3IF6A

Crystal structure of oxa-46 beta-lactamase from p. aeruginosa
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
242
structure length
227
Chain Sequence
b'VVIRSDWKKFFSDLQAEGAIVIADERQAKHTLSVFDQERAAKRYSPASTFKIPHTLFALDADAVRDEFQVFRWQDQDLRSAMRNSTVWVYELFAKDIGEDKARRYLKQIDYGNVDPSGDYWIDGNLKISAHEQILFLRKLYRNQLPFKVEHQRLVKDLMITEAGRSWILRAKTGWEGRFGWWVGWIEWPTGPVFFALNIDTPNRTDDLFREAIARAILRSIDALPPN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords OXA-46 oxacillinase
publication title Crystal structure of the narrow-spectrum OXA-46 class D beta-lactamase: relationship between active-site lysine carbamylation and inhibition by polycarboxylates
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Hydrolase
total genus 67
structure length 227
sequence length 242
ec nomenclature
pdb deposition date 2009-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3if6A00
4OQGA 1ES3A 4R4RA 3VP2A 3VSLA 3W8KA 3UN7A 3A3IA 4WMCA 1KVLA 3N8LA 2Y2LA 3NDGA 3BM6A 2ZJ9A 3QHYA 5G18A 1K54C 4QU3A 4MBFA 4MLLA 2PU2A 1PIOA 2XH9A 5AQ7A 5F82A 1XXMA 4X6TA 3EQUA 3IF6B 2G2WA 3MKEA 2H0TA 2WADA 3AGEA 3IHBA 2ZQ8A 3LEZA 4XUXA 1MWRA 4EQIA 4ZDXA 5EE8A 2G2UA 4GN2A 3SH7A 3Q81A 2OLUA 3IF6A 2XR0A 5KZHA 2QZ6A 2ZC5B 1YLPA 2ZM2A 4KZ3A 3JYIA 4L0LA 1JTDA 3VP3A 3HLCA 3OPHA 4P85A 1ES5A 4KZ9A 3BEBA 3ZFZA 5EVLA 4Y0UA 3C4PA 5EECA 3A3FA 3BECA 4OOLA 3SH8A 2X71A 2ZC6B 1U60A 4C6YA 2XD1A 3TG9A 3HREA 1K6RA 4QB8A 1FCMA 3VFHA 3O3VA 4S2NA 4BD0A 1YLWA 4E6WA 4JF6A 2EX2A 3IQAA 1VQQA 3GQZA 3GV9A 1K55A 1BULA 3IWIA 3E2LA 4UA9A 2H0YA 1K38A 1TDLA 4IVKA 4WELA 4X55A 3C7VA 1HTZA 1FCOA 2WAFA 3BYDA 3UE3A 3ZVTA 4PM6A 5BOHA 5FQIA 3GVBA 4S2NC 4UA6A 5M18A 3WS4A 1Y54A 3HLBA 1IEMA 3UE0A 4R3JA 5FAOA 4ZJ3A 4UA7A 3VP0A 1BTLA 2H10A 1LHYA 4Q8IA 4OPQA 1I2SA 3IXHA 1VM1A 3HLGA 1IYOA 3HLFA 4F94A 1E3UD 4X69A 5M19A 4OP5A 2V20A 4R3BA 3ZVWA 4OH0A 1H5XA 1PWCA 2CC1A 4LENA 4JXVA 4M3KA 4WBGA 4CJNA 3MXRA 4OLGA 4ID4A 1M40A 1FOFA 2DRWA 3EQVA 5J8XA 2P9VB 3V3RA 4K91A 1SDNA 5EVIC 5JYOA 4S2KA 1CEFA 3HLEA 1J9MA 2P9VA 1K57A 3LY3A 1YLJA 3CJMA 5EOOA 4FH4A 5DF8A 1AXBA 5GLDA 1BLHA 1ES2A 3BFGA 5FQKA 1WE4A 2R9WA 4HBUA 5A93A 2XGNA 1SHVA 1ESUA 4JLFA 3HL9A 4FH2A 1SKFA 4RX2A 4OOMA 5DVAA 2HP9A 5E2GA 3Q82A 2JBFA 4U3TA 1NYYA 4WMCD 4WYYA 2Q9NA 1L0DA 1NXYA 2ZC3B 3ISGA 3MKFA 4OONA 5HAQA 2Q9MA 1DJAA 2WUQA 3BRMA 1ERMA 1YLTA 1YLZA 2Y2KA 4IVIA 4GB7A 3NDEA 4R4SA 3P98A 2I72A 2JCHA 1E3UA 2X02A 3RXWA 1M6KA 1IKGA 3NC8A 2WZZA 4GKUA 4KG2A 3WRTA 4DKIA 4EBPA 1BLSA 3S4XA 3OCNA 5CHJA 2A49A 3OZHA 3CZDA 3UDIA 1K4EA 5E2HA 3BFDA 3G30A 5CEDA 4E3LA 1GHMA 3PAGA 2WGWB 5EPHA 3HUMA 4A5RA 3GTCA 3ZG0A 3O87A 4ZTKA 2XK1A 3ZG8B 3Q07A 2ZQAA 4JF4A 3BLSA 4S2OA 4B88A 4QHCA 4IBXA 2XDMA 4N92A 2WGWA 1KDWA 4BL2A 3DTMA 1K54A 2ZQCA 1LI9A 1PWGA 3O88A 1IYPA 2IWCA 1DY6A 2Y2GA 4R1GA 5A91A 1E25A 4GDBA 1NYMA 4DXBA 3IWQA 1CK3A 1JWZA 3PBTA 4EWFA 4H8RA 4QY5A 3N6IA 2JE5A 4DE3A 2P74A 3QNBA 4WZ5C 3O86A 3W4OA 1LLBA 4DF6A 2Y2IA 2ZQ9A 3WRZA 2ZM8A 4UAAA 3BFCA 4E3IA 3B3XA 3ZGAB 2B5RA 1IELA 5EVID 3PBNA 3ZCZA 4GOGA 3AGDA 4LCMA 1XA7A 1W7FA 1NRFA 4KQOA 4GD6A 3TOIA 1ZG4A 5CRFA 3DWKA 2ZD8A 5A90A 4ZAMA 3IT9A 3G2ZA 4JXWA 1YMXA 3GR2A 4DDYA 3A3JA 5FI7A 4GZBA 1JWPA 1BT5A 1G6AA 5EUAA 3IXBA 1ES4A 5FAPA 3W4PA 2XD5A 5HARA 3VSKA 3PBSA 3ZG7B 3UO9A 1IYSA 3ZG5A 2XFTA 2Y2MA 3GRJA 1PW1A 4YFMA 1EROA 3VP1A 1BLPA 5CXWA 4JBFA 3VOYA 1O07A 1K4FA 4BQMA 1PW8A 1E4DA 1CI8A 4PM8A 1PI5A 5U47A 4E6XA 2IWBA 4OOYA 5L2FA 4BJPA 5EVIB 4BD1A 4MBKA 2OV5A 1SDEA 4OP8A 1GHIA 4RVAA 2HDRA 5HFOA 2WYXA 3UY6A 4RX3A 3IXGA 5EVIA 4Y0TA 4E3KA 1NZOA 2Y4AA 3FYZA 3OCLA 1QMEA 1IKIA 1MKIA 3Q7VB 2IWDA 1L0FA 3RXXA 3IWOA 5FASA 2ZLYA 5IHVA 5CEBA 2Z2MB 4OPRA 5E2FA 2WKHA 3HBRA 4B4XA 3Q7VA 2XEPA 1FQGA 5GHXA 1MWTA 3V50A 3GSGA 4EV4A 1BZAA 1KGFA 4MNRA 4R0QA 2EXBA 1H8YA 1XKZA 1PI4A 2WK0A 4E3OA 2V2FF 4EUZA 5JYPA 1KGGA 1Z6FA 3MFDA 4D2OA 2J8YA 5FI6A 4U0XA 2WZXA 4P87A 4YINA 5GL9A 4RYEA 4KZ5A 4DDSA 5TFQA 1FSYA 3M2JA 3WS2A 1PYYA 1I2WA 1XP4A 2Y2HA 4N1HA 5FAQA 1W8YA 2JC7A 3N8SA 1XA1A 3E2KA 3M6HA 3CG5A 5FQMA 3A3DA 1L0GA 5CHMA 1Q2QA 1GCEA 4R23A 2VGKA 3P09A 4C3QA 5F1FA 2Y2QA 3FKVA 3ZG9B 1W5DA 3S1YA 2HP5A 5CTNA 5CECA 4EBLA 4X56A 3HVFA 4NETA 3C7UA 1JVJA 1C3BA 2C6WB 3QNCA 1ERQA 1YMSA 4N1XA 4B4ZA 2Y55A 1ESIA 1YT4A 5GHZA 5CGWA 1HD8A 1JWVA 4KZBA 3CMZA 5I94A 3Q7ZA 4GNUA 3NCKA 3HUNA 5AQAA 5CTMA 5DTSA 4O7DA 4UHUA 4LCLA 1K56D 5GLBA 1WYCA 4X53A 3BFEA 3G34A 5CERA 4KG6A 1KDSA 3VOZA 4WZ5A 3DW0A 4KQRA 4WEJA 1N4OA 3FKWA 1I5QA 2HDQA 1S6RA 3IF5A 4HBTA 3SS4A 3SOIA 4E3NA 4E3MA 1ZG6A 4OLDA 4Y7PA 5CGSA 3LY4A 1LL5A 4GDNA 1ZKJA 2RCXA 4MBHA 3LCEA 1LI0A 1LL9A 1O7EA 4P0MA 3V5MA 2EXAA 3FV7A 1KVMA 3G35A 5FQ9A 3ZNYA 1L2SA 5FSRA 1SCWA 1W79A 2RL3A 5CHUA 2ZC7A 4OPZA 4KZ7A 3OC2A 3C5AA 1MY8A 3IHAA 1CI9A 2Y2OA 3RJUA 2ZMAA 4FCFA 4GD8A 3WWXA 3PAEA 2HDUA 4X68A 4LV0A 4N9LA 3N7WA 2BG1A 2HPBA 1ZC2A 3SH9A 5DTKA 1YLYA 2E8IA 5AQ9A 5KMWA 2V1ZA 5DF9A 3VFFA 1KE3A 4WM9A 4QJGA 4KZ8A 3FZCA 3HLDA 1K56A 3ITAA 4KZAA 2J7VA 4P6BA 5DTTA 3UPPA 5FI2A 5HL1A 3I7JA 4N9KA 1FCNA 1H8ZA 2EX6A 4K0XA 4LV2A 4DRTA 4DE2A 1NJ4A 1N9BA 3LO7A 4JXGA 2XFSA 1MWUA 3IH8A 3UE1A 1EWZA 4QD4A 3ITBA 4S2PA 2R9XA 3NI9A 1FSWA 2GDNA 1RGYA 3BFFA 1G68A 3ZDJA 4S2LA 2X01A 3VP4A 3S22A 1KGEA 1Q2PA 2WGVA 4BENA 5KSHA 5D3OA 4KQQA 4E3JA 3MZFA 4JKTA 3G32A 1FR1A 3IF6C 3N8RA 3UPOA 2EX8A 5FA7A 4IBRA 3G4PA 1DJBA 5FDHA 2J9PA 3M2KA 5TR7A 3NY4A 3MBZA 1XGIA 4S2JA 2XF3A 3M6BA 1L0EA 3WS1A 5GLAA 4IEDA 4ZJ1A 1KE0A 1W8QA 2Y2NA 2UWXA 2Y2PA 1ONGA 5F83A 3UDXA 2OSUA 3AGFA 2A3UA 2QPNA 4HEFA 1WYBA 1OMEA 1HZOA 3IH9A 2FFFB 4PMAA 2EFUA 2BLSA 5EOEA 5AQBA 1K55C 5KSCA 2XLNA 3DWZA 3Q1FA 4FD8A 3VMAA 2ZC4B 4BL3A 3UNWA 2Y59A 2OLVA 1FR6A 5E2EA 3HLWA 5HW3A 4OQIA 1BLCA 2J9OA 4DE1A 3HUOA 1MPLA 1BSGA 4BLMA 1K25A 1CEGA 4NK3A 4OQHA 4WEKA 3PBRA 2EFXA 4OQ0A 2ZQ7A 3SS5A 1RCJA 1K6SA 2WGIA 1NY0A 5DF7A 5A92A 2Y91A 3MZEA 3OPLA 2WKEA 3PBQA 4JF5A 4K0WA 1IYQA 3SS3A 3WS5A 5FQJA 1TEMA 4KZ6A 4JPMA 4DXCA 1GA0A 4OKPA 4RA7A 3V39A 4PM9A 4CPKA 4Y0OA 3BLMA 2VGJA 4HESA 4C75A 5F1GA 1S0WA 1MXOA 3ZHHA 4WZ4A 2Y2JA 2DCFA 1PZOA 4XUZA 4OPYA 3UPNA 1MWSA 2WKIA 4PM5A 3FWLA 1DJCA 1KE4A 2Z2LB 3IXDA 4KG5A 4KENB 1K57C 1MBLA 4QY6A 1GHPA 3ZNTA 2WAEA 4PPRA 1YM1A 1TDGA 1JTGA 3C4OA 4Z9QA 1TVFA 4MEZA 5FQQA 1NZUA 1YQSA 2XQZA 3PTEA 3N4IA 5HX9A 1PWDA 2H5SA 1XGJA 2ZM0A 3G31A 3TSGA 2PBYA 3W4QA 4OVDA 2QMIA 4ZJ2A 1PZPA 1RP5A 1QMFA 2ZQDA 3PBOA 1ONHA 2PU4A 3MXSA 5GHYA 2DNSA 3NBLA 3OPRA 4U0TA 1RGZA 3MZDA 5HAPA 5GLCA 4S2IA 1BUEA 4KZ4A 5E43A 5TGFA 2FFYA 3OPPA 4JXSA 4ZBEA 3D4FA 5HAIA 3WS0A 3A3EA 5FATA 4DE0A 3G2YA 1ALQA 4S2MA 1GA9A 4FSFA 3NIAA 4LV3A 4PM7A 1EI5A 5M1AA 2EX9A 3V3SA 4XXRA 3GMWA 4LV1A 5CGXA 2HDSA 2C5WB 1XX2A 2HP6A 4EBNA 1HVBA 3UDFA 1XPBA
chains in the Genus database with same CATH superfamily
1JNUA 3W8KA 4WMCA 2Y2LA 3BM6A 2ZJ9A 3QHYA 4MLLA 2PU2A 1VEUA 1XXMA 2ZL1A 2G2WA 3MKEA 2H0TA 3F1PA 3F1NA 3LEZA 4EQIA 4ZDXA 4WF0A 2XR0A 1F5MA 3RFBA 3ZYTA 3JYIA 3VP3A 3HLCA 1ES5A 5HDSA 3BEBA 4DMZA 2OAQ1 3SH8A 1U60A 4EW7A 4Y5FA 3HREA 1FCMA 3VFHA 3O3VA 4S2NA 1YLWA 4E6WA 3IQAA 2B02A 1BULA 3IWIA 4I3AA 3QP2A 1EW0A 1FCOA 3UE3A 5BOHA 5FQIA 3T50A 2QYBA 3MJQA 2ACGA 4R3AA 4UA7A 3VP0A 1BTLA 4OPQA 1I2SA 3IXHA 2HGVA 1IYOA 3HLFA 1E3UD 4X69A 2V20A 4R3BA 3KO6A 4P6ZM 3ZVWA 5FDSA 5EFWA 2W3DA 1CQAA 2P08A 3QP8A 2L1MA 2P9VA 2QJ7A 1K57A 1YLJA 3CJMA 2PT7A 5EOOA 5GLDA 1WE4A 2R9WA 5A93A 1OPXA 4JLFA 4OOMA 3Q82A 5HPFA 4U3TA 2D01A 1NXYA 2Q9MA 1DJAA 4GB7A 3NHQA 4PKYG 2I72A 3RXWA 1M6KA 1IKGA 3WRTA 3MS6A 4DJ2A 4DKIA 3CPTB 1L3LA 1BLSA 2W1RA 1PNEA 5CHJA 2A49A 3CZDA 3UDIA 1ZTUA 4E3LA 4ESPA 3B47A 5EPHA 3HUMA 3O87A 4B88A 3S7QA 1VETB 1KDWA 1MC0A 1K54A 4Y2FA 2IWCA 1NRJA 5A91A 2Z6CA 2KDKA 4IJGA 1JWZA 4EWFA 4H8RA 4JGPA 2JE5A 1NLZA 2JN7A 3LIEA 4HHDA 4MCWA 3BFCA 3ZGAB 2B5RA 4K08A 5EVID 3PBNA 3ZCZA 3CLOA 3OOVA 4KQOA 4GD6A 5K5BA 1ZG4A 2ZD8A 2GX5A 5KIZA 5A90A 3G2ZA 4JXWA 4GJ4A 3H7WB 5FI7A 1S1ZA 1XJ6A 3R7WA 1ES4A 5HARA 3DTKA 3PBSA 4NEED 4CLCA 3SZTA 3LIBA 5EVEA 4ETZA 3V67A 4JBFA 4DJ3A 4I3JA 2DMWA 4YWZA 4OOYA 1HLUP 3LIAA 4BD1A 2HDRA 3UY6A 1F9IA 1SKOB 2PD8A 5J3WA 2V0WA 3Q7VB 3U2AA 2ZLYA 2Z2MB 4OPRA 3HBRA 1MWTA 4PHTA 4EV4A 1BZAA 3UMEA 2EXBA 3KSGA 2YKHA 2WK0A 4EERA 5HL6A 4EUZA 1Z6FA 3MFDA 3CWFA 1T1BA 4U0XA 5FL3A 4YINA 5GL9A 5TFQA 3KYZA 4MN6A 1PYYA 1XP4A 3NULA 3N8SA 2JC7A 1TS8A 1GCEA 2GZAA 3P09A 2UV0E 5F69A 4GW9A 3ZG9B 2HP5A 3EGDC 4EBLA 2VX8A 4X56A 1LSWA 3G6OA 4NETA 5HWTA 1ESIA 5CGWA 1FIKA 1OTEA 4GNUA 2XROA 5AQAA 1K56D 4HJ3A 5CERA 4KG6A 3DW0A 1N4OA 2V1AA 4HBTA 3SOIA 3NECA 5G4YA 4KUKA 1ZG6A 4OLDA 2CMNA 3W2ZA 4GDNA 1ZKJA 4MBHA 2PR5A 3V5MA 1KVMA 3TW8A 4AFIA 5FQ9A 5J7EA 3T4QA 5FSRA 2RL3A 2ZC7A 4KZ7A 4GS9A 3IHAA 1CI9A 4GD8A 4X68A 2HPBA 1ZC2A 5DTKA 2E8IA 3B42A 5DF9A 1T18A 5DTTA 3ITAA 5FEFA 2J7VA 1H8ZA 4K0XA 1NJ4A 1TS6A 1P97A 4HIAA 4S2PA 2GDNA 2X01A 3VP4A 5AVEA 1Q2PA 3BJNA 3LR4A 5KSHA 4E3JA 3BQAA 3BW6A 3MBZA 3E4QA 5GLAA 2INWA 2UWXA 3S7NA 3KYEA 2JKTI 4HEFA 3IH9A 2FFFB 2BLSA 5F5YA 5AQBA 2Q0OA 2XLNA 3VE3A 1OTDA 5IU1A 3HLWA 5DFYA 1CEGA 4OQHA 3PBRA 4OQ0A 2ZQ7A 2HZ5A 1RCJA 1K6SA 4GHIB 4HI4A 5DF7A 3MZEA 3PYPA 2WKEA 1TEMA 4KZ6A 4JPMA 4DXCA 2ZMFA 4Z1WA 4QPRA 2DCFA 1PZOA 3PR6A 1DJCA 2GJ3A 3IXDA 4KG5A 1K57C 1MBLA 4QY6A 1GHPA 4NXGA 3C4OA 4Q0IA 3LEQA 3T4OA 4C3QA 2H5SA 1XGJA 3W4QA 5G4ZA 4OVDA 2QMIA 4ZJ2A 1PZPA 1RP5A 2ZQDA 1ONHA 1MKMA 2R78A 1F98A 5HWWA 1UGUA 4ZBEA 3D4FA 3WS0A 3LYXA 3G2YA 4S2MA 1GA9A 4O0PA 1EI5A 3GMWA 3BY8A 4EXOA 3P01A 3UB5P 2C5WB 1XX2A 2HP6A 1HVBA 3KYQA 4OQGA 3IBJA 4R4RA 3VP2A 3UN7A 3A3IA 2VEAA 4X1LA 4L9FA 4Q0HA 1K54C 2OWJA 1PIOA 2XH9A 1FILA 4X6TA 3IF6B 4WN5A 3IHBA 3AGEA 3LUQA 2ZQ8A 3P7NA 1MWRA 3NOUC 5EE8A 2G2UA 4GN2A 3SH7A 2VJWA 1YLPA 2ZM2A 1JTDA 3H9WA 3T4KA 3T4SA 5EVLA 4Y0UA 3C4PA 1LSVA 1V9YA 4OOLA 2ZC6B 2OWHA 3TG9A 1VHMA 4BD0A 3GV9A 3E2LA 4WELA 2H0YA 3VOLA 4X55A 2WAFA 3BYDA 1D06A 4PM6A 4NXEA 4UA6A 5M18A 3WS4A 3HLBA 4CLCC 4G3WA 5L10A 2H10A 2M1CA 5C5KA 4LRXC 4F3LB 1VM1A 2GNXA 4OP5A 2YKFA 1H5XA 4PKYA 4LENA 4M3KA 3MXRA 3HJIA 4OLGA 3EQVA 4HJ6A 5J8XA 1YKDA 4K91A 1CEFA 3HLEA 4CLCE 4FH4A 2VV6A 4EU0A 3BQ8A 3BFGA 5FQKA 3QP6A 4LLOB 1SZVA 1SHVA 1ESUA 2K2NA 3HL9A 1SKFA 4RX2A 5E2GA 3UB8A 1NYYA 2ZC3B 1UWNX 1YLTA 4EETB 3E98A 3P98A 3QP1A 3NC8A 3S4XA 1XJ4A 5HZHA 1K4EA 3G30A 3UE6A 1GHMA 3CPTA 2WGWB 4HQAA 3KX0X 3DAVA 3ZG8B 3BLSA 4QHCA 4IBXA 4BL2A 1G5UA 2O9CA 4R1GA 1E25A 1VETA 1NYMA 4GDBA 3IWQA 4QY5A 1MZUA 3W4OA 3MMHA 4HP4A 2Y2IA 3WRZA 2ZM8A 4KQDA 1N9OA 3B3XA 4GOGA 2JKGA 3TRCA 4LCMA 1XA7A 3FPWA 1W7FA 5CRFA 3K3DA 5DJUA 4JGQA 5CX7A 2ZOHA 1YMXA 2ZMVA 5F68A 1JWPA 5EUAA 2BTFP 3ZG7B 3H7WA 1IYSA 3UO9A 3ZG5A 5HPIA 2PR6A 4LGWA 1OTIA 1PW1A 4YFMA 3VOYA 4BQMA 3FC7A 1E4DA 4E6XA 2IWBA 5EVIB 4MBKA 2OV5A 1SDEA 1GHIA 2J3WA 2WYXA 3MQ0A 2V8CA 1NZOA 2J3TC 3FYZA 3OCLA 1QMEA 4R70A 1MKIA 1STZA 1SKOA 5CEBA 5E2FA 4EEPA 3E4OA 3Q7VA 5GHXA 3UB9A 4G3KA 4MNRA 1XKZA 4YOFA 2WZXA 2FH5A 4P87A 4DDSA 4EEUA 3M2JA 1NWZA 3WS2A 2Y2HA 4HY8A 1W8YA 3M6HA 3CG5A 3A3DA 4IUHA 5F1FA 2Y2QA 5TJJA 4WUJA 1W5DA 2W1TB 3CUEC 3NJAA 5CTNA 2NUPC 3HVFA 1GSXA 2C6WB 1YMSA 4R38A 4B4ZA 3LFVA 1YT4A 2JKFA 3A0SA 2VV7A 1JWVA 1N9NA 3HUNA 4UHUA 3TE8A 4QWOA 3BFEA 4KQRA 3FKWA 3IF5A 5DKLA 4Y13A 2W27A 2W3GA 4E3NA 4E3MA 3LIFA 5CGSA 1LL5A 3UMDA 2RCXA 3E0YA 3LCEA 1P9RA 3IBRA 2QJ5A 1LL9A 1G28A 4P0MA 3G35A 2ZOIA 1SCWA 1W79A 3C5AA 5HD3A 3RJUA 2ZMAA 4BBTA 4LV0A 2BG1A 3T4LA 1YSPA 3T1QB 3VFFA 4QJGA 3FZCA 3HLDA 2XSSA 3I7JA 1FCNA 4LV2A 3LO7A 5DJTA 1MWUA 1ACFA 2QWSA 4QD4A 3LI9A 3ZDJA 3S22A 1KGEA 3QP4A 5HSQA 2XRNA 1T1AA 3N8RA 5J4EA 3LR0A 5FA7A 1V9ZA 3UPOA 1DJBA 2J9PA 3OLOA 1S4SA 3EEAA 4S2JA 3M6BA 2V8FA 1W8QA 1ONGA 3UDXA 3AGFA 3D3OA 5EV0A 4L9GA 3UNWA 3BWLA 2Y59A 4YNRA 2OLVA 2WKPA 1MPLA 4HJ4A 4BLMA 1K25A 4LRYC 4NXFA 1NY0A 5A92A 5I5LA 2Y91A 2K31A 3PBQA 3SS3A 1IYQA 5FQJA 4GHIA 2HV1A 3V39A 4CPKA 3BLMA 2VGJA 4C75A 4XT2B 2QKPA 4CQHA 4XUZA 3C38A 3UPNA 1MWSA 2WKIA 4PM5A 3FWLA 1KE4A 2Z2LB 4KENB 4Y15A 2WAEA 1YM1A 4Z9QA 4MEZA 4R6LA 5HX9A 3TSGA 3N4IA 3MXQA 2PBYA 4I3IA 1QMFA 2A24B 4U0TA 3UB6A 1BUEA 4EQ1A 2HJEA 1WA9A 5E43A 5TGFA 5HAIA 3OBFA 4LV3A 4PM7A 5M1AA 2EX9A 1YPRA 2HDSA 2W0NA 3VSLA 1ES3A 3LGOA 3C30A 5L09A 1KVLA 5G18A 4MBFA 1X0OA 4XUXA 4LRZE 3IF6A 2ZC5B 4KZ3A 5HDCA 4L0LA 1Z09A 4DN0A 2ZBBA 4P85A 4II7A 4FOFA 3C8CA 5EECA 2X71A 4C6YA 2XD1A 3C2WA 4PAUA 3ICYA 1OTAA 3JVVA 2JKRI 1VQQA 3ZQ5A 3GQZA 3VV4A 3LIDA 1K38A 1TDLA 4IVKA 3K3CA 3RTYA 3GVBA 4S2NC 1Y54A 3MQOA 3UE0A 3MFXA 4Q8IA 1S1YA 5M19A 2O9BA 4WBGA 4F3LA 2KX6A 4CJNA 4ID4A 3GDIA 1FOFA 2DRWA 4BMWA 3DBAA 3V3RA 2O0YA 4H6JB 2VKSA 1J9MA 1XFNA 5DF8A 1AXBA 1GSWA 1BLHA 1ES2A 3FPVA 2XGNA 2PYPA 4FH2A 4HH2A 5DVAA 2JBFA 1XJ3A 3ISGA 3T1XA 4X1MA 4OONA 5HAQA 2WUQA 4ETXA 2Y2KA 2L4RA 4IVIA 4FUWA 4HNBA 4R4SA 1IOUA 3EWKA 1E3UA 2X02A 4GKUA 2WZZA 4L9EA 3OCNA 1PRQA 1DP8A 5E2HA 3BFDA 3CAXA 3PAGA 4A5RA 2XK1A 3Q07A 2ZQAA 4S2OA 4N92A 2WGWA 3DTMA 2ZQCA 4CLCD 4O8GA 3PBTA 2Z6DA 3N6IA 4DE3A 1OJGA 4UEYA 1PFLA 1LLBA 3L7HA 2ZQ9A 4I5SA 3KSFA 1IELA 3H82B 1ZHHB 3AGDA 1NRFA 2V1BA 3TOIA 4BWIA 2JKRM 4ZAMA 3IT9A 3S7OA 4DDYA 3ULFA 1BT5A 3RH8B 1G6AA 2LB5A 3IXBA 2JKTM 2XD5A 2XFTA 2Y2MA 3PHYA 1EROA 3VP1A 1BLPA 5CXWA 1K4FA 1CI8A 4PM8A 5U47A 5TBMB 4BJPA 4RVAA 3IXGA 5EVIA 2Y4AA 4M4XA 1IKIA 3MSHA 2KOIA 3RXXA 1DP9A 1NLYA 5IHVA 2WKHA 1FQGA 1H0MA 4E3OA 4X25A 4D2OA 3MQQA 2J8YA 5FI6A 3IS2B 4RYEA 2BASA 4KZ5A 3JVUA 1VB6A 2VK3A 4MMNA 1I2WA 4N1HA 5FAQA 1XA1A 4BBUA 5CHMA 1ODVA 2VGKA 2KLIA 3FKVA 5CECA 2VGLS 3C7UA 1ERQA 2W1TA 2Y55A 5GHZA 5DKKA 1HD8A 3CMZA 5I94A 3NCKA 4G3VA 5DTSA 2EWVA 4O7DA 2J80A 5GLBA 1WYCA 4X53A 4E04A 5FEGA 4WZ5A 2HDQA 1S6RA 4B9OA 2I9VA 3CHWP 4Y7PA 3LR3A 3LY4A 5HDDA 4EESA 2J3TD 1KOUA 1O7EA 2EXAA 3FV7A 3ZNYA 1L2SA 5CHUA 2B18A 2Y2OA 4FCFA 2HDUA 4N9LA 3N7WA 4ZRRA 3SH9A 1YLYA 5KMWA 3PXPA 1KE3A 1TD5A 2FZ0A 4JGOA 4WM9A 4KZAA 1K56A 4P6BA 5HL1A 5FI2A 4D60A 4N9KA 1OT9A 2Y8HA 4DRTA 2EA9A 4DE2A 1N9BA 4JXGA 1P9WA 2XFSA 3IH8A 3UE1A 2O9AA 3ITBA 2R9XA 3T1SA 5D3OA 3MZFA 5F6AA 3D9YA 5MC7A 3IF6C 4IBRA 1UWPX 4I38A 5FDHA 1F2KA 3NY4A 1XGIA 2Y2NA 5F83A 2A3UA 3A0RA 1BYWA 1WYBA 1OMEA 1XFQA 2EFUA 1LSXA 2M7VA 5KSCA 3Q1FA 4FD8A 3VMAA 2ZC4B 1T19A 1J3WA 1FR6A 2OAP1 5HW3A 4OQIA 2J9OA 4DE1A 1BSGA 4EUVA 2V9AA 3SS5A 2WGIA 5L07A 1G6OA 4JF5A 4K0WA 3WS5A 5DFXA 4RA7A 4PM9A 1S67L 1W63Q 1IFQA 5F1GA 2PAVP 1S0WA 3ZHHA 4WZ4A 3QP5A 4OPYA 4P6ZS 4XT2A 4ARZB 4PPRA 1JTGA 1TVFA 4WLAA 1S4RA 3PTEA 1PWDA 3G31A 2ZM0A 3PBOA 4B93A 2PU4A 3T4TA 3NBLA 5IS1A 4Q0JA 1RGZA 5HAPA 3HCYA 4S2IA 4HP9A 2FFYA 3OPPA 2A24A 4JXSA 3A3EA 4KUOA 1ALQA 3V3SA 2G7UA 3CITA 4XXRA 4LV1A 2P04A 4GCZA 4NKPA 3S7PA 3SW1A 3LI8A 4EBNA 3UDFA 1S66L 3T12B 2VLGA 2HF6A 5EM0A 3N8LA 1VEUB 3IX8A 3NDGA 2ZL1B 3F1PB 3F1NB 3T4JA 4QU3A 1T1CA 2NUTC 5AQ7A 5F82A 3EQUA 1H3QA 2WADA 1Y28A 3Q81A 2K7SA 2OLUA 5KZHA 2QZ6A 1GSVA 4Y3IA 3OPHA 4JGRA 5IT5A 4KZ9A 4Y17A 3ZFZA 3A3FA 3BECA 1K6RA 4QB8A 3KSHA 4JF6A 3F1OA 2WKRA 2EX2A 1K55A 1A0KA 4UA9A 3C7VA 1HTZA 3ZVTA 3U4LP 3K2NA 2O99A 1IEMA 4I39A 4R3JA 5FAOA 4ZJ3A 1LHYA 1TF1A 3HLGA 4F94A 5AVFA 4OH0A 2CC1A 1PWCA 4JXVA 1M40A 2VV8A 2D02A 3TJZC 2P9VB 4LPZA 1SDNA 5EVIC 5JYOA 5HD5A 4S2KA 3B33A 1AWIA 3LY3A 4UQIM 4HH3A 4MN7A 4H6JA 4HBUA 4MN5A 3EGXC 2HP9A 4WMCD 4WYYA 1L0DA 2Q9NA 3MKFA 2V0UA 3BRMA 4GLQA 1ERMA 1YLZA 3NDEA 2JCHA 3E4PA 2H28A 4WL9A 4KG2A 2OOLA 4UQIS 3FG8A 2A2LA 4EBPA 2PD7A 3OZHA 3R4KA 2HJ9C 3DTEA 3MF0A 5CEDA 3GTCA 3ZG0A 2PBDP 4ZTKA 4JF4A 2XDMA 2L0WA 1LI9A 1PWGA 3EEHA 3O88A 1IYPA 1DY6A 2Y2GA 1H8MA 4DXBA 2P7JA 1CK3A 1W63M 1P0ZA 2P74A 3QNBA 4WZ5C 3O86A 4DF6A 1CF0A 4UAAA 4E3IA 4FTXA 2WKQA 1DRMA 1K0KA 1DP6A 2LB9A 3DWKA 3H82A 2VZWA 3IX3A 3R7WB 5HWVA 3F1OB 3GR2A 3A3JA 4GZBA 4CLCB 1Y4OA 5FAPA 2M7UA 3W4PA 3VSKA 1TS0A 3GRJA 5L8MA 4HOIA 1OTBA 1O07A 1PW8A 2PDRA 1PI5A 5L2FA 1LT0A 4OP8A 5HFOA 5AJGA 4RX3A 5TBMA 4Y0TA 4E3KA 2EWWA 3NOPC 3MR0A 2IWDA 5A8BA 1L0FA 2W3FA 3IWOA 5FASA 4B4XA 2XEPA 3V50A 3GSGA 4R0QA 1KGFA 2JHEA 1H8YA 1PI4A 2V2FF 5JYPA 1KGGA 2XA7M 4MDZA 3UB7A 2VA0A 3LR5A 3D72A 1FSYA 3CUEA 1YSQA 3IS2A 3E2KA 1L0GA 5FQMA 1Q2QA 4R23A 3EOIA 2QHKA 3S1YA 4NG2A 1JVJA 1C3BA 3QNCA 2XA7S 4N1XA 4NXBA 2AVXA 4KZBA 3Q7ZA 5CTMA 4LCLA 1YAXA 3G34A 2Y79A 1KDSA 3VOZA 4WEJA 1I5QA 3SS4A 3LICA 1LI0A 4GS9B 1CJFA 2W3HA 4OPZA 1OJ5A 3OC2A 1MY8A 3WWXA 3PAEA 1LL8A 5AQ9A 2V1ZA 4KZ8A 3UPPA 2EX6A 2PYRA 1TS7A 3IX4A 1EWZA 3NI9A 1FSWA 1RGYA 3BFFA 1G68A 4S2LA 2WGVA 4BENA 4KQQA 4JKTA 2W3EA 3G32A 1FR1A 2EX8A 2MJ6A 3G4PA 1XJ2A 5TR7A 3M2KA 2XF3A 1L0EA 3JPUA 3NOTC 3WS1A 4IEDA 4ZJ1A 1KE0A 2Y2PA 3CI6A 3DTIA 2OSUA 3A0VA 2QPNA 1HZOA 4ME4A 2PHYA 4PMAA 5EOEA 2VGLM 1K55C 3DWZA 4IHQA 4BL3A 3GECA 5E2EA 1N9LA 1BLCA 3HUOA 4RQ9A 4IUKA 4NK3A 4WEKA 2EFXA 3OPLA 1GA0A 4OKPA 4Y0OA 2PRFA 4HESA 1MXOA 5EM1A 2Y2JA 3O5YA 4BBVA 3KSIA 1D1JA 2E8JA 2IA2A 3ZNTA 1TDGA 3L9KA 5FQQA 1NZUA 1YQSA 2XQZA 4O01A 1D7EA 2B95A 4ARZA 3T1RA 3MXSA 5GHYA 2DNSA 3OPRA 5LBRA 3MZDA 5GLCA 4LFUA 4KZ4A 3BY9A 3VE4A 1OT6A 5FATA 4DE0A 3HJKA 4FSFA 3NIAA 5CGXA 1XPBA
chains in the Genus database with same CATH topology
4OQGA 1ES3A 4R4RA 3VP2A 3VSLA 3W8KA 3UN7A 3A3IA 4WMCA 1KVLA 3N8LA 2Y2LA 3NDGA 3BM6A 2ZJ9A 3QHYA 5G18A 1K54C 4QU3A 4MBFA 4MLLA 2PU2A 1PIOA 2XH9A 5AQ7A 5F82A 1XXMA 4X6TA 3EQUA 3IF6B 2G2WA 3MKEA 2H0TA 2WADA 3AGEA 3IHBA 2ZQ8A 3LEZA 4XUXA 1MWRA 4EQIA 4ZDXA 5EE8A 2G2UA 4GN2A 3SH7A 3Q81A 2OLUA 3IF6A 2XR0A 5KZHA 2QZ6A 2ZC5B 1YLPA 2ZM2A 4KZ3A 3JYIA 4L0LA 1JTDA 3VP3A 3HLCA 3OPHA 4P85A 1ES5A 4KZ9A 3BEBA 3ZFZA 5EVLA 4Y0UA 3C4PA 5EECA 3A3FA 3BECA 4OOLA 3SH8A 2X71A 2ZC6B 1U60A 4C6YA 2XD1A 3TG9A 3HREA 1K6RA 4QB8A 1FCMA 3VFHA 3O3VA 4S2NA 4BD0A 1YLWA 4E6WA 4JF6A 2EX2A 3IQAA 1VQQA 3GQZA 3GV9A 1K55A 1BULA 3IWIA 3E2LA 4UA9A 2H0YA 1K38A 1TDLA 4IVKA 4WELA 4X55A 3C7VA 1HTZA 1FCOA 2WAFA 3BYDA 3UE3A 3ZVTA 4PM6A 5BOHA 5FQIA 3GVBA 4S2NC 4UA6A 5M18A 3WS4A 1Y54A 3HLBA 1IEMA 3UE0A 4R3JA 5FAOA 4ZJ3A 4UA7A 3VP0A 1BTLA 2H10A 1LHYA 4Q8IA 4OPQA 1I2SA 3IXHA 1VM1A 3HLGA 1IYOA 3HLFA 4F94A 1E3UD 4X69A 5M19A 4OP5A 2V20A 4R3BA 3ZVWA 4OH0A 1H5XA 1PWCA 2CC1A 4LENA 4JXVA 4M3KA 4WBGA 4CJNA 3MXRA 4OLGA 4ID4A 1M40A 1FOFA 2DRWA 3EQVA 5J8XA 2P9VB 3V3RA 4K91A 1SDNA 5EVIC 5JYOA 4S2KA 1CEFA 3HLEA 1J9MA 2P9VA 1K57A 3LY3A 1YLJA 3CJMA 5EOOA 4FH4A 5DF8A 1AXBA 5GLDA 1BLHA 1ES2A 3BFGA 5FQKA 1WE4A 2R9WA 4HBUA 5A93A 2XGNA 1SHVA 1ESUA 4JLFA 3HL9A 4FH2A 1SKFA 4RX2A 4OOMA 5DVAA 2HP9A 5E2GA 3Q82A 2JBFA 4U3TA 1NYYA 4WMCD 4WYYA 2Q9NA 1L0DA 1NXYA 2ZC3B 3ISGA 3MKFA 4OONA 5HAQA 2Q9MA 1DJAA 2WUQA 3BRMA 1ERMA 1YLTA 1YLZA 2Y2KA 4IVIA 4GB7A 3NDEA 4R4SA 3P98A 2I72A 2JCHA 1E3UA 2X02A 3RXWA 1M6KA 1IKGA 3NC8A 2WZZA 4GKUA 4KG2A 3WRTA 4DKIA 4EBPA 1BLSA 3S4XA 3OCNA 5CHJA 2A49A 3OZHA 3CZDA 3UDIA 1K4EA 5E2HA 3BFDA 3G30A 5CEDA 4E3LA 1GHMA 3PAGA 2WGWB 5EPHA 3HUMA 4A5RA 3GTCA 3ZG0A 3O87A 4ZTKA 2XK1A 3ZG8B 3Q07A 2ZQAA 4JF4A 3BLSA 4S2OA 4B88A 4QHCA 4IBXA 2XDMA 4N92A 2WGWA 1KDWA 4BL2A 3DTMA 1K54A 2ZQCA 1LI9A 1PWGA 3O88A 1IYPA 2IWCA 1DY6A 2Y2GA 4R1GA 5A91A 1E25A 4GDBA 1NYMA 4DXBA 3IWQA 1CK3A 1JWZA 3PBTA 4EWFA 4H8RA 4QY5A 3N6IA 2JE5A 4DE3A 2P74A 3QNBA 4WZ5C 3O86A 3W4OA 1LLBA 4DF6A 2Y2IA 2ZQ9A 3WRZA 2ZM8A 4UAAA 3BFCA 4E3IA 3B3XA 3ZGAB 2B5RA 1IELA 5EVID 3PBNA 3ZCZA 4GOGA 3AGDA 4LCMA 1XA7A 1W7FA 1NRFA 4KQOA 4GD6A 3TOIA 1ZG4A 5CRFA 3DWKA 2ZD8A 5A90A 4ZAMA 3IT9A 3G2ZA 4JXWA 1YMXA 3GR2A 4DDYA 3A3JA 5FI7A 4GZBA 1JWPA 1BT5A 1G6AA 5EUAA 3IXBA 1ES4A 5FAPA 3W4PA 2XD5A 5HARA 3VSKA 3PBSA 3ZG7B 3UO9A 1IYSA 3ZG5A 2XFTA 2Y2MA 3GRJA 1PW1A 4YFMA 1EROA 3VP1A 1BLPA 5CXWA 4JBFA 3VOYA 1O07A 1K4FA 4BQMA 1PW8A 1E4DA 1CI8A 4PM8A 1PI5A 5U47A 4E6XA 2IWBA 4OOYA 5L2FA 4BJPA 5EVIB 4BD1A 4MBKA 2OV5A 1SDEA 4OP8A 1GHIA 4RVAA 2HDRA 5HFOA 2WYXA 3UY6A 4RX3A 3IXGA 5EVIA 4Y0TA 4E3KA 1NZOA 2Y4AA 3FYZA 3OCLA 1QMEA 1IKIA 1MKIA 3Q7VB 2IWDA 1L0FA 3RXXA 3IWOA 5FASA 2ZLYA 5IHVA 5CEBA 2Z2MB 4OPRA 5E2FA 2WKHA 3HBRA 4B4XA 3Q7VA 2XEPA 1FQGA 5GHXA 1MWTA 3V50A 3GSGA 4EV4A 1BZAA 1KGFA 4MNRA 4R0QA 2EXBA 1H8YA 1XKZA 1PI4A 2WK0A 4E3OA 2V2FF 4EUZA 5JYPA 1KGGA 1Z6FA 3MFDA 4D2OA 2J8YA 5FI6A 4U0XA 2WZXA 4P87A 4YINA 5GL9A 4RYEA 4KZ5A 4DDSA 5TFQA 1FSYA 3M2JA 3WS2A 1PYYA 1I2WA 1XP4A 2Y2HA 4N1HA 5FAQA 1W8YA 2JC7A 3N8SA 1XA1A 3E2KA 3M6HA 3CG5A 5FQMA 3A3DA 1L0GA 5CHMA 1Q2QA 1GCEA 4R23A 2VGKA 3P09A 4C3QA 5F1FA 2Y2QA 3FKVA 3ZG9B 1W5DA 3S1YA 2HP5A 5CTNA 5CECA 4EBLA 4X56A 3HVFA 4NETA 3C7UA 1JVJA 1C3BA 2C6WB 3QNCA 1ERQA 1YMSA 4N1XA 4B4ZA 2Y55A 1ESIA 1YT4A 5GHZA 5CGWA 1HD8A 1JWVA 4KZBA 3CMZA 5I94A 3Q7ZA 4GNUA 3NCKA 3HUNA 5AQAA 5CTMA 5DTSA 4O7DA 4UHUA 4LCLA 1K56D 5GLBA 1WYCA 4X53A 3BFEA 3G34A 5CERA 4KG6A 1KDSA 3VOZA 4WZ5A 3DW0A 4KQRA 4WEJA 1N4OA 3FKWA 1I5QA 2HDQA 1S6RA 3IF5A 4HBTA 3SS4A 3SOIA 4E3NA 4E3MA 1ZG6A 4OLDA 4Y7PA 5CGSA 3LY4A 1LL5A 4GDNA 1ZKJA 2RCXA 4MBHA 3LCEA 1LI0A 1LL9A 1O7EA 4P0MA 3V5MA 2EXAA 3FV7A 1KVMA 3G35A 5FQ9A 3ZNYA 1L2SA 5FSRA 1SCWA 1W79A 2RL3A 5CHUA 2ZC7A 4OPZA 4KZ7A 3OC2A 3C5AA 1MY8A 3IHAA 1CI9A 2Y2OA 3RJUA 2ZMAA 4FCFA 4GD8A 3WWXA 3PAEA 2HDUA 4X68A 4LV0A 4N9LA 3N7WA 2BG1A 2HPBA 1ZC2A 3SH9A 5DTKA 1YLYA 2E8IA 5AQ9A 5KMWA 2V1ZA 5DF9A 3VFFA 1KE3A 4WM9A 4QJGA 4KZ8A 3FZCA 3HLDA 1K56A 3ITAA 4KZAA 2J7VA 4P6BA 5DTTA 3UPPA 5FI2A 5HL1A 3I7JA 4N9KA 1FCNA 1H8ZA 2EX6A 4K0XA 4LV2A 4DRTA 4DE2A 1NJ4A 1N9BA 3LO7A 4JXGA 2XFSA 1MWUA 3IH8A 3UE1A 1EWZA 4QD4A 3ITBA 4S2PA 2R9XA 3NI9A 1FSWA 2GDNA 1RGYA 3BFFA 1G68A 3ZDJA 4S2LA 2X01A 3VP4A 3S22A 1KGEA 1Q2PA 2WGVA 4BENA 5KSHA 5D3OA 4KQQA 4E3JA 3MZFA 4JKTA 3G32A 1FR1A 3IF6C 3N8RA 3UPOA 2EX8A 5FA7A 4IBRA 3G4PA 1DJBA 5FDHA 2J9PA 3M2KA 5TR7A 3NY4A 3MBZA 1XGIA 4S2JA 2XF3A 3M6BA 1L0EA 3WS1A 5GLAA 4IEDA 4ZJ1A 1KE0A 1W8QA 2Y2NA 2UWXA 2Y2PA 1ONGA 5F83A 3UDXA 2OSUA 3AGFA 2A3UA 2QPNA 4HEFA 1WYBA 1OMEA 1HZOA 3IH9A 2FFFB 4PMAA 2EFUA 2BLSA 5EOEA 5AQBA 1K55C 5KSCA 2XLNA 3DWZA 3Q1FA 4FD8A 3VMAA 2ZC4B 4BL3A 3UNWA 2Y59A 2OLVA 1FR6A 5E2EA 3HLWA 5HW3A 4OQIA 1BLCA 2J9OA 4DE1A 3HUOA 1MPLA 1BSGA 4BLMA 1K25A 1CEGA 4NK3A 4OQHA 4WEKA 3PBRA 2EFXA 4OQ0A 2ZQ7A 3SS5A 1RCJA 1K6SA 2WGIA 1NY0A 5DF7A 5A92A 2Y91A 3MZEA 3OPLA 2WKEA 3PBQA 4JF5A 4K0WA 1IYQA 3SS3A 3WS5A 5FQJA 1TEMA 4KZ6A 4JPMA 4DXCA 1GA0A 4OKPA 4RA7A 3V39A 4PM9A 4CPKA 4Y0OA 3BLMA 2VGJA 4HESA 4C75A 5F1GA 1S0WA 1MXOA 3ZHHA 4WZ4A 2Y2JA 2DCFA 1PZOA 4XUZA 4OPYA 3UPNA 1MWSA 2WKIA 4PM5A 3FWLA 1DJCA 1KE4A 2Z2LB 3IXDA 4KG5A 4KENB 1K57C 1MBLA 4QY6A 1GHPA 3ZNTA 2WAEA 4PPRA 1YM1A 1TDGA 1JTGA 3C4OA 4Z9QA 1TVFA 4MEZA 5FQQA 1NZUA 1YQSA 2XQZA 3PTEA 3N4IA 5HX9A 1PWDA 2H5SA 1XGJA 2ZM0A 3G31A 3TSGA 2PBYA 3W4QA 4OVDA 2QMIA 4ZJ2A 1PZPA 1RP5A 1QMFA 2ZQDA 3PBOA 1ONHA 2PU4A 3MXSA 5GHYA 2DNSA 3NBLA 3OPRA 4U0TA 1RGZA 3MZDA 5HAPA 5GLCA 4S2IA 1BUEA 4KZ4A 5E43A 5TGFA 2FFYA 3OPPA 4JXSA 4ZBEA 3D4FA 5HAIA 3WS0A 3A3EA 5FATA 4DE0A 3G2YA 1ALQA 4S2MA 1GA9A 4FSFA 3NIAA 4LV3A 4PM7A 1EI5A 5M1AA 2EX9A 3V3SA 4XXRA 3GMWA 4LV1A 5CGXA 2HDSA 2C5WB 1XX2A 2HP6A 4EBNA 1HVBA 3UDFA 1XPBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OQG A;  1ES3 A;  4R4R A;  3VP2 A;  3VSL A;  3W8K A;  3UN7 A;  3A3I A;  4WMC A;  1KVL A;  3N8L A;  2Y2L A;  3NDG A;  3BM6 A;  2ZJ9 A;  3QHY A;  5G18 A;  1K54 C;  4QU3 A;  4MBF A;  4MLL A;  2PU2 A;  1PIO A;  2XH9 A;  5AQ7 A;  5F82 A;  1XXM A;  4X6T A;  3EQU A;  3IF6 B;  2G2W A;  3MKE A;  2H0T A;  2WAD A;  3AGE A;  3IHB A;  2ZQ8 A;  3LEZ A;  4XUX A;  1MWR A;  4EQI A;  4ZDX A;  5EE8 A;  2G2U A;  4GN2 A;  3SH7 A;  3Q81 A;  2OLU A;  3IF6 A;  2XR0 A;  5KZH A;  2QZ6 A;  2ZC5 B;  1YLP A;  2ZM2 A;  4KZ3 A;  3JYI A;  4L0L A;  1JTD A;  3VP3 A;  3HLC A;  3OPH A;  4P85 A;  1ES5 A;  4KZ9 A;  3BEB A;  3ZFZ A;  5EVL A;  4Y0U A;  3C4P A;  5EEC A;  3A3F A;  3BEC A;  4OOL A;  3SH8 A;  2X71 A;  2ZC6 B;  1U60 A;  4C6Y A;  2XD1 A;  3TG9 A;  3HRE A;  1K6R A;  4QB8 A;  1FCM A;  3VFH A;  3O3V A;  4S2N A;  4BD0 A;  1YLW A;  4E6W A;  4JF6 A;  2EX2 A;  3IQA A;  1VQQ A;  3GQZ A;  3GV9 A;  1K55 A;  1BUL A;  3IWI A;  3E2L A;  4UA9 A;  2H0Y A;  1K38 A;  1TDL A;  4IVK A;  4WEL A;  4X55 A;  3C7V A;  1HTZ A;  1FCO A;  2WAF A;  3BYD A;  3UE3 A;  3ZVT A;  4PM6 A;  5BOH A;  5FQI A;  3GVB A;  4S2N C;  4UA6 A;  5M18 A;  3WS4 A;  1Y54 A;  3HLB A;  1IEM A;  3UE0 A;  4R3J A;  5FAO A;  4ZJ3 A;  4UA7 A;  3VP0 A;  1BTL A;  2H10 A;  1LHY A;  4Q8I A;  4OPQ A;  1I2S A;  3IXH A;  1VM1 A;  3HLG A;  1IYO A;  3HLF A;  4F94 A;  1E3U D;  4X69 A;  5M19 A;  4OP5 A;  2V20 A;  4R3B A;  3ZVW A;  4OH0 A;  1H5X A;  1PWC A;  2CC1 A;  4LEN A;  4JXV A;  4M3K A;  4WBG A;  4CJN A;  3MXR A;  4OLG A;  4ID4 A;  1M40 A;  1FOF A;  2DRW A;  3EQV A;  5J8X A;  2P9V B;  3V3R A;  4K91 A;  1SDN A;  5EVI C;  5JYO A;  4S2K A;  1CEF A;  3HLE A;  1J9M A;  2P9V A;  1K57 A;  3LY3 A;  1YLJ A;  3CJM A;  5EOO A;  4FH4 A;  5DF8 A;  1AXB A;  5GLD A;  1BLH A;  1ES2 A;  3BFG A;  5FQK A;  1WE4 A;  2R9W A;  4HBU A;  5A93 A;  2XGN A;  1SHV A;  1ESU A;  4JLF A;  3HL9 A;  4FH2 A;  1SKF A;  4RX2 A;  4OOM A;  5DVA A;  2HP9 A;  5E2G A;  3Q82 A;  2JBF A;  4U3T A;  1NYY A;  4WMC D;  4WYY A;  2Q9N A;  1L0D A;  1NXY A;  2ZC3 B;  3ISG A;  3MKF A;  4OON A;  5HAQ A;  2Q9M A;  1DJA A;  2WUQ A;  3BRM A;  1ERM A;  1YLT A;  1YLZ A;  2Y2K A;  4IVI A;  4GB7 A;  3NDE A;  4R4S A;  3P98 A;  2I72 A;  2JCH A;  1E3U A;  2X02 A;  3RXW A;  1M6K A;  1IKG A;  3NC8 A;  2WZZ A;  4GKU A;  4KG2 A;  3WRT A;  4DKI A;  4EBP A;  1BLS A;  3S4X A;  3OCN A;  5CHJ A;  2A49 A;  3OZH A;  3CZD A;  3UDI A;  1K4E A;  5E2H A;  3BFD A;  3G30 A;  5CED A;  4E3L A;  1GHM A;  3PAG A;  2WGW B;  5EPH A;  3HUM A;  4A5R A;  3GTC A;  3ZG0 A;  3O87 A;  4ZTK A;  2XK1 A;  3ZG8 B;  3Q07 A;  2ZQA A;  4JF4 A;  3BLS A;  4S2O A;  4B88 A;  4QHC A;  4IBX A;  2XDM A;  4N92 A;  2WGW A;  1KDW A;  4BL2 A;  3DTM A;  1K54 A;  2ZQC A;  1LI9 A;  1PWG A;  3O88 A;  1IYP A;  2IWC A;  1DY6 A;  2Y2G A;  4R1G A;  5A91 A;  1E25 A;  4GDB A;  1NYM A;  4DXB A;  3IWQ A;  1CK3 A;  1JWZ A;  3PBT A;  4EWF A;  4H8R A;  4QY5 A;  3N6I A;  2JE5 A;  4DE3 A;  2P74 A;  3QNB A;  4WZ5 C;  3O86 A;  3W4O A;  1LLB A;  4DF6 A;  2Y2I A;  2ZQ9 A;  3WRZ A;  2ZM8 A;  4UAA A;  3BFC A;  4E3I A;  3B3X A;  3ZGA B;  2B5R A;  1IEL A;  5EVI D;  3PBN A;  3ZCZ A;  4GOG A;  3AGD A;  4LCM A;  1XA7 A;  1W7F A;  1NRF A;  4KQO A;  4GD6 A;  3TOI A;  1ZG4 A;  5CRF A;  3DWK A;  2ZD8 A;  5A90 A;  4ZAM A;  3IT9 A;  3G2Z A;  4JXW A;  1YMX A;  3GR2 A;  4DDY A;  3A3J A;  5FI7 A;  4GZB A;  1JWP A;  1BT5 A;  1G6A A;  5EUA A;  3IXB A;  1ES4 A;  5FAP A;  3W4P A;  2XD5 A;  5HAR A;  3VSK A;  3PBS A;  3ZG7 B;  3UO9 A;  1IYS A;  3ZG5 A;  2XFT A;  2Y2M A;  3GRJ A;  1PW1 A;  4YFM A;  1ERO A;  3VP1 A;  1BLP A;  5CXW A;  4JBF A;  3VOY A;  1O07 A;  1K4F A;  4BQM A;  1PW8 A;  1E4D A;  1CI8 A;  4PM8 A;  1PI5 A;  5U47 A;  4E6X A;  2IWB A;  4OOY A;  5L2F A;  4BJP A;  5EVI B;  4BD1 A;  4MBK A;  2OV5 A;  1SDE A;  4OP8 A;  1GHI A;  4RVA A;  2HDR A;  5HFO A;  2WYX A;  3UY6 A;  4RX3 A;  3IXG A;  5EVI A;  4Y0T A;  4E3K A;  1NZO A;  2Y4A A;  3FYZ A;  3OCL A;  1QME A;  1IKI A;  1MKI A;  3Q7V B;  2IWD A;  1L0F A;  3RXX A;  3IWO A;  5FAS A;  2ZLY A;  5IHV A;  5CEB A;  2Z2M B;  4OPR A;  5E2F A;  2WKH A;  3HBR A;  4B4X A;  3Q7V A;  2XEP A;  1FQG A;  5GHX A;  1MWT A;  3V50 A;  3GSG A;  4EV4 A;  1BZA A;  1KGF A;  4MNR A;  4R0Q A;  2EXB A;  1H8Y A;  1XKZ A;  1PI4 A;  2WK0 A;  4E3O A;  2V2F F;  4EUZ A;  5JYP A;  1KGG A;  1Z6F A;  3MFD A;  4D2O A;  2J8Y A;  5FI6 A;  4U0X A;  2WZX A;  4P87 A;  4YIN A;  5GL9 A;  4RYE A;  4KZ5 A;  4DDS A;  5TFQ A;  1FSY A;  3M2J A;  3WS2 A;  1PYY A;  1I2W A;  1XP4 A;  2Y2H A;  4N1H A;  5FAQ A;  1W8Y A;  2JC7 A;  3N8S A;  1XA1 A;  3E2K A;  3M6H A;  3CG5 A;  5FQM A;  3A3D A;  1L0G A;  5CHM A;  1Q2Q A;  1GCE A;  4R23 A;  2VGK A;  3P09 A;  4C3Q A;  5F1F A;  2Y2Q A;  3FKV A;  3ZG9 B;  1W5D A;  3S1Y A;  2HP5 A;  5CTN A;  5CEC A;  4EBL A;  4X56 A;  3HVF A;  4NET A;  3C7U A;  1JVJ A;  1C3B A;  2C6W B;  3QNC A;  1ERQ A;  1YMS A;  4N1X A;  4B4Z A;  2Y55 A;  1ESI A;  1YT4 A;  5GHZ A;  5CGW A;  1HD8 A;  1JWV A;  4KZB A;  3CMZ A;  5I94 A;  3Q7Z A;  4GNU A;  3NCK A;  3HUN A;  5AQA A;  5CTM A;  5DTS A;  4O7D A;  4UHU A;  4LCL A;  1K56 D;  5GLB A;  1WYC A;  4X53 A;  3BFE A;  3G34 A;  5CER A;  4KG6 A;  1KDS A;  3VOZ A;  4WZ5 A;  3DW0 A;  4KQR A;  4WEJ A;  1N4O A;  3FKW A;  1I5Q A;  2HDQ A;  1S6R A;  3IF5 A;  4HBT A;  3SS4 A;  3SOI A;  4E3N A;  4E3M A;  1ZG6 A;  4OLD A;  4Y7P A;  5CGS A;  3LY4 A;  1LL5 A;  4GDN A;  1ZKJ A;  2RCX A;  4MBH A;  3LCE A;  1LI0 A;  1LL9 A;  1O7E A;  4P0M A;  3V5M A;  2EXA A;  3FV7 A;  1KVM A;  3G35 A;  5FQ9 A;  3ZNY A;  1L2S A;  5FSR A;  1SCW A;  1W79 A;  2RL3 A;  5CHU A;  2ZC7 A;  4OPZ A;  4KZ7 A;  3OC2 A;  3C5A A;  1MY8 A;  3IHA A;  1CI9 A;  2Y2O A;  3RJU A;  2ZMA A;  4FCF A;  4GD8 A;  3WWX A;  3PAE A;  2HDU A;  4X68 A;  4LV0 A;  4N9L A;  3N7W A;  2BG1 A;  2HPB A;  1ZC2 A;  3SH9 A;  5DTK A;  1YLY A;  2E8I A;  5AQ9 A;  5KMW A;  2V1Z A;  5DF9 A;  3VFF A;  1KE3 A;  4WM9 A;  4QJG A;  4KZ8 A;  3FZC A;  3HLD A;  1K56 A;  3ITA A;  4KZA A;  2J7V A;  4P6B A;  5DTT A;  3UPP A;  5FI2 A;  5HL1 A;  3I7J A;  4N9K A;  1FCN A;  1H8Z A;  2EX6 A;  4K0X A;  4LV2 A;  4DRT A;  4DE2 A;  1NJ4 A;  1N9B A;  3LO7 A;  4JXG A;  2XFS A;  1MWU A;  3IH8 A;  3UE1 A;  1EWZ A;  4QD4 A;  3ITB A;  4S2P A;  2R9X A;  3NI9 A;  1FSW A;  2GDN A;  1RGY A;  3BFF A;  1G68 A;  3ZDJ A;  4S2L A;  2X01 A;  3VP4 A;  3S22 A;  1KGE A;  1Q2P A;  2WGV A;  4BEN A;  5KSH A;  5D3O A;  4KQQ A;  4E3J A;  3MZF A;  4JKT A;  3G32 A;  1FR1 A;  3IF6 C;  3N8R A;  3UPO A;  2EX8 A;  5FA7 A;  4IBR A;  3G4P A;  1DJB A;  5FDH A;  2J9P A;  3M2K A;  5TR7 A;  3NY4 A;  3MBZ A;  1XGI A;  4S2J A;  2XF3 A;  3M6B A;  1L0E A;  3WS1 A;  5GLA A;  4IED A;  4ZJ1 A;  1KE0 A;  1W8Q A;  2Y2N A;  2UWX A;  2Y2P A;  1ONG A;  5F83 A;  3UDX A;  2OSU A;  3AGF A;  2A3U A;  2QPN A;  4HEF A;  1WYB A;  1OME A;  1HZO A;  3IH9 A;  2FFF B;  4PMA A;  2EFU A;  2BLS A;  5EOE A;  5AQB A;  1K55 C;  5KSC A;  2XLN A;  3DWZ A;  3Q1F A;  4FD8 A;  3VMA A;  2ZC4 B;  4BL3 A;  3UNW A;  2Y59 A;  2OLV A;  1FR6 A;  5E2E A;  3HLW A;  5HW3 A;  4OQI A;  1BLC A;  2J9O A;  4DE1 A;  3HUO A;  1MPL A;  1BSG A;  4BLM A;  1K25 A;  1CEG A;  4NK3 A;  4OQH A;  4WEK A;  3PBR A;  2EFX A;  4OQ0 A;  2ZQ7 A;  3SS5 A;  1RCJ A;  1K6S A;  2WGI A;  1NY0 A;  5DF7 A;  5A92 A;  2Y91 A;  3MZE A;  3OPL A;  2WKE A;  3PBQ A;  4JF5 A;  4K0W A;  1IYQ A;  3SS3 A;  3WS5 A;  5FQJ A;  1TEM A;  4KZ6 A;  4JPM A;  4DXC A;  1GA0 A;  4OKP A;  4RA7 A;  3V39 A;  4PM9 A;  4CPK A;  4Y0O A;  3BLM A;  2VGJ A;  4HES A;  4C75 A;  5F1G A;  1S0W A;  1MXO A;  3ZHH A;  4WZ4 A;  2Y2J A;  2DCF A;  1PZO A;  4XUZ A;  4OPY A;  3UPN A;  1MWS A;  2WKI A;  4PM5 A;  3FWL A;  1DJC A;  1KE4 A;  2Z2L B;  3IXD A;  4KG5 A;  4KEN B;  1K57 C;  1MBL A;  4QY6 A;  1GHP A;  3ZNT A;  2WAE A;  4PPR A;  1YM1 A;  1TDG A;  1JTG A;  3C4O A;  4Z9Q A;  1TVF A;  4MEZ A;  5FQQ A;  1NZU A;  1YQS A;  2XQZ A;  3PTE A;  3N4I A;  5HX9 A;  1PWD A;  2H5S A;  1XGJ A;  2ZM0 A;  3G31 A;  3TSG A;  2PBY A;  3W4Q A;  4OVD A;  2QMI A;  4ZJ2 A;  1PZP A;  1RP5 A;  1QMF A;  2ZQD A;  3PBO A;  1ONH A;  2PU4 A;  3MXS A;  5GHY A;  2DNS A;  3NBL A;  3OPR A;  4U0T A;  1RGZ A;  3MZD A;  5HAP A;  5GLC A;  4S2I A;  1BUE A;  4KZ4 A;  5E43 A;  5TGF A;  2FFY A;  3OPP A;  4JXS A;  4ZBE A;  3D4F A;  5HAI A;  3WS0 A;  3A3E A;  5FAT A;  4DE0 A;  3G2Y A;  1ALQ A;  4S2M A;  1GA9 A;  4FSF A;  3NIA A;  4LV3 A;  4PM7 A;  1EI5 A;  5M1A A;  2EX9 A;  3V3S A;  4XXR A;  3GMW A;  4LV1 A;  5CGX A;  2HDS A;  2C5W B;  1XX2 A;  2HP6 A;  4EBN A;  1HVB A;  3UDF A;  1XPB A; 
#chains in the Genus database with same CATH topology
 1JNU A;  3W8K A;  4WMC A;  2Y2L A;  3BM6 A;  2ZJ9 A;  3QHY A;  4MLL A;  2PU2 A;  1VEU A;  1XXM A;  2ZL1 A;  2G2W A;  3MKE A;  2H0T A;  3F1P A;  3F1N A;  3LEZ A;  4EQI A;  4ZDX A;  4WF0 A;  2XR0 A;  1F5M A;  3RFB A;  3ZYT A;  3JYI A;  3VP3 A;  3HLC A;  1ES5 A;  5HDS A;  3BEB A;  4DMZ A;  2OAQ 1;  3SH8 A;  1U60 A;  4EW7 A;  4Y5F A;  3HRE A;  1FCM A;  3VFH A;  3O3V A;  4S2N A;  1YLW A;  4E6W A;  3IQA A;  2B02 A;  1BUL A;  3IWI A;  4I3A A;  3QP2 A;  1EW0 A;  1FCO A;  3UE3 A;  5BOH A;  5FQI A;  3T50 A;  2QYB A;  3MJQ A;  2ACG A;  4R3A A;  4UA7 A;  3VP0 A;  1BTL A;  4OPQ A;  1I2S A;  3IXH A;  2HGV A;  1IYO A;  3HLF A;  1E3U D;  4X69 A;  2V20 A;  4R3B A;  3KO6 A;  4P6Z M;  3ZVW A;  5FDS A;  5EFW A;  2W3D A;  1CQA A;  2P08 A;  3QP8 A;  2L1M A;  2P9V A;  2QJ7 A;  1K57 A;  1YLJ A;  3CJM A;  2PT7 A;  5EOO A;  5GLD A;  1WE4 A;  2R9W A;  5A93 A;  1OPX A;  4JLF A;  4OOM A;  3Q82 A;  5HPF A;  4U3T A;  2D01 A;  1NXY A;  2Q9M A;  1DJA A;  4GB7 A;  3NHQ A;  4PKY G;  2I72 A;  3RXW A;  1M6K A;  1IKG A;  3WRT A;  3MS6 A;  4DJ2 A;  4DKI A;  3CPT B;  1L3L A;  1BLS A;  2W1R A;  1PNE A;  5CHJ A;  2A49 A;  3CZD A;  3UDI A;  1ZTU A;  4E3L A;  4ESP A;  3B47 A;  5EPH A;  3HUM A;  3O87 A;  4B88 A;  3S7Q A;  1VET B;  1KDW A;  1MC0 A;  1K54 A;  4Y2F A;  2IWC A;  1NRJ A;  5A91 A;  2Z6C A;  2KDK A;  4IJG A;  1JWZ A;  4EWF A;  4H8R A;  4JGP A;  2JE5 A;  1NLZ A;  2JN7 A;  3LIE A;  4HHD A;  4MCW A;  3BFC A;  3ZGA B;  2B5R A;  4K08 A;  5EVI D;  3PBN A;  3ZCZ A;  3CLO A;  3OOV A;  4KQO A;  4GD6 A;  5K5B A;  1ZG4 A;  2ZD8 A;  2GX5 A;  5KIZ A;  5A90 A;  3G2Z A;  4JXW A;  4GJ4 A;  3H7W B;  5FI7 A;  1S1Z A;  1XJ6 A;  3R7W A;  1ES4 A;  5HAR A;  3DTK A;  3PBS A;  4NEE D;  4CLC A;  3SZT A;  3LIB A;  5EVE A;  4ETZ A;  3V67 A;  4JBF A;  4DJ3 A;  4I3J A;  2DMW A;  4YWZ A;  4OOY A;  1HLU P;  3LIA A;  4BD1 A;  2HDR A;  3UY6 A;  1F9I A;  1SKO B;  2PD8 A;  5J3W A;  2V0W A;  3Q7V B;  3U2A A;  2ZLY A;  2Z2M B;  4OPR A;  3HBR A;  1MWT A;  4PHT A;  4EV4 A;  1BZA A;  3UME A;  2EXB A;  3KSG A;  2YKH A;  2WK0 A;  4EER A;  5HL6 A;  4EUZ A;  1Z6F A;  3MFD A;  3CWF A;  1T1B A;  4U0X A;  5FL3 A;  4YIN A;  5GL9 A;  5TFQ A;  3KYZ A;  4MN6 A;  1PYY A;  1XP4 A;  3NUL A;  3N8S A;  2JC7 A;  1TS8 A;  1GCE A;  2GZA A;  3P09 A;  2UV0 E;  5F69 A;  4GW9 A;  3ZG9 B;  2HP5 A;  3EGD C;  4EBL A;  2VX8 A;  4X56 A;  1LSW A;  3G6O A;  4NET A;  5HWT A;  1ESI A;  5CGW A;  1FIK A;  1OTE A;  4GNU A;  2XRO A;  5AQA A;  1K56 D;  4HJ3 A;  5CER A;  4KG6 A;  3DW0 A;  1N4O A;  2V1A A;  4HBT A;  3SOI A;  3NEC A;  5G4Y A;  4KUK A;  1ZG6 A;  4OLD A;  2CMN A;  3W2Z A;  4GDN A;  1ZKJ A;  4MBH A;  2PR5 A;  3V5M A;  1KVM A;  3TW8 A;  4AFI A;  5FQ9 A;  5J7E A;  3T4Q A;  5FSR A;  2RL3 A;  2ZC7 A;  4KZ7 A;  4GS9 A;  3IHA A;  1CI9 A;  4GD8 A;  4X68 A;  2HPB A;  1ZC2 A;  5DTK A;  2E8I A;  3B42 A;  5DF9 A;  1T18 A;  5DTT A;  3ITA A;  5FEF A;  2J7V A;  1H8Z A;  4K0X A;  1NJ4 A;  1TS6 A;  1P97 A;  4HIA A;  4S2P A;  2GDN A;  2X01 A;  3VP4 A;  5AVE A;  1Q2P A;  3BJN A;  3LR4 A;  5KSH A;  4E3J A;  3BQA A;  3BW6 A;  3MBZ A;  3E4Q A;  5GLA A;  2INW A;  2UWX A;  3S7N A;  3KYE A;  2JKT I;  4HEF A;  3IH9 A;  2FFF B;  2BLS A;  5F5Y A;  5AQB A;  2Q0O A;  2XLN A;  3VE3 A;  1OTD A;  5IU1 A;  3HLW A;  5DFY A;  1CEG A;  4OQH A;  3PBR A;  4OQ0 A;  2ZQ7 A;  2HZ5 A;  1RCJ A;  1K6S A;  4GHI B;  4HI4 A;  5DF7 A;  3MZE A;  3PYP A;  2WKE A;  1TEM A;  4KZ6 A;  4JPM A;  4DXC A;  2ZMF A;  4Z1W A;  4QPR A;  2DCF A;  1PZO A;  3PR6 A;  1DJC A;  2GJ3 A;  3IXD A;  4KG5 A;  1K57 C;  1MBL A;  4QY6 A;  1GHP A;  4NXG A;  3C4O A;  4Q0I A;  3LEQ A;  3T4O A;  4C3Q A;  2H5S A;  1XGJ A;  3W4Q A;  5G4Z A;  4OVD A;  2QMI A;  4ZJ2 A;  1PZP A;  1RP5 A;  2ZQD A;  1ONH A;  1MKM A;  2R78 A;  1F98 A;  5HWW A;  1UGU A;  4ZBE A;  3D4F A;  3WS0 A;  3LYX A;  3G2Y A;  4S2M A;  1GA9 A;  4O0P A;  1EI5 A;  3GMW A;  3BY8 A;  4EXO A;  3P01 A;  3UB5 P;  2C5W B;  1XX2 A;  2HP6 A;  1HVB A;  3KYQ A;  4OQG A;  3IBJ A;  4R4R A;  3VP2 A;  3UN7 A;  3A3I A;  2VEA A;  4X1L A;  4L9F A;  4Q0H A;  1K54 C;  2OWJ A;  1PIO A;  2XH9 A;  1FIL A;  4X6T A;  3IF6 B;  4WN5 A;  3IHB A;  3AGE A;  3LUQ A;  2ZQ8 A;  3P7N A;  1MWR A;  3NOU C;  5EE8 A;  2G2U A;  4GN2 A;  3SH7 A;  2VJW A;  1YLP A;  2ZM2 A;  1JTD A;  3H9W A;  3T4K A;  3T4S A;  5EVL A;  4Y0U A;  3C4P A;  1LSV A;  1V9Y A;  4OOL A;  2ZC6 B;  2OWH A;  3TG9 A;  1VHM A;  4BD0 A;  3GV9 A;  3E2L A;  4WEL A;  2H0Y A;  3VOL A;  4X55 A;  2WAF A;  3BYD A;  1D06 A;  4PM6 A;  4NXE A;  4UA6 A;  5M18 A;  3WS4 A;  3HLB A;  4CLC C;  4G3W A;  5L10 A;  2H10 A;  2M1C A;  5C5K A;  4LRX C;  4F3L B;  1VM1 A;  2GNX A;  4OP5 A;  2YKF A;  1H5X A;  4PKY A;  4LEN A;  4M3K A;  3MXR A;  3HJI A;  4OLG A;  3EQV A;  4HJ6 A;  5J8X A;  1YKD A;  4K91 A;  1CEF A;  3HLE A;  4CLC E;  4FH4 A;  2VV6 A;  4EU0 A;  3BQ8 A;  3BFG A;  5FQK A;  3QP6 A;  4LLO B;  1SZV A;  1SHV A;  1ESU A;  2K2N A;  3HL9 A;  1SKF A;  4RX2 A;  5E2G A;  3UB8 A;  1NYY A;  2ZC3 B;  1UWN X;  1YLT A;  4EET B;  3E98 A;  3P98 A;  3QP1 A;  3NC8 A;  3S4X A;  1XJ4 A;  5HZH A;  1K4E A;  3G30 A;  3UE6 A;  1GHM A;  3CPT A;  2WGW B;  4HQA A;  3KX0 X;  3DAV A;  3ZG8 B;  3BLS A;  4QHC A;  4IBX A;  4BL2 A;  1G5U A;  2O9C A;  4R1G A;  1E25 A;  1VET A;  1NYM A;  4GDB A;  3IWQ A;  4QY5 A;  1MZU A;  3W4O A;  3MMH A;  4HP4 A;  2Y2I A;  3WRZ A;  2ZM8 A;  4KQD A;  1N9O A;  3B3X A;  4GOG A;  2JKG A;  3TRC A;  4LCM A;  1XA7 A;  3FPW A;  1W7F A;  5CRF A;  3K3D A;  5DJU A;  4JGQ A;  5CX7 A;  2ZOH A;  1YMX A;  2ZMV A;  5F68 A;  1JWP A;  5EUA A;  2BTF P;  3ZG7 B;  3H7W A;  1IYS A;  3UO9 A;  3ZG5 A;  5HPI A;  2PR6 A;  4LGW A;  1OTI A;  1PW1 A;  4YFM A;  3VOY A;  4BQM A;  3FC7 A;  1E4D A;  4E6X A;  2IWB A;  5EVI B;  4MBK A;  2OV5 A;  1SDE A;  1GHI A;  2J3W A;  2WYX A;  3MQ0 A;  2V8C A;  1NZO A;  2J3T C;  3FYZ A;  3OCL A;  1QME A;  4R70 A;  1MKI A;  1STZ A;  1SKO A;  5CEB A;  5E2F A;  4EEP A;  3E4O A;  3Q7V A;  5GHX A;  3UB9 A;  4G3K A;  4MNR A;  1XKZ A;  4YOF A;  2WZX A;  2FH5 A;  4P87 A;  4DDS A;  4EEU A;  3M2J A;  1NWZ A;  3WS2 A;  2Y2H A;  4HY8 A;  1W8Y A;  3M6H A;  3CG5 A;  3A3D A;  4IUH A;  5F1F A;  2Y2Q A;  5TJJ A;  4WUJ A;  1W5D A;  2W1T B;  3CUE C;  3NJA A;  5CTN A;  2NUP C;  3HVF A;  1GSX A;  2C6W B;  1YMS A;  4R38 A;  4B4Z A;  3LFV A;  1YT4 A;  2JKF A;  3A0S A;  2VV7 A;  1JWV A;  1N9N A;  3HUN A;  4UHU A;  3TE8 A;  4QWO A;  3BFE A;  4KQR A;  3FKW A;  3IF5 A;  5DKL A;  4Y13 A;  2W27 A;  2W3G A;  4E3N A;  4E3M A;  3LIF A;  5CGS A;  1LL5 A;  3UMD A;  2RCX A;  3E0Y A;  3LCE A;  1P9R A;  3IBR A;  2QJ5 A;  1LL9 A;  1G28 A;  4P0M A;  3G35 A;  2ZOI A;  1SCW A;  1W79 A;  3C5A A;  5HD3 A;  3RJU A;  2ZMA A;  4BBT A;  4LV0 A;  2BG1 A;  3T4L A;  1YSP A;  3T1Q B;  3VFF A;  4QJG A;  3FZC A;  3HLD A;  2XSS A;  3I7J A;  1FCN A;  4LV2 A;  3LO7 A;  5DJT A;  1MWU A;  1ACF A;  2QWS A;  4QD4 A;  3LI9 A;  3ZDJ A;  3S22 A;  1KGE A;  3QP4 A;  5HSQ A;  2XRN A;  1T1A A;  3N8R A;  5J4E A;  3LR0 A;  5FA7 A;  1V9Z A;  3UPO A;  1DJB A;  2J9P A;  3OLO A;  1S4S A;  3EEA A;  4S2J A;  3M6B A;  2V8F A;  1W8Q A;  1ONG A;  3UDX A;  3AGF A;  3D3O A;  5EV0 A;  4L9G A;  3UNW A;  3BWL A;  2Y59 A;  4YNR A;  2OLV A;  2WKP A;  1MPL A;  4HJ4 A;  4BLM A;  1K25 A;  4LRY C;  4NXF A;  1NY0 A;  5A92 A;  5I5L A;  2Y91 A;  2K31 A;  3PBQ A;  3SS3 A;  1IYQ A;  5FQJ A;  4GHI A;  2HV1 A;  3V39 A;  4CPK A;  3BLM A;  2VGJ A;  4C75 A;  4XT2 B;  2QKP A;  4CQH A;  4XUZ A;  3C38 A;  3UPN A;  1MWS A;  2WKI A;  4PM5 A;  3FWL A;  1KE4 A;  2Z2L B;  4KEN B;  4Y15 A;  2WAE A;  1YM1 A;  4Z9Q A;  4MEZ A;  4R6L A;  5HX9 A;  3TSG A;  3N4I A;  3MXQ A;  2PBY A;  4I3I A;  1QMF A;  2A24 B;  4U0T A;  3UB6 A;  1BUE A;  4EQ1 A;  2HJE A;  1WA9 A;  5E43 A;  5TGF A;  5HAI A;  3OBF A;  4LV3 A;  4PM7 A;  5M1A A;  2EX9 A;  1YPR A;  2HDS A;  2W0N A;  3VSL A;  1ES3 A;  3LGO A;  3C30 A;  5L09 A;  1KVL A;  5G18 A;  4MBF A;  1X0O A;  4XUX A;  4LRZ E;  3IF6 A;  2ZC5 B;  4KZ3 A;  5HDC A;  4L0L A;  1Z09 A;  4DN0 A;  2ZBB A;  4P85 A;  4II7 A;  4FOF A;  3C8C A;  5EEC A;  2X71 A;  4C6Y A;  2XD1 A;  3C2W A;  4PAU A;  3ICY A;  1OTA A;  3JVV A;  2JKR I;  1VQQ A;  3ZQ5 A;  3GQZ A;  3VV4 A;  3LID A;  1K38 A;  1TDL A;  4IVK A;  3K3C A;  3RTY A;  3GVB A;  4S2N C;  1Y54 A;  3MQO A;  3UE0 A;  3MFX A;  4Q8I A;  1S1Y A;  5M19 A;  2O9B A;  4WBG A;  4F3L A;  2KX6 A;  4CJN A;  4ID4 A;  3GDI A;  1FOF A;  2DRW A;  4BMW A;  3DBA A;  3V3R A;  2O0Y A;  4H6J B;  2VKS A;  1J9M A;  1XFN A;  5DF8 A;  1AXB A;  1GSW A;  1BLH A;  1ES2 A;  3FPV A;  2XGN A;  2PYP A;  4FH2 A;  4HH2 A;  5DVA A;  2JBF A;  1XJ3 A;  3ISG A;  3T1X A;  4X1M A;  4OON A;  5HAQ A;  2WUQ A;  4ETX A;  2Y2K A;  2L4R A;  4IVI A;  4FUW A;  4HNB A;  4R4S A;  1IOU A;  3EWK A;  1E3U A;  2X02 A;  4GKU A;  2WZZ A;  4L9E A;  3OCN A;  1PRQ A;  1DP8 A;  5E2H A;  3BFD A;  3CAX A;  3PAG A;  4A5R A;  2XK1 A;  3Q07 A;  2ZQA A;  4S2O A;  4N92 A;  2WGW A;  3DTM A;  2ZQC A;  4CLC D;  4O8G A;  3PBT A;  2Z6D A;  3N6I A;  4DE3 A;  1OJG A;  4UEY A;  1PFL A;  1LLB A;  3L7H A;  2ZQ9 A;  4I5S A;  3KSF A;  1IEL A;  3H82 B;  1ZHH B;  3AGD A;  1NRF A;  2V1B A;  3TOI A;  4BWI A;  2JKR M;  4ZAM A;  3IT9 A;  3S7O A;  4DDY A;  3ULF A;  1BT5 A;  3RH8 B;  1G6A A;  2LB5 A;  3IXB A;  2JKT M;  2XD5 A;  2XFT A;  2Y2M A;  3PHY A;  1ERO A;  3VP1 A;  1BLP A;  5CXW A;  1K4F A;  1CI8 A;  4PM8 A;  5U47 A;  5TBM B;  4BJP A;  4RVA A;  3IXG A;  5EVI A;  2Y4A A;  4M4X A;  1IKI A;  3MSH A;  2KOI A;  3RXX A;  1DP9 A;  1NLY A;  5IHV A;  2WKH A;  1FQG A;  1H0M A;  4E3O A;  4X25 A;  4D2O A;  3MQQ A;  2J8Y A;  5FI6 A;  3IS2 B;  4RYE A;  2BAS A;  4KZ5 A;  3JVU A;  1VB6 A;  2VK3 A;  4MMN A;  1I2W A;  4N1H A;  5FAQ A;  1XA1 A;  4BBU A;  5CHM A;  1ODV A;  2VGK A;  2KLI A;  3FKV A;  5CEC A;  2VGL S;  3C7U A;  1ERQ A;  2W1T A;  2Y55 A;  5GHZ A;  5DKK A;  1HD8 A;  3CMZ A;  5I94 A;  3NCK A;  4G3V A;  5DTS A;  2EWV A;  4O7D A;  2J80 A;  5GLB A;  1WYC A;  4X53 A;  4E04 A;  5FEG A;  4WZ5 A;  2HDQ A;  1S6R A;  4B9O A;  2I9V A;  3CHW P;  4Y7P A;  3LR3 A;  3LY4 A;  5HDD A;  4EES A;  2J3T D;  1KOU A;  1O7E A;  2EXA A;  3FV7 A;  3ZNY A;  1L2S A;  5CHU A;  2B18 A;  2Y2O A;  4FCF A;  2HDU A;  4N9L A;  3N7W A;  4ZRR A;  3SH9 A;  1YLY A;  5KMW A;  3PXP A;  1KE3 A;  1TD5 A;  2FZ0 A;  4JGO A;  4WM9 A;  4KZA A;  1K56 A;  4P6B A;  5HL1 A;  5FI2 A;  4D60 A;  4N9K A;  1OT9 A;  2Y8H A;  4DRT A;  2EA9 A;  4DE2 A;  1N9B A;  4JXG A;  1P9W A;  2XFS A;  3IH8 A;  3UE1 A;  2O9A A;  3ITB A;  2R9X A;  3T1S A;  5D3O A;  3MZF A;  5F6A A;  3D9Y A;  5MC7 A;  3IF6 C;  4IBR A;  1UWP X;  4I38 A;  5FDH A;  1F2K A;  3NY4 A;  1XGI A;  2Y2N A;  5F83 A;  2A3U A;  3A0R A;  1BYW A;  1WYB A;  1OME A;  1XFQ A;  2EFU A;  1LSX A;  2M7V A;  5KSC A;  3Q1F A;  4FD8 A;  3VMA A;  2ZC4 B;  1T19 A;  1J3W A;  1FR6 A;  2OAP 1;  5HW3 A;  4OQI A;  2J9O A;  4DE1 A;  1BSG A;  4EUV A;  2V9A A;  3SS5 A;  2WGI A;  5L07 A;  1G6O A;  4JF5 A;  4K0W A;  3WS5 A;  5DFX A;  4RA7 A;  4PM9 A;  1S67 L;  1W63 Q;  1IFQ A;  5F1G A;  2PAV P;  1S0W A;  3ZHH A;  4WZ4 A;  3QP5 A;  4OPY A;  4P6Z S;  4XT2 A;  4ARZ B;  4PPR A;  1JTG A;  1TVF A;  4WLA A;  1S4R A;  3PTE A;  1PWD A;  3G31 A;  2ZM0 A;  3PBO A;  4B93 A;  2PU4 A;  3T4T A;  3NBL A;  5IS1 A;  4Q0J A;  1RGZ A;  5HAP A;  3HCY A;  4S2I A;  4HP9 A;  2FFY A;  3OPP A;  2A24 A;  4JXS A;  3A3E A;  4KUO A;  1ALQ A;  3V3S A;  2G7U A;  3CIT A;  4XXR A;  4LV1 A;  2P04 A;  4GCZ A;  4NKP A;  3S7P A;  3SW1 A;  3LI8 A;  4EBN A;  3UDF A;  1S66 L;  3T12 B;  2VLG A;  2HF6 A;  5EM0 A;  3N8L A;  1VEU B;  3IX8 A;  3NDG A;  2ZL1 B;  3F1P B;  3F1N B;  3T4J A;  4QU3 A;  1T1C A;  2NUT C;  5AQ7 A;  5F82 A;  3EQU A;  1H3Q A;  2WAD A;  1Y28 A;  3Q81 A;  2K7S A;  2OLU A;  5KZH A;  2QZ6 A;  1GSV A;  4Y3I A;  3OPH A;  4JGR A;  5IT5 A;  4KZ9 A;  4Y17 A;  3ZFZ A;  3A3F A;  3BEC A;  1K6R A;  4QB8 A;  3KSH A;  4JF6 A;  3F1O A;  2WKR A;  2EX2 A;  1K55 A;  1A0K A;  4UA9 A;  3C7V A;  1HTZ A;  3ZVT A;  3U4L P;  3K2N A;  2O99 A;  1IEM A;  4I39 A;  4R3J A;  5FAO A;  4ZJ3 A;  1LHY A;  1TF1 A;  3HLG A;  4F94 A;  5AVF A;  4OH0 A;  2CC1 A;  1PWC A;  4JXV A;  1M40 A;  2VV8 A;  2D02 A;  3TJZ C;  2P9V B;  4LPZ A;  1SDN A;  5EVI C;  5JYO A;  5HD5 A;  4S2K A;  3B33 A;  1AWI A;  3LY3 A;  4UQI M;  4HH3 A;  4MN7 A;  4H6J A;  4HBU A;  4MN5 A;  3EGX C;  2HP9 A;  4WMC D;  4WYY A;  1L0D A;  2Q9N A;  3MKF A;  2V0U A;  3BRM A;  4GLQ A;  1ERM A;  1YLZ A;  3NDE A;  2JCH A;  3E4P A;  2H28 A;  4WL9 A;  4KG2 A;  2OOL A;  4UQI S;  3FG8 A;  2A2L A;  4EBP A;  2PD7 A;  3OZH A;  3R4K A;  2HJ9 C;  3DTE A;  3MF0 A;  5CED A;  3GTC A;  3ZG0 A;  2PBD P;  4ZTK A;  4JF4 A;  2XDM A;  2L0W A;  1LI9 A;  1PWG A;  3EEH A;  3O88 A;  1IYP A;  1DY6 A;  2Y2G A;  1H8M A;  4DXB A;  2P7J A;  1CK3 A;  1W63 M;  1P0Z A;  2P74 A;  3QNB A;  4WZ5 C;  3O86 A;  4DF6 A;  1CF0 A;  4UAA A;  4E3I A;  4FTX A;  2WKQ A;  1DRM A;  1K0K A;  1DP6 A;  2LB9 A;  3DWK A;  3H82 A;  2VZW A;  3IX3 A;  3R7W B;  5HWV A;  3F1O B;  3GR2 A;  3A3J A;  4GZB A;  4CLC B;  1Y4O A;  5FAP A;  2M7U A;  3W4P A;  3VSK A;  1TS0 A;  3GRJ A;  5L8M A;  4HOI A;  1OTB A;  1O07 A;  1PW8 A;  2PDR A;  1PI5 A;  5L2F A;  1LT0 A;  4OP8 A;  5HFO A;  5AJG A;  4RX3 A;  5TBM A;  4Y0T A;  4E3K A;  2EWW A;  3NOP C;  3MR0 A;  2IWD A;  5A8B A;  1L0F A;  2W3F A;  3IWO A;  5FAS A;  4B4X A;  2XEP A;  3V50 A;  3GSG A;  4R0Q A;  1KGF A;  2JHE A;  1H8Y A;  1PI4 A;  2V2F F;  5JYP A;  1KGG A;  2XA7 M;  4MDZ A;  3UB7 A;  2VA0 A;  3LR5 A;  3D72 A;  1FSY A;  3CUE A;  1YSQ A;  3IS2 A;  3E2K A;  1L0G A;  5FQM A;  1Q2Q A;  4R23 A;  3EOI A;  2QHK A;  3S1Y A;  4NG2 A;  1JVJ A;  1C3B A;  3QNC A;  2XA7 S;  4N1X A;  4NXB A;  2AVX A;  4KZB A;  3Q7Z A;  5CTM A;  4LCL A;  1YAX A;  3G34 A;  2Y79 A;  1KDS A;  3VOZ A;  4WEJ A;  1I5Q A;  3SS4 A;  3LIC A;  1LI0 A;  4GS9 B;  1CJF A;  2W3H A;  4OPZ A;  1OJ5 A;  3OC2 A;  1MY8 A;  3WWX A;  3PAE A;  1LL8 A;  5AQ9 A;  2V1Z A;  4KZ8 A;  3UPP A;  2EX6 A;  2PYR A;  1TS7 A;  3IX4 A;  1EWZ A;  3NI9 A;  1FSW A;  1RGY A;  3BFF A;  1G68 A;  4S2L A;  2WGV A;  4BEN A;  4KQQ A;  4JKT A;  2W3E A;  3G32 A;  1FR1 A;  2EX8 A;  2MJ6 A;  3G4P A;  1XJ2 A;  5TR7 A;  3M2K A;  2XF3 A;  1L0E A;  3JPU A;  3NOT C;  3WS1 A;  4IED A;  4ZJ1 A;  1KE0 A;  2Y2P A;  3CI6 A;  3DTI A;  2OSU A;  3A0V A;  2QPN A;  1HZO A;  4ME4 A;  2PHY A;  4PMA A;  5EOE A;  2VGL M;  1K55 C;  3DWZ A;  4IHQ A;  4BL3 A;  3GEC A;  5E2E A;  1N9L A;  1BLC A;  3HUO A;  4RQ9 A;  4IUK A;  4NK3 A;  4WEK A;  2EFX A;  3OPL A;  1GA0 A;  4OKP A;  4Y0O A;  2PRF A;  4HES A;  1MXO A;  5EM1 A;  2Y2J A;  3O5Y A;  4BBV A;  3KSI A;  1D1J A;  2E8J A;  2IA2 A;  3ZNT A;  1TDG A;  3L9K A;  5FQQ A;  1NZU A;  1YQS A;  2XQZ A;  4O01 A;  1D7E A;  2B95 A;  4ARZ A;  3T1R A;  3MXS A;  5GHY A;  2DNS A;  3OPR A;  5LBR A;  3MZD A;  5GLC A;  4LFU A;  4KZ4 A;  3BY9 A;  3VE4 A;  1OT6 A;  5FAT A;  4DE0 A;  3HJK A;  4FSF A;  3NIA A;  5CGX A;  1XPB A; 
#chains in the Genus database with same CATH homology
 4OQG A;  1ES3 A;  4R4R A;  3VP2 A;  3VSL A;  3W8K A;  3UN7 A;  3A3I A;  4WMC A;  1KVL A;  3N8L A;  2Y2L A;  3NDG A;  3BM6 A;  2ZJ9 A;  3QHY A;  5G18 A;  1K54 C;  4QU3 A;  4MBF A;  4MLL A;  2PU2 A;  1PIO A;  2XH9 A;  5AQ7 A;  5F82 A;  1XXM A;  4X6T A;  3EQU A;  3IF6 B;  2G2W A;  3MKE A;  2H0T A;  2WAD A;  3AGE A;  3IHB A;  2ZQ8 A;  3LEZ A;  4XUX A;  1MWR A;  4EQI A;  4ZDX A;  5EE8 A;  2G2U A;  4GN2 A;  3SH7 A;  3Q81 A;  2OLU A;  3IF6 A;  2XR0 A;  5KZH A;  2QZ6 A;  2ZC5 B;  1YLP A;  2ZM2 A;  4KZ3 A;  3JYI A;  4L0L A;  1JTD A;  3VP3 A;  3HLC A;  3OPH A;  4P85 A;  1ES5 A;  4KZ9 A;  3BEB A;  3ZFZ A;  5EVL A;  4Y0U A;  3C4P A;  5EEC A;  3A3F A;  3BEC A;  4OOL A;  3SH8 A;  2X71 A;  2ZC6 B;  1U60 A;  4C6Y A;  2XD1 A;  3TG9 A;  3HRE A;  1K6R A;  4QB8 A;  1FCM A;  3VFH A;  3O3V A;  4S2N A;  4BD0 A;  1YLW A;  4E6W A;  4JF6 A;  2EX2 A;  3IQA A;  1VQQ A;  3GQZ A;  3GV9 A;  1K55 A;  1BUL A;  3IWI A;  3E2L A;  4UA9 A;  2H0Y A;  1K38 A;  1TDL A;  4IVK A;  4WEL A;  4X55 A;  3C7V A;  1HTZ A;  1FCO A;  2WAF A;  3BYD A;  3UE3 A;  3ZVT A;  4PM6 A;  5BOH A;  5FQI A;  3GVB A;  4S2N C;  4UA6 A;  5M18 A;  3WS4 A;  1Y54 A;  3HLB A;  1IEM A;  3UE0 A;  4R3J A;  5FAO A;  4ZJ3 A;  4UA7 A;  3VP0 A;  1BTL A;  2H10 A;  1LHY A;  4Q8I A;  4OPQ A;  1I2S A;  3IXH A;  1VM1 A;  3HLG A;  1IYO A;  3HLF A;  4F94 A;  1E3U D;  4X69 A;  5M19 A;  4OP5 A;  2V20 A;  4R3B A;  3ZVW A;  4OH0 A;  1H5X A;  1PWC A;  2CC1 A;  4LEN A;  4JXV A;  4M3K A;  4WBG A;  4CJN A;  3MXR A;  4OLG A;  4ID4 A;  1M40 A;  1FOF A;  2DRW A;  3EQV A;  5J8X A;  2P9V B;  3V3R A;  4K91 A;  1SDN A;  5EVI C;  5JYO A;  4S2K A;  1CEF A;  3HLE A;  1J9M A;  2P9V A;  1K57 A;  3LY3 A;  1YLJ A;  3CJM A;  5EOO A;  4FH4 A;  5DF8 A;  1AXB A;  5GLD A;  1BLH A;  1ES2 A;  3BFG A;  5FQK A;  1WE4 A;  2R9W A;  4HBU A;  5A93 A;  2XGN A;  1SHV A;  1ESU A;  4JLF A;  3HL9 A;  4FH2 A;  1SKF A;  4RX2 A;  4OOM A;  5DVA A;  2HP9 A;  5E2G A;  3Q82 A;  2JBF A;  4U3T A;  1NYY A;  4WMC D;  4WYY A;  2Q9N A;  1L0D A;  1NXY A;  2ZC3 B;  3ISG A;  3MKF A;  4OON A;  5HAQ A;  2Q9M A;  1DJA A;  2WUQ A;  3BRM A;  1ERM A;  1YLT A;  1YLZ A;  2Y2K A;  4IVI A;  4GB7 A;  3NDE A;  4R4S A;  3P98 A;  2I72 A;  2JCH A;  1E3U A;  2X02 A;  3RXW A;  1M6K A;  1IKG A;  3NC8 A;  2WZZ A;  4GKU A;  4KG2 A;  3WRT A;  4DKI A;  4EBP A;  1BLS A;  3S4X A;  3OCN A;  5CHJ A;  2A49 A;  3OZH A;  3CZD A;  3UDI A;  1K4E A;  5E2H A;  3BFD A;  3G30 A;  5CED A;  4E3L A;  1GHM A;  3PAG A;  2WGW B;  5EPH A;  3HUM A;  4A5R A;  3GTC A;  3ZG0 A;  3O87 A;  4ZTK A;  2XK1 A;  3ZG8 B;  3Q07 A;  2ZQA A;  4JF4 A;  3BLS A;  4S2O A;  4B88 A;  4QHC A;  4IBX A;  2XDM A;  4N92 A;  2WGW A;  1KDW A;  4BL2 A;  3DTM A;  1K54 A;  2ZQC A;  1LI9 A;  1PWG A;  3O88 A;  1IYP A;  2IWC A;  1DY6 A;  2Y2G A;  4R1G A;  5A91 A;  1E25 A;  4GDB A;  1NYM A;  4DXB A;  3IWQ A;  1CK3 A;  1JWZ A;  3PBT A;  4EWF A;  4H8R A;  4QY5 A;  3N6I A;  2JE5 A;  4DE3 A;  2P74 A;  3QNB A;  4WZ5 C;  3O86 A;  3W4O A;  1LLB A;  4DF6 A;  2Y2I A;  2ZQ9 A;  3WRZ A;  2ZM8 A;  4UAA A;  3BFC A;  4E3I A;  3B3X A;  3ZGA B;  2B5R A;  1IEL A;  5EVI D;  3PBN A;  3ZCZ A;  4GOG A;  3AGD A;  4LCM A;  1XA7 A;  1W7F A;  1NRF A;  4KQO A;  4GD6 A;  3TOI A;  1ZG4 A;  5CRF A;  3DWK A;  2ZD8 A;  5A90 A;  4ZAM A;  3IT9 A;  3G2Z A;  4JXW A;  1YMX A;  3GR2 A;  4DDY A;  3A3J A;  5FI7 A;  4GZB A;  1JWP A;  1BT5 A;  1G6A A;  5EUA A;  3IXB A;  1ES4 A;  5FAP A;  3W4P A;  2XD5 A;  5HAR A;  3VSK A;  3PBS A;  3ZG7 B;  3UO9 A;  1IYS A;  3ZG5 A;  2XFT A;  2Y2M A;  3GRJ A;  1PW1 A;  4YFM A;  1ERO A;  3VP1 A;  1BLP A;  5CXW A;  4JBF A;  3VOY A;  1O07 A;  1K4F A;  4BQM A;  1PW8 A;  1E4D A;  1CI8 A;  4PM8 A;  1PI5 A;  5U47 A;  4E6X A;  2IWB A;  4OOY A;  5L2F A;  4BJP A;  5EVI B;  4BD1 A;  4MBK A;  2OV5 A;  1SDE A;  4OP8 A;  1GHI A;  4RVA A;  2HDR A;  5HFO A;  2WYX A;  3UY6 A;  4RX3 A;  3IXG A;  5EVI A;  4Y0T A;  4E3K A;  1NZO A;  2Y4A A;  3FYZ A;  3OCL A;  1QME A;  1IKI A;  1MKI A;  3Q7V B;  2IWD A;  1L0F A;  3RXX A;  3IWO A;  5FAS A;  2ZLY A;  5IHV A;  5CEB A;  2Z2M B;  4OPR A;  5E2F A;  2WKH A;  3HBR A;  4B4X A;  3Q7V A;  2XEP A;  1FQG A;  5GHX A;  1MWT A;  3V50 A;  3GSG A;  4EV4 A;  1BZA A;  1KGF A;  4MNR A;  4R0Q A;  2EXB A;  1H8Y A;  1XKZ A;  1PI4 A;  2WK0 A;  4E3O A;  2V2F F;  4EUZ A;  5JYP A;  1KGG A;  1Z6F A;  3MFD A;  4D2O A;  2J8Y A;  5FI6 A;  4U0X A;  2WZX A;  4P87 A;  4YIN A;  5GL9 A;  4RYE A;  4KZ5 A;  4DDS A;  5TFQ A;  1FSY A;  3M2J A;  3WS2 A;  1PYY A;  1I2W A;  1XP4 A;  2Y2H A;  4N1H A;  5FAQ A;  1W8Y A;  2JC7 A;  3N8S A;  1XA1 A;  3E2K A;  3M6H A;  3CG5 A;  5FQM A;  3A3D A;  1L0G A;  5CHM A;  1Q2Q A;  1GCE A;  4R23 A;  2VGK A;  3P09 A;  4C3Q A;  5F1F A;  2Y2Q A;  3FKV A;  3ZG9 B;  1W5D A;  3S1Y A;  2HP5 A;  5CTN A;  5CEC A;  4EBL A;  4X56 A;  3HVF A;  4NET A;  3C7U A;  1JVJ A;  1C3B A;  2C6W B;  3QNC A;  1ERQ A;  1YMS A;  4N1X A;  4B4Z A;  2Y55 A;  1ESI A;  1YT4 A;  5GHZ A;  5CGW A;  1HD8 A;  1JWV A;  4KZB A;  3CMZ A;  5I94 A;  3Q7Z A;  4GNU A;  3NCK A;  3HUN A;  5AQA A;  5CTM A;  5DTS A;  4O7D A;  4UHU A;  4LCL A;  1K56 D;  5GLB A;  1WYC A;  4X53 A;  3BFE A;  3G34 A;  5CER A;  4KG6 A;  1KDS A;  3VOZ A;  4WZ5 A;  3DW0 A;  4KQR A;  4WEJ A;  1N4O A;  3FKW A;  1I5Q A;  2HDQ A;  1S6R A;  3IF5 A;  4HBT A;  3SS4 A;  3SOI A;  4E3N A;  4E3M A;  1ZG6 A;  4OLD A;  4Y7P A;  5CGS A;  3LY4 A;  1LL5 A;  4GDN A;  1ZKJ A;  2RCX A;  4MBH A;  3LCE A;  1LI0 A;  1LL9 A;  1O7E A;  4P0M A;  3V5M A;  2EXA A;  3FV7 A;  1KVM A;  3G35 A;  5FQ9 A;  3ZNY A;  1L2S A;  5FSR A;  1SCW A;  1W79 A;  2RL3 A;  5CHU A;  2ZC7 A;  4OPZ A;  4KZ7 A;  3OC2 A;  3C5A A;  1MY8 A;  3IHA A;  1CI9 A;  2Y2O A;  3RJU A;  2ZMA A;  4FCF A;  4GD8 A;  3WWX A;  3PAE A;  2HDU A;  4X68 A;  4LV0 A;  4N9L A;  3N7W A;  2BG1 A;  2HPB A;  1ZC2 A;  3SH9 A;  5DTK A;  1YLY A;  2E8I A;  5AQ9 A;  5KMW A;  2V1Z A;  5DF9 A;  3VFF A;  1KE3 A;  4WM9 A;  4QJG A;  4KZ8 A;  3FZC A;  3HLD A;  1K56 A;  3ITA A;  4KZA A;  2J7V A;  4P6B A;  5DTT A;  3UPP A;  5FI2 A;  5HL1 A;  3I7J A;  4N9K A;  1FCN A;  1H8Z A;  2EX6 A;  4K0X A;  4LV2 A;  4DRT A;  4DE2 A;  1NJ4 A;  1N9B A;  3LO7 A;  4JXG A;  2XFS A;  1MWU A;  3IH8 A;  3UE1 A;  1EWZ A;  4QD4 A;  3ITB A;  4S2P A;  2R9X A;  3NI9 A;  1FSW A;  2GDN A;  1RGY A;  3BFF A;  1G68 A;  3ZDJ A;  4S2L A;  2X01 A;  3VP4 A;  3S22 A;  1KGE A;  1Q2P A;  2WGV A;  4BEN A;  5KSH A;  5D3O A;  4KQQ A;  4E3J A;  3MZF A;  4JKT A;  3G32 A;  1FR1 A;  3IF6 C;  3N8R A;  3UPO A;  2EX8 A;  5FA7 A;  4IBR A;  3G4P A;  1DJB A;  5FDH A;  2J9P A;  3M2K A;  5TR7 A;  3NY4 A;  3MBZ A;  1XGI A;  4S2J A;  2XF3 A;  3M6B A;  1L0E A;  3WS1 A;  5GLA A;  4IED A;  4ZJ1 A;  1KE0 A;  1W8Q A;  2Y2N A;  2UWX A;  2Y2P A;  1ONG A;  5F83 A;  3UDX A;  2OSU A;  3AGF A;  2A3U A;  2QPN A;  4HEF A;  1WYB A;  1OME A;  1HZO A;  3IH9 A;  2FFF B;  4PMA A;  2EFU A;  2BLS A;  5EOE A;  5AQB A;  1K55 C;  5KSC A;  2XLN A;  3DWZ A;  3Q1F A;  4FD8 A;  3VMA A;  2ZC4 B;  4BL3 A;  3UNW A;  2Y59 A;  2OLV A;  1FR6 A;  5E2E A;  3HLW A;  5HW3 A;  4OQI A;  1BLC A;  2J9O A;  4DE1 A;  3HUO A;  1MPL A;  1BSG A;  4BLM A;  1K25 A;  1CEG A;  4NK3 A;  4OQH A;  4WEK A;  3PBR A;  2EFX A;  4OQ0 A;  2ZQ7 A;  3SS5 A;  1RCJ A;  1K6S A;  2WGI A;  1NY0 A;  5DF7 A;  5A92 A;  2Y91 A;  3MZE A;  3OPL A;  2WKE A;  3PBQ A;  4JF5 A;  4K0W A;  1IYQ A;  3SS3 A;  3WS5 A;  5FQJ A;  1TEM A;  4KZ6 A;  4JPM A;  4DXC A;  1GA0 A;  4OKP A;  4RA7 A;  3V39 A;  4PM9 A;  4CPK A;  4Y0O A;  3BLM A;  2VGJ A;  4HES A;  4C75 A;  5F1G A;  1S0W A;  1MXO A;  3ZHH A;  4WZ4 A;  2Y2J A;  2DCF A;  1PZO A;  4XUZ A;  4OPY A;  3UPN A;  1MWS A;  2WKI A;  4PM5 A;  3FWL A;  1DJC A;  1KE4 A;  2Z2L B;  3IXD A;  4KG5 A;  4KEN B;  1K57 C;  1MBL A;  4QY6 A;  1GHP A;  3ZNT A;  2WAE A;  4PPR A;  1YM1 A;  1TDG A;  1JTG A;  3C4O A;  4Z9Q A;  1TVF A;  4MEZ A;  5FQQ A;  1NZU A;  1YQS A;  2XQZ A;  3PTE A;  3N4I A;  5HX9 A;  1PWD A;  2H5S A;  1XGJ A;  2ZM0 A;  3G31 A;  3TSG A;  2PBY A;  3W4Q A;  4OVD A;  2QMI A;  4ZJ2 A;  1PZP A;  1RP5 A;  1QMF A;  2ZQD A;  3PBO A;  1ONH A;  2PU4 A;  3MXS A;  5GHY A;  2DNS A;  3NBL A;  3OPR A;  4U0T A;  1RGZ A;  3MZD A;  5HAP A;  5GLC A;  4S2I A;  1BUE A;  4KZ4 A;  5E43 A;  5TGF A;  2FFY A;  3OPP A;  4JXS A;  4ZBE A;  3D4F A;  5HAI A;  3WS0 A;  3A3E A;  5FAT A;  4DE0 A;  3G2Y A;  1ALQ A;  4S2M A;  1GA9 A;  4FSF A;  3NIA A;  4LV3 A;  4PM7 A;  1EI5 A;  5M1A A;  2EX9 A;  3V3S A;  4XXR A;  3GMW A;  4LV1 A;  5CGX A;  2HDS A;  2C5W B;  1XX2 A;  2HP6 A;  4EBN A;  1HVB A;  3UDF A;  1XPB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...