A;  3F1O A;  4HH3 A;  4I38 A;  3PR6 A;  3OC2 A;  2JHE A;  1T19 A;  1P97 A;  4HHD A;  1GSX A;  1MKM A;  2O99 A;  4B9O A;  3NOP C;  5MC7 A;  4KQD A;  4I3A A;  3A0S A;  3IBR A;  5HWW A;  2XSS A;  4BBT A;  2Z6C A;  2ZMF A;  1IOU A;  4ZRR A;  4HOI A;  4FOF A;  4PKY A;  4R3A A;  1LSV A;  3CI6 A;  4RQ9 A;  3RFB A;  3S7N A;  5J7E A;  1XJ6 A;  5TJJ A;  2EWV A;  2J3T D;  5DFX A;  3IBJ A;  3MJQ A;  3EQU A;  4L9G A;  3DBA A;  4UQI M;  4EER A;  3F1N A;  1DP6 A;  1NRJ A;  4XT2 A;  2LB5 A;  5I5L A;  3PXP A;  4NXG A;  2W3H A;  2B18 A;  1LT0 A;  1MC0 A;  4BWI A;  5IU1 A;  4LRY C;  3NJA A;  3CWF A;  4F3L A;  1YSP A;  3H82 A;  1DP8 A;  1VHM A;  5HDC A;  3UE3 A;  2LB9 A;  3F1P B;  3VOL A;  3H7W A;  2VGL S;  3C38 A;  1EW0 A;  5C5K A;  1W63 M;  1S4S A;  5IT5 A;  1VB6 A;  3BY9 A;  5TBM B;  2OWH A;  5HZH A;  1D06 A;  5HDS A;  4YWZ A;  1MZU A;  2YKH A;  3B47 A;  3K2N A;  3MQO A;  2HJE A;  5FL3 A;  2VV8 A;  4DJ2 A;  4WF0 A;  4I5S A;  3TE8 A;  2XA7 S;  1DP9 A;  3UE6 A;  4EEU A;  5K5B A;  1F5M A;  2O9A A;  4HNB A;  4Y3I A;  4PKY G;  1OT6 A;  2I9V A;  2Z6D A;  5F5Y A;  3ICY A;  5G4Y A;  3KSG A;  1TS6 A;  2L4R A;  1G28 A;  3MFX A;  2XA7 M;  5HL6 A;  5DJU A;  1IFQ A;  1NLY A;  1NWZ A;  4NEE D;  2VA0 A;  5J4E A;  4ARZ B;  1LSX A;  3EWK A;  3T50 A;  5DF9 A;  2V1B A;  4WEL A;  3K3D A;  4HH2 A;  4OOM A;  2KDK A;  2GZA A;  3BW6 A;  1XJ2 A;  4HQA A;  2QYB A;  4OOL A;  3UMD A;  3H82 B;  2JN7 A;  3PHY A;  2PDR A;  3G6O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...