1ACFA

Acanthamoeba castellanii profilin ib
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
125
structure length
125
Chain Sequence
SWQTYVDTNLVGTGAVTQAAILGLDGNTWATSAGFAVTPAQGTTLAGAFNNADAIRAGGFDLAGVHYVTLRADDRSIYGKKGSSGVITVKTSKAILVGVYNEKIQPGTAANVVEKLADYLIGQGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Contractile protein
molecule keywords PROFILIN I
publication title X-ray structures of isoforms of the actin-binding protein profilin that differ in their affinity for phosphatidylinositol phosphates.
pubmed doi rcsb
source organism Acanthamoeba castellanii
total genus 34
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 1994-07-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.30 Alpha Beta 2-Layer Sandwich Beta-Lactamase Dynein light chain 2a, cytoplasmic 1acfA00
2VK3A 3MSHA 1F2KA 2ZL1B 3MS6A 3LGOA 1SZVA 2ZL1A 2PBDP 1CJFA 3T1SA 1HLUP 3L9KA 3KYEA 1D1JA 3T12B 4QWOA 1ACFA 1A0KA 1Y4OA 3T1XA 2HZ5A 4X1MA 4X25A 1SKOB 4FTXA 1K0KA 1SKOA 4FUWA 3U4LP 3NECA 5EVEA 5EM1A 1VEUB 3UB5P 3L7HA 5FEGA 1VEUA 2E8JA 2BTFP 3D9YA 3DAVA 1Z09A 1CQAA 1VETB 1YPRA 4ESPA 3LEQA 4X1LA 1VETA 5FDSA 3T1QB 3CHWP 1J3WA 2JKFA 1AWIA 5EM0A 1PNEA 2PAVP 1FILA 1PFLA 2JKGA 1CF0A 1FIKA 3CPTB 1PRQA 2ACGA 3CPTA 2V8FA 3NULA 2B95A 2V8CA 4D60A 5EV0A 2PRFA 3T1RA 5FEFA 1G5UA
chains in the Genus database with same CATH superfamily
4HH2A 3CAXA 2MJ6A 3E0YA 4JGOA 2Y59A 3MZFA 2WKIA 1W5DA 2PBDP 1OPXA 5F82A 3G35A 3ITBA 1MY8A 2ZMFA 4B88A 3DTEA 4IBXA 4LCLA 5FA7A 4H6JB 4K91A 4QWOA 5CGSA 4JF4A 1K57C 3CUEC 3KYQA 2O9BA 3ZQ5A 3PHYA 2Y2GA 4EEUA 5JYPA 4R6LA 3VE4A 3SS5A 3QP5A 5GLDA 2W1TB 4L9GA 4R23A 3H9WA 3HLEA 2ZC4B 3HL9A 2HGVA 3DW0A 3LYXA 1U60A 1ESUA 3HJIA 4BD0A 1FCOA 4BBUA 3KSGA 2WKRA 5EFWA 4ESPA 4UA7A 3SOIA 4C6YA 3LIAA 4KZ9A 3GTCA 1YAXA 4HNBA 1TS8A 2Q0OA 3BECA 3HVFA 4MBHA 4R3JA 2PU2A 3Q7VA 5HAPA 3V5MA 4LRZE 4N9KA 5CHUA 4C3QA 2ZMAA 4JLFA 3JPUA 2P08A 5L2FA 1NYMA 1XX2A 2OV5A 4LCMA 2HDUA 1YM1A 3S7QA 2M7VA 3VP2A 4JPMA 3CI6A 3EEAA 3BQ8A 5AVFA 4UQIM 1DY6A 2W1RA 5HDCA 2OAP1 4HP4A 3BFGA 1W79A 1FQGA 1K56D 3LCEA 3N8RA 3ZCZA 3T1XA 2HZ5A 5CECA 3VFFA 5CERA 4IUHA 3Q81A 4OONA 4RA7A 2W3FA 1BLCA 2V9AA 4ZBEA 5FQJA 4GHIB 1LHYA 3IH9A 2Y4AA 5CTNA 3C8CA 1P9WA 2BASA 1DP8A 3MMHA 3LICA 4X1LA 3HLBA 4ME4A 3KX0X 1JTGA 3C38A 5IS1A 1XJ4A 1WE4A 2Y2IA 4WBGA 1J9MA 2H0TA 4BQMA 5EVIA 4B9OA 1OTBA 3BY8A 1I5QA 3O88A 3NDGA 4QU3A 4I3AA 3LY3A 1IEMA 3AGFA 4WZ5A 4IUKA 3MQ0A 3DBAA 4KZ4A 5EVLA 4YWZA 5A8BA 3E2KA 4S2LA 4KQDA 3BLSA 2OWHA 1K6SA 3UPOA 4P6ZM 2VKSA 1P0ZA 2JKRM 4D60A 3FYZA 3K3CA 2XK1A 2X71A 1GHPA 3ICYA 2ZLYA 3HCYA 2PR5A 4X53A 2PBYA 4BJPA 2K2NA 1HTZA 4B4ZA 4Y5FA 4DXCA 1S0WA 3VE3A 3T12B 1L2SA 4HHDA 2V2FF 4ARZA 4Q0IA 1S6RA 4BL3A 1BTLA 2Z2LB 2OSUA 3B3XA 3T50A 1E3UD 1ES3A 1KOUA 4E3LA 2DMWA 3MXQA 3EQVA 2C5WB 4RVAA 2VZWA 5M18A 3CWFA 4HBUA 4GZBA 4OLDA 3O3VA 3CUEA 2W3EA 4OQIA 2PDRA 4CLCE 5TGFA 3T4TA 5KIZA 2E8JA 4JGPA 4GDBA 3UPPA 1Z09A 4LV1A 3A0RA 5FQQA 4EWFA 1DRMA 1FOFA 5J7EA 5E2EA 1G6AA 3PAEA 4OQ0A 1MPLA 5CEBA 4X55A 3S4XA 1XGJA 5FQKA 1FILA 2QWSA 3G32A 4KZBA 5IHVA 4JGQA 3H7WA 4X68A 1OJ5A 4E3MA 3IX4A 2WAFA 1FCMA 4JKTA 2I9VA 4EQ1A 1AXBA 3SH7A 1STZA 2J3WA 1CEFA 1S1YA 3BY9A 1FR6A 4FSFA 4F3LA 4OOLA 2QYBA 3C5AA 5U47A 3QP8A 5AQ9A 5CEDA 2DCFA 4Y0OA 4P6BA 4Y17A 3IXHA 2LB5A 2PT7A 2HP5A 1QMEA 4UQIS 1D7EA 4XUZA 5G18A 2VEAA 1TVFA 1YLZA 4BBTA 1LL5A 2GNXA 4MCWA 3UDFA 4S2KA 4LGWA 5HW3A 2A24A 2XFTA 3E4PA 2H0YA 3U4LP 4R0QA 3H82A 4S2NA 5TR7A 1SDEA 1MKIA 5I94A 5HD5A 3KO6A 1I2WA 1VEUA 2BTFP 5FI2A 2J9OA 2ZC5B 2HJEA 3VP1A 4R4SA 4HH3A 4GS9A 2WK0A 3V67A 5HWVA 4CLCA 3UO9A 4DXBA 2PU4A 1DP6A 4WZ4A 2P04A 1J3WA 3G2YA 4UA9A 1AWIA 1MXOA 2IWDA 3G2ZA 2V0WA 1PNEA 3Q7VB 3PAGA 3ULFA 1XJ6A 5AJGA 4O0PA 1KGFA 1L0DA 1PFLA 4GN2A 3NOPC 3BM6A 4MBKA 1G6OA 1GSVA 4L9FA 1RGYA 2ZQ7A 5HARA 1K38A 4MN5A 3CPTA 3OLOA 1K25A 2B95A 4O7DA 3UB7A 2V8CA 2JCHA 1FR1A 3IWIA 3IQAA 3IH8A 3JVUA 4OP5A 5C5KA 4P6ZS 4WM9A 1ES2A 3HLGA 3BLMA 1OT6A 1BLSA 2FZ0A 1O07A 1GSXA 2HJ9C 4X6TA 1ZHHB 5CRFA 3L9KA 3DTIA 4YOFA 3CJMA 1S1ZA 2FFYA 3WS1A 5M19A 3QP6A 3DWKA 3IWQA 4RX2A 1OTAA 2ZC6B 4MMNA 5KZHA 2Y2QA 4X1MA 3KSFA 4NXBA 2Y91A 4FTXA 2OLVA 3D3OA 3RXWA 3ISGA 3MFXA 2W0NA 2K31A 2QHKA 5DF7A 1P9RA 4JF6A 2EA9A 3M2JA 3ZG9B 1XPBA 2NUTC 3PBOA 1CEGA 2YKFA 4NKPA 1ES4A 1PW8A 4LPZA 4P85A 3QP1A 2HPBA 3ITAA 4DE1A 1YPRA 4ETXA 2AVXA 2QPNA 1NLZA 4HIAA 4EQIA 3QP2A 2XA7M 1Y54A 3CZDA 5EVIB 4Y3IA 5EM0A 1M40A 4EU0A 4HQAA 4JXSA 1LT0A 5EVIC 1FCNA 3OOVA 4DF6A 3N8LA 1PRQA 4QHCA 1YLWA 3OPRA 4WZ5C 4ID4A 4P0MA 5HSQA 3EGDC 2UWXA 2W27A 4KG2A 4DE2A 5CXWA 5EVID 3NOUC 3WS4A 2W3HA 1W63Q 1UWNX 1IYOA 2H10A 2RCXA 3HLFA 4Y0UA 3LI9A 5L07A 3MF0A 1L3LA 3P01A 5AQ7A 3K3DA 3BJNA 1Y4OA 2ZC3B 4WELA 4E04A 1H8ZA 1K0KA 2XEPA 3UDXA 2Y2MA 2HP6A 3GQZA 2XD5A 3NECA 4QB8A 4R70A 5I5LA 4DDYA 3OC2A 1EWZA 3AGEA 2Y2NA 3MZEA 2IWBA 1OJGA 1QMFA 3ZYTA 4OOYA 5FL3A 2G2WA 4R1GA 1PW1A 4LV0A 1VETA 5FDSA 1YKDA 4HESA 3NHQA 3ZDJA 4JF5A 2XDMA 2Y55A 5HPFA 1NRFA 1W7FA 2INWA 1Q2PA 1ZG6A 2P9VA 5FSRA 4F94A 1ERMA 1EI5A 2J8YA 3H7WB 5FI7A 3F1OA 3CITA 2Y2HA 1TDLA 1TD5A 3B47A 3C30A 3R7WA 1IELA 3HUOA 4S2PA 5EOEA 2ZBBA 4UHUA 2M1CA 3UNWA 5FQ9A 2EWWA 3MFDA 2R78A 3ZNTA 1NZUA 4KG5A 1E25A 3FG8A 3GV9A 4F3LB 3IXBA 3LR5A 2ZL1A 3FZCA 2BLSA 3CG5A 4KZ5A 4QD4A 5GLBA 1HLUP 3BFCA 4EW7A 4S2IA 1XFNA 5IT5A 2PD7A 3K2NA 2VGLM 4IVIA 3VV4A 4PKYG 1WYBA 1MWRA 1DJBA 1YSPA 2Q9MA 1PZOA 5G4ZA 3PYPA 2XGNA 4X25A 2WUQA 4WN5A 2A24B 3VOZA 3KSIA 1PZPA 3IHAA 5G4YA 3LIBA 3H82B 3HBRA 2O99A 5HDDA 3O86A 4OPRA 2ZD8A 2Q9NA 1ESIA 1HVBA 1VEUB 3W4OA 3EQUA 2QZ6A 4KQRA 4S2NC 1G28A 4ETZA 4GS9B 1XXMA 3D4FA 3U2AA 4EXOA 1NZOA 2QJ7A 3S1YA 3LR3A 3M6HA 4E6WA 5AQAA 4HP9A 3FPVA 4FOFA 3SS3A 4IEDA 4EBNA 2ZC7A 4BWIA 2L1MA 4CLCC 1JTDA 4IBRA 5DTTA 4KZAA 3IHBA 2LB9A 2XA7S 3FV7A 1HD8A 3OPHA 1FIKA 1I2SA 3CPTB 4A5RA 2FH5A 2Z6DA 3NCKA 1H0MA 3HLDA 5DTSA 1ONHA 3S22A 4FH2A 2Y2KA 4WEKA 4IVKA 3ZG7B 2ZOHA 2VK3A 5J8XA 1JWVA 3P09A 3MS6A 2XF3A 3QNCA 3LGOA 4NK3A 1ALQA 4BL2A 1CJFA 1UWPX 3PXPA 2WAEA 1GA0A 2J7VA 2V1AA 4ZTKA 1D1JA 3G34A 4N92A 4LRXC 5GLAA 2Y2JA 1N9LA 3W2ZA 3IXDA 2ZOIA 4GCZA 5A91A 2C6WB 4FUWA 5TBMA 3G4PA 4GD6A 5EUAA 5EM1A 3V39A 3MQOA 5FQIA 5F68A 1IFQA 3NJAA 3WWXA 4JBFA 5KSCA 1JVJA 3FWLA 1IKGA 1P97A 3I7JA 5DF8A 2EX2A 3ZVTA 1ZC2A 5MC7A 4PKYA 1OTIA 3C7VA 1MZUA 2JN7A 3NI9A 1NY0A 4QY5A 1TEMA 5F69A 5F83A 3LI8A 1S4SA 2WZXA 1H8MA 4NXEA 2OAQ1 1F5MA 2E8IA 4OLGA 3UE0A 5D3OA 2HDQA 2WZZA 1T1BA 3JYIA 3P98A 1H8YA 3WS5A 1KGGA 3N7WA 4EUVA 4DN0A 2L4RA 1C3BA 4S2OA 2J3TC 4O01A 1TDGA 5FEFA 4ZJ1A 1F2KA 3FC7A 1TF1A 1BULA 4KG6A 1XKZA 1F98A 1TS0A 1MC0A 4ZJ2A 4OH0A 4EERA 5FQMA 5CX7A 4PM5A 4OPZA 4WEJA 1N4OA 3C4OA 4EV4A 1ONGA 4DKIA 2HDRA 2EXBA 2VGLS 3G31A 5E2HA 2VV8A 1N9NA 1YQSA 3DTMA 2PYPA 5FAQA 3RH8B 1MWSA 1D06A 4M4XA 2O0YA 5CGXA 1EW0A 2Y2LA 3UE6A 5K5BA 3UY6A 1CI9A 4KUOA 3BRMA 2JKTI 1VETB 4X69A 4CQHA 4HBTA 3IF5A 3V3RA 4GDNA 5J3WA 4B93A 4ZAMA 1TS7A 1ZTUA 1HZOA 3P7NA 5F1FA 1YMSA 1JWPA 4ZDXA 1CF0A 3R7WB 2A49A 3OCLA 4E3JA 5DF9A 4XT2A 3C4PA 3BFEA 4MEZA 3BYDA 2O9AA 1RCJA 2BG1A 1BT5A 4OQHA 2GZAA 1YT4A 2RL3A 3MSHA 1ZKJA 2ZL1B 3MBZA 1XA1A 4MNRA 3QHYA 3PBRA 3AGDA 3FPWA 4Y15A 4E3NA 2ZQ9A 3IXGA 2XR0A 1K55C 5HAQA 2PYRA 4H8RA 3VP0A 4KQQA 2IA2A 1BUEA 3NDEA 3BQAA 4QJGA 1W8YA 1PI4A 3BFDA 4LRYC 5HX9A 3MKFA 4AFIA 3TG9A 2KX6A 3E2LA 1VM1A 3DWZA 4WYYA 4LFUA 1BLPA 1GSWA 2Y2PA 2EX8A 3WRZA 3OPLA 3ZG0A 3G6OA 3T4LA 3VSLA 4EESA 1PI5A 3HREA 1XP4A 1KGEA 5DVAA 1G68A 5TJJA 4GKUA 3T1QB 2WGVA 2OOLA 1OMEA 5AQBA 4GNUA 4NETA 3ZNYA 3WS0A 4NXFA 1E3UA 5GHXA 1T1CA 3QP4A 5FI6A 4DE3A 5FAOA 5DKKA 1EROA 4XUXA 2CMNA 3A3FA 3QNBA 1GHIA 4Z9QA 4NEED 2P7JA 1UGUA 2HV1A 1G5UA 3OZHA 2X01A 3VSKA 4Y2FA 3ZGAB 4GLQA 2V1ZA 3B42A 3IBJA 3S7OA 1SZVA 2P74A 3TW8A 1MKMA 3KSHA 5DTKA 3N6IA 5DJTA 4GOGA 2XD1A 3M2KA 4LLOB 2OLUA 2G7UA 2PD8A 3FKVA 3RFBA 5IU1A 4R38A 2EXAA 2CC1A 5DFYA 1E4DA 1SCWA 1N9OA 2KLIA 1LSXA 2GX5A 5DFXA 5TBMB 1LL8A 2R9WA 1OT9A 4D2OA 4WF0A 1FSWA 2H28A 4ARZB 3LIFA 4ZJ3A 5DJUA 4U0XA 2XFSA 3F1PA 2ZJ9A 1KVMA 3HLCA 5BOHA 4GW9A 4O8GA 3PBQA 3R4KA 2K7SA 5GL9A 2WKEA 3UB8A 5HZHA 5EE8A 3A3IA 4C75A 2H5SA 3LR4A 1L0GA 1NXYA 5FASA 1RP5A 3T4QA 1W8QA 3EOIA 2VA0A 4R3AA 3HLWA 2FFFB 1V9YA 4L0LA 2ACGA 4N9LA 4E3OA 4MN6A 2HP9A 3RXXA 3S7PA 4BBVA 3N8SA 5M1AA 4WMCA 3SH9A 4UA6A 2X02A 1MBLA 3VFHA 3T4OA 1K54A 5F1GA 1VHMA 1K6RA 4RX3A 4GB7A 3VMAA 5GHYA 4WUJA 3VOLA 3GRJA 4EBLA 4U3TA 2G2UA 1T19A 4PHTA 1W63M 3OCNA 1XJ3A 5KSHA 4I3JA 5L8MA 1PWDA 3OPPA 4NG2A 1YMXA 4G3VA 2ZQDA 5FAPA 5KMWA 2WGWA 1BZAA 3IS2A 1NRJA 1SKOA 1K55A 1VB6A 1Q2QA 2VV6A 3MZDA 5EVEA 1Z6FA 2EX6A 2JC7A 2Z6CA 4DJ3A 1WYCA 3T4SA 1LL9A 2PHYA 1BYWA 4OPQA 4Z1WA 2A3UA 5L09A 2WKQA 4I3IA 5HD3A 4GJ4A 4KUKA 1IOUA 1S67L 2O9CA 4HI4A 4DE0A 5HWWA 4OKPA 1K4FA 3GMWA 5E2FA 4FH4A 3LEZA 3UB6A 3VP4A 3GDIA 5LBRA 3NY4A 4UEYA 2HF6A 3W8KA 4XT2B 5EECA 4CLCB 3TRCA 3IT9A 1ERQA 2KDKA 3MKEA 3T4JA 2UV0E 3IF6A 1X0OA 4OOMA 5F6AA 1CK3A 2V8FA 2JE5A 3NULA 4RQ9A 2WGIA 5EOOA 3UE1A 3MQQA 3HUMA 4N1XA 3NC8A 4K08A 4EUZA 3C7UA 4KENB 4M3KA 3RJUA 4P87A 2V0UA 2JHEA 3DTKA 2ZM0A 3UMEA 3WRTA 2VX8A 4G3KA 4JXGA 4CLCD 5AVEA 1PIOA 1F9IA 2JKRI 4XXRA 5GLCA 4PM6A 4R4RA 4I39A 3OBFA 2R9XA 4Q0HA 2V1BA 5EPHA 4LV2A 4OVDA 4BENA 4E3IA 4Y7PA 2HDSA 2W3GA 4KZ6A 1YSQA 2WYXA 1YLYA 3UB5P 3D72A 3EEHA 3L7HA 3M6BA 3DAVA 3F1NA 4OPYA 2W3DA 2XH9A 3KYZA 3W4QA 2I72A 5CTMA 2D01A 4K0XA 4GD8A 4R3BA 4BLMA 1H3QA 3PTEA 2EX9A 3NBLA 3RTYA 1XFQA 1O7EA 4FD8A 1ES5A 1H5XA 5FDHA 1NJ4A 3MXRA 2VJWA 1BLHA 2B02A 4DJ2A 3LUQA 3N4IA 3TE8A 1YLJA 4OP8A 3UN7A 3WS2A 3PR6A 5JYOA 2EFUA 4K0WA 1T18A 5EV0A 3T1RA 2WADA 3Q7ZA 1DJAA 3TOIA 4DRTA 2J80A 3ZG5A 2XRNA 4BD1A 4DMZA 4HY8A 3V50A 4G3WA 1LSVA 2B18A 2JBFA 2XLNA 4KQOA 1MWUA 4FCFA 4KZ3A 3UB9A 1NYYA 1K57A 5CGWA 4EETB 4MBFA 1IYQA 1JNUA 3LY4A 4H6JA 4PPRA 2VGJA 4RYEA 4PMAA 1T1AA 3GECA 1GCEA 4X56A 4EEPA 4BMWA 3LFVA 1DP9A 3PBSA 2D02A 1OTDA 5HL6A 5L10A 2Y79A 1TS6A 2W1TA 3BWLA 3SS4A 3T4KA 2B5RA 2QJ5A 2J3TD 3UMDA 4PM7A 3CLOA 3F1PB 5HAIA 3TJZC 3MR0A 4HJ4A 3HUNA 4KZ8A 5E2GA 3UE3A 3G30A 4Y13A 3CMZA 3LEQA 4I5SA 1KDSA 4CPKA 1V9ZA 5TFQA 1PYYA 2ZMVA 3Q1FA 1BSGA 3IX3A 4Q8IA 4WLAA 2Y8HA 1WA9A 3GR2A 1KVLA 3V3SA 3UPNA 3ZVWA 3MXSA 3ZG8B 4Q0JA 2IWCA 4E3KA 2XROA 4Y0TA 2QMIA 1KDWA 5HFOA 3NOTC 1GHMA 4U0TA 1K56A 3IBRA 3C2WA 3EWKA 1YLTA 2P9VB 2WKPA 3E98A 4KZ7A 1K4EA 4MN7A 2XQZA 2VV7A 3F1OB 4OQGA 1M6KA 3UDIA 3SW1A 1KE3A 3S7NA 2GJ3A 4JGRA 5J4EA 1ZG4A 5A90A 1K54C 4HJ3A 5A93A 1LSWA 4S2MA 4QY6A 2JKTM 2WGWB 1LLBA 1A0KA 4S2JA 4I38A 3JVVA 3IS2B 3LR0A 1NLYA 1XJ2A 4WMCD 1SKOB 5A92A 2OWJA 4YFMA 3HJKA 3TSGA 2GDNA 3EGXC 4QPRA 2V20A 1LI0A 4B4XA 1IYPA 4GHIA 5HPIA 4LV3A 3LO7A 1OTEA 3D9YA 2XSSA 4PAUA 3O5YA 1CQAA 1SKFA 3Q07A 5F5YA 2J9PA 1XA7A 1L0EA 2ZQCA 2ZQAA 3PBNA 4MDZA 2JKFA 1KE4A 4IJGA 3B33A 1L0FA 1YLPA 3A3DA 2PAVP 3PBTA 2ZM8A 4E6XA 1LI9A 2VGKA 1JWZA 2A2LA 3IF6B 3A0SA 3IX8A 1SHVA 5CHJA 3LIEA 4HOIA 2DRWA 3BEBA 5E43A 1ODVA 3IF6C 1FSYA 4CJNA 3IWOA 4WL9A 2EFXA 3T1SA 4UAAA 1VQQA 2PR6A 4LENA 2ZQ8A 3GVBA 3SH8A 3KYEA 4JXVA 1ACFA 1PWGA 2Z2MB 5GHZA 1PWCA 1S66L 3GSGA 5HL1A 4PM8A 1RGZA 2DNSA 2L0WA 3BW6A 1IKIA 3BFFA 3W4PA 5HWTA 1Y28A 4L9EA 3A3JA 4MLLA 1DJCA 3VP3A 2NUPC 3F1NB 4HJ6A 4DDSA 5FEGA 3NIAA 2Y2OA 2VLGA 3E4QA 3SZTA 1KE0A 4N1HA 1NWZA 3A0VA 1XGIA 1MWTA 5HDSA 3A3EA 4ZRRA 3CHWP 2EWVA 4IHQA 3FKWA 3Q82A 4II7A 4YNRA 3MJQA 1S4RA 5FATA 2M7UA 1GA9A 3O87A 3LIDA 5CHMA 1N9BA 4EBPA 3E4OA 2KOIA 2ZM2A 2JKGA 3ZFZA 4NXGA 4JXWA 4YINA 2YKHA 1CI8A 2QKPA 1SDNA 3ZHHA 5DKLA 2WKHA 4HEFA 1IYSA 3VOYA 2PRFA 4PM9A
chains in the Genus database with same CATH topology
2VK3A 3MSHA 1F2KA 2ZL1B 3MS6A 3LGOA 1SZVA 2ZL1A 2PBDP 1CJFA 3T1SA 1HLUP 3L9KA 3KYEA 1D1JA 3T12B 4QWOA 1ACFA 1A0KA 1Y4OA 3T1XA 2HZ5A 4X1MA 4X25A 1SKOB 4FTXA 1K0KA 1SKOA 4FUWA 3U4LP 3NECA 5EVEA 5EM1A 1VEUB 3UB5P 3L7HA 5FEGA 1VEUA 2E8JA 2BTFP 3D9YA 3DAVA 1Z09A 1CQAA 1VETB 1YPRA 4ESPA 3LEQA 4X1LA 1VETA 5FDSA 3T1QB 3CHWP 1J3WA 2JKFA 1AWIA 5EM0A 1PNEA 2PAVP 1FILA 1PFLA 2JKGA 1CF0A 1FIKA 3CPTB 1PRQA 2ACGA 3CPTA 2V8FA 3NULA 2B95A 2V8CA 4D60A 5EV0A 2PRFA 3T1RA 5FEFA 1G5UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VK3 A;  3MSH A;  1F2K A;  2ZL1 B;  3MS6 A;  3LGO A;  1SZV A;  2ZL1 A;  2PBD P;  1CJF A;  3T1S A;  1HLU P;  3L9K A;  3KYE A;  1D1J A;  3T12 B;  4QWO A;  1ACF A;  1A0K A;  1Y4O A;  3T1X A;  2HZ5 A;  4X1M A;  4X25 A;  1SKO B;  4FTX A;  1K0K A;  1SKO A;  4FUW A;  3U4L P;  3NEC A;  5EVE A;  5EM1 A;  1VEU B;  3UB5 P;  3L7H A;  5FEG A;  1VEU A;  2E8J A;  2BTF P;  3D9Y A;  3DAV A;  1Z09 A;  1CQA A;  1VET B;  1YPR A;  4ESP A;  3LEQ A;  4X1L A;  1VET A;  5FDS A;  3T1Q B;  3CHW P;  1J3W A;  2JKF A;  1AWI A;  5EM0 A;  1PNE A;  2PAV P;  1FIL A;  1PFL A;  2JKG A;  1CF0 A;  1FIK A;  3CPT B;  1PRQ A;  2ACG A;  3CPT A;  2V8F A;  3NUL A;  2B95 A;  2V8C A;  4D60 A;  5EV0 A;  2PRF A;  3T1R A;  5FEF A;  1G5U A; 
#chains in the Genus database with same CATH topology
 4HH2 A;  3CAX A;  2MJ6 A;  3E0Y A;  4JGO A;  2Y59 A;  3MZF A;  2WKI A;  1W5D A;  2PBD P;  1OPX A;  5F82 A;  3G35 A;  3ITB A;  1MY8 A;  2ZMF A;  4B88 A;  3DTE A;  4IBX A;  4LCL A;  5FA7 A;  4H6J B;  4K91 A;  4QWO A;  5CGS A;  4JF4 A;  1K57 C;  3CUE C;  3KYQ A;  2O9B A;  3ZQ5 A;  3PHY A;  2Y2G A;  4EEU A;  5JYP A;  4R6L A;  3VE4 A;  3SS5 A;  3QP5 A;  5GLD A;  2W1T B;  4L9G A;  4R23 A;  3H9W A;  3HLE A;  2ZC4 B;  3HL9 A;  2HGV A;  3DW0 A;  3LYX A;  1U60 A;  1ESU A;  3HJI A;  4BD0 A;  1FCO A;  4BBU A;  3KSG A;  2WKR A;  5EFW A;  4ESP A;  4UA7 A;  3SOI A;  4C6Y A;  3LIA A;  4KZ9 A;  3GTC A;  1YAX A;  4HNB A;  1TS8 A;  2Q0O A;  3BEC A;  3HVF A;  4MBH A;  4R3J A;  2PU2 A;  3Q7V A;  5HAP A;  3V5M A;  4LRZ E;  4N9K A;  5CHU A;  4C3Q A;  2ZMA A;  4JLF A;  3JPU A;  2P08 A;  5L2F A;  1NYM A;  1XX2 A;  2OV5 A;  4LCM A;  2HDU A;  1YM1 A;  3S7Q A;  2M7V A;  3VP2 A;  4JPM A;  3CI6 A;  3EEA A;  3BQ8 A;  5AVF A;  4UQI M;  1DY6 A;  2W1R A;  5HDC A;  2OAP 1;  4HP4 A;  3BFG A;  1W79 A;  1FQG A;  1K56 D;  3LCE A;  3N8R A;  3ZCZ A;  3T1X A;  2HZ5 A;  5CEC A;  3VFF A;  5CER A;  4IUH A;  3Q81 A;  4OON A;  4RA7 A;  2W3F A;  1BLC A;  2V9A A;  4ZBE A;  5FQJ A;  4GHI B;  1LHY A;  3IH9 A;  2Y4A A;  5CTN A;  3C8C A;  1P9W A;  2BAS A;  1DP8 A;  3MMH A;  3LIC A;  4X1L A;  3HLB A;  4ME4 A;  3KX0 X;  1JTG A;  3C38 A;  5IS1 A;  1XJ4 A;  1WE4 A;  2Y2I A;  4WBG A;  1J9M A;  2H0T A;  4BQM A;  5EVI A;  4B9O A;  1OTB A;  3BY8 A;  1I5Q A;  3O88 A;  3NDG A;  4QU3 A;  4I3A A;  3LY3 A;  1IEM A;  3AGF A;  4WZ5 A;  4IUK A;  3MQ0 A;  3DBA A;  4KZ4 A;  5EVL A;  4YWZ A;  5A8B A;  3E2K A;  4S2L A;  4KQD A;  3BLS A;  2OWH A;  1K6S A;  3UPO A;  4P6Z M;  2VKS A;  1P0Z A;  2JKR M;  4D60 A;  3FYZ A;  3K3C A;  2XK1 A;  2X71 A;  1GHP A;  3ICY A;  2ZLY A;  3HCY A;  2PR5 A;  4X53 A;  2PBY A;  4BJP A;  2K2N A;  1HTZ A;  4B4Z A;  4Y5F A;  4DXC A;  1S0W A;  3VE3 A;  3T12 B;  1L2S A;  4HHD A;  2V2F F;  4ARZ A;  4Q0I A;  1S6R A;  4BL3 A;  1BTL A;  2Z2L B;  2OSU A;  3B3X A;  3T50 A;  1E3U D;  1ES3 A;  1KOU A;  4E3L A;  2DMW A;  3MXQ A;  3EQV A;  2C5W B;  4RVA A;  2VZW A;  5M18 A;  3CWF A;  4HBU A;  4GZB A;  4OLD A;  3O3V A;  3CUE A;  2W3E A;  4OQI A;  2PDR A;  4CLC E;  5TGF A;  3T4T A;  5KIZ A;  2E8J A;  4JGP A;  4GDB A;  3UPP A;  1Z09 A;  4LV1 A;  3A0R A;  5FQQ A;  4EWF A;  1DRM A;  1FOF A;  5J7E A;  5E2E A;  1G6A A;  3PAE A;  4OQ0 A;  1MPL A;  5CEB A;  4X55 A;  3S4X A;  1XGJ A;  5FQK A;  1FIL A;  2QWS A;  3G32 A;  4KZB A;  5IHV A;  4JGQ A;  3H7W A;  4X68 A;  1OJ5 A;  4E3M A;  3IX4 A;  2WAF A;  1FCM A;  4JKT A;  2I9V A;  4EQ1 A;  1AXB A;  3SH7 A;  1STZ A;  2J3W A;  1CEF A;  1S1Y A;  3BY9 A;  1FR6 A;  4FSF A;  4F3L A;  4OOL A;  2QYB A;  3C5A A;  5U47 A;  3QP8 A;  5AQ9 A;  5CED A;  2DCF A;  4Y0O A;  4P6B A;  4Y17 A;  3IXH A;  2LB5 A;  2PT7 A;  2HP5 A;  1QME A;  4UQI S;  1D7E A;  4XUZ A;  5G18 A;  2VEA A;  1TVF A;  1YLZ A;  4BBT A;  1LL5 A;  2GNX A;  4MCW A;  3UDF A;  4S2K A;  4LGW A;  5HW3 A;  2A24 A;  2XFT A;  3E4P A;  2H0Y A;  3U4L P;  4R0Q A;  3H82 A;  4S2N A;  5TR7 A;  1SDE A;  1MKI A;  5I94 A;  5HD5 A;  3KO6 A;  1I2W A;  1VEU A;  2BTF P;  5FI2 A;  2J9O A;  2ZC5 B;  2HJE A;  3VP1 A;  4R4S A;  4HH3 A;  4GS9 A;  2WK0 A;  3V67 A;  5HWV A;  4CLC A;  3UO9 A;  4DXB A;  2PU4 A;  1DP6 A;  4WZ4 A;  2P04 A;  1J3W A;  3G2Y A;  4UA9 A;  1AWI A;  1MXO A;  2IWD A;  3G2Z A;  2V0W A;  1PNE A;  3Q7V B;  3PAG A;  3ULF A;  1XJ6 A;  5AJG A;  4O0P A;  1KGF A;  1L0D A;  1PFL A;  4GN2 A;  3NOP C;  3BM6 A;  4MBK A;  1G6O A;  1GSV A;  4L9F A;  1RGY A;  2ZQ7 A;  5HAR A;  1K38 A;  4MN5 A;  3CPT A;  3OLO A;  1K25 A;  2B95 A;  4O7D A;  3UB7 A;  2V8C A;  2JCH A;  1FR1 A;  3IWI A;  3IQA A;  3IH8 A;  3JVU A;  4OP5 A;  5C5K A;  4P6Z S;  4WM9 A;  1ES2 A;  3HLG A;  3BLM A;  1OT6 A;  1BLS A;  2FZ0 A;  1O07 A;  1GSX A;  2HJ9 C;  4X6T A;  1ZHH B;  5CRF A;  3L9K A;  3DTI A;  4YOF A;  3CJM A;  1S1Z A;  2FFY A;  3WS1 A;  5M19 A;  3QP6 A;  3DWK A;  3IWQ A;  4RX2 A;  1OTA A;  2ZC6 B;  4MMN A;  5KZH A;  2Y2Q A;  4X1M A;  3KSF A;  4NXB A;  2Y91 A;  4FTX A;  2OLV A;  3D3O A;  3RXW A;  3ISG A;  3MFX A;  2W0N A;  2K31 A;  2QHK A;  5DF7 A;  1P9R A;  4JF6 A;  2EA9 A;  3M2J A;  3ZG9 B;  1XPB A;  2NUT C;  3PBO A;  1CEG A;  2YKF A;  4NKP A;  1ES4 A;  1PW8 A;  4LPZ A;  4P85 A;  3QP1 A;  2HPB A;  3ITA A;  4DE1 A;  1YPR A;  4ETX A;  2AVX A;  2QPN A;  1NLZ A;  4HIA A;  4EQI A;  3QP2 A;  2XA7 M;  1Y54 A;  3CZD A;  5EVI B;  4Y3I A;  5EM0 A;  1M40 A;  4EU0 A;  4HQA A;  4JXS A;  1LT0 A;  5EVI C;  1FCN A;  3OOV A;  4DF6 A;  3N8L A;  1PRQ A;  4QHC A;  1YLW A;  3OPR A;  4WZ5 C;  4ID4 A;  4P0M A;  5HSQ A;  3EGD C;  2UWX A;  2W27 A;  4KG2 A;  4DE2 A;  5CXW A;  5EVI D;  3NOU C;  3WS4 A;  2W3H A;  1W63 Q;  1UWN X;  1IYO A;  2H10 A;  2RCX A;  3HLF A;  4Y0U A;  3LI9 A;  5L07 A;  3MF0 A;  1L3L A;  3P01 A;  5AQ7 A;  3K3D A;  3BJN A;  1Y4O A;  2ZC3 B;  4WEL A;  4E04 A;  1H8Z A;  1K0K A;  2XEP A;  3UDX A;  2Y2M A;  2HP6 A;  3GQZ A;  2XD5 A;  3NEC A;  4QB8 A;  4R70 A;  5I5L A;  4DDY A;  3OC2 A;  1EWZ A;  3AGE A;  2Y2N A;  3MZE A;  2IWB A;  1OJG A;  1QMF A;  3ZYT A;  4OOY A;  5FL3 A;  2G2W A;  4R1G A;  1PW1 A;  4LV0 A;  1VET A;  5FDS A;  1YKD A;  4HES A;  3NHQ A;  3ZDJ A;  4JF5 A;  2XDM A;  2Y55 A;  5HPF A;  1NRF A;  1W7F A;  2INW A;  1Q2P A;  1ZG6 A;  2P9V A;  5FSR A;  4F94 A;  1ERM A;  1EI5 A;  2J8Y A;  3H7W B;  5FI7 A;  3F1O A;  3CIT A;  2Y2H A;  1TDL A;  1TD5 A;  3B47 A;  3C30 A;  3R7W A;  1IEL A;  3HUO A;  4S2P A;  5EOE A;  2ZBB A;  4UHU A;  2M1C A;  3UNW A;  5FQ9 A;  2EWW A;  3MFD A;  2R78 A;  3ZNT A;  1NZU A;  4KG5 A;  1E25 A;  3FG8 A;  3GV9 A;  4F3L B;  3IXB A;  3LR5 A;  2ZL1 A;  3FZC A;  2BLS A;  3CG5 A;  4KZ5 A;  4QD4 A;  5GLB A;  1HLU P;  3BFC A;  4EW7 A;  4S2I A;  1XFN A;  5IT5 A;  2PD7 A;  3K2N A;  2VGL M;  4IVI A;  3VV4 A;  4PKY G;  1WYB A;  1MWR A;  1DJB A;  1YSP A;  2Q9M A;  1PZO A;  5G4Z A;  3PYP A;  2XGN A;  4X25 A;  2WUQ A;  4WN5 A;  2A24 B;  3VOZ A;  3KSI A;  1PZP A;  3IHA A;  5G4Y A;  3LIB A;  3H82 B;  3HBR A;  2O99 A;  5HDD A;  3O86 A;  4OPR A;  2ZD8 A;  2Q9N A;  1ESI A;  1HVB A;  1VEU B;  3W4O A;  3EQU A;  2QZ6 A;  4KQR A;  4S2N C;  1G28 A;  4ETZ A;  4GS9 B;  1XXM A;  3D4F A;  3U2A A;  4EXO A;  1NZO A;  2QJ7 A;  3S1Y A;  3LR3 A;  3M6H A;  4E6W A;  5AQA A;  4HP9 A;  3FPV A;  4FOF A;  3SS3 A;  4IED A;  4EBN A;  2ZC7 A;  4BWI A;  2L1M A;  4CLC C;  1JTD A;  4IBR A;  5DTT A;  4KZA A;  3IHB A;  2LB9 A;  2XA7 S;  3FV7 A;  1HD8 A;  3OPH A;  1FIK A;  1I2S A;  3CPT B;  4A5R A;  2FH5 A;  2Z6D A;  3NCK A;  1H0M A;  3HLD A;  5DTS A;  1ONH A;  3S22 A;  4FH2 A;  2Y2K A;  4WEK A;  4IVK A;  3ZG7 B;  2ZOH A;  2VK3 A;  5J8X A;  1JWV A;  3P09 A;  3MS6 A;  2XF3 A;  3QNC A;  3LGO A;  4NK3 A;  1ALQ A;  4BL2 A;  1CJF A;  1UWP X;  3PXP A;  2WAE A;  1GA0 A;  2J7V A;  2V1A A;  4ZTK A;  1D1J A;  3G34 A;  4N92 A;  4LRX C;  5GLA A;  2Y2J A;  1N9L A;  3W2Z A;  3IXD A;  2ZOI A;  4GCZ A;  5A91 A;  2C6W B;  4FUW A;  5TBM A;  3G4P A;  4GD6 A;  5EUA A;  5EM1 A;  3V39 A;  3MQO A;  5FQI A;  5F68 A;  1IFQ A;  3NJA A;  3WWX A;  4JBF A;  5KSC A;  1JVJ A;  3FWL A;  1IKG A;  1P97 A;  3I7J A;  5DF8 A;  2EX2 A;  3ZVT A;  1ZC2 A;  5MC7 A;  4PKY A;  1OTI A;  3C7V A;  1MZU A;  2JN7 A;  3NI9 A;  1NY0 A;  4QY5 A;  1TEM A;  5F69 A;  5F83 A;  3LI8 A;  1S4S A;  2WZX A;  1H8M A;  4NXE A;  2OAQ 1;  1F5M A;  2E8I A;  4OLG A;  3UE0 A;  5D3O A;  2HDQ A;  2WZZ A;  1T1B A;  3JYI A;  3P98 A;  1H8Y A;  3WS5 A;  1KGG A;  3N7W A;  4EUV A;  4DN0 A;  2L4R A;  1C3B A;  4S2O A;  2J3T C;  4O01 A;  1TDG A;  5FEF A;  4ZJ1 A;  1F2K A;  3FC7 A;  1TF1 A;  1BUL A;  4KG6 A;  1XKZ A;  1F98 A;  1TS0 A;  1MC0 A;  4ZJ2 A;  4OH0 A;  4EER A;  5FQM A;  5CX7 A;  4PM5 A;  4OPZ A;  4WEJ A;  1N4O A;  3C4O A;  4EV4 A;  1ONG A;  4DKI A;  2HDR A;  2EXB A;  2VGL S;  3G31 A;  5E2H A;  2VV8 A;  1N9N A;  1YQS A;  3DTM A;  2PYP A;  5FAQ A;  3RH8 B;  1MWS A;  1D06 A;  4M4X A;  2O0Y A;  5CGX A;  1EW0 A;  2Y2L A;  3UE6 A;  5K5B A;  3UY6 A;  1CI9 A;  4KUO A;  3BRM A;  2JKT I;  1VET B;  4X69 A;  4CQH A;  4HBT A;  3IF5 A;  3V3R A;  4GDN A;  5J3W A;  4B93 A;  4ZAM A;  1TS7 A;  1ZTU A;  1HZO A;  3P7N A;  5F1F A;  1YMS A;  1JWP A;  4ZDX A;  1CF0 A;  3R7W B;  2A49 A;  3OCL A;  4E3J A;  5DF9 A;  4XT2 A;  3C4P A;  3BFE A;  4MEZ A;  3BYD A;  2O9A A;  1RCJ A;  2BG1 A;  1BT5 A;  4OQH A;  2GZA A;  1YT4 A;  2RL3 A;  3MSH A;  1ZKJ A;  2ZL1 B;  3MBZ A;  1XA1 A;  4MNR A;  3QHY A;  3PBR A;  3AGD A;  3FPW A;  4Y15 A;  4E3N A;  2ZQ9 A;  3IXG A;  2XR0 A;  1K55 C;  5HAQ A;  2PYR A;  4H8R A;  3VP0 A;  4KQQ A;  2IA2 A;  1BUE A;  3NDE A;  3BQA A;  4QJG A;  1W8Y A;  1PI4 A;  3BFD A;  4LRY C;  5HX9 A;  3MKF A;  4AFI A;  3TG9 A;  2KX6 A;  3E2L A;  1VM1 A;  3DWZ A;  4WYY A;  4LFU A;  1BLP A;  1GSW A;  2Y2P A;  2EX8 A;  3WRZ A;  3OPL A;  3ZG0 A;  3G6O A;  3T4L A;  3VSL A;  4EES A;  1PI5 A;  3HRE A;  1XP4 A;  1KGE A;  5DVA A;  1G68 A;  5TJJ A;  4GKU A;  3T1Q B;  2WGV A;  2OOL A;  1OME A;  5AQB A;  4GNU A;  4NET A;  3ZNY A;  3WS0 A;  4NXF A;  1E3U A;  5GHX A;  1T1C A;  3QP4 A;  5FI6 A;  4DE3 A;  5FAO A;  5DKK A;  1ERO A;  4XUX A;  2CMN A;  3A3F A;  3QNB A;  1GHI A;  4Z9Q A;  4NEE D;  2P7J A;  1UGU A;  2HV1 A;  1G5U A;  3OZH A;  2X01 A;  3VSK A;  4Y2F A;  3ZGA B;  4GLQ A;  2V1Z A;  3B42 A;  3IBJ A;  3S7O A;  1SZV A;  2P74 A;  3TW8 A;  1MKM A;  3KSH A;  5DTK A;  3N6I A;  5DJT A;  4GOG A;  2XD1 A;  3M2K A;  4LLO B;  2OLU A;  2G7U A;  2PD8 A;  3FKV A;  3RFB A;  5IU1 A;  4R38 A;  2EXA A;  2CC1 A;  5DFY A;  1E4D A;  1SCW A;  1N9O A;  2KLI A;  1LSX A;  2GX5 A;  5DFX A;  5TBM B;  1LL8 A;  2R9W A;  1OT9 A;  4D2O A;  4WF0 A;  1FSW A;  2H28 A;  4ARZ B;  3LIF A;  4ZJ3 A;  5DJU A;  4U0X A;  2XFS A;  3F1P A;  2ZJ9 A;  1KVM A;  3HLC A;  5BOH A;  4GW9 A;  4O8G A;  3PBQ A;  3R4K A;  2K7S A;  5GL9 A;  2WKE A;  3UB8 A;  5HZH A;  5EE8 A;  3A3I A;  4C75 A;  2H5S A;  3LR4 A;  1L0G A;  1NXY A;  5FAS A;  1RP5 A;  3T4Q A;  1W8Q A;  3EOI A;  2VA0 A;  4R3A A;  3HLW A;  2FFF B;  1V9Y A;  4L0L A;  2ACG A;  4N9L A;  4E3O A;  4MN6 A;  2HP9 A;  3RXX A;  3S7P A;  4BBV A;  3N8S A;  5M1A A;  4WMC A;  3SH9 A;  4UA6 A;  2X02 A;  1MBL A;  3VFH A;  3T4O A;  1K54 A;  5F1G A;  1VHM A;  1K6R A;  4RX3 A;  4GB7 A;  3VMA A;  5GHY A;  4WUJ A;  3VOL A;  3GRJ A;  4EBL A;  4U3T A;  2G2U A;  1T19 A;  4PHT A;  1W63 M;  3OCN A;  1XJ3 A;  5KSH A;  4I3J A;  5L8M A;  1PWD A;  3OPP A;  4NG2 A;  1YMX A;  4G3V A;  2ZQD A;  5FAP A;  5KMW A;  2WGW A;  1BZA A;  3IS2 A;  1NRJ A;  1SKO A;  1K55 A;  1VB6 A;  1Q2Q A;  2VV6 A;  3MZD A;  5EVE A;  1Z6F A;  2EX6 A;  2JC7 A;  2Z6C A;  4DJ3 A;  1WYC A;  3T4S A;  1LL9 A;  2PHY A;  1BYW A;  4OPQ A;  4Z1W A;  2A3U A;  5L09 A;  2WKQ A;  4I3I A;  5HD3 A;  4GJ4 A;  4KUK A;  1IOU A;  1S67 L;  2O9C A;  4HI4 A;  4DE0 A;  5HWW A;  4OKP A;  1K4F A;  3GMW A;  5E2F A;  4FH4 A;  3LEZ A;  3UB6 A;  3VP4 A;  3GDI A;  5LBR A;  3NY4 A;  4UEY A;  2HF6 A;  3W8K A;  4XT2 B;  5EEC A;  4CLC B;  3TRC A;  3IT9 A;  1ERQ A;  2KDK A;  3MKE A;  3T4J A;  2UV0 E;  3IF6 A;  1X0O A;  4OOM A;  5F6A A;  1CK3 A;  2V8F A;  2JE5 A;  3NUL A;  4RQ9 A;  2WGI A;  5EOO A;  3UE1 A;  3MQQ A;  3HUM A;  4N1X A;  3NC8 A;  4K08 A;  4EUZ A;  3C7U A;  4KEN B;  4M3K A;  3RJU A;  4P87 A;  2V0U A;  2JHE A;  3DTK A;  2ZM0 A;  3UME A;  3WRT A;  2VX8 A;  4G3K A;  4JXG A;  4CLC D;  5AVE A;  1PIO A;  1F9I A;  2JKR I;  4XXR A;  5GLC A;  4PM6 A;  4R4R A;  4I39 A;  3OBF A;  2R9X A;  4Q0H A;  2V1B A;  5EPH A;  4LV2 A;  4OVD A;  4BEN A;  4E3I A;  4Y7P A;  2HDS A;  2W3G A;  4KZ6 A;  1YSQ A;  2WYX A;  1YLY A;  3UB5 P;  3D72 A;  3EEH A;  3L7H A;  3M6B A;  3DAV A;  3F1N A;  4OPY A;  2W3D A;  2XH9 A;  3KYZ A;  3W4Q A;  2I72 A;  5CTM A;  2D01 A;  4K0X A;  4GD8 A;  4R3B A;  4BLM A;  1H3Q A;  3PTE A;  2EX9 A;  3NBL A;  3RTY A;  1XFQ A;  1O7E A;  4FD8 A;  1ES5 A;  1H5X A;  5FDH A;  1NJ4 A;  3MXR A;  2VJW A;  1BLH A;  2B02 A;  4DJ2 A;  3LUQ A;  3N4I A;  3TE8 A;  1YLJ A;  4OP8 A;  3UN7 A;  3WS2 A;  3PR6 A;  5JYO A;  2EFU A;  4K0W A;  1T18 A;  5EV0 A;  3T1R A;  2WAD A;  3Q7Z A;  1DJA A;  3TOI A;  4DRT A;  2J80 A;  3ZG5 A;  2XRN A;  4BD1 A;  4DMZ A;  4HY8 A;  3V50 A;  4G3W A;  1LSV A;  2B18 A;  2JBF A;  2XLN A;  4KQO A;  1MWU A;  4FCF A;  4KZ3 A;  3UB9 A;  1NYY A;  1K57 A;  5CGW A;  4EET B;  4MBF A;  1IYQ A;  1JNU A;  3LY4 A;  4H6J A;  4PPR A;  2VGJ A;  4RYE A;  4PMA A;  1T1A A;  3GEC A;  1GCE A;  4X56 A;  4EEP A;  4BMW A;  3LFV A;  1DP9 A;  3PBS A;  2D02 A;  1OTD A;  5HL6 A;  5L10 A;  2Y79 A;  1TS6 A;  2W1T A;  3BWL A;  3SS4 A;  3T4K A;  2B5R A;  2QJ5 A;  2J3T D;  3UMD A;  4PM7 A;  3CLO A;  3F1P B;  5HAI A;  3TJZ C;  3MR0 A;  4HJ4 A;  3HUN A;  4KZ8 A;  5E2G A;  3UE3 A;  3G30 A;  4Y13 A;  3CMZ A;  3LEQ A;  4I5S A;  1KDS A;  4CPK A;  1V9Z A;  5TFQ A;  1PYY A;  2ZMV A;  3Q1F A;  1BSG A;  3IX3 A;  4Q8I A;  4WLA A;  2Y8H A;  1WA9 A;  3GR2 A;  1KVL A;  3V3S A;  3UPN A;  3ZVW A;  3MXS A;  3ZG8 B;  4Q0J A;  2IWC A;  4E3K A;  2XRO A;  4Y0T A;  2QMI A;  1KDW A;  5HFO A;  3NOT C;  1GHM A;  4U0T A;  1K56 A;  3IBR A;  3C2W A;  3EWK A;  1YLT A;  2P9V B;  2WKP A;  3E98 A;  4KZ7 A;  1K4E A;  4MN7 A;  2XQZ A;  2VV7 A;  3F1O B;  4OQG A;  1M6K A;  3UDI A;  3SW1 A;  1KE3 A;  3S7N A;  2GJ3 A;  4JGR A;  5J4E A;  1ZG4 A;  5A90 A;  1K54 C;  4HJ3 A;  5A93 A;  1LSW A;  4S2M A;  4QY6 A;  2JKT M;  2WGW B;  1LLB A;  1A0K A;  4S2J A;  4I38 A;  3JVV A;  3IS2 B;  3LR0 A;  1NLY A;  1XJ2 A;  4WMC D;  1SKO B;  5A92 A;  2OWJ A;  4YFM A;  3HJK A;  3TSG A;  2GDN A;  3EGX C;  4QPR A;  2V20 A;  1LI0 A;  4B4X A;  1IYP A;  4GHI A;  5HPI A;  4LV3 A;  3LO7 A;  1OTE A;  3D9Y A;  2XSS A;  4PAU A;  3O5Y A;  1CQA A;  1SKF A;  3Q07 A;  5F5Y A;  2J9P A;  1XA7 A;  1L0E A;  2ZQC A;  2ZQA A;  3PBN A;  4MDZ A;  2JKF A;  1KE4 A;  4IJG A;  3B33 A;  1L0F A;  1YLP A;  3A3D A;  2PAV P;  3PBT A;  2ZM8 A;  4E6X A;  1LI9 A;  2VGK A;  1JWZ A;  2A2L A;  3IF6 B;  3A0S A;  3IX8 A;  1SHV A;  5CHJ A;  3LIE A;  4HOI A;  2DRW A;  3BEB A;  5E43 A;  1ODV A;  3IF6 C;  1FSY A;  4CJN A;  3IWO A;  4WL9 A;  2EFX A;  3T1S A;  4UAA A;  1VQQ A;  2PR6 A;  4LEN A;  2ZQ8 A;  3GVB A;  3SH8 A;  3KYE A;  4JXV A;  1ACF A;  1PWG A;  2Z2M B;  5GHZ A;  1PWC A;  1S66 L;  3GSG A;  5HL1 A;  4PM8 A;  1RGZ A;  2DNS A;  2L0W A;  3BW6 A;  1IKI A;  3BFF A;  3W4P A;  5HWT A;  1Y28 A;  4L9E A;  3A3J A;  4MLL A;  1DJC A;  3VP3 A;  2NUP C;  3F1N B;  4HJ6 A;  4DDS A;  5FEG A;  3NIA A;  2Y2O A;  2VLG A;  3E4Q A;  3SZT A;  1KE0 A;  4N1H A;  1NWZ A;  3A0V A;  1XGI A;  1MWT A;  5HDS A;  3A3E A;  4ZRR A;  3CHW P;  2EWV A;  4IHQ A;  3FKW A;  3Q82 A;  4II7 A;  4YNR A;  3MJQ A;  1S4R A;  5FAT A;  2M7U A;  1GA9 A;  3O87 A;  3LID A;  5CHM A;  1N9B A;  4EBP A;  3E4O A;  2KOI A;  2ZM2 A;  2JKG A;  3ZFZ A;  4NXG A;  4JXW A;  4YIN A;  2YKH A;  1CI8 A;  2QKP A;  1SDN A;  3ZHH A;  5DKL A;  2WKH A;  4HEF A;  1IYS A;  3VOY A;  2PRF A;  4PM9 A; 
#chains in the Genus database with same CATH homology
 2VK3 A;  3MSH A;  1F2K A;  2ZL1 B;  3MS6 A;  3LGO A;  1SZV A;  2ZL1 A;  2PBD P;  1CJF A;  3T1S A;  1HLU P;  3L9K A;  3KYE A;  1D1J A;  3T12 B;  4QWO A;  1ACF A;  1A0K A;  1Y4O A;  3T1X A;  2HZ5 A;  4X1M A;  4X25 A;  1SKO B;  4FTX A;  1K0K A;  1SKO A;  4FUW A;  3U4L P;  3NEC A;  5EVE A;  5EM1 A;  1VEU B;  3UB5 P;  3L7H A;  5FEG A;  1VEU A;  2E8J A;  2BTF P;  3D9Y A;  3DAV A;  1Z09 A;  1CQA A;  1VET B;  1YPR A;  4ESP A;  3LEQ A;  4X1L A;  1VET A;  5FDS A;  3T1Q B;  3CHW P;  1J3W A;  2JKF A;  1AWI A;  5EM0 A;  1PNE A;  2PAV P;  1FIL A;  1PFL A;  2JKG A;  1CF0 A;  1FIK A;  3CPT B;  1PRQ A;  2ACG A;  3CPT A;  2V8F A;  3NUL A;  2B95 A;  2V8C A;  4D60 A;  5EV0 A;  2PRF A;  3T1R A;  5FEF A;  1G5U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...