3IF6A

Crystal structure of oxa-46 beta-lactamase from p. aeruginosa
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
242
structure length
227
Chain Sequence
VVIRSDWKKFFSDLQAEGAIVIADERQAKHTLSVFDQERAAKRYSPASTFKIPHTLFALDADAVRDEFQVFRWQDQDLRSAMRNSTVWVYELFAKDIGEDKARRYLKQIDYGNVDPSGDYWIDGNLKISAHEQILFLRKLYRNQLPFKVEHQRLVKDLMITEAGRSWILRAKTGWEGRFGWWVGWIEWPTGPVFFALNIDTPNRTDDLFREAIARAILRSIDALPPN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords OXA-46 oxacillinase
publication title Crystal structure of the narrow-spectrum OXA-46 class D beta-lactamase: relationship between active-site lysine carbamylation and inhibition by polycarboxylates
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 67
structure length 227
sequence length 242
ec nomenclature
pdb deposition date 2009-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3if6A00
1GA0A 3PBRA 4WZ5A 2G2UA 4E3KA 3Q7VA 4GDBA 4GN2A 1E25A 3BEBA 4UA6A 1K38A 2WUQA 2H0TA 1ZG4A 2WAFA 1FSWA 2HDRA 2QMIA 3HBRA 5F1GA 2HDQA 1PIOA 5FAQA 4MBHA 1H8ZA 2Z2LB 4GZBA 1O07A 4OPRA 5TR7A 4PM5A 4HEFA 3OPHA 4OPQA 4RYEA 2A3UA 1FR1A 2PU4A 4WMCA 5CGXA 2ZC4B 1KE3A 3WS0A 3G2YA 3TSGA 3WRTA 3IXBA 3G34A 4X55A 4KZ5A 1RGZA 4KZ6A 5DVAA 3SH7A 4EWFA 1EI5A 4OH0A 5M1AA 4C3QA 4JXSA 3E2KA 3SS3A 3BFCA 3Q7ZA 1BUEA 2Y55A 4KZBA 3PBNA 5FA7A 1K6SA 2C5WB 2XD5A 1SCWA 4EUZA 3PBQA 3SH9A 5AQ9A 4F94A 4S2JA 1YLWA 3OPLA 5CXWA 3CMZA 3BFDA 3CJMA 5CERA 1H8YA 3MZDA 3HUNA 5F1FA 2JBFA 2Y2QA 3IH9A 3OCNA 5I94A 1E4DA 3NDEA 3VMAA 4Y0OA 4N1XA 4EBLA 1BSGA 5GHYA 1QMEA 4DE2A 3NY4A 5CHMA 4P87A 3HLBA 4WZ4A 3IF6B 3WS4A 4DF6A 3UN7A 3VP4A 1S6RA 1KGFA 3HLDA 4ZJ2A 1BULA 1LL5A 3BM6A 4WYYA 5CHUA 1VM1A 2H0YA 1XX2A 3A3DA 4JPMA 4E6XA 4U0XA 1ES5A 3HLGA 3JYIA 3P09A 4GKUA 4OPZA 5AQAA 1MY8A 2DNSA 2ZQDA 3ZG8B 4DXCA 1FR6A 2ZMAA 4LENA 2J8YA 4EBPA 4UHUA 2WK0A 3VP1A 1GHIA 3UE1A 1K57C 5KZHA 3BYDA 3N8LA 4OP5A 4R23A 3S1YA 3VFFA 1JTGA 2XD1A 5FASA 2ZM0A 3HLCA 1LI0A 4BENA 1ESUA 4JKTA 1NXYA 1L0GA 1ES3A 3Q81A 2XLNA 1K56A 1YLZA 4RX2A 4DRTA 1L0DA 2Y2NA 3NDGA 4IBRA 2BLSA 4UA7A 1LI9A 3NIAA 3GMWA 2XFSA 1JTDA 1GA9A 4R3BA 1PZPA 4LV3A 5DF8A 4N1HA 2Y2PA 1PW1A 5M18A 3HLEA 2WAEA 2R9WA 1XGIA 2WZXA 3S22A 1CEFA 1XGJA 4Z9QA 4X68A 3VOZA 3FZCA 1HVBA 1MPLA 4A5RA 2PU2A 3WRZA 1NZOA 2EX2A 3DW0A 5U47A 5HAIA 4KQOA 3MXRA 1ERQA 4X56A 3PBSA 5CTMA 1MXOA 3G31A 2H5SA 4WM9A 3BFEA 5FQMA 5GLBA 4DDYA 5BOHA 3G2ZA 4S2KA 3BRMA 3RXXA 3HLFA 4EQIA 1GCEA 5FI6A 2IWBA 4C6YA 4O7DA 3ZFZA 4DE0A 4NK3A 3N8RA 2IWDA 1ONHA 4QB8A 3QNCA 3P98A 3VP3A 4EV4A 3UO9A 3MXSA 1I2SA 5AQ7A 3WS5A 4ZTKA 2XDMA 4S2PA 4FD8A 4BLMA 2V1ZA 4LV0A 3GTCA 3ZG9B 3GVBA 5HAPA 1SDNA 4LV2A 3UDIA 5FATA 1PZOA 3Q07A 1KGEA 1Y54A 3ZNYA 4E3OA 3VSKA 3GRJA 1EWZA 1ZKJA 3G4PA 5FI7A 5KMWA 2ZC7A 4JBFA 3BFGA 5GHXA 2EFXA 2ZJ9A 3DTMA 3E2LA 1BLHA 1YLPA 3NC8A 1BZAA 1Z6FA 1IYPA 1NYMA 2HP5A 4HBUA 4P0MA 4MNRA 4ZBEA 2V2FF 2RCXA 1OMEA 1ONGA 4ID4A 3O3VA 3W4PA 3AGFA 4KZAA 3FYZA 3HUOA 4OONA 4WEKA 4JXWA 2Y2HA 3M6HA 3VSLA 4PM9A 3O86A 4HESA 4L0LA 5JYOA 1HTZA 1KE0A 3HUMA 1BLSA 1IYOA 1NY0A 4QD4A 3WS2A 1G68A 1BT5A 3LY4A 3DWKA 1ALQA 4B4XA 2GDNA 2P9VA 2J9OA 3Q82A 5EOOA 4BJPA 4N9LA 5IHVA 5J8XA 1KGGA 3V39A 3ZG5A 5HARA 1KE4A 3PAGA 2WZZA 5E2GA 3IF6C 4OPYA 1NRFA 3ZGAB 3CZDA 4LCLA 4WZ5C 1SHVA 1K54C 3GSGA 3UY6A 3NBLA 3HLWA 2Y2GA 4PMAA 5EE8A 2Y2IA 3ZVTA 1JWZA 5EVIB 4P85A 4IVIA 4GD8A 5GLAA 4QU3A 2EX8A 2ZQCA 4KZ8A 3ZG0A 5HL1A 1MWUA 3C7VA 4XXRA 2Q9MA 3ZHHA 3UPPA 3IXGA 1E3UD 3A3FA 5A90A 3IXHA 5HAQA 1W7FA 2VGJA 4KENB 5E2HA 4Q8IA 1K57A 3Q7VB 5M19A 1XA7A 4DE1A 3GQZA 5DTTA 4E6WA 4RVAA 1PW8A 5EOEA 2Y91A 3PBOA 2OLUA 2Y2JA 3FV7A 2EXBA 3C5AA 4H8RA 1ESIA 3MKEA 4R0QA 4Y0TA 5EVID 2Y2KA 2X02A 3LCEA 3BFFA 2WADA 4IBXA 2WGWA 1IYSA 4WEJA 3W4OA 3ZVWA 2XFTA 5KSHA 1I5QA 1MWTA 4KG6A 5A91A 2WGIA 5E43A 1FCNA 1DJBA 1PI5A 2ZQAA 3NI9A 5FQIA 4OQIA 1J9MA 1HD8A 4MBKA 1LHYA 4Y0UA 2FFFB 3A3JA 2OV5A 5FQ9A 1AXBA 3O88A 4BQMA 5CEDA 2QZ6A 2XR0A 3UPNA 2ZC3B 2WKEA 2JCHA 2HDUA 5HW3A 1XA1A 3LO7A 1K4FA 1BTLA 1YLYA 4IEDA 3ISGA 2XK1A 5E2EA 3OCLA 1H5XA 3SOIA 3IF5A 4LCMA 4WMCD 1YQSA 4BL2A 1K55C 2C6WB 1Q2PA 1I2WA 3ITAA 3MKFA 2CC1A 5CECA 4QY5A 3ZNTA 1LLBA 3MFDA 5DTSA 1FCOA 1FSYA 3N6IA 2IWCA 5FAPA 3A3EA 1W8QA 2DRWA 3VFHA 4R3JA 5JYPA 4JXVA 2XH9A 3IHBA 4S2NC 5HFOA 1CI9A 4PPRA 1JWVA 2ZM2A 4X6TA 2PBYA 1MKIA 1U60A 3N7WA 5CGSA 4KG5A 1ZC2A 1DJAA 4D2OA 1SDEA 4MBFA 1ES4A 1CEGA 3IWQA 5AQBA 5E2FA 2ZD8A 5F82A 4B4ZA 3M6BA 2HDSA 3NCKA 1KVLA 2Y4AA 2WGWB 1CI8A 2XEPA 2ZQ9A 2I72A 4K91A 1TEMA 3EQVA 4DKIA 1FCMA 2ZC6B 1XKZA 3HVFA 4R4SA 4QJGA 1PWCA 3SH8A 2HPBA 4K0WA 1YT4A 4E3JA 1M6KA 3BLMA 3M2KA 3SS5A 5CEBA 1IELA 4E3LA 5FSRA 4BD1A 4GDNA 3G32A 2QPNA 5FQJA 4FH2A 4B88A 2JC7A 3VP2A 4BL3A 5GHZA 1WYBA 3MZEA 2J9PA 2WGVA 2XF3A 1NYYA 3C4PA 1CK3A 5TGFA 3AGDA 3B3XA 3IHAA 1DY6A 2ZQ8A 4JF5A 3TG9A 4CPKA 4QY6A 1K25A 3N4IA 3WS1A 3OPPA 3PBTA 4NETA 3VOYA 4U0TA 2X01A 4OKPA 1K54A 4FSFA 2V20A 1TDGA 5EVIC 4X53A 3TOIA 2ZM8A 1K56D 1HZOA 4OLDA 3IWOA 1W5DA 3SS4A 5D3OA 2Y2MA 1W8YA 4OP8A 1YMSA 1N4OA 4DXBA 3V3RA 1IKIA 4PM7A 1NJ4A 1GHPA 3C7UA 3QNBA 3HREA 3V50A 5EUAA 2G2WA 5DTKA 3PTEA 1GHMA 3FKVA 4R1GA 5KSCA 4WBGA 3V5MA 1IYQA 5CTNA 1PWDA 3Q1FA 4K0XA 3VP0A 1PI4A 1IEMA 4EBNA 4S2IA 3UDXA 4GD6A 4U3TA 3UNWA 5FAOA 3GR2A 3G30A 3ZCZA 3OC2A 1XXMA 3C4OA 5GLDA 3AGEA 4BD0A 3IT9A 1BLPA 1XPBA 5A93A 1L0EA 4OLGA 3RXWA 2BG1A 4KZ3A 1YLTA 1FOFA 1KDWA 1LL9A 1JVJA 2JE5A 2Y59A 4RA7A 3ZDJA 2OSUA 4UA9A 1JWPA 1YMXA 2UWXA 1S0WA 4C75A 1RP5A 4MLLA 1SKFA 4XUXA 2Z2MB 1C3BA 3IXDA 4RX3A 4JF6A 1G6AA 2WKHA 4DE3A 4KZ9A 4FCFA 2WYXA 5FI2A 1Q2QA 3DWZA 3M2JA 4QHCA 1YLJA 5CHJA 3BLSA 3OPRA 2Y2OA 4FH4A 3OZHA 2HP6A 4S2OA 3MBZA 4YINA 5A92A 2XQZA 3GV9A 2EXAA 2J7VA 2P9VB 4JXGA 5TFQA 1KVMA 3EQUA 1O7EA 1L2SA 2R9XA 4GOGA 3HL9A 1K55A 4JF4A 1ZG6A 2Q9NA 5CGWA 3G35A 4OQGA 1NZUA 3S4XA 1MWRA 3IWIA 4P6BA 5GL9A 3D4FA 3FKWA 4PM6A 4YFMA 4JLFA 4KZ4A 3W4QA 5EPHA 4S2NA 2EX9A 1W79A 4E3MA 4HBTA 4KZ7A 4OOYA 4ZAMA 4PM8A 2B5RA 5FQQA 4E3NA 4LV1A 3UPOA 3UE0A 4KQQA 5FQKA 3CG5A 3A3IA 1QMFA 3UE3A 1BLCA 4ZDXA 1DJCA 2RL3A 5HX9A 2Y2LA 3QHYA 1WE4A 3MZFA 2ZC5B 1YM1A 3UDFA 1ERMA 2X71A 1TDLA 2EX6A 1RGYA 5G18A 3V3SA 4E3IA 4KG2A 1K4EA 5EVLA 2DCFA 4ZJ1A 4KQRA 3N8SA 4CJNA 4OQ0A 3LEZA 3IQAA 5CRFA 3ITBA 1MBLA 1TVFA 1PYYA 3LY3A 1VQQA 2FFYA 4IVKA 4Y7PA 4OVDA 4S2MA 2A49A 3O87A 1E3UA 4R4RA 4MEZA 2XGNA 4GB7A 3RJUA 1L0FA 4M3KA 1RCJA 4OQHA 5GLCA 1K6RA 1PWGA 2WKIA 2EFUA 3BECA 5FDHA 4DDSA 4XUZA 3IH8A 2OLVA 4N9KA 5EECA 3W8KA 1N9BA 5EVIA 4S2LA 2HP9A 5F83A 5DF9A 1ES2A 4WELA 1EROA 3PAEA 4X69A 4ZJ3A 2ZQ7A 1WYCA 4OOMA 2P74A 3FWLA 1IKGA 2E8IA 4N92A 3ZG7B 4UAAA 3WWXA 3I7JA 5DF7A 2H10A 2ZLYA 1XP4A 3IF6A 4OOLA 1M40A 1MWSA 2VGKA 4GNUA 1FQGA 5L2FA 1KDSA
chains in the Genus database with same CATH superfamily
4WZ5A 3LICA 2W1RA 3BEBA 2O9CA 3CAXA 1FSWA 2K2NA 3BY8A 5TR7A 1TS0A 3RTYA 1FR1A 1KE3A 3IS2B 4P6ZM 3TSGA 3IXBA 4Y5FA 3CPTB 3BFCA 1YSQA 2L1MA 2OWJA 4I3JA 2C5WB 4JGRA 3SZTA 2JKTI 1SCWA 2H28A 3EEAA 5AQ9A 4F94A 4S2JA 1OJGA 3CMZA 5EFWA 1AWIA 4YNRA 2VV7A 2JBFA 5I94A 4Y0OA 5J3WA 4B93A 4P87A 3UN7A 3VP4A 2WKQA 1S6RA 4D60A 3CLOA 1XJ4A 3BM6A 4OPZA 3ZG8B 3P01A 4EESA 2V0WA 2J8YA 2WK0A 1K57C 1OTEA 4EETB 1JTGA 3CUEA 4GW9A 1LI0A 3T1RA 4BENA 4R70A 4YOFA 4JKTA 1NXYA 1L0GA 3LIDA 4RX2A 1L0DA 2Y2NA 2P08A 3NDGA 4Z1WA 1GA9A 5DF8A 4LV3A 1PW1A 4Z9QA 3VOZA 1HVBA 4I39A 2PYRA 4X56A 2NUPC 2H5SA 3BFEA 5FQMA 2D02A 1STZA 4C6YA 5HPFA 4XT2B 1S67L 1TS7A 1K0KA 2L0WA 1WA9A 3UO9A 1CJFA 4ZTKA 1CF0A 4BLMA 1X0OA 3GTCA 3GVBA 4LV2A 4F3LB 1Y54A 3GRJA 5FI7A 4JBFA 3BFGA 5GHXA 2EFXA 3ZYTA 1OMEA 1ONGA 1N9LA 3AGFA 3FYZA 4WEKA 3C8CA 2VEAA 3O86A 4HESA 5JYOA 3E98A 5L09A 3EGDC 4N9LA 5IHVA 5J8XA 1D1JA 2G7UA 3V39A 3LUQA 4Y17A 2FH5A 5E2GA 3KSIA 4OPYA 1NRFA 2QJ7A 1LSWA 1SHVA 3UY6A 5AJGA 2Y2GA 2Y2IA 4K08A 4P85A 5GLAA 3BJNA 2P04A 2EX8A 3O5YA 3ZG0A 3UPPA 4CLCE 3A3FA 5A90A 3IXHA 4MMNA 3BWLA 4Q8IA 1K57A 1N9NA 5M19A 1XA7A 4EW7A 2GX5A 1H8MA 4RVAA 5AVFA 2B02A 3FV7A 3LIAA 3C5AA 4Y13A 1ESIA 4Y0TA 2OAQ1 4DMZA 2WADA 4WEJA 3ZVWA 2XFTA 5KSHA 1MWTA 4X1MA 1DJBA 1PI5A 2PAVP 4OQIA 2FFFB 2AVXA 5FQ9A 1AXBA 1YPRA 1T1BA 3L7HA 3UPNA 5DKKA 2JCHA 3E4OA 4IEDA 4PAUA 3MMHA 5LBRA 3OCLA 4AFIA 4LCMA 5HPIA 2PHYA 3FC7A 1LLBA 3EGXC 3N6IA 3UB9A 3A3EA 3HJKA 3D3OA 3D9YA 4R3JA 3VFHA 3LI8A 4S2NC 3H9WA 4PPRA 3N7WA 1MKIA 5CGSA 3K3CA 1ZC2A 4LRZE 4D2OA 4G3KA 2O9BA 2VGLM 3LR0A 4B4ZA 3S7QA 1NLZA 4K91A 2I72A 3LIEA 1S1YA 1ZHHB 3HVFA 3BQAA 3SH8A 2HPBA 3MQQA 1YT4A 2DMWA 4K0WA 1M6KA 3BLMA 5CEBA 5FQJA 3CITA 4FH2A 4IUHA 1N9OA 3VE4A 5GHZA 3MZEA 3AGDA 3B3XA 3IHAA 2Y79A 3TG9A 2W1TA 3KX0X 1K25A 3VOYA 2X01A 4OKPA 5EVIC 4KUKA 1N4OA 4PM7A 3FG8A 2G2WA 2R78A 2PBDP 5KSCA 4Q0IA 5G4ZA 3Q1FA 4S2IA 3F1OA 5FAOA 3G30A 3OC2A 3C4OA 4BD0A 1BLPA 1XPBA 5A93A 1L0EA 3RXWA 1YLTA 1FOFA 2JE5A 2Y59A 4X1LA 1YMXA 1RP5A 4MLLA 4XUXA 2O99A 4B9OA 3A0SA 3IBRA 3T1QB 5FI2A 5HWWA 1Q2QA 1IOUA 4HOIA 4FOFA 3OZHA 2HP6A 1LSVA 4YINA 2J3TD 2J7VA 4JXGA 3MJQA 4L9GA 4JF4A 1NRJA 1ZG6A 1PNEA 4OQGA 5I5LA 1MWRA 2W3HA 3D4FA 3FKWA 4JLFA 5EPHA 4S2NA 4OOYA 5FQQA 4ZAMA 4PM8A 5HDCA 1PRQA 3UE3A 3H7WA 2VGLS 3C38A 5C5KA 3BY9A 3UDFA 1TDLA 2OWHA 2EX6A 3V3SA 4KG2A 5FDSA 4YWZA 3N8SA 1MZUA 3B47A 3LEZA 3IQAA 2VV8A 1PYYA 4I5SA 1ACFA 4S2MA 3QP6A 1E3UA 4HNBA 5EM0A 3ICYA 1PWGA 2L4RA 5FDHA 1IFQA 1NWZA 4NEED 2VA0A 3IH8A 3W8KA 5EVIA 2HP9A 3K3DA 1EROA 4ZJ3A 1WYCA 2KDKA 2P74A 3ZG7B 3WWXA 3I7JA 1M40A 3H82B 2JN7A 1FQGA 1KDSA 1GA0A 3PBRA 1ZTUA 2G2UA 3UMEA 4GDBA 4HI4A 1K38A 2H0TA 2QMIA 3TRCA 1PIOA 4MBHA 4GZBA 2Z2LB 4OPQA 4WMCA 2PU4A 5CGXA 2ZC4B 3G2YA 2QJ5A 5M1AA 1KOUA 2Y55A 4KZBA 2PYPA 4EXOA 3PBNA 4ETXA 2XD5A 1ODVA 3T1XA 4EUZA 3PBQA 3MXQA 2A2LA 1YLWA 3LIFA 3OPLA 5CXWA 2IA2A 3BFDA 1H8YA 3MZDA 2HF6A 4MN5A 2Y2QA 3IH9A 1E4DA 4EBLA 3A0RA 3DTKA 4WLAA 1OTIA 3HLBA 2W1TB 4WZ4A 4DF6A 4HY8A 1BULA 1LL5A 3LEQA 4PHTA 4WYYA 4U0XA 5AQAA 3JYIA 1Y28A 1MY8A 2J3WA 4DXCA 4UHUA 1TF1A 3UE1A 2W0NA 3OBFA 5KZHA 4OP5A 3N8LA 3S1YA 3VFFA 4E04A 2XD1A 5FASA 3HLCA 1ESUA 3Q81A 1K56A 3F1OB 2BLSA 4JGQA 2A24A 2XFSA 1JTDA 4R3BA 4N1HA 1S4RA 2WAEA 2WZXA 1F2KA 1CEFA 1XGJA 3S22A 3UB5P 3WRZA 2EX2A 5HWTA 3MXRA 3QP5A 5CTMA 5HSQA 4WM9A 5GLBA 5BOHA 3G2ZA 3TW8A 1ONHA 4EV4A 4GCZA 4S2PA 4FD8A 2V1ZA 4LV0A 2ZL1A 5HAPA 1SDNA 4E3OA 3S7OA 3T4JA 5KMWA 1Z09A 2OOLA 3DTMA 4PM5A 3H7WB 3NC8A 4ME4A 1NYMA 2HP5A 4P0MA 3HJIA 1UGUA 2RCXA 3L9KA 2VK3A 4LPZA 3HUOA 4OONA 4PM9A 2CMNA 4L0LA 1KE0A 1D7EA 3HUMA 4QD4A 1IYOA 1NY0A 3WS2A 3NECA 4B4XA 2GDNA 2J9OA 4CLCC 5HARA 1XFQA 3ZGAB 3SW1A 4MDZA 2PR6A 1K54C 3EOIA 4CQHA 3LGOA 5EVIB 4IVIA 2VKSA 2ZQCA 1MWUA 2WKRA 3C7VA 4XXRA 3IXGA 1G5UA 4KENB 2ACGA 5TBMA 4EEPA 3ZQ5A 5DTTA 4HP9A 2OLUA 2EXBA 2Y2KA 2HZ5A 4IBXA 1IYSA 3UB7A 3BQ8A 2WGIA 1H0MA 1FCNA 1HD8A 1LHYA 2XRNA 4Y0UA 2OV5A 3O88A 2QZ6A 2HDUA 5HW3A 4KUOA 2XK1A 5E2EA 1H5XA 3SOIA 3IF5A 1OTAA 3NHQA 4BL2A 1K55C 2C6WB 1Q2PA 1I2WA 3MKFA 2VLGA 4QY5A 4EUVA 4MCWA 3UB8A 4UEYA 2DRWA 5JYPA 4IHQA 3T4KA 4JXVA 3IHBA 5HFOA 1CI9A 4X6TA 2ZM2A 2EA9A 3T4TA 4KG5A 2GJ3A 1SDEA 1ES4A 5E2FA 4O8GA 1KVLA 2Y4AA 2WGWB 2XEPA 3MF0A 1TEMA 1FILA 1FCMA 1XKZA 1PWCA 3SS5A 4E3LA 5FSRA 4BD1A 1VEUA 2BTFP 3G32A 1OTDA 3VP2A 2A24B 1P9WA 1WYBA 2WGVA 2XF3A 2Y8HA 1A0KA 4CLCA 5F68A 4EU0A 3JVUA 3OLOA 1T1AA 3R4KA 3OPPA 2NUTC 4NETA 1K54A 4X53A 4HP4A 3LR5A 5F6AA 2Y2MA 4OP8A 4DXBA 1F9IA 3P7NA 4ESPA 3HREA 2J3TC 5EUAA 3FKVA 3KSHA 4R1GA 2YKFA 4ETZA 4G3VA 1IYQA 4K0XA 2ZL1B 3VP0A 1PI4A 3UDXA 1J3WA 4GD6A 4I38A 5GLDA 4OLGA 3ZDJA 1JVJA 4UA9A 1S0WA 2Z2MB 1C3BA 1G6AA 4KQDA 4I3AA 4ZRRA 4PKYA 5J7EA 3S7NA 1XJ6A 5TJJA 5A92A 2XQZA 3GV9A 2EXAA 3DBAA 2R9XA 4GOGA 1K55A 3F1NA 5FEFA 3S4XA 4NXGA 2B18A 1LT0A 3W4QA 3CHWP 4BWIA 1FIKA 4E3MA 5IU1A 3T12B 3CWFA 4KQQA 3H82A 5FQKA 1QMFA 2Y2LA 1W63M 1S4SA 5IT5A 5TBMB 1RGYA 1K4EA 3T1SA 2YKHA 3K2NA 3MQOA 3ITBA 1MBLA 1TVFA 4DJ2A 3LY3A 4IVKA 2XA7S 2A49A 4R4RA 3MSHA 4PKYG 2XGNA 2I9VA 4M3KA 2Z6DA 5G4YA 3KSGA 2EFUA 3BECA 5DJUA 1NLYA 4XUZA 1LSXA 1ES2A 4X69A 4OOMA 1IKGA 2GZAA 4UAAA 1XJ2A 4HQAA 2ZLYA 3JPUA 4OOLA 3UMDA 3WS0A 2PDRA 3G6OA 5L2FA 4BMWA 3FPWA 2HDRA 3HBRA 3LFVA 4OPRA 1O07A 4HEFA 3OPHA 3WRTA 3SH7A 4EWFA 4OH0A 4C3QA 3E2KA 3IX4A 1BYWA 3VE3A 1BUEA 1V9ZA 3PYPA 1OTBA 1VEUB 3CJMA 5CERA 1L3LA 4NKPA 5F1FA 3NDEA 4WUJA 3VMAA 3JVVA 1BSGA 4CLCB 5GHYA 2W3EA 5HD5A 4ZJ2A 3E0YA 1XFNA 2PRFA 4EQ1A 3T4OA 5CHUA 1VM1A 2H0YA 3A3DA 1GSVA 2HV1A 1ES5A 3UB6A 4GKUA 2DNSA 2ZMAA 1S1ZA 4NXFA 1OT9A 1GHIA 4LFUA 3R7WA 3BYDA 3KYZA 5KIZA 1SKOB 3MS6A 1ES3A 1OPXA 2XLNA 1YLZA 4IBRA 4I3IA 4L9FA 3GMWA 3T4LA 1XGIA 3S7PA 3FZCA 3V67A 4GLQA 5U47A 5HAIA 4H6JB 1ERQA 2K31A 3NOTC 1MXOA 3G31A 2ZMVA 4S2KA 3RXXA 4EQIA 5FI6A 2IWBA 4O7DA 2V8FA 3ZFZA 3F1NB 4DE0A 3N8RA 2IWDA 2KOIA 3P98A 3VP3A 3NOUC 3C2WA 1YAXA 5AQ7A 3D72A 4MN6A 3ZG9B 1YKDA 5FATA 1KGEA 1EWZA 1ZKJA 4BBVA 2ZJ9A 3E2LA 1YLPA 1IYPA 4MNRA 2HGVA 4ID4A 3KO6A 3W4PA 4O0PA 3QP1A 4JXWA 1UWPX 2Y2HA 3M6HA 1TD5A 1HTZA 2QWSA 2W3FA 1BLSA 3DWKA 1ALQA 4HJ4A 3Q82A 5EOOA 2JKRI 3PAGA 2WZZA 2FZ0A 3QP4A 4Y2FA 3IF6C 1PFLA 1OJ5A 3CZDA 4LCLA 3E4QA 4WZ5C 3GSGA 3HLWA 4PMAA 5EE8A 3ZVTA 1F98A 4GD8A 4KZ8A 3ZHHA 3GDIA 1E3UD 2VJWA 3DTEA 5HAQA 4HIAA 4DE1A 3C30A 3GQZA 3LYXA 4E6WA 2XROA 1PW8A 3PBOA 2Y2JA 3MKEA 4R0QA 5EVID 2X02A 3LCEA 2WGWA 5DJTA 4KG6A 2PD8A 3NI9A 2ZQAA 3B42A 3U2AA 3W2ZA 2JKFA 2QHKA 2XR0A 2WKEA 1S66L 1XA1A 1HLUP 1YLYA 4IJGA 3ISGA 1T1CA 4WMCD 1JNUA 1YQSA 4L9EA 3ITAA 5CECA 3ZNTA 3MFDA 4X25A 1FCOA 5FAPA 3CUEC 1U60A 4LRXC 1DJAA 4MBFA 1CEGA 3IWQA 5AQBA 2ZD8A 5F82A 2HDSA 3NCKA 2HJ9C 1P0ZA 3R7WB 2ZC6B 4QJGA 4E3JA 3M2KA 4B88A 4BBUA 2J9PA 1VETA 1NYYA 3C4PA 1CK3A 2ZQ8A 3TJZC 4QY6A 3IX8A 3N4IA 3PBTA 4WN5A 2EWWA 4HJ6A 3B33A 4U0TA 4FSFA 2V20A 4QPRA 3TOIA 5L10A 1K56D 1HZOA 4GJ4A 2W27A 3SS4A 1W63Q 5D3OA 1W8YA 1YMSA 3V3RA 1IKIA 1NJ4A 1GHPA 3C7UA 4GHIA 3V50A 3PTEA 3FPVA 2W3DA 3GECA 4WBGA 4Y15A 5CTNA 2V0UA 1IEMA 4EBNA 4U3TA 3GR2A 4HH3A 3PR6A 1XXMA 3AGEA 2JHEA 2BG1A 1LL9A 4RA7A 4HHDA 1JWPA 1GSXA 2UWXA 1SKFA 3IXDA 2WKHA 4DE3A 5MC7A 4KZ9A 4FCFA 2WYXA 3DWZA 3M2JA 4QHCA 2Z6CA 4S2OA 4RQ9A 3IBJA 1O7EA 4UQIM 2Q9NA 2LB5A 5CGWA 4P6BA 4PM6A 4YFMA 4KZ4A 1MC0A 4HBTA 4KZ7A 3UPOA 2B5RA 4E3NA 4LV1A 1YSPA 3A3IA 1BLCA 2RL3A 3VOLA 5HX9A 3QHYA 1WE4A 2ZC5B 5L07A 1ERMA 4E3IA 4KQRA 4CJNA 2HJEA 5CRFA 1VQQA 2FFYA 3TE8A 3O87A 4EEUA 5K5BA 1F5MA 2V8CA 4Y3IA 1L0FA 1RCJA 4OQHA 5F5YA 5GLCA 1TS6A 1G28A 3MFXA 2XA7M 5HL6A 5J4EA 4N9KA 5EECA 2B95A 1N9BA 3EWKA 4S2LA 3PAEA 2ZQ7A 4HH2A 3FWLA 4N92A 3BW6A 2H10A 1XP4A 3PHYA 3IWOA 2VGKA 4NG2A 4E3KA 3Q7VA 4GN2A 1E25A 4UA6A 2JKGA 2V1AA 4P6ZS 2WUQA 3E4PA 1ZG4A 2WAFA 5F1GA 2HDQA 5FAQA 5EV0A 3KYEA 5HDDA 1H8ZA 4RYEA 2A3UA 3G34A 4X55A 4KZ5A 1RGZA 4KZ6A 5DVAA 1EI5A 4JXSA 1SZVA 3SS3A 2ZOIA 1SKOA 3Q7ZA 5FA7A 1K6SA 5DFYA 4Q0HA 3SH9A 1VETB 3HUNA 3OCNA 3NULA 4N1XA 1QMEA 3OOVA 4H6JA 4UQIS 4DE2A 3NY4A 5CHMA 3IF6B 3WS4A 1KGFA 3HLDA 1DRMA 3U4LP 1XX2A 4JGPA 4JPMA 2PR5A 2VZWA 4E6XA 3HLGA 3P09A 2ZQDA 1FR6A 4LENA 4GHIB 4EBPA 5L8MA 1LL8A 3VP1A 4CLCD 5HD3A 4R23A 4R6LA 1G6OA 2ZM0A 4WL9A 3T4SA 1Y4OA 3MQ0A 3RH8B 4DRTA 4UA7A 1TS8A 1LI9A 3NIAA 3VV4A 2E8JA 1PZPA 2Y2PA 5F69A 3HLEA 5M18A 3LI9A 2R9WA 4DN0A 1CQAA 2M1CA 4X68A 3LR3A 1MPLA 4A5RA 2PU2A 1NZOA 3DW0A 3A0VA 4FUWA 4KQOA 5A8BA 2VX8A 3PBSA 4DDYA 3BRMA 3HLFA 5CX7A 1GCEA 4NK3A 4QB8A 3QNCA 4O01A 3MXSA 1I2SA 3WS5A 2XDMA 2KX6A 4GS9A 3UDIA 1PZOA 3Q07A 3ZNYA 3VSKA 5AVEA 3G4PA 2ZC7A 2V9AA 1BLHA 1BZAA 1Z6FA 4HBUA 4ZBEA 2V2FF 4NXEA 1GSWA 3ULFA 3O3VA 4KZAA 3EEHA 3VSLA 1V9YA 2JKRM 1G68A 1BT5A 3LY4A 1UWNX 2P7JA 2P9VA 1P9RA 2KLIA 4BJPA 1KGGA 3ZG5A 1KE4A 2GNXA 2QKPA 4Q0JA 2WKPA 2PT7A 4QWOA 3NBLA 1JWZA 2VV6A 4JGOA 4QU3A 5IS1A 2INWA 4IUKA 5HL1A 2Q9MA 3F1PA 1W7FA 2VGJA 5E2HA 3Q7VB 3DTIA 5EOEA 2Y91A 4H8RA 4NXBA 3BFFA 3W4OA 1I5QA 5A91A 5E43A 3KSFA 4DJ3A 5FQIA 1J9MA 4MBKA 2OAP1 3A3JA 4MN7A 4BQMA 5CEDA 2ZC3B 3LO7A 1K4FA 1BTLA 4ARZA 4II7A 2J80A 5FEGA 2CC1A 2ZBBA 5DTSA 2O0YA 1FSYA 2IWCA 1W8QA 5DKLA 2XH9A 1JWVA 2PBYA 1XJ3A 3HCYA 1H3QA 3IS2A 2MJ6A 3M6BA 4HJ3A 3CPTA 2W3GA 1CI8A 2ZQ9A 3EQVA 4DKIA 4R4SA 2M7VA 1IELA 4GDNA 2QPNA 2JC7A 2BASA 4BL3A 4LLOB 3QP2A 5TGFA 4R38A 1DY6A 4JF5A 2D01A 2PD7A 4CPKA 5EVEA 3WS1A 3T4QA 1TDGA 3QP8A 2ZM8A 4OLDA 1W5DA 2K7SA 2ZOHA 3LR4A 3LIBA 3IX3A 3QNBA 2M7UA 5DTKA 1T18A 1GHMA 4G3WA 4M4XA 5HWVA 3V5MA 3MR0A 1PWDA 3KYQA 2JKTM 4GS9B 3UNWA 3ZCZA 4FTXA 3IT9A 4KZ3A 1KDWA 2Q0OA 1T19A 1P97A 2OSUA 4C75A 1MKMA 4RX3A 4JF6A 3NOPC 2XSSA 4BBTA 1YLJA 5CHJA 2ZMFA 3BLSA 3OPRA 2Y2OA 4FH4A 4R3AA 3RFBA 3CI6A 3MBZA 2EWVA 5DFXA 2P9VB 5TFQA 1KVMA 3EQUA 1L2SA 4EERA 3HL9A 1DP6A 4XT2A 3G35A 1NZUA 3PXPA 2UV0E 3IWIA 5GL9A 2EX9A 1W79A 4LRYC 3NJAA 4F3LA 3UE0A 3CG5A 1DP8A 1VHMA 2LB9A 4ZDXA 1DJCA 3F1PB 1EW0A 1VB6A 3MZFA 1YM1A 2X71A 5G18A 5EVLA 5HZHA 1D06A 2DCFA 4ZJ1A 5HDSA 4OQ0A 5FL3A 5EM1A 4WF0A 4Y7PA 4OVDA 1DP9A 3UE6A 2O9AA 4MEZA 1OT6A 3DAVA 4GB7A 3RJUA 1K6RA 2WKIA 4DDSA 2OLVA 4ARZB 4LGWA 5F83A 3T50A 5DF9A 2V1BA 4WELA 2E8IA 5DF7A 2QYBA 3IF6A 1MWSA 4GNUA
chains in the Genus database with same CATH topology
1GA0A 3PBRA 4WZ5A 2G2UA 4E3KA 3Q7VA 4GDBA 4GN2A 1E25A 3BEBA 4UA6A 1K38A 2WUQA 2H0TA 1ZG4A 2WAFA 1FSWA 2HDRA 2QMIA 3HBRA 5F1GA 2HDQA 1PIOA 5FAQA 4MBHA 1H8ZA 2Z2LB 4GZBA 1O07A 4OPRA 5TR7A 4PM5A 4HEFA 3OPHA 4OPQA 4RYEA 2A3UA 1FR1A 2PU4A 4WMCA 5CGXA 2ZC4B 1KE3A 3WS0A 3G2YA 3TSGA 3WRTA 3IXBA 3G34A 4X55A 4KZ5A 1RGZA 4KZ6A 5DVAA 3SH7A 4EWFA 1EI5A 4OH0A 5M1AA 4C3QA 4JXSA 3E2KA 3SS3A 3BFCA 3Q7ZA 1BUEA 2Y55A 4KZBA 3PBNA 5FA7A 1K6SA 2C5WB 2XD5A 1SCWA 4EUZA 3PBQA 3SH9A 5AQ9A 4F94A 4S2JA 1YLWA 3OPLA 5CXWA 3CMZA 3BFDA 3CJMA 5CERA 1H8YA 3MZDA 3HUNA 5F1FA 2JBFA 2Y2QA 3IH9A 3OCNA 5I94A 1E4DA 3NDEA 3VMAA 4Y0OA 4N1XA 4EBLA 1BSGA 5GHYA 1QMEA 4DE2A 3NY4A 5CHMA 4P87A 3HLBA 4WZ4A 3IF6B 3WS4A 4DF6A 3UN7A 3VP4A 1S6RA 1KGFA 3HLDA 4ZJ2A 1BULA 1LL5A 3BM6A 4WYYA 5CHUA 1VM1A 2H0YA 1XX2A 3A3DA 4JPMA 4E6XA 4U0XA 1ES5A 3HLGA 3JYIA 3P09A 4GKUA 4OPZA 5AQAA 1MY8A 2DNSA 2ZQDA 3ZG8B 4DXCA 1FR6A 2ZMAA 4LENA 2J8YA 4EBPA 4UHUA 2WK0A 3VP1A 1GHIA 3UE1A 1K57C 5KZHA 3BYDA 3N8LA 4OP5A 4R23A 3S1YA 3VFFA 1JTGA 2XD1A 5FASA 2ZM0A 3HLCA 1LI0A 4BENA 1ESUA 4JKTA 1NXYA 1L0GA 1ES3A 3Q81A 2XLNA 1K56A 1YLZA 4RX2A 4DRTA 1L0DA 2Y2NA 3NDGA 4IBRA 2BLSA 4UA7A 1LI9A 3NIAA 3GMWA 2XFSA 1JTDA 1GA9A 4R3BA 1PZPA 4LV3A 5DF8A 4N1HA 2Y2PA 1PW1A 5M18A 3HLEA 2WAEA 2R9WA 1XGIA 2WZXA 3S22A 1CEFA 1XGJA 4Z9QA 4X68A 3VOZA 3FZCA 1HVBA 1MPLA 4A5RA 2PU2A 3WRZA 1NZOA 2EX2A 3DW0A 5U47A 5HAIA 4KQOA 3MXRA 1ERQA 4X56A 3PBSA 5CTMA 1MXOA 3G31A 2H5SA 4WM9A 3BFEA 5FQMA 5GLBA 4DDYA 5BOHA 3G2ZA 4S2KA 3BRMA 3RXXA 3HLFA 4EQIA 1GCEA 5FI6A 2IWBA 4C6YA 4O7DA 3ZFZA 4DE0A 4NK3A 3N8RA 2IWDA 1ONHA 4QB8A 3QNCA 3P98A 3VP3A 4EV4A 3UO9A 3MXSA 1I2SA 5AQ7A 3WS5A 4ZTKA 2XDMA 4S2PA 4FD8A 4BLMA 2V1ZA 4LV0A 3GTCA 3ZG9B 3GVBA 5HAPA 1SDNA 4LV2A 3UDIA 5FATA 1PZOA 3Q07A 1KGEA 1Y54A 3ZNYA 4E3OA 3VSKA 3GRJA 1EWZA 1ZKJA 3G4PA 5FI7A 5KMWA 2ZC7A 4JBFA 3BFGA 5GHXA 2EFXA 2ZJ9A 3DTMA 3E2LA 1BLHA 1YLPA 3NC8A 1BZAA 1Z6FA 1IYPA 1NYMA 2HP5A 4HBUA 4P0MA 4MNRA 4ZBEA 2V2FF 2RCXA 1OMEA 1ONGA 4ID4A 3O3VA 3W4PA 3AGFA 4KZAA 3FYZA 3HUOA 4OONA 4WEKA 4JXWA 2Y2HA 3M6HA 3VSLA 4PM9A 3O86A 4HESA 4L0LA 5JYOA 1HTZA 1KE0A 3HUMA 1BLSA 1IYOA 1NY0A 4QD4A 3WS2A 1G68A 1BT5A 3LY4A 3DWKA 1ALQA 4B4XA 2GDNA 2P9VA 2J9OA 3Q82A 5EOOA 4BJPA 4N9LA 5IHVA 5J8XA 1KGGA 3V39A 3ZG5A 5HARA 1KE4A 3PAGA 2WZZA 5E2GA 3IF6C 4OPYA 1NRFA 3ZGAB 3CZDA 4LCLA 4WZ5C 1SHVA 1K54C 3GSGA 3UY6A 3NBLA 3HLWA 2Y2GA 4PMAA 5EE8A 2Y2IA 3ZVTA 1JWZA 5EVIB 4P85A 4IVIA 4GD8A 5GLAA 4QU3A 2EX8A 2ZQCA 4KZ8A 3ZG0A 5HL1A 1MWUA 3C7VA 4XXRA 2Q9MA 3ZHHA 3UPPA 3IXGA 1E3UD 3A3FA 5A90A 3IXHA 5HAQA 1W7FA 2VGJA 4KENB 5E2HA 4Q8IA 1K57A 3Q7VB 5M19A 1XA7A 4DE1A 3GQZA 5DTTA 4E6WA 4RVAA 1PW8A 5EOEA 2Y91A 3PBOA 2OLUA 2Y2JA 3FV7A 2EXBA 3C5AA 4H8RA 1ESIA 3MKEA 4R0QA 4Y0TA 5EVID 2Y2KA 2X02A 3LCEA 3BFFA 2WADA 4IBXA 2WGWA 1IYSA 4WEJA 3W4OA 3ZVWA 2XFTA 5KSHA 1I5QA 1MWTA 4KG6A 5A91A 2WGIA 5E43A 1FCNA 1DJBA 1PI5A 2ZQAA 3NI9A 5FQIA 4OQIA 1J9MA 1HD8A 4MBKA 1LHYA 4Y0UA 2FFFB 3A3JA 2OV5A 5FQ9A 1AXBA 3O88A 4BQMA 5CEDA 2QZ6A 2XR0A 3UPNA 2ZC3B 2WKEA 2JCHA 2HDUA 5HW3A 1XA1A 3LO7A 1K4FA 1BTLA 1YLYA 4IEDA 3ISGA 2XK1A 5E2EA 3OCLA 1H5XA 3SOIA 3IF5A 4LCMA 4WMCD 1YQSA 4BL2A 1K55C 2C6WB 1Q2PA 1I2WA 3ITAA 3MKFA 2CC1A 5CECA 4QY5A 3ZNTA 1LLBA 3MFDA 5DTSA 1FCOA 1FSYA 3N6IA 2IWCA 5FAPA 3A3EA 1W8QA 2DRWA 3VFHA 4R3JA 5JYPA 4JXVA 2XH9A 3IHBA 4S2NC 5HFOA 1CI9A 4PPRA 1JWVA 2ZM2A 4X6TA 2PBYA 1MKIA 1U60A 3N7WA 5CGSA 4KG5A 1ZC2A 1DJAA 4D2OA 1SDEA 4MBFA 1ES4A 1CEGA 3IWQA 5AQBA 5E2FA 2ZD8A 5F82A 4B4ZA 3M6BA 2HDSA 3NCKA 1KVLA 2Y4AA 2WGWB 1CI8A 2XEPA 2ZQ9A 2I72A 4K91A 1TEMA 3EQVA 4DKIA 1FCMA 2ZC6B 1XKZA 3HVFA 4R4SA 4QJGA 1PWCA 3SH8A 2HPBA 4K0WA 1YT4A 4E3JA 1M6KA 3BLMA 3M2KA 3SS5A 5CEBA 1IELA 4E3LA 5FSRA 4BD1A 4GDNA 3G32A 2QPNA 5FQJA 4FH2A 4B88A 2JC7A 3VP2A 4BL3A 5GHZA 1WYBA 3MZEA 2J9PA 2WGVA 2XF3A 1NYYA 3C4PA 1CK3A 5TGFA 3AGDA 3B3XA 3IHAA 1DY6A 2ZQ8A 4JF5A 3TG9A 4CPKA 4QY6A 1K25A 3N4IA 3WS1A 3OPPA 3PBTA 4NETA 3VOYA 4U0TA 2X01A 4OKPA 1K54A 4FSFA 2V20A 1TDGA 5EVIC 4X53A 3TOIA 2ZM8A 1K56D 1HZOA 4OLDA 3IWOA 1W5DA 3SS4A 5D3OA 2Y2MA 1W8YA 4OP8A 1YMSA 1N4OA 4DXBA 3V3RA 1IKIA 4PM7A 1NJ4A 1GHPA 3C7UA 3QNBA 3HREA 3V50A 5EUAA 2G2WA 5DTKA 3PTEA 1GHMA 3FKVA 4R1GA 5KSCA 4WBGA 3V5MA 1IYQA 5CTNA 1PWDA 3Q1FA 4K0XA 3VP0A 1PI4A 1IEMA 4EBNA 4S2IA 3UDXA 4GD6A 4U3TA 3UNWA 5FAOA 3GR2A 3G30A 3ZCZA 3OC2A 1XXMA 3C4OA 5GLDA 3AGEA 4BD0A 3IT9A 1BLPA 1XPBA 5A93A 1L0EA 4OLGA 3RXWA 2BG1A 4KZ3A 1YLTA 1FOFA 1KDWA 1LL9A 1JVJA 2JE5A 2Y59A 4RA7A 3ZDJA 2OSUA 4UA9A 1JWPA 1YMXA 2UWXA 1S0WA 4C75A 1RP5A 4MLLA 1SKFA 4XUXA 2Z2MB 1C3BA 3IXDA 4RX3A 4JF6A 1G6AA 2WKHA 4DE3A 4KZ9A 4FCFA 2WYXA 5FI2A 1Q2QA 3DWZA 3M2JA 4QHCA 1YLJA 5CHJA 3BLSA 3OPRA 2Y2OA 4FH4A 3OZHA 2HP6A 4S2OA 3MBZA 4YINA 5A92A 2XQZA 3GV9A 2EXAA 2J7VA 2P9VB 4JXGA 5TFQA 1KVMA 3EQUA 1O7EA 1L2SA 2R9XA 4GOGA 3HL9A 1K55A 4JF4A 1ZG6A 2Q9NA 5CGWA 3G35A 4OQGA 1NZUA 3S4XA 1MWRA 3IWIA 4P6BA 5GL9A 3D4FA 3FKWA 4PM6A 4YFMA 4JLFA 4KZ4A 3W4QA 5EPHA 4S2NA 2EX9A 1W79A 4E3MA 4HBTA 4KZ7A 4OOYA 4ZAMA 4PM8A 2B5RA 5FQQA 4E3NA 4LV1A 3UPOA 3UE0A 4KQQA 5FQKA 3CG5A 3A3IA 1QMFA 3UE3A 1BLCA 4ZDXA 1DJCA 2RL3A 5HX9A 2Y2LA 3QHYA 1WE4A 3MZFA 2ZC5B 1YM1A 3UDFA 1ERMA 2X71A 1TDLA 2EX6A 1RGYA 5G18A 3V3SA 4E3IA 4KG2A 1K4EA 5EVLA 2DCFA 4ZJ1A 4KQRA 3N8SA 4CJNA 4OQ0A 3LEZA 3IQAA 5CRFA 3ITBA 1MBLA 1TVFA 1PYYA 3LY3A 1VQQA 2FFYA 4IVKA 4Y7PA 4OVDA 4S2MA 2A49A 3O87A 1E3UA 4R4RA 4MEZA 2XGNA 4GB7A 3RJUA 1L0FA 4M3KA 1RCJA 4OQHA 5GLCA 1K6RA 1PWGA 2WKIA 2EFUA 3BECA 5FDHA 4DDSA 4XUZA 3IH8A 2OLVA 4N9KA 5EECA 3W8KA 1N9BA 5EVIA 4S2LA 2HP9A 5F83A 5DF9A 1ES2A 4WELA 1EROA 3PAEA 4X69A 4ZJ3A 2ZQ7A 1WYCA 4OOMA 2P74A 3FWLA 1IKGA 2E8IA 4N92A 3ZG7B 4UAAA 3WWXA 3I7JA 5DF7A 2H10A 2ZLYA 1XP4A 3IF6A 4OOLA 1M40A 1MWSA 2VGKA 4GNUA 1FQGA 5L2FA 1KDSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GA0 A;  3PBR A;  4WZ5 A;  2G2U A;  4E3K A;  3Q7V A;  4GDB A;  4GN2 A;  1E25 A;  3BEB A;  4UA6 A;  1K38 A;  2WUQ A;  2H0T A;  1ZG4 A;  2WAF A;  1FSW A;  2HDR A;  2QMI A;  3HBR A;  5F1G A;  2HDQ A;  1PIO A;  5FAQ A;  4MBH A;  1H8Z A;  2Z2L B;  4GZB A;  1O07 A;  4OPR A;  5TR7 A;  4PM5 A;  4HEF A;  3OPH A;  4OPQ A;  4RYE A;  2A3U A;  1FR1 A;  2PU4 A;  4WMC A;  5CGX A;  2ZC4 B;  1KE3 A;  3WS0 A;  3G2Y A;  3TSG A;  3WRT A;  3IXB A;  3G34 A;  4X55 A;  4KZ5 A;  1RGZ A;  4KZ6 A;  5DVA A;  3SH7 A;  4EWF A;  1EI5 A;  4OH0 A;  5M1A A;  4C3Q A;  4JXS A;  3E2K A;  3SS3 A;  3BFC A;  3Q7Z A;  1BUE A;  2Y55 A;  4KZB A;  3PBN A;  5FA7 A;  1K6S A;  2C5W B;  2XD5 A;  1SCW A;  4EUZ A;  3PBQ A;  3SH9 A;  5AQ9 A;  4F94 A;  4S2J A;  1YLW A;  3OPL A;  5CXW A;  3CMZ A;  3BFD A;  3CJM A;  5CER A;  1H8Y A;  3MZD A;  3HUN A;  5F1F A;  2JBF A;  2Y2Q A;  3IH9 A;  3OCN A;  5I94 A;  1E4D A;  3NDE A;  3VMA A;  4Y0O A;  4N1X A;  4EBL A;  1BSG A;  5GHY A;  1QME A;  4DE2 A;  3NY4 A;  5CHM A;  4P87 A;  3HLB A;  4WZ4 A;  3IF6 B;  3WS4 A;  4DF6 A;  3UN7 A;  3VP4 A;  1S6R A;  1KGF A;  3HLD A;  4ZJ2 A;  1BUL A;  1LL5 A;  3BM6 A;  4WYY A;  5CHU A;  1VM1 A;  2H0Y A;  1XX2 A;  3A3D A;  4JPM A;  4E6X A;  4U0X A;  1ES5 A;  3HLG A;  3JYI A;  3P09 A;  4GKU A;  4OPZ A;  5AQA A;  1MY8 A;  2DNS A;  2ZQD A;  3ZG8 B;  4DXC A;  1FR6 A;  2ZMA A;  4LEN A;  2J8Y A;  4EBP A;  4UHU A;  2WK0 A;  3VP1 A;  1GHI A;  3UE1 A;  1K57 C;  5KZH A;  3BYD A;  3N8L A;  4OP5 A;  4R23 A;  3S1Y A;  3VFF A;  1JTG A;  2XD1 A;  5FAS A;  2ZM0 A;  3HLC A;  1LI0 A;  4BEN A;  1ESU A;  4JKT A;  1NXY A;  1L0G A;  1ES3 A;  3Q81 A;  2XLN A;  1K56 A;  1YLZ A;  4RX2 A;  4DRT A;  1L0D A;  2Y2N A;  3NDG A;  4IBR A;  2BLS A;  4UA7 A;  1LI9 A;  3NIA A;  3GMW A;  2XFS A;  1JTD A;  1GA9 A;  4R3B A;  1PZP A;  4LV3 A;  5DF8 A;  4N1H A;  2Y2P A;  1PW1 A;  5M18 A;  3HLE A;  2WAE A;  2R9W A;  1XGI A;  2WZX A;  3S22 A;  1CEF A;  1XGJ A;  4Z9Q A;  4X68 A;  3VOZ A;  3FZC A;  1HVB A;  1MPL A;  4A5R A;  2PU2 A;  3WRZ A;  1NZO A;  2EX2 A;  3DW0 A;  5U47 A;  5HAI A;  4KQO A;  3MXR A;  1ERQ A;  4X56 A;  3PBS A;  5CTM A;  1MXO A;  3G31 A;  2H5S A;  4WM9 A;  3BFE A;  5FQM A;  5GLB A;  4DDY A;  5BOH A;  3G2Z A;  4S2K A;  3BRM A;  3RXX A;  3HLF A;  4EQI A;  1GCE A;  5FI6 A;  2IWB A;  4C6Y A;  4O7D A;  3ZFZ A;  4DE0 A;  4NK3 A;  3N8R A;  2IWD A;  1ONH A;  4QB8 A;  3QNC A;  3P98 A;  3VP3 A;  4EV4 A;  3UO9 A;  3MXS A;  1I2S A;  5AQ7 A;  3WS5 A;  4ZTK A;  2XDM A;  4S2P A;  4FD8 A;  4BLM A;  2V1Z A;  4LV0 A;  3GTC A;  3ZG9 B;  3GVB A;  5HAP A;  1SDN A;  4LV2 A;  3UDI A;  5FAT A;  1PZO A;  3Q07 A;  1KGE A;  1Y54 A;  3ZNY A;  4E3O A;  3VSK A;  3GRJ A;  1EWZ A;  1ZKJ A;  3G4P A;  5FI7 A;  5KMW A;  2ZC7 A;  4JBF A;  3BFG A;  5GHX A;  2EFX A;  2ZJ9 A;  3DTM A;  3E2L A;  1BLH A;  1YLP A;  3NC8 A;  1BZA A;  1Z6F A;  1IYP A;  1NYM A;  2HP5 A;  4HBU A;  4P0M A;  4MNR A;  4ZBE A;  2V2F F;  2RCX A;  1OME A;  1ONG A;  4ID4 A;  3O3V A;  3W4P A;  3AGF A;  4KZA A;  3FYZ A;  3HUO A;  4OON A;  4WEK A;  4JXW A;  2Y2H A;  3M6H A;  3VSL A;  4PM9 A;  3O86 A;  4HES A;  4L0L A;  5JYO A;  1HTZ A;  1KE0 A;  3HUM A;  1BLS A;  1IYO A;  1NY0 A;  4QD4 A;  3WS2 A;  1G68 A;  1BT5 A;  3LY4 A;  3DWK A;  1ALQ A;  4B4X A;  2GDN A;  2P9V A;  2J9O A;  3Q82 A;  5EOO A;  4BJP A;  4N9L A;  5IHV A;  5J8X A;  1KGG A;  3V39 A;  3ZG5 A;  5HAR A;  1KE4 A;  3PAG A;  2WZZ A;  5E2G A;  3IF6 C;  4OPY A;  1NRF A;  3ZGA B;  3CZD A;  4LCL A;  4WZ5 C;  1SHV A;  1K54 C;  3GSG A;  3UY6 A;  3NBL A;  3HLW A;  2Y2G A;  4PMA A;  5EE8 A;  2Y2I A;  3ZVT A;  1JWZ A;  5EVI B;  4P85 A;  4IVI A;  4GD8 A;  5GLA A;  4QU3 A;  2EX8 A;  2ZQC A;  4KZ8 A;  3ZG0 A;  5HL1 A;  1MWU A;  3C7V A;  4XXR A;  2Q9M A;  3ZHH A;  3UPP A;  3IXG A;  1E3U D;  3A3F A;  5A90 A;  3IXH A;  5HAQ A;  1W7F A;  2VGJ A;  4KEN B;  5E2H A;  4Q8I A;  1K57 A;  3Q7V B;  5M19 A;  1XA7 A;  4DE1 A;  3GQZ A;  5DTT A;  4E6W A;  4RVA A;  1PW8 A;  5EOE A;  2Y91 A;  3PBO A;  2OLU A;  2Y2J A;  3FV7 A;  2EXB A;  3C5A A;  4H8R A;  1ESI A;  3MKE A;  4R0Q A;  4Y0T A;  5EVI D;  2Y2K A;  2X02 A;  3LCE A;  3BFF A;  2WAD A;  4IBX A;  2WGW A;  1IYS A;  4WEJ A;  3W4O A;  3ZVW A;  2XFT A;  5KSH A;  1I5Q A;  1MWT A;  4KG6 A;  5A91 A;  2WGI A;  5E43 A;  1FCN A;  1DJB A;  1PI5 A;  2ZQA A;  3NI9 A;  5FQI A;  4OQI A;  1J9M A;  1HD8 A;  4MBK A;  1LHY A;  4Y0U A;  2FFF B;  3A3J A;  2OV5 A;  5FQ9 A;  1AXB A;  3O88 A;  4BQM A;  5CED A;  2QZ6 A;  2XR0 A;  3UPN A;  2ZC3 B;  2WKE A;  2JCH A;  2HDU A;  5HW3 A;  1XA1 A;  3LO7 A;  1K4F A;  1BTL A;  1YLY A;  4IED A;  3ISG A;  2XK1 A;  5E2E A;  3OCL A;  1H5X A;  3SOI A;  3IF5 A;  4LCM A;  4WMC D;  1YQS A;  4BL2 A;  1K55 C;  2C6W B;  1Q2P A;  1I2W A;  3ITA A;  3MKF A;  2CC1 A;  5CEC A;  4QY5 A;  3ZNT A;  1LLB A;  3MFD A;  5DTS A;  1FCO A;  1FSY A;  3N6I A;  2IWC A;  5FAP A;  3A3E A;  1W8Q A;  2DRW A;  3VFH A;  4R3J A;  5JYP A;  4JXV A;  2XH9 A;  3IHB A;  4S2N C;  5HFO A;  1CI9 A;  4PPR A;  1JWV A;  2ZM2 A;  4X6T A;  2PBY A;  1MKI A;  1U60 A;  3N7W A;  5CGS A;  4KG5 A;  1ZC2 A;  1DJA A;  4D2O A;  1SDE A;  4MBF A;  1ES4 A;  1CEG A;  3IWQ A;  5AQB A;  5E2F A;  2ZD8 A;  5F82 A;  4B4Z A;  3M6B A;  2HDS A;  3NCK A;  1KVL A;  2Y4A A;  2WGW B;  1CI8 A;  2XEP A;  2ZQ9 A;  2I72 A;  4K91 A;  1TEM A;  3EQV A;  4DKI A;  1FCM A;  2ZC6 B;  1XKZ A;  3HVF A;  4R4S A;  4QJG A;  1PWC A;  3SH8 A;  2HPB A;  4K0W A;  1YT4 A;  4E3J A;  1M6K A;  3BLM A;  3M2K A;  3SS5 A;  5CEB A;  1IEL A;  4E3L A;  5FSR A;  4BD1 A;  4GDN A;  3G32 A;  2QPN A;  5FQJ A;  4FH2 A;  4B88 A;  2JC7 A;  3VP2 A;  4BL3 A;  5GHZ A;  1WYB A;  3MZE A;  2J9P A;  2WGV A;  2XF3 A;  1NYY A;  3C4P A;  1CK3 A;  5TGF A;  3AGD A;  3B3X A;  3IHA A;  1DY6 A;  2ZQ8 A;  4JF5 A;  3TG9 A;  4CPK A;  4QY6 A;  1K25 A;  3N4I A;  3WS1 A;  3OPP A;  3PBT A;  4NET A;  3VOY A;  4U0T A;  2X01 A;  4OKP A;  1K54 A;  4FSF A;  2V20 A;  1TDG A;  5EVI C;  4X53 A;  3TOI A;  2ZM8 A;  1K56 D;  1HZO A;  4OLD A;  3IWO A;  1W5D A;  3SS4 A;  5D3O A;  2Y2M A;  1W8Y A;  4OP8 A;  1YMS A;  1N4O A;  4DXB A;  3V3R A;  1IKI A;  4PM7 A;  1NJ4 A;  1GHP A;  3C7U A;  3QNB A;  3HRE A;  3V50 A;  5EUA A;  2G2W A;  5DTK A;  3PTE A;  1GHM A;  3FKV A;  4R1G A;  5KSC A;  4WBG A;  3V5M A;  1IYQ A;  5CTN A;  1PWD A;  3Q1F A;  4K0X A;  3VP0 A;  1PI4 A;  1IEM A;  4EBN A;  4S2I A;  3UDX A;  4GD6 A;  4U3T A;  3UNW A;  5FAO A;  3GR2 A;  3G30 A;  3ZCZ A;  3OC2 A;  1XXM A;  3C4O A;  5GLD A;  3AGE A;  4BD0 A;  3IT9 A;  1BLP A;  1XPB A;  5A93 A;  1L0E A;  4OLG A;  3RXW A;  2BG1 A;  4KZ3 A;  1YLT A;  1FOF A;  1KDW A;  1LL9 A;  1JVJ A;  2JE5 A;  2Y59 A;  4RA7 A;  3ZDJ A;  2OSU A;  4UA9 A;  1JWP A;  1YMX A;  2UWX A;  1S0W A;  4C75 A;  1RP5 A;  4MLL A;  1SKF A;  4XUX A;  2Z2M B;  1C3B A;  3IXD A;  4RX3 A;  4JF6 A;  1G6A A;  2WKH A;  4DE3 A;  4KZ9 A;  4FCF A;  2WYX A;  5FI2 A;  1Q2Q A;  3DWZ A;  3M2J A;  4QHC A;  1YLJ A;  5CHJ A;  3BLS A;  3OPR A;  2Y2O A;  4FH4 A;  3OZH A;  2HP6 A;  4S2O A;  3MBZ A;  4YIN A;  5A92 A;  2XQZ A;  3GV9 A;  2EXA A;  2J7V A;  2P9V B;  4JXG A;  5TFQ A;  1KVM A;  3EQU A;  1O7E A;  1L2S A;  2R9X A;  4GOG A;  3HL9 A;  1K55 A;  4JF4 A;  1ZG6 A;  2Q9N A;  5CGW A;  3G35 A;  4OQG A;  1NZU A;  3S4X A;  1MWR A;  3IWI A;  4P6B A;  5GL9 A;  3D4F A;  3FKW A;  4PM6 A;  4YFM A;  4JLF A;  4KZ4 A;  3W4Q A;  5EPH A;  4S2N A;  2EX9 A;  1W79 A;  4E3M A;  4HBT A;  4KZ7 A;  4OOY A;  4ZAM A;  4PM8 A;  2B5R A;  5FQQ A;  4E3N A;  4LV1 A;  3UPO A;  3UE0 A;  4KQQ A;  5FQK A;  3CG5 A;  3A3I A;  1QMF A;  3UE3 A;  1BLC A;  4ZDX A;  1DJC A;  2RL3 A;  5HX9 A;  2Y2L A;  3QHY A;  1WE4 A;  3MZF A;  2ZC5 B;  1YM1 A;  3UDF A;  1ERM A;  2X71 A;  1TDL A;  2EX6 A;  1RGY A;  5G18 A;  3V3S A;  4E3I A;  4KG2 A;  1K4E A;  5EVL A;  2DCF A;  4ZJ1 A;  4KQR A;  3N8S A;  4CJN A;  4OQ0 A;  3LEZ A;  3IQA A;  5CRF A;  3ITB A;  1MBL A;  1TVF A;  1PYY A;  3LY3 A;  1VQQ A;  2FFY A;  4IVK A;  4Y7P A;  4OVD A;  4S2M A;  2A49 A;  3O87 A;  1E3U A;  4R4R A;  4MEZ A;  2XGN A;  4GB7 A;  3RJU A;  1L0F A;  4M3K A;  1RCJ A;  4OQH A;  5GLC A;  1K6R A;  1PWG A;  2WKI A;  2EFU A;  3BEC A;  5FDH A;  4DDS A;  4XUZ A;  3IH8 A;  2OLV A;  4N9K A;  5EEC A;  3W8K A;  1N9B A;  5EVI A;  4S2L A;  2HP9 A;  5F83 A;  5DF9 A;  1ES2 A;  4WEL A;  1ERO A;  3PAE A;  4X69 A;  4ZJ3 A;  2ZQ7 A;  1WYC A;  4OOM A;  2P74 A;  3FWL A;  1IKG A;  2E8I A;  4N92 A;  3ZG7 B;  4UAA A;  3WWX A;  3I7J A;  5DF7 A;  2H10 A;  2ZLY A;  1XP4 A;  3IF6 A;  4OOL A;  1M40 A;  1MWS A;  2VGK A;  4GNU A;  1FQG A;  5L2F A;  1KDS A; 
#chains in the Genus database with same CATH topology
 4WZ5 A;  3LIC A;  2W1R A;  3BEB A;  2O9C A;  3CAX A;  1FSW A;  2K2N A;  3BY8 A;  5TR7 A;  1TS0 A;  3RTY A;  1FR1 A;  1KE3 A;  3IS2 B;  4P6Z M;  3TSG A;  3IXB A;  4Y5F A;  3CPT B;  3BFC A;  1YSQ A;  2L1M A;  2OWJ A;  4I3J A;  2C5W B;  4JGR A;  3SZT A;  2JKT I;  1SCW A;  2H28 A;  3EEA A;  5AQ9 A;  4F94 A;  4S2J A;  1OJG A;  3CMZ A;  5EFW A;  1AWI A;  4YNR A;  2VV7 A;  2JBF A;  5I94 A;  4Y0O A;  5J3W A;  4B93 A;  4P87 A;  3UN7 A;  3VP4 A;  2WKQ A;  1S6R A;  4D60 A;  3CLO A;  1XJ4 A;  3BM6 A;  4OPZ A;  3ZG8 B;  3P01 A;  4EES A;  2V0W A;  2J8Y A;  2WK0 A;  1K57 C;  1OTE A;  4EET B;  1JTG A;  3CUE A;  4GW9 A;  1LI0 A;  3T1R A;  4BEN A;  4R70 A;  4YOF A;  4JKT A;  1NXY A;  1L0G A;  3LID A;  4RX2 A;  1L0D A;  2Y2N A;  2P08 A;  3NDG A;  4Z1W A;  1GA9 A;  5DF8 A;  4LV3 A;  1PW1 A;  4Z9Q A;  3VOZ A;  1HVB A;  4I39 A;  2PYR A;  4X56 A;  2NUP C;  2H5S A;  3BFE A;  5FQM A;  2D02 A;  1STZ A;  4C6Y A;  5HPF A;  4XT2 B;  1S67 L;  1TS7 A;  1K0K A;  2L0W A;  1WA9 A;  3UO9 A;  1CJF A;  4ZTK A;  1CF0 A;  4BLM A;  1X0O A;  3GTC A;  3GVB A;  4LV2 A;  4F3L B;  1Y54 A;  3GRJ A;  5FI7 A;  4JBF A;  3BFG A;  5GHX A;  2EFX A;  3ZYT A;  1OME A;  1ONG A;  1N9L A;  3AGF A;  3FYZ A;  4WEK A;  3C8C A;  2VEA A;  3O86 A;  4HES A;  5JYO A;  3E98 A;  5L09 A;  3EGD C;  4N9L A;  5IHV A;  5J8X A;  1D1J A;  2G7U A;  3V39 A;  3LUQ A;  4Y17 A;  2FH5 A;  5E2G A;  3KSI A;  4OPY A;  1NRF A;  2QJ7 A;  1LSW A;  1SHV A;  3UY6 A;  5AJG A;  2Y2G A;  2Y2I A;  4K08 A;  4P85 A;  5GLA A;  3BJN A;  2P04 A;  2EX8 A;  3O5Y A;  3ZG0 A;  3UPP A;  4CLC E;  3A3F A;  5A90 A;  3IXH A;  4MMN A;  3BWL A;  4Q8I A;  1K57 A;  1N9N A;  5M19 A;  1XA7 A;  4EW7 A;  2GX5 A;  1H8M A;  4RVA A;  5AVF A;  2B02 A;  3FV7 A;  3LIA A;  3C5A A;  4Y13 A;  1ESI A;  4Y0T A;  2OAQ 1;  4DMZ A;  2WAD A;  4WEJ A;  3ZVW A;  2XFT A;  5KSH A;  1MWT A;  4X1M A;  1DJB A;  1PI5 A;  2PAV P;  4OQI A;  2FFF B;  2AVX A;  5FQ9 A;  1AXB A;  1YPR A;  1T1B A;  3L7H A;  3UPN A;  5DKK A;  2JCH A;  3E4O A;  4IED A;  4PAU A;  3MMH A;  5LBR A;  3OCL A;  4AFI A;  4LCM A;  5HPI A;  2PHY A;  3FC7 A;  1LLB A;  3EGX C;  3N6I A;  3UB9 A;  3A3E A;  3HJK A;  3D3O A;  3D9Y A;  4R3J A;  3VFH A;  3LI8 A;  4S2N C;  3H9W A;  4PPR A;  3N7W A;  1MKI A;  5CGS A;  3K3C A;  1ZC2 A;  4LRZ E;  4D2O A;  4G3K A;  2O9B A;  2VGL M;  3LR0 A;  4B4Z A;  3S7Q A;  1NLZ A;  4K91 A;  2I72 A;  3LIE A;  1S1Y A;  1ZHH B;  3HVF A;  3BQA A;  3SH8 A;  2HPB A;  3MQQ A;  1YT4 A;  2DMW A;  4K0W A;  1M6K A;  3BLM A;  5CEB A;  5FQJ A;  3CIT A;  4FH2 A;  4IUH A;  1N9O A;  3VE4 A;  5GHZ A;  3MZE A;  3AGD A;  3B3X A;  3IHA A;  2Y79 A;  3TG9 A;  2W1T A;  3KX0 X;  1K25 A;  3VOY A;  2X01 A;  4OKP A;  5EVI C;  4KUK A;  1N4O A;  4PM7 A;  3FG8 A;  2G2W A;  2R78 A;  2PBD P;  5KSC A;  4Q0I A;  5G4Z A;  3Q1F A;  4S2I A;  3F1O A;  5FAO A;  3G30 A;  3OC2 A;  3C4O A;  4BD0 A;  1BLP A;  1XPB A;  5A93 A;  1L0E A;  3RXW A;  1YLT A;  1FOF A;  2JE5 A;  2Y59 A;  4X1L A;  1YMX A;  1RP5 A;  4MLL A;  4XUX A;  2O99 A;  4B9O A;  3A0S A;  3IBR A;  3T1Q B;  5FI2 A;  5HWW A;  1Q2Q A;  1IOU A;  4HOI A;  4FOF A;  3OZH A;  2HP6 A;  1LSV A;  4YIN A;  2J3T D;  2J7V A;  4JXG A;  3MJQ A;  4L9G A;  4JF4 A;  1NRJ A;  1ZG6 A;  1PNE A;  4OQG A;  5I5L A;  1MWR A;  2W3H A;  3D4F A;  3FKW A;  4JLF A;  5EPH A;  4S2N A;  4OOY A;  5FQQ A;  4ZAM A;  4PM8 A;  5HDC A;  1PRQ A;  3UE3 A;  3H7W A;  2VGL S;  3C38 A;  5C5K A;  3BY9 A;  3UDF A;  1TDL A;  2OWH A;  2EX6 A;  3V3S A;  4KG2 A;  5FDS A;  4YWZ A;  3N8S A;  1MZU A;  3B47 A;  3LEZ A;  3IQA A;  2VV8 A;  1PYY A;  4I5S A;  1ACF A;  4S2M A;  3QP6 A;  1E3U A;  4HNB A;  5EM0 A;  3ICY A;  1PWG A;  2L4R A;  5FDH A;  1IFQ A;  1NWZ A;  4NEE D;  2VA0 A;  3IH8 A;  3W8K A;  5EVI A;  2HP9 A;  3K3D A;  1ERO A;  4ZJ3 A;  1WYC A;  2KDK A;  2P74 A;  3ZG7 B;  3WWX A;  3I7J A;  1M40 A;  3H82 B;  2JN7 A;  1FQG A;  1KDS A;  1GA0 A;  3PBR A;  1ZTU A;  2G2U A;  3UME A;  4GDB A;  4HI4 A;  1K38 A;  2H0T A;  2QMI A;  3TRC A;  1PIO A;  4MBH A;  4GZB A;  2Z2L B;  4OPQ A;  4WMC A;  2PU4 A;  5CGX A;  2ZC4 B;  3G2Y A;  2QJ5 A;  5M1A A;  1KOU A;  2Y55 A;  4KZB A;  2PYP A;  4EXO A;  3PBN A;  4ETX A;  2XD5 A;  1ODV A;  3T1X A;  4EUZ A;  3PBQ A;  3MXQ A;  2A2L A;  1YLW A;  3LIF A;  3OPL A;  5CXW A;  2IA2 A;  3BFD A;  1H8Y A;  3MZD A;  2HF6 A;  4MN5 A;  2Y2Q A;  3IH9 A;  1E4D A;  4EBL A;  3A0R A;  3DTK A;  4WLA A;  1OTI A;  3HLB A;  2W1T B;  4WZ4 A;  4DF6 A;  4HY8 A;  1BUL A;  1LL5 A;  3LEQ A;  4PHT A;  4WYY A;  4U0X A;  5AQA A;  3JYI A;  1Y28 A;  1MY8 A;  2J3W A;  4DXC A;  4UHU A;  1TF1 A;  3UE1 A;  2W0N A;  3OBF A;  5KZH A;  4OP5 A;  3N8L A;  3S1Y A;  3VFF A;  4E04 A;  2XD1 A;  5FAS A;  3HLC A;  1ESU A;  3Q81 A;  1K56 A;  3F1O B;  2BLS A;  4JGQ A;  2A24 A;  2XFS A;  1JTD A;  4R3B A;  4N1H A;  1S4R A;  2WAE A;  2WZX A;  1F2K A;  1CEF A;  1XGJ A;  3S22 A;  3UB5 P;  3WRZ A;  2EX2 A;  5HWT A;  3MXR A;  3QP5 A;  5CTM A;  5HSQ A;  4WM9 A;  5GLB A;  5BOH A;  3G2Z A;  3TW8 A;  1ONH A;  4EV4 A;  4GCZ A;  4S2P A;  4FD8 A;  2V1Z A;  4LV0 A;  2ZL1 A;  5HAP A;  1SDN A;  4E3O A;  3S7O A;  3T4J A;  5KMW A;  1Z09 A;  2OOL A;  3DTM A;  4PM5 A;  3H7W B;  3NC8 A;  4ME4 A;  1NYM A;  2HP5 A;  4P0M A;  3HJI A;  1UGU A;  2RCX A;  3L9K A;  2VK3 A;  4LPZ A;  3HUO A;  4OON A;  4PM9 A;  2CMN A;  4L0L A;  1KE0 A;  1D7E A;  3HUM A;  4QD4 A;  1IYO A;  1NY0 A;  3WS2 A;  3NEC A;  4B4X A;  2GDN A;  2J9O A;  4CLC C;  5HAR A;  1XFQ A;  3ZGA B;  3SW1 A;  4MDZ A;  2PR6 A;  1K54 C;  3EOI A;  4CQH A;  3LGO A;  5EVI B;  4IVI A;  2VKS A;  2ZQC A;  1MWU A;  2WKR A;  3C7V A;  4XXR A;  3IXG A;  1G5U A;  4KEN B;  2ACG A;  5TBM A;  4EEP A;  3ZQ5 A;  5DTT A;  4HP9 A;  2OLU A;  2EXB A;  2Y2K A;  2HZ5 A;  4IBX A;  1IYS A;  3UB7 A;  3BQ8 A;  2WGI A;  1H0M A;  1FCN A;  1HD8 A;  1LHY A;  2XRN A;  4Y0U A;  2OV5 A;  3O88 A;  2QZ6 A;  2HDU A;  5HW3 A;  4KUO A;  2XK1 A;  5E2E A;  1H5X A;  3SOI A;  3IF5 A;  1OTA A;  3NHQ A;  4BL2 A;  1K55 C;  2C6W B;  1Q2P A;  1I2W A;  3MKF A;  2VLG A;  4QY5 A;  4EUV A;  4MCW A;  3UB8 A;  4UEY A;  2DRW A;  5JYP A;  4IHQ A;  3T4K A;  4JXV A;  3IHB A;  5HFO A;  1CI9 A;  4X6T A;  2ZM2 A;  2EA9 A;  3T4T A;  4KG5 A;  2GJ3 A;  1SDE A;  1ES4 A;  5E2F A;  4O8G A;  1KVL A;  2Y4A A;  2WGW B;  2XEP A;  3MF0 A;  1TEM A;  1FIL A;  1FCM A;  1XKZ A;  1PWC A;  3SS5 A;  4E3L A;  5FSR A;  4BD1 A;  1VEU A;  2BTF P;  3G32 A;  1OTD A;  3VP2 A;  2A24 B;  1P9W A;  1WYB A;  2WGV A;  2XF3 A;  2Y8H A;  1A0K A;  4CLC A;  5F68 A;  4EU0 A;  3JVU A;  3OLO A;  1T1A A;  3R4K A;  3OPP A;  2NUT C;  4NET A;  1K54 A;  4X53 A;  4HP4 A;  3LR5 A;  5F6A A;  2Y2M A;  4OP8 A;  4DXB A;  1F9I A;  3P7N A;  4ESP A;  3HRE A;  2J3T C;  5EUA A;  3FKV A;  3KSH A;  4R1G A;  2YKF A;  4ETZ A;  4G3V A;  1IYQ A;  4K0X A;  2ZL1 B;  3VP0 A;  1PI4 A;  3UDX A;  1J3W A;  4GD6 A;  4I38 A;  5GLD A;  4OLG A;  3ZDJ A;  1JVJ A;  4UA9 A;  1S0W A;  2Z2M B;  1C3B A;  1G6A A;  4KQD A;  4I3A A;  4ZRR A;  4PKY A;  5J7E A;  3S7N A;  1XJ6 A;  5TJJ A;  5A92 A;  2XQZ A;  3GV9 A;  2EXA A;  3DBA A;  2R9X A;  4GOG A;  1K55 A;  3F1N A;  5FEF A;  3S4X A;  4NXG A;  2B18 A;  1LT0 A;  3W4Q A;  3CHW P;  4BWI A;  1FIK A;  4E3M A;  5IU1 A;  3T12 B;  3CWF A;  4KQQ A;  3H82 A;  5FQK A;  1QMF A;  2Y2L A;  1W63 M;  1S4S A;  5IT5 A;  5TBM B;  1RGY A;  1K4E A;  3T1S A;  2YKH A;  3K2N A;  3MQO A;  3ITB A;  1MBL A;  1TVF A;  4DJ2 A;  3LY3 A;  4IVK A;  2XA7 S;  2A49 A;  4R4R A;  3MSH A;  4PKY G;  2XGN A;  2I9V A;  4M3K A;  2Z6D A;  5G4Y A;  3KSG A;  2EFU A;  3BEC A;  5DJU A;  1NLY A;  4XUZ A;  1LSX A;  1ES2 A;  4X69 A;  4OOM A;  1IKG A;  2GZA A;  4UAA A;  1XJ2 A;  4HQA A;  2ZLY A;  3JPU A;  4OOL A;  3UMD A;  3WS0 A;  2PDR A;  3G6O A;  5L2F A;  4BMW A;  3FPW A;  2HDR A;  3HBR A;  3LFV A;  4OPR A;  1O07 A;  4HEF A;  3OPH A;  3WRT A;  3SH7 A;  4EWF A;  4OH0 A;  4C3Q A;  3E2K A;  3IX4 A;  1BYW A;  3VE3 A;  1BUE A;  1V9Z A;  3PYP A;  1OTB A;  1VEU B;  3CJM A;  5CER A;  1L3L A;  4NKP A;  5F1F A;  3NDE A;  4WUJ A;  3VMA A;  3JVV A;  1BSG A;  4CLC B;  5GHY A;  2W3E A;  5HD5 A;  4ZJ2 A;  3E0Y A;  1XFN A;  2PRF A;  4EQ1 A;  3T4O A;  5CHU A;  1VM1 A;  2H0Y A;  3A3D A;  1GSV A;  2HV1 A;  1ES5 A;  3UB6 A;  4GKU A;  2DNS A;  2ZMA A;  1S1Z A;  4NXF A;  1OT9 A;  1GHI A;  4LFU A;  3R7W A;  3BYD A;  3KYZ A;  5KIZ A;  1SKO B;  3MS6 A;  1ES3 A;  1OPX A;  2XLN A;  1YLZ A;  4IBR A;  4I3I A;  4L9F A;  3GMW A;  3T4L A;  1XGI A;  3S7P A;  3FZC A;  3V67 A;  4GLQ A;  5U47 A;  5HAI A;  4H6J B;  1ERQ A;  2K31 A;  3NOT C;  1MXO A;  3G31 A;  2ZMV A;  4S2K A;  3RXX A;  4EQI A;  5FI6 A;  2IWB A;  4O7D A;  2V8F A;  3ZFZ A;  3F1N B;  4DE0 A;  3N8R A;  2IWD A;  2KOI A;  3P98 A;  3VP3 A;  3NOU C;  3C2W A;  1YAX A;  5AQ7 A;  3D72 A;  4MN6 A;  3ZG9 B;  1YKD A;  5FAT A;  1KGE A;  1EWZ A;  1ZKJ A;  4BBV A;  2ZJ9 A;  3E2L A;  1YLP A;  1IYP A;  4MNR A;  2HGV A;  4ID4 A;  3KO6 A;  3W4P A;  4O0P A;  3QP1 A;  4JXW A;  1UWP X;  2Y2H A;  3M6H A;  1TD5 A;  1HTZ A;  2QWS A;  2W3F A;  1BLS A;  3DWK A;  1ALQ A;  4HJ4 A;  3Q82 A;  5EOO A;  2JKR I;  3PAG A;  2WZZ A;  2FZ0 A;  3QP4 A;  4Y2F A;  3IF6 C;  1PFL A;  1OJ5 A;  3CZD A;  4LCL A;  3E4Q A;  4WZ5 C;  3GSG A;  3HLW A;  4PMA A;  5EE8 A;  3ZVT A;  1F98 A;  4GD8 A;  4KZ8 A;  3ZHH A;  3GDI A;  1E3U D;  2VJW A;  3DTE A;  5HAQ A;  4HIA A;  4DE1 A;  3C30 A;  3GQZ A;  3LYX A;  4E6W A;  2XRO A;  1PW8 A;  3PBO A;  2Y2J A;  3MKE A;  4R0Q A;  5EVI D;  2X02 A;  3LCE A;  2WGW A;  5DJT A;  4KG6 A;  2PD8 A;  3NI9 A;  2ZQA A;  3B42 A;  3U2A A;  3W2Z A;  2JKF A;  2QHK A;  2XR0 A;  2WKE A;  1S66 L;  1XA1 A;  1HLU P;  1YLY A;  4IJG A;  3ISG A;  1T1C A;  4WMC D;  1JNU A;  1YQS A;  4L9E A;  3ITA A;  5CEC A;  3ZNT A;  3MFD A;  4X25 A;  1FCO A;  5FAP A;  3CUE C;  1U60 A;  4LRX C;  1DJA A;  4MBF A;  1CEG A;  3IWQ A;  5AQB A;  2ZD8 A;  5F82 A;  2HDS A;  3NCK A;  2HJ9 C;  1P0Z A;  3R7W B;  2ZC6 B;  4QJG A;  4E3J A;  3M2K A;  4B88 A;  4BBU A;  2J9P A;  1VET A;  1NYY A;  3C4P A;  1CK3 A;  2ZQ8 A;  3TJZ C;  4QY6 A;  3IX8 A;  3N4I A;  3PBT A;  4WN5 A;  2EWW A;  4HJ6 A;  3B33 A;  4U0T A;  4FSF A;  2V20 A;  4QPR A;  3TOI A;  5L10 A;  1K56 D;  1HZO A;  4GJ4 A;  2W27 A;  3SS4 A;  1W63 Q;  5D3O A;  1W8Y A;  1YMS A;  3V3R A;  1IKI A;  1NJ4 A;  1GHP A;  3C7U A;  4GHI A;  3V50 A;  3PTE A;  3FPV A;  2W3D A;  3GEC A;  4WBG A;  4Y15 A;  5CTN A;  2V0U A;  1IEM A;  4EBN A;  4U3T A;  3GR2 A;  4HH3 A;  3PR6 A;  1XXM A;  3AGE A;  2JHE A;  2BG1 A;  1LL9 A;  4RA7 A;  4HHD A;  1JWP A;  1GSX A;  2UWX A;  1SKF A;  3IXD A;  2WKH A;  4DE3 A;  5MC7 A;  4KZ9 A;  4FCF A;  2WYX A;  3DWZ A;  3M2J A;  4QHC A;  2Z6C A;  4S2O A;  4RQ9 A;  3IBJ A;  1O7E A;  4UQI M;  2Q9N A;  2LB5 A;  5CGW A;  4P6B A;  4PM6 A;  4YFM A;  4KZ4 A;  1MC0 A;  4HBT A;  4KZ7 A;  3UPO A;  2B5R A;  4E3N A;  4LV1 A;  1YSP A;  3A3I A;  1BLC A;  2RL3 A;  3VOL A;  5HX9 A;  3QHY A;  1WE4 A;  2ZC5 B;  5L07 A;  1ERM A;  4E3I A;  4KQR A;  4CJN A;  2HJE A;  5CRF A;  1VQQ A;  2FFY A;  3TE8 A;  3O87 A;  4EEU A;  5K5B A;  1F5M A;  2V8C A;  4Y3I A;  1L0F A;  1RCJ A;  4OQH A;  5F5Y A;  5GLC A;  1TS6 A;  1G28 A;  3MFX A;  2XA7 M;  5HL6 A;  5J4E A;  4N9K A;  5EEC A;  2B95 A;  1N9B A;  3EWK A;  4S2L A;  3PAE A;  2ZQ7 A;  4HH2 A;  3FWL A;  4N92 A;  3BW6 A;  2H10 A;  1XP4 A;  3PHY A;  3IWO A;  2VGK A;  4NG2 A;  4E3K A;  3Q7V A;  4GN2 A;  1E25 A;  4UA6 A;  2JKG A;  2V1A A;  4P6Z S;  2WUQ A;  3E4P A;  1ZG4 A;  2WAF A;  5F1G A;  2HDQ A;  5FAQ A;  5EV0 A;  3KYE A;  5HDD A;  1H8Z A;  4RYE A;  2A3U A;  3G34 A;  4X55 A;  4KZ5 A;  1RGZ A;  4KZ6 A;  5DVA A;  1EI5 A;  4JXS A;  1SZV A;  3SS3 A;  2ZOI A;  1SKO A;  3Q7Z A;  5FA7 A;  1K6S A;  5DFY A;  4Q0H A;  3SH9 A;  1VET B;  3HUN A;  3OCN A;  3NUL A;  4N1X A;  1QME A;  3OOV A;  4H6J A;  4UQI S;  4DE2 A;  3NY4 A;  5CHM A;  3IF6 B;  3WS4 A;  1KGF A;  3HLD A;  1DRM A;  3U4L P;  1XX2 A;  4JGP A;  4JPM A;  2PR5 A;  2VZW A;  4E6X A;  3HLG A;  3P09 A;  2ZQD A;  1FR6 A;  4LEN A;  4GHI B;  4EBP A;  5L8M A;  1LL8 A;  3VP1 A;  4CLC D;  5HD3 A;  4R23 A;  4R6L A;  1G6O A;  2ZM0 A;  4WL9 A;  3T4S A;  1Y4O A;  3MQ0 A;  3RH8 B;  4DRT A;  4UA7 A;  1TS8 A;  1LI9 A;  3NIA A;  3VV4 A;  2E8J A;  1PZP A;  2Y2P A;  5F69 A;  3HLE A;  5M18 A;  3LI9 A;  2R9W A;  4DN0 A;  1CQA A;  2M1C A;  4X68 A;  3LR3 A;  1MPL A;  4A5R A;  2PU2 A;  1NZO A;  3DW0 A;  3A0V A;  4FUW A;  4KQO A;  5A8B A;  2VX8 A;  3PBS A;  4DDY A;  3BRM A;  3HLF A;  5CX7 A;  1GCE A;  4NK3 A;  4QB8 A;  3QNC A;  4O01 A;  3MXS A;  1I2S A;  3WS5 A;  2XDM A;  2KX6 A;  4GS9 A;  3UDI A;  1PZO A;  3Q07 A;  3ZNY A;  3VSK A;  5AVE A;  3G4P A;  2ZC7 A;  2V9A A;  1BLH A;  1BZA A;  1Z6F A;  4HBU A;  4ZBE A;  2V2F F;  4NXE A;  1GSW A;  3ULF A;  3O3V A;  4KZA A;  3EEH A;  3VSL A;  1V9Y A;  2JKR M;  1G68 A;  1BT5 A;  3LY4 A;  1UWN X;  2P7J A;  2P9V A;  1P9R A;  2KLI A;  4BJP A;  1KGG A;  3ZG5 A;  1KE4 A;  2GNX A;  2QKP A;  4Q0J A;  2WKP A;  2PT7 A;  4QWO A;  3NBL A;  1JWZ A;  2VV6 A;  4JGO A;  4QU3 A;  5IS1 A;  2INW A;  4IUK A;  5HL1 A;  2Q9M A;  3F1P A;  1W7F A;  2VGJ A;  5E2H A;  3Q7V B;  3DTI A;  5EOE A;  2Y91 A;  4H8R A;  4NXB A;  3BFF A;  3W4O A;  1I5Q A;  5A91 A;  5E43 A;  3KSF A;  4DJ3 A;  5FQI A;  1J9M A;  4MBK A;  2OAP 1;  3A3J A;  4MN7 A;  4BQM A;  5CED A;  2ZC3 B;  3LO7 A;  1K4F A;  1BTL A;  4ARZ A;  4II7 A;  2J80 A;  5FEG A;  2CC1 A;  2ZBB A;  5DTS A;  2O0Y A;  1FSY A;  2IWC A;  1W8Q A;  5DKL A;  2XH9 A;  1JWV A;  2PBY A;  1XJ3 A;  3HCY A;  1H3Q A;  3IS2 A;  2MJ6 A;  3M6B A;  4HJ3 A;  3CPT A;  2W3G A;  1CI8 A;  2ZQ9 A;  3EQV A;  4DKI A;  4R4S A;  2M7V A;  1IEL A;  4GDN A;  2QPN A;  2JC7 A;  2BAS A;  4BL3 A;  4LLO B;  3QP2 A;  5TGF A;  4R38 A;  1DY6 A;  4JF5 A;  2D01 A;  2PD7 A;  4CPK A;  5EVE A;  3WS1 A;  3T4Q A;  1TDG A;  3QP8 A;  2ZM8 A;  4OLD A;  1W5D A;  2K7S A;  2ZOH A;  3LR4 A;  3LIB A;  3IX3 A;  3QNB A;  2M7U A;  5DTK A;  1T18 A;  1GHM A;  4G3W A;  4M4X A;  5HWV A;  3V5M A;  3MR0 A;  1PWD A;  3KYQ A;  2JKT M;  4GS9 B;  3UNW A;  3ZCZ A;  4FTX A;  3IT9 A;  4KZ3 A;  1KDW A;  2Q0O A;  1T19 A;  1P97 A;  2OSU A;  4C75 A;  1MKM A;  4RX3 A;  4JF6 A;  3NOP C;  2XSS A;  4BBT A;  1YLJ A;  5CHJ A;  2ZMF A;  3BLS A;  3OPR A;  2Y2O A;  4FH4 A;  4R3A A;  3RFB A;  3CI6 A;  3MBZ A;  2EWV A;  5DFX A;  2P9V B;  5TFQ A;  1KVM A;  3EQU A;  1L2S A;  4EER A;  3HL9 A;  1DP6 A;  4XT2 A;  3G35 A;  1NZU A;  3PXP A;  2UV0 E;  3IWI A;  5GL9 A;  2EX9 A;  1W79 A;  4LRY C;  3NJA A;  4F3L A;  3UE0 A;  3CG5 A;  1DP8 A;  1VHM A;  2LB9 A;  4ZDX A;  1DJC A;  3F1P B;  1EW0 A;  1VB6 A;  3MZF A;  1YM1 A;  2X71 A;  5G18 A;  5EVL A;  5HZH A;  1D06 A;  2DCF A;  4ZJ1 A;  5HDS A;  4OQ0 A;  5FL3 A;  5EM1 A;  4WF0 A;  4Y7P A;  4OVD A;  1DP9 A;  3UE6 A;  2O9A A;  4MEZ A;  1OT6 A;  3DAV A;  4GB7 A;  3RJU A;  1K6R A;  2WKI A;  4DDS A;  2OLV A;  4ARZ B;  4LGW A;  5F83 A;  3T50 A;  5DF9 A;  2V1B A;  4WEL A;  2E8I A;  5DF7 A;  2QYB A;  3IF6 A;  1MWS A;  4GNU A; 
#chains in the Genus database with same CATH homology
 1GA0 A;  3PBR A;  4WZ5 A;  2G2U A;  4E3K A;  3Q7V A;  4GDB A;  4GN2 A;  1E25 A;  3BEB A;  4UA6 A;  1K38 A;  2WUQ A;  2H0T A;  1ZG4 A;  2WAF A;  1FSW A;  2HDR A;  2QMI A;  3HBR A;  5F1G A;  2HDQ A;  1PIO A;  5FAQ A;  4MBH A;  1H8Z A;  2Z2L B;  4GZB A;  1O07 A;  4OPR A;  5TR7 A;  4PM5 A;  4HEF A;  3OPH A;  4OPQ A;  4RYE A;  2A3U A;  1FR1 A;  2PU4 A;  4WMC A;  5CGX A;  2ZC4 B;  1KE3 A;  3WS0 A;  3G2Y A;  3TSG A;  3WRT A;  3IXB A;  3G34 A;  4X55 A;  4KZ5 A;  1RGZ A;  4KZ6 A;  5DVA A;  3SH7 A;  4EWF A;  1EI5 A;  4OH0 A;  5M1A A;  4C3Q A;  4JXS A;  3E2K A;  3SS3 A;  3BFC A;  3Q7Z A;  1BUE A;  2Y55 A;  4KZB A;  3PBN A;  5FA7 A;  1K6S A;  2C5W B;  2XD5 A;  1SCW A;  4EUZ A;  3PBQ A;  3SH9 A;  5AQ9 A;  4F94 A;  4S2J A;  1YLW A;  3OPL A;  5CXW A;  3CMZ A;  3BFD A;  3CJM A;  5CER A;  1H8Y A;  3MZD A;  3HUN A;  5F1F A;  2JBF A;  2Y2Q A;  3IH9 A;  3OCN A;  5I94 A;  1E4D A;  3NDE A;  3VMA A;  4Y0O A;  4N1X A;  4EBL A;  1BSG A;  5GHY A;  1QME A;  4DE2 A;  3NY4 A;  5CHM A;  4P87 A;  3HLB A;  4WZ4 A;  3IF6 B;  3WS4 A;  4DF6 A;  3UN7 A;  3VP4 A;  1S6R A;  1KGF A;  3HLD A;  4ZJ2 A;  1BUL A;  1LL5 A;  3BM6 A;  4WYY A;  5CHU A;  1VM1 A;  2H0Y A;  1XX2 A;  3A3D A;  4JPM A;  4E6X A;  4U0X A;  1ES5 A;  3HLG A;  3JYI A;  3P09 A;  4GKU A;  4OPZ A;  5AQA A;  1MY8 A;  2DNS A;  2ZQD A;  3ZG8 B;  4DXC A;  1FR6 A;  2ZMA A;  4LEN A;  2J8Y A;  4EBP A;  4UHU A;  2WK0 A;  3VP1 A;  1GHI A;  3UE1 A;  1K57 C;  5KZH A;  3BYD A;  3N8L A;  4OP5 A;  4R23 A;  3S1Y A;  3VFF A;  1JTG A;  2XD1 A;  5FAS A;  2ZM0 A;  3HLC A;  1LI0 A;  4BEN A;  1ESU A;  4JKT A;  1NXY A;  1L0G A;  1ES3 A;  3Q81 A;  2XLN A;  1K56 A;  1YLZ A;  4RX2 A;  4DRT A;  1L0D A;  2Y2N A;  3NDG A;  4IBR A;  2BLS A;  4UA7 A;  1LI9 A;  3NIA A;  3GMW A;  2XFS A;  1JTD A;  1GA9 A;  4R3B A;  1PZP A;  4LV3 A;  5DF8 A;  4N1H A;  2Y2P A;  1PW1 A;  5M18 A;  3HLE A;  2WAE A;  2R9W A;  1XGI A;  2WZX A;  3S22 A;  1CEF A;  1XGJ A;  4Z9Q A;  4X68 A;  3VOZ A;  3FZC A;  1HVB A;  1MPL A;  4A5R A;  2PU2 A;  3WRZ A;  1NZO A;  2EX2 A;  3DW0 A;  5U47 A;  5HAI A;  4KQO A;  3MXR A;  1ERQ A;  4X56 A;  3PBS A;  5CTM A;  1MXO A;  3G31 A;  2H5S A;  4WM9 A;  3BFE A;  5FQM A;  5GLB A;  4DDY A;  5BOH A;  3G2Z A;  4S2K A;  3BRM A;  3RXX A;  3HLF A;  4EQI A;  1GCE A;  5FI6 A;  2IWB A;  4C6Y A;  4O7D A;  3ZFZ A;  4DE0 A;  4NK3 A;  3N8R A;  2IWD A;  1ONH A;  4QB8 A;  3QNC A;  3P98 A;  3VP3 A;  4EV4 A;  3UO9 A;  3MXS A;  1I2S A;  5AQ7 A;  3WS5 A;  4ZTK A;  2XDM A;  4S2P A;  4FD8 A;  4BLM A;  2V1Z A;  4LV0 A;  3GTC A;  3ZG9 B;  3GVB A;  5HAP A;  1SDN A;  4LV2 A;  3UDI A;  5FAT A;  1PZO A;  3Q07 A;  1KGE A;  1Y54 A;  3ZNY A;  4E3O A;  3VSK A;  3GRJ A;  1EWZ A;  1ZKJ A;  3G4P A;  5FI7 A;  5KMW A;  2ZC7 A;  4JBF A;  3BFG A;  5GHX A;  2EFX A;  2ZJ9 A;  3DTM A;  3E2L A;  1BLH A;  1YLP A;  3NC8 A;  1BZA A;  1Z6F A;  1IYP A;  1NYM A;  2HP5 A;  4HBU A;  4P0M A;  4MNR A;  4ZBE A;  2V2F F;  2RCX A;  1OME A;  1ONG A;  4ID4 A;  3O3V A;  3W4P A;  3AGF A;  4KZA A;  3FYZ A;  3HUO A;  4OON A;  4WEK A;  4JXW A;  2Y2H A;  3M6H A;  3VSL A;  4PM9 A;  3O86 A;  4HES A;  4L0L A;  5JYO A;  1HTZ A;  1KE0 A;  3HUM A;  1BLS A;  1IYO A;  1NY0 A;  4QD4 A;  3WS2 A;  1G68 A;  1BT5 A;  3LY4 A;  3DWK A;  1ALQ A;  4B4X A;  2GDN A;  2P9V A;  2J9O A;  3Q82 A;  5EOO A;  4BJP A;  4N9L A;  5IHV A;  5J8X A;  1KGG A;  3V39 A;  3ZG5 A;  5HAR A;  1KE4 A;  3PAG A;  2WZZ A;  5E2G A;  3IF6 C;  4OPY A;  1NRF A;  3ZGA B;  3CZD A;  4LCL A;  4WZ5 C;  1SHV A;  1K54 C;  3GSG A;  3UY6 A;  3NBL A;  3HLW A;  2Y2G A;  4PMA A;  5EE8 A;  2Y2I A;  3ZVT A;  1JWZ A;  5EVI B;  4P85 A;  4IVI A;  4GD8 A;  5GLA A;  4QU3 A;  2EX8 A;  2ZQC A;  4KZ8 A;  3ZG0 A;  5HL1 A;  1MWU A;  3C7V A;  4XXR A;  2Q9M A;  3ZHH A;  3UPP A;  3IXG A;  1E3U D;  3A3F A;  5A90 A;  3IXH A;  5HAQ A;  1W7F A;  2VGJ A;  4KEN B;  5E2H A;  4Q8I A;  1K57 A;  3Q7V B;  5M19 A;  1XA7 A;  4DE1 A;  3GQZ A;  5DTT A;  4E6W A;  4RVA A;  1PW8 A;  5EOE A;  2Y91 A;  3PBO A;  2OLU A;  2Y2J A;  3FV7 A;  2EXB A;  3C5A A;  4H8R A;  1ESI A;  3MKE A;  4R0Q A;  4Y0T A;  5EVI D;  2Y2K A;  2X02 A;  3LCE A;  3BFF A;  2WAD A;  4IBX A;  2WGW A;  1IYS A;  4WEJ A;  3W4O A;  3ZVW A;  2XFT A;  5KSH A;  1I5Q A;  1MWT A;  4KG6 A;  5A91 A;  2WGI A;  5E43 A;  1FCN A;  1DJB A;  1PI5 A;  2ZQA A;  3NI9 A;  5FQI A;  4OQI A;  1J9M A;  1HD8 A;  4MBK A;  1LHY A;  4Y0U A;  2FFF B;  3A3J A;  2OV5 A;  5FQ9 A;  1AXB A;  3O88 A;  4BQM A;  5CED A;  2QZ6 A;  2XR0 A;  3UPN A;  2ZC3 B;  2WKE A;  2JCH A;  2HDU A;  5HW3 A;  1XA1 A;  3LO7 A;  1K4F A;  1BTL A;  1YLY A;  4IED A;  3ISG A;  2XK1 A;  5E2E A;  3OCL A;  1H5X A;  3SOI A;  3IF5 A;  4LCM A;  4WMC D;  1YQS A;  4BL2 A;  1K55 C;  2C6W B;  1Q2P A;  1I2W A;  3ITA A;  3MKF A;  2CC1 A;  5CEC A;  4QY5 A;  3ZNT A;  1LLB A;  3MFD A;  5DTS A;  1FCO A;  1FSY A;  3N6I A;  2IWC A;  5FAP A;  3A3E A;  1W8Q A;  2DRW A;  3VFH A;  4R3J A;  5JYP A;  4JXV A;  2XH9 A;  3IHB A;  4S2N C;  5HFO A;  1CI9 A;  4PPR A;  1JWV A;  2ZM2 A;  4X6T A;  2PBY A;  1MKI A;  1U60 A;  3N7W A;  5CGS A;  4KG5 A;  1ZC2 A;  1DJA A;  4D2O A;  1SDE A;  4MBF A;  1ES4 A;  1CEG A;  3IWQ A;  5AQB A;  5E2F A;  2ZD8 A;  5F82 A;  4B4Z A;  3M6B A;  2HDS A;  3NCK A;  1KVL A;  2Y4A A;  2WGW B;  1CI8 A;  2XEP A;  2ZQ9 A;  2I72 A;  4K91 A;  1TEM A;  3EQV A;  4DKI A;  1FCM A;  2ZC6 B;  1XKZ A;  3HVF A;  4R4S A;  4QJG A;  1PWC A;  3SH8 A;  2HPB A;  4K0W A;  1YT4 A;  4E3J A;  1M6K A;  3BLM A;  3M2K A;  3SS5 A;  5CEB A;  1IEL A;  4E3L A;  5FSR A;  4BD1 A;  4GDN A;  3G32 A;  2QPN A;  5FQJ A;  4FH2 A;  4B88 A;  2JC7 A;  3VP2 A;  4BL3 A;  5GHZ A;  1WYB A;  3MZE A;  2J9P A;  2WGV A;  2XF3 A;  1NYY A;  3C4P A;  1CK3 A;  5TGF A;  3AGD A;  3B3X A;  3IHA A;  1DY6 A;  2ZQ8 A;  4JF5 A;  3TG9 A;  4CPK A;  4QY6 A;  1K25 A;  3N4I A;  3WS1 A;  3OPP A;  3PBT A;  4NET A;  3VOY A;  4U0T A;  2X01 A;  4OKP A;  1K54 A;  4FSF A;  2V20 A;  1TDG A;  5EVI C;  4X53 A;  3TOI A;  2ZM8 A;  1K56 D;  1HZO A;  4OLD A;  3IWO A;  1W5D A;  3SS4 A;  5D3O A;  2Y2M A;  1W8Y A;  4OP8 A;  1YMS A;  1N4O A;  4DXB A;  3V3R A;  1IKI A;  4PM7 A;  1NJ4 A;  1GHP A;  3C7U A;  3QNB A;  3HRE A;  3V50 A;  5EUA A;  2G2W A;  5DTK A;  3PTE A;  1GHM A;  3FKV A;  4R1G A;  5KSC A;  4WBG A;  3V5M A;  1IYQ A;  5CTN A;  1PWD A;  3Q1F A;  4K0X A;  3VP0 A;  1PI4 A;  1IEM A;  4EBN A;  4S2I A;  3UDX A;  4GD6 A;  4U3T A;  3UNW A;  5FAO A;  3GR2 A;  3G30 A;  3ZCZ A;  3OC2 A;  1XXM A;  3C4O A;  5GLD A;  3AGE A;  4BD0 A;  3IT9 A;  1BLP A;  1XPB A;  5A93 A;  1L0E A;  4OLG A;  3RXW A;  2BG1 A;  4KZ3 A;  1YLT A;  1FOF A;  1KDW A;  1LL9 A;  1JVJ A;  2JE5 A;  2Y59 A;  4RA7 A;  3ZDJ A;  2OSU A;  4UA9 A;  1JWP A;  1YMX A;  2UWX A;  1S0W A;  4C75 A;  1RP5 A;  4MLL A;  1SKF A;  4XUX A;  2Z2M B;  1C3B A;  3IXD A;  4RX3 A;  4JF6 A;  1G6A A;  2WKH A;  4DE3 A;  4KZ9 A;  4FCF A;  2WYX A;  5FI2 A;  1Q2Q A;  3DWZ A;  3M2J A;  4QHC A;  1YLJ A;  5CHJ A;  3BLS A;  3OPR A;  2Y2O A;  4FH4 A;  3OZH A;  2HP6 A;  4S2O A;  3MBZ A;  4YIN A;  5A92 A;  2XQZ A;  3GV9 A;  2EXA A;  2J7V A;  2P9V B;  4JXG A;  5TFQ A;  1KVM A;  3EQU A;  1O7E A;  1L2S A;  2R9X A;  4GOG A;  3HL9 A;  1K55 A;  4JF4 A;  1ZG6 A;  2Q9N A;  5CGW A;  3G35 A;  4OQG A;  1NZU A;  3S4X A;  1MWR A;  3IWI A;  4P6B A;  5GL9 A;  3D4F A;  3FKW A;  4PM6 A;  4YFM A;  4JLF A;  4KZ4 A;  3W4Q A;  5EPH A;  4S2N A;  2EX9 A;  1W79 A;  4E3M A;  4HBT A;  4KZ7 A;  4OOY A;  4ZAM A;  4PM8 A;  2B5R A;  5FQQ A;  4E3N A;  4LV1 A;  3UPO A;  3UE0 A;  4KQQ A;  5FQK A;  3CG5 A;  3A3I A;  1QMF A;  3UE3 A;  1BLC A;  4ZDX A;  1DJC A;  2RL3 A;  5HX9 A;  2Y2L A;  3QHY A;  1WE4 A;  3MZF A;  2ZC5 B;  1YM1 A;  3UDF A;  1ERM A;  2X71 A;  1TDL A;  2EX6 A;  1RGY A;  5G18 A;  3V3S A;  4E3I A;  4KG2 A;  1K4E A;  5EVL A;  2DCF A;  4ZJ1 A;  4KQR A;  3N8S A;  4CJN A;  4OQ0 A;  3LEZ A;  3IQA A;  5CRF A;  3ITB A;  1MBL A;  1TVF A;  1PYY A;  3LY3 A;  1VQQ A;  2FFY A;  4IVK A;  4Y7P A;  4OVD A;  4S2M A;  2A49 A;  3O87 A;  1E3U A;  4R4R A;  4MEZ A;  2XGN A;  4GB7 A;  3RJU A;  1L0F A;  4M3K A;  1RCJ A;  4OQH A;  5GLC A;  1K6R A;  1PWG A;  2WKI A;  2EFU A;  3BEC A;  5FDH A;  4DDS A;  4XUZ A;  3IH8 A;  2OLV A;  4N9K A;  5EEC A;  3W8K A;  1N9B A;  5EVI A;  4S2L A;  2HP9 A;  5F83 A;  5DF9 A;  1ES2 A;  4WEL A;  1ERO A;  3PAE A;  4X69 A;  4ZJ3 A;  2ZQ7 A;  1WYC A;  4OOM A;  2P74 A;  3FWL A;  1IKG A;  2E8I A;  4N92 A;  3ZG7 B;  4UAA A;  3WWX A;  3I7J A;  5DF7 A;  2H10 A;  2ZLY A;  1XP4 A;  3IF6 A;  4OOL A;  1M40 A;  1MWS A;  2VGK A;  4GNU A;  1FQG A;  5L2F A;  1KDS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...