1ACFA

Acanthamoeba castellanii profilin ib
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
125
structure length
125
Chain Sequence
SWQTYVDTNLVGTGAVTQAAILGLDGNTWATSAGFAVTPAQGTTLAGAFNNADAIRAGGFDLAGVHYVTLRADDRSIYGKKGSSGVITVKTSKAILVGVYNEKIQPGTAANVVEKLADYLIGQGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROFILIN I
publication title X-ray structures of isoforms of the actin-binding protein profilin that differ in their affinity for phosphatidylinositol phosphates.
pubmed doi rcsb
source organism Acanthamoeba castellanii
molecule tags Contractile protein
total genus 34
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 1994-07-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.30 Alpha Beta 2-Layer Sandwich Beta-Lactamase Dynein light chain 2a, cytoplasmic 1acfA00
5EM0A 2ZL1B 5EVEA 3NULA 1CF0A 3MSHA 3T1SA 3T1RA 1SKOA 1AWIA 3T12B 1HLUP 3CPTB 3L9KA 4D60A 1A0KA 1K0KA 1J3WA 2JKGA 1VETA 3KYEA 1PRQA 3UB5P 3T1XA 3MS6A 3LEQA 4FTXA 3T1QB 2PRFA 5FEFA 1YPRA 1G5UA 1VEUB 5FEGA 2ZL1A 2E8JA 1F2KA 4QWOA 1Z09A 1FILA 4X1LA 2B95A 2BTFP 2V8FA 2PAVP 2HZ5A 2V8CA 4X25A 1CJFA 1SZVA 3L7HA 3CPTA 1PNEA 1PFLA 2JKFA 3U4LP 1FIKA 1CQAA 2PBDP 2VK3A 3CHWP 4X1MA 1SKOB 3D9YA 5FDSA 5EV0A 1D1JA 4ESPA 1Y4OA 4FUWA 1VETB 3DAVA 3LGOA 1VEUA 3NECA 1ACFA 2ACGA 5EM1A
chains in the Genus database with same CATH superfamily
2ZM8A 3FYZA 3EGXC 4MEZA 1PWCA 4UA9A 4CLCC 2ZM2A 2Y8HA 4EETB 4ZJ3A 3ZG0A 2IWDA 3T4LA 2VGLM 4WELA 3LI8A 1GSVA 3QP8A 3LIDA 3IHBA 3WRTA 3ULFA 2KOIA 2HGVA 3MZDA 4Y0TA 2LB5A 3MJQA 3OOVA 1ONHA 3S7OA 3LR0A 2JKTM 4NETA 4EQIA 3LIFA 1YLJA 3E2KA 2ZOIA 3QNBA 2OAQ1 2ZC3B 1YQSA 3NC8A 3WS0A 4QWOA 3LIEA 3UE6A 2HZ5A 5FAQA 4MMNA 1XJ2A 4B9OA 4EWFA 3CLOA 3P7NA 1ALQA 4R4RA 2XDMA 1LI9A 4O0PA 5L07A 3SS3A 3EWKA 4QD4A 5KSHA 3Q81A 3SS5A 3EEAA 4KZ9A 4Y7PA 5FAOA 4GLQA 3EOIA 2W1TA 1DJAA 3K2NA 1CI9A 5TGFA 1VEUA 2H28A 3ZG7B 2JHEA 3S7NA 4BBUA 5DFYA 4DKIA 2WKHA 5EM0A 3KSFA 4OOMA 3Q7VB 3OPPA 4YOFA 3NULA 2PYRA 2KLIA 2WKIA 1KDWA 2ZJ9A 1PW8A 3BFDA 5FQQA 1CEGA 3C4PA 4NG2A 3F1NA 5DTSA 3T12B 3CPTB 1TS0A 2V1ZA 4OONA 1IYSA 3T50A 1ODVA 3A0VA 3PAGA 4KG6A 4QY6A 4HH3A 1EI5A 1IYPA 3UDFA 4L0LA 3N8SA 4Y0OA 5GHZA 1M6KA 3MZEA 4YWZA 2QWSA 4DJ3A 3A3DA 4DRTA 4ZTKA 3KSIA 4R70A 1G6AA 3ZHHA 2VLGA 1FILA 4IJGA 5IU1A 3LEZA 4F3LB 4BLMA 4EU0A 3FZCA 1RGYA 3F1PB 1CJFA 2B5RA 3MFDA 4LFUA 2XH9A 1SHVA 3JYIA 2J3TD 5GLAA 3U4LP 4CLCA 3Q1FA 4LGWA 5FSRA 2PD7A 5EOEA 4IEDA 3HBRA 4E3NA 3UE0A 5HFOA 4IVKA 3E2LA 5J3WA 3IBRA 2Y59A 2P7JA 2Q9NA 3IWIA 2V1BA 4PM6A 5FASA 1K56D 1ES4A 4GS9A 3D4FA 2HP9A 5DVAA 2ZQCA 3H82A 1DP8A 2XR0A 3KX0X 5L10A 3FPWA 2INWA 1LSVA 3BECA 3PBQA 4KZ4A 2WYXA 5D3OA 2JBFA 3C7VA 2XROA 4EBNA 4NXEA 4OVDA 1TS6A 2C6WB 4HJ6A 4HH2A 5AVEA 1LL5A 2PBYA 4EXOA 1HLUP 4GJ4A 2PR5A 3BM6A 2P9VA 5EVLA 4IUHA 4PM9A 3KO6A 2ZD8A 1X0OA 4JGOA 5KIZA 4I39A 2X71A 3LEQA 4JXWA 5CGWA 4UQIM 4R6LA 4P6ZS 5F5YA 3VFHA 2QHKA 3JVUA 4S2PA 3ZNTA 3FKWA 5J4EA 3BEBA 2BTFP 4LV3A 2RL3A 3T4SA 4DE0A 4Y15A 3UB7A 1K57C 4DF6A 3PBNA 2WK0A 3OZHA 1N9LA 3E4QA 3QNCA 2BASA 1GSWA 2PBDP 3W4OA 2A24A 3SH7A 3PHYA 1ERMA 4OP5A 3LR3A 4ESPA 3HUOA 3ZDJA 3UNWA 3BRMA 5E2HA 1FSYA 3NIAA 1NRFA 4OQ0A 5HL6A 3UN7A 2OWJA 3KSGA 3ZCZA 3G34A 4YFMA 4BMWA 4EERA 2O99A 1XA1A 3B47A 1NZUA 1YSPA 2Y2QA 4EBLA 4E6XA 3BY9A 1NXYA 1CF0A 3P01A 1ZG6A 4CPKA 3MFXA 4CLCD 2O9CA 2D02A 4GB7A 4E3JA 4KZ3A 2WGWB 5IS1A 1K0KA 1MPLA 4E6WA 4KZ5A 5HPFA 3N4IA 1JWVA 3KYEA 5G4ZA 3ZG9B 3UB5P 1E3UA 1DJBA 4I3IA 3BQAA 3GMWA 4XT2B 2V0UA 2EWVA 2MJ6A 4X68A 4UA7A 1LI0A 4IBRA 3BJNA 5GHXA 4GOGA 4EUVA 5AQ7A 4QJGA 3G2ZA 2PDRA 1STZA 3IT9A 3IWQA 1M40A 5DF8A 1H3QA 5JYPA 3V67A 1H8ZA 2VV7A 1XX2A 1FR1A 1LL9A 2ZMAA 1WA9A 4ZJ1A 1VM1A 3UPNA 4WN5A 1XGJA 3IS2A 4B4XA 1BLPA 4WF0A 4LLOB 4KUKA 4RA7A 1K55C 3NBLA 1TEMA 4MNRA 3IH8A 4X56A 3C8CA 1GCEA 2JKRI 2EX6A 2VGJA 3MZFA 5F68A 1C3BA 5CECA 1GHPA 1IFQA 4KZ6A 3DBAA 2WKQA 4ZJ2A 1UWNX 3MXRA 2E8IA 4Y2FA 4YNRA 4Z1WA 2XSSA 1F9IA 4QU3A 3CZDA 4B93A 3F1OA 1ZTUA 5HW3A 5I94A 3NOPC 1T19A 3R7WB 3MXSA 1VB6A 1JWPA 1JWZA 1K57A 3DTEA 1S1ZA 2JKGA 1PRQA 4M4XA 4Y17A 1NYYA 4IVIA 3UMDA 1XFQA 3QP6A 4P6BA 1W7FA 3QP5A 4Y0UA 1YAXA 3MBZA 3FG8A 3NCKA 3BLSA 1NWZA 3G30A 2JKRM 3BFEA 3HLGA 4QPRA 5EOOA 3VSKA 3A3JA 2HDUA 4E3OA 2R9WA 5TBMA 2PAVP 2Q9MA 1UGUA 4PM8A 4BL3A 3LR5A 1SZVA 5HAPA 3ZVWA 3NI9A 1D06A 1L0FA 1PFLA 4P85A 2Y91A 4PM5A 3T4OA 3HVFA 5F82A 2B18A 2W3GA 5J8XA 4HOIA 1CQAA 4LV1A 4OH0A 4S2LA 1Y28A 4B88A 4U0XA 4WZ5C 1IKIA 4FUWA 2K7SA 2QPNA 1P0ZA 5FI7A 5G18A 4DJ2A 1VHMA 1OJGA 2ACGA 4CJNA 3IF6B 2VEAA 3OCNA 4PMAA 3IXBA 4EW7A 4L9FA 5FI2A 2BLSA 3B33A 5AQBA 5HDCA 3IX8A 4K08A 3NY4A 1TS7A 2JCHA 1FQGA 4GDNA 1VETA 3N7WA 3MS6A 4ME4A 5HSQA 4DE2A 3PXPA 4HESA 2J9PA 4GNUA 3ITBA 4FTXA 4WEKA 3EQVA 3CAXA 1OT6A 1F2KA 1K55A 3SW1A 3MR0A 1WE4A 1MWSA 1E4DA 4HHDA 3T4KA 2V8CA 4HQAA 2Z2MB 1NJ4A 1OTBA 4EV4A 5M19A 1RCJA 4ZBEA 1ZKJA 3V3SA 2ZQ8A 2OV5A 1K6SA 2BG1A 3R4KA 2IWBA 1V9ZA 3O88A 4C75A 1D1JA 5HD3A 1N9OA 4BWIA 4JXGA 1SDNA 3DTKA 5GLDA 4ETZA 1N4OA 1P9RA 4WEJA 2HDRA 5CHUA 3PTEA 3VP0A 1JVJA 2L1MA 3ICYA 1YLYA 4C6YA 1PWDA 4JPMA 2EWWA 3E98A 4OPQA 4RVAA 3WS5A 2OWHA 3ZVTA 3VOLA 3S7PA 4DN0A 4N1XA 1JNUA 1BLCA 3AGDA 3GDIA 2D01A 4NKPA 1Q2QA 4UEYA 3P98A 1ZHHB 3UY6A 2ZLYA 4BBVA 1MC0A 5G4YA 2NUTC 1KE3A 2K31A 3C30A 1J3WA 4S2MA 4XUXA 3LY3A 5A93A 3G2YA 4R23A 5HWVA 5F1FA 4DE3A 1EW0A 5DJTA 4OOLA 4X6TA 4WZ5A 3LUQA 1N9BA 2XEPA 1BSGA 2W1TB 1XFNA 1PWGA 1LT0A 3WRZA 2J8YA 4KQDA 1V9YA 1VEUB 1W79A 3RXWA 2QYBA 5IT5A 2WZZA 1Z09A 4WYYA 3W4PA 4BQMA 3M2KA 1GSXA 5HDDA 1MKMA 1PNEA 2PHYA 3QP2A 2VV8A 3F1NB 3UB9A 3G4PA 5CX7A 5EV0A 5CEBA 4U3TA 1L3LA 1XJ4A 1LLBA 4WLAA 3FPVA 4I5SA 4CLCE 1KGGA 2KX6A 5E43A 2ZQDA 1O7EA 5FQ9A 1DP6A 1F98A 5DKLA 3LYXA 4H6JA 3LIAA 2W0NA 1YSQA 5E2EA 5EVEA 3C4OA 2ZQ9A 1IKGA 2ZBBA 4JF5A 2ZC5B 3WS1A 2H5SA 4JGQA 1H0MA 2J80A 3H7WA 4X69A 2XGNA 1IEMA 3FC7A 4GD6A 4GW9A 1ZC2A 1JTGA 4CLCB 5HX9A 5DTKA 1FR6A 4EBPA 4O7DA 3C5AA 1CK3A 2HDQA 3ZG5A 3BY8A 1FCOA 4MN6A 3UB8A 3UE1A 4RX2A 3PBTA 1ES3A 3QP4A 4MLLA 3ZQ5A 2LB9A 1T1BA 3RTYA 2XA7M 1TS8A 5F83A 4S2KA 3NJAA 2YKHA 4GS9B 5FEGA 2HPBA 4GHIA 2FFFB 3H82B 2B95A 1OT9A 4PM7A 3OCLA 4MN7A 1RP5A 4KZ8A 4Q0JA 1S0WA 3RXXA 3O87A 3UO9A 2M7VA 3G31A 3B42A 4I3AA 3D9YA 3PBSA 1I5QA 2EX2A 1TVFA 1S4SA 2P9VB 3IHAA 2VGLS 2WAEA 5TR7A 3S7QA 4KG2A 1DY6A 3V39A 1L2SA 1IYOA 2PD8A 1Y54A 4Z9QA 1PZPA 1QMFA 5HAQA 3HLDA 4G3WA 1L0DA 1UWPX 2UV0E 5KMWA 4X55A 3V3RA 1XJ3A 4PHTA 3TW8A 3LIBA 1G6OA 3QHYA 4N1HA 1SDEA 2G2WA 4D60A 2XF3A 4OLDA 4R4SA 4BD0A 3LI9A 2A24B 4ETXA 1D7EA 2ZC4B 3SH9A 1QMEA 2L0WA 2WZXA 1LSXA 2HV1A 3NDEA 5EVIC 3OPHA 1MY8A 1KDSA 4PKYG 4U0TA 3T1QB 3IXDA 1YPRA 3NOUC 4K0WA 3BWLA 3FV7A 1YLWA 3LO7A 2ZL1A 5EECA 5F6AA 1HVBA 2Y79A 3GR2A 4A5RA 1XA7A 1GHMA 4OLGA 2QJ7A 3VSLA 5FATA 4H8RA 4MBFA 5I5LA 4JXVA 3N6IA 4MCWA 3IX4A 3Q7ZA 2Z6DA 4OPYA 2PR6A 4MN5A 1F5MA 3GSGA 4IHQA 2VA0A 4HEFA 1MKIA 5C5KA 4X1MA 3CHWP 3IQAA 1XXMA 4HP9A 3MXQA 3T4JA 3VP3A 1YLPA 3A3FA 3A3EA 1PIOA 3G35A 4LV0A 5HARA 1NY0A 3LGOA 2G2UA 4E3LA 1YKDA 2VZWA 2Y4AA 4X53A 1W63Q 1YLZA 1G28A 1NYMA 5FQMA 4L9EA 5FQKA 2W3FA 2WGVA 2X01A 5CXWA 3CG5A 3GECA 2WAFA 5CHJA 1PZOA 3IF5A 5HZHA 1ESUA 2WKEA 3GQZA 2R9XA 1TD5A 2EFXA 1AWIA 3HCYA 2Y2NA 4HJ3A 2Y2PA 1PYYA 5CTNA 1H5XA 2WADA 4OPZA 1BTLA 3RJUA 3CMZA 2WKRA 4I3JA 4LENA 2ZC6B 5DKKA 4WM9A 3A0SA 3D3OA 1JTDA 3VV4A 3M2JA 2RCXA 5FQJA 4LV2A 2VV6A 2XFSA 4R1GA 5CTMA 1G68A 1TDGA 4Q0HA 4R3JA 2K2NA 3HLFA 4ARZA 1K54C 3C2WA 4XXRA 4LRZE 1EWZA 3T4TA 2W1RA 4OQGA 1XKZA 3F1OB 3LFVA 3O86A 4IBXA 2OLUA 4BD1A 3M6HA 3UE3A 1FSWA 5KSCA 3BYDA 4GD8A 4LCMA 3HLCA 2IA2A 2Y2GA 2GDNA 1IELA 1Y4OA 4G3VA 4RYEA 4D2OA 3CITA 5CEDA 3VP1A 2Y2LA 3LY4A 1MWTA 4OQHA 2W3EA 3NECA 2JE5A 2M1CA 3HJIA 4JGPA 3GV9A 1N9NA 3C38A 2R78A 3WWXA 4LRXC 4MDZA 5EVIA 2ZMFA 2HF6A 4UQIS 1NLZA 2Y2HA 4JBFA 1P97A 4GZBA 5TBMB 4O01A 1E3UD 1NLYA 2Y2MA 3BLMA 5A90A 5F1GA 2I9VA 4EEPA 1SKOA 4BL2A 3EGDC 3MQ0A 4NK3A 5EFWA 3PYPA 3CJMA 4PPRA 1OTDA 1LL8A 3H9WA 4N9LA 4KUOA 5JYOA 5AJGA 3OBFA 5E2FA 1KGFA 5EE8A 1Z6FA 5MC7A 3FKVA 5DFXA 1S1YA 3VE4A 5GL9A 3S1YA 1IOUA 3DTIA 3VOZA 3CI6A 1YMSA 3ZNYA 2AVXA 1XGIA 4WL9A 4Y3IA 5J7EA 2ZOHA 2P04A 3VFFA 3ZGAB 1L0EA 3L7HA 2DRWA 5HPIA 5U47A 2GX5A 1MWUA 3E4PA 3TJZC 3SS4A 2VK3A 4P6ZM 2WGIA 5FDSA 2HJEA 1HTZA 3S4XA 2I72A 3HUNA 1K6RA 4P0MA 4KQQA 1VETB 3DAVA 5TFQA 2A49A 2PT7A 4O8GA 4EUZA 2XD5A 1T1CA 4HIAA 4DE1A 2PYPA 1LHYA 3SOIA 4ZDXA 4S2OA 2W3DA 3IXHA 1BYWA 3A0RA 2Z2LB 4MBHA 5EPHA 3G6OA 4UA6A 2X02A 2C5WB 1K56A 1BULA 2DNSA 1K54A 3CWFA 1GHIA 3K3DA 2EXBA 3V5MA 3TG9A 4B4ZA 3OPLA 5BOHA 3T1XA 3DWKA 4FCFA 4HNBA 2IWCA 2PU4A 3ISGA 4Y5FA 1W8QA 1J9MA 1NZOA 2JN7A 5CHMA 5IHVA 1IYQA 1G5UA 3U2AA 1MZUA 3Q7VA 2J7VA 3P09A 5EVID 2YKFA 1I2SA 1NRJA 1I2WA 5LBRA 4HBTA 5FI6A 4JKTA 4F94A 3CPTA 3SH8A 4Q8IA 2JKFA 4HY8A 4KZ7A 5AQ9A 1HZOA 5AQAA 4E3KA 4HI4A 5FQIA 3GRJA 2ZQAA 4GDBA 3K3CA 1GA9A 2OLVA 4JGRA 3IX3A 5TJJA 4LCLA 2WUQA 1K4EA 4HBUA 2XRNA 1OTAA 1ACFA 2ZQ7A 3PBRA 5EM1A 1SKFA 5CERA 5KZHA 1OMEA 4F3LA 4Q0IA 1XPBA 1EROA 3HLWA 4OOYA 2XLNA 3F1PA 1VQQA 4PKYA 4UAAA 3OPRA 4II7A 3Q82A 3CUEC 4KZAA 4GN2A 1S4RA 2ZM0A 4Y13A 4M3KA 3DWZA 4OKPA 5L2FA 1U60A 2EX9A 3L9KA 4UHUA 4PAUA 4S2NC 1ZG4A 1A0KA 4WUJA 4K91A 4JXSA 5HL1A 3NOTC 3PBOA 1KE0A 4WMCA 4ID4A 1CEFA 1E25A 1L0GA 1ES5A 5E2GA 1O07A 4KG5A 1YM1A 1ONGA 4WBGA 3AGFA 1BUEA 1TDLA 1K4FA 4QHCA 5HAIA 4H6JB 4OPRA 3GVBA 1TF1A 1DP9A 5F69A 4EQ1A 1WYBA 5CGSA 3LCEA 3G32A 4JF6A 3E4OA 1H8YA 2VKSA 3MQQA 1H8MA 2EXAA 3ZYTA 5CGXA 2M7UA 2Y2IA 3VMAA 1W63M 4DXCA 1FIKA 4DDYA 2VGKA 3M6BA 3H7WB 5HD5A 3HLBA 2G7UA 3TOIA 4FD8A 3W8KA 3HREA 3ZG8B 3ITAA 5HDSA 2V9AA 2EX8A 4NXFA 4C3QA 2Y2JA 1Q2PA 1W8YA 4GHIB 5GLCA 3RFBA 3VP2A 3MKFA 5FA7A 5HWWA 3V50A 4QY5A 2V2FF 2ZMVA 1K25A 1W5DA 5M1AA 4EESA 1S67L 1T18A 5L09A 1MWRA 1AXBA 2ZC7A 2J3WA 4DDSA 3KYQA 3LR4A 2XFTA 2HJ9C 3IH9A 2UWXA 2Y2KA 3MQOA 3LICA 3KYZA 2QKPA 1DJCA 4CQHA 4GKUA 2O9AA 2V1AA 3C7UA 2H10A 3MF0A 1FOFA 4BBTA 3GTCA 3UMEA 3HLEA 4BENA 1XJ6A 1FCMA 1GA0A 3KSHA 3WS2A 2JC7A 1P9WA 3EEHA 2HP5A 4X1LA 3DW0A 4XUZA 2V0WA 4G3KA 4N92A 4N9KA 4HP4A 4WZ4A 3E0YA 3O3VA 5DF9A 5FAPA 1KVMA 2V20A 1LSWA 2WGWA 4GCZA 3S22A 1KE4A 4R38A 3CUEA 2Y2OA 2P74A 5GLBA 3IF6C 3IBJA 3IXGA 4XT2A 3PAEA 4WMCD 2CC1A 4LRYC 1BT5A 4DXBA 3I7JA 4I38A 4KQOA 4S2NA 2GJ3A 1K38A 5A91A 3NHQA 2VJWA 1OPXA 3B3XA 3RH8B 2PU2A 4S2JA 4E3IA 4RX3A 3JVVA 3BW6A 4NXBA 2ZL1B 3Q07A 2FH5A 1CI8A 4DMZA 3NDGA 4KQRA 4S2IA 3W2ZA 3T1RA 3UPOA 3A3IA 1OJ5A 2EFUA 2H0TA 3FWLA 3BFGA 2XQZA 1PI5A 5EUAA 4R3AA 4AFIA 5DTTA 2L4RA 1BLSA 2DCFA 2W27A 1KVLA 1PI4A 2B02A 4YINA 2GZAA 2QJ5A 2FZ0A 3BQ8A 3BFCA 3HUMA 2O0YA 2W3HA 3DTMA 4FSFA 4MBKA 3HL9A 3ZFZA 4IUKA 2CMNA 3UPPA 2OAP1 5FDHA 3PR6A 5DJUA 4RQ9A 2J3TC 2P08A 4FH4A 1MXOA 2HDSA 4K0XA 1ERQA 5CRFA 3R7WA 2A2LA 2XK1A 3IS2B 4NXGA 1HD8A 1BLHA 5GHYA 4OQIA 4FH2A 3TRCA 1T1AA 5AVFA 2HP6A 1YT4A 4KENB 1OTIA 1KOUA 3O5YA 1KGEA 2O9BA 2QMIA 3VOYA 2OOLA 3VE3A 1YMXA 1RGZA 3BFFA 4EEUA 1DRMA 1XP4A 5K5BA 2A3UA 1BZAA 4ARZB 4P87A 3WS4A 4LPZA 5FL3A 1WYCA 2XA7S 4FOFA 3MSHA 3TSGA 2NUPC 3IWOA 3W4QA 4JLFA 3T1SA 3OC2A 3AGEA 4HJ4A 2Q0OA 4L9GA 3SZTA 4E3MA 4QB8A 4NEED 1ESIA 3D72A 2QZ6A 3UDXA 5HWTA 2OSUA 3MKEA 2GNXA 3UB6A 4JF4A 1MBLA 1OTEA 2EA9A 2FFYA 5A92A 2PRFA 3T4QA 5FEFA 3IF6A 1ES2A 1PW1A 3VP4A 3QP1A 4R0QA 5M18A 2E8JA 3TE8A 4E04A 2Z6CA 1YLTA 5DF7A 3UDIA 2V8FA 5EVIB 4ZAMA 4ZRRA 4X25A 2J9OA 1S6RA 3HJKA 2H0YA 2Y55A 4KZBA 2KDKA 1FCNA 3OLOA 3N8LA 1SKOB 1S66L 3MMHA 2DMWA 3JPUA 5A8BA 4BJPA 5L8MA 1SCWA 2VX8A 3N8RA 2WKPA 4OP8A 2JKTI 4R3BA 2XD1A 3EQUA
chains in the Genus database with same CATH topology
5EM0A 2ZL1B 5EVEA 3NULA 1CF0A 3MSHA 3T1SA 3T1RA 1SKOA 1AWIA 3T12B 1HLUP 3CPTB 3L9KA 4D60A 1A0KA 1K0KA 1J3WA 2JKGA 1VETA 3KYEA 1PRQA 3UB5P 3T1XA 3MS6A 3LEQA 4FTXA 3T1QB 2PRFA 5FEFA 1YPRA 1G5UA 1VEUB 5FEGA 2ZL1A 2E8JA 1F2KA 4QWOA 1Z09A 1FILA 4X1LA 2B95A 2BTFP 2V8FA 2PAVP 2HZ5A 2V8CA 4X25A 1CJFA 1SZVA 3L7HA 3CPTA 1PNEA 1PFLA 2JKFA 3U4LP 1FIKA 1CQAA 2PBDP 2VK3A 3CHWP 4X1MA 1SKOB 3D9YA 5FDSA 5EV0A 1D1JA 4ESPA 1Y4OA 4FUWA 1VETB 3DAVA 3LGOA 1VEUA 3NECA 1ACFA 2ACGA 5EM1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EM0 A;  2ZL1 B;  5EVE A;  3NUL A;  1CF0 A;  3MSH A;  3T1S A;  3T1R A;  1SKO A;  1AWI A;  3T12 B;  1HLU P;  3CPT B;  3L9K A;  4D60 A;  1A0K A;  1K0K A;  1J3W A;  2JKG A;  1VET A;  3KYE A;  1PRQ A;  3UB5 P;  3T1X A;  3MS6 A;  3LEQ A;  4FTX A;  3T1Q B;  2PRF A;  5FEF A;  1YPR A;  1G5U A;  1VEU B;  5FEG A;  2ZL1 A;  2E8J A;  1F2K A;  4QWO A;  1Z09 A;  1FIL A;  4X1L A;  2B95 A;  2BTF P;  2V8F A;  2PAV P;  2HZ5 A;  2V8C A;  4X25 A;  1CJF A;  1SZV A;  3L7H A;  3CPT A;  1PNE A;  1PFL A;  2JKF A;  3U4L P;  1FIK A;  1CQA A;  2PBD P;  2VK3 A;  3CHW P;  4X1M A;  1SKO B;  3D9Y A;  5FDS A;  5EV0 A;  1D1J A;  4ESP A;  1Y4O A;  4FUW A;  1VET B;  3DAV A;  3LGO A;  1VEU A;  3NEC A;  1ACF A;  2ACG A;  5EM1 A; 
#chains in the Genus database with same CATH topology
 2ZM8 A;  3FYZ A;  3EGX C;  4MEZ A;  1PWC A;  4UA9 A;  4CLC C;  2ZM2 A;  2Y8H A;  4EET B;  4ZJ3 A;  3ZG0 A;  2IWD A;  3T4L A;  2VGL M;  4WEL A;  3LI8 A;  1GSV A;  3QP8 A;  3LID A;  3IHB A;  3WRT A;  3ULF A;  2KOI A;  2HGV A;  3MZD A;  4Y0T A;  2LB5 A;  3MJQ A;  3OOV A;  1ONH A;  3S7O A;  3LR0 A;  2JKT M;  4NET A;  4EQI A;  3LIF A;  1YLJ A;  3E2K A;  2ZOI A;  3QNB A;  2OAQ 1;  2ZC3 B;  1YQS A;  3NC8 A;  3WS0 A;  4QWO A;  3LIE A;  3UE6 A;  2HZ5 A;  5FAQ A;  4MMN A;  1XJ2 A;  4B9O A;  4EWF A;  3CLO A;  3P7N A;  1ALQ A;  4R4R A;  2XDM A;  1LI9 A;  4O0P A;  5L07 A;  3SS3 A;  3EWK A;  4QD4 A;  5KSH A;  3Q81 A;  3SS5 A;  3EEA A;  4KZ9 A;  4Y7P A;  5FAO A;  4GLQ A;  3EOI A;  2W1T A;  1DJA A;  3K2N A;  1CI9 A;  5TGF A;  1VEU A;  2H28 A;  3ZG7 B;  2JHE A;  3S7N A;  4BBU A;  5DFY A;  4DKI A;  2WKH A;  5EM0 A;  3KSF A;  4OOM A;  3Q7V B;  3OPP A;  4YOF A;  3NUL A;  2PYR A;  2KLI A;  2WKI A;  1KDW A;  2ZJ9 A;  1PW8 A;  3BFD A;  5FQQ A;  1CEG A;  3C4P A;  4NG2 A;  3F1N A;  5DTS A;  3T12 B;  3CPT B;  1TS0 A;  2V1Z A;  4OON A;  1IYS A;  3T50 A;  1ODV A;  3A0V A;  3PAG A;  4KG6 A;  4QY6 A;  4HH3 A;  1EI5 A;  1IYP A;  3UDF A;  4L0L A;  3N8S A;  4Y0O A;  5GHZ A;  1M6K A;  3MZE A;  4YWZ A;  2QWS A;  4DJ3 A;  3A3D A;  4DRT A;  4ZTK A;  3KSI A;  4R70 A;  1G6A A;  3ZHH A;  2VLG A;  1FIL A;  4IJG A;  5IU1 A;  3LEZ A;  4F3L B;  4BLM A;  4EU0 A;  3FZC A;  1RGY A;  3F1P B;  1CJF A;  2B5R A;  3MFD A;  4LFU A;  2XH9 A;  1SHV A;  3JYI A;  2J3T D;  5GLA A;  3U4L P;  4CLC A;  3Q1F A;  4LGW A;  5FSR A;  2PD7 A;  5EOE A;  4IED A;  3HBR A;  4E3N A;  3UE0 A;  5HFO A;  4IVK A;  3E2L A;  5J3W A;  3IBR A;  2Y59 A;  2P7J A;  2Q9N A;  3IWI A;  2V1B A;  4PM6 A;  5FAS A;  1K56 D;  1ES4 A;  4GS9 A;  3D4F A;  2HP9 A;  5DVA A;  2ZQC A;  3H82 A;  1DP8 A;  2XR0 A;  3KX0 X;  5L10 A;  3FPW A;  2INW A;  1LSV A;  3BEC A;  3PBQ A;  4KZ4 A;  2WYX A;  5D3O A;  2JBF A;  3C7V A;  2XRO A;  4EBN A;  4NXE A;  4OVD A;  1TS6 A;  2C6W B;  4HJ6 A;  4HH2 A;  5AVE A;  1LL5 A;  2PBY A;  4EXO A;  1HLU P;  4GJ4 A;  2PR5 A;  3BM6 A;  2P9V A;  5EVL A;  4IUH A;  4PM9 A;  3KO6 A;  2ZD8 A;  1X0O A;  4JGO A;  5KIZ A;  4I39 A;  2X71 A;  3LEQ A;  4JXW A;  5CGW A;  4UQI M;  4R6L A;  4P6Z S;  5F5Y A;  3VFH A;  2QHK A;  3JVU A;  4S2P A;  3ZNT A;  3FKW A;  5J4E A;  3BEB A;  2BTF P;  4LV3 A;  2RL3 A;  3T4S A;  4DE0 A;  4Y15 A;  3UB7 A;  1K57 C;  4DF6 A;  3PBN A;  2WK0 A;  3OZH A;  1N9L A;  3E4Q A;  3QNC A;  2BAS A;  1GSW A;  2PBD P;  3W4O A;  2A24 A;  3SH7 A;  3PHY A;  1ERM A;  4OP5 A;  3LR3 A;  4ESP A;  3HUO A;  3ZDJ A;  3UNW A;  3BRM A;  5E2H A;  1FSY A;  3NIA A;  1NRF A;  4OQ0 A;  5HL6 A;  3UN7 A;  2OWJ A;  3KSG A;  3ZCZ A;  3G34 A;  4YFM A;  4BMW A;  4EER A;  2O99 A;  1XA1 A;  3B47 A;  1NZU A;  1YSP A;  2Y2Q A;  4EBL A;  4E6X A;  3BY9 A;  1NXY A;  1CF0 A;  3P01 A;  1ZG6 A;  4CPK A;  3MFX A;  4CLC D;  2O9C A;  2D02 A;  4GB7 A;  4E3J A;  4KZ3 A;  2WGW B;  5IS1 A;  1K0K A;  1MPL A;  4E6W A;  4KZ5 A;  5HPF A;  3N4I A;  1JWV A;  3KYE A;  5G4Z A;  3ZG9 B;  3UB5 P;  1E3U A;  1DJB A;  4I3I A;  3BQA A;  3GMW A;  4XT2 B;  2V0U A;  2EWV A;  2MJ6 A;  4X68 A;  4UA7 A;  1LI0 A;  4IBR A;  3BJN A;  5GHX A;  4GOG A;  4EUV A;  5AQ7 A;  4QJG A;  3G2Z A;  2PDR A;  1STZ A;  3IT9 A;  3IWQ A;  1M40 A;  5DF8 A;  1H3Q A;  5JYP A;  3V67 A;  1H8Z A;  2VV7 A;  1XX2 A;  1FR1 A;  1LL9 A;  2ZMA A;  1WA9 A;  4ZJ1 A;  1VM1 A;  3UPN A;  4WN5 A;  1XGJ A;  3IS2 A;  4B4X A;  1BLP A;  4WF0 A;  4LLO B;  4KUK A;  4RA7 A;  1K55 C;  3NBL A;  1TEM A;  4MNR A;  3IH8 A;  4X56 A;  3C8C A;  1GCE A;  2JKR I;  2EX6 A;  2VGJ A;  3MZF A;  5F68 A;  1C3B A;  5CEC A;  1GHP A;  1IFQ A;  4KZ6 A;  3DBA A;  2WKQ A;  4ZJ2 A;  1UWN X;  3MXR A;  2E8I A;  4Y2F A;  4YNR A;  4Z1W A;  2XSS A;  1F9I A;  4QU3 A;  3CZD A;  4B93 A;  3F1O A;  1ZTU A;  5HW3 A;  5I94 A;  3NOP C;  1T19 A;  3R7W B;  3MXS A;  1VB6 A;  1JWP A;  1JWZ A;  1K57 A;  3DTE A;  1S1Z A;  2JKG A;  1PRQ A;  4M4X A;  4Y17 A;  1NYY A;  4IVI A;  3UMD A;  1XFQ A;  3QP6 A;  4P6B A;  1W7F A;  3QP5 A;  4Y0U A;  1YAX A;  3MBZ A;  3FG8 A;  3NCK A;  3BLS A;  1NWZ A;  3G30 A;  2JKR M;  3BFE A;  3HLG A;  4QPR A;  5EOO A;  3VSK A;  3A3J A;  2HDU A;  4E3O A;  2R9W A;  5TBM A;  2PAV P;  2Q9M A;  1UGU A;  4PM8 A;  4BL3 A;  3LR5 A;  1SZV A;  5HAP A;  3ZVW A;  3NI9 A;  1D06 A;  1L0F A;  1PFL A;  4P85 A;  2Y91 A;  4PM5 A;  3T4O A;  3HVF A;  5F82 A;  2B18 A;  2W3G A;  5J8X A;  4HOI A;  1CQA A;  4LV1 A;  4OH0 A;  4S2L A;  1Y28 A;  4B88 A;  4U0X A;  4WZ5 C;  1IKI A;  4FUW A;  2K7S A;  2QPN A;  1P0Z A;  5FI7 A;  5G18 A;  4DJ2 A;  1VHM A;  1OJG A;  2ACG A;  4CJN A;  3IF6 B;  2VEA A;  3OCN A;  4PMA A;  3IXB A;  4EW7 A;  4L9F A;  5FI2 A;  2BLS A;  3B33 A;  5AQB A;  5HDC A;  3IX8 A;  4K08 A;  3NY4 A;  1TS7 A;  2JCH A;  1FQG A;  4GDN A;  1VET A;  3N7W A;  3MS6 A;  4ME4 A;  5HSQ A;  4DE2 A;  3PXP A;  4HES A;  2J9P A;  4GNU A;  3ITB A;  4FTX A;  4WEK A;  3EQV A;  3CAX A;  1OT6 A;  1F2K A;  1K55 A;  3SW1 A;  3MR0 A;  1WE4 A;  1MWS A;  1E4D A;  4HHD A;  3T4K A;  2V8C A;  4HQA A;  2Z2M B;  1NJ4 A;  1OTB A;  4EV4 A;  5M19 A;  1RCJ A;  4ZBE A;  1ZKJ A;  3V3S A;  2ZQ8 A;  2OV5 A;  1K6S A;  2BG1 A;  3R4K A;  2IWB A;  1V9Z A;  3O88 A;  4C75 A;  1D1J A;  5HD3 A;  1N9O A;  4BWI A;  4JXG A;  1SDN A;  3DTK A;  5GLD A;  4ETZ A;  1N4O A;  1P9R A;  4WEJ A;  2HDR A;  5CHU A;  3PTE A;  3VP0 A;  1JVJ A;  2L1M A;  3ICY A;  1YLY A;  4C6Y A;  1PWD A;  4JPM A;  2EWW A;  3E98 A;  4OPQ A;  4RVA A;  3WS5 A;  2OWH A;  3ZVT A;  3VOL A;  3S7P A;  4DN0 A;  4N1X A;  1JNU A;  1BLC A;  3AGD A;  3GDI A;  2D01 A;  4NKP A;  1Q2Q A;  4UEY A;  3P98 A;  1ZHH B;  3UY6 A;  2ZLY A;  4BBV A;  1MC0 A;  5G4Y A;  2NUT C;  1KE3 A;  2K31 A;  3C30 A;  1J3W A;  4S2M A;  4XUX A;  3LY3 A;  5A93 A;  3G2Y A;  4R23 A;  5HWV A;  5F1F A;  4DE3 A;  1EW0 A;  5DJT A;  4OOL A;  4X6T A;  4WZ5 A;  3LUQ A;  1N9B A;  2XEP A;  1BSG A;  2W1T B;  1XFN A;  1PWG A;  1LT0 A;  3WRZ A;  2J8Y A;  4KQD A;  1V9Y A;  1VEU B;  1W79 A;  3RXW A;  2QYB A;  5IT5 A;  2WZZ A;  1Z09 A;  4WYY A;  3W4P A;  4BQM A;  3M2K A;  1GSX A;  5HDD A;  1MKM A;  1PNE A;  2PHY A;  3QP2 A;  2VV8 A;  3F1N B;  3UB9 A;  3G4P A;  5CX7 A;  5EV0 A;  5CEB A;  4U3T A;  1L3L A;  1XJ4 A;  1LLB A;  4WLA A;  3FPV A;  4I5S A;  4CLC E;  1KGG A;  2KX6 A;  5E43 A;  2ZQD A;  1O7E A;  5FQ9 A;  1DP6 A;  1F98 A;  5DKL A;  3LYX A;  4H6J A;  3LIA A;  2W0N A;  1YSQ A;  5E2E A;  5EVE A;  3C4O A;  2ZQ9 A;  1IKG A;  2ZBB A;  4JF5 A;  2ZC5 B;  3WS1 A;  2H5S A;  4JGQ A;  1H0M A;  2J80 A;  3H7W A;  4X69 A;  2XGN A;  1IEM A;  3FC7 A;  4GD6 A;  4GW9 A;  1ZC2 A;  1JTG A;  4CLC B;  5HX9 A;  5DTK A;  1FR6 A;  4EBP A;  4O7D A;  3C5A A;  1CK3 A;  2HDQ A;  3ZG5 A;  3BY8 A;  1FCO A;  4MN6 A;  3UB8 A;  3UE1 A;  4RX2 A;  3PBT A;  1ES3 A;  3QP4 A;  4MLL A;  3ZQ5 A;  2LB9 A;  1T1B A;  3RTY A;  2XA7 M;  1TS8 A;  5F83 A;  4S2K A;  3NJA A;  2YKH A;  4GS9 B;  5FEG A;  2HPB A;  4GHI A;  2FFF B;  3H82 B;  2B95 A;  1OT9 A;  4PM7 A;  3OCL A;  4MN7 A;  1RP5 A;  4KZ8 A;  4Q0J A;  1S0W A;  3RXX A;  3O87 A;  3UO9 A;  2M7V A;  3G31 A;  3B42 A;  4I3A A;  3D9Y A;  3PBS A;  1I5Q A;  2EX2 A;  1TVF A;  1S4S A;  2P9V B;  3IHA A;  2VGL S;  2WAE A;  5TR7 A;  3S7Q A;  4KG2 A;  1DY6 A;  3V39 A;  1L2S A;  1IYO A;  2PD8 A;  1Y54 A;  4Z9Q A;  1PZP A;  1QMF A;  5HAQ A;  3HLD A;  4G3W A;  1L0D A;  1UWP X;  2UV0 E;  5KMW A;  4X55 A;  3V3R A;  1XJ3 A;  4PHT A;  3TW8 A;  3LIB A;  1G6O A;  3QHY A;  4N1H A;  1SDE A;  2G2W A;  4D60 A;  2XF3 A;  4OLD A;  4R4S A;  4BD0 A;  3LI9 A;  2A24 B;  4ETX A;  1D7E A;  2ZC4 B;  3SH9 A;  1QME A;  2L0W A;  2WZX A;  1LSX A;  2HV1 A;  3NDE A;  5EVI C;  3OPH A;  1MY8 A;  1KDS A;  4PKY G;  4U0T A;  3T1Q B;  3IXD A;  1YPR A;  3NOU C;  4K0W A;  3BWL A;  3FV7 A;  1YLW A;  3LO7 A;  2ZL1 A;  5EEC A;  5F6A A;  1HVB A;  2Y79 A;  3GR2 A;  4A5R A;  1XA7 A;  1GHM A;  4OLG A;  2QJ7 A;  3VSL A;  5FAT A;  4H8R A;  4MBF A;  5I5L A;  4JXV A;  3N6I A;  4MCW A;  3IX4 A;  3Q7Z A;  2Z6D A;  4OPY A;  2PR6 A;  4MN5 A;  1F5M A;  3GSG A;  4IHQ A;  2VA0 A;  4HEF A;  1MKI A;  5C5K A;  4X1M A;  3CHW P;  3IQA A;  1XXM A;  4HP9 A;  3MXQ A;  3T4J A;  3VP3 A;  1YLP A;  3A3F A;  3A3E A;  1PIO A;  3G35 A;  4LV0 A;  5HAR A;  1NY0 A;  3LGO A;  2G2U A;  4E3L A;  1YKD A;  2VZW A;  2Y4A A;  4X53 A;  1W63 Q;  1YLZ A;  1G28 A;  1NYM A;  5FQM A;  4L9E A;  5FQK A;  2W3F A;  2WGV A;  2X01 A;  5CXW A;  3CG5 A;  3GEC A;  2WAF A;  5CHJ A;  1PZO A;  3IF5 A;  5HZH A;  1ESU A;  2WKE A;  3GQZ A;  2R9X A;  1TD5 A;  2EFX A;  1AWI A;  3HCY A;  2Y2N A;  4HJ3 A;  2Y2P A;  1PYY A;  5CTN A;  1H5X A;  2WAD A;  4OPZ A;  1BTL A;  3RJU A;  3CMZ A;  2WKR A;  4I3J A;  4LEN A;  2ZC6 B;  5DKK A;  4WM9 A;  3A0S A;  3D3O A;  1JTD A;  3VV4 A;  3M2J A;  2RCX A;  5FQJ A;  4LV2 A;  2VV6 A;  2XFS A;  4R1G A;  5CTM A;  1G68 A;  1TDG A;  4Q0H A;  4R3J A;  2K2N A;  3HLF A;  4ARZ A;  1K54 C;  3C2W A;  4XXR A;  4LRZ E;  1EWZ A;  3T4T A;  2W1R A;  4OQG A;  1XKZ A;  3F1O B;  3LFV A;  3O86 A;  4IBX A;  2OLU A;  4BD1 A;  3M6H A;  3UE3 A;  1FSW A;  5KSC A;  3BYD A;  4GD8 A;  4LCM A;  3HLC A;  2IA2 A;  2Y2G A;  2GDN A;  1IEL A;  1Y4O A;  4G3V A;  4RYE A;  4D2O A;  3CIT A;  5CED A;  3VP1 A;  2Y2L A;  3LY4 A;  1MWT A;  4OQH A;  2W3E A;  3NEC A;  2JE5 A;  2M1C A;  3HJI A;  4JGP A;  3GV9 A;  1N9N A;  3C38 A;  2R78 A;  3WWX A;  4LRX C;  4MDZ A;  5EVI A;  2ZMF A;  2HF6 A;  4UQI S;  1NLZ A;  2Y2H A;  4JBF A;  1P97 A;  4GZB A;  5TBM B;  4O01 A;  1E3U D;  1NLY A;  2Y2M A;  3BLM A;  5A90 A;  5F1G A;  2I9V A;  4EEP A;  1SKO A;  4BL2 A;  3EGD C;  3MQ0 A;  4NK3 A;  5EFW A;  3PYP A;  3CJM A;  4PPR A;  1OTD A;  1LL8 A;  3H9W A;  4N9L A;  4KUO A;  5JYO A;  5AJG A;  3OBF A;  5E2F A;  1KGF A;  5EE8 A;  1Z6F A;  5MC7 A;  3FKV A;  5DFX A;  1S1Y A;  3VE4 A;  5GL9 A;  3S1Y A;  1IOU A;  3DTI A;  3VOZ A;  3CI6 A;  1YMS A;  3ZNY A;  2AVX A;  1XGI A;  4WL9 A;  4Y3I A;  5J7E A;  2ZOH A;  2P04 A;  3VFF A;  3ZGA B;  1L0E A;  3L7H A;  2DRW A;  5HPI A;  5U47 A;  2GX5 A;  1MWU A;  3E4P A;  3TJZ C;  3SS4 A;  2VK3 A;  4P6Z M;  2WGI A;  5FDS A;  2HJE A;  1HTZ A;  3S4X A;  2I72 A;  3HUN A;  1K6R A;  4P0M A;  4KQQ A;  1VET B;  3DAV A;  5TFQ A;  2A49 A;  2PT7 A;  4O8G A;  4EUZ A;  2XD5 A;  1T1C A;  4HIA A;  4DE1 A;  2PYP A;  1LHY A;  3SOI A;  4ZDX A;  4S2O A;  2W3D A;  3IXH A;  1BYW A;  3A0R A;  2Z2L B;  4MBH A;  5EPH A;  3G6O A;  4UA6 A;  2X02 A;  2C5W B;  1K56 A;  1BUL A;  2DNS A;  1K54 A;  3CWF A;  1GHI A;  3K3D A;  2EXB A;  3V5M A;  3TG9 A;  4B4Z A;  3OPL A;  5BOH A;  3T1X A;  3DWK A;  4FCF A;  4HNB A;  2IWC A;  2PU4 A;  3ISG A;  4Y5F A;  1W8Q A;  1J9M A;  1NZO A;  2JN7 A;  5CHM A;  5IHV A;  1IYQ A;  1G5U A;  3U2A A;  1MZU A;  3Q7V A;  2J7V A;  3P09 A;  5EVI D;  2YKF A;  1I2S A;  1NRJ A;  1I2W A;  5LBR A;  4HBT A;  5FI6 A;  4JKT A;  4F94 A;  3CPT A;  3SH8 A;  4Q8I A;  2JKF A;  4HY8 A;  4KZ7 A;  5AQ9 A;  1HZO A;  5AQA A;  4E3K A;  4HI4 A;  5FQI A;  3GRJ A;  2ZQA A;  4GDB A;  3K3C A;  1GA9 A;  2OLV A;  4JGR A;  3IX3 A;  5TJJ A;  4LCL A;  2WUQ A;  1K4E A;  4HBU A;  2XRN A;  1OTA A;  1ACF A;  2ZQ7 A;  3PBR A;  5EM1 A;  1SKF A;  5CER A;  5KZH A;  1OME A;  4F3L A;  4Q0I A;  1XPB A;  1ERO A;  3HLW A;  4OOY A;  2XLN A;  3F1P A;  1VQQ A;  4PKY A;  4UAA A;  3OPR A;  4II7 A;  3Q82 A;  3CUE C;  4KZA A;  4GN2 A;  1S4R A;  2ZM0 A;  4Y13 A;  4M3K A;  3DWZ A;  4OKP A;  5L2F A;  1U60 A;  2EX9 A;  3L9K A;  4UHU A;  4PAU A;  4S2N C;  1ZG4 A;  1A0K A;  4WUJ A;  4K91 A;  4JXS A;  5HL1 A;  3NOT C;  3PBO A;  1KE0 A;  4WMC A;  4ID4 A;  1CEF A;  1E25 A;  1L0G A;  1ES5 A;  5E2G A;  1O07 A;  4KG5 A;  1YM1 A;  1ONG A;  4WBG A;  3AGF A;  1BUE A;  1TDL A;  1K4F A;  4QHC A;  5HAI A;  4H6J B;  4OPR A;  3GVB A;  1TF1 A;  1DP9 A;  5F69 A;  4EQ1 A;  1WYB A;  5CGS A;  3LCE A;  3G32 A;  4JF6 A;  3E4O A;  1H8Y A;  2VKS A;  3MQQ A;  1H8M A;  2EXA A;  3ZYT A;  5CGX A;  2M7U A;  2Y2I A;  3VMA A;  1W63 M;  4DXC A;  1FIK A;  4DDY A;  2VGK A;  3M6B A;  3H7W B;  5HD5 A;  3HLB A;  2G7U A;  3TOI A;  4FD8 A;  3W8K A;  3HRE A;  3ZG8 B;  3ITA A;  5HDS A;  2V9A A;  2EX8 A;  4NXF A;  4C3Q A;  2Y2J A;  1Q2P A;  1W8Y A;  4GHI B;  5GLC A;  3RFB A;  3VP2 A;  3MKF A;  5FA7 A;  5HWW A;  3V50 A;  4QY5 A;  2V2F F;  2ZMV A;  1K25 A;  1W5D A;  5M1A A;  4EES A;  1S67 L;  1T18 A;  5L09 A;  1MWR A;  1AXB A;  2ZC7 A;  2J3W A;  4DDS A;  3KYQ A;  3LR4 A;  2XFT A;  2HJ9 C;  3IH9 A;  2UWX A;  2Y2K A;  3MQO A;  3LIC A;  3KYZ A;  2QKP A;  1DJC A;  4CQH A;  4GKU A;  2O9A A;  2V1A A;  3C7U A;  2H10 A;  3MF0 A;  1FOF A;  4BBT A;  3GTC A;  3UME A;  3HLE A;  4BEN A;  1XJ6 A;  1FCM A;  1GA0 A;  3KSH A;  3WS2 A;  2JC7 A;  1P9W A;  3EEH A;  2HP5 A;  4X1L A;  3DW0 A;  4XUZ A;  2V0W A;  4G3K A;  4N92 A;  4N9K A;  4HP4 A;  4WZ4 A;  3E0Y A;  3O3V A;  5DF9 A;  5FAP A;  1KVM A;  2V20 A;  1LSW A;  2WGW A;  4GCZ A;  3S22 A;  1KE4 A;  4R38 A;  3CUE A;  2Y2O A;  2P74 A;  5GLB A;  3IF6 C;  3IBJ A;  3IXG A;  4XT2 A;  3PAE A;  4WMC D;  2CC1 A;  4LRY C;  1BT5 A;  4DXB A;  3I7J A;  4I38 A;  4KQO A;  4S2N A;  2GJ3 A;  1K38 A;  5A91 A;  3NHQ A;  2VJW A;  1OPX A;  3B3X A;  3RH8 B;  2PU2 A;  4S2J A;  4E3I A;  4RX3 A;  3JVV A;  3BW6 A;  4NXB A;  2ZL1 B;  3Q07 A;  2FH5 A;  1CI8 A;  4DMZ A;  3NDG A;  4KQR A;  4S2I A;  3W2Z A;  3T1R A;  3UPO A;  3A3I A;  1OJ5 A;  2EFU A;  2H0T A;  3FWL A;  3BFG A;  2XQZ A;  1PI5 A;  5EUA A;  4R3A A;  4AFI A;  5DTT A;  2L4R A;  1BLS A;  2DCF A;  2W27 A;  1KVL A;  1PI4 A;  2B02 A;  4YIN A;  2GZA A;  2QJ5 A;  2FZ0 A;  3BQ8 A;  3BFC A;  3HUM A;  2O0Y A;  2W3H A;  3DTM A;  4FSF A;  4MBK A;  3HL9 A;  3ZFZ A;  4IUK A;  2CMN A;  3UPP A;  2OAP 1;  5FDH A;  3PR6 A;  5DJU A;  4RQ9 A;  2J3T C;  2P08 A;  4FH4 A;  1MXO A;  2HDS A;  4K0X A;  1ERQ A;  5CRF A;  3R7W A;  2A2L A;  2XK1 A;  3IS2 B;  4NXG A;  1HD8 A;  1BLH A;  5GHY A;  4OQI A;  4FH2 A;  3TRC A;  1T1A A;  5AVF A;  2HP6 A;  1YT4 A;  4KEN B;  1OTI A;  1KOU A;  3O5Y A;  1KGE A;  2O9B A;  2QMI A;  3VOY A;  2OOL A;  3VE3 A;  1YMX A;  1RGZ A;  3BFF A;  4EEU A;  1DRM A;  1XP4 A;  5K5B A;  2A3U A;  1BZA A;  4ARZ B;  4P87 A;  3WS4 A;  4LPZ A;  5FL3 A;  1WYC A;  2XA7 S;  4FOF A;  3MSH A;  3TSG A;  2NUP C;  3IWO A;  3W4Q A;  4JLF A;  3T1S A;  3OC2 A;  3AGE A;  4HJ4 A;  2Q0O A;  4L9G A;  3SZT A;  4E3M A;  4QB8 A;  4NEE D;  1ESI A;  3D72 A;  2QZ6 A;  3UDX A;  5HWT A;  2OSU A;  3MKE A;  2GNX A;  3UB6 A;  4JF4 A;  1MBL A;  1OTE A;  2EA9 A;  2FFY A;  5A92 A;  2PRF A;  3T4Q A;  5FEF A;  3IF6 A;  1ES2 A;  1PW1 A;  3VP4 A;  3QP1 A;  4R0Q A;  5M18 A;  2E8J A;  3TE8 A;  4E04 A;  2Z6C A;  1YLT A;  5DF7 A;  3UDI A;  2V8F A;  5EVI B;  4ZAM A;  4ZRR A;  4X25 A;  2J9O A;  1S6R A;  3HJK A;  2H0Y A;  2Y55 A;  4KZB A;  2KDK A;  1FCN A;  3OLO A;  3N8L A;  1SKO B;  1S66 L;  3MMH A;  2DMW A;  3JPU A;  5A8B A;  4BJP A;  5L8M A;  1SCW A;  2VX8 A;  3N8R A;  2WKP A;  4OP8 A;  2JKT I;  4R3B A;  2XD1 A;  3EQU A; 
#chains in the Genus database with same CATH homology
 5EM0 A;  2ZL1 B;  5EVE A;  3NUL A;  1CF0 A;  3MSH A;  3T1S A;  3T1R A;  1SKO A;  1AWI A;  3T12 B;  1HLU P;  3CPT B;  3L9K A;  4D60 A;  1A0K A;  1K0K A;  1J3W A;  2JKG A;  1VET A;  3KYE A;  1PRQ A;  3UB5 P;  3T1X A;  3MS6 A;  3LEQ A;  4FTX A;  3T1Q B;  2PRF A;  5FEF A;  1YPR A;  1G5U A;  1VEU B;  5FEG A;  2ZL1 A;  2E8J A;  1F2K A;  4QWO A;  1Z09 A;  1FIL A;  4X1L A;  2B95 A;  2BTF P;  2V8F A;  2PAV P;  2HZ5 A;  2V8C A;  4X25 A;  1CJF A;  1SZV A;  3L7H A;  3CPT A;  1PNE A;  1PFL A;  2JKF A;  3U4L P;  1FIK A;  1CQA A;  2PBD P;  2VK3 A;  3CHW P;  4X1M A;  1SKO B;  3D9Y A;  5FDS A;  5EV0 A;  1D1J A;  4ESP A;  1Y4O A;  4FUW A;  1VET B;  3DAV A;  3LGO A;  1VEU A;  3NEC A;  1ACF A;  2ACG A;  5EM1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...