4WUJA

Structural biochemistry of a fungal lov domain photoreceptor reveals an evolutionarily conserved pathway integrating blue-light and oxidative stress
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
147
structure length
139
Chain Sequence
GAMDGIYSASGIDVMGILLRIASRPNPTIDLGPLDCSVSLTLCDISLPDAPIVYASPGFYQLTGYSAPEIMGRNCRFLQNSVSDAVQEMRRAIRAHQEVQVRIVNYKKNGTPFTNVVTILPLWADPSGHHFAVGLQAEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Circadian clock protein
molecule keywords Glycoside hydrolase family 15, cellulose signaling associate
publication title Structural Biochemistry of a Fungal LOV Domain Photoreceptor Reveals an Evolutionarily Conserved Pathway Integrating Light and Oxidative Stress.
pubmed doi rcsb
source organism Hypocrea jecorina
total genus 36
structure length 139
sequence length 147
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4wujA00
4F3LB 3T50A 5F5YA 5HZHA 3LIAA 2L0WA 4RQ9A 2PDRA 3G6OA 4NXBA 3LUQA 4GCZA 5TBMA 1G28A 3A0SA 5TBMB 5HWWA 3D72A 4WL9A 1S67L 1OTEA 1XFNA 4HJ6A 4WLAA 4KUKA 3UE6A 1D7EA 4HJ4A 1WA9A 4R3AA 2J80A 4HH3A 1UWNX 5EFWA 2QKPA 2KX6A 4GHIA 4GW9A 3ZQ5A 4GHIB 3KX0X 4L9FA 1T1CA 3HJIA 3PYPA 3NOTC 4LRXC 4NXFA 1S66L 2YKHA 2HV1A 1GSVA 1LL8A 5F68A 1T1BA 2W0NA 1TS0A 1ODVA 1S1ZA 4EQ1A 1XJ2A 5HD5A 1VB6A 2B02A 3LIFA 1P97A 4MN5A 3RTYA 1UWPX 1F98A 1DP9A 2WKRA 2I9VA 4M4XA 3VE4A 1XJ3A 4DJ3A 3FC7A 3B33A 3UMEA 5J3WA 3FG8A 3MQQA 3LIEA 5AVEA 1N9OA 1T19A 2PR5A 4NXEA 5HWTA 3LI9A 1T18A 3C2WA 3UB6A 4HIAA 2JHEA 4KQDA 3NJAA 4K08A 3F1OA 3NHQA 2L1MA 2R78A 4H6JA 3F1OB 3E4QA 3UB8A 1S4SA 1JNUA 2INWA 3F1NA 2WKQA 1OTDA 4E04A 2L4RA 2ZOHA 3UB9A 2V1AA 3EWKA 4HP4A 4KUOA 4LRZE 1DP8A 2PHYA 4LRYC 1OT9A 4LLOB 5HDCA 1N9LA 3LI8A 3MFXA 1NWZA 2P7JA 1LSXA 2D01A 5A8BA 4LPZA 5J4EA 3F1PA 2V1BA 4EESA 1TS6A 2V0WA 3F1PB 3MJQA 3H7WA 3E4OA 4EW7A 2H28A 3H7WB 4I3IA 5HSQA 5HDSA 1S4RA 2BASA 3K3CA 4I3JA 2QHKA 1OJ5A 4B9OA 4HOIA 3VE3A 5IU1A 5DKLA 1DRMA 1EW0A 2QWSA 3A0VA 3E4PA 4EEUA 4WUJA 4I38A 4L9GA 4I5SA 1OJGA 5AVFA 5F69A 4EERA 4GS9A 3MXQA 1OTAA 4YWZA 5DKKA 4GS9B 4EXOA 2YKFA 1BYWA 1XJ6A 3NOPC 2PYRA 1P0ZA 2PYPA 5IS1A 1D06A 5DJTA 1T1AA 4HY8A 4PKYG 2W27A 2Z6CA 1OTIA 3BY9A 4I3AA 5DJUA 1F9IA 3LIBA 5HDDA 4JGQA 5KIZA 3GECA 5I5LA 1LSVA 2A24A 3K3DA 3BWLA 4H6JB 4XT2A 1XFQA 5HWVA 2VEAA 4NXGA 2A24B 3LICA 3F1NB 2CMNA 2VLGA 3LIDA 4R6LA 2V0UA 4PKYA 3LYXA 1KOUA 1S1YA 1XJ4A 3CWFA 4JGOA 3BY8A 1OTBA 1Y28A 2WKPA 4EETB 1LSWA 4WN5A 2ZOIA 4WF0A 2D02A 4JGPA 2Z6DA 2VV6A 4HJ3A 1X0OA 4BBVA 4HNBA 5J7EA 3CAXA 3MR0A 4HH2A 2QJ5A 1V9ZA 2M1CA 5G4YA 2V9AA 1DP6A 4JGRA 5G4ZA 3RH8B 4R70A 5HD3A 2OWHA 2VV7A 4BBUA 4HI4A 3GDIA 4I39A 2QJ7A 3NOUC 1UGUA 2K7SA 3C8CA 3OLOA 2PD8A 2JN7A 3PHYA 3MQOA 3P7NA 3A0RA 1N9NA 4DJ2A 3ULFA 1TS8A 3ICYA 3H82A 1LT0A 4HQAA 3VOLA 1MZUA 3H82B 1V9YA 4HP9A 3SW1A 1TS7A 2EA9A 3H9WA 4BBTA 4XT2B 2PR6A 3EEHA 2OWJA 2KDKA 3IBRA 1GSWA 2GJ3A 2ZBBA 1GSXA 4R38A 4HHDA 3UB7A 3CLOA 4EEPA 4L9EA 3IS2A 4MN6A 3IS2B 2PD7A 3HJKA 2OOLA 5F6AA 4F3LA 2VV8A 3UMDA 1OT6A
chains in the Genus database with same CATH superfamily
4X25A 4DDSA 1NY0A 1K54A 1K56D 4WMCD 2PAVP 3PXPA 2GDNA 2HDQA 1W8YA 1MKMA 4YOFA 1YKDA 5FAOA 3HLBA 1ERQA 5HWWA 3O88A 4WL9A 4OPYA 2Y2QA 2Y2KA 3ZGAB 3EGXC 4FTXA 3UE6A 4HJ4A 1KDSA 4DE0A 4IBRA 2OSUA 3S22A 4R3AA 2X02A 1BT5A 2QKPA 1BLHA 5DVAA 4A5RA 2ZD8A 2DRWA 4K0XA 2EX2A 1FILA 3L9KA 1W63Q 1G6OA 1T1CA 2E8JA 1CEGA 3HJIA 3PAEA 1JTDA 4LRXC 2DNSA 3G2ZA 3VSLA 1JTGA 2YKHA 1GSVA 4JXSA 4YINA 2Q9MA 4EQ1A 5HD5A 1VB6A 3LIFA 5CTMA 2WGWB 4CLCE 4EV4A 4B4ZA 3KO6A 5FAPA 1UWPX 1F98A 4Y7PA 4EQIA 4WZ5A 1FCNA 5HL1A 5CECA 1BULA 4M4XA 3VE4A 4DMZA 2EXBA 3LIEA 1T19A 5HWTA 4F94A 3NECA 5AQ7A 4K91A 2EX6A 4KZ5A 2HJ9C 4HIAA 3WS0A 5DTTA 3O3VA 2W1RA 3GTCA 1KGFA 3E4QA 1ES2A 5E2FA 1VEUB 2EX9A 2WKQA 3QNBA 1OTDA 4UQIS 1VM1A 5AQBA 4ARZA 4DE3A 3LGOA 3HLGA 4E04A 2OLVA 2ZMAA 2QPNA 4ZDXA 2FFYA 4KUOA 5FA7A 4R23A 1DP8A 1XX2A 4LRYC 4ESPA 4R0QA 4JKTA 1XA1A 4OQGA 4U0TA 1H8ZA 4Y0OA 3OPPA 1NLZA 2XD1A 1FR6A 3WS2A 1BLCA 5FAQA 2D01A 5A8BA 4LPZA 1W8QA 3QHYA 4MBFA 5CXWA 1W79A 3MSHA 3WWXA 2WUQA 3TG9A 2ZC4B 2XDMA 3GMWA 1NRJA 3H7WA 5E2EA 4EW7A 1DJAA 2HP5A 1S4RA 3K3CA 2B18A 1J9MA 3UE3A 3MZFA 3O87A 5EE8A 3VE3A 5FQJA 4CLCD 2FZ0A 1YLTA 3KYQA 4ZBEA 3ZG9B 3LEQA 2FFFB 4I5SA 1OJGA 2Y2OA 4P6ZM 4LV2A 4MMNA 4JF5A 2V8CA 4PM6A 2XA7S 1MWRA 3FKWA 4FUWA 5KSCA 4GS9B 2V1ZA 4X1LA 1BSGA 2PYRA 4GN2A 1ALQA 5HAPA 1MWUA 3NCKA 3QP6A 1HD8A 1D06A 3TJZC 5IS1A 4X53A 4PKYG 1OPXA 3R4KA 4S2LA 4C75A 5CERA 1J3WA 3N4IA 3VOZA 1F9IA 3DTMA 5HDDA 2G2UA 3WRTA 1SCWA 2W1TB 2O99A 3K2NA 3K3DA 1FR1A 4XT2A 4FSFA 2DCFA 3F1NB 2H0TA 4OPZA 2VLGA 4OQHA 1RP5A 1PW8A 1KOUA 5JYPA 4S2NA 2JKFA 3O5YA 4OONA 1AXBA 1YQSA 3PTEA 2B5RA 3CPTA 3CWFA 4N9LA 1LLBA 3ZG7B 3N7WA 3O86A 4QU3A 2WADA 4WN5A 3IQAA 4LFUA 3JVVA 2ZQ8A 3Q1FA 4CLCB 1QMEA 2D02A 5CEBA 2JC7A 4LV3A 5CTNA 3BEBA 3IF5A 5HAQA 3ZG0A 2ZC7A 2VK3A 4JPMA 2VV6A 1GHMA 4HJ3A 1Q2PA 2W3HA 2M7UA 4BBVA 1PNEA 3CAXA 3D9YA 3MR0A 4MDZA 1YSQA 1NRFA 2QMIA 4K0WA 5G4YA 1XKZA 3G2YA 4IUKA 4QY6A 4HBUA 1DP6A 5TGFA 3LY4A 2X01A 4R70A 2OWHA 2J9OA 1M40A 1VETA 4Y0UA 2XD5A 2ZLYA 3PBQA 3T1XA 2BLSA 1S0WA 1UGUA 4DKIA 3T4OA 1IFQA 2IWDA 1K4EA 2WKHA 2JN7A 1KE4A 4X69A 1PYYA 2WGWA 3L7HA 3VV4A 3A0RA 4BWIA 3M6HA 4DJ2A 3IXGA 2HDUA 2Y91A 3UPOA 4CLCC 2HDRA 4UHUA 2VZWA 3M2KA 2RCXA 4RYEA 2Y2MA 3Q7ZA 3T12B 3T4LA 3NULA 3GR2A 4IVKA 3SW1A 3H9WA 3SS4A 4ZJ1A 1K56A 4WMCA 2KDKA 5EVIB 2MJ6A 5EECA 4JLFA 4E6XA 5F1FA 2ZBBA 1GSXA 5EM1A 5CHJA 1K55A 1KDWA 4X68A 4LENA 2HJEA 2V20A 3OPLA 1CF0A 3CLOA 3UB7A 2JE5A 4EEPA 4L9EA 3QP5A 3S7NA 3UNWA 3IS2B 3U2AA 2BTFP 2Y2LA 3HJKA 4F3LA 1PWDA 1OT6A 5GLDA 5AQ9A 4DN0A 5GHXA 3T50A 4OVDA 4UA6A 3ZNYA 4OP8A 2O0YA 4JXGA 1D1JA 2L0WA 2ZMFA 3Q07A 2PDRA 4EUVA 3C5AA 4GCZA 2Y2IA 4KQRA 4GDBA 2WK0A 4Y5FA 2NUTC 4JXVA 4KZ4A 5TBMB 3LR5A 3MQ0A 3Q7VA 1KVMA 3V3RA 3UDXA 3UY6A 2E8IA 1IKGA 2B95A 1XFNA 2PU4A 4OPRA 4UEYA 1SKOA 1D7EA 2VJWA 3LCEA 3OCNA 1WA9A 2J80A 5EFWA 1H5XA 2VGLM 5TR7A 4G3WA 2Y55A 5EVIC 4GW9A 2JKTM 4GHIB 2HZ5A 1BUEA 1CEFA 2XLNA 4X6TA 3PYPA 5BOHA 1K6RA 3QP8A 3RJUA 1S66L 2X71A 1MC0A 2HV1A 1KGGA 5F68A 1T1BA 2W0NA 1JWZA 1S1ZA 1VHMA 1NJ4A 1P97A 1HZOA 3JPUA 4S2KA 4MN5A 4BD1A 1LL5A 2WKRA 2O9BA 1ZKJA 1M6KA 2J3TC 5DFXA 3DBAA 1XJ3A 4DJ3A 1A0KA 2HP6A 3FC7A 2Y2HA 2Z2MB 5J3WA 2W3EA 4P85A 3IHAA 3FG8A 3OPRA 1JWPA 4NXEA 3LFVA 4HESA 4DRTA 2CC1A 3C2WA 4HEFA 2W1TA 4K08A 4RX3A 3F1OA 3NHQA 3NIAA 3HLEA 3G32A 3F1NA 2UV0E 1CK3A 3T1SA 4KQOA 2XEPA 2J8YA 5U47A 4RVAA 3CUEA 2FH5A 4QJGA 2ZOHA 3C30A 3UB9A 4KZ7A 3RXWA 4HP4A 5CRFA 3SOIA 3MXRA 4LRZE 3ZHHA 2A2LA 4LLOB 4CQHA 5IT5A 3T4JA 1LI0A 1SDNA 1YLWA 4CLCA 3MFXA 3BFGA 4MNRA 2P7JA 4R3JA 2P9VB 5L10A 2J3WA 2HPBA 4MN7A 3BFCA 3W4OA 3F1PA 3C4OA 2V1BA 2KLIA 1ESIA 1TS6A 3T4KA 3BQAA 4KENB 3TOIA 4LCLA 4I3IA 5DFYA 1DY6A 2K31A 3DTKA 2VKSA 1DRMA 3A0VA 4EEUA 4WUJA 1K6SA 4OLDA 1F2KA 3NC8A 4N9KA 4EERA 1YMXA 3OCLA 2R9WA 4EXOA 4OPQA 1E4DA 4PM7A 2PRFA 1BYWA 4O01A 4KZAA 3VP2A 2RL3A 1XJ6A 3Q81A 4N1XA 4X1MA 4B4XA 2PYPA 1YLZA 1T1AA 5GLAA 4HY8A 2P74A 4O7DA 1FSYA 2W27A 1EROA 2ZQAA 3V67A 3TW8A 1N4OA 3G4PA 5FQMA 4DE2A 4KG6A 3LIBA 4JGQA 5I5LA 5FI6A 1SDEA 1RGYA 1H8MA 5A91A 3BWLA 5TJJA 2ZC5B 4DDYA 4NETA 4Y3IA 2A24B 2Y2JA 4OP5A 2WAEA 4Q0IA 3IBJA 3R7WB 3ZG5A 2XRNA 1NYMA 2PT7A 1CI8A 1Q2QA 5L09A 3BY8A 4S2IA 1Y54A 3IHBA 1ZG6A 3GRJA 2WGVA 3N8SA 4QWOA 2ZOIA 1E25A 1TF1A 4WF0A 2C6WB 2ZL1B 4GNUA 3GVBA 4BLMA 1DJCA 3M2JA 2XSSA 2G7UA 1ONHA 4ZTKA 4BL3A 1X0OA 4P0MA 1SKFA 4HNBA 4XUXA 5J7EA 1XPBA 3GV9A 4RX2A 3PAGA 3ZVWA 2QJ5A 3UE1A 4PAUA 4FOFA 5FQIA 5GL9A 3DWZA 3VP0A 4R1GA 4BD0A 2P04A 3DW0A 4JGRA 4BQMA 5K5BA 3NDEA 4IVIA 2WKEA 3BLMA 4BBUA 1G5UA 2VV7A 3C7VA 4UA7A 2XFTA 1XXMA 4EWFA 2XQZA 4Q0HA 3CHWP 3LR4A 4S2JA 2XROA 2QJ7A 1W7FA 2JKRM 1K57C 3NOUC 2VGJA 3OZHA 4CPKA 3V50A 3P01A 4NEED 5FQKA 3PHYA 5KSHA 3VMAA 4WELA 3V3SA 2O9AA 1CJFA 4OOLA 1N9NA 3NY4A 5HPIA 1BZAA 3ULFA 5L8MA 1W63M 2J7VA 3UB5P 1Y4OA 4E3MA 3HUMA 3MKEA 1MPLA 4FH2A 5E2HA 1GHPA 4R4SA 3AGFA 3ZYTA 1LT0A 4HQAA 3VOLA 3SH7A 3H82B 4BBTA 2NUPC 1C3BA 3G30A 1ES3A 2GJ3A 3IF6B 1ES5A 3BFDA 4WYYA 3MF0A 5I94A 3DWKA 3ZDJA 4PMAA 2Y2PA 3C38A 2AVXA 4E3KA 5A92A 3FYZA 3S4XA 1WYBA 5EVID 4EU0A 4D60A 3VP1A 5F5YA 3PBNA 4P6ZS 3LIAA 3SS5A 2XF3A 1VQQA 1I5QA 2WZZA 3G6OA 3OBFA 4NXBA 3HUOA 3CZDA 5CX7A 1G28A 2JKGA 5JYOA 5FEFA 3BFEA 2Y4AA 3D72A 5GLBA 1OTEA 3P98A 3T4SA 4ETZA 4GD6A 4HJ6A 2DMWA 4Z9QA 4WLAA 3ITAA 2J3TD 3T4TA 1TD5A 1CQAA 1L0GA 3KSHA 1FIKA 4HH3A 3BLSA 4ETXA 2EFXA 2P08A 1UWNX 4FD8A 4DXCA 5HX9A 2KX6A 1ESUA 1TDGA 4MLLA 3ZQ5A 5A90A 2VA0A 4GJ4A 3HL9A 3IF6C 4FH4A 2WGIA 1FQGA 5M1AA 3UPPA 4NXFA 3UO9A 5HARA 3BFFA 3MZDA 2LB5A 1IYPA 1XJ2A 4O0PA 5AJGA 2B02A 3UE0A 3RTYA 2HP9A 1DP9A 2I9VA 3HVFA 4IHQA 1IYOA 4XXRA 3UMEA 4B88A 5FASA 1K54C 1STZA 4Y2FA 3MQQA 5AVEA 3T4QA 1N9OA 2KOIA 1T18A 2OV5A 2JHEA 4KQDA 4G3VA 4E3IA 4JXWA 1BLPA 3Q82A 5HW3A 1VEUA 3UB8A 1S4SA 5HFOA 1JNUA 3SH8A 2INWA 2HDSA 3KSIA 1PI4A 1IEMA 4D2OA 1P9RA 3R7WA 3DAVA 3SS3A 1XP4A 3E2KA 3G34A 1YLJA 2ZQ9A 4KG5A 3EWKA 2A3UA 1IYQA 3KYZA 3LY3A 4DF6A 1E3UD 3UDFA 4NK3A 3IWQA 1N9LA 3LI8A 3KYEA 3MKFA 5GHZA 3G35A 5F83A 1XA7A 3ZG8B 2ZL1A 1NWZA 3BQ8A 4S2PA 1L3LA 1IOUA 5FL3A 3HLDA 4WZ5C 3WS5A 4Z1WA 3CITA 1NZUA 4ZRRA 2H28A 3H7WB 3PR6A 4LCMA 1WYCA 2EWVA 5HSQA 3IXBA 4LV0A 4IUHA 4I3JA 3E98A 4B9OA 1MKIA 4HOIA 4U3TA 3WRZA 3LO7A 3UN7A 2EWWA 1YMSA 5CGXA 2PU2A 5FI2A 2QWSA 3E4PA 1MXOA 3ZCZA 2VGKA 5TFQA 3BYDA 3LR0A 1LI9A 4GKUA 4Y15A 3GQZA 5F69A 4GS9A 3MXQA 1OTAA 5DKKA 2YKFA 2K2NA 4X55A 2XK1A 2ZM0A 3T1RA 2LB9A 3NI9A 5CGWA 4QY5A 1OTIA 5EV0A 3W8KA 1G6AA 3BY9A 5EVEA 3M6BA 4I3AA 5DJUA 2WYXA 3ZVTA 4G3KA 3MFDA 3GECA 5DF9A 2XR0A 3CI6A 4H6JB 1ES4A 5HWVA 3MS6A 2VEAA 4NXGA 3KSGA 3LICA 1CI9A 3VFHA 1KE3A 1ZTUA 3LIDA 4N92A 3LYXA 2GX5A 4GLQA 3T1QB 1L0FA 1OTBA 3FV7A 2VGLS 2WKPA 4EETB 1LSWA 4BMWA 1U60A 1O7EA 1HTZA 4EUZA 4S2MA 1H0MA 4XUZA 2ZC3B 4E3JA 4RA7A 5DTKA 4QPRA 1PI5A 3ZNTA 3LR3A 3W4QA 2V2FF 3RFBA 5MC7A 1FCMA 3DTIA 2G2WA 4DXBA 1GA0A 4C3QA 4HH2A 1W5DA 3EEAA 4UQIM 4MCWA 5AQAA 1L0DA 1V9ZA 4B93A 2M1CA 4C6YA 1YPRA 2QYBA 4KQQA 3VP4A 2Z2LB 1GHIA 5G4ZA 1K4FA 3RH8B 3VFFA 2PBDP 2Y79A 3A3JA 1YLPA 4QHCA 1FSWA 5LBRA 1VETB 4R3BA 4I39A 1ERMA 1K0KA 3HUNA 5IHVA 2K7SA 1P9WA 1FOFA 4S2NC 3C8CA 1EWZA 1L0EA 3IH8A 3P7NA 1Z09A 1Z6FA 5HL6A 3S7OA 3UPNA 5F1GA 3FPWA 1H8YA 5E2GA 1YAXA 4S2OA 3N8RA 5M19A 5EPHA 3SZTA 5HPFA 5KZHA 4HP9A 4LGWA 1WE4A 2EA9A 2O9CA 5EVIA 2IWCA 3EEHA 4WM9A 2OWJA 3IBRA 1GSWA 2XA7M 4PPRA 1ONGA 3WS4A 4IJGA 4L0LA 3PBSA 3VOYA 3EQUA 1L2SA 4E6WA 3VSKA 3IS2A 2ZJ9A 1PFLA 4ME4A 1SZVA 3ITBA 2PD7A 4O8GA 3IXDA 3MXSA 1RCJA 4F3LB 2HGVA 5HZHA 2ZQCA 3IH9A 2M7VA 4RQ9A 5A93A 1PRQA 2Y2NA 4MBKA 5FATA 2VX8A 3LUQA 4JBFA 4P87A 2JKRI 5TBMA 1PWGA 3HLFA 3RXXA 3A0SA 4KZ3A 5EUAA 1JWVA 1S67L 2C5WB 2JBFA 3V39A 2ZM8A 3Q7VB 3EQVA 1IYSA 5L07A 2XH9A 1ZG4A 4NKPA 5DF7A 4KUKA 1YT4A 1SKOB 3MBZA 4M3KA 3IXHA 5KMWA 3JVUA 4OOYA 1PZPA 4GHIA 4AFIA 3W4PA 4OH0A 1SHVA 4H8RA 1XGIA 1MWTA 3S7PA 3KX0X 4L9FA 1LHYA 1YLYA 3NOTC 3PBOA 2XFSA 1HLUP 3BECA 1K55C 5CEDA 1LL9A 1LL8A 1I2WA 1O07A 2Y8HA 1TS0A 1AWIA 1ODVA 3N8LA 3U4LP 5CGSA 3PBTA 3A3EA 1G68A 2QZ6A 4E3OA 3B33A 1RGZA 2JCHA 3HCYA 2EFUA 2EXAA 2PR5A 3LI9A 4IEDA 1E3UA 4KG2A 3UB6A 4ZJ2A 3NJAA 4Q0JA 4II7A 3SH9A 4E3NA 2W3GA 2ZMVA 2L1MA 2OAQ1 2R78A 3TRCA 1I2SA 4H6JA 2WZXA 3F1OB 2GNXA 3IX8A 3IWIA 4HBTA 4U0XA 3BW6A 3C4PA 5L2FA 2I72A 3QP2A 3GSGA 3A3DA 1DJBA 3PBRA 2L4RA 1GCEA 4OQ0A 2V1AA 1QMFA 4GD8A 4OQIA 5D3OA 2IA2A 3V5MA 2GZAA 2PHYA 5CHUA 2BG1A 4P6BA 1OT9A 1ACFA 5E43A 5HDCA 1KGEA 2XGNA 4PHTA 2P9VA 5FI7A 3W2ZA 1LSXA 3G31A 4JF6A 4UAAA 1XGJA 3HREA 5J4EA 4BL2A 5J8XA 4EESA 4Y17A 2V0WA 3F1PB 3MJQA 3AGDA 3E4OA 3C7UA 3HLWA 4KZBA 4JF4A 3BJNA 5HDSA 2BASA 4IBXA 2QHKA 1OJ5A 5G18A 5GHYA 3S7QA 5M18A 5FSRA 2PBYA 5DKLA 5FDSA 5IU1A 1EW0A 1OMEA 3QP4A 4YFMA 2Y59A 1MWSA 4I38A 1TEMA 4L9GA 3P09A 5HAIA 1IELA 5AVFA 2J9PA 2WKIA 4OKPA 4ZJ3A 4WEJA 3FZCA 2EX8A 3A3IA 3CJMA 2R9XA 4YWZA 2WAFA 4Y0TA 3CUEC 2HF6A 3NOPC 1N9BA 1PZOA 1S6RA 4FCFA 1P0ZA 3FWLA 5DJTA 3MZEA 5DF8A 2H0YA 2ACGA 3VP3A 2Z6CA 3DTEA 3NBLA 2Y2GA 3UDIA 3ZFZA 2OAP1 2W3FA 5KIZA 3EOIA 1LSVA 2A24A 3I7JA 5EVLA 1XFQA 4WZ4A 1PW1A 3A3FA 3IWOA 2CMNA 5CHMA 1NYYA 3IX3A 2H10A 3E0YA 1ZHHB 4R6LA 4ARZB 1K57A 2V0UA 4KZ8A 4PKYA 1TDLA 3NDGA 1NLYA 3HLCA 5FQ9A 1S1YA 3BRMA 3D3OA 3IX4A 3BM6A 4R4RA 3S1YA 1XJ4A 2ZQ7A 3OOVA 4JGOA 4PM9A 1ZC2A 1MY8A 1Y28A 3FPVA 3IT9A 2JKTI 2Q0OA 2OLUA 2ZC6B 3B3XA 4JGPA 1YSPA 2ZQDA 1K25A 2Z6DA 4OLGA 2V8FA 4GZBA 4EBLA 1PIOA 1K38A 3CG5A 3FKVA 3ISGA 5C5KA 4GB7A 1JVJA 4X56A 3TSGA 2Q9NA 4CJNA 3OC2A 5FQQA 4QD4A 3JYIA 2IWBA 4Y13A 4NG2A 4MBHA 4GDNA 4ZAMA 4E3LA 5DTSA 2V9AA 3D4FA 4UA9A 1BTLA 5HD3A 4N1HA 4HI4A 1TVFA 3GDIA 1F5MA 1PWCA 1MBLA 3N6IA 4OOMA 4YNRA 1EI5A 3OLOA 2PD8A 5FDHA 4PM8A 3MQOA 3B47A 4EBPA 5GLCA 4DE1A 4LV1A 2ZM2A 3TE8A 3HBRA 1KE0A 1YM1A 4KZ6A 4KZ9A 1TS8A 2H5SA 2W3DA 4MEZA 3ICYA 3H82A 4PM5A 1GA9A 3LEZA 1MZUA 1H3QA 3OPHA 4BENA 1V9YA 5FEGA 1TS7A 4XT2B 2PR6A 3KSFA 3CMZA 4WEKA 3IF6A 3QNCA 1HVBA 3MMHA 1KVLA 3E2LA 2A49A 3QP1A 1BLSA 5EOOA 4QB8A 5F82A 4R38A 4HHDA 3AGEA 4WBGA 3CPTB 5EOEA 4MN6A 1NZOA 3EGDC 4GOGA 1IKIA 1NXYA 4EBNA 4Q8IA 2OOLA 5F6AA 4ID4A 2UWXA 2VV8A 5EM0A 3UMDA 4BJPA 3B42A 1FCOA 3WS1A
chains in the Genus database with same CATH topology
4DN0A 4EU0A 4F3LB 3T50A 2HGVA 5F5YA 3PBNA 4P6ZS 5HZHA 3LIAA 2O0YA 2M7VA 2L0WA 2ZMFA 4RQ9A 2PDRA 3G6OA 3PXPA 4EUVA 3OBFA 4NXBA 2VX8A 3LUQA 4GCZA 2JKRI 1MKMA 5TBMA 4YOFA 1YKDA 5CX7A 1G28A 4Y5FA 2NUTC 3A0SA 5TBMB 3LR5A 5HWWA 3D72A 4WL9A 1S67L 3MQ0A 1OTEA 3T4SA 4ETZA 1XFNA 3EQVA 4HJ6A 2DMWA 4WLAA 3EGXC 4NKPA 4UEYA 2J3TD 3T4TA 4KUKA 3UE6A 1D7EA 4HJ4A 1TD5A 2VJWA 3OCNA 1WA9A 3KSHA 4R3AA 2J80A 4HH3A 4ETXA 2P08A 1UWNX 3JVUA 5EFWA 2QKPA 2VGLM 4G3WA 2KX6A 4GHIA 4GW9A 4AFIA 1W63Q 2JKTM 3ZQ5A 1G6OA 4GHIB 2VA0A 3S7PA 4GJ4A 3KX0X 4L9FA 1T1CA 3HJIA 3PYPA 3NOTC 4LRXC 3PBOA 4NXFA 1S66L 1MC0A 2YKHA 2HV1A 1GSVA 1LL8A 2Y8HA 5F68A 2LB5A 1T1BA 2W0NA 1TS0A 1ODVA 1S1ZA 4EQ1A 1XJ2A 1VHMA 5HD5A 1VB6A 4O0PA 5AJGA 2B02A 3LIFA 1P97A 4CLCE 4MN5A 3KO6A 1UWPX 1F98A 3RTYA 3PBTA 1DP9A 2WKRA 2I9VA 2O9BA 4M4XA 2J3TC 3VE4A 4IHQA 3DBAA 5DFXA 1XJ3A 4DMZA 4DJ3A 3FC7A 3B33A 3UMEA 5J3WA 2W3EA 1STZA 4Y2FA 3FG8A 3HCYA 3MQQA 3LIEA 5AVEA 3T4QA 1N9OA 1T19A 2PR5A 2KOIA 4NXEA 5HWTA 3LI9A 3LFVA 1T18A 3C2WA 3UB6A 2HJ9C 2JHEA 4HIAA 4KQDA 4G3VA 3NJAA 2W1TA 4Q0JA 4II7A 4K08A 3F1OA 3NHQA 2W3GA 2ZMVA 2W1RA 2L1MA 2OAQ1 2R78A 3TRCA 4H6JA 3F1OB 3E4QA 2GNXA 3UB8A 1S4SA 1JNUA 2INWA 3KSIA 3F1NA 2WKQA 3BW6A 4KQOA 1OTDA 4UQIS 3CUEA 4ARZA 2FH5A 1P9RA 3R7WA 3PBRA 4E04A 2L4RA 2ZOHA 3C30A 3UB9A 2V1AA 3EWKA 4HP4A 4KUOA 3KYZA 4LRZE 2IA2A 1DP8A 2GZAA 2PHYA 2A2LA 4LRYC 1OT9A 4LLOB 5HDCA 4CQHA 5IT5A 3T4JA 1N9LA 3LI8A 4CLCA 1NLZA 4PHTA 3MFXA 1NWZA 3BQ8A 2P7JA 3W2ZA 1LSXA 1IOUA 2D01A 5FL3A 5A8BA 4LPZA 2J3WA 4MN7A 5J4EA 3F1PA 2V1BA 2KLIA 4EESA 1TS6A 2V0WA 3F1PB 3T4KA 3MJQA 4Z1WA 1NRJA 3CITA 3H7WA 3BQAA 4ZRRA 3E4OA 4EW7A 2H28A 3H7WB 3PR6A 4I3IA 2EWVA 3BJNA 5DFYA 5HDSA 5HSQA 1S4RA 2BASA 3K3CA 4IUHA 2K31A 4I3JA 2QHKA 1OJ5A 3E98A 2B18A 4B9OA 2VKSA 4HOIA 3S7QA 3UE3A 3VE3A 5DKLA 5IU1A 2EWWA 1DRMA 4CLCD 1EW0A 2FZ0A 2QWSA 3A0VA 3E4PA 3KYQA 4EEUA 4WUJA 4I38A 4L9GA 4I5SA 1OJGA 5AVFA 3LR0A 4WEJA 4P6ZM 4MMNA 5F69A 4EERA 3OCLA 2XA7S 4GS9A 3MXQA 1OTAA 4YWZA 5DKKA 4GS9B 4EXOA 2YKFA 3CUEC 1BYWA 4O01A 2HF6A 1XJ6A 2K2NA 3NOPC 2PYRA 1P0ZA 2PYPA 2LB9A 1D06A 3TJZC 5DJTA 5IS1A 1T1AA 4HY8A 4PKYG 2W27A 2Z6CA 1OTIA 3V67A 1OPXA 3R4KA 3TW8A 3BY9A 4I3AA 5DJUA 1F9IA 4G3KA 3LIBA 2OAP1 2W3FA 5HDDA 4JGQA 5KIZA 3GECA 5I5LA 5DF9A 2W1TB 3EOIA 2O99A 3K2NA 1H8MA 1LSVA 2A24A 3CI6A 3BWLA 3K3DA 4H6JB 5TJJA 4XT2A 1XFQA 5HWVA 4Y3IA 2VEAA 4NXGA 4FSFA 2A24B 3KSGA 3LICA 3F1NB 2CMNA 2VLGA 3E0YA 4Q0IA 1ZHHB 1ZTUA 3IBJA 3LIDA 4R6LA 4ARZB 2V0UA 4PKYA 3LYXA 1KOUA 3R7WB 1NLYA 2GX5A 4GLQA 3O5YA 1S1YA 3D3OA 2XRNA 2PT7A 1XJ4A 3CWFA 3OOVA 4JGOA 3BY8A 1OTBA 1Y28A 3FPVA 2VGLS 2WKPA 4EETB 1LSWA 2JKTI 4WN5A 4BMWA 3JVVA 2ZOIA 4CLCB 1TF1A 4WF0A 2D02A 4JGPA 1YSPA 2Z6DA 4QPRA 2XSSA 2G7UA 2VV6A 3LR3A 4HJ3A 3RFBA 5MC7A 2W3HA 2M7UA 5C5KA 1X0OA 4BBVA 4HNBA 5J7EA 3CAXA 3MR0A 4HH2A 3EEAA 3OC2A 2QJ5A 4UQIM 4MDZA 4PAUA 4MCWA 1YSQA 4FOFA 1V9ZA 4B93A 2M1CA 5G4YA 2QYBA 2P04A 4IUKA 2V9AA 1DP6A 4JGRA 5G4ZA 3RH8B 5K5BA 2Y79A 4R70A 5HD3A 2OWHA 2VV7A 4BBUA 4HI4A 3GDIA 5LBRA 4Q0HA 4I39A 1F5MA 4OOMA 3LR4A 2XROA 2QJ7A 3PBQA 2JKRM 3NOUC 1UGUA 2K7SA 1P9WA 3P01A 3C8CA 4YNRA 3T4OA 1IFQA 3OLOA 4NEED 2PD8A 2JN7A 3PHYA 5KSHA 3MQOA 3B47A 3P7NA 4WELA 2O9AA 5HL6A 3VV4A 3A0RA 1N9NA 4OOLA 4BWIA 4DJ2A 5HPIA 3S7OA 3ULFA 3TE8A 4CLCC 5L8MA 1TS8A 1W63M 2VZWA 2W3DA 3FPWA 3ICYA 1YAXA 3ZYTA 3H82A 1LT0A 4HQAA 3VOLA 1MZUA 3H82B 1H3QA 3T4LA 5HPFA 1V9YA 4HP9A 3SW1A 1TS7A 2EA9A 2O9CA 3H9WA 4BBTA 4XT2B 2PR6A 3KSFA 3EEHA 2NUPC 2OWJA 2KDKA 2MJ6A 4WEKA 3IBRA 1GSWA 2XA7M 3MMHA 2GJ3A 2ZBBA 4IJGA 1GSXA 4L0LA 3PBSA 2HJEA 3EQUA 3MF0A 4R38A 4HHDA 3UB7A 3CLOA 4EEPA 4L9EA 3C38A 3IS2A 4MN6A 3S7NA 3EGDC 4ME4A 3IS2B 2PD7A 4O8GA 3U2AA 3HJKA 2OOLA 5F6AA 4F3LA 2VV8A 3UMDA 4BJPA 3B42A 1OT6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F3L B;  3T50 A;  5F5Y A;  5HZH A;  3LIA A;  2L0W A;  4RQ9 A;  2PDR A;  3G6O A;  4NXB A;  3LUQ A;  4GCZ A;  5TBM A;  1G28 A;  3A0S A;  5TBM B;  5HWW A;  3D72 A;  4WL9 A;  1S67 L;  1OTE A;  1XFN A;  4HJ6 A;  4WLA A;  4KUK A;  3UE6 A;  1D7E A;  4HJ4 A;  1WA9 A;  4R3A A;  2J80 A;  4HH3 A;  1UWN X;  5EFW A;  2QKP A;  2KX6 A;  4GHI A;  4GW9 A;  3ZQ5 A;  4GHI B;  3KX0 X;  4L9F A;  1T1C A;  3HJI A;  3PYP A;  3NOT C;  4LRX C;  4NXF A;  1S66 L;  2YKH A;  2HV1 A;  1GSV A;  1LL8 A;  5F68 A;  1T1B A;  2W0N A;  1TS0 A;  1ODV A;  1S1Z A;  4EQ1 A;  1XJ2 A;  5HD5 A;  1VB6 A;  2B02 A;  3LIF A;  1P97 A;  4MN5 A;  3RTY A;  1UWP X;  1F98 A;  1DP9 A;  2WKR A;  2I9V A;  4M4X A;  3VE4 A;  1XJ3 A;  4DJ3 A;  3FC7 A;  3B33 A;  3UME A;  5J3W A;  3FG8 A;  3MQQ A;  3LIE A;  5AVE A;  1N9O A;  1T19 A;  2PR5 A;  4NXE A;  5HWT A;  3LI9 A;  1T18 A;  3C2W A;  3UB6 A;  4HIA A;  2JHE A;  4KQD A;  3NJA A;  4K08 A;  3F1O A;  3NHQ A;  2L1M A;  2R78 A;  4H6J A;  3F1O B;  3E4Q A;  3UB8 A;  1S4S A;  1JNU A;  2INW A;  3F1N A;  2WKQ A;  1OTD A;  4E04 A;  2L4R A;  2ZOH A;  3UB9 A;  2V1A A;  3EWK A;  4HP4 A;  4KUO A;  4LRZ E;  1DP8 A;  2PHY A;  4LRY C;  1OT9 A;  4LLO B;  5HDC A;  1N9L A;  3LI8 A;  3MFX A;  1NWZ A;  2P7J A;  1LSX A;  2D01 A;  5A8B A;  4LPZ A;  5J4E A;  3F1P A;  2V1B A;  4EES A;  1TS6 A;  2V0W A;  3F1P B;  3MJQ A;  3H7W A;  3E4O A;  4EW7 A;  2H28 A;  3H7W B;  4I3I A;  5HSQ A;  5HDS A;  1S4R A;  2BAS A;  3K3C A;  4I3J A;  2QHK A;  1OJ5 A;  4B9O A;  4HOI A;  3VE3 A;  5IU1 A;  5DKL A;  1DRM A;  1EW0 A;  2QWS A;  3A0V A;  3E4P A;  4EEU A;  4WUJ A;  4I38 A;  4L9G A;  4I5S A;  1OJG A;  5AVF A;  5F69 A;  4EER A;  4GS9 A;  3MXQ A;  1OTA A;  4YWZ A;  5DKK A;  4GS9 B;  4EXO A;  2YKF A;  1BYW A;  1XJ6 A;  3NOP C;  2PYR A;  1P0Z A;  2PYP A;  5IS1 A;  1D06 A;  5DJT A;  1T1A A;  4HY8 A;  4PKY G;  2W27 A;  2Z6C A;  1OTI A;  3BY9 A;  4I3A A;  5DJU A;  1F9I A;  3LIB A;  5HDD A;  4JGQ A;  5KIZ A;  3GEC A;  5I5L A;  1LSV A;  2A24 A;  3K3D A;  3BWL A;  4H6J B;  4XT2 A;  1XFQ A;  5HWV A;  2VEA A;  4NXG A;  2A24 B;  3LIC A;  3F1N B;  2CMN A;  2VLG A;  3LID A;  4R6L A;  2V0U A;  4PKY A;  3LYX A;  1KOU A;  1S1Y A;  1XJ4 A;  3CWF A;  4JGO A;  3BY8 A;  1OTB A;  1Y28 A;  2WKP A;  4EET B;  1LSW A;  4WN5 A;  2ZOI A;  4WF0 A;  2D02 A;  4JGP A;  2Z6D A;  2VV6 A;  4HJ3 A;  1X0O A;  4BBV A;  4HNB A;  5J7E A;  3CAX A;  3MR0 A;  4HH2 A;  2QJ5 A;  1V9Z A;  2M1C A;  5G4Y A;  2V9A A;  1DP6 A;  4JGR A;  5G4Z A;  3RH8 B;  4R70 A;  5HD3 A;  2OWH A;  2VV7 A;  4BBU A;  4HI4 A;  3GDI A;  4I39 A;  2QJ7 A;  3NOU C;  1UGU A;  2K7S A;  3C8C A;  3OLO A;  2PD8 A;  2JN7 A;  3PHY A;  3MQO A;  3P7N A;  3A0R A;  1N9N A;  4DJ2 A;  3ULF A;  1TS8 A;  3ICY A;  3H82 A;  1LT0 A;  4HQA A;  3VOL A;  1MZU A;  3H82 B;  1V9Y A;  4HP9 A;  3SW1 A;  1TS7 A;  2EA9 A;  3H9W A;  4BBT A;  4XT2 B;  2PR6 A;  3EEH A;  2OWJ A;  2KDK A;  3IBR A;  1GSW A;  2GJ3 A;  2ZBB A;  1GSX A;  4R38 A;  4HHD A;  3UB7 A;  3CLO A;  4EEP A;  4L9E A;  3IS2 A;  4MN6 A;  3IS2 B;  2PD7 A;  3HJK A;  2OOL A;  5F6A A;  4F3L A;  2VV8 A;  3UMD A;  1OT6 A; 
#chains in the Genus database with same CATH topology
 4X25 A;  4DDS A;  1NY0 A;  1K54 A;  1K56 D;  4WMC D;  2PAV P;  3PXP A;  2GDN A;  2HDQ A;  1W8Y A;  1MKM A;  4YOF A;  1YKD A;  5FAO A;  3HLB A;  1ERQ A;  5HWW A;  3O88 A;  4WL9 A;  4OPY A;  2Y2Q A;  2Y2K A;  3ZGA B;  3EGX C;  4FTX A;  3UE6 A;  4HJ4 A;  1KDS A;  4DE0 A;  4IBR A;  2OSU A;  3S22 A;  4R3A A;  2X02 A;  1BT5 A;  2QKP A;  1BLH A;  5DVA A;  4A5R A;  2ZD8 A;  2DRW A;  4K0X A;  2EX2 A;  1FIL A;  3L9K A;  1W63 Q;  1G6O A;  1T1C A;  2E8J A;  1CEG A;  3HJI A;  3PAE A;  1JTD A;  4LRX C;  2DNS A;  3G2Z A;  3VSL A;  1JTG A;  2YKH A;  1GSV A;  4JXS A;  4YIN A;  2Q9M A;  4EQ1 A;  5HD5 A;  1VB6 A;  3LIF A;  5CTM A;  2WGW B;  4CLC E;  4EV4 A;  4B4Z A;  3KO6 A;  5FAP A;  1UWP X;  1F98 A;  4Y7P A;  4EQI A;  4WZ5 A;  1FCN A;  5HL1 A;  5CEC A;  1BUL A;  4M4X A;  3VE4 A;  4DMZ A;  2EXB A;  3LIE A;  1T19 A;  5HWT A;  4F94 A;  3NEC A;  5AQ7 A;  4K91 A;  2EX6 A;  4KZ5 A;  2HJ9 C;  4HIA A;  3WS0 A;  5DTT A;  3O3V A;  2W1R A;  3GTC A;  1KGF A;  3E4Q A;  1ES2 A;  5E2F A;  1VEU B;  2EX9 A;  2WKQ A;  3QNB A;  1OTD A;  4UQI S;  1VM1 A;  5AQB A;  4ARZ A;  4DE3 A;  3LGO A;  3HLG A;  4E04 A;  2OLV A;  2ZMA A;  2QPN A;  4ZDX A;  2FFY A;  4KUO A;  5FA7 A;  4R23 A;  1DP8 A;  1XX2 A;  4LRY C;  4ESP A;  4R0Q A;  4JKT A;  1XA1 A;  4OQG A;  4U0T A;  1H8Z A;  4Y0O A;  3OPP A;  1NLZ A;  2XD1 A;  1FR6 A;  3WS2 A;  1BLC A;  5FAQ A;  2D01 A;  5A8B A;  4LPZ A;  1W8Q A;  3QHY A;  4MBF A;  5CXW A;  1W79 A;  3MSH A;  3WWX A;  2WUQ A;  3TG9 A;  2ZC4 B;  2XDM A;  3GMW A;  1NRJ A;  3H7W A;  5E2E A;  4EW7 A;  1DJA A;  2HP5 A;  1S4R A;  3K3C A;  2B18 A;  1J9M A;  3UE3 A;  3MZF A;  3O87 A;  5EE8 A;  3VE3 A;  5FQJ A;  4CLC D;  2FZ0 A;  1YLT A;  3KYQ A;  4ZBE A;  3ZG9 B;  3LEQ A;  2FFF B;  4I5S A;  1OJG A;  2Y2O A;  4P6Z M;  4LV2 A;  4MMN A;  4JF5 A;  2V8C A;  4PM6 A;  2XA7 S;  1MWR A;  3FKW A;  4FUW A;  5KSC A;  4GS9 B;  2V1Z A;  4X1L A;  1BSG A;  2PYR A;  4GN2 A;  1ALQ A;  5HAP A;  1MWU A;  3NCK A;  3QP6 A;  1HD8 A;  1D06 A;  3TJZ C;  5IS1 A;  4X53 A;  4PKY G;  1OPX A;  3R4K A;  4S2L A;  4C75 A;  5CER A;  1J3W A;  3N4I A;  3VOZ A;  1F9I A;  3DTM A;  5HDD A;  2G2U A;  3WRT A;  1SCW A;  2W1T B;  2O99 A;  3K2N A;  3K3D A;  1FR1 A;  4XT2 A;  4FSF A;  2DCF A;  3F1N B;  2H0T A;  4OPZ A;  2VLG A;  4OQH A;  1RP5 A;  1PW8 A;  1KOU A;  5JYP A;  4S2N A;  2JKF A;  3O5Y A;  4OON A;  1AXB A;  1YQS A;  3PTE A;  2B5R A;  3CPT A;  3CWF A;  4N9L A;  1LLB A;  3ZG7 B;  3N7W A;  3O86 A;  4QU3 A;  2WAD A;  4WN5 A;  3IQA A;  4LFU A;  3JVV A;  2ZQ8 A;  3Q1F A;  4CLC B;  1QME A;  2D02 A;  5CEB A;  2JC7 A;  4LV3 A;  5CTN A;  3BEB A;  3IF5 A;  5HAQ A;  3ZG0 A;  2ZC7 A;  2VK3 A;  4JPM A;  2VV6 A;  1GHM A;  4HJ3 A;  1Q2P A;  2W3H A;  2M7U A;  4BBV A;  1PNE A;  3CAX A;  3D9Y A;  3MR0 A;  4MDZ A;  1YSQ A;  1NRF A;  2QMI A;  4K0W A;  5G4Y A;  1XKZ A;  3G2Y A;  4IUK A;  4QY6 A;  4HBU A;  1DP6 A;  5TGF A;  3LY4 A;  2X01 A;  4R70 A;  2OWH A;  2J9O A;  1M40 A;  1VET A;  4Y0U A;  2XD5 A;  2ZLY A;  3PBQ A;  3T1X A;  2BLS A;  1S0W A;  1UGU A;  4DKI A;  3T4O A;  1IFQ A;  2IWD A;  1K4E A;  2WKH A;  2JN7 A;  1KE4 A;  4X69 A;  1PYY A;  2WGW A;  3L7H A;  3VV4 A;  3A0R A;  4BWI A;  3M6H A;  4DJ2 A;  3IXG A;  2HDU A;  2Y91 A;  3UPO A;  4CLC C;  2HDR A;  4UHU A;  2VZW A;  3M2K A;  2RCX A;  4RYE A;  2Y2M A;  3Q7Z A;  3T12 B;  3T4L A;  3NUL A;  3GR2 A;  4IVK A;  3SW1 A;  3H9W A;  3SS4 A;  4ZJ1 A;  1K56 A;  4WMC A;  2KDK A;  5EVI B;  2MJ6 A;  5EEC A;  4JLF A;  4E6X A;  5F1F A;  2ZBB A;  1GSX A;  5EM1 A;  5CHJ A;  1K55 A;  1KDW A;  4X68 A;  4LEN A;  2HJE A;  2V20 A;  3OPL A;  1CF0 A;  3CLO A;  3UB7 A;  2JE5 A;  4EEP A;  4L9E A;  3QP5 A;  3S7N A;  3UNW A;  3IS2 B;  3U2A A;  2BTF P;  2Y2L A;  3HJK A;  4F3L A;  1PWD A;  1OT6 A;  5GLD A;  5AQ9 A;  4DN0 A;  5GHX A;  3T50 A;  4OVD A;  4UA6 A;  3ZNY A;  4OP8 A;  2O0Y A;  4JXG A;  1D1J A;  2L0W A;  2ZMF A;  3Q07 A;  2PDR A;  4EUV A;  3C5A A;  4GCZ A;  2Y2I A;  4KQR A;  4GDB A;  2WK0 A;  4Y5F A;  2NUT C;  4JXV A;  4KZ4 A;  5TBM B;  3LR5 A;  3MQ0 A;  3Q7V A;  1KVM A;  3V3R A;  3UDX A;  3UY6 A;  2E8I A;  1IKG A;  2B95 A;  1XFN A;  2PU4 A;  4OPR A;  4UEY A;  1SKO A;  1D7E A;  2VJW A;  3LCE A;  3OCN A;  1WA9 A;  2J80 A;  5EFW A;  1H5X A;  2VGL M;  5TR7 A;  4G3W A;  2Y55 A;  5EVI C;  4GW9 A;  2JKT M;  4GHI B;  2HZ5 A;  1BUE A;  1CEF A;  2XLN A;  4X6T A;  3PYP A;  5BOH A;  1K6R A;  3QP8 A;  3RJU A;  1S66 L;  2X71 A;  1MC0 A;  2HV1 A;  1KGG A;  5F68 A;  1T1B A;  2W0N A;  1JWZ A;  1S1Z A;  1VHM A;  1NJ4 A;  1P97 A;  1HZO A;  3JPU A;  4S2K A;  4MN5 A;  4BD1 A;  1LL5 A;  2WKR A;  2O9B A;  1ZKJ A;  1M6K A;  2J3T C;  5DFX A;  3DBA A;  1XJ3 A;  4DJ3 A;  1A0K A;  2HP6 A;  3FC7 A;  2Y2H A;  2Z2M B;  5J3W A;  2W3E A;  4P85 A;  3IHA A;  3FG8 A;  3OPR A;  1JWP A;  4NXE A;  3LFV A;  4HES A;  4DRT A;  2CC1 A;  3C2W A;  4HEF A;  2W1T A;  4K08 A;  4RX3 A;  3F1O A;  3NHQ A;  3NIA A;  3HLE A;  3G32 A;  3F1N A;  2UV0 E;  1CK3 A;  3T1S A;  4KQO A;  2XEP A;  2J8Y A;  5U47 A;  4RVA A;  3CUE A;  2FH5 A;  4QJG A;  2ZOH A;  3C30 A;  3UB9 A;  4KZ7 A;  3RXW A;  4HP4 A;  5CRF A;  3SOI A;  3MXR A;  4LRZ E;  3ZHH A;  2A2L A;  4LLO B;  4CQH A;  5IT5 A;  3T4J A;  1LI0 A;  1SDN A;  1YLW A;  4CLC A;  3MFX A;  3BFG A;  4MNR A;  2P7J A;  4R3J A;  2P9V B;  5L10 A;  2J3W A;  2HPB A;  4MN7 A;  3BFC A;  3W4O A;  3F1P A;  3C4O A;  2V1B A;  2KLI A;  1ESI A;  1TS6 A;  3T4K A;  3BQA A;  4KEN B;  3TOI A;  4LCL A;  4I3I A;  5DFY A;  1DY6 A;  2K31 A;  3DTK A;  2VKS A;  1DRM A;  3A0V A;  4EEU A;  4WUJ A;  1K6S A;  4OLD A;  1F2K A;  3NC8 A;  4N9K A;  4EER A;  1YMX A;  3OCL A;  2R9W A;  4EXO A;  4OPQ A;  1E4D A;  4PM7 A;  2PRF A;  1BYW A;  4O01 A;  4KZA A;  3VP2 A;  2RL3 A;  1XJ6 A;  3Q81 A;  4N1X A;  4X1M A;  4B4X A;  2PYP A;  1YLZ A;  1T1A A;  5GLA A;  4HY8 A;  2P74 A;  4O7D A;  1FSY A;  2W27 A;  1ERO A;  2ZQA A;  3V67 A;  3TW8 A;  1N4O A;  3G4P A;  5FQM A;  4DE2 A;  4KG6 A;  3LIB A;  4JGQ A;  5I5L A;  5FI6 A;  1SDE A;  1RGY A;  1H8M A;  5A91 A;  3BWL A;  5TJJ A;  2ZC5 B;  4DDY A;  4NET A;  4Y3I A;  2A24 B;  2Y2J A;  4OP5 A;  2WAE A;  4Q0I A;  3IBJ A;  3R7W B;  3ZG5 A;  2XRN A;  1NYM A;  2PT7 A;  1CI8 A;  1Q2Q A;  5L09 A;  3BY8 A;  4S2I A;  1Y54 A;  3IHB A;  1ZG6 A;  3GRJ A;  2WGV A;  3N8S A;  4QWO A;  2ZOI A;  1E25 A;  1TF1 A;  4WF0 A;  2C6W B;  2ZL1 B;  4GNU A;  3GVB A;  4BLM A;  1DJC A;  3M2J A;  2XSS A;  2G7U A;  1ONH A;  4ZTK A;  4BL3 A;  1X0O A;  4P0M A;  1SKF A;  4HNB A;  4XUX A;  5J7E A;  1XPB A;  3GV9 A;  4RX2 A;  3PAG A;  3ZVW A;  2QJ5 A;  3UE1 A;  4PAU A;  4FOF A;  5FQI A;  5GL9 A;  3DWZ A;  3VP0 A;  4R1G A;  4BD0 A;  2P04 A;  3DW0 A;  4JGR A;  4BQM A;  5K5B A;  3NDE A;  4IVI A;  2WKE A;  3BLM A;  4BBU A;  1G5U A;  2VV7 A;  3C7V A;  4UA7 A;  2XFT A;  1XXM A;  4EWF A;  2XQZ A;  4Q0H A;  3CHW P;  3LR4 A;  4S2J A;  2XRO A;  2QJ7 A;  1W7F A;  2JKR M;  1K57 C;  3NOU C;  2VGJ A;  3OZH A;  4CPK A;  3V50 A;  3P01 A;  4NEE D;  5FQK A;  3PHY A;  5KSH A;  3VMA A;  4WEL A;  3V3S A;  2O9A A;  1CJF A;  4OOL A;  1N9N A;  3NY4 A;  5HPI A;  1BZA A;  3ULF A;  5L8M A;  1W63 M;  2J7V A;  3UB5 P;  1Y4O A;  4E3M A;  3HUM A;  3MKE A;  1MPL A;  4FH2 A;  5E2H A;  1GHP A;  4R4S A;  3AGF A;  3ZYT A;  1LT0 A;  4HQA A;  3VOL A;  3SH7 A;  3H82 B;  4BBT A;  2NUP C;  1C3B A;  3G30 A;  1ES3 A;  2GJ3 A;  3IF6 B;  1ES5 A;  3BFD A;  4WYY A;  3MF0 A;  5I94 A;  3DWK A;  3ZDJ A;  4PMA A;  2Y2P A;  3C38 A;  2AVX A;  4E3K A;  5A92 A;  3FYZ A;  3S4X A;  1WYB A;  5EVI D;  4EU0 A;  4D60 A;  3VP1 A;  5F5Y A;  3PBN A;  4P6Z S;  3LIA A;  3SS5 A;  2XF3 A;  1VQQ A;  1I5Q A;  2WZZ A;  3G6O A;  3OBF A;  4NXB A;  3HUO A;  3CZD A;  5CX7 A;  1G28 A;  2JKG A;  5JYO A;  5FEF A;  3BFE A;  2Y4A A;  3D72 A;  5GLB A;  1OTE A;  3P98 A;  3T4S A;  4ETZ A;  4GD6 A;  4HJ6 A;  2DMW A;  4Z9Q A;  4WLA A;  3ITA A;  2J3T D;  3T4T A;  1TD5 A;  1CQA A;  1L0G A;  3KSH A;  1FIK A;  4HH3 A;  3BLS A;  4ETX A;  2EFX A;  2P08 A;  1UWN X;  4FD8 A;  4DXC A;  5HX9 A;  2KX6 A;  1ESU A;  1TDG A;  4MLL A;  3ZQ5 A;  5A90 A;  2VA0 A;  4GJ4 A;  3HL9 A;  3IF6 C;  4FH4 A;  2WGI A;  1FQG A;  5M1A A;  3UPP A;  4NXF A;  3UO9 A;  5HAR A;  3BFF A;  3MZD A;  2LB5 A;  1IYP A;  1XJ2 A;  4O0P A;  5AJG A;  2B02 A;  3UE0 A;  3RTY A;  2HP9 A;  1DP9 A;  2I9V A;  3HVF A;  4IHQ A;  1IYO A;  4XXR A;  3UME A;  4B88 A;  5FAS A;  1K54 C;  1STZ A;  4Y2F A;  3MQQ A;  5AVE A;  3T4Q A;  1N9O A;  2KOI A;  1T18 A;  2OV5 A;  2JHE A;  4KQD A;  4G3V A;  4E3I A;  4JXW A;  1BLP A;  3Q82 A;  5HW3 A;  1VEU A;  3UB8 A;  1S4S A;  5HFO A;  1JNU A;  3SH8 A;  2INW A;  2HDS A;  3KSI A;  1PI4 A;  1IEM A;  4D2O A;  1P9R A;  3R7W A;  3DAV A;  3SS3 A;  1XP4 A;  3E2K A;  3G34 A;  1YLJ A;  2ZQ9 A;  4KG5 A;  3EWK A;  2A3U A;  1IYQ A;  3KYZ A;  3LY3 A;  4DF6 A;  1E3U D;  3UDF A;  4NK3 A;  3IWQ A;  1N9L A;  3LI8 A;  3KYE A;  3MKF A;  5GHZ A;  3G35 A;  5F83 A;  1XA7 A;  3ZG8 B;  2ZL1 A;  1NWZ A;  3BQ8 A;  4S2P A;  1L3L A;  1IOU A;  5FL3 A;  3HLD A;  4WZ5 C;  3WS5 A;  4Z1W A;  3CIT A;  1NZU A;  4ZRR A;  2H28 A;  3H7W B;  3PR6 A;  4LCM A;  1WYC A;  2EWV A;  5HSQ A;  3IXB A;  4LV0 A;  4IUH A;  4I3J A;  3E98 A;  4B9O A;  1MKI A;  4HOI A;  4U3T A;  3WRZ A;  3LO7 A;  3UN7 A;  2EWW A;  1YMS A;  5CGX A;  2PU2 A;  5FI2 A;  2QWS A;  3E4P A;  1MXO A;  3ZCZ A;  2VGK A;  5TFQ A;  3BYD A;  3LR0 A;  1LI9 A;  4GKU A;  4Y15 A;  3GQZ A;  5F69 A;  4GS9 A;  3MXQ A;  1OTA A;  5DKK A;  2YKF A;  2K2N A;  4X55 A;  2XK1 A;  2ZM0 A;  3T1R A;  2LB9 A;  3NI9 A;  5CGW A;  4QY5 A;  1OTI A;  5EV0 A;  3W8K A;  1G6A A;  3BY9 A;  5EVE A;  3M6B A;  4I3A A;  5DJU A;  2WYX A;  3ZVT A;  4G3K A;  3MFD A;  3GEC A;  5DF9 A;  2XR0 A;  3CI6 A;  4H6J B;  1ES4 A;  5HWV A;  3MS6 A;  2VEA A;  4NXG A;  3KSG A;  3LIC A;  1CI9 A;  3VFH A;  1KE3 A;  1ZTU A;  3LID A;  4N92 A;  3LYX A;  2GX5 A;  4GLQ A;  3T1Q B;  1L0F A;  1OTB A;  3FV7 A;  2VGL S;  2WKP A;  4EET B;  1LSW A;  4BMW A;  1U60 A;  1O7E A;  1HTZ A;  4EUZ A;  4S2M A;  1H0M A;  4XUZ A;  2ZC3 B;  4E3J A;  4RA7 A;  5DTK A;  4QPR A;  1PI5 A;  3ZNT A;  3LR3 A;  3W4Q A;  2V2F F;  3RFB A;  5MC7 A;  1FCM A;  3DTI A;  2G2W A;  4DXB A;  1GA0 A;  4C3Q A;  4HH2 A;  1W5D A;  3EEA A;  4UQI M;  4MCW A;  5AQA A;  1L0D A;  1V9Z A;  4B93 A;  2M1C A;  4C6Y A;  1YPR A;  2QYB A;  4KQQ A;  3VP4 A;  2Z2L B;  1GHI A;  5G4Z A;  1K4F A;  3RH8 B;  3VFF A;  2PBD P;  2Y79 A;  3A3J A;  1YLP A;  4QHC A;  1FSW A;  5LBR A;  1VET B;  4R3B A;  4I39 A;  1ERM A;  1K0K A;  3HUN A;  5IHV A;  2K7S A;  1P9W A;  1FOF A;  4S2N C;  3C8C A;  1EWZ A;  1L0E A;  3IH8 A;  3P7N A;  1Z09 A;  1Z6F A;  5HL6 A;  3S7O A;  3UPN A;  5F1G A;  3FPW A;  1H8Y A;  5E2G A;  1YAX A;  4S2O A;  3N8R A;  5M19 A;  5EPH A;  3SZT A;  5HPF A;  5KZH A;  4HP9 A;  4LGW A;  1WE4 A;  2EA9 A;  2O9C A;  5EVI A;  2IWC A;  3EEH A;  4WM9 A;  2OWJ A;  3IBR A;  1GSW A;  2XA7 M;  4PPR A;  1ONG A;  3WS4 A;  4IJG A;  4L0L A;  3PBS A;  3VOY A;  3EQU A;  1L2S A;  4E6W A;  3VSK A;  3IS2 A;  2ZJ9 A;  1PFL A;  4ME4 A;  1SZV A;  3ITB A;  2PD7 A;  4O8G A;  3IXD A;  3MXS A;  1RCJ A;  4F3L B;  2HGV A;  5HZH A;  2ZQC A;  3IH9 A;  2M7V A;  4RQ9 A;  5A93 A;  1PRQ A;  2Y2N A;  4MBK A;  5FAT A;  2VX8 A;  3LUQ A;  4JBF A;  4P87 A;  2JKR I;  5TBM A;  1PWG A;  3HLF A;  3RXX A;  3A0S A;  4KZ3 A;  5EUA A;  1JWV A;  1S67 L;  2C5W B;  2JBF A;  3V39 A;  2ZM8 A;  3Q7V B;  3EQV A;  1IYS A;  5L07 A;  2XH9 A;  1ZG4 A;  4NKP A;  5DF7 A;  4KUK A;  1YT4 A;  1SKO B;  3MBZ A;  4M3K A;  3IXH A;  5KMW A;  3JVU A;  4OOY A;  1PZP A;  4GHI A;  4AFI A;  3W4P A;  4OH0 A;  1SHV A;  4H8R A;  1XGI A;  1MWT A;  3S7P A;  3KX0 X;  4L9F A;  1LHY A;  1YLY A;  3NOT C;  3PBO A;  2XFS A;  1HLU P;  3BEC A;  1K55 C;  5CED A;  1LL9 A;  1LL8 A;  1I2W A;  1O07 A;  2Y8H A;  1TS0 A;  1AWI A;  1ODV A;  3N8L A;  3U4L P;  5CGS A;  3PBT A;  3A3E A;  1G68 A;  2QZ6 A;  4E3O A;  3B33 A;  1RGZ A;  2JCH A;  3HCY A;  2EFU A;  2EXA A;  2PR5 A;  3LI9 A;  4IED A;  1E3U A;  4KG2 A;  3UB6 A;  4ZJ2 A;  3NJA A;  4Q0J A;  4II7 A;  3SH9 A;  4E3N A;  2W3G A;  2ZMV A;  2L1M A;  2OAQ 1;  2R78 A;  3TRC A;  1I2S A;  4H6J A;  2WZX A;  3F1O B;  2GNX A;  3IX8 A;  3IWI A;  4HBT A;  4U0X A;  3BW6 A;  3C4P A;  5L2F A;  2I72 A;  3QP2 A;  3GSG A;  3A3D A;  1DJB A;  3PBR A;  2L4R A;  1GCE A;  4OQ0 A;  2V1A A;  1QMF A;  4GD8 A;  4OQI A;  5D3O A;  2IA2 A;  3V5M A;  2GZA A;  2PHY A;  5CHU A;  2BG1 A;  4P6B A;  1OT9 A;  1ACF A;  5E43 A;  5HDC A;  1KGE A;  2XGN A;  4PHT A;  2P9V A;  5FI7 A;  3W2Z A;  1LSX A;  3G31 A;  4JF6 A;  4UAA A;  1XGJ A;  3HRE A;  5J4E A;  4BL2 A;  5J8X A;  4EES A;  4Y17 A;  2V0W A;  3F1P B;  3MJQ A;  3AGD A;  3E4O A;  3C7U A;  3HLW A;  4KZB A;  4JF4 A;  3BJN A;  5HDS A;  2BAS A;  4IBX A;  2QHK A;  1OJ5 A;  5G18 A;  5GHY A;  3S7Q A;  5M18 A;  5FSR A;  2PBY A;  5DKL A;  5FDS A;  5IU1 A;  1EW0 A;  1OME A;  3QP4 A;  4YFM A;  2Y59 A;  1MWS A;  4I38 A;  1TEM A;  4L9G A;  3P09 A;  5HAI A;  1IEL A;  5AVF A;  2J9P A;  2WKI A;  4OKP A;  4ZJ3 A;  4WEJ A;  3FZC A;  2EX8 A;  3A3I A;  3CJM A;  2R9X A;  4YWZ A;  2WAF A;  4Y0T A;  3CUE C;  2HF6 A;  3NOP C;  1N9B A;  1PZO A;  1S6R A;  4FCF A;  1P0Z A;  3FWL A;  5DJT A;  3MZE A;  5DF8 A;  2H0Y A;  2ACG A;  3VP3 A;  2Z6C A;  3DTE A;  3NBL A;  2Y2G A;  3UDI A;  3ZFZ A;  2OAP 1;  2W3F A;  5KIZ A;  3EOI A;  1LSV A;  2A24 A;  3I7J A;  5EVL A;  1XFQ A;  4WZ4 A;  1PW1 A;  3A3F A;  3IWO A;  2CMN A;  5CHM A;  1NYY A;  3IX3 A;  2H10 A;  3E0Y A;  1ZHH B;  4R6L A;  4ARZ B;  1K57 A;  2V0U A;  4KZ8 A;  4PKY A;  1TDL A;  3NDG A;  1NLY A;  3HLC A;  5FQ9 A;  1S1Y A;  3BRM A;  3D3O A;  3IX4 A;  3BM6 A;  4R4R A;  3S1Y A;  1XJ4 A;  2ZQ7 A;  3OOV A;  4JGO A;  4PM9 A;  1ZC2 A;  1MY8 A;  1Y28 A;  3FPV A;  3IT9 A;  2JKT I;  2Q0O A;  2OLU A;  2ZC6 B;  3B3X A;  4JGP A;  1YSP A;  2ZQD A;  1K25 A;  2Z6D A;  4OLG A;  2V8F A;  4GZB A;  4EBL A;  1PIO A;  1K38 A;  3CG5 A;  3FKV A;  3ISG A;  5C5K A;  4GB7 A;  1JVJ A;  4X56 A;  3TSG A;  2Q9N A;  4CJN A;  3OC2 A;  5FQQ A;  4QD4 A;  3JYI A;  2IWB A;  4Y13 A;  4NG2 A;  4MBH A;  4GDN A;  4ZAM A;  4E3L A;  5DTS A;  2V9A A;  3D4F A;  4UA9 A;  1BTL A;  5HD3 A;  4N1H A;  4HI4 A;  1TVF A;  3GDI A;  1F5M A;  1PWC A;  1MBL A;  3N6I A;  4OOM A;  4YNR A;  1EI5 A;  3OLO A;  2PD8 A;  5FDH A;  4PM8 A;  3MQO A;  3B47 A;  4EBP A;  5GLC A;  4DE1 A;  4LV1 A;  2ZM2 A;  3TE8 A;  3HBR A;  1KE0 A;  1YM1 A;  4KZ6 A;  4KZ9 A;  1TS8 A;  2H5S A;  2W3D A;  4MEZ A;  3ICY A;  3H82 A;  4PM5 A;  1GA9 A;  3LEZ A;  1MZU A;  1H3Q A;  3OPH A;  4BEN A;  1V9Y A;  5FEG A;  1TS7 A;  4XT2 B;  2PR6 A;  3KSF A;  3CMZ A;  4WEK A;  3IF6 A;  3QNC A;  1HVB A;  3MMH A;  1KVL A;  3E2L A;  2A49 A;  3QP1 A;  1BLS A;  5EOO A;  4QB8 A;  5F82 A;  4R38 A;  4HHD A;  3AGE A;  4WBG A;  3CPT B;  5EOE A;  4MN6 A;  1NZO A;  3EGD C;  4GOG A;  1IKI A;  1NXY A;  4EBN A;  4Q8I A;  2OOL A;  5F6A A;  4ID4 A;  2UWX A;  2VV8 A;  5EM0 A;  3UMD A;  4BJP A;  3B42 A;  1FCO A;  3WS1 A; 
#chains in the Genus database with same CATH homology
 4DN0 A;  4EU0 A;  4F3L B;  3T50 A;  2HGV A;  5F5Y A;  3PBN A;  4P6Z S;  5HZH A;  3LIA A;  2O0Y A;  2M7V A;  2L0W A;  2ZMF A;  4RQ9 A;  2PDR A;  3G6O A;  3PXP A;  4EUV A;  3OBF A;  4NXB A;  2VX8 A;  3LUQ A;  4GCZ A;  2JKR I;  1MKM A;  5TBM A;  4YOF A;  1YKD A;  5CX7 A;  1G28 A;  4Y5F A;  2NUT C;  3A0S A;  5TBM B;  3LR5 A;  5HWW A;  3D72 A;  4WL9 A;  1S67 L;  3MQ0 A;  1OTE A;  3T4S A;  4ETZ A;  1XFN A;  3EQV A;  4HJ6 A;  2DMW A;  4WLA A;  3EGX C;  4NKP A;  4UEY A;  2J3T D;  3T4T A;  4KUK A;  3UE6 A;  1D7E A;  4HJ4 A;  1TD5 A;  2VJW A;  3OCN A;  1WA9 A;  3KSH A;  4R3A A;  2J80 A;  4HH3 A;  4ETX A;  2P08 A;  1UWN X;  3JVU A;  5EFW A;  2QKP A;  2VGL M;  4G3W A;  2KX6 A;  4GHI A;  4GW9 A;  4AFI A;  1W63 Q;  2JKT M;  3ZQ5 A;  1G6O A;  4GHI B;  2VA0 A;  3S7P A;  4GJ4 A;  3KX0 X;  4L9F A;  1T1C A;  3HJI A;  3PYP A;  3NOT C;  4LRX C;  3PBO A;  4NXF A;  1S66 L;  1MC0 A;  2YKH A;  2HV1 A;  1GSV A;  1LL8 A;  2Y8H A;  5F68 A;  2LB5 A;  1T1B A;  2W0N A;  1TS0 A;  1ODV A;  1S1Z A;  4EQ1 A;  1XJ2 A;  1VHM A;  5HD5 A;  1VB6 A;  4O0P A;  5AJG A;  2B02 A;  3LIF A;  1P97 A;  4CLC E;  4MN5 A;  3KO6 A;  1UWP X;  1F98 A;  3RTY A;  3PBT A;  1DP9 A;  2WKR A;  2I9V A;  2O9B A;  4M4X A;  2J3T C;  3VE4 A;  4IHQ A;  3DBA A;  5DFX A;  1XJ3 A;  4DMZ A;  4DJ3 A;  3FC7 A;  3B33 A;  3UME A;  5J3W A;  2W3E A;  1STZ A;  4Y2F A;  3FG8 A;  3HCY A;  3MQQ A;  3LIE A;  5AVE A;  3T4Q A;  1N9O A;  1T19 A;  2PR5 A;  2KOI A;  4NXE A;  5HWT A;  3LI9 A;  3LFV A;  1T18 A;  3C2W A;  3UB6 A;  2HJ9 C;  2JHE A;  4HIA A;  4KQD A;  4G3V A;  3NJA A;  2W1T A;  4Q0J A;  4II7 A;  4K08 A;  3F1O A;  3NHQ A;  2W3G A;  2ZMV A;  2W1R A;  2L1M A;  2OAQ 1;  2R78 A;  3TRC A;  4H6J A;  3F1O B;  3E4Q A;  2GNX A;  3UB8 A;  1S4S A;  1JNU A;  2INW A;  3KSI A;  3F1N A;  2WKQ A;  3BW6 A;  4KQO A;  1OTD A;  4UQI S;  3CUE A;  4ARZ A;  2FH5 A;  1P9R A;  3R7W A;  3PBR A;  4E04 A;  2L4R A;  2ZOH A;  3C30 A;  3UB9 A;  2V1A A;  3EWK A;  4HP4 A;  4KUO A;  3KYZ A;  4LRZ E;  2IA2 A;  1DP8 A;  2GZA A;  2PHY A;  2A2L A;  4LRY C;  1OT9 A;  4LLO B;  5HDC A;  4CQH A;  5IT5 A;  3T4J A;  1N9L A;  3LI8 A;  4CLC A;  1NLZ A;  4PHT A;  3MFX A;  1NWZ A;  3BQ8 A;  2P7J A;  3W2Z A;  1LSX A;  1IOU A;  2D01 A;  5FL3 A;  5A8B A;  4LPZ A;  2J3W A;  4MN7 A;  5J4E A;  3F1P A;  2V1B A;  2KLI A;  4EES A;  1TS6 A;  2V0W A;  3F1P B;  3T4K A;  3MJQ A;  4Z1W A;  1NRJ A;  3CIT A;  3H7W A;  3BQA A;  4ZRR A;  3E4O A;  4EW7 A;  2H28 A;  3H7W B;  3PR6 A;  4I3I A;  2EWV A;  3BJN A;  5DFY A;  5HDS A;  5HSQ A;  1S4R A;  2BAS A;  3K3C A;  4IUH A;  2K31 A;  4I3J A;  2QHK A;  1OJ5 A;  3E98 A;  2B18 A;  4B9O A;  2VKS A;  4HOI A;  3S7Q A;  3UE3 A;  3VE3 A;  5DKL A;  5IU1 A;  2EWW A;  1DRM A;  4CLC D;  1EW0 A;  2FZ0 A;  2QWS A;  3A0V A;  3E4P A;  3KYQ A;  4EEU A;  4WUJ A;  4I38 A;  4L9G A;  4I5S A;  1OJG A;  5AVF A;  3LR0 A;  4WEJ A;  4P6Z M;  4MMN A;  5F69 A;  4EER A;  3OCL A;  2XA7 S;  4GS9 A;  3MXQ A;  1OTA A;  4YWZ A;  5DKK A;  4GS9 B;  4EXO A;  2YKF A;  3CUE C;  1BYW A;  4O01 A;  2HF6 A;  1XJ6 A;  2K2N A;  3NOP C;  2PYR A;  1P0Z A;  2PYP A;  2LB9 A;  1D06 A;  3TJZ C;  5DJT A;  5IS1 A;  1T1A A;  4HY8 A;  4PKY G;  2W27 A;  2Z6C A;  1OTI A;  3V67 A;  1OPX A;  3R4K A;  3TW8 A;  3BY9 A;  4I3A A;  5DJU A;  1F9I A;  4G3K A;  3LIB A;  2OAP 1;  2W3F A;  5HDD A;  4JGQ A;  5KIZ A;  3GEC A;  5I5L A;  5DF9 A;  2W1T B;  3EOI A;  2O99 A;  3K2N A;  1H8M A;  1LSV A;  2A24 A;  3CI6 A;  3BWL A;  3K3D A;  4H6J B;  5TJJ A;  4XT2 A;  1XFQ A;  5HWV A;  4Y3I A;  2VEA A;  4NXG A;  4FSF A;  2A24 B;  3KSG A;  3LIC A;  3F1N B;  2CMN A;  2VLG A;  3E0Y A;  4Q0I A;  1ZHH B;  1ZTU A;  3IBJ A;  3LID A;  4R6L A;  4ARZ B;  2V0U A;  4PKY A;  3LYX A;  1KOU A;  3R7W B;  1NLY A;  2GX5 A;  4GLQ A;  3O5Y A;  1S1Y A;  3D3O A;  2XRN A;  2PT7 A;  1XJ4 A;  3CWF A;  3OOV A;  4JGO A;  3BY8 A;  1OTB A;  1Y28 A;  3FPV A;  2VGL S;  2WKP A;  4EET B;  1LSW A;  2JKT I;  4WN5 A;  4BMW A;  3JVV A;  2ZOI A;  4CLC B;  1TF1 A;  4WF0 A;  2D02 A;  4JGP A;  1YSP A;  2Z6D A;  4QPR A;  2XSS A;  2G7U A;  2VV6 A;  3LR3 A;  4HJ3 A;  3RFB A;  5MC7 A;  2W3H A;  2M7U A;  5C5K A;  1X0O A;  4BBV A;  4HNB A;  5J7E A;  3CAX A;  3MR0 A;  4HH2 A;  3EEA A;  3OC2 A;  2QJ5 A;  4UQI M;  4MDZ A;  4PAU A;  4MCW A;  1YSQ A;  4FOF A;  1V9Z A;  4B93 A;  2M1C A;  5G4Y A;  2QYB A;  2P04 A;  4IUK A;  2V9A A;  1DP6 A;  4JGR A;  5G4Z A;  3RH8 B;  5K5B A;  2Y79 A;  4R70 A;  5HD3 A;  2OWH A;  2VV7 A;  4BBU A;  4HI4 A;  3GDI A;  5LBR A;  4Q0H A;  4I39 A;  1F5M A;  4OOM A;  3LR4 A;  2XRO A;  2QJ7 A;  3PBQ A;  2JKR M;  3NOU C;  1UGU A;  2K7S A;  1P9W A;  3P01 A;  3C8C A;  4YNR A;  3T4O A;  1IFQ A;  3OLO A;  4NEE D;  2PD8 A;  2JN7 A;  3PHY A;  5KSH A;  3MQO A;  3B47 A;  3P7N A;  4WEL A;  2O9A A;  5HL6 A;  3VV4 A;  3A0R A;  1N9N A;  4OOL A;  4BWI A;  4DJ2 A;  5HPI A;  3S7O A;  3ULF A;  3TE8 A;  4CLC C;  5L8M A;  1TS8 A;  1W63 M;  2VZW A;  2W3D A;  3FPW A;  3ICY A;  1YAX A;  3ZYT A;  3H82 A;  1LT0 A;  4HQA A;  3VOL A;  1MZU A;  3H82 B;  1H3Q A;  3T4L A;  5HPF A;  1V9Y A;  4HP9 A;  3SW1 A;  1TS7 A;  2EA9 A;  2O9C A;  3H9W A;  4BBT A;  4XT2 B;  2PR6 A;  3KSF A;  3EEH A;  2NUP C;  2OWJ A;  2KDK A;  2MJ6 A;  4WEK A;  3IBR A;  1GSW A;  2XA7 M;  3MMH A;  2GJ3 A;  2ZBB A;  4IJG A;  1GSX A;  4L0L A;  3PBS A;  2HJE A;  3EQU A;  3MF0 A;  4R38 A;  4HHD A;  3UB7 A;  3CLO A;  4EEP A;  4L9E A;  3C38 A;  3IS2 A;  4MN6 A;  3S7N A;  3EGD C;  4ME4 A;  3IS2 B;  2PD7 A;  4O8G A;  3U2A A;  3HJK A;  2OOL A;  5F6A A;  4F3L A;  2VV8 A;  3UMD A;  4BJP A;  3B42 A;  1OT6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...