1ACFA

Acanthamoeba castellanii profilin ib
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
125
structure length
125
Chain Sequence
SWQTYVDTNLVGTGAVTQAAILGLDGNTWATSAGFAVTPAQGTTLAGAFNNADAIRAGGFDLAGVHYVTLRADDRSIYGKKGSSGVITVKTSKAILVGVYNEKIQPGTAANVVEKLADYLIGQGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray structures of isoforms of the actin-binding protein profilin that differ in their affinity for phosphatidylinositol phosphates.
pubmed doi rcsb
source organism Acanthamoeba castellanii
molecule tags Contractile protein
molecule keywords PROFILIN I
total genus 34
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 1994-07-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.30 Alpha Beta 2-Layer Sandwich Beta-Lactamase Dynein light chain 2a, cytoplasmic 1acfA00
2HZ5A 3U4LP 1CQAA 1G5UA 2ACGA 3CPTA 3L7HA 2V8FA 3NULA 2ZL1A 1A0KA 4X25A 1PFLA 1CJFA 2ZL1B 2PAVP 1SKOA 5FEFA 1PRQA 2JKGA 2VK3A 3D9YA 3KYEA 4D60A 1VEUA 4QWOA 2B95A 4FTXA 5EM0A 2V8CA 3CPTB 1PNEA 1Z09A 1VETA 5FEGA 1CF0A 3MS6A 3NECA 2PRFA 3T1XA 1F2KA 3LGOA 3L9KA 3MSHA 5EM1A 4X1MA 1AWIA 5EV0A 1SZVA 1VEUB 1HLUP 1VETB 3T1SA 1ACFA 2E8JA 3T1RA 3T1QB 1SKOB 4ESPA 3DAVA 2BTFP 1Y4OA 4X1LA 3T12B 1J3WA 2PBDP 2JKFA 1D1JA 3CHWP 4FUWA 5EVEA 5FDSA 3UB5P 3LEQA 1FIKA 1K0KA 1YPRA 1FILA
chains in the Genus database with same CATH superfamily
3LY4A 3QP5A 5A90A 1G5UA 4JKTA 4KUKA 5LBRA 3NOPC 2XD1A 3CUEC 4UAAA 2ZC4B 5EECA 4UEYA 4EERA 4L9FA 5EOEA 2GDNA 4S2NC 3QP8A 4OOYA 3T4LA 3Q81A 4GHIA 3FV7A 1CK3A 4KG6A 1DP9A 3ZG0A 3H82A 4Q0JA 4YOFA 3TRCA 3A3IA 4WELA 3CPTB 3FPVA 4PM5A 4RYEA 2V9AA 4GDNA 2W0NA 2Y79A 1BLHA 1XJ4A 1FSYA 4GNUA 3OLOA 4EV4A 5L2FA 2GZAA 4Y0TA 3NY4A 2O9AA 4N1HA 5DKLA 4KG5A 3ZG7B 3LIBA 2O9CA 3IX4A 2P9VA 3EEAA 2Y2GA 3BWLA 1LL8A 4K0XA 3VOYA 1OTEA 2BTFP 4Z1WA 2VJWA 2M7VA 1DJBA 5HZHA 4F3LA 2NUTC 2WGVA 5MC7A 5TGFA 1JNUA 4GOGA 3MBZA 3OOVA 4CLCC 3IXDA 4OOMA 3LO7A 2HDRA 1FCNA 1S4RA 1I5QA 1K54C 3GRJA 3MQOA 3SZTA 4L9EA 1PYYA 2R78A 1KGFA 2H5SA 5HWWA 4PPRA 3KYEA 3ZG9B 3JVVA 4OPYA 1K25A 2Z2LB 4BWIA 4D2OA 2W1TB 4PAUA 4IHQA 3T1RA 1BZAA 3BECA 3HUMA 2ZQAA 4PMAA 1YAXA 4H6JA 4G3WA 1T1CA 1KVLA 3VP3A 1H8ZA 2W3HA 4ZJ1A 4G3KA 4HEFA 4KENB 4GS9A 2BLSA 3C4PA 2EX8A 4KQRA 4HH3A 5IU1A 1GHIA 4NXBA 1OJGA 4KZAA 1T18A 3T4KA 3IF5A 2OV5A 2Y2JA 2ZQDA 3M6BA 4XUXA 4EUZA 4NXEA 1X0OA 3OC2A 4F3LB 3M2JA 1L3LA 4E3JA 1L0GA 1WE4A 4PM8A 1VB6A 3DW0A 3MS6A 2J3TD 1W8QA 3DTIA 3IWIA 3MZEA 3CITA 3BEBA 2Q9NA 3T12B 4GJ4A 3Q7VA 2XRNA 4R70A 3F1OA 3WS5A 1HVBA 4C6YA 5HWVA 3IS2B 1GA0A 1YMSA 4LRZE 4CLCB 2M1CA 5TBMB 4IUHA 3QNBA 3NOTC 3PR6A 4KZ9A 5CHJA 2PBDP 4FUWA 4IJGA 1TDGA 5CRFA 2UWXA 3I7JA 4H8RA 3HLBA 1V9ZA 2JKGA 1VEUA 3EGXC 1XJ2A 2XA7M 3T4SA 1VETA 4FD8A 4Y5FA 3PHYA 4IUKA 4KQOA 1GA9A 5J8XA 3BQ8A 2W3FA 3UB6A 3UN7A 4HJ4A 3D3OA 2J3WA 3S7QA 5CGWA 2K31A 1Z6FA 2Y2LA 4MEZA 4E6XA 5E2FA 2WUQA 3OPPA 1SKOA 3K3CA 2VX8A 1YMXA 4E3IA 3D4FA 1K57C 1XJ3A 3VP1A 1YLTA 1E3UA 3HLEA 4O0PA 1F9IA 2QPNA 1FCOA 5FQ9A 2P9VB 3MFDA 2VLGA 3E98A 5CEDA 5JYOA 3HJKA 3BRMA 1BULA 3T4JA 1UWNX 3HLFA 2IWCA 3SH9A 4JLFA 3H7WA 2V8CA 4B9OA 4X56A 1GCEA 5F69A 4QD4A 2VGLM 1CEFA 4Y7PA 5L09A 2ZC5B 4HNBA 3RXWA 5DF7A 4Z9QA 3JVUA 3V39A 3O87A 2GJ3A 1H0MA 4GD6A 3IHBA 4E3NA 1OPXA 2Y59A 5CTMA 3LIAA 4K08A 2VV8A 3QP6A 3MQ0A 4R3JA 1SDEA 3W4PA 2CMNA 1ERQA 2LB9A 2O0YA 4KZ3A 4MBHA 3WRTA 1MWUA 3DBAA 3NDEA 3T50A 3H9WA 3BFGA 3LR0A 4YWZA 3CI6A 5A93A 3PBQA 4NK3A 4G3VA 1L0EA 1T1BA 1XGIA 2FZ0A 2PT7A 4BD1A 3H82B 5U47A 1C3BA 2H28A 3MFXA 3ZQ5A 1QMFA 4KZ4A 4LCMA 4KZ8A 1EW0A 5KZHA 2OLUA 1K57A 1LI0A 2Y2KA 3EOIA 4B93A 5AJGA 4WUJA 4QPRA 1TS8A 5HD3A 1PNEA 1I2SA 2R9XA 2IWBA 3BLMA 3UE1A 3Q82A 3T1SA 4R23A 3G4PA 1W8YA 5CERA 3NBLA 4WF0A 4LV2A 4WLAA 3LUQA 4GS9B 5EFWA 1PFLA 3BW6A 1TS0A 2ZQ8A 3GECA 3IH9A 3VOZA 4IBXA 1ALQA 5AVFA 2XH9A 3LICA 4O7DA 4UA9A 4E04A 4LV3A 1ES5A 1ZHHB 4OLDA 1PIOA 4LV1A 3ZNYA 4OQ0A 3U4LP 1YM1A 2ZJ9A 4S2OA 3ZFZA 2DRWA 1MWSA 4OONA 1E4DA 5GLDA 1H5XA 3KSIA 1OMEA 3PBRA 3VSLA 2XEPA 3PAGA 3LGOA 1G68A 2L1MA 3MKFA 5DFYA 3LY3A 4Q0IA 3PBSA 5TJJA 2FFFB 2EX2A 4KG2A 2Q9MA 2H0TA 2PYPA 4S2PA 1HZOA 3DWKA 4OKPA 1Z09A 3NECA 4ETXA 4R1GA 1D06A 3V50A 3SW1A 4LPZA 1ZC2A 1IKIA 2JKRM 1IFQA 1GSVA 3NHQA 2QMIA 1KVMA 2HGVA 2RL3A 3MR0A 5DJUA 4S2IA 2W3DA 5HDDA 1OT6A 2HP9A 5EVID 5FEFA 1LT0A 2QJ5A 1DY6A 4GD8A 3O5YA 4BBUA 2YKFA 4S2LA 3R4KA 3T4OA 3G35A 3ICYA 1XP4A 5FDSA 2Y2QA 3E2LA 4JF5A 1DP8A 2JKTM 1N4OA 2HP5A 2RCXA 5GLCA 2H0YA 1FR1A 4I3JA 1M40A 3TJZC 5JYPA 2UV0E 1LI9A 1MPLA 1YLZA 4JXWA 2JN7A 2DCFA 3VFHA 5D3OA 3W4OA 1XA1A 1JVJA 2JC7A 3BFFA 3CLOA 4RX2A 1L2SA 2EFUA 3E0YA 1ESUA 4EBNA 4FCFA 5TBMA 5IS1A 2QWSA 2R9WA 2EWWA 5FI2A 1NYYA 2XA7S 3EGDC 1D1JA 4DXBA 1FIKA 2JE5A 2JHEA 3L7HA 4P85A 3PBOA 1ONHA 3MQQA 3IF6C 4I5SA 2HDQA 1YLWA 2XGNA 3BQAA 4RVAA 5DF9A 3F1OB 5G4ZA 1L0DA 3O86A 3V3SA 2Q0OA 4ZRRA 5HPFA 5CEBA 2JCHA 3UPPA 1KE3A 1PWCA 1K55C 4EQIA 4HHDA 2V20A 5EOOA 2XR0A 5HDSA 1ZG6A 3W4QA 1S4SA 3KYZA 3UE3A 3PXPA 1TD5A 2ZOHA 3MSHA 3IH8A 4M4XA 2VZWA 3VE4A 2WKRA 3OPLA 2HF6A 3N8LA 4KUOA 5EVEA 2I72A 4CPKA 3KO6A 5HL1A 4CJNA 5KSCA 1N9NA 3CUEA 4JF4A 3OPRA 3N4IA 3ZYTA 4H6JB 2Z2MB 3N6IA 1JTDA 3PTEA 2EX6A 5FSRA 3HLDA 3IT9A 5DF8A 1MXOA 1PI5A 4IEDA 2J9OA 4MMNA 3VP2A 5CECA 3SH8A 4OQHA 3HUOA 2WYXA 1KDSA 2KOIA 2EA9A 5F68A 1BYWA 4IBRA 3NULA 2L4RA 3PYPA 1HTZA 1LL5A 3ZG8B 1BLSA 4EESA 4WMCA 3T4TA 4DE2A 4N92A 4YFMA 2OSUA 2FH5A 5AQBA 4QU3A 1BLPA 4NETA 4HP9A 1FQGA 1SKOB 3IS2A 2ZM8A 3OCLA 4JBFA 2ZL1A 1TS7A 4JGRA 4JPMA 5E2EA 2A24B 4EQ1A 2FFYA 5FATA 2XQZA 5DTSA 3T1XA 4DE1A 5E2GA 1K6RA 1KOUA 4OOLA 1XFQA 2ZM0A 4LLOB 2B18A 2P74A 4X25A 3BM6A 2KLIA 1CI9A 1XJ6A 4WZ5A 4WBGA 4CQHA 4ZAMA 4KZBA 2WKPA 1OTIA 2IWDA 3ITBA 4I3AA 4BL3A 3MJQA 5CHUA 1DJCA 5GHXA 3E2KA 1BSGA 1CEGA 1WYBA 1CJFA 1PRQA 4UQIM 4QWOA 3BFDA 3ZGAB 3KSFA 2EX9A 3T1QB 4R3BA 1EI5A 1W63Q 4C75A 2A49A 2K2NA 5F6AA 1JWVA 1YLJA 5BOHA 3NI9A 5TR7A 1NWZA 5FQKA 1TDLA 5CGXA 5G18A 3LEZA 1OT9A 3QP2A 4D60A 4ID4A 2WAFA 5CTNA 3QNCA 3G6OA 5DTKA 1TS6A 1GSWA 4I3IA 3HBRA 2LB5A 4OQIA 2OLVA 3HL9A 2P08A 5J3WA 4JXGA 4DDYA 2BASA 4L0LA 5DFXA 2DMWA 1KDWA 4R38A 4AFIA 4Y15A 4X53A 4DMZA 1TVFA 5HX9A 2WKIA 3W2ZA 1OTAA 1K56A 1S1ZA 2P7JA 3EWKA 1TF1A 1HD8A 3K3DA 3ULFA 4Y3IA 4X68A 3IWQA 1CF0A 4DXCA 4HI4A 3LI9A 5F83A 3FKWA 2V1BA 1HLUP 1VETB 4U0TA 2OAP1 2E8IA 1O7EA 1RP5A 3ZCZA 1K0KA 2PR6A 2WKEA 3KYQA 1YT4A 3BFCA 4U0XA 3ZVTA 3C2WA 5EM0A 1G28A 2ZOIA 4E3KA 1K38A 3HCYA 4PM6A 1VEUB 2ZMFA 1RGZA 4B4ZA 1LSVA 3MXQA 1ESIA 4OP8A 4P6ZS 5FI6A 3EEHA 2XK1A 4FH4A 4RQ9A 1KGEA 1K4FA 3BY9A 2VGLS 2ZM2A 1S6RA 4QJGA 1NJ4A 2CC1A 3HLWA 1EROA 4R0QA 2A24A 4I38A 3O88A 3HREA 2XDMA 1N9OA 2EWVA 2HZ5A 4EBPA 5DTTA 5FDHA 2ZC3B 4F94A 5FL3A 2B5RA 5DJTA 5F1FA 3KSGA 3BFEA 3QP1A 4PM9A 3GDIA 3S1YA 1MC0A 2BG1A 3UDFA 4GCZA 5I94A 4ZTKA 2W3EA 4PKYG 4N9KA 4BJPA 5EUAA 2J80A 1K6SA 2V1AA 2M7UA 3A3FA 1JTGA 5CXWA 4BBTA 2PD8A 3DTKA 2K7SA 3LIEA 1PZOA 4HJ6A 4OPZA 1XFNA 1ZTUA 2ZC6B 3A0VA 5IT5A 4OLGA 3TOIA 3JYIA 2XLNA 3UB5P 4FOFA 3ZVWA 3JPUA 2QHKA 2Y4AA 3ZDJA 1V9YA 4MBKA 1L0FA 4BBVA 3F1NA 5M19A 3EQVA 4MN7A 4NG2A 2WADA 1J9MA 5EM1A 4HOIA 5KMWA 4X1MA 4LFUA 5L10A 4JXSA 3V3RA 4PM7A 1G6OA 4Y0OA 1YSQA 3IXHA 2VV7A 1KGGA 1M6KA 3N7WA 3NDGA 4KZ5A 5KSHA 2VEAA 1IKGA 5HAIA 3GTCA 1MWTA 1RGYA 4BENA 1E3UD 1H3QA 4OQGA 3FZCA 5GHYA 2WAEA 3P09A 3V5MA 3GR2A 4XUZA 3RFBA 2PRFA 5FQIA 1VM1A 2XFTA 4LENA 2D01A 3LYXA 1ODVA 4DDSA 3B3XA 1LLBA 1OJ5A 2HDUA 2YKHA 4UHUA 2Y2OA 4S2JA 5HW3A 4NEED 4Y0UA 3RH8B 3ISGA 2WGWB 2PR5A 1DRMA 3BLSA 4WM9A 3UDXA 4EW7A 1BTLA 3WS0A 4UA6A 1RCJA 4KQQA 3SH7A 4HH2A 4X1LA 3WS4A 1IYOA 5J4EA 3G2YA 1K55A 1BLCA 3F1PB 4DKIA 3FYZA 2EXAA 3UB7A 5EE8A 1ERMA 2C5WB 3NIAA 2PAVP 1S0WA 3D9YA 4QB8A 5DKKA 4HP4A 5FQJA 3ZG5A 2WGIA 1Y28A 1W7FA 5EVLA 3IX3A 2XF3A 5F82A 2O99A 1F5MA 4R3AA 4LRXC 3G34A 2JKFA 4P6ZM 4GB7A 3F1PA 1PZPA 1PWDA 4OH0A 3C7UA 4O8GA 4M3KA 5A8BA 3S7OA 1PW1A 4OPQA 4R4SA 4A5RA 2PU2A 4DRTA 2HJ9C 5EVIC 4R6LA 4ZJ3A 1IYPA 4WMCD 3LEQA 4B88A 4ZJ2A 2NUPC 1K56D 1A0KA 3HJIA 1MZUA 2Y2IA 3FWLA 4FTXA 2JKRI 4K0WA 2VA0A 3L9KA 5HWTA 3GMWA 3NCKA 3LIDA 4QY5A 3UNWA 3UE0A 4DJ3A 2V0WA 4P6BA 5FASA 3IXBA 3RXXA 3SS3A 3G30A 3IF6A 4X55A 5L07A 3QP4A 1NY0A 4EWFA 2XFSA 3C8CA 3BY8A 4EEUA 3MF0A 2X01A 3VE3A 3LIFA 3CMZA 3VOLA 1BUEA 5KIZA 4P87A 3NC8A 3OCNA 1BT5A 3MXRA 4EXOA 2V8FA 1YPRA 4HBTA 5A91A 3O3VA 3G31A 4XT2B 2QYBA 3S4XA 4NXGA 2G2UA 3TW8A 2PD7A 2V1ZA 5L8MA 4E6WA 3B47A 4EETB 3S22A 4BL2A 4B4XA 4HQAA 1NYMA 2KX6A 4BLMA 3IHAA 5GLBA 5EVIA 2PHYA 1PWGA 3IX8A 1LSWA 4EU0A 4GW9A 3E4QA 4WZ5C 1MY8A 2HV1A 4WL9A 2D02A 1SCWA 1UGUA 3PBNA 3IQAA 1ZG4A 4HJ3A 4PHTA 4IVIA 5M1AA 4ARZB 4E3OA 3A3JA 2XROA 4DN0A 5AQ9A 3GSGA 3D72A 1E25A 1XPBA 3OZHA 3BJNA 4ZDXA 4CLCA 3HVFA 4YINA 4GN2A 5HFOA 1XA7A 2OWJA 1CQAA 5CGSA 1FOFA 3MKEA 4WEKA 2Y91A 4XXRA 3WWXA 2VK3A 1IEMA 3B42A 4Q8IA 4BMWA 4U3TA 2GNXA 3FG8A 4K91A 3B33A 4JGOA 4MDZA 5CHMA 3OPHA 3C30A 2ZQ9A 4S2NA 1FSWA 2ZQCA 3UO9A 5FA7A 2EXBA 2WGWA 2Y2NA 1OTBA 3ZNTA 1DJAA 4JXVA 1PW8A 1Q2PA 4S2KA 1ES2A 2B02A 3BYDA 3VV4A 5G4YA 4FSFA 5HPIA 3U2AA 1XGJA 3C7VA 4ESPA 3RTYA 2QJ7A 1GSXA 1LSXA 2MJ6A 5A92A 2HPBA 2WK0A 4PKYA 4Y2FA 2W27A 3A3DA 3P98A 1IELA 5FAPA 4HIAA 4MCWA 3F1NB 2C6WB 4WN5A 2QKPA 1Y4OA 3GVBA 2VV6A 3C5AA 4HBUA 1ES3A 1Y54A 4WYYA 5C5KA 2W3GA 4CLCD 4UA7A 2X02A 5GLAA 3FPWA 4DE0A 5AQAA 1YQSA 2ZLYA 5AQ7A 3SS5A 1IYSA 5HDCA 1P9RA 1K54A 1MKIA 3UY6A 2L0WA 5DVAA 1T19A 4HESA 3VFFA 1UWPX 4LRYC 2ZQ7A 3C38A 4UQIS 1LHYA 2WZZA 2QZ6A 5FEGA 5CX7A 2HDSA 5IHVA 5EV0A 1T1AA 2Z6DA 3DTEA 3EQUA 4GDBA 4N9LA 3FC7A 4S2MA 3LR3A 4C3QA 2J3TC 4X6TA 3UPOA 3CAXA 4CLCE 4NKPA 1MWRA 3E4PA 4MN5A 2ZD8A 4GHIB 4BD0A 1XKZA 1F2KA 3TSGA 1XXMA 3A0SA 3MXSA 3OBFA 5FAQA 1U60A 1YLPA 2PBYA 3VP0A 1GHPA 1LL9A 3G2ZA 3UDIA 5TFQA 3PBTA 1QMEA 2B95A 2OWHA 2Y2PA 3HLGA 1NLZA 1W5DA 2JBFA 4LV0A 1MBLA 1H8YA 1VQQA 3DAVA 5HARA 4OVDA 1VHMA 4EEPA 4L9GA 3R7WB 2V0UA 1MKMA 3FKVA 1K4EA 3PAEA 3W8KA 2Y8HA 2V2FF 3E4OA 2Y55A 3UE6A 3CWFA 3IXGA 4RX3A 3SS4A 3Q07A 1GHMA 3M2KA 4GLQA 1KE0A 3AGEA 3CG5A 1ONGA 3AGDA 4I39A 1WYCA 1D7EA 3IF6B 3Q7ZA 4EUVA 3GQZA 3N8SA 1KE4A 3DWZA 1G6AA 1XX2A 1S1YA 3QHYA 2IA2A 1AWIA 4IVKA 1NLYA 3R7WA 4JGPA 2VKSA 2I9VA 2DNSA 4X69A 5FAOA 4E3MA 3UMEA 3UPNA 2Y2HA 5E2HA 2PYRA 1P9WA 3UB9A 5HL6A 1AXBA 3VMAA 1O07A 2OOLA 3UB8A 5HD5A 1IOUA 4NXFA 4GZBA 1DP6A 2VGJA 1OTDA 5FQQA 1J3WA 1IYQA 4ME4A 4QY6A 2J7VA 1PI4A 3P01A 1YLYA 1P97A 4YNRA 5K5BA 1I2WA 2WKQA 3CJMA 4LCLA 2PU4A 1JWPA 2W1TA 2A3UA 5AVEA 1SZVA 5I5LA 3T4QA 4KQDA 2KDKA 1NRFA 4N1XA 2XSSA 4KZ6A 3LR5A 4RA7A 3A3EA 3K2NA 1WA9A 2J9PA 3TG9A 2ZL1B 3GV9A 4MN6A 5E43A 2OAQ1 4DJ2A 1W63M 4HY8A 2G2WA 3LCEA 4MBFA 1FR6A 4II7A 3G32A 1CI8A 1S66L 1YKDA 3NOUC 1SKFA 3MZFA 3CZDA 2ZC7A 5F1GA 3CPTA 2H10A 1FCMA 3N8RA 5J7EA 2VGKA 3LI8A 2WZXA 4GKUA 4DF6A 1TEMA 1SHVA 3KSHA 5M18A 1S67L 2ZMAA 3MZDA 1N9LA 3P7NA 1EWZA 2Z6CA 3WS1A 2J8YA 2ACGA 4WEJA 5F5YA 5FQMA 1N9BA 1NZOA 3ITAA 1ES4A 2A2LA 1Q2QA 2GX5A 4Y17A 1NZUA 4BQMA 3ZHHA 4MLLA 2XD5A 1ACFA 2E8JA 1W79A 3IBJA 5EVIB 2WKHA 3AGFA 3IWOA 3KX0X 1YSPA 1STZA 2X71A 4EBLA 2G7UA 2EFXA 4R4RA 5HSQA 3TE8A 5FI7A 4WZ4A 5HAPA 3C4OA 2ZBBA 4ARZA 3LR4A 4P0MA 2AVXA 4QHCA 2HJEA 2ZMVA 4O01A 4XT2A 5HAQA 2P04A 3LFVA 5EPHA 2HP6A 4OP5A 4JF6A 2Y2MA 3V67A 4DE3A 3S7PA 3IBRA 3DTMA 3H7WB 3HLCA 4LGWA 3WS2A 3UMDA 5GHZA 1FILA 4JGQA 4ZBEA 4Y13A 5GL9A 3RJUA 1NXYA 3MMHA 3VSKA 3S7NA 2INWA 4Q0HA 1H8MA 4E3LA 2W1RA 3A0RA 4ETZA 3WRZA 1ZKJA 1JWZA 2PDRA 3Q7VB 4FH2A 3HUNA 3Q1FA 1SDNA 1NRJA 4KZ7A 4OPRA 2JKTI 3SOIA 3NJAA 2O9BA 3VP4A 1P0ZA 3M6HA 4MNRA 3CHWP 1F98A
chains in the Genus database with same CATH topology
2HZ5A 3U4LP 1CQAA 1G5UA 2ACGA 3CPTA 3L7HA 2V8FA 3NULA 2ZL1A 1A0KA 4X25A 1PFLA 1CJFA 2ZL1B 2PAVP 1SKOA 5FEFA 1PRQA 2JKGA 2VK3A 3D9YA 3KYEA 4D60A 1VEUA 4QWOA 2B95A 4FTXA 5EM0A 2V8CA 3CPTB 1PNEA 1Z09A 1VETA 5FEGA 1CF0A 3MS6A 3NECA 2PRFA 3T1XA 1F2KA 3LGOA 3L9KA 3MSHA 5EM1A 4X1MA 1AWIA 5EV0A 1SZVA 1VEUB 1HLUP 1VETB 3T1SA 1ACFA 2E8JA 3T1RA 3T1QB 1SKOB 4ESPA 3DAVA 2BTFP 1Y4OA 4X1LA 3T12B 1J3WA 2PBDP 2JKFA 1D1JA 3CHWP 4FUWA 5EVEA 5FDSA 3UB5P 3LEQA 1FIKA 1K0KA 1YPRA 1FILA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HZ5 A;  3U4L P;  1CQA A;  1G5U A;  2ACG A;  3CPT A;  3L7H A;  2V8F A;  3NUL A;  2ZL1 A;  1A0K A;  4X25 A;  1PFL A;  1CJF A;  2ZL1 B;  2PAV P;  1SKO A;  5FEF A;  1PRQ A;  2JKG A;  2VK3 A;  3D9Y A;  3KYE A;  4D60 A;  1VEU A;  4QWO A;  2B95 A;  4FTX A;  5EM0 A;  2V8C A;  3CPT B;  1PNE A;  1Z09 A;  1VET A;  5FEG A;  1CF0 A;  3MS6 A;  3NEC A;  2PRF A;  3T1X A;  1F2K A;  3LGO A;  3L9K A;  3MSH A;  5EM1 A;  4X1M A;  1AWI A;  5EV0 A;  1SZV A;  1VEU B;  1HLU P;  1VET B;  3T1S A;  1ACF A;  2E8J A;  3T1R A;  3T1Q B;  1SKO B;  4ESP A;  3DAV A;  2BTF P;  1Y4O A;  4X1L A;  3T12 B;  1J3W A;  2PBD P;  2JKF A;  1D1J A;  3CHW P;  4FUW A;  5EVE A;  5FDS A;  3UB5 P;  3LEQ A;  1FIK A;  1K0K A;  1YPR A;  1FIL A; 
#chains in the Genus database with same CATH topology
 3LY4 A;  3QP5 A;  5A90 A;  1G5U A;  4JKT A;  4KUK A;  5LBR A;  3NOP C;  2XD1 A;  3CUE C;  4UAA A;  2ZC4 B;  5EEC A;  4UEY A;  4EER A;  4L9F A;  5EOE A;  2GDN A;  4S2N C;  3QP8 A;  4OOY A;  3T4L A;  3Q81 A;  4GHI A;  3FV7 A;  1CK3 A;  4KG6 A;  1DP9 A;  3ZG0 A;  3H82 A;  4Q0J A;  4YOF A;  3TRC A;  3A3I A;  4WEL A;  3CPT B;  3FPV A;  4PM5 A;  4RYE A;  2V9A A;  4GDN A;  2W0N A;  2Y79 A;  1BLH A;  1XJ4 A;  1FSY A;  4GNU A;  3OLO A;  4EV4 A;  5L2F A;  2GZA A;  4Y0T A;  3NY4 A;  2O9A A;  4N1H A;  5DKL A;  4KG5 A;  3ZG7 B;  3LIB A;  2O9C A;  3IX4 A;  2P9V A;  3EEA A;  2Y2G A;  3BWL A;  1LL8 A;  4K0X A;  3VOY A;  1OTE A;  2BTF P;  4Z1W A;  2VJW A;  2M7V A;  1DJB A;  5HZH A;  4F3L A;  2NUT C;  2WGV A;  5MC7 A;  5TGF A;  1JNU A;  4GOG A;  3MBZ A;  3OOV A;  4CLC C;  3IXD A;  4OOM A;  3LO7 A;  2HDR A;  1FCN A;  1S4R A;  1I5Q A;  1K54 C;  3GRJ A;  3MQO A;  3SZT A;  4L9E A;  1PYY A;  2R78 A;  1KGF A;  2H5S A;  5HWW A;  4PPR A;  3KYE A;  3ZG9 B;  3JVV A;  4OPY A;  1K25 A;  2Z2L B;  4BWI A;  4D2O A;  2W1T B;  4PAU A;  4IHQ A;  3T1R A;  1BZA A;  3BEC A;  3HUM A;  2ZQA A;  4PMA A;  1YAX A;  4H6J A;  4G3W A;  1T1C A;  1KVL A;  3VP3 A;  1H8Z A;  2W3H A;  4ZJ1 A;  4G3K A;  4HEF A;  4KEN B;  4GS9 A;  2BLS A;  3C4P A;  2EX8 A;  4KQR A;  4HH3 A;  5IU1 A;  1GHI A;  4NXB A;  1OJG A;  4KZA A;  1T18 A;  3T4K A;  3IF5 A;  2OV5 A;  2Y2J A;  2ZQD A;  3M6B A;  4XUX A;  4EUZ A;  4NXE A;  1X0O A;  3OC2 A;  4F3L B;  3M2J A;  1L3L A;  4E3J A;  1L0G A;  1WE4 A;  4PM8 A;  1VB6 A;  3DW0 A;  3MS6 A;  2J3T D;  1W8Q A;  3DTI A;  3IWI A;  3MZE A;  3CIT A;  3BEB A;  2Q9N A;  3T12 B;  4GJ4 A;  3Q7V A;  2XRN A;  4R70 A;  3F1O A;  3WS5 A;  1HVB A;  4C6Y A;  5HWV A;  3IS2 B;  1GA0 A;  1YMS A;  4LRZ E;  4CLC B;  2M1C A;  5TBM B;  4IUH A;  3QNB A;  3NOT C;  3PR6 A;  4KZ9 A;  5CHJ A;  2PBD P;  4FUW A;  4IJG A;  1TDG A;  5CRF A;  2UWX A;  3I7J A;  4H8R A;  3HLB A;  1V9Z A;  2JKG A;  1VEU A;  3EGX C;  1XJ2 A;  2XA7 M;  3T4S A;  1VET A;  4FD8 A;  4Y5F A;  3PHY A;  4IUK A;  4KQO A;  1GA9 A;  5J8X A;  3BQ8 A;  2W3F A;  3UB6 A;  3UN7 A;  4HJ4 A;  3D3O A;  2J3W A;  3S7Q A;  5CGW A;  2K31 A;  1Z6F A;  2Y2L A;  4MEZ A;  4E6X A;  5E2F A;  2WUQ A;  3OPP A;  1SKO A;  3K3C A;  2VX8 A;  1YMX A;  4E3I A;  3D4F A;  1K57 C;  1XJ3 A;  3VP1 A;  1YLT A;  1E3U A;  3HLE A;  4O0P A;  1F9I A;  2QPN A;  1FCO A;  5FQ9 A;  2P9V B;  3MFD A;  2VLG A;  3E98 A;  5CED A;  5JYO A;  3HJK A;  3BRM A;  1BUL A;  3T4J A;  1UWN X;  3HLF A;  2IWC A;  3SH9 A;  4JLF A;  3H7W A;  2V8C A;  4B9O A;  4X56 A;  1GCE A;  5F69 A;  4QD4 A;  2VGL M;  1CEF A;  4Y7P A;  5L09 A;  2ZC5 B;  4HNB A;  3RXW A;  5DF7 A;  4Z9Q A;  3JVU A;  3V39 A;  3O87 A;  2GJ3 A;  1H0M A;  4GD6 A;  3IHB A;  4E3N A;  1OPX A;  2Y59 A;  5CTM A;  3LIA A;  4K08 A;  2VV8 A;  3QP6 A;  3MQ0 A;  4R3J A;  1SDE A;  3W4P A;  2CMN A;  1ERQ A;  2LB9 A;  2O0Y A;  4KZ3 A;  4MBH A;  3WRT A;  1MWU A;  3DBA A;  3NDE A;  3T50 A;  3H9W A;  3BFG A;  3LR0 A;  4YWZ A;  3CI6 A;  5A93 A;  3PBQ A;  4NK3 A;  4G3V A;  1L0E A;  1T1B A;  1XGI A;  2FZ0 A;  2PT7 A;  4BD1 A;  3H82 B;  5U47 A;  1C3B A;  2H28 A;  3MFX A;  3ZQ5 A;  1QMF A;  4KZ4 A;  4LCM A;  4KZ8 A;  1EW0 A;  5KZH A;  2OLU A;  1K57 A;  1LI0 A;  2Y2K A;  3EOI A;  4B93 A;  5AJG A;  4WUJ A;  4QPR A;  1TS8 A;  5HD3 A;  1PNE A;  1I2S A;  2R9X A;  2IWB A;  3BLM A;  3UE1 A;  3Q82 A;  3T1S A;  4R23 A;  3G4P A;  1W8Y A;  5CER A;  3NBL A;  4WF0 A;  4LV2 A;  4WLA A;  3LUQ A;  4GS9 B;  5EFW A;  1PFL A;  3BW6 A;  1TS0 A;  2ZQ8 A;  3GEC A;  3IH9 A;  3VOZ A;  4IBX A;  1ALQ A;  5AVF A;  2XH9 A;  3LIC A;  4O7D A;  4UA9 A;  4E04 A;  4LV3 A;  1ES5 A;  1ZHH B;  4OLD A;  1PIO A;  4LV1 A;  3ZNY A;  4OQ0 A;  3U4L P;  1YM1 A;  2ZJ9 A;  4S2O A;  3ZFZ A;  2DRW A;  1MWS A;  4OON A;  1E4D A;  5GLD A;  1H5X A;  3KSI A;  1OME A;  3PBR A;  3VSL A;  2XEP A;  3PAG A;  3LGO A;  1G68 A;  2L1M A;  3MKF A;  5DFY A;  3LY3 A;  4Q0I A;  3PBS A;  5TJJ A;  2FFF B;  2EX2 A;  4KG2 A;  2Q9M A;  2H0T A;  2PYP A;  4S2P A;  1HZO A;  3DWK A;  4OKP A;  1Z09 A;  3NEC A;  4ETX A;  4R1G A;  1D06 A;  3V50 A;  3SW1 A;  4LPZ A;  1ZC2 A;  1IKI A;  2JKR M;  1IFQ A;  1GSV A;  3NHQ A;  2QMI A;  1KVM A;  2HGV A;  2RL3 A;  3MR0 A;  5DJU A;  4S2I A;  2W3D A;  5HDD A;  1OT6 A;  2HP9 A;  5EVI D;  5FEF A;  1LT0 A;  2QJ5 A;  1DY6 A;  4GD8 A;  3O5Y A;  4BBU A;  2YKF A;  4S2L A;  3R4K A;  3T4O A;  3G35 A;  3ICY A;  1XP4 A;  5FDS A;  2Y2Q A;  3E2L A;  4JF5 A;  1DP8 A;  2JKT M;  1N4O A;  2HP5 A;  2RCX A;  5GLC A;  2H0Y A;  1FR1 A;  4I3J A;  1M40 A;  3TJZ C;  5JYP A;  2UV0 E;  1LI9 A;  1MPL A;  1YLZ A;  4JXW A;  2JN7 A;  2DCF A;  3VFH A;  5D3O A;  3W4O A;  1XA1 A;  1JVJ A;  2JC7 A;  3BFF A;  3CLO A;  4RX2 A;  1L2S A;  2EFU A;  3E0Y A;  1ESU A;  4EBN A;  4FCF A;  5TBM A;  5IS1 A;  2QWS A;  2R9W A;  2EWW A;  5FI2 A;  1NYY A;  2XA7 S;  3EGD C;  1D1J A;  4DXB A;  1FIK A;  2JE5 A;  2JHE A;  3L7H A;  4P85 A;  3PBO A;  1ONH A;  3MQQ A;  3IF6 C;  4I5S A;  2HDQ A;  1YLW A;  2XGN A;  3BQA A;  4RVA A;  5DF9 A;  3F1O B;  5G4Z A;  1L0D A;  3O86 A;  3V3S A;  2Q0O A;  4ZRR A;  5HPF A;  5CEB A;  2JCH A;  3UPP A;  1KE3 A;  1PWC A;  1K55 C;  4EQI A;  4HHD A;  2V20 A;  5EOO A;  2XR0 A;  5HDS A;  1ZG6 A;  3W4Q A;  1S4S A;  3KYZ A;  3UE3 A;  3PXP A;  1TD5 A;  2ZOH A;  3MSH A;  3IH8 A;  4M4X A;  2VZW A;  3VE4 A;  2WKR A;  3OPL A;  2HF6 A;  3N8L A;  4KUO A;  5EVE A;  2I72 A;  4CPK A;  3KO6 A;  5HL1 A;  4CJN A;  5KSC A;  1N9N A;  3CUE A;  4JF4 A;  3OPR A;  3N4I A;  3ZYT A;  4H6J B;  2Z2M B;  3N6I A;  1JTD A;  3PTE A;  2EX6 A;  5FSR A;  3HLD A;  3IT9 A;  5DF8 A;  1MXO A;  1PI5 A;  4IED A;  2J9O A;  4MMN A;  3VP2 A;  5CEC A;  3SH8 A;  4OQH A;  3HUO A;  2WYX A;  1KDS A;  2KOI A;  2EA9 A;  5F68 A;  1BYW A;  4IBR A;  3NUL A;  2L4R A;  3PYP A;  1HTZ A;  1LL5 A;  3ZG8 B;  1BLS A;  4EES A;  4WMC A;  3T4T A;  4DE2 A;  4N92 A;  4YFM A;  2OSU A;  2FH5 A;  5AQB A;  4QU3 A;  1BLP A;  4NET A;  4HP9 A;  1FQG A;  1SKO B;  3IS2 A;  2ZM8 A;  3OCL A;  4JBF A;  2ZL1 A;  1TS7 A;  4JGR A;  4JPM A;  5E2E A;  2A24 B;  4EQ1 A;  2FFY A;  5FAT A;  2XQZ A;  5DTS A;  3T1X A;  4DE1 A;  5E2G A;  1K6R A;  1KOU A;  4OOL A;  1XFQ A;  2ZM0 A;  4LLO B;  2B18 A;  2P74 A;  4X25 A;  3BM6 A;  2KLI A;  1CI9 A;  1XJ6 A;  4WZ5 A;  4WBG A;  4CQH A;  4ZAM A;  4KZB A;  2WKP A;  1OTI A;  2IWD A;  3ITB A;  4I3A A;  4BL3 A;  3MJQ A;  5CHU A;  1DJC A;  5GHX A;  3E2K A;  1BSG A;  1CEG A;  1WYB A;  1CJF A;  1PRQ A;  4UQI M;  4QWO A;  3BFD A;  3ZGA B;  3KSF A;  2EX9 A;  3T1Q B;  4R3B A;  1EI5 A;  1W63 Q;  4C75 A;  2A49 A;  2K2N A;  5F6A A;  1JWV A;  1YLJ A;  5BOH A;  3NI9 A;  5TR7 A;  1NWZ A;  5FQK A;  1TDL A;  5CGX A;  5G18 A;  3LEZ A;  1OT9 A;  3QP2 A;  4D60 A;  4ID4 A;  2WAF A;  5CTN A;  3QNC A;  3G6O A;  5DTK A;  1TS6 A;  1GSW A;  4I3I A;  3HBR A;  2LB5 A;  4OQI A;  2OLV A;  3HL9 A;  2P08 A;  5J3W A;  4JXG A;  4DDY A;  2BAS A;  4L0L A;  5DFX A;  2DMW A;  1KDW A;  4R38 A;  4AFI A;  4Y15 A;  4X53 A;  4DMZ A;  1TVF A;  5HX9 A;  2WKI A;  3W2Z A;  1OTA A;  1K56 A;  1S1Z A;  2P7J A;  3EWK A;  1TF1 A;  1HD8 A;  3K3D A;  3ULF A;  4Y3I A;  4X68 A;  3IWQ A;  1CF0 A;  4DXC A;  4HI4 A;  3LI9 A;  5F83 A;  3FKW A;  2V1B A;  1HLU P;  1VET B;  4U0T A;  2OAP 1;  2E8I A;  1O7E A;  1RP5 A;  3ZCZ A;  1K0K A;  2PR6 A;  2WKE A;  3KYQ A;  1YT4 A;  3BFC A;  4U0X A;  3ZVT A;  3C2W A;  5EM0 A;  1G28 A;  2ZOI A;  4E3K A;  1K38 A;  3HCY A;  4PM6 A;  1VEU B;  2ZMF A;  1RGZ A;  4B4Z A;  1LSV A;  3MXQ A;  1ESI A;  4OP8 A;  4P6Z S;  5FI6 A;  3EEH A;  2XK1 A;  4FH4 A;  4RQ9 A;  1KGE A;  1K4F A;  3BY9 A;  2VGL S;  2ZM2 A;  1S6R A;  4QJG A;  1NJ4 A;  2CC1 A;  3HLW A;  1ERO A;  4R0Q A;  2A24 A;  4I38 A;  3O88 A;  3HRE A;  2XDM A;  1N9O A;  2EWV A;  2HZ5 A;  4EBP A;  5DTT A;  5FDH A;  2ZC3 B;  4F94 A;  5FL3 A;  2B5R A;  5DJT A;  5F1F A;  3KSG A;  3BFE A;  3QP1 A;  4PM9 A;  3GDI A;  3S1Y A;  1MC0 A;  2BG1 A;  3UDF A;  4GCZ A;  5I94 A;  4ZTK A;  2W3E A;  4PKY G;  4N9K A;  4BJP A;  5EUA A;  2J80 A;  1K6S A;  2V1A A;  2M7U A;  3A3F A;  1JTG A;  5CXW A;  4BBT A;  2PD8 A;  3DTK A;  2K7S A;  3LIE A;  1PZO A;  4HJ6 A;  4OPZ A;  1XFN A;  1ZTU A;  2ZC6 B;  3A0V A;  5IT5 A;  4OLG A;  3TOI A;  3JYI A;  2XLN A;  3UB5 P;  4FOF A;  3ZVW A;  3JPU A;  2QHK A;  2Y4A A;  3ZDJ A;  1V9Y A;  4MBK A;  1L0F A;  4BBV A;  3F1N A;  5M19 A;  3EQV A;  4MN7 A;  4NG2 A;  2WAD A;  1J9M A;  5EM1 A;  4HOI A;  5KMW A;  4X1M A;  4LFU A;  5L10 A;  4JXS A;  3V3R A;  4PM7 A;  1G6O A;  4Y0O A;  1YSQ A;  3IXH A;  2VV7 A;  1KGG A;  1M6K A;  3N7W A;  3NDG A;  4KZ5 A;  5KSH A;  2VEA A;  1IKG A;  5HAI A;  3GTC A;  1MWT A;  1RGY A;  4BEN A;  1E3U D;  1H3Q A;  4OQG A;  3FZC A;  5GHY A;  2WAE A;  3P09 A;  3V5M A;  3GR2 A;  4XUZ A;  3RFB A;  2PRF A;  5FQI A;  1VM1 A;  2XFT A;  4LEN A;  2D01 A;  3LYX A;  1ODV A;  4DDS A;  3B3X A;  1LLB A;  1OJ5 A;  2HDU A;  2YKH A;  4UHU A;  2Y2O A;  4S2J A;  5HW3 A;  4NEE D;  4Y0U A;  3RH8 B;  3ISG A;  2WGW B;  2PR5 A;  1DRM A;  3BLS A;  4WM9 A;  3UDX A;  4EW7 A;  1BTL A;  3WS0 A;  4UA6 A;  1RCJ A;  4KQQ A;  3SH7 A;  4HH2 A;  4X1L A;  3WS4 A;  1IYO A;  5J4E A;  3G2Y A;  1K55 A;  1BLC A;  3F1P B;  4DKI A;  3FYZ A;  2EXA A;  3UB7 A;  5EE8 A;  1ERM A;  2C5W B;  3NIA A;  2PAV P;  1S0W A;  3D9Y A;  4QB8 A;  5DKK A;  4HP4 A;  5FQJ A;  3ZG5 A;  2WGI A;  1Y28 A;  1W7F A;  5EVL A;  3IX3 A;  2XF3 A;  5F82 A;  2O99 A;  1F5M A;  4R3A A;  4LRX C;  3G34 A;  2JKF A;  4P6Z M;  4GB7 A;  3F1P A;  1PZP A;  1PWD A;  4OH0 A;  3C7U A;  4O8G A;  4M3K A;  5A8B A;  3S7O A;  1PW1 A;  4OPQ A;  4R4S A;  4A5R A;  2PU2 A;  4DRT A;  2HJ9 C;  5EVI C;  4R6L A;  4ZJ3 A;  1IYP A;  4WMC D;  3LEQ A;  4B88 A;  4ZJ2 A;  2NUP C;  1K56 D;  1A0K A;  3HJI A;  1MZU A;  2Y2I A;  3FWL A;  4FTX A;  2JKR I;  4K0W A;  2VA0 A;  3L9K A;  5HWT A;  3GMW A;  3NCK A;  3LID A;  4QY5 A;  3UNW A;  3UE0 A;  4DJ3 A;  2V0W A;  4P6B A;  5FAS A;  3IXB A;  3RXX A;  3SS3 A;  3G30 A;  3IF6 A;  4X55 A;  5L07 A;  3QP4 A;  1NY0 A;  4EWF A;  2XFS A;  3C8C A;  3BY8 A;  4EEU A;  3MF0 A;  2X01 A;  3VE3 A;  3LIF A;  3CMZ A;  3VOL A;  1BUE A;  5KIZ A;  4P87 A;  3NC8 A;  3OCN A;  1BT5 A;  3MXR A;  4EXO A;  2V8F A;  1YPR A;  4HBT A;  5A91 A;  3O3V A;  3G31 A;  4XT2 B;  2QYB A;  3S4X A;  4NXG A;  2G2U A;  3TW8 A;  2PD7 A;  2V1Z A;  5L8M A;  4E6W A;  3B47 A;  4EET B;  3S22 A;  4BL2 A;  4B4X A;  4HQA A;  1NYM A;  2KX6 A;  4BLM A;  3IHA A;  5GLB A;  5EVI A;  2PHY A;  1PWG A;  3IX8 A;  1LSW A;  4EU0 A;  4GW9 A;  3E4Q A;  4WZ5 C;  1MY8 A;  2HV1 A;  4WL9 A;  2D02 A;  1SCW A;  1UGU A;  3PBN A;  3IQA A;  1ZG4 A;  4HJ3 A;  4PHT A;  4IVI A;  5M1A A;  4ARZ B;  4E3O A;  3A3J A;  2XRO A;  4DN0 A;  5AQ9 A;  3GSG A;  3D72 A;  1E25 A;  1XPB A;  3OZH A;  3BJN A;  4ZDX A;  4CLC A;  3HVF A;  4YIN A;  4GN2 A;  5HFO A;  1XA7 A;  2OWJ A;  1CQA A;  5CGS A;  1FOF A;  3MKE A;  4WEK A;  2Y91 A;  4XXR A;  3WWX A;  2VK3 A;  1IEM A;  3B42 A;  4Q8I A;  4BMW A;  4U3T A;  2GNX A;  3FG8 A;  4K91 A;  3B33 A;  4JGO A;  4MDZ A;  5CHM A;  3OPH A;  3C30 A;  2ZQ9 A;  4S2N A;  1FSW A;  2ZQC A;  3UO9 A;  5FA7 A;  2EXB A;  2WGW A;  2Y2N A;  1OTB A;  3ZNT A;  1DJA A;  4JXV A;  1PW8 A;  1Q2P A;  4S2K A;  1ES2 A;  2B02 A;  3BYD A;  3VV4 A;  5G4Y A;  4FSF A;  5HPI A;  3U2A A;  1XGJ A;  3C7V A;  4ESP A;  3RTY A;  2QJ7 A;  1GSX A;  1LSX A;  2MJ6 A;  5A92 A;  2HPB A;  2WK0 A;  4PKY A;  4Y2F A;  2W27 A;  3A3D A;  3P98 A;  1IEL A;  5FAP A;  4HIA A;  4MCW A;  3F1N B;  2C6W B;  4WN5 A;  2QKP A;  1Y4O A;  3GVB A;  2VV6 A;  3C5A A;  4HBU A;  1ES3 A;  1Y54 A;  4WYY A;  5C5K A;  2W3G A;  4CLC D;  4UA7 A;  2X02 A;  5GLA A;  3FPW A;  4DE0 A;  5AQA A;  1YQS A;  2ZLY A;  5AQ7 A;  3SS5 A;  1IYS A;  5HDC A;  1P9R A;  1K54 A;  1MKI A;  3UY6 A;  2L0W A;  5DVA A;  1T19 A;  4HES A;  3VFF A;  1UWP X;  4LRY C;  2ZQ7 A;  3C38 A;  4UQI S;  1LHY A;  2WZZ A;  2QZ6 A;  5FEG A;  5CX7 A;  2HDS A;  5IHV A;  5EV0 A;  1T1A A;  2Z6D A;  3DTE A;  3EQU A;  4GDB A;  4N9L A;  3FC7 A;  4S2M A;  3LR3 A;  4C3Q A;  2J3T C;  4X6T A;  3UPO A;  3CAX A;  4CLC E;  4NKP A;  1MWR A;  3E4P A;  4MN5 A;  2ZD8 A;  4GHI B;  4BD0 A;  1XKZ A;  1F2K A;  3TSG A;  1XXM A;  3A0S A;  3MXS A;  3OBF A;  5FAQ A;  1U60 A;  1YLP A;  2PBY A;  3VP0 A;  1GHP A;  1LL9 A;  3G2Z A;  3UDI A;  5TFQ A;  3PBT A;  1QME A;  2B95 A;  2OWH A;  2Y2P A;  3HLG A;  1NLZ A;  1W5D A;  2JBF A;  4LV0 A;  1MBL A;  1H8Y A;  1VQQ A;  3DAV A;  5HAR A;  4OVD A;  1VHM A;  4EEP A;  4L9G A;  3R7W B;  2V0U A;  1MKM A;  3FKV A;  1K4E A;  3PAE A;  3W8K A;  2Y8H A;  2V2F F;  3E4O A;  2Y55 A;  3UE6 A;  3CWF A;  3IXG A;  4RX3 A;  3SS4 A;  3Q07 A;  1GHM A;  3M2K A;  4GLQ A;  1KE0 A;  3AGE A;  3CG5 A;  1ONG A;  3AGD A;  4I39 A;  1WYC A;  1D7E A;  3IF6 B;  3Q7Z A;  4EUV A;  3GQZ A;  3N8S A;  1KE4 A;  3DWZ A;  1G6A A;  1XX2 A;  1S1Y A;  3QHY A;  2IA2 A;  1AWI A;  4IVK A;  1NLY A;  3R7W A;  4JGP A;  2VKS A;  2I9V A;  2DNS A;  4X69 A;  5FAO A;  4E3M A;  3UME A;  3UPN A;  2Y2H A;  5E2H A;  2PYR A;  1P9W A;  3UB9 A;  5HL6 A;  1AXB A;  3VMA A;  1O07 A;  2OOL A;  3UB8 A;  5HD5 A;  1IOU A;  4NXF A;  4GZB A;  1DP6 A;  2VGJ A;  1OTD A;  5FQQ A;  1J3W A;  1IYQ A;  4ME4 A;  4QY6 A;  2J7V A;  1PI4 A;  3P01 A;  1YLY A;  1P97 A;  4YNR A;  5K5B A;  1I2W A;  2WKQ A;  3CJM A;  4LCL A;  2PU4 A;  1JWP A;  2W1T A;  2A3U A;  5AVE A;  1SZV A;  5I5L A;  3T4Q A;  4KQD A;  2KDK A;  1NRF A;  4N1X A;  2XSS A;  4KZ6 A;  3LR5 A;  4RA7 A;  3A3E A;  3K2N A;  1WA9 A;  2J9P A;  3TG9 A;  2ZL1 B;  3GV9 A;  4MN6 A;  5E43 A;  2OAQ 1;  4DJ2 A;  1W63 M;  4HY8 A;  2G2W A;  3LCE A;  4MBF A;  1FR6 A;  4II7 A;  3G32 A;  1CI8 A;  1S66 L;  1YKD A;  3NOU C;  1SKF A;  3MZF A;  3CZD A;  2ZC7 A;  5F1G A;  3CPT A;  2H10 A;  1FCM A;  3N8R A;  5J7E A;  2VGK A;  3LI8 A;  2WZX A;  4GKU A;  4DF6 A;  1TEM A;  1SHV A;  3KSH A;  5M18 A;  1S67 L;  2ZMA A;  3MZD A;  1N9L A;  3P7N A;  1EWZ A;  2Z6C A;  3WS1 A;  2J8Y A;  2ACG A;  4WEJ A;  5F5Y A;  5FQM A;  1N9B A;  1NZO A;  3ITA A;  1ES4 A;  2A2L A;  1Q2Q A;  2GX5 A;  4Y17 A;  1NZU A;  4BQM A;  3ZHH A;  4MLL A;  2XD5 A;  1ACF A;  2E8J A;  1W79 A;  3IBJ A;  5EVI B;  2WKH A;  3AGF A;  3IWO A;  3KX0 X;  1YSP A;  1STZ A;  2X71 A;  4EBL A;  2G7U A;  2EFX A;  4R4R A;  5HSQ A;  3TE8 A;  5FI7 A;  4WZ4 A;  5HAP A;  3C4O A;  2ZBB A;  4ARZ A;  3LR4 A;  4P0M A;  2AVX A;  4QHC A;  2HJE A;  2ZMV A;  4O01 A;  4XT2 A;  5HAQ A;  2P04 A;  3LFV A;  5EPH A;  2HP6 A;  4OP5 A;  4JF6 A;  2Y2M A;  3V67 A;  4DE3 A;  3S7P A;  3IBR A;  3DTM A;  3H7W B;  3HLC A;  4LGW A;  3WS2 A;  3UMD A;  5GHZ A;  1FIL A;  4JGQ A;  4ZBE A;  4Y13 A;  5GL9 A;  3RJU A;  1NXY A;  3MMH A;  3VSK A;  3S7N A;  2INW A;  4Q0H A;  1H8M A;  4E3L A;  2W1R A;  3A0R A;  4ETZ A;  3WRZ A;  1ZKJ A;  1JWZ A;  2PDR A;  3Q7V B;  4FH2 A;  3HUN A;  3Q1F A;  1SDN A;  1NRJ A;  4KZ7 A;  4OPR A;  2JKT I;  3SOI A;  3NJA A;  2O9B A;  3VP4 A;  1P0Z A;  3M6H A;  4MNR A;  3CHW P;  1F98 A; 
#chains in the Genus database with same CATH homology
 2HZ5 A;  3U4L P;  1CQA A;  1G5U A;  2ACG A;  3CPT A;  3L7H A;  2V8F A;  3NUL A;  2ZL1 A;  1A0K A;  4X25 A;  1PFL A;  1CJF A;  2ZL1 B;  2PAV P;  1SKO A;  5FEF A;  1PRQ A;  2JKG A;  2VK3 A;  3D9Y A;  3KYE A;  4D60 A;  1VEU A;  4QWO A;  2B95 A;  4FTX A;  5EM0 A;  2V8C A;  3CPT B;  1PNE A;  1Z09 A;  1VET A;  5FEG A;  1CF0 A;  3MS6 A;  3NEC A;  2PRF A;  3T1X A;  1F2K A;  3LGO A;  3L9K A;  3MSH A;  5EM1 A;  4X1M A;  1AWI A;  5EV0 A;  1SZV A;  1VEU B;  1HLU P;  1VET B;  3T1S A;  1ACF A;  2E8J A;  3T1R A;  3T1Q B;  1SKO B;  4ESP A;  3DAV A;  2BTF P;  1Y4O A;  4X1L A;  3T12 B;  1J3W A;  2PBD P;  2JKF A;  1D1J A;  3CHW P;  4FUW A;  5EVE A;  5FDS A;  3UB5 P;  3LEQ A;  1FIK A;  1K0K A;  1YPR A;  1FIL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...