3IF6A

Crystal structure of oxa-46 beta-lactamase from p. aeruginosa
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
242
structure length
227
Chain Sequence
VVIRSDWKKFFSDLQAEGAIVIADERQAKHTLSVFDQERAAKRYSPASTFKIPHTLFALDADAVRDEFQVFRWQDQDLRSAMRNSTVWVYELFAKDIGEDKARRYLKQIDYGNVDPSGDYWIDGNLKISAHEQILFLRKLYRNQLPFKVEHQRLVKDLMITEAGRSWILRAKTGWEGRFGWWVGWIEWPTGPVFFALNIDTPNRTDDLFREAIARAILRSIDALPPN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords OXA-46 oxacillinase
publication title Crystal structure of the narrow-spectrum OXA-46 class D beta-lactamase: relationship between active-site lysine carbamylation and inhibition by polycarboxylates
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Hydrolase
total genus 67
structure length 227
sequence length 242
ec nomenclature
pdb deposition date 2009-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3if6A00
4ZTKA 3FV7A 4KZAA 4R1GA 4N1XA 1I5QA 3CG5A 3G34A 3G2ZA 4S2KA 1KE0A 2JBFA 1YLYA 1K57C 1PYYA 1L0DA 1KDSA 1MWSA 3V39A 3ZHHA 3IXBA 4QJGA 3HUOA 4OKPA 1L0EA 1YLJA 4E3KA 5EVID 4GD6A 1Q2PA 1H8ZA 5EE8A 3ZNYA 2V1ZA 3VSKA 2B5RA 4GN2A 1BT5A 1DJCA 3IH9A 4GNUA 3GQZA 4KZ3A 1XKZA 4LCMA 1ZC2A 3SS5A 4HBTA 4GZBA 1YMXA 5G18A 4XXRA 2XF3A 1JWZA 4JKTA 1KVLA 3BECA 4N9LA 4GOGA 5AQ9A 3MZDA 5EUAA 4E3JA 1MKIA 1VQQA 2ZQ9A 5HX9A 4JXSA 3ZVTA 2HDSA 3C4PA 5AQAA 3OCLA 2HDQA 3D4FA 3B3XA 3BFFA 3GRJA 1U60A 4YFMA 4YINA 2IWBA 2Q9MA 1K25A 1ERMA 2OV5A 1CI8A 4RVAA 2Y2GA 3W4QA 4OQ0A 2Y2OA 4PM8A 5I94A 2C6WB 1GHIA 3IHBA 5JYOA 1MBLA 3HLEA 3V50A 3BFEA 3HLBA 3G30A 4LV3A 3LY3A 1KDWA 1Q2QA 2Y2MA 5E2FA 4QU3A 1GHMA 4DF6A 3VP1A 3Q7ZA 3MZFA 2Y59A 3FZCA 2Y2PA 3ITBA 1FSWA 3SH8A 3MKEA 1C3BA 1YLZA 4DXCA 1K55C 1YMSA 2H0YA 2XEPA 3BFDA 4OPQA 3WS2A 4K0XA 5CXWA 5FQ9A 3BM6A 2EFXA 2HPBA 2X01A 2Q9NA 2C5WB 2ZQAA 4FCFA 1FCNA 3AGFA 5FI6A 3ZFZA 2FFFB 2PBYA 4KZ7A 4E3OA 3QNBA 2J9PA 5FSRA 2WKHA 2IWDA 2JCHA 1PI4A 1L2SA 5E2GA 5FQIA 3IXGA 2ZQCA 3I7JA 1FR1A 3G31A 2Y2HA 4DDYA 3GR2A 4Y7PA 4XUXA 5AQBA 4JXWA 3W4OA 5E2HA 1JTDA 4ZJ1A 4HBUA 1LL5A 1SCWA 2ZQ7A 1IYOA 1I2WA 2WGWA 3LY4A 4IVIA 5FI2A 3ZG5A 1TDLA 5M19A 2ZM2A 5DF7A 1J9MA 3NBLA 1LL9A 5CEDA 1MWTA 4R0QA 1DY6A 4OQHA 5CHMA 3FWLA 1NY0A 2H10A 3SH9A 1M6KA 3IF5A 4ZAMA 5DTSA 1RCJA 1H5XA 1FR6A 4JPMA 4X68A 3MFDA 4EBLA 2WZXA 3BFCA 1XA1A 2J7VA 3QNCA 3OPLA 4C75A 1ESIA 4DE1A 1KE3A 2P9VA 1TDGA 5TFQA 4UA9A 2WKIA 1E25A 4WMCA 1Z6FA 1HZOA 3PBOA 1CEGA 4RA7A 3P98A 2Y2NA 5HARA 2OSUA 3EQVA 3BFGA 4KQOA 2WUQA 5HAQA 4X69A 2WYXA 3A3JA 4EBNA 1FQGA 4PM6A 4Y0UA 1W8YA 4KQQA 5CHJA 3UN7A 3OCNA 5GLCA 4BL3A 4DXBA 5AQ7A 5KSCA 1QMFA 3IF6C 2ZC6B 2EX6A 2ZC3B 1MWUA 4U3TA 3E2LA 1FOFA 3IWIA 1EWZA 1TEMA 1LLBA 1PWCA 4JXGA 1LI9A 3OC2A 5FAOA 2EX9A 4C6YA 2QPNA 5IHVA 2A3UA 4JLFA 4BD0A 1ES4A 1CK3A 3NCKA 2ZQ8A 1KE4A 5GHXA 4WMCD 4P0MA 1GA9A 1NJ4A 2ZLYA 3NIAA 3WRTA 2WADA 3NDGA 3G35A 1XPBA 1E3UD 3N8LA 3PBQA 1W7FA 5CTNA 5M18A 3ZG0A 1EROA 2EFUA 3BLSA 2ZD8A 4DRTA 2I72A 3WS5A 3IXDA 4ZJ3A 4QHCA 4M3KA 5CHUA 2Z2LB 3GV9A 3PAEA 2XR0A 3G32A 3VP2A 4ID4A 1IEMA 1XGJA 3UE0A 4WM9A 4OP8A 1K55A 3O88A 4UHUA 3AGDA 3MKFA 5FQJA 3WWXA 1HTZA 4E3MA 2WGWB 2WKEA 3IWOA 4RX2A 4S2JA 4N1HA 3UDFA 5CERA 3W4PA 2WAFA 2VGKA 5E2EA 2WZZA 5HFOA 1S0WA 3RXXA 1ESUA 2ZM0A 1TVFA 5CEBA 1BLPA 1JVJA 2R9XA 4E3LA 1WYBA 3HBRA 1XXMA 1K54A 3ZCZA 3UE1A 3Q7VA 2WGIA 3O86A 1ZG6A 4Z9QA 4KZ5A 4GB7A 5GLAA 1YLWA 4KZ6A 5EECA 2IWCA 4OP5A 2PU4A 3HLDA 5TGFA 3Q81A 2XH9A 4GD8A 4S2NC 3CJMA 3BRMA 4KZBA 2RCXA 1W8QA 3ZG7B 3IHAA 1RP5A 1IELA 2Y2IA 1KGGA 3A3DA 3BYDA 4WZ5C 1K6SA 1XA7A 4K91A 4R4RA 4CPKA 4D2OA 4EBPA 1N9BA 5EVIB 2DNSA 4QB8A 5F1FA 2BG1A 2XD1A 4PM5A 1YLTA 1SDNA 2XFSA 4MBKA 4UA7A 1EI5A 1Y54A 5E43A 1PZOA 1SKFA 4X55A 3PBNA 1IYQA 5M1AA 3S1YA 3FYZA 1NRFA 1NYYA 3HLCA 3P09A 3WS1A 1ZKJA 3DTMA 3NY4A 5FQMA 3TOIA 4U0TA 5FATA 2RL3A 1JWPA 3EQUA 5EVLA 5FASA 3SOIA 3O87A 5F1GA 1E4DA 3M2JA 2Y2LA 4P85A 4OONA 4LV2A 3VOYA 5A93A 4X53A 4XUZA 4DE2A 5EPHA 1BUEA 3HLGA 5HAPA 3DW0A 5EOOA 2ZQDA 3HL9A 1WE4A 4Y0OA 3ITAA 3DWKA 1VM1A 4EWFA 1XX2A 3UY6A 5BOHA 2WGVA 1HD8A 1W5DA 4NETA 4ZBEA 4BJPA 4BL2A 5CECA 4E6XA 2OLVA 1W79A 1BZAA 4HESA 4QD4A 1G6AA 2WK0A 5F82A 2ZC4B 1BLSA 4EQIA 1KGFA 3VFFA 5FQKA 1YQSA 5FAPA 1CI9A 3NI9A 3IF6A 4RX3A 1BSGA 3HUNA 4LV0A 1FCMA 4BENA 2GDNA 4ZJ2A 3VOZA 2VGJA 3IWQA 4JF6A 2ZC5B 2DCFA 1BLCA 5J8XA 2JC7A 4GDNA 1GA0A 1ZG4A 4EUZA 4E3IA 1PW8A 3WRZA 3A3IA 2XQZA 2BLSA 2FFYA 2ZM8A 3Q82A 4MBFA 4OLDA 4Y0TA 1ES5A 1K57A 2HDUA 4MEZA 1AXBA 4OOYA 4QY6A 1IYPA 1FSYA 3MXSA 5A90A 4IEDA 1MXOA 2HP5A 1LI0A 1BULA 1NZOA 3M6HA 4WZ4A 5DVAA 4E3NA 3ZNTA 3OPRA 4FSFA 5GL9A 3SS3A 1ES3A 3LCEA 5D3OA 3WS4A 4FH2A 5FA7A 4NK3A 1SDEA 3HVFA 4IBRA 3VP3A 1IKIA 5U47A 1BTLA 4LCLA 3N8RA 1ALQA 1K38A 3QHYA 4O7DA 1ONHA 3Q07A 3BLMA 3C7VA 1KVMA 3IT9A 2EX8A 5KZHA 3UE3A 3E2KA 3GVBA 3VMAA 1PZPA 5GLDA 4OQIA 4RYEA 4KZ4A 4WELA 4IVKA 1IKGA 1K6RA 1NYMA 2XGNA 3IXHA 4MNRA 5JYPA 3HREA 1DJAA 4FD8A 1YT4A 4U0XA 4PM7A 1FCOA 1IYSA 3HUMA 3A3FA 4KQRA 1ONGA 4PMAA 1L0FA 4KZ9A 1O7EA 3UPOA 2Y2QA 4QY5A 4S2NA 2HP9A 5CRFA 2QZ6A 3VSLA 4S2MA 4WBGA 3N4IA 3W8KA 3M6BA 4OVDA 4WZ5A 1GHPA 2DRWA 1N4OA 4PM9A 4KZ8A 5EVIC 5HW3A 1WYCA 3AGEA 3C7UA 4S2LA 2Y4AA 4F94A 4S2OA 2XFTA 4JF4A 4X56A 4KG6A 2X71A 1MY8A 2H5SA 3N7WA 1LHYA 3IF6B 2Y2JA 4E6WA 2PU2A 2CC1A 2Y91A 1PWGA 5DTKA 3VP0A 3ZG9B 2Y55A 5GLBA 3TSGA 2J9OA 1CEFA 3UNWA 3LO7A 2OLUA 4DDSA 1JWVA 3Q1FA 2P9VB 4OH0A 2JE5A 3PBTA 3SS4A 1JTGA 4JF5A 1H8YA 1SHVA 4H8RA 5CTMA 5DF9A 4N92A 4DKIA 2UWXA 3UPNA 3ZGAB 5EOEA 3S4XA 2XD5A 2XK1A 4OPZA 2ZC7A 2G2UA 1O07A 4OPRA 3PTEA 5DF8A 4UA6A 2WAEA 3C5AA 3CMZA 1S6RA 4B88A 2ZJ9A 4OLGA 3V5MA 2ZMAA 4WEKA 5L2FA 3OPPA 3G4PA 3ZG8B 4GDBA 4L0LA 4HEFA 4BD1A 5CGSA 4C3QA 5GHZA 4UAAA 3IH8A 2X02A 4MBHA 1ERQA 3CZDA 1PI5A 3BEBA 4R3BA 1G68A 4PPRA 3JYIA 3RXWA 4CJNA 3UPPA 3A3EA 4OOMA 4DE0A 1K54C 3UDIA 5KMWA 3PBSA 4IBXA 4R3JA 4LV1A 3TG9A 4KENB 1K4EA 4N9KA 3S22A 1MWRA 4DE3A 3PAGA 4R23A 5FI7A 2Y2KA 1K56A 2HP6A 1DJBA 4WEJA 3GTCA 2E8IA 3N8SA 2QMIA 1RGYA 5DTTA 1I2SA 3MZEA 1NXYA 3MBZA 2XDMA 3NDEA 5HAIA 2J8YA 4GKUA 1L0GA 3FKWA 3V3SA 3O3VA 4OOLA 3VP4A 4R4SA 3FKVA 2H0TA 3GMWA 3WS0A 5A91A 5CGWA 4Q8IA 2R9WA 3Q7VB 1HVBA 1PIOA 3IQAA 4P6BA 1QMEA 5GHYA 2Z2MB 3C4OA 3SH7A 1RGZA 5HL1A 1YLPA 4S2IA 5FAQA 3VFHA 3PBRA 1OMEA 2G2WA 1ES2A 4KG2A 1GCEA 4EV4A 4A5RA 4MLLA 3G2YA 5A92A 2EXAA 4JXVA 1YM1A 4FH4A 3V3RA 4OQGA 3ZDJA 1NZUA 3OZHA 1K56D 4P87A 5FDHA 1KGEA 2V2FF 4ZDXA 4B4ZA 2HDRA 3RJUA 3UO9A 4WYYA 4JBFA 3ZVWA 3HLWA 5EVIA 1E3UA 1PW1A 4BLMA 2XLNA 5KSHA 3ISGA 1XGIA 4S2PA 3UDXA 4X6TA 2A49A 1PWDA 3DWZA 3LEZA 3NC8A 1K4FA 2EX2A 1XP4A 4KG5A 5TR7A 4OPYA 4BQMA 4B4XA 4LENA 4K0WA 2V20A 3N6IA 5CGXA 5FQQA 3GSGA 3OPHA 1MPLA 3MXRA 2P74A 5F83A 2EXBA 1BLHA 1M40A 3HLFA 3M2KA
chains in the Genus database with same CATH superfamily
1I5QA 4O0PA 4S2KA 2B18A 2D01A 1L0DA 1KDSA 4NG2A 1L0EA 2V1ZA 2B5RA 4GN2A 4K08A 3L9KA 1DJCA 3GQZA 2VK3A 1ZC2A 1YMXA 4XXRA 2O9AA 2L1MA 5EUAA 3MZDA 5HX9A 3ZVTA 3C4PA 5AQAA 1P97A 2HDQA 3D4FA 3GRJA 4YINA 2ZL1B 1ERMA 3W4QA 4OQ0A 4ETXA 5I94A 2JHEA 1GHIA 4UEYA 1MBLA 4HP9A 3G30A 2WKQA 5E2FA 3FZCA 3ITBA 4Q0HA 4DXCA 4WF0A 1F5MA 4GJ4A 2HPBA 2Q9NA 3P01A 1UWNX 1PFLA 2WKHA 1L2SA 5E2GA 4HJ6A 2PRFA 3P7NA 2ZQCA 2YKFA 3GR2A 3VOLA 4XUXA 4JXWA 3LY4A 1LL5A 1SCWA 2ZQ7A 1IYOA 2WGWA 5M19A 2VEAA 3T4SA 1MKMA 2OOLA 1J9MA 3KYEA 4R0QA 5CHMA 3FWLA 5A8BA 1STZA 3SH9A 5J7EA 5DTSA 3JVUA 4X68A 3MFDA 1CJFA 3QNCA 2L0WA 4F3LB 4UA9A 5L10A 4GS9A 5FEFA 4X69A 3A3JA 4PM6A 5GLCA 4BL3A 2JKTM 3T4QA 4BBTA 5KSCA 1PRQA 3OC2A 4YNRA 5IHVA 3IX4A 2O9CA 1TF1A 3NCKA 3D72A 3NULA 2ZOHA 3IBRA 1NRJA 2WADA 3N8LA 4DRTA 2JKFA 4GHIA 2CMNA 5HWTA 2Z6DA 4ID4A 1IEMA 4WM9A 5HDCA 4OP8A 1K55A 3O88A 4UHUA 3V67A 3MKFA 2WGWB 3W4PA 4O01A 1DP6A 3S7PA 5CEBA 4HQAA 4E3LA 3HBRA 3QP1A 1XXMA 3O86A 1ZG6A 2V8FA 4GB7A 1LSWA 4NXGA 2IWCA 4OP5A 4KQDA 4GD8A 4JGPA 2RCXA 4Y13A 3ZG7B 3IHAA 1RP5A 4GS9B 2VKSA 4CPKA 3MS6A 4ME4A 1N9BA 2XFSA 3C8CA 5DFYA 3PBNA 1IYQA 5M1AA 1S4RA 3S1YA 1NRFA 2W1RA 3DTMA 3ZQ5A 3KX0X 3IS2B 3O87A 1E4DA 4OONA 5EOOA 3HL9A 3EGDC 5G4YA 2JKRI 2R78A 1VM1A 3UY6A 2WGVA 4ZBEA 2ACGA 4B93A 4E6XA 3PHYA 3A0VA 1BZAA 2ZC4B 1BLSA 4HJ4A 4GHIB 1CF0A 4EQIA 1YQSA 3QP4A 3NI9A 1FCMA 2OAQ1 1BLCA 1GA0A 3WRZA 2ZM8A 4OLDA 2FFYA 1AXBA 4QY6A 5A90A 4HOIA 1MXOA 2HP5A 1BULA 3A0RA 4E3NA 3OPRA 3SS3A 1ES3A 1XFQA 5D3OA 4FH2A 3PXPA 5FA7A 3HVFA 1TS8A 2KLIA 3EOIA 4HIAA 3F1OB 5L07A 2O99A 1K38A 3QHYA 4O7DA 3Q07A 3CUEC 1KVMA 3VMAA 4R6LA 1PZPA 2OWJA 2XGNA 4G3VA 5JYPA 4U0XA 1IYSA 3HUMA 1ONGA 5AVEA 1O7EA 2Y2QA 5CRFA 3ICYA 4WBGA 3N4IA 1KOUA 4WZ5A 3CWFA 2W3HA 1GHPA 2J3TD 2DRWA 4PM9A 5EVIC 5HW3A 1WYCA 4F94A 4S2OA 1WA9A 3RFBA 4HI4A 4KG6A 5FEGA 2VV6A 2UV0E 1G28A 3UB8A 1HLUP 1EW0A 3MQQA 3CPTA 4OH0A 2LB9A 3PBTA 3DTEA 3KO6A 5F6AA 3T4TA 1SHVA 4NXEA 1TD5A 2XD5A 2JN7A 5IU1A 2XK1A 3TJZC 2ZC7A 3L7HA 4UA6A 2WAEA 1UWPX 3CMZA 4B88A 4HEFA 2X02A 4R38A 1H3QA 3MFXA 3JYIA 2V0UA 1K54C 5KMWA 1SZVA 3TG9A 3KYZA 4N9KA 4FTXA 3K2NA 3PAGA 4R23A 2Y2KA 5TBMB 2J3WA 2HP6A 3F1NA 3QP2A 4PKYA 3IX8A 1YPRA 5TJJA 5HAIA 2J8YA 1S4SA 3CHWP 3FKWA 4OOLA 3T1XA 3GMWA 2Y79A 4Q8IA 1QMEA 5HL1A 3IX3A 5EM1A 3CPTB 1NZUA 1OT9A 1V9ZA 1KGEA 5FDSA 3UO9A 4E04A 4BLMA 5KSHA 4S2PA 3UDXA 4X6TA 1G5UA 2GJ3A 3LEZA 2O9BA 4BQMA 4B4XA 2VV8A 3T1QB 2ZOIA 5FQQA 3GSGA 1MPLA 2KDKA 4HY8A 3MBZA 2VV7A 2H28A 3FV7A 1Y4OA 2BASA 4Y3IA 1XJ2A 1KE0A 3NHQA 5EFWA 1MWSA 3IXBA 2K2NA 1YLJA 4E3KA 3R7WA 2A24B 3T50A 4GNUA 1D1JA 3EGXC 3EEHA 3LI9A 3MF0A 3SS5A 4HBTA 4GZBA 1JWZA 4JKTA 1KVLA 3BECA 4E3JA 5A92A 3F1NB 3OCLA 3BFFA 4ZRRA 3JVVA 4MN6A 2XSSA 2OV5A 4ARZA 3IHBA 3V50A 3HLBA 1A0KA 4IUKA 1KDWA 1Q2QA 2Y2MA 4I38A 3Q7ZA 3MZFA 2Y59A 4UQIS 2Y2PA 2V9AA 3MKEA 1YLZA 1YMSA 2H0YA 2XEPA 4OPQA 3WS2A 4K0XA 2BTFP 5CXWA 5FQ9A 2EFXA 2HF6A 2X01A 2ZQAA 3ZFZA 3BWLA 2J9PA 5FQIA 2VLGA 5HD3A 2Y2HA 4JGQA 4PHTA 4CLCC 5FL3A 4Y7PA 3LICA 3W4OA 2QJ5A 3B33A 4ZJ1A 4HBUA 1TS6A 5FI2A 4JGOA 4EW7A 1TDLA 2ZM2A 4Y17A 1DY6A 1NY0A 2H10A 4ZAMA 3BFCA 1XA1A 2J7VA 3OPLA 4C75A 1ESIA 4DE1A 1KE3A 3H82A 1TDGA 5TFQA 3HCYA 3PBOA 2OSUA 5HAQA 2WUQA 1OJGA 4NXFA 2WYXA 4EBNA 4XT2A 3OCNA 4DXBA 5AQ7A 1QMFA 3IF6C 4U3TA 1FOFA 3LIFA 2Y8HA 1W63M 3HJIA 4BD0A 1ES4A 1CK3A 5HZHA 1KE4A 5GHXA 3CI6A 1NJ4A 2ZLYA 3NIAA 1ZTUA 3WRTA 3NDGA 1XPBA 1E3UD 5M18A 1EROA 2I72A 3ULFA 3FPWA 1XJ3A 4QHCA 3PAEA 2XR0A 3VP2A 3K3DA 3UE0A 3AGDA 2WKEA 4S2JA 4N1HA 3UDFA 3KSGA 2WZZA 4ESPA 2HZ5A 3RXXA 1BLPA 2R9XA 4QPRA 4X1LA 4DJ2A 3UE6A 3Q7VA 2WGIA 4Z9QA 1GSVA 4KZ6A 5EECA 2PU4A 3HLDA 3Q81A 4JGRA 3LR4A 3EEAA 4MDZA 4Q0JA 2OAP1 2OWHA 4K91A 4EBPA 5F1FA 4KUOA 1F9IA 3JPUA 4MBKA 5HL6A 4L9GA 1Y54A 5E43A 1SKFA 3FYZA 1NLYA 5DKLA 3NY4A 3TOIA 4MMNA 2RL3A 2K31A 2V1AA 2VGLM 4I3IA 4LLOB 3GDIA 3M2JA 2Y2LA 4LV2A 4X53A 3HLGA 3DW0A 2VX8A 4EWFA 1XX2A 5BOHA 1W5DA 4BJPA 1W79A 3BY9A 3OLOA 4HESA 4Y2FA 1FILA 3VFFA 4RX3A 4ZJ2A 2VGJA 2JKTI 4DN0A 2IA2A 2ZC5B 2W0NA 4E3IA 3A3IA 5EM0A 2BLSA 4X25A 1ES5A 1K57A 4MEZA 4OOYA 1IYPA 3MXSA 4I39A 3S7QA 4IEDA 3M6HA 3ZNTA 3C30A 2PD8A 4FSFA 4EEPA 4IBRA 4UQIM 1TS0A 1YSPA 3N8RA 1ALQA 1LL8A 2PR5A 3GVBA 4RYEA 1K0KA 1IKGA 1K6RA 1NYMA 2W27A 3IXHA 4MNRA 4FD8A 1YT4A 1FCOA 4PMAA 4WL9A 2PAVP 3UPOA 4QY5A 3MR0A 3S7NA 2QZ6A 3W8KA 3M6BA 3VE4A 1YSQA 3UB6A 1BYWA 4KZ8A 3AGEA 4S2LA 2Y4AA 4PAUA 2XFTA 2H5SA 3LUQA 2Y2JA 2CC1A 4HJ3A 1PWGA 5DTKA 2Y55A 5GLBA 3TSGA 1VHMA 4DDSA 3LYXA 3Q1FA 5DF9A 4N92A 4DKIA 2UWXA 3UPNA 5EOEA 2FH5A 1S6RA 5L2FA 4OLGA 3V5MA 4BD1A 5GHZA 5HDDA 3BEBA 3CLOA 4PPRA 4CJNA 2EA9A 3UDIA 2P08A 2B95A 4IBXA 1K4EA 4O8GA 3S22A 3BY8A 4M4XA 5FI7A 2GZAA 1K56A 1DJBA 3GTCA 3T4JA 4MN5A 5DTTA 3LR0A 1NXYA 3CUEA 1FIKA 3NDEA 3IBJA 4GKUA 1L0GA 2VZWA 3V3SA 5HPIA 3KYQA 4LRYC 3ZYTA 3FKVA 2H0TA 3WS0A 1HVBA 3H7WA 1JNUA 2Z2MB 3C4OA 4I3JA 3PBRA 4KG2A 1GCEA 2KOIA 1P9RA 4OQGA 1K56D 4ZDXA 2V2FF 2M7VA 3HLWA 2W3FA 4II7A 5EVIA 1PW1A 3ISGA 1XGIA 2E8JA 1K4FA 2EX2A 2W1TA 4KG5A 3NOPC 2V20A 5CGXA 3LI8A 4EQ1A 2P74A 2EXBA 1M40A 1XFNA 3HLFA 3M2KA 5HWWA 1S66L 1P0ZA 4LFUA 4R1GA 5L8MA 3FG8A 3G2ZA 1YLYA 1PYYA 4QJGA 4OKPA 5EVID 1Q2PA 3VSKA 4AFIA 3KSHA 4KZ3A 4LCMA 1Y28A 4N9LA 1MKIA 1VQQA 2ZQ9A 4JXSA 2HDSA 2J3TC 4YFMA 4FOFA 1CI8A 4RVAA 2XA7S 2C6WB 3HLEA 3BFEA 3U2AA 3LY3A 4DF6A 5DKKA 4HH3A 3VP1A 3BFDA 4P6ZS 3NECA 2C5WB 1VEUA 4FCFA 3MQ0A 3AGFA 5FI6A 2FFFB 2W1TB 2PBYA 3SZTA 4D60A 2JCHA 3IXGA 1FR1A 4DDYA 2V8CA 5EV0A 5AQBA 2QWSA 1F2KA 4IVIA 4IHQA 5DF7A 2VJWA 1LL9A 2HV1A 1NLZA 4OQHA 1RCJA 1H5XA 3O5YA 3BW6A 4EBLA 5L09A 2P9VA 2PHYA 2WKIA 1ACFA 1E25A 4WMCA 4EESA 1S67L 1CEGA 3P98A 3EQVA 3BFGA 4KQOA 4HHDA 4L9EA 1W8YA 5CHJA 3G6OA 4LGWA 4BBVA 2EX6A 2ZC3B 3IWIA 1EWZA 1LLBA 1PWCA 2PR6A 4JXGA 2EX9A 4BBUA 4C6YA 2QPNA 4FUWA 4JLFA 1T1BA 4PKYG 2MJ6A 3NJAA 4H6JA 4WMCD 2W3GA 1GA9A 3G35A 3PBQA 5J4EA 2GX5A 3ZG0A 1OTIA 5HPFA 2EFUA 2QYBA 3WS5A 3IXDA 1T1CA 4M3KA 5CHUA 2Z2LB 3GV9A 3G32A 3QP5A 2XROA 3UB5P 3KSFA 5FQJA 3WWXA 4E3MA 3IWOA 4RX2A 5CERA 1VETA 5E2EA 5HFOA 1SKOA 1DRMA 1ESUA 2ZM0A 1LSXA 1TVFA 1JVJA 1V9YA 4X1MA 1WYBA 1S1YA 3UE1A 4KZ5A 3LR5A 5GLAA 1YLWA 2K7SA 4G3WA 5TGFA 4S2NC 3CJMA 3BRMA 5DFXA 2VA0A 2Y2IA 1KGGA 3A3DA 3BYDA 4Z1WA 4D2OA 2DNSA 3H9WA 4PM5A 1YLTA 2XRNA 4UA7A 1PZOA 1NYYA 4QWOA 3HLCA 3P09A 3WS1A 1ZKJA 3T4KA 1N9NA 4U0TA 4HH2A 1JWPA 5EVLA 5FASA 5F1GA 2HGVA 3T4OA 5A93A 5EPHA 5HAPA 2ZQDA 2PBDP 3DWKA 4BL2A 4NETA 4Y5FA 4BWIA 3R7WB 1G6AA 2WK0A 5F82A 5HSQA 5FAPA 3IF6A 1BSGA 3HUNA 5HDSA 3LIDA 3VOZA 4JF6A 4HNBA 2D02A 1XJ6A 2DCFA 5J8XA 2JC7A 4GDNA 1ZG4A 4EUZA 3HJKA 1VETB 3Q82A 4MBFA 4Y0TA 2ZL1A 1FSYA 4EU0A 2XA7M 1LI0A 4ARZB 1NZOA 4WZ4A 5EVEA 5DVAA 5F68A 1D06A 5GL9A 3LCEA 1F98A 4NK3A 1AWIA 3VP3A 1IKIA 3QP8A 3T1RA 1BTLA 4LCLA 3BLMA 3IT9A 4GW9A 3EWKA 2EX8A 3BQ8A 4R3AA 2Q0OA 4OQIA 4KZ4A 4WELA 3HREA 1DJAA 2NUTC 2LB5A 4PM7A 3A3FA 4LPZA 1L0FA 2EWWA 2HP9A 4S2MA 3CITA 2V1BA 3TRCA 2HJ9C 2EWVA 1MY8A 3N7WA 3IF6B 2J9OA 2P7JA 1CEFA 2OLUA 3H82B 1Z09A 4F3LA 4JF5A 4GCZA 5CTMA 3UB9A 3ZGAB 1IOUA 3S4XA 5HD5A 4XT2B 1O07A 4OPRA 5DF8A 4WEKA 3OPPA 3G4PA 4GDBA 3NOTC 4L0LA 5AVFA 4UAAA 3IH8A 3CZDA 1PI5A 1YAXA 5IT5A 1OTAA 2QKPA 1G68A 3RXWA 4HP4A 3UPPA 4OOMA 4DE0A 3PBSA 4LV1A 2PDRA 4KENB 3UMDA 1MWRA 4DE3A 3TW8A 2QHKA 4WEJA 3PR6A 2E8IA 3N8SA 2QMIA 1PNEA 1I2SA 4WUJA 4NEED 5LBRA 3VP4A 4R4SA 2J80A 4RQ9A 5A91A 5CGWA 3Q7VB 4P6BA 3IQAA 3SH7A 5GHYA 4MN7A 1RGZA 2P04A 2QJ7A 4A5RA 4MLLA 1XJ4A 2EXAA 4JXVA 1YM1A 4FH4A 3V3RA 3LGOA 3ZDJA 4P87A 1CQAA 1G6OA 5FDHA 1T1AA 3RJUA 5DJTA 4JBFA 3ZVWA 3MMHA 2ZMFA 2A49A 5C5KA 3DWZA 4LRZE 1XP4A 4LENA 1YKDA 4K0WA 4R70A 3N6IA 4EUVA 3OPHA 3MXRA 1BLHA 5AJGA 3IS2A 4ZTKA 4KZAA 3DTKA 4N1XA 3CG5A 3G34A 2FZ0A 2JBFA 1K57C 3LIAA 3V39A 3ZHHA 3C2WA 3HUOA 3CAXA 4GD6A 1H8ZA 5EE8A 3ZNYA 1ZHHB 1BT5A 3IH9A 1XKZA 1OT6A 1H8MA 5G18A 2XF3A 5AQ9A 4GOGA 2INWA 3B3XA 1U60A 2IWBA 1UGUA 1T19A 3B42A 2Q9MA 1K25A 3F1PA 1N9LA 2ZBBA 2Y2GA 3T4LA 2Y2OA 4I3AA 4PM8A 5JYOA 3A0SA 3R4KA 1MZUA 4B9OA 4LV3A 1LSVA 1OPXA 1MC0A 4QU3A 1GHMA 1N9OA 1FSWA 3SH8A 2GNXA 1C3BA 1K55C 3F1OA 1OTEA 3BM6A 1L3LA 3U4LP 1J3WA 1DP9A 1FCNA 1IFQA 4KZ7A 4E3OA 3QNBA 5FSRA 5MC7A 2DMWA 2IWDA 1PI4A 3I7JA 3G31A 5DJUA 2WKPA 4MCWA 3K3CA 3UB7A 5E2HA 1JTDA 1H0MA 4Q0IA 1I2WA 3MSHA 3ZG5A 3DTIA 5CX7A 3NBLA 5CEDA 1MWTA 1M6KA 3IF5A 1FR6A 4JPMA 4NKPA 3QP6A 2WZXA 3MXQA 3E98A 2JKGA 2JKRM 2L4RA 3LR3A 4GLQA 3F1PB 1Z6FA 1HZOA 2G7UA 4RA7A 5HARA 2Y2NA 2KX6A 3GECA 1FQGA 4Y0UA 4KQQA 3UN7A 3PYPA 3E4OA 2WKRA 2O0YA 4EEUA 2ZC6B 1MWUA 1ODVA 3E2LA 3FC7A 1TEMA 1LI9A 5FAOA 2A3UA 2PD7A 2ZQ8A 5HWVA 4P0MA 4WN5A 2B02A 4IJGA 3NOUC 5CTNA 1W7FA 5F5YA 3BLSA 2ZD8A 3LFVA 4ZJ3A 4DMZA 1XGJA 5TBMA 1TS7A 3W2ZA 3FPVA 1HTZA 1OJ5A 2WAFA 2VGKA 1S0WA 3UMEA 4ETZA 3H7WB 1K54A 3ZCZA 2W3DA 2A2LA 2XH9A 4KZBA 2W3EA 1OTBA 1W8QA 4YWZA 1IELA 4WZ5C 1XA7A 1K6SA 4R4RA 3RTYA 5EVIB 4QB8A 2BG1A 2XD1A 1SDNA 2V0WA 1EI5A 3OOVA 4EXOA 4DJ3A 4X55A 4Y15A 5FQMA 5FATA 5F69A 3EQUA 3SOIA 3VV4A 4P85A 3VOYA 4XUZA 4DE2A 1BUEA 5J3WA 1WE4A 4Y0OA 3ITAA 3S7OA 3SW1A 2PT7A 3LIEA 1HD8A 5CECA 2OLVA 4CQHA 4QD4A 4LRXC 3T1SA 2A24A 1KGFA 5FQKA 1CI9A 1W63Q 4LV0A 4BENA 5G4ZA 2GDNA 3IWQA 1PW8A 2XQZA 3BQAA 4CLCE 2HDUA 3OBFA 3E4PA 2AVXA 2HJEA 3WS4A 3E4QA 1SDEA 5U47A 1GSWA 4IUHA 1ONHA 3C7VA 3DBAA 5KZHA 1LT0A 3UE3A 1VEUB 3E2KA 5GLDA 4IVKA 2ZMVA 1D7EA 1GSXA 4KQRA 2VGLS 4KZ9A 3LEQA 4S2NA 3LIBA 3VSLA 4OVDA 5I5LA 3KSIA 1OTDA 4EERA 1N4OA 1S1ZA 3C7UA 3D3OA 4I5SA 4JF4A 4X56A 2NUPC 2X71A 4BMWA 1LHYA 4L9FA 4E6WA 2PU2A 2Y91A 3VP0A 3ZG9B 3UNWA 3LO7A 4CLCA 4G3KA 1JWVA 2P9VB 2JE5A 3SS4A 4NXBA 3C38A 3B47A 1NWZA 1JTGA 1X0OA 1H8YA 4H8RA 3VE3A 4OPZA 2G2UA 3PTEA 5IS1A 3C5AA 2ZJ9A 2ZMAA 3ZG8B 2PYPA 3RH8B 5CGSA 4C3QA 4CLCD 2I9VA 4MBHA 4WLAA 1ERQA 4H6JB 4R3BA 3E0YA 4YOFA 2PYRA 3A3EA 2Z6CA 4R3JA 2M1CA 1DP8A 3D9YA 1P9WA 1RGYA 3MZEA 2XDMA 1SKOB 3MJQA 5KIZA 3O3VA 4EETB 2R9WA 1PIOA 1YLPA 4S2IA 5FAQA 3VFHA 1OMEA 2G2WA 1ES2A 1VB6A 3MQOA 4EV4A 3BJNA 3T12B 3G2YA 1T18A 4CLCB 3OZHA 5K5BA 4B4ZA 2HDRA 4WYYA 1E3UA 2XLNA 4P6ZM 2M7UA 1PWDA 3NC8A 5TR7A 4KUKA 4OPYA 2YKHA 3TE8A 3DAVA 5F83A
chains in the Genus database with same CATH topology
4ZTKA 3FV7A 4KZAA 4R1GA 4N1XA 1I5QA 3CG5A 3G34A 3G2ZA 4S2KA 1KE0A 2JBFA 1YLYA 1K57C 1PYYA 1L0DA 1KDSA 1MWSA 3V39A 3ZHHA 3IXBA 4QJGA 3HUOA 4OKPA 1L0EA 1YLJA 4E3KA 5EVID 4GD6A 1Q2PA 1H8ZA 5EE8A 3ZNYA 2V1ZA 3VSKA 2B5RA 4GN2A 1BT5A 1DJCA 3IH9A 4GNUA 3GQZA 4KZ3A 1XKZA 4LCMA 1ZC2A 3SS5A 4HBTA 4GZBA 1YMXA 5G18A 4XXRA 2XF3A 1JWZA 4JKTA 1KVLA 3BECA 4N9LA 4GOGA 5AQ9A 3MZDA 5EUAA 4E3JA 1MKIA 1VQQA 2ZQ9A 5HX9A 4JXSA 3ZVTA 2HDSA 3C4PA 5AQAA 3OCLA 2HDQA 3D4FA 3B3XA 3BFFA 3GRJA 1U60A 4YFMA 4YINA 2IWBA 2Q9MA 1K25A 1ERMA 2OV5A 1CI8A 4RVAA 2Y2GA 3W4QA 4OQ0A 2Y2OA 4PM8A 5I94A 2C6WB 1GHIA 3IHBA 5JYOA 1MBLA 3HLEA 3V50A 3BFEA 3HLBA 3G30A 4LV3A 3LY3A 1KDWA 1Q2QA 2Y2MA 5E2FA 4QU3A 1GHMA 4DF6A 3VP1A 3Q7ZA 3MZFA 2Y59A 3FZCA 2Y2PA 3ITBA 1FSWA 3SH8A 3MKEA 1C3BA 1YLZA 4DXCA 1K55C 1YMSA 2H0YA 2XEPA 3BFDA 4OPQA 3WS2A 4K0XA 5CXWA 5FQ9A 3BM6A 2EFXA 2HPBA 2X01A 2Q9NA 2C5WB 2ZQAA 4FCFA 1FCNA 3AGFA 5FI6A 3ZFZA 2FFFB 2PBYA 4KZ7A 4E3OA 3QNBA 2J9PA 5FSRA 2WKHA 2IWDA 2JCHA 1PI4A 1L2SA 5E2GA 5FQIA 3IXGA 2ZQCA 3I7JA 1FR1A 3G31A 2Y2HA 4DDYA 3GR2A 4Y7PA 4XUXA 5AQBA 4JXWA 3W4OA 5E2HA 1JTDA 4ZJ1A 4HBUA 1LL5A 1SCWA 2ZQ7A 1IYOA 1I2WA 2WGWA 3LY4A 4IVIA 5FI2A 3ZG5A 1TDLA 5M19A 2ZM2A 5DF7A 1J9MA 3NBLA 1LL9A 5CEDA 1MWTA 4R0QA 1DY6A 4OQHA 5CHMA 3FWLA 1NY0A 2H10A 3SH9A 1M6KA 3IF5A 4ZAMA 5DTSA 1RCJA 1H5XA 1FR6A 4JPMA 4X68A 3MFDA 4EBLA 2WZXA 3BFCA 1XA1A 2J7VA 3QNCA 3OPLA 4C75A 1ESIA 4DE1A 1KE3A 2P9VA 1TDGA 5TFQA 4UA9A 2WKIA 1E25A 4WMCA 1Z6FA 1HZOA 3PBOA 1CEGA 4RA7A 3P98A 2Y2NA 5HARA 2OSUA 3EQVA 3BFGA 4KQOA 2WUQA 5HAQA 4X69A 2WYXA 3A3JA 4EBNA 1FQGA 4PM6A 4Y0UA 1W8YA 4KQQA 5CHJA 3UN7A 3OCNA 5GLCA 4BL3A 4DXBA 5AQ7A 5KSCA 1QMFA 3IF6C 2ZC6B 2EX6A 2ZC3B 1MWUA 4U3TA 3E2LA 1FOFA 3IWIA 1EWZA 1TEMA 1LLBA 1PWCA 4JXGA 1LI9A 3OC2A 5FAOA 2EX9A 4C6YA 2QPNA 5IHVA 2A3UA 4JLFA 4BD0A 1ES4A 1CK3A 3NCKA 2ZQ8A 1KE4A 5GHXA 4WMCD 4P0MA 1GA9A 1NJ4A 2ZLYA 3NIAA 3WRTA 2WADA 3NDGA 3G35A 1XPBA 1E3UD 3N8LA 3PBQA 1W7FA 5CTNA 5M18A 3ZG0A 1EROA 2EFUA 3BLSA 2ZD8A 4DRTA 2I72A 3WS5A 3IXDA 4ZJ3A 4QHCA 4M3KA 5CHUA 2Z2LB 3GV9A 3PAEA 2XR0A 3G32A 3VP2A 4ID4A 1IEMA 1XGJA 3UE0A 4WM9A 4OP8A 1K55A 3O88A 4UHUA 3AGDA 3MKFA 5FQJA 3WWXA 1HTZA 4E3MA 2WGWB 2WKEA 3IWOA 4RX2A 4S2JA 4N1HA 3UDFA 5CERA 3W4PA 2WAFA 2VGKA 5E2EA 2WZZA 5HFOA 1S0WA 3RXXA 1ESUA 2ZM0A 1TVFA 5CEBA 1BLPA 1JVJA 2R9XA 4E3LA 1WYBA 3HBRA 1XXMA 1K54A 3ZCZA 3UE1A 3Q7VA 2WGIA 3O86A 1ZG6A 4Z9QA 4KZ5A 4GB7A 5GLAA 1YLWA 4KZ6A 5EECA 2IWCA 4OP5A 2PU4A 3HLDA 5TGFA 3Q81A 2XH9A 4GD8A 4S2NC 3CJMA 3BRMA 4KZBA 2RCXA 1W8QA 3ZG7B 3IHAA 1RP5A 1IELA 2Y2IA 1KGGA 3A3DA 3BYDA 4WZ5C 1K6SA 1XA7A 4K91A 4R4RA 4CPKA 4D2OA 4EBPA 1N9BA 5EVIB 2DNSA 4QB8A 5F1FA 2BG1A 2XD1A 4PM5A 1YLTA 1SDNA 2XFSA 4MBKA 4UA7A 1EI5A 1Y54A 5E43A 1PZOA 1SKFA 4X55A 3PBNA 1IYQA 5M1AA 3S1YA 3FYZA 1NRFA 1NYYA 3HLCA 3P09A 3WS1A 1ZKJA 3DTMA 3NY4A 5FQMA 3TOIA 4U0TA 5FATA 2RL3A 1JWPA 3EQUA 5EVLA 5FASA 3SOIA 3O87A 5F1GA 1E4DA 3M2JA 2Y2LA 4P85A 4OONA 4LV2A 3VOYA 5A93A 4X53A 4XUZA 4DE2A 5EPHA 1BUEA 3HLGA 5HAPA 3DW0A 5EOOA 2ZQDA 3HL9A 1WE4A 4Y0OA 3ITAA 3DWKA 1VM1A 4EWFA 1XX2A 3UY6A 5BOHA 2WGVA 1HD8A 1W5DA 4NETA 4ZBEA 4BJPA 4BL2A 5CECA 4E6XA 2OLVA 1W79A 1BZAA 4HESA 4QD4A 1G6AA 2WK0A 5F82A 2ZC4B 1BLSA 4EQIA 1KGFA 3VFFA 5FQKA 1YQSA 5FAPA 1CI9A 3NI9A 3IF6A 4RX3A 1BSGA 3HUNA 4LV0A 1FCMA 4BENA 2GDNA 4ZJ2A 3VOZA 2VGJA 3IWQA 4JF6A 2ZC5B 2DCFA 1BLCA 5J8XA 2JC7A 4GDNA 1GA0A 1ZG4A 4EUZA 4E3IA 1PW8A 3WRZA 3A3IA 2XQZA 2BLSA 2FFYA 2ZM8A 3Q82A 4MBFA 4OLDA 4Y0TA 1ES5A 1K57A 2HDUA 4MEZA 1AXBA 4OOYA 4QY6A 1IYPA 1FSYA 3MXSA 5A90A 4IEDA 1MXOA 2HP5A 1LI0A 1BULA 1NZOA 3M6HA 4WZ4A 5DVAA 4E3NA 3ZNTA 3OPRA 4FSFA 5GL9A 3SS3A 1ES3A 3LCEA 5D3OA 3WS4A 4FH2A 5FA7A 4NK3A 1SDEA 3HVFA 4IBRA 3VP3A 1IKIA 5U47A 1BTLA 4LCLA 3N8RA 1ALQA 1K38A 3QHYA 4O7DA 1ONHA 3Q07A 3BLMA 3C7VA 1KVMA 3IT9A 2EX8A 5KZHA 3UE3A 3E2KA 3GVBA 3VMAA 1PZPA 5GLDA 4OQIA 4RYEA 4KZ4A 4WELA 4IVKA 1IKGA 1K6RA 1NYMA 2XGNA 3IXHA 4MNRA 5JYPA 3HREA 1DJAA 4FD8A 1YT4A 4U0XA 4PM7A 1FCOA 1IYSA 3HUMA 3A3FA 4KQRA 1ONGA 4PMAA 1L0FA 4KZ9A 1O7EA 3UPOA 2Y2QA 4QY5A 4S2NA 2HP9A 5CRFA 2QZ6A 3VSLA 4S2MA 4WBGA 3N4IA 3W8KA 3M6BA 4OVDA 4WZ5A 1GHPA 2DRWA 1N4OA 4PM9A 4KZ8A 5EVIC 5HW3A 1WYCA 3AGEA 3C7UA 4S2LA 2Y4AA 4F94A 4S2OA 2XFTA 4JF4A 4X56A 4KG6A 2X71A 1MY8A 2H5SA 3N7WA 1LHYA 3IF6B 2Y2JA 4E6WA 2PU2A 2CC1A 2Y91A 1PWGA 5DTKA 3VP0A 3ZG9B 2Y55A 5GLBA 3TSGA 2J9OA 1CEFA 3UNWA 3LO7A 2OLUA 4DDSA 1JWVA 3Q1FA 2P9VB 4OH0A 2JE5A 3PBTA 3SS4A 1JTGA 4JF5A 1H8YA 1SHVA 4H8RA 5CTMA 5DF9A 4N92A 4DKIA 2UWXA 3UPNA 3ZGAB 5EOEA 3S4XA 2XD5A 2XK1A 4OPZA 2ZC7A 2G2UA 1O07A 4OPRA 3PTEA 5DF8A 4UA6A 2WAEA 3C5AA 3CMZA 1S6RA 4B88A 2ZJ9A 4OLGA 3V5MA 2ZMAA 4WEKA 5L2FA 3OPPA 3G4PA 3ZG8B 4GDBA 4L0LA 4HEFA 4BD1A 5CGSA 4C3QA 5GHZA 4UAAA 3IH8A 2X02A 4MBHA 1ERQA 3CZDA 1PI5A 3BEBA 4R3BA 1G68A 4PPRA 3JYIA 3RXWA 4CJNA 3UPPA 3A3EA 4OOMA 4DE0A 1K54C 3UDIA 5KMWA 3PBSA 4IBXA 4R3JA 4LV1A 3TG9A 4KENB 1K4EA 4N9KA 3S22A 1MWRA 4DE3A 3PAGA 4R23A 5FI7A 2Y2KA 1K56A 2HP6A 1DJBA 4WEJA 3GTCA 2E8IA 3N8SA 2QMIA 1RGYA 5DTTA 1I2SA 3MZEA 1NXYA 3MBZA 2XDMA 3NDEA 5HAIA 2J8YA 4GKUA 1L0GA 3FKWA 3V3SA 3O3VA 4OOLA 3VP4A 4R4SA 3FKVA 2H0TA 3GMWA 3WS0A 5A91A 5CGWA 4Q8IA 2R9WA 3Q7VB 1HVBA 1PIOA 3IQAA 4P6BA 1QMEA 5GHYA 2Z2MB 3C4OA 3SH7A 1RGZA 5HL1A 1YLPA 4S2IA 5FAQA 3VFHA 3PBRA 1OMEA 2G2WA 1ES2A 4KG2A 1GCEA 4EV4A 4A5RA 4MLLA 3G2YA 5A92A 2EXAA 4JXVA 1YM1A 4FH4A 3V3RA 4OQGA 3ZDJA 1NZUA 3OZHA 1K56D 4P87A 5FDHA 1KGEA 2V2FF 4ZDXA 4B4ZA 2HDRA 3RJUA 3UO9A 4WYYA 4JBFA 3ZVWA 3HLWA 5EVIA 1E3UA 1PW1A 4BLMA 2XLNA 5KSHA 3ISGA 1XGIA 4S2PA 3UDXA 4X6TA 2A49A 1PWDA 3DWZA 3LEZA 3NC8A 1K4FA 2EX2A 1XP4A 4KG5A 5TR7A 4OPYA 4BQMA 4B4XA 4LENA 4K0WA 2V20A 3N6IA 5CGXA 5FQQA 3GSGA 3OPHA 1MPLA 3MXRA 2P74A 5F83A 2EXBA 1BLHA 1M40A 3HLFA 3M2KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZTK A;  3FV7 A;  4KZA A;  4R1G A;  4N1X A;  1I5Q A;  3CG5 A;  3G34 A;  3G2Z A;  4S2K A;  1KE0 A;  2JBF A;  1YLY A;  1K57 C;  1PYY A;  1L0D A;  1KDS A;  1MWS A;  3V39 A;  3ZHH A;  3IXB A;  4QJG A;  3HUO A;  4OKP A;  1L0E A;  1YLJ A;  4E3K A;  5EVI D;  4GD6 A;  1Q2P A;  1H8Z A;  5EE8 A;  3ZNY A;  2V1Z A;  3VSK A;  2B5R A;  4GN2 A;  1BT5 A;  1DJC A;  3IH9 A;  4GNU A;  3GQZ A;  4KZ3 A;  1XKZ A;  4LCM A;  1ZC2 A;  3SS5 A;  4HBT A;  4GZB A;  1YMX A;  5G18 A;  4XXR A;  2XF3 A;  1JWZ A;  4JKT A;  1KVL A;  3BEC A;  4N9L A;  4GOG A;  5AQ9 A;  3MZD A;  5EUA A;  4E3J A;  1MKI A;  1VQQ A;  2ZQ9 A;  5HX9 A;  4JXS A;  3ZVT A;  2HDS A;  3C4P A;  5AQA A;  3OCL A;  2HDQ A;  3D4F A;  3B3X A;  3BFF A;  3GRJ A;  1U60 A;  4YFM A;  4YIN A;  2IWB A;  2Q9M A;  1K25 A;  1ERM A;  2OV5 A;  1CI8 A;  4RVA A;  2Y2G A;  3W4Q A;  4OQ0 A;  2Y2O A;  4PM8 A;  5I94 A;  2C6W B;  1GHI A;  3IHB A;  5JYO A;  1MBL A;  3HLE A;  3V50 A;  3BFE A;  3HLB A;  3G30 A;  4LV3 A;  3LY3 A;  1KDW A;  1Q2Q A;  2Y2M A;  5E2F A;  4QU3 A;  1GHM A;  4DF6 A;  3VP1 A;  3Q7Z A;  3MZF A;  2Y59 A;  3FZC A;  2Y2P A;  3ITB A;  1FSW A;  3SH8 A;  3MKE A;  1C3B A;  1YLZ A;  4DXC A;  1K55 C;  1YMS A;  2H0Y A;  2XEP A;  3BFD A;  4OPQ A;  3WS2 A;  4K0X A;  5CXW A;  5FQ9 A;  3BM6 A;  2EFX A;  2HPB A;  2X01 A;  2Q9N A;  2C5W B;  2ZQA A;  4FCF A;  1FCN A;  3AGF A;  5FI6 A;  3ZFZ A;  2FFF B;  2PBY A;  4KZ7 A;  4E3O A;  3QNB A;  2J9P A;  5FSR A;  2WKH A;  2IWD A;  2JCH A;  1PI4 A;  1L2S A;  5E2G A;  5FQI A;  3IXG A;  2ZQC A;  3I7J A;  1FR1 A;  3G31 A;  2Y2H A;  4DDY A;  3GR2 A;  4Y7P A;  4XUX A;  5AQB A;  4JXW A;  3W4O A;  5E2H A;  1JTD A;  4ZJ1 A;  4HBU A;  1LL5 A;  1SCW A;  2ZQ7 A;  1IYO A;  1I2W A;  2WGW A;  3LY4 A;  4IVI A;  5FI2 A;  3ZG5 A;  1TDL A;  5M19 A;  2ZM2 A;  5DF7 A;  1J9M A;  3NBL A;  1LL9 A;  5CED A;  1MWT A;  4R0Q A;  1DY6 A;  4OQH A;  5CHM A;  3FWL A;  1NY0 A;  2H10 A;  3SH9 A;  1M6K A;  3IF5 A;  4ZAM A;  5DTS A;  1RCJ A;  1H5X A;  1FR6 A;  4JPM A;  4X68 A;  3MFD A;  4EBL A;  2WZX A;  3BFC A;  1XA1 A;  2J7V A;  3QNC A;  3OPL A;  4C75 A;  1ESI A;  4DE1 A;  1KE3 A;  2P9V A;  1TDG A;  5TFQ A;  4UA9 A;  2WKI A;  1E25 A;  4WMC A;  1Z6F A;  1HZO A;  3PBO A;  1CEG A;  4RA7 A;  3P98 A;  2Y2N A;  5HAR A;  2OSU A;  3EQV A;  3BFG A;  4KQO A;  2WUQ A;  5HAQ A;  4X69 A;  2WYX A;  3A3J A;  4EBN A;  1FQG A;  4PM6 A;  4Y0U A;  1W8Y A;  4KQQ A;  5CHJ A;  3UN7 A;  3OCN A;  5GLC A;  4BL3 A;  4DXB A;  5AQ7 A;  5KSC A;  1QMF A;  3IF6 C;  2ZC6 B;  2EX6 A;  2ZC3 B;  1MWU A;  4U3T A;  3E2L A;  1FOF A;  3IWI A;  1EWZ A;  1TEM A;  1LLB A;  1PWC A;  4JXG A;  1LI9 A;  3OC2 A;  5FAO A;  2EX9 A;  4C6Y A;  2QPN A;  5IHV A;  2A3U A;  4JLF A;  4BD0 A;  1ES4 A;  1CK3 A;  3NCK A;  2ZQ8 A;  1KE4 A;  5GHX A;  4WMC D;  4P0M A;  1GA9 A;  1NJ4 A;  2ZLY A;  3NIA A;  3WRT A;  2WAD A;  3NDG A;  3G35 A;  1XPB A;  1E3U D;  3N8L A;  3PBQ A;  1W7F A;  5CTN A;  5M18 A;  3ZG0 A;  1ERO A;  2EFU A;  3BLS A;  2ZD8 A;  4DRT A;  2I72 A;  3WS5 A;  3IXD A;  4ZJ3 A;  4QHC A;  4M3K A;  5CHU A;  2Z2L B;  3GV9 A;  3PAE A;  2XR0 A;  3G32 A;  3VP2 A;  4ID4 A;  1IEM A;  1XGJ A;  3UE0 A;  4WM9 A;  4OP8 A;  1K55 A;  3O88 A;  4UHU A;  3AGD A;  3MKF A;  5FQJ A;  3WWX A;  1HTZ A;  4E3M A;  2WGW B;  2WKE A;  3IWO A;  4RX2 A;  4S2J A;  4N1H A;  3UDF A;  5CER A;  3W4P A;  2WAF A;  2VGK A;  5E2E A;  2WZZ A;  5HFO A;  1S0W A;  3RXX A;  1ESU A;  2ZM0 A;  1TVF A;  5CEB A;  1BLP A;  1JVJ A;  2R9X A;  4E3L A;  1WYB A;  3HBR A;  1XXM A;  1K54 A;  3ZCZ A;  3UE1 A;  3Q7V A;  2WGI A;  3O86 A;  1ZG6 A;  4Z9Q A;  4KZ5 A;  4GB7 A;  5GLA A;  1YLW A;  4KZ6 A;  5EEC A;  2IWC A;  4OP5 A;  2PU4 A;  3HLD A;  5TGF A;  3Q81 A;  2XH9 A;  4GD8 A;  4S2N C;  3CJM A;  3BRM A;  4KZB A;  2RCX A;  1W8Q A;  3ZG7 B;  3IHA A;  1RP5 A;  1IEL A;  2Y2I A;  1KGG A;  3A3D A;  3BYD A;  4WZ5 C;  1K6S A;  1XA7 A;  4K91 A;  4R4R A;  4CPK A;  4D2O A;  4EBP A;  1N9B A;  5EVI B;  2DNS A;  4QB8 A;  5F1F A;  2BG1 A;  2XD1 A;  4PM5 A;  1YLT A;  1SDN A;  2XFS A;  4MBK A;  4UA7 A;  1EI5 A;  1Y54 A;  5E43 A;  1PZO A;  1SKF A;  4X55 A;  3PBN A;  1IYQ A;  5M1A A;  3S1Y A;  3FYZ A;  1NRF A;  1NYY A;  3HLC A;  3P09 A;  3WS1 A;  1ZKJ A;  3DTM A;  3NY4 A;  5FQM A;  3TOI A;  4U0T A;  5FAT A;  2RL3 A;  1JWP A;  3EQU A;  5EVL A;  5FAS A;  3SOI A;  3O87 A;  5F1G A;  1E4D A;  3M2J A;  2Y2L A;  4P85 A;  4OON A;  4LV2 A;  3VOY A;  5A93 A;  4X53 A;  4XUZ A;  4DE2 A;  5EPH A;  1BUE A;  3HLG A;  5HAP A;  3DW0 A;  5EOO A;  2ZQD A;  3HL9 A;  1WE4 A;  4Y0O A;  3ITA A;  3DWK A;  1VM1 A;  4EWF A;  1XX2 A;  3UY6 A;  5BOH A;  2WGV A;  1HD8 A;  1W5D A;  4NET A;  4ZBE A;  4BJP A;  4BL2 A;  5CEC A;  4E6X A;  2OLV A;  1W79 A;  1BZA A;  4HES A;  4QD4 A;  1G6A A;  2WK0 A;  5F82 A;  2ZC4 B;  1BLS A;  4EQI A;  1KGF A;  3VFF A;  5FQK A;  1YQS A;  5FAP A;  1CI9 A;  3NI9 A;  3IF6 A;  4RX3 A;  1BSG A;  3HUN A;  4LV0 A;  1FCM A;  4BEN A;  2GDN A;  4ZJ2 A;  3VOZ A;  2VGJ A;  3IWQ A;  4JF6 A;  2ZC5 B;  2DCF A;  1BLC A;  5J8X A;  2JC7 A;  4GDN A;  1GA0 A;  1ZG4 A;  4EUZ A;  4E3I A;  1PW8 A;  3WRZ A;  3A3I A;  2XQZ A;  2BLS A;  2FFY A;  2ZM8 A;  3Q82 A;  4MBF A;  4OLD A;  4Y0T A;  1ES5 A;  1K57 A;  2HDU A;  4MEZ A;  1AXB A;  4OOY A;  4QY6 A;  1IYP A;  1FSY A;  3MXS A;  5A90 A;  4IED A;  1MXO A;  2HP5 A;  1LI0 A;  1BUL A;  1NZO A;  3M6H A;  4WZ4 A;  5DVA A;  4E3N A;  3ZNT A;  3OPR A;  4FSF A;  5GL9 A;  3SS3 A;  1ES3 A;  3LCE A;  5D3O A;  3WS4 A;  4FH2 A;  5FA7 A;  4NK3 A;  1SDE A;  3HVF A;  4IBR A;  3VP3 A;  1IKI A;  5U47 A;  1BTL A;  4LCL A;  3N8R A;  1ALQ A;  1K38 A;  3QHY A;  4O7D A;  1ONH A;  3Q07 A;  3BLM A;  3C7V A;  1KVM A;  3IT9 A;  2EX8 A;  5KZH A;  3UE3 A;  3E2K A;  3GVB A;  3VMA A;  1PZP A;  5GLD A;  4OQI A;  4RYE A;  4KZ4 A;  4WEL A;  4IVK A;  1IKG A;  1K6R A;  1NYM A;  2XGN A;  3IXH A;  4MNR A;  5JYP A;  3HRE A;  1DJA A;  4FD8 A;  1YT4 A;  4U0X A;  4PM7 A;  1FCO A;  1IYS A;  3HUM A;  3A3F A;  4KQR A;  1ONG A;  4PMA A;  1L0F A;  4KZ9 A;  1O7E A;  3UPO A;  2Y2Q A;  4QY5 A;  4S2N A;  2HP9 A;  5CRF A;  2QZ6 A;  3VSL A;  4S2M A;  4WBG A;  3N4I A;  3W8K A;  3M6B A;  4OVD A;  4WZ5 A;  1GHP A;  2DRW A;  1N4O A;  4PM9 A;  4KZ8 A;  5EVI C;  5HW3 A;  1WYC A;  3AGE A;  3C7U A;  4S2L A;  2Y4A A;  4F94 A;  4S2O A;  2XFT A;  4JF4 A;  4X56 A;  4KG6 A;  2X71 A;  1MY8 A;  2H5S A;  3N7W A;  1LHY A;  3IF6 B;  2Y2J A;  4E6W A;  2PU2 A;  2CC1 A;  2Y91 A;  1PWG A;  5DTK A;  3VP0 A;  3ZG9 B;  2Y55 A;  5GLB A;  3TSG A;  2J9O A;  1CEF A;  3UNW A;  3LO7 A;  2OLU A;  4DDS A;  1JWV A;  3Q1F A;  2P9V B;  4OH0 A;  2JE5 A;  3PBT A;  3SS4 A;  1JTG A;  4JF5 A;  1H8Y A;  1SHV A;  4H8R A;  5CTM A;  5DF9 A;  4N92 A;  4DKI A;  2UWX A;  3UPN A;  3ZGA B;  5EOE A;  3S4X A;  2XD5 A;  2XK1 A;  4OPZ A;  2ZC7 A;  2G2U A;  1O07 A;  4OPR A;  3PTE A;  5DF8 A;  4UA6 A;  2WAE A;  3C5A A;  3CMZ A;  1S6R A;  4B88 A;  2ZJ9 A;  4OLG A;  3V5M A;  2ZMA A;  4WEK A;  5L2F A;  3OPP A;  3G4P A;  3ZG8 B;  4GDB A;  4L0L A;  4HEF A;  4BD1 A;  5CGS A;  4C3Q A;  5GHZ A;  4UAA A;  3IH8 A;  2X02 A;  4MBH A;  1ERQ A;  3CZD A;  1PI5 A;  3BEB A;  4R3B A;  1G68 A;  4PPR A;  3JYI A;  3RXW A;  4CJN A;  3UPP A;  3A3E A;  4OOM A;  4DE0 A;  1K54 C;  3UDI A;  5KMW A;  3PBS A;  4IBX A;  4R3J A;  4LV1 A;  3TG9 A;  4KEN B;  1K4E A;  4N9K A;  3S22 A;  1MWR A;  4DE3 A;  3PAG A;  4R23 A;  5FI7 A;  2Y2K A;  1K56 A;  2HP6 A;  1DJB A;  4WEJ A;  3GTC A;  2E8I A;  3N8S A;  2QMI A;  1RGY A;  5DTT A;  1I2S A;  3MZE A;  1NXY A;  3MBZ A;  2XDM A;  3NDE A;  5HAI A;  2J8Y A;  4GKU A;  1L0G A;  3FKW A;  3V3S A;  3O3V A;  4OOL A;  3VP4 A;  4R4S A;  3FKV A;  2H0T A;  3GMW A;  3WS0 A;  5A91 A;  5CGW A;  4Q8I A;  2R9W A;  3Q7V B;  1HVB A;  1PIO A;  3IQA A;  4P6B A;  1QME A;  5GHY A;  2Z2M B;  3C4O A;  3SH7 A;  1RGZ A;  5HL1 A;  1YLP A;  4S2I A;  5FAQ A;  3VFH A;  3PBR A;  1OME A;  2G2W A;  1ES2 A;  4KG2 A;  1GCE A;  4EV4 A;  4A5R A;  4MLL A;  3G2Y A;  5A92 A;  2EXA A;  4JXV A;  1YM1 A;  4FH4 A;  3V3R A;  4OQG A;  3ZDJ A;  1NZU A;  3OZH A;  1K56 D;  4P87 A;  5FDH A;  1KGE A;  2V2F F;  4ZDX A;  4B4Z A;  2HDR A;  3RJU A;  3UO9 A;  4WYY A;  4JBF A;  3ZVW A;  3HLW A;  5EVI A;  1E3U A;  1PW1 A;  4BLM A;  2XLN A;  5KSH A;  3ISG A;  1XGI A;  4S2P A;  3UDX A;  4X6T A;  2A49 A;  1PWD A;  3DWZ A;  3LEZ A;  3NC8 A;  1K4F A;  2EX2 A;  1XP4 A;  4KG5 A;  5TR7 A;  4OPY A;  4BQM A;  4B4X A;  4LEN A;  4K0W A;  2V20 A;  3N6I A;  5CGX A;  5FQQ A;  3GSG A;  3OPH A;  1MPL A;  3MXR A;  2P74 A;  5F83 A;  2EXB A;  1BLH A;  1M40 A;  3HLF A;  3M2K A; 
#chains in the Genus database with same CATH topology
 1I5Q A;  4O0P A;  4S2K A;  2B18 A;  2D01 A;  1L0D A;  1KDS A;  4NG2 A;  1L0E A;  2V1Z A;  2B5R A;  4GN2 A;  4K08 A;  3L9K A;  1DJC A;  3GQZ A;  2VK3 A;  1ZC2 A;  1YMX A;  4XXR A;  2O9A A;  2L1M A;  5EUA A;  3MZD A;  5HX9 A;  3ZVT A;  3C4P A;  5AQA A;  1P97 A;  2HDQ A;  3D4F A;  3GRJ A;  4YIN A;  2ZL1 B;  1ERM A;  3W4Q A;  4OQ0 A;  4ETX A;  5I94 A;  2JHE A;  1GHI A;  4UEY A;  1MBL A;  4HP9 A;  3G30 A;  2WKQ A;  5E2F A;  3FZC A;  3ITB A;  4Q0H A;  4DXC A;  4WF0 A;  1F5M A;  4GJ4 A;  2HPB A;  2Q9N A;  3P01 A;  1UWN X;  1PFL A;  2WKH A;  1L2S A;  5E2G A;  4HJ6 A;  2PRF A;  3P7N A;  2ZQC A;  2YKF A;  3GR2 A;  3VOL A;  4XUX A;  4JXW A;  3LY4 A;  1LL5 A;  1SCW A;  2ZQ7 A;  1IYO A;  2WGW A;  5M19 A;  2VEA A;  3T4S A;  1MKM A;  2OOL A;  1J9M A;  3KYE A;  4R0Q A;  5CHM A;  3FWL A;  5A8B A;  1STZ A;  3SH9 A;  5J7E A;  5DTS A;  3JVU A;  4X68 A;  3MFD A;  1CJF A;  3QNC A;  2L0W A;  4F3L B;  4UA9 A;  5L10 A;  4GS9 A;  5FEF A;  4X69 A;  3A3J A;  4PM6 A;  5GLC A;  4BL3 A;  2JKT M;  3T4Q A;  4BBT A;  5KSC A;  1PRQ A;  3OC2 A;  4YNR A;  5IHV A;  3IX4 A;  2O9C A;  1TF1 A;  3NCK A;  3D72 A;  3NUL A;  2ZOH A;  3IBR A;  1NRJ A;  2WAD A;  3N8L A;  4DRT A;  2JKF A;  4GHI A;  2CMN A;  5HWT A;  2Z6D A;  4ID4 A;  1IEM A;  4WM9 A;  5HDC A;  4OP8 A;  1K55 A;  3O88 A;  4UHU A;  3V67 A;  3MKF A;  2WGW B;  3W4P A;  4O01 A;  1DP6 A;  3S7P A;  5CEB A;  4HQA A;  4E3L A;  3HBR A;  3QP1 A;  1XXM A;  3O86 A;  1ZG6 A;  2V8F A;  4GB7 A;  1LSW A;  4NXG A;  2IWC A;  4OP5 A;  4KQD A;  4GD8 A;  4JGP A;  2RCX A;  4Y13 A;  3ZG7 B;  3IHA A;  1RP5 A;  4GS9 B;  2VKS A;  4CPK A;  3MS6 A;  4ME4 A;  1N9B A;  2XFS A;  3C8C A;  5DFY A;  3PBN A;  1IYQ A;  5M1A A;  1S4R A;  3S1Y A;  1NRF A;  2W1R A;  3DTM A;  3ZQ5 A;  3KX0 X;  3IS2 B;  3O87 A;  1E4D A;  4OON A;  5EOO A;  3HL9 A;  3EGD C;  5G4Y A;  2JKR I;  2R78 A;  1VM1 A;  3UY6 A;  2WGV A;  4ZBE A;  2ACG A;  4B93 A;  4E6X A;  3PHY A;  3A0V A;  1BZA A;  2ZC4 B;  1BLS A;  4HJ4 A;  4GHI B;  1CF0 A;  4EQI A;  1YQS A;  3QP4 A;  3NI9 A;  1FCM A;  2OAQ 1;  1BLC A;  1GA0 A;  3WRZ A;  2ZM8 A;  4OLD A;  2FFY A;  1AXB A;  4QY6 A;  5A90 A;  4HOI A;  1MXO A;  2HP5 A;  1BUL A;  3A0R A;  4E3N A;  3OPR A;  3SS3 A;  1ES3 A;  1XFQ A;  5D3O A;  4FH2 A;  3PXP A;  5FA7 A;  3HVF A;  1TS8 A;  2KLI A;  3EOI A;  4HIA A;  3F1O B;  5L07 A;  2O99 A;  1K38 A;  3QHY A;  4O7D A;  3Q07 A;  3CUE C;  1KVM A;  3VMA A;  4R6L A;  1PZP A;  2OWJ A;  2XGN A;  4G3V A;  5JYP A;  4U0X A;  1IYS A;  3HUM A;  1ONG A;  5AVE A;  1O7E A;  2Y2Q A;  5CRF A;  3ICY A;  4WBG A;  3N4I A;  1KOU A;  4WZ5 A;  3CWF A;  2W3H A;  1GHP A;  2J3T D;  2DRW A;  4PM9 A;  5EVI C;  5HW3 A;  1WYC A;  4F94 A;  4S2O A;  1WA9 A;  3RFB A;  4HI4 A;  4KG6 A;  5FEG A;  2VV6 A;  2UV0 E;  1G28 A;  3UB8 A;  1HLU P;  1EW0 A;  3MQQ A;  3CPT A;  4OH0 A;  2LB9 A;  3PBT A;  3DTE A;  3KO6 A;  5F6A A;  3T4T A;  1SHV A;  4NXE A;  1TD5 A;  2XD5 A;  2JN7 A;  5IU1 A;  2XK1 A;  3TJZ C;  2ZC7 A;  3L7H A;  4UA6 A;  2WAE A;  1UWP X;  3CMZ A;  4B88 A;  4HEF A;  2X02 A;  4R38 A;  1H3Q A;  3MFX A;  3JYI A;  2V0U A;  1K54 C;  5KMW A;  1SZV A;  3TG9 A;  3KYZ A;  4N9K A;  4FTX A;  3K2N A;  3PAG A;  4R23 A;  2Y2K A;  5TBM B;  2J3W A;  2HP6 A;  3F1N A;  3QP2 A;  4PKY A;  3IX8 A;  1YPR A;  5TJJ A;  5HAI A;  2J8Y A;  1S4S A;  3CHW P;  3FKW A;  4OOL A;  3T1X A;  3GMW A;  2Y79 A;  4Q8I A;  1QME A;  5HL1 A;  3IX3 A;  5EM1 A;  3CPT B;  1NZU A;  1OT9 A;  1V9Z A;  1KGE A;  5FDS A;  3UO9 A;  4E04 A;  4BLM A;  5KSH A;  4S2P A;  3UDX A;  4X6T A;  1G5U A;  2GJ3 A;  3LEZ A;  2O9B A;  4BQM A;  4B4X A;  2VV8 A;  3T1Q B;  2ZOI A;  5FQQ A;  3GSG A;  1MPL A;  2KDK A;  4HY8 A;  3MBZ A;  2VV7 A;  2H28 A;  3FV7 A;  1Y4O A;  2BAS A;  4Y3I A;  1XJ2 A;  1KE0 A;  3NHQ A;  5EFW A;  1MWS A;  3IXB A;  2K2N A;  1YLJ A;  4E3K A;  3R7W A;  2A24 B;  3T50 A;  4GNU A;  1D1J A;  3EGX C;  3EEH A;  3LI9 A;  3MF0 A;  3SS5 A;  4HBT A;  4GZB A;  1JWZ A;  4JKT A;  1KVL A;  3BEC A;  4E3J A;  5A92 A;  3F1N B;  3OCL A;  3BFF A;  4ZRR A;  3JVV A;  4MN6 A;  2XSS A;  2OV5 A;  4ARZ A;  3IHB A;  3V50 A;  3HLB A;  1A0K A;  4IUK A;  1KDW A;  1Q2Q A;  2Y2M A;  4I38 A;  3Q7Z A;  3MZF A;  2Y59 A;  4UQI S;  2Y2P A;  2V9A A;  3MKE A;  1YLZ A;  1YMS A;  2H0Y A;  2XEP A;  4OPQ A;  3WS2 A;  4K0X A;  2BTF P;  5CXW A;  5FQ9 A;  2EFX A;  2HF6 A;  2X01 A;  2ZQA A;  3ZFZ A;  3BWL A;  2J9P A;  5FQI A;  2VLG A;  5HD3 A;  2Y2H A;  4JGQ A;  4PHT A;  4CLC C;  5FL3 A;  4Y7P A;  3LIC A;  3W4O A;  2QJ5 A;  3B33 A;  4ZJ1 A;  4HBU A;  1TS6 A;  5FI2 A;  4JGO A;  4EW7 A;  1TDL A;  2ZM2 A;  4Y17 A;  1DY6 A;  1NY0 A;  2H10 A;  4ZAM A;  3BFC A;  1XA1 A;  2J7V A;  3OPL A;  4C75 A;  1ESI A;  4DE1 A;  1KE3 A;  3H82 A;  1TDG A;  5TFQ A;  3HCY A;  3PBO A;  2OSU A;  5HAQ A;  2WUQ A;  1OJG A;  4NXF A;  2WYX A;  4EBN A;  4XT2 A;  3OCN A;  4DXB A;  5AQ7 A;  1QMF A;  3IF6 C;  4U3T A;  1FOF A;  3LIF A;  2Y8H A;  1W63 M;  3HJI A;  4BD0 A;  1ES4 A;  1CK3 A;  5HZH A;  1KE4 A;  5GHX A;  3CI6 A;  1NJ4 A;  2ZLY A;  3NIA A;  1ZTU A;  3WRT A;  3NDG A;  1XPB A;  1E3U D;  5M18 A;  1ERO A;  2I72 A;  3ULF A;  3FPW A;  1XJ3 A;  4QHC A;  3PAE A;  2XR0 A;  3VP2 A;  3K3D A;  3UE0 A;  3AGD A;  2WKE A;  4S2J A;  4N1H A;  3UDF A;  3KSG A;  2WZZ A;  4ESP A;  2HZ5 A;  3RXX A;  1BLP A;  2R9X A;  4QPR A;  4X1L A;  4DJ2 A;  3UE6 A;  3Q7V A;  2WGI A;  4Z9Q A;  1GSV A;  4KZ6 A;  5EEC A;  2PU4 A;  3HLD A;  3Q81 A;  4JGR A;  3LR4 A;  3EEA A;  4MDZ A;  4Q0J A;  2OAP 1;  2OWH A;  4K91 A;  4EBP A;  5F1F A;  4KUO A;  1F9I A;  3JPU A;  4MBK A;  5HL6 A;  4L9G A;  1Y54 A;  5E43 A;  1SKF A;  3FYZ A;  1NLY A;  5DKL A;  3NY4 A;  3TOI A;  4MMN A;  2RL3 A;  2K31 A;  2V1A A;  2VGL M;  4I3I A;  4LLO B;  3GDI A;  3M2J A;  2Y2L A;  4LV2 A;  4X53 A;  3HLG A;  3DW0 A;  2VX8 A;  4EWF A;  1XX2 A;  5BOH A;  1W5D A;  4BJP A;  1W79 A;  3BY9 A;  3OLO A;  4HES A;  4Y2F A;  1FIL A;  3VFF A;  4RX3 A;  4ZJ2 A;  2VGJ A;  2JKT I;  4DN0 A;  2IA2 A;  2ZC5 B;  2W0N A;  4E3I A;  3A3I A;  5EM0 A;  2BLS A;  4X25 A;  1ES5 A;  1K57 A;  4MEZ A;  4OOY A;  1IYP A;  3MXS A;  4I39 A;  3S7Q A;  4IED A;  3M6H A;  3ZNT A;  3C30 A;  2PD8 A;  4FSF A;  4EEP A;  4IBR A;  4UQI M;  1TS0 A;  1YSP A;  3N8R A;  1ALQ A;  1LL8 A;  2PR5 A;  3GVB A;  4RYE A;  1K0K A;  1IKG A;  1K6R A;  1NYM A;  2W27 A;  3IXH A;  4MNR A;  4FD8 A;  1YT4 A;  1FCO A;  4PMA A;  4WL9 A;  2PAV P;  3UPO A;  4QY5 A;  3MR0 A;  3S7N A;  2QZ6 A;  3W8K A;  3M6B A;  3VE4 A;  1YSQ A;  3UB6 A;  1BYW A;  4KZ8 A;  3AGE A;  4S2L A;  2Y4A A;  4PAU A;  2XFT A;  2H5S A;  3LUQ A;  2Y2J A;  2CC1 A;  4HJ3 A;  1PWG A;  5DTK A;  2Y55 A;  5GLB A;  3TSG A;  1VHM A;  4DDS A;  3LYX A;  3Q1F A;  5DF9 A;  4N92 A;  4DKI A;  2UWX A;  3UPN A;  5EOE A;  2FH5 A;  1S6R A;  5L2F A;  4OLG A;  3V5M A;  4BD1 A;  5GHZ A;  5HDD A;  3BEB A;  3CLO A;  4PPR A;  4CJN A;  2EA9 A;  3UDI A;  2P08 A;  2B95 A;  4IBX A;  1K4E A;  4O8G A;  3S22 A;  3BY8 A;  4M4X A;  5FI7 A;  2GZA A;  1K56 A;  1DJB A;  3GTC A;  3T4J A;  4MN5 A;  5DTT A;  3LR0 A;  1NXY A;  3CUE A;  1FIK A;  3NDE A;  3IBJ A;  4GKU A;  1L0G A;  2VZW A;  3V3S A;  5HPI A;  3KYQ A;  4LRY C;  3ZYT A;  3FKV A;  2H0T A;  3WS0 A;  1HVB A;  3H7W A;  1JNU A;  2Z2M B;  3C4O A;  4I3J A;  3PBR A;  4KG2 A;  1GCE A;  2KOI A;  1P9R A;  4OQG A;  1K56 D;  4ZDX A;  2V2F F;  2M7V A;  3HLW A;  2W3F A;  4II7 A;  5EVI A;  1PW1 A;  3ISG A;  1XGI A;  2E8J A;  1K4F A;  2EX2 A;  2W1T A;  4KG5 A;  3NOP C;  2V20 A;  5CGX A;  3LI8 A;  4EQ1 A;  2P74 A;  2EXB A;  1M40 A;  1XFN A;  3HLF A;  3M2K A;  5HWW A;  1S66 L;  1P0Z A;  4LFU A;  4R1G A;  5L8M A;  3FG8 A;  3G2Z A;  1YLY A;  1PYY A;  4QJG A;  4OKP A;  5EVI D;  1Q2P A;  3VSK A;  4AFI A;  3KSH A;  4KZ3 A;  4LCM A;  1Y28 A;  4N9L A;  1MKI A;  1VQQ A;  2ZQ9 A;  4JXS A;  2HDS A;  2J3T C;  4YFM A;  4FOF A;  1CI8 A;  4RVA A;  2XA7 S;  2C6W B;  3HLE A;  3BFE A;  3U2A A;  3LY3 A;  4DF6 A;  5DKK A;  4HH3 A;  3VP1 A;  3BFD A;  4P6Z S;  3NEC A;  2C5W B;  1VEU A;  4FCF A;  3MQ0 A;  3AGF A;  5FI6 A;  2FFF B;  2W1T B;  2PBY A;  3SZT A;  4D60 A;  2JCH A;  3IXG A;  1FR1 A;  4DDY A;  2V8C A;  5EV0 A;  5AQB A;  2QWS A;  1F2K A;  4IVI A;  4IHQ A;  5DF7 A;  2VJW A;  1LL9 A;  2HV1 A;  1NLZ A;  4OQH A;  1RCJ A;  1H5X A;  3O5Y A;  3BW6 A;  4EBL A;  5L09 A;  2P9V A;  2PHY A;  2WKI A;  1ACF A;  1E25 A;  4WMC A;  4EES A;  1S67 L;  1CEG A;  3P98 A;  3EQV A;  3BFG A;  4KQO A;  4HHD A;  4L9E A;  1W8Y A;  5CHJ A;  3G6O A;  4LGW A;  4BBV A;  2EX6 A;  2ZC3 B;  3IWI A;  1EWZ A;  1LLB A;  1PWC A;  2PR6 A;  4JXG A;  2EX9 A;  4BBU A;  4C6Y A;  2QPN A;  4FUW A;  4JLF A;  1T1B A;  4PKY G;  2MJ6 A;  3NJA A;  4H6J A;  4WMC D;  2W3G A;  1GA9 A;  3G35 A;  3PBQ A;  5J4E A;  2GX5 A;  3ZG0 A;  1OTI A;  5HPF A;  2EFU A;  2QYB A;  3WS5 A;  3IXD A;  1T1C A;  4M3K A;  5CHU A;  2Z2L B;  3GV9 A;  3G32 A;  3QP5 A;  2XRO A;  3UB5 P;  3KSF A;  5FQJ A;  3WWX A;  4E3M A;  3IWO A;  4RX2 A;  5CER A;  1VET A;  5E2E A;  5HFO A;  1SKO A;  1DRM A;  1ESU A;  2ZM0 A;  1LSX A;  1TVF A;  1JVJ A;  1V9Y A;  4X1M A;  1WYB A;  1S1Y A;  3UE1 A;  4KZ5 A;  3LR5 A;  5GLA A;  1YLW A;  2K7S A;  4G3W A;  5TGF A;  4S2N C;  3CJM A;  3BRM A;  5DFX A;  2VA0 A;  2Y2I A;  1KGG A;  3A3D A;  3BYD A;  4Z1W A;  4D2O A;  2DNS A;  3H9W A;  4PM5 A;  1YLT A;  2XRN A;  4UA7 A;  1PZO A;  1NYY A;  4QWO A;  3HLC A;  3P09 A;  3WS1 A;  1ZKJ A;  3T4K A;  1N9N A;  4U0T A;  4HH2 A;  1JWP A;  5EVL A;  5FAS A;  5F1G A;  2HGV A;  3T4O A;  5A93 A;  5EPH A;  5HAP A;  2ZQD A;  2PBD P;  3DWK A;  4BL2 A;  4NET A;  4Y5F A;  4BWI A;  3R7W B;  1G6A A;  2WK0 A;  5F82 A;  5HSQ A;  5FAP A;  3IF6 A;  1BSG A;  3HUN A;  5HDS A;  3LID A;  3VOZ A;  4JF6 A;  4HNB A;  2D02 A;  1XJ6 A;  2DCF A;  5J8X A;  2JC7 A;  4GDN A;  1ZG4 A;  4EUZ A;  3HJK A;  1VET B;  3Q82 A;  4MBF A;  4Y0T A;  2ZL1 A;  1FSY A;  4EU0 A;  2XA7 M;  1LI0 A;  4ARZ B;  1NZO A;  4WZ4 A;  5EVE A;  5DVA A;  5F68 A;  1D06 A;  5GL9 A;  3LCE A;  1F98 A;  4NK3 A;  1AWI A;  3VP3 A;  1IKI A;  3QP8 A;  3T1R A;  1BTL A;  4LCL A;  3BLM A;  3IT9 A;  4GW9 A;  3EWK A;  2EX8 A;  3BQ8 A;  4R3A A;  2Q0O A;  4OQI A;  4KZ4 A;  4WEL A;  3HRE A;  1DJA A;  2NUT C;  2LB5 A;  4PM7 A;  3A3F A;  4LPZ A;  1L0F A;  2EWW A;  2HP9 A;  4S2M A;  3CIT A;  2V1B A;  3TRC A;  2HJ9 C;  2EWV A;  1MY8 A;  3N7W A;  3IF6 B;  2J9O A;  2P7J A;  1CEF A;  2OLU A;  3H82 B;  1Z09 A;  4F3L A;  4JF5 A;  4GCZ A;  5CTM A;  3UB9 A;  3ZGA B;  1IOU A;  3S4X A;  5HD5 A;  4XT2 B;  1O07 A;  4OPR A;  5DF8 A;  4WEK A;  3OPP A;  3G4P A;  4GDB A;  3NOT C;  4L0L A;  5AVF A;  4UAA A;  3IH8 A;  3CZD A;  1PI5 A;  1YAX A;  5IT5 A;  1OTA A;  2QKP A;  1G68 A;  3RXW A;  4HP4 A;  3UPP A;  4OOM A;  4DE0 A;  3PBS A;  4LV1 A;  2PDR A;  4KEN B;  3UMD A;  1MWR A;  4DE3 A;  3TW8 A;  2QHK A;  4WEJ A;  3PR6 A;  2E8I A;  3N8S A;  2QMI A;  1PNE A;  1I2S A;  4WUJ A;  4NEE D;  5LBR A;  3VP4 A;  4R4S A;  2J80 A;  4RQ9 A;  5A91 A;  5CGW A;  3Q7V B;  4P6B A;  3IQA A;  3SH7 A;  5GHY A;  4MN7 A;  1RGZ A;  2P04 A;  2QJ7 A;  4A5R A;  4MLL A;  1XJ4 A;  2EXA A;  4JXV A;  1YM1 A;  4FH4 A;  3V3R A;  3LGO A;  3ZDJ A;  4P87 A;  1CQA A;  1G6O A;  5FDH A;  1T1A A;  3RJU A;  5DJT A;  4JBF A;  3ZVW A;  3MMH A;  2ZMF A;  2A49 A;  5C5K A;  3DWZ A;  4LRZ E;  1XP4 A;  4LEN A;  1YKD A;  4K0W A;  4R70 A;  3N6I A;  4EUV A;  3OPH A;  3MXR A;  1BLH A;  5AJG A;  3IS2 A;  4ZTK A;  4KZA A;  3DTK A;  4N1X A;  3CG5 A;  3G34 A;  2FZ0 A;  2JBF A;  1K57 C;  3LIA A;  3V39 A;  3ZHH A;  3C2W A;  3HUO A;  3CAX A;  4GD6 A;  1H8Z A;  5EE8 A;  3ZNY A;  1ZHH B;  1BT5 A;  3IH9 A;  1XKZ A;  1OT6 A;  1H8M A;  5G18 A;  2XF3 A;  5AQ9 A;  4GOG A;  2INW A;  3B3X A;  1U60 A;  2IWB A;  1UGU A;  1T19 A;  3B42 A;  2Q9M A;  1K25 A;  3F1P A;  1N9L A;  2ZBB A;  2Y2G A;  3T4L A;  2Y2O A;  4I3A A;  4PM8 A;  5JYO A;  3A0S A;  3R4K A;  1MZU A;  4B9O A;  4LV3 A;  1LSV A;  1OPX A;  1MC0 A;  4QU3 A;  1GHM A;  1N9O A;  1FSW A;  3SH8 A;  2GNX A;  1C3B A;  1K55 C;  3F1O A;  1OTE A;  3BM6 A;  1L3L A;  3U4L P;  1J3W A;  1DP9 A;  1FCN A;  1IFQ A;  4KZ7 A;  4E3O A;  3QNB A;  5FSR A;  5MC7 A;  2DMW A;  2IWD A;  1PI4 A;  3I7J A;  3G31 A;  5DJU A;  2WKP A;  4MCW A;  3K3C A;  3UB7 A;  5E2H A;  1JTD A;  1H0M A;  4Q0I A;  1I2W A;  3MSH A;  3ZG5 A;  3DTI A;  5CX7 A;  3NBL A;  5CED A;  1MWT A;  1M6K A;  3IF5 A;  1FR6 A;  4JPM A;  4NKP A;  3QP6 A;  2WZX A;  3MXQ A;  3E98 A;  2JKG A;  2JKR M;  2L4R A;  3LR3 A;  4GLQ A;  3F1P B;  1Z6F A;  1HZO A;  2G7U A;  4RA7 A;  5HAR A;  2Y2N A;  2KX6 A;  3GEC A;  1FQG A;  4Y0U A;  4KQQ A;  3UN7 A;  3PYP A;  3E4O A;  2WKR A;  2O0Y A;  4EEU A;  2ZC6 B;  1MWU A;  1ODV A;  3E2L A;  3FC7 A;  1TEM A;  1LI9 A;  5FAO A;  2A3U A;  2PD7 A;  2ZQ8 A;  5HWV A;  4P0M A;  4WN5 A;  2B02 A;  4IJG A;  3NOU C;  5CTN A;  1W7F A;  5F5Y A;  3BLS A;  2ZD8 A;  3LFV A;  4ZJ3 A;  4DMZ A;  1XGJ A;  5TBM A;  1TS7 A;  3W2Z A;  3FPV A;  1HTZ A;  1OJ5 A;  2WAF A;  2VGK A;  1S0W A;  3UME A;  4ETZ A;  3H7W B;  1K54 A;  3ZCZ A;  2W3D A;  2A2L A;  2XH9 A;  4KZB A;  2W3E A;  1OTB A;  1W8Q A;  4YWZ A;  1IEL A;  4WZ5 C;  1XA7 A;  1K6S A;  4R4R A;  3RTY A;  5EVI B;  4QB8 A;  2BG1 A;  2XD1 A;  1SDN A;  2V0W A;  1EI5 A;  3OOV A;  4EXO A;  4DJ3 A;  4X55 A;  4Y15 A;  5FQM A;  5FAT A;  5F69 A;  3EQU A;  3SOI A;  3VV4 A;  4P85 A;  3VOY A;  4XUZ A;  4DE2 A;  1BUE A;  5J3W A;  1WE4 A;  4Y0O A;  3ITA A;  3S7O A;  3SW1 A;  2PT7 A;  3LIE A;  1HD8 A;  5CEC A;  2OLV A;  4CQH A;  4QD4 A;  4LRX C;  3T1S A;  2A24 A;  1KGF A;  5FQK A;  1CI9 A;  1W63 Q;  4LV0 A;  4BEN A;  5G4Z A;  2GDN A;  3IWQ A;  1PW8 A;  2XQZ A;  3BQA A;  4CLC E;  2HDU A;  3OBF A;  3E4P A;  2AVX A;  2HJE A;  3WS4 A;  3E4Q A;  1SDE A;  5U47 A;  1GSW A;  4IUH A;  1ONH A;  3C7V A;  3DBA A;  5KZH A;  1LT0 A;  3UE3 A;  1VEU B;  3E2K A;  5GLD A;  4IVK A;  2ZMV A;  1D7E A;  1GSX A;  4KQR A;  2VGL S;  4KZ9 A;  3LEQ A;  4S2N A;  3LIB A;  3VSL A;  4OVD A;  5I5L A;  3KSI A;  1OTD A;  4EER A;  1N4O A;  1S1Z A;  3C7U A;  3D3O A;  4I5S A;  4JF4 A;  4X56 A;  2NUP C;  2X71 A;  4BMW A;  1LHY A;  4L9F A;  4E6W A;  2PU2 A;  2Y91 A;  3VP0 A;  3ZG9 B;  3UNW A;  3LO7 A;  4CLC A;  4G3K A;  1JWV A;  2P9V B;  2JE5 A;  3SS4 A;  4NXB A;  3C38 A;  3B47 A;  1NWZ A;  1JTG A;  1X0O A;  1H8Y A;  4H8R A;  3VE3 A;  4OPZ A;  2G2U A;  3PTE A;  5IS1 A;  3C5A A;  2ZJ9 A;  2ZMA A;  3ZG8 B;  2PYP A;  3RH8 B;  5CGS A;  4C3Q A;  4CLC D;  2I9V A;  4MBH A;  4WLA A;  1ERQ A;  4H6J B;  4R3B A;  3E0Y A;  4YOF A;  2PYR A;  3A3E A;  2Z6C A;  4R3J A;  2M1C A;  1DP8 A;  3D9Y A;  1P9W A;  1RGY A;  3MZE A;  2XDM A;  1SKO B;  3MJQ A;  5KIZ A;  3O3V A;  4EET B;  2R9W A;  1PIO A;  1YLP A;  4S2I A;  5FAQ A;  3VFH A;  1OME A;  2G2W A;  1ES2 A;  1VB6 A;  3MQO A;  4EV4 A;  3BJN A;  3T12 B;  3G2Y A;  1T18 A;  4CLC B;  3OZH A;  5K5B A;  4B4Z A;  2HDR A;  4WYY A;  1E3U A;  2XLN A;  4P6Z M;  2M7U A;  1PWD A;  3NC8 A;  5TR7 A;  4KUK A;  4OPY A;  2YKH A;  3TE8 A;  3DAV A;  5F83 A; 
#chains in the Genus database with same CATH homology
 4ZTK A;  3FV7 A;  4KZA A;  4R1G A;  4N1X A;  1I5Q A;  3CG5 A;  3G34 A;  3G2Z A;  4S2K A;  1KE0 A;  2JBF A;  1YLY A;  1K57 C;  1PYY A;  1L0D A;  1KDS A;  1MWS A;  3V39 A;  3ZHH A;  3IXB A;  4QJG A;  3HUO A;  4OKP A;  1L0E A;  1YLJ A;  4E3K A;  5EVI D;  4GD6 A;  1Q2P A;  1H8Z A;  5EE8 A;  3ZNY A;  2V1Z A;  3VSK A;  2B5R A;  4GN2 A;  1BT5 A;  1DJC A;  3IH9 A;  4GNU A;  3GQZ A;  4KZ3 A;  1XKZ A;  4LCM A;  1ZC2 A;  3SS5 A;  4HBT A;  4GZB A;  1YMX A;  5G18 A;  4XXR A;  2XF3 A;  1JWZ A;  4JKT A;  1KVL A;  3BEC A;  4N9L A;  4GOG A;  5AQ9 A;  3MZD A;  5EUA A;  4E3J A;  1MKI A;  1VQQ A;  2ZQ9 A;  5HX9 A;  4JXS A;  3ZVT A;  2HDS A;  3C4P A;  5AQA A;  3OCL A;  2HDQ A;  3D4F A;  3B3X A;  3BFF A;  3GRJ A;  1U60 A;  4YFM A;  4YIN A;  2IWB A;  2Q9M A;  1K25 A;  1ERM A;  2OV5 A;  1CI8 A;  4RVA A;  2Y2G A;  3W4Q A;  4OQ0 A;  2Y2O A;  4PM8 A;  5I94 A;  2C6W B;  1GHI A;  3IHB A;  5JYO A;  1MBL A;  3HLE A;  3V50 A;  3BFE A;  3HLB A;  3G30 A;  4LV3 A;  3LY3 A;  1KDW A;  1Q2Q A;  2Y2M A;  5E2F A;  4QU3 A;  1GHM A;  4DF6 A;  3VP1 A;  3Q7Z A;  3MZF A;  2Y59 A;  3FZC A;  2Y2P A;  3ITB A;  1FSW A;  3SH8 A;  3MKE A;  1C3B A;  1YLZ A;  4DXC A;  1K55 C;  1YMS A;  2H0Y A;  2XEP A;  3BFD A;  4OPQ A;  3WS2 A;  4K0X A;  5CXW A;  5FQ9 A;  3BM6 A;  2EFX A;  2HPB A;  2X01 A;  2Q9N A;  2C5W B;  2ZQA A;  4FCF A;  1FCN A;  3AGF A;  5FI6 A;  3ZFZ A;  2FFF B;  2PBY A;  4KZ7 A;  4E3O A;  3QNB A;  2J9P A;  5FSR A;  2WKH A;  2IWD A;  2JCH A;  1PI4 A;  1L2S A;  5E2G A;  5FQI A;  3IXG A;  2ZQC A;  3I7J A;  1FR1 A;  3G31 A;  2Y2H A;  4DDY A;  3GR2 A;  4Y7P A;  4XUX A;  5AQB A;  4JXW A;  3W4O A;  5E2H A;  1JTD A;  4ZJ1 A;  4HBU A;  1LL5 A;  1SCW A;  2ZQ7 A;  1IYO A;  1I2W A;  2WGW A;  3LY4 A;  4IVI A;  5FI2 A;  3ZG5 A;  1TDL A;  5M19 A;  2ZM2 A;  5DF7 A;  1J9M A;  3NBL A;  1LL9 A;  5CED A;  1MWT A;  4R0Q A;  1DY6 A;  4OQH A;  5CHM A;  3FWL A;  1NY0 A;  2H10 A;  3SH9 A;  1M6K A;  3IF5 A;  4ZAM A;  5DTS A;  1RCJ A;  1H5X A;  1FR6 A;  4JPM A;  4X68 A;  3MFD A;  4EBL A;  2WZX A;  3BFC A;  1XA1 A;  2J7V A;  3QNC A;  3OPL A;  4C75 A;  1ESI A;  4DE1 A;  1KE3 A;  2P9V A;  1TDG A;  5TFQ A;  4UA9 A;  2WKI A;  1E25 A;  4WMC A;  1Z6F A;  1HZO A;  3PBO A;  1CEG A;  4RA7 A;  3P98 A;  2Y2N A;  5HAR A;  2OSU A;  3EQV A;  3BFG A;  4KQO A;  2WUQ A;  5HAQ A;  4X69 A;  2WYX A;  3A3J A;  4EBN A;  1FQG A;  4PM6 A;  4Y0U A;  1W8Y A;  4KQQ A;  5CHJ A;  3UN7 A;  3OCN A;  5GLC A;  4BL3 A;  4DXB A;  5AQ7 A;  5KSC A;  1QMF A;  3IF6 C;  2ZC6 B;  2EX6 A;  2ZC3 B;  1MWU A;  4U3T A;  3E2L A;  1FOF A;  3IWI A;  1EWZ A;  1TEM A;  1LLB A;  1PWC A;  4JXG A;  1LI9 A;  3OC2 A;  5FAO A;  2EX9 A;  4C6Y A;  2QPN A;  5IHV A;  2A3U A;  4JLF A;  4BD0 A;  1ES4 A;  1CK3 A;  3NCK A;  2ZQ8 A;  1KE4 A;  5GHX A;  4WMC D;  4P0M A;  1GA9 A;  1NJ4 A;  2ZLY A;  3NIA A;  3WRT A;  2WAD A;  3NDG A;  3G35 A;  1XPB A;  1E3U D;  3N8L A;  3PBQ A;  1W7F A;  5CTN A;  5M18 A;  3ZG0 A;  1ERO A;  2EFU A;  3BLS A;  2ZD8 A;  4DRT A;  2I72 A;  3WS5 A;  3IXD A;  4ZJ3 A;  4QHC A;  4M3K A;  5CHU A;  2Z2L B;  3GV9 A;  3PAE A;  2XR0 A;  3G32 A;  3VP2 A;  4ID4 A;  1IEM A;  1XGJ A;  3UE0 A;  4WM9 A;  4OP8 A;  1K55 A;  3O88 A;  4UHU A;  3AGD A;  3MKF A;  5FQJ A;  3WWX A;  1HTZ A;  4E3M A;  2WGW B;  2WKE A;  3IWO A;  4RX2 A;  4S2J A;  4N1H A;  3UDF A;  5CER A;  3W4P A;  2WAF A;  2VGK A;  5E2E A;  2WZZ A;  5HFO A;  1S0W A;  3RXX A;  1ESU A;  2ZM0 A;  1TVF A;  5CEB A;  1BLP A;  1JVJ A;  2R9X A;  4E3L A;  1WYB A;  3HBR A;  1XXM A;  1K54 A;  3ZCZ A;  3UE1 A;  3Q7V A;  2WGI A;  3O86 A;  1ZG6 A;  4Z9Q A;  4KZ5 A;  4GB7 A;  5GLA A;  1YLW A;  4KZ6 A;  5EEC A;  2IWC A;  4OP5 A;  2PU4 A;  3HLD A;  5TGF A;  3Q81 A;  2XH9 A;  4GD8 A;  4S2N C;  3CJM A;  3BRM A;  4KZB A;  2RCX A;  1W8Q A;  3ZG7 B;  3IHA A;  1RP5 A;  1IEL A;  2Y2I A;  1KGG A;  3A3D A;  3BYD A;  4WZ5 C;  1K6S A;  1XA7 A;  4K91 A;  4R4R A;  4CPK A;  4D2O A;  4EBP A;  1N9B A;  5EVI B;  2DNS A;  4QB8 A;  5F1F A;  2BG1 A;  2XD1 A;  4PM5 A;  1YLT A;  1SDN A;  2XFS A;  4MBK A;  4UA7 A;  1EI5 A;  1Y54 A;  5E43 A;  1PZO A;  1SKF A;  4X55 A;  3PBN A;  1IYQ A;  5M1A A;  3S1Y A;  3FYZ A;  1NRF A;  1NYY A;  3HLC A;  3P09 A;  3WS1 A;  1ZKJ A;  3DTM A;  3NY4 A;  5FQM A;  3TOI A;  4U0T A;  5FAT A;  2RL3 A;  1JWP A;  3EQU A;  5EVL A;  5FAS A;  3SOI A;  3O87 A;  5F1G A;  1E4D A;  3M2J A;  2Y2L A;  4P85 A;  4OON A;  4LV2 A;  3VOY A;  5A93 A;  4X53 A;  4XUZ A;  4DE2 A;  5EPH A;  1BUE A;  3HLG A;  5HAP A;  3DW0 A;  5EOO A;  2ZQD A;  3HL9 A;  1WE4 A;  4Y0O A;  3ITA A;  3DWK A;  1VM1 A;  4EWF A;  1XX2 A;  3UY6 A;  5BOH A;  2WGV A;  1HD8 A;  1W5D A;  4NET A;  4ZBE A;  4BJP A;  4BL2 A;  5CEC A;  4E6X A;  2OLV A;  1W79 A;  1BZA A;  4HES A;  4QD4 A;  1G6A A;  2WK0 A;  5F82 A;  2ZC4 B;  1BLS A;  4EQI A;  1KGF A;  3VFF A;  5FQK A;  1YQS A;  5FAP A;  1CI9 A;  3NI9 A;  3IF6 A;  4RX3 A;  1BSG A;  3HUN A;  4LV0 A;  1FCM A;  4BEN A;  2GDN A;  4ZJ2 A;  3VOZ A;  2VGJ A;  3IWQ A;  4JF6 A;  2ZC5 B;  2DCF A;  1BLC A;  5J8X A;  2JC7 A;  4GDN A;  1GA0 A;  1ZG4 A;  4EUZ A;  4E3I A;  1PW8 A;  3WRZ A;  3A3I A;  2XQZ A;  2BLS A;  2FFY A;  2ZM8 A;  3Q82 A;  4MBF A;  4OLD A;  4Y0T A;  1ES5 A;  1K57 A;  2HDU A;  4MEZ A;  1AXB A;  4OOY A;  4QY6 A;  1IYP A;  1FSY A;  3MXS A;  5A90 A;  4IED A;  1MXO A;  2HP5 A;  1LI0 A;  1BUL A;  1NZO A;  3M6H A;  4WZ4 A;  5DVA A;  4E3N A;  3ZNT A;  3OPR A;  4FSF A;  5GL9 A;  3SS3 A;  1ES3 A;  3LCE A;  5D3O A;  3WS4 A;  4FH2 A;  5FA7 A;  4NK3 A;  1SDE A;  3HVF A;  4IBR A;  3VP3 A;  1IKI A;  5U47 A;  1BTL A;  4LCL A;  3N8R A;  1ALQ A;  1K38 A;  3QHY A;  4O7D A;  1ONH A;  3Q07 A;  3BLM A;  3C7V A;  1KVM A;  3IT9 A;  2EX8 A;  5KZH A;  3UE3 A;  3E2K A;  3GVB A;  3VMA A;  1PZP A;  5GLD A;  4OQI A;  4RYE A;  4KZ4 A;  4WEL A;  4IVK A;  1IKG A;  1K6R A;  1NYM A;  2XGN A;  3IXH A;  4MNR A;  5JYP A;  3HRE A;  1DJA A;  4FD8 A;  1YT4 A;  4U0X A;  4PM7 A;  1FCO A;  1IYS A;  3HUM A;  3A3F A;  4KQR A;  1ONG A;  4PMA A;  1L0F A;  4KZ9 A;  1O7E A;  3UPO A;  2Y2Q A;  4QY5 A;  4S2N A;  2HP9 A;  5CRF A;  2QZ6 A;  3VSL A;  4S2M A;  4WBG A;  3N4I A;  3W8K A;  3M6B A;  4OVD A;  4WZ5 A;  1GHP A;  2DRW A;  1N4O A;  4PM9 A;  4KZ8 A;  5EVI C;  5HW3 A;  1WYC A;  3AGE A;  3C7U A;  4S2L A;  2Y4A A;  4F94 A;  4S2O A;  2XFT A;  4JF4 A;  4X56 A;  4KG6 A;  2X71 A;  1MY8 A;  2H5S A;  3N7W A;  1LHY A;  3IF6 B;  2Y2J A;  4E6W A;  2PU2 A;  2CC1 A;  2Y91 A;  1PWG A;  5DTK A;  3VP0 A;  3ZG9 B;  2Y55 A;  5GLB A;  3TSG A;  2J9O A;  1CEF A;  3UNW A;  3LO7 A;  2OLU A;  4DDS A;  1JWV A;  3Q1F A;  2P9V B;  4OH0 A;  2JE5 A;  3PBT A;  3SS4 A;  1JTG A;  4JF5 A;  1H8Y A;  1SHV A;  4H8R A;  5CTM A;  5DF9 A;  4N92 A;  4DKI A;  2UWX A;  3UPN A;  3ZGA B;  5EOE A;  3S4X A;  2XD5 A;  2XK1 A;  4OPZ A;  2ZC7 A;  2G2U A;  1O07 A;  4OPR A;  3PTE A;  5DF8 A;  4UA6 A;  2WAE A;  3C5A A;  3CMZ A;  1S6R A;  4B88 A;  2ZJ9 A;  4OLG A;  3V5M A;  2ZMA A;  4WEK A;  5L2F A;  3OPP A;  3G4P A;  3ZG8 B;  4GDB A;  4L0L A;  4HEF A;  4BD1 A;  5CGS A;  4C3Q A;  5GHZ A;  4UAA A;  3IH8 A;  2X02 A;  4MBH A;  1ERQ A;  3CZD A;  1PI5 A;  3BEB A;  4R3B A;  1G68 A;  4PPR A;  3JYI A;  3RXW A;  4CJN A;  3UPP A;  3A3E A;  4OOM A;  4DE0 A;  1K54 C;  3UDI A;  5KMW A;  3PBS A;  4IBX A;  4R3J A;  4LV1 A;  3TG9 A;  4KEN B;  1K4E A;  4N9K A;  3S22 A;  1MWR A;  4DE3 A;  3PAG A;  4R23 A;  5FI7 A;  2Y2K A;  1K56 A;  2HP6 A;  1DJB A;  4WEJ A;  3GTC A;  2E8I A;  3N8S A;  2QMI A;  1RGY A;  5DTT A;  1I2S A;  3MZE A;  1NXY A;  3MBZ A;  2XDM A;  3NDE A;  5HAI A;  2J8Y A;  4GKU A;  1L0G A;  3FKW A;  3V3S A;  3O3V A;  4OOL A;  3VP4 A;  4R4S A;  3FKV A;  2H0T A;  3GMW A;  3WS0 A;  5A91 A;  5CGW A;  4Q8I A;  2R9W A;  3Q7V B;  1HVB A;  1PIO A;  3IQA A;  4P6B A;  1QME A;  5GHY A;  2Z2M B;  3C4O A;  3SH7 A;  1RGZ A;  5HL1 A;  1YLP A;  4S2I A;  5FAQ A;  3VFH A;  3PBR A;  1OME A;  2G2W A;  1ES2 A;  4KG2 A;  1GCE A;  4EV4 A;  4A5R A;  4MLL A;  3G2Y A;  5A92 A;  2EXA A;  4JXV A;  1YM1 A;  4FH4 A;  3V3R A;  4OQG A;  3ZDJ A;  1NZU A;  3OZH A;  1K56 D;  4P87 A;  5FDH A;  1KGE A;  2V2F F;  4ZDX A;  4B4Z A;  2HDR A;  3RJU A;  3UO9 A;  4WYY A;  4JBF A;  3ZVW A;  3HLW A;  5EVI A;  1E3U A;  1PW1 A;  4BLM A;  2XLN A;  5KSH A;  3ISG A;  1XGI A;  4S2P A;  3UDX A;  4X6T A;  2A49 A;  1PWD A;  3DWZ A;  3LEZ A;  3NC8 A;  1K4F A;  2EX2 A;  1XP4 A;  4KG5 A;  5TR7 A;  4OPY A;  4BQM A;  4B4X A;  4LEN A;  4K0W A;  2V20 A;  3N6I A;  5CGX A;  5FQQ A;  3GSG A;  3OPH A;  1MPL A;  3MXR A;  2P74 A;  5F83 A;  2EXB A;  1BLH A;  1M40 A;  3HLF A;  3M2K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...