3FYZA

Oxa-24 beta-lactamase complex with sa4-17 inhibitor
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
244
structure length
243
Chain Sequence
HISSQQHEKAIKSYFDEAQTQGVIIIKEGKNLSTYGNALARANKEYVPASTFMLNALIGLENHKATTNEIFKWDGKKRTYPMWEKDMTLGEAMALSAVPVYQELARRTGLELMQKEVKRVNFGNTNIGTQVDNFWLVGPLKITPVQEVNFADDLAHNRLPFKLETQEEVKKMLLIKEVNGSKIYAKSGWGMGVTPQVGWLTGWVEQANGKKIPFSLNLEMKEGMSGSIRNEITYKSLENLGII
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase OXA-24
publication title Design, synthesis, and crystal structures of 6-alkylidene-2'-substituted penicillanic acid sulfones as potent inhibitors of Acinetobacter baumannii OXA-24 carbapenemase.
pubmed doi rcsb
source organism Acinetobacter baumannii
molecule tags Hydrolase
total genus 81
structure length 243
sequence length 244
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2009-01-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3fyzA00
4P6BA 2XEPA 1XA7A 4OQIA 3WS1A 2C6WB 5CHUA 2EX9A 3ZNTA 4E6WA 2JC7A 4MLLA 5EVIA 3IWIA 1RCJA 3ZG5A 3A3DA 3HBRA 2H10A 2BLSA 5EPHA 1BZAA 3PAEA 3G35A 1EROA 3NI9A 1LLBA 4QB8A 5AQ7A 2WYXA 3NY4A 4Y0TA 3WS0A 1E25A 2XD1A 4KG2A 1ZKJA 2R9XA 4KQQA 1TDLA 3ZG0A 2X02A 1K54C 1IYQA 4KZAA 4YFMA 2ZD8A 2PU2A 5U47A 3LEZA 1SHVA 4IBRA 1IELA 1WE4A 3ZG9B 3BFGA 3DWKA 2VGJA 1KVLA 2XK1A 2ZQ7A 1H8ZA 4Y0UA 3FWLA 4GD8A 2JCHA 1TDGA 5GHZA 4DXCA 2HDQA 1FSYA 1C3BA 4S2IA 3W8KA 1IKIA 5M18A 3JYIA 3NDEA 2HDRA 4JKTA 1JWPA 3OZHA 4OOLA 3CMZA 3GSGA 1NZOA 3LY4A 1FCMA 4BL3A 4P85A 3W4QA 5E2EA 1JWVA 5HARA 3PBOA 4JPMA 4UA6A 2J8YA 4X55A 1NY0A 3OCNA 2OLVA 1U60A 4FSFA 5JYPA 4DRTA 3HLEA 1XXMA 5E2HA 1J9MA 3ZFZA 4BD1A 4GD6A 4N9LA 4S2PA 5J8XA 5A92A 5DF9A 1I2SA 1WYBA 4S2LA 1Q2PA 5CGWA 4GDBA 2XFTA 2J7VA 3IF6A 5CTNA 1YLJA 4KG6A 3C5AA 3A3EA 3UDFA 3FYZA 5CECA 1K55A 1ES4A 1G6AA 3SH9A 4WZ4A 1K38A 3ZHHA 4KZ4A 3BFFA 4H8RA 4BJPA 3MKFA 3ZG8B 3GTCA 1PZPA 5EVIB 2R9WA 2Y59A 1H8YA 4MNRA 1PW8A 3IXGA 1YT4A 2IWDA 5FQ9A 4F94A 4ZTKA 2G2WA 1K56A 2GDNA 4DE1A 4BD0A 2JE5A 1NYYA 2WKHA 1S6RA 1NZUA 3IWQA 1I5QA 4B4ZA 1MWUA 1ZC2A 4UHUA 2WKEA 1XP4A 3CJMA 4GOGA 1W7FA 1BLSA 3ZVWA 1Z6FA 4GKUA 3ZGAB 2EX8A 2P74A 3S22A 4DDYA 4ZJ2A 2WGVA 3VP1A 1HTZA 5A90A 2Y2KA 2RCXA 4PM9A 4MBHA 5FI7A 4EQIA 1ESIA 4HBUA 3IF5A 4KQRA 2Y2IA 2V2FF 4N92A 3HVFA 3RJUA 1MWSA 5KSCA 3UO9A 5FATA 1YLYA 3HUNA 2WKIA 3IT9A 1YLTA 3GMWA 5EVIC 3OPLA 3OPPA 2WGWA 3HLBA 3IHBA 1YMSA 3M6BA 4OLGA 3OC2A 3UE1A 2EX6A 2ZQCA 1RGYA 3TSGA 1W5DA 3Q81A 4B4XA 5L2FA 4S2NA 3NDGA 2Y2QA 3O88A 3V3RA 3UDIA 3AGFA 5GLBA 3UNWA 1FR6A 3IWOA 3C7UA 3IF6B 1JVJA 5DTTA 2FFFB 2VGKA 2QMIA 4IVIA 4KZ8A 3HREA 1VQQA 1BULA 1DJBA 5TGFA 4U0TA 3UY6A 4QY6A 5FAQA 1KVMA 4KENB 4S2OA 5DTSA 3D4FA 3VSLA 4OVDA 4CJNA 4OH0A 5GLAA 3M2KA 2HP6A 2DRWA 2HDUA 2ZMAA 2HP9A 5FQJA 4E3KA 3SH7A 5JYOA 1LI0A 3LY3A 4D2OA 5E2GA 4ZJ3A 4X68A 3HLWA 4UA7A 2G2UA 4WBGA 4WEJA 4EBLA 4OQHA 2XFSA 3BEBA 5BOHA 4JXSA 1IKGA 1N4OA 2Q9MA 5DVAA 2WK0A 3Q7VA 4JBFA 1MY8A 2XGNA 4NETA 3V39A 3G32A 2Y2PA 1CK3A 4C3QA 4LCMA 3B3XA 1TEMA 5HL1A 3IF6C 4KZ7A 5HAQA 3G4PA 1BLHA 2H0YA 4LCLA 1MKIA 2Z2LB 3FV7A 1MWRA 1PYYA 1XPBA 1JTDA 4FCFA 5FQIA 1FQGA 3FKWA 4KQOA 4OPRA 2UWXA 1FOFA 1W79A 4RX2A 3SS3A 1M40A 5E2FA 3WS5A 4DE2A 3FKVA 3S4XA 1QMFA 2E8IA 4XUZA 3P98A 4BENA 2QPNA 5M1AA 4XUXA 2Y2HA 3MXRA 2ZM2A 4JXVA 4PM7A 4ZAMA 3MBZA 4RVAA 1K57A 5EOEA 4GN2A 2XQZA 3BRMA 2ZC4B 5GHYA 4N9KA 5FQMA 1KGEA 4U3TA 4DE3A 3HL9A 5FQQA 3BECA 4DF6A 5A93A 5FA7A 4RX3A 3Q1FA 3IQAA 3DW0A 3MZFA 4S2MA 1FR1A 1ZG4A 1DJAA 1EI5A 1H5XA 4KZBA 4NK3A 3S1YA 4IEDA 1BLCA 4QU3A 5CEBA 5CXWA 3C4PA 3AGEA 2V1ZA 4EUZA 3SS5A 3WS2A 4OQ0A 1MXOA 4OP5A 3VP3A 1GA0A 4OONA 4JXGA 4KZ3A 4WEKA 1YLWA 5E43A 4Q8IA 5FAPA 1PWGA 2V20A 3EQVA 3CZDA 4OP8A 1BTLA 3LCEA 4UAAA 5DF8A 5D3OA 4WM9A 2Y2OA 3O86A 1K6RA 4E3NA 5F82A 4S2NC 3G31A 1G68A 1XX2A 3HLCA 4HBTA 4ZDXA 3A3JA 3M6HA 1E3UD 2BG1A 4EBPA 1GHPA 3GRJA 5HAPA 3NBLA 2XH9A 3BM6A 5FQKA 5HFOA 1CI8A 5F1GA 3MFDA 1LHYA 1NYMA 3BLMA 2ZC3B 5CHJA 3SOIA 1AXBA 4R0QA 4P87A 1VM1A 4Y7PA 4E3OA 2WADA 2Y2GA 4QD4A 1PZOA 2Z2MB 3PBQA 2WUQA 2XLNA 3PBTA 3QHYA 4LV3A 1L0EA 4KZ6A 1RGZA 2ZQ9A 1Y54A 4OPQA 2ZC6B 2FFYA 4E3JA 1MWTA 3N4IA 5FAOA 4DE0A 4FD8A 3ZDJA 1W8QA 2H0TA 3IH9A 5M19A 4KZ9A 3ZNYA 4S2JA 5CGSA 3WRTA 2WZXA 1ES2A 1K6SA 1SCWA 5HW3A 3O87A 4HESA 4M3KA 1O07A 3PTEA 1TVFA 5G18A 2Y2NA 3BLSA 4C6YA 1JWZA 4JLFA 2ZQDA 3G34A 4LV1A 3UN7A 4Y0OA 2Y4AA 3AGDA 5CRFA 5KZHA 3MZEA 1XKZA 1NRFA 1CEFA 1OMEA 1YQSA 3HUOA 4E3MA 3FZCA 4S2KA 5GLDA 1IYPA 1ES5A 1PI5A 1PIOA 4ID4A 4LENA 3W4OA 1GHMA 1K57C 2OV5A 3V50A 2B5RA 1E4DA 2EFXA 3N8RA 3N8LA 2ZJ9A 3I7JA 4WMCD 1S0WA 2DCFA 5EECA 3GR2A 4JXWA 3N7WA 2WAEA 1IEMA 1WYCA 1M6KA 1NXYA 1BSGA 2EFUA 4BL2A 4K0XA 2EX2A 3OCLA 4WZ5A 3VFHA 4E3IA 1W8YA 4R4SA 1K25A 3UE3A 3WWXA 1Q2QA 3LO7A 4HEFA 4OPYA 5F83A 1KDWA 2HPBA 5GL9A 2RL3A 4OQGA 4R3JA 3Q82A 5AQBA 4ZJ1A 5DF7A 3PBSA 2P9VA 1N9BA 1PWDA 2HDSA 2J9PA 4KZ5A 4U0XA 1K55C 5FI2A 2PU4A 1IYOA 3NC8A 3UE0A 3PAGA 4X53A 4A5RA 3C7VA 4GZBA 5FDHA 5EOOA 2OLUA 1XGJA 4JF6A 1GA9A 2WGWB 3VMAA 2CC1A 3HUMA 3WRZA 2J9OA 4DKIA 4FH4A 4X6TA 3M2JA 2IWCA 3RXXA 3ZG7B 5TFQA 5EVID 3GVBA 3Q7ZA 3UPNA 4OPZA 5EUAA 1DY6A 1FCOA 2ZM8A 4MEZA 3HLGA 3TOIA 3VFFA 5F1FA 5KSHA 3BFEA 3IHAA 2OSUA 1ERQA 4GNUA 5AQAA 4UA9A 4DDSA 3BYDA 3P09A 4OLDA 5GLCA 3DWZA 4PM5A 2ZM0A 1CI9A 5FASA 1LI9A 3UPOA 4OOMA 4ZBEA 2ZQ8A 2XF3A 2DNSA 4GDNA 4OKPA 1LL9A 5CTMA 4R23A 3UDXA 2A3UA 1JTGA 1L0GA 4EBNA 4R3BA 3RXWA 4WELA 1BLPA 1ESUA 4K0WA 4CPKA 4E3LA 3V3SA 3W4PA 1EWZA 1MBLA 3HLDA 5IHVA 4K91A 3HLFA 3ITBA 1IYSA 1KGFA 3QNBA 3Q7VB 1RP5A 3G2YA 3WS4A 3UPPA 1PWCA 3BFDA 3SH8A 3V5MA 4WYYA 1E3UA 4N1HA 3O3VA 2A49A 2PBYA 4JF4A 5DTKA 3VP4A 3GV9A 3NIAA 1GCEA 2P9VB 4EV4A 3IXHA 1K54A 4KG5A 3CG5A 1XA1A 4R1GA 2HP5A 3ZVTA 1KE3A 4B88A 1FCNA 4LV0A 4R4RA 3G30A 4YINA 4BLMA 2XR0A 2ZC5B 1PW1A 5EE8A 5HAIA 2Y2MA 3QNCA 3VP0A 1I2WA 2X71A 4PMAA 1ALQA 2I72A 3A3FA 3ISGA 3ITAA 2WZZA 1KE0A 4PM8A 2Q9NA 5A91A 1ZG6A 2EXBA 4Z9QA 4LV2A 3VOZA 2Y2LA 1QMEA 4E6XA 1ES3A 2XDMA 1K56D 3IXDA 3OPRA 3PBRA 4OOYA 4WZ5C 1SDNA 4X56A 3BFCA 1NJ4A 1HD8A 1MPLA 3DTMA 4O7DA 5FI6A 4C75A 4FH2A 4RA7A 3C4OA 1L0DA 1K4EA 3TG9A 3ZCZA 1YLZA 4P0MA 4XXRA 5EVLA 2JBFA 1L2SA 4EWFA 3GQZA 1SKFA 1LL5A 1GHIA 1K4FA 1SDEA 1YMXA 2WGIA 1DJCA 4MBKA 2ZLYA 3A3IA 1KGGA 1CEGA 5CHMA 3MKEA 4DXBA 1FSWA 1ONHA 3G2ZA 3VSKA 3VOYA 4L0LA 3VP2A 4WMCA 4N1XA 2Y2JA 3MXSA 4X69A 5GHXA 5I94A 2ZQAA 5CGXA 3NCKA 2EXAA 4QHCA 2XD5A 2H5SA 5AQ9A 3IXBA 1YLPA 4IVKA 3OPHA 1BUEA 1HZOA 1YM1A 4PPRA 1KE4A 2QZ6A 4MBFA 1ONGA 1ERMA 2X01A 1BT5A 3N8SA 5CERA 1PI4A 4RYEA 4GB7A 5CEDA 5KMWA 4BQMA 3MZDA 3E2LA 3PBNA 4QY5A 2Y91A 2ZC7A 4IBXA 1L0FA 2IWBA 2WAFA 5HX9A 4QJGA 3EQUA 2C5WB 4PM6A 3IH8A 5TR7A 1XGIA 3E2KA 5FSRA 1O7EA 3N6IA 2Y55A 1HVBA 3Q07A 1KDSA 3SS4A 4JF5A
chains in the Genus database with same CATH superfamily
4P6ZM 5CHUA 4E6WA 4MLLA 5EVIA 4IHQA 3HJIA 2V1BA 3RH8B 4EXOA 1E25A 1TDLA 2V9AA 2XA7S 4KZAA 1A0KA 2ZD8A 2ZOIA 1SHVA 1IELA 1MKMA 1KVLA 1H8ZA 4GD8A 2JCHA 1FSYA 1IKIA 2HDRA 2QYBA 5HARA 3PBOA 3NECA 4X55A 3OCNA 2W27A 1J9MA 1KDSA 3ZFZA 1I2SA 2O0YA 1Q2PA 4GDBA 1YLJA 1LT0A 3UDFA 5CECA 3P01A 3SH9A 3DBAA 4WZ4A 1VEUA 2R78A 3UB7A 3CAXA 1YKDA 2R9WA 2Y59A 1H8YA 3G6OA 2IWDA 4F94A 2WKRA 4DE1A 4BD0A 1STZA 3IWQA 1I5QA 4B4ZA 3B47A 3ZVWA 5HWWA 4CLCB 2P74A 4K08A 1HTZA 2Y2KA 1DP8A 5FI7A 3PHYA 5HPIA 4KUKA 5IS1A 2W0NA 3RJUA 5HWTA 5FATA 3IT9A 3OPLA 3NHQA 3HLBA 3M6BA 5F5YA 5J3WA 2HGVA 2ZQCA 3Q81A 5L2FA 3V3RA 3UDIA 3AGFA 3IWOA 5DTTA 2FFFB 2VGKA 4KZ8A 1BULA 1KVMA 1LSVA 3D4FA 4OH0A 3M2KA 3TJZC 5FQJA 4HH2A 4ZJ3A 3HLWA 2G2UA 3BEBA 1OTEA 1H8MA 3UE6A 2Y2PA 4O8GA 3EEHA 3BWLA 3B3XA 5A8BA 3IF6C 1P9WA 3KYQA 4EU0A 2GJ3A 3MFXA 1MWRA 2UWXA 3SS3A 3FKVA 3S4XA 4XUZA 3DTIA 3P98A 5HDDA 3U4LP 4XUXA 2Y2HA 3MXRA 4ZAMA 3MBZA 3R7WA 1OT9A 2GNXA 3GECA 1UGUA 2QJ5A 4N9KA 4DF6A 3BECA 3GDIA 3Q1FA 3IQAA 3LYXA 1FR1A 3O5YA 4HJ4A 1ZG4A 1S67L 1EI5A 1TF1A 3MMHA 2D01A 3T4QA 3LR3A 5I5LA 2V1ZA 3SZTA 3VE4A 3SS5A 2B02A 2A2LA 4OQ0A 1MXOA 5DKKA 3VP3A 1DP9A 4KZ3A 2A24B 5FAPA 3CUEA 1MZUA 2V20A 5G4ZA 4B9OA 4L9GA 3O86A 4E3NA 3L9KA 3CWFA 2IA2A 4ZDXA 2XA7M 3IS2B 1E3UD 1AWIA 4EBPA 3GRJA 5HAPA 5FQKA 1KOUA 2HF6A 5CHJA 1AXBA 4EETB 2GX5A 4Y7PA 4E3OA 4ETZA 4QD4A 2WUQA 3PBTA 3DTKA 4KZ6A 1S1YA 1RGZA 4OPQA 2W1TA 2D02A 4GS9B 3BY8A 3VV4A 3N4IA 5FAOA 4EQ1A 4B93A 3ZDJA 4S2JA 3LIEA 5CGSA 3WRTA 4FOFA 3T1QB 5HW3A 4M3KA 3PTEA 2V1AA 1TVFA 5G18A 3BLSA 1JWZA 4JLFA 2ZQDA 4WF0A 3AGDA 5KZHA 4WLAA 1CEFA 3KO6A 1S66L 4E3MA 4S2KA 4WUJA 1IYPA 1PI5A 1K57C 2OV5A 3KYZA 3N8RA 2ZJ9A 5FDSA 1P0ZA 1IEMA 1WYCA 1OPXA 1M6KA 3F1NA 2KX6A 4BL2A 3OCLA 3UE3A 4FTXA 3C2WA 2HPBA 2RL3A 3Q82A 4ZJ1A 3H7WA 2HDSA 3PAGA 3MR0A 1XGJA 2EWWA 3HUMA 3M2JA 3RXXA 1X0OA 5EVID 4YNRA 1VETB 1DY6A 1LSXA 2VJWA 3HLGA 3TOIA 3VFFA 5KSHA 4GNUA 5G4YA 1NLYA 2L4RA 4MN5A 3UPOA 3QP6A 4GDNA 5CTMA 2A3UA 4KQDA 1JTGA 4Q0JA 2PR5A 3NOUC 4R3BA 1MC0A 4K0WA 2PT7A 3W4PA 4EUVA 5HWVA 4H6JA 1RP5A 2J3WA 3WS4A 3UPPA 3T1SA 4WYYA 5HZHA 3LR5A 5AVFA 3VP4A 3KSIA 3QP2A 1FCNA 1S1ZA 4LV0A 4YINA 4BLMA 2XR0A 5EE8A 5HAIA 3QNCA 3S7NA 2X71A 1UWPX 2WZZA 4PM8A 4EESA 3DAVA 3IXDA 3OPRA 4WZ5C 4OOYA 4BBTA 4FH2A 4I39A 3C4OA 1YLZA 5EVLA 1SKFA 1GHIA 1CQAA 1SDEA 1SKOA 3KSHA 3F1PB 1PNEA 3G2ZA 4LRXC 3VOYA 4WMCA 1ODVA 3JVUA 2Y2JA 3MXSA 4X69A 2ZQAA 5CGXA 4QHCA 2H5SA 3CITA 4IVKA 4HOIA 2P7JA 4MBFA 5AJGA 1CF0A 4RYEA 1GSXA 1L0FA 2WAFA 4QJGA 5TR7A 3CHWP 2KOIA 2C6WB 3ZNTA 2JC7A 4BBVA 2BASA 1T19A 1RCJA 4HHDA 3A3DA 1BZAA 4G3WA 1LLBA 5AQ7A 2WYXA 3NY4A 2ZMFA 2W3EA 5DFYA 4KQQA 3ZG0A 1K54C 2I9VA 2PU2A 5U47A 1V9YA 3LEZA 1WE4A 3MQOA 1GSWA 3BFGA 1NWZA 5EFWA 3FWLA 1TDGA 5GHZA 2VZWA 4BBUA 3JYIA 3H82B 4JKTA 1JWPA 3OZHA 3EGXC 1NZOA 1SZVA 4P85A 3W4QA 1D1JA 2OLVA 5JYPA 3HLEA 2PBDP 4DMZA 2XRNA 5J8XA 3LIDA 1VHMA 4D60A 1WYBA 5CGWA 2EWVA 5CTNA 4KG6A 2J80A 3R4KA 3ZHHA 1YSQA 4H8RA 4BJPA 3MKFA 1P97A 3GTCA 1PZPA 3PYPA 5EVIB 3ZQ5A 2Y79A 4LRZE 3BQAA 4ZTKA 2G2WA 1K56A 4Y2FA 1XFNA 1NZUA 1MWUA 1ZC2A 3FPWA 4UHUA 1BLSA 2EX8A 1XJ4A 3VP1A 2RCXA 4PM9A 4MBHA 4HP4A 2KDKA 4N92A 3HVFA 1MWSA 3UO9A 1OJGA 1YPRA 3UMEA 2W3GA 3IHBA 1VB6A 5L8MA 3OC2A 3UE1A 2EX6A 3TSGA 5K5BA 4S2NA 4HP9A 3O88A 5GLBA 4CLCC 5TGFA 2GZAA 4QY6A 5CX7A 5FAQA 4KENB 4S2OA 5DKLA 1VEUB 3VSLA 4CJNA 3DTEA 2HP6A 2HJ9C 1LI0A 1OTIA 3FPVA 1V9ZA 4NXBA 4WEJA 2XFSA 5BOHA 2JHEA 1N4OA 2Q9MA 5DVAA 2WK0A 3Q7VA 4JBFA 1MY8A 4DN0A 3S7PA 3IX8A 1TEMA 2ZL1A 5HL1A 4KZ7A 5HAQA 3G4PA 4YOFA 4LCLA 1IFQA 5FQIA 1JTDA 1FQGA 4KQOA 3EOIA 4RQ9A 1FOFA 3WS5A 1M40A 2HZ5A 4NXFA 3TRCA 2E8IA 4PHTA 4RVAA 2JKFA 2XQZA 2QHKA 5LBRA 2PHYA 1KGEA 4DE3A 5A93A 4GJ4A 3DW0A 4S2MA 1XFQA 4QU3A 3AGEA 4O0PA 2E8JA 1XJ3A 1YLWA 4UAAA 5D3OA 5MC7A 2JKGA 3LR0A 1G68A 1Z09A 2INWA 4HBTA 2BG1A 1NLZA 3E0YA 3BM6A 2PR6A 5HFOA 1CI8A 5F1GA 3BLMA 4R0QA 3JPUA 4P87A 3RFBA 2Y2GA 3R7WB 2XLNA 3QHYA 1Y54A 2ZC6B 3LICA 2OOLA 2H0TA 3IH9A 4KZ9A 4MMNA 5F69A 3LUQA 3O87A 4L9FA 5HDCA 4GLQA 3UN7A 2Y4AA 5CRFA 4YWZA 1NRFA 1DRMA 1W63M 1YQSA 2V0UA 4ID4A 3V50A 2EFXA 1E4DA 3VOLA 4WMCD 2DCFA 3JVVA 3N7WA 2PD7A 4LPZA 4G3VA 5FEGA 1NXYA 2JKTI 4E3IA 4R4SA 3S7OA 5GL9A 5DF7A 4UEYA 2V8FA 1H3QA 2J9PA 5FI2A 3C7VA 5FDHA 5EOOA 2PDRA 4JF6A 2W1TB 2WGWB 2CC1A 3WRZA 4XT2A 2J9OA 4DKIA 4QPRA 2VGLS 4X6TA 2IWCA 3EEAA 2JN7A 1ZTUA 2PYRA 3GVBA 2Z6CA 4OPZA 5EUAA 4I38A 5IU1A 4NKPA 3IHAA 5AQAA 4DDSA 4G3KA 2YKFA 3BYDA 4OLDA 5GLCA 2ZM0A 1CI9A 2J3TD 2DNSA 4OKPA 3T4JA 3KX0X 2VV7A 3UDXA 4F3LA 1EW0A 4E3LA 3V3SA 1EWZA 2W3DA 3HLDA 5TBMA 4PAUA 1T1AA 3G2YA 3F1NB 3UB6A 3ULFA 2K2NA 4JF4A 3H7WB 3GV9A 1YAXA 3NIAA 2VK3A 3CG5A 2PYPA 4Y17A 3ZVTA 4B88A 2W3HA 4R4RA 3G30A 1PW1A 2Y2MA 3W2ZA 1KE0A 2Q9NA 3QP5A 2EXBA 2ZBBA 3VOZA 1S4SA 1ES3A 2XDMA 1K56D 2H28A 1SDNA 1NJ4A 4X1LA 3DTMA 5EM0A 1L0DA 5AVEA 3PXPA 3TG9A 4XXRA 4P0MA 4EWFA 2UV0E 3HCYA 1KGGA 1CEGA 2OAQ1 5CHMA 5EV0A 4L0LA 4I3JA 3CI6A 5GHXA 4H6JB 3NCKA 1YLPA 4ETXA 3F1OA 3N8SA 5CEDA 3OOVA 4BQMA 3E2LA 2JKTM 4IBXA 5DJUA 2WKPA 5EM1A 1N9LA 1XGIA 1HVBA 4YFMA 3SS4A 4BWIA 2EX9A 2V8CA 4ESPA 1BYWA 2BLSA 5EPHA 3PAEA 3NI9A 4NXGA 5FL3A 2XD1A 3E4QA 2ZMVA 3LFVA 3ZG9B 3DWKA 2VGJA 4Y0UA 4DXCA 2HDQA 1PFLA 3W8KA 4ARZA 4MCWA 3RTYA 4JGRA 1T1CA 3LIFA 3LGOA 3LY4A 1FCMA 1H0MA 3UB5P 5E2EA 4EEUA 4GS9A 1JWVA 4JPMA 4UA6A 2PRFA 1NY0A 1U60A 3UB8A 1XXMA 2NUPC 4GD6A 3LIAA 4N9LA 4X1MA 5DF9A 2XFTA 3IF6A 4IUHA 3C5AA 3EWKA 3K2NA 3A3EA 4LFUA 2M7VA 3FYZA 3FG8A 1K38A 2NUTC 3BFFA 2XSSA 3ZG8B 2VEAA 3T4SA 4PKYA 1PW8A 4JGOA 3IXGA 1YT4A 5FQ9A 4WL9A 2WKQA 2VGLM 1K0KA 1NYYA 2WKHA 1W7FA 1Z6FA 3S22A 4R70A 4FUWA 4ZJ2A 4HH3A 5IT5A 4I3IA 2Y2IA 3UMDA 3HUNA 5EVIC 3T4LA 3OPPA 1DP6A 4OLGA 5J4EA 4R38A 1Y4OA 5DJTA 1OTBA 1VETA 1W5DA 3T4TA 4EEPA 3C30A 2EA9A 2Y2QA 3UNWA 3C7UA 4IVIA 1VQQA 1DJBA 4U0TA 1CJFA 5DTSA 4OVDA 3ICYA 3BJNA 5GLAA 3TW8A 2DRWA 2ZMAA 2HP9A 5JYOA 4UA7A 4WBGA 1TD5A 4EBLA 1IKGA 4Y13A 4WN5A 3NOPC 2XGNA 4NETA 3V39A 3G32A 4EW7A 1F2KA 4C3QA 2Z6DA 1J3WA 3MXQA 4LCMA 4M4XA 2H0YA 1XPBA 4FCFA 1W79A 5E2FA 4ZRRA 4DE2A 3CLOA 4GHIA 4IUKA 2QPNA 5M1AA 2ZM2A 4JXVA 3MF0A 1K57A 5EOEA 4GN2A 3BRMA 1F9IA 1F5MA 5FQMA 3HL9A 5FQQA 4CQHA 3MZFA 3LR4A 1DJAA 3S1YA 4KZBA 4EUZA 3F1PA 3WS2A 4OP5A 4OONA 5E43A 3B42A 3EQVA 3L7HA 3LCEA 1PRQA 2Y2OA 5F82A 1XX2A 2O9CA 1HLUP 4R6LA 3CPTA 1OT6A 3D3OA 3M6HA 1GHPA 3NBLA 1ZHHB 4NG2A 3SW1A 2QJ7A 3MFDA 2ZC3B 2CMNA 3SOIA 1VM1A 2W1RA 2WADA 1PZOA 3PBQA 4LV3A 1L0EA 3BY9A 2ZQ9A 4E3JA 1MWTA 3KYEA 2M1CA 2WZXA 1ES2A 3T4OA 1SCWA 2FZ0A 3B33A 4HESA 2Y2NA 1XJ6A 4LV1A 2Q0OA 3MZEA 1XKZA 3FZCA 5GLDA 1ES5A 3W4OA 1GHMA 3E98A 2B5RA 3I7JA 1S0WA 5EECA 2V0WA 3GR2A 4JXWA 5J7EA 3QP1A 1BSGA 4HJ3A 4K0XA 4WZ5A 3LI8A 3WWXA 3T50A 4R3JA 3PBSA 4L9EA 2DMWA 2P9VA 4KZ5A 4U0XA 1K55C 2PAVP 4A5RA 4Q0IA 3LEQA 4LLOB 2OLUA 3CUEC 4Z1WA 3UB9A 4FH4A 3ZG7B 1G5UA 5TFQA 2L0WA 2O99A 3NULA 3UPNA 3Q7ZA 4MEZA 1FCOA 2VV8A 4Y3IA 1F98A 1T1BA 3BFEA 4MN7A 4JGQA 4UA9A 5FASA 1LI9A 4OOMA 4ZBEA 2ZQ8A 2XF3A 1LL9A 1L0GA 3H9WA 5HSQA 4Q0HA 2AVXA 5IHVA 3HLFA 3ITBA 1KGFA 4CLCE 1ACFA 3IX3A 4N1HA 4LGWA 1T18A 4EV4A 3IXHA 1K54A 4KG5A 4E04A 1KE3A 4ME4A 3D72A 1NRJA 4AFIA 4PKYG 2ZC5B 4PMAA 1ALQA 4XT2B 3ISGA 4QWOA 3ITAA 5A91A 1ZG6A 4EERA 4Z9QA 4E6XA 3PBRA 5FI6A 3BFCA 1HD8A 1MPLA 3OLOA 3A0SA 5KIZA 4RA7A 3ZCZA 2JBFA 1L2SA 3GQZA 3P7NA 1LSWA 4F3LB 1DJCA 3A3IA 3E4PA 5HL6A 4DXBA 1FSWA 1ONHA 3VSKA 3VP2A 4N1XA 5TBMB 5I94A 5DFXA 2EXAA 2XD5A 5AQ9A 1GSVA 1BUEA 2P08A 1YM1A 4PPRA 2X01A 1BT5A 2B18A 5CERA 4O01A 1PI4A 5L07A 3TE8A 3PBNA 2Y91A 2ZC7A 3QP8A 2IWBA 2FH5A 3EQUA 2C5WB 4PM6A 1S4RA 1O7EA 3N6IA 4JF5A 1L3LA 2OWJA 4P6BA 2XEPA 1XA7A 3C38A 4OQIA 3WS1A 1OTAA 3IWIA 3ZG5A 4HY8A 3HBRA 2H10A 4I3AA 3G35A 1EROA 4QB8A 1D7EA 5TJJA 4Y0TA 3WS0A 3MQQA 4KG2A 1ZKJA 2R9XA 2X02A 4CLCA 1IYQA 4IBRA 2K31A 2XK1A 2ZQ7A 4HJ6A 1P9RA 2HV1A 1C3BA 4S2IA 5M18A 3NDEA 4OOLA 3CMZA 3GSGA 3HJKA 4BL3A 2HJEA 3F1OB 2J8YA 4FSFA 4DRTA 5E2HA 4BD1A 4S2PA 5A92A 2LB9A 1N9OA 4S2LA 5EVEA 2JKRI 2J7VA 4DJ2A 1K55A 1ES4A 1G6AA 5F6AA 4KZ4A 4NXEA 1FILA 4MNRA 2ACGA 4HQAA 3IBJA 2GDNA 2JE5A 2OWHA 1S6RA 3KSFA 2WKEA 1XP4A 3CJMA 4GOGA 4GKUA 3BW6A 3ZGAB 4BMWA 4DDYA 2WGVA 5A90A 4EQIA 1ESIA 4HBUA 3IF5A 4KQRA 4ARZB 2W3FA 2V2FF 5KSCA 1YLYA 1IOUA 2WKIA 2VLGA 1YLTA 3GMWA 2L1MA 2WGWA 2XROA 1YMSA 4I5SA 2Y8HA 1RGYA 3T12B 4X25A 3K3DA 4B4XA 2BTFP 3NDGA 3BQ8A 2J3TC 1FR6A 3IF6B 1JVJA 4UQIS 4MDZA 2QMIA 3HREA 3UY6A 3MS6A 2HDUA 4E3KA 3SH7A 3LY3A 4D2OA 5HD3A 5E2GA 4X68A 1FIKA 4HIAA 4OQHA 4JXSA 5HDSA 2A24A 3V67A 2G7UA 1CK3A 3MQ0A 2YKHA 4II7A 1Y28A 1BLHA 1MKIA 3FV7A 3IS2A 1PYYA 3FKWA 4OPRA 4RX2A 3MSHA 3T4KA 1SKOB 1QMFA 1XJ2A 5L10A 5HPFA 4BENA 4PM7A 2ZOHA 2ZC4B 1TS7A 5GHYA 4U3TA 3ZYTA 5FA7A 4RX3A 4LRYC 2VA0A 1H5XA 4IJGA 4NK3A 4IEDA 1BLCA 5CEBA 5CXWA 3C4PA 2JKRM 3D9YA 2OAP1 1GA0A 4JXGA 4WEKA 4Q8IA 2VKSA 1PWGA 3QP4A 1TS0A 3CZDA 4OP8A 3K3CA 3IX4A 1BTLA 5DF8A 4WM9A 1K6RA 4MN6A 4S2NC 3G31A 3HLCA 2M7UA 3A3JA 2XH9A 1OJ5A 2PD8A 1LHYA 1NYMA 4GHIB 4P6ZS 2Z2MB 2KLIA 3A0VA 2FFYA 3C8CA 4DE0A 4FD8A 1W8QA 2MJ6A 5M19A 3ZNYA 1K6SA 1O07A 4NEED 2B95A 4C6YA 3G34A 4Y0OA 3PR6A 1OMEA 4R3AA 3HUOA 4JGPA 5F68A 1JNUA 4LENA 1LL8A 1PIOA 3EGDC 2VV6A 3N8LA 5FEFA 2WAEA 3CPTB 2EFUA 3VFHA 2EX2A 1W8YA 1K25A 1Q2QA 1TS8A 3LO7A 4HEFA 4OPYA 5F83A 1KDWA 4OQGA 5AQBA 3LI9A 1N9BA 1PWDA 2PU4A 3KSGA 1IYOA 3NC8A 3UE0A 4X53A 4GZBA 2QWSA 2P04A 1GA9A 3VMAA 3LIBA 3U2AA 2VX8A 4Y15A 3MJQA 2ZM8A 2O9BA 5F1FA 2QKPA 4GW9A 2OSUA 1ERQA 4UQIM 3P09A 2K7SA 4HNBA 3DWZA 4PM5A 3IBRA 4CLCD 4R23A 1N9NA 4EBNA 3RXWA 4WELA 1BLPA 1ESUA 5C5KA 4CPKA 2O9AA 1MBLA 4K91A 3A0RA 1WA9A 1IYSA 3QNBA 5HD5A 3Q7VB 1PWCA 3BFDA 3SH8A 3V5MA 1E3UA 3NJAA 3O3VA 2A49A 2ZL1B 2PBYA 5DTKA 1GCEA 2P9VB 1XA1A 2LB5A 1TS6A 4R1GA 2HP5A 1OTDA 3VP0A 1I2WA 2I72A 3A3FA 4LV2A 4Y5FA 2Y2LA 1QMEA 3OBFA 4X56A 4O7DA 4C75A 3FC7A 1K4EA 1G28A 1LL5A 3T1XA 1K4FA 1UWNX 1YMXA 2WGIA 4MBKA 2ZLYA 4KUOA 1D06A 3MKEA 1G6OA 4GCZA 4HI4A 4DJ3A 3H82A 3E4OA 3T1RA 3IXBA 3S7QA 3OPHA 1HZOA 1YSPA 1KE4A 2QZ6A 3NOTC 1ONGA 1ERMA 4GB7A 5KMWA 1W63Q 3MZDA 3VE3A 4QY5A 5HX9A 5L09A 3IH8A 3E2KA 5FSRA 2Y55A 3Q07A 2Z2LB
chains in the Genus database with same CATH topology
4P6BA 2XEPA 1XA7A 4OQIA 3WS1A 2C6WB 5CHUA 2EX9A 3ZNTA 4E6WA 2JC7A 4MLLA 5EVIA 3IWIA 1RCJA 3ZG5A 3A3DA 3HBRA 2H10A 2BLSA 5EPHA 1BZAA 3PAEA 3G35A 1EROA 3NI9A 1LLBA 4QB8A 5AQ7A 2WYXA 3NY4A 4Y0TA 3WS0A 1E25A 2XD1A 4KG2A 1ZKJA 2R9XA 4KQQA 1TDLA 3ZG0A 2X02A 1K54C 1IYQA 4KZAA 4YFMA 2ZD8A 2PU2A 5U47A 3LEZA 1SHVA 4IBRA 1IELA 1WE4A 3ZG9B 3BFGA 3DWKA 2VGJA 1KVLA 2XK1A 2ZQ7A 1H8ZA 4Y0UA 3FWLA 4GD8A 2JCHA 1TDGA 5GHZA 4DXCA 2HDQA 1FSYA 1C3BA 4S2IA 3W8KA 1IKIA 5M18A 3JYIA 3NDEA 2HDRA 4JKTA 1JWPA 3OZHA 4OOLA 3CMZA 3GSGA 1NZOA 3LY4A 1FCMA 4BL3A 4P85A 3W4QA 5E2EA 1JWVA 5HARA 3PBOA 4JPMA 4UA6A 2J8YA 4X55A 1NY0A 3OCNA 2OLVA 1U60A 4FSFA 5JYPA 4DRTA 3HLEA 1XXMA 5E2HA 1J9MA 3ZFZA 4BD1A 4GD6A 4N9LA 4S2PA 5J8XA 5A92A 5DF9A 1I2SA 1WYBA 4S2LA 1Q2PA 5CGWA 4GDBA 2XFTA 2J7VA 3IF6A 5CTNA 1YLJA 4KG6A 3C5AA 3A3EA 3UDFA 3FYZA 5CECA 1K55A 1ES4A 1G6AA 3SH9A 4WZ4A 1K38A 3ZHHA 4KZ4A 3BFFA 4H8RA 4BJPA 3MKFA 3ZG8B 3GTCA 1PZPA 5EVIB 2R9WA 2Y59A 1H8YA 4MNRA 1PW8A 3IXGA 1YT4A 2IWDA 5FQ9A 4F94A 4ZTKA 2G2WA 1K56A 2GDNA 4DE1A 4BD0A 2JE5A 1NYYA 2WKHA 1S6RA 1NZUA 3IWQA 1I5QA 4B4ZA 1MWUA 1ZC2A 4UHUA 2WKEA 1XP4A 3CJMA 4GOGA 1W7FA 1BLSA 3ZVWA 1Z6FA 4GKUA 3ZGAB 2EX8A 2P74A 3S22A 4DDYA 4ZJ2A 2WGVA 3VP1A 1HTZA 5A90A 2Y2KA 2RCXA 4PM9A 4MBHA 5FI7A 4EQIA 1ESIA 4HBUA 3IF5A 4KQRA 2Y2IA 2V2FF 4N92A 3HVFA 3RJUA 1MWSA 5KSCA 3UO9A 5FATA 1YLYA 3HUNA 2WKIA 3IT9A 1YLTA 3GMWA 5EVIC 3OPLA 3OPPA 2WGWA 3HLBA 3IHBA 1YMSA 3M6BA 4OLGA 3OC2A 3UE1A 2EX6A 2ZQCA 1RGYA 3TSGA 1W5DA 3Q81A 4B4XA 5L2FA 4S2NA 3NDGA 2Y2QA 3O88A 3V3RA 3UDIA 3AGFA 5GLBA 3UNWA 1FR6A 3IWOA 3C7UA 3IF6B 1JVJA 5DTTA 2FFFB 2VGKA 2QMIA 4IVIA 4KZ8A 3HREA 1VQQA 1BULA 1DJBA 5TGFA 4U0TA 3UY6A 4QY6A 5FAQA 1KVMA 4KENB 4S2OA 5DTSA 3D4FA 3VSLA 4OVDA 4CJNA 4OH0A 5GLAA 3M2KA 2HP6A 2DRWA 2HDUA 2ZMAA 2HP9A 5FQJA 4E3KA 3SH7A 5JYOA 1LI0A 3LY3A 4D2OA 5E2GA 4ZJ3A 4X68A 3HLWA 4UA7A 2G2UA 4WBGA 4WEJA 4EBLA 4OQHA 2XFSA 3BEBA 5BOHA 4JXSA 1IKGA 1N4OA 2Q9MA 5DVAA 2WK0A 3Q7VA 4JBFA 1MY8A 2XGNA 4NETA 3V39A 3G32A 2Y2PA 1CK3A 4C3QA 4LCMA 3B3XA 1TEMA 5HL1A 3IF6C 4KZ7A 5HAQA 3G4PA 1BLHA 2H0YA 4LCLA 1MKIA 2Z2LB 3FV7A 1MWRA 1PYYA 1XPBA 1JTDA 4FCFA 5FQIA 1FQGA 3FKWA 4KQOA 4OPRA 2UWXA 1FOFA 1W79A 4RX2A 3SS3A 1M40A 5E2FA 3WS5A 4DE2A 3FKVA 3S4XA 1QMFA 2E8IA 4XUZA 3P98A 4BENA 2QPNA 5M1AA 4XUXA 2Y2HA 3MXRA 2ZM2A 4JXVA 4PM7A 4ZAMA 3MBZA 4RVAA 1K57A 5EOEA 4GN2A 2XQZA 3BRMA 2ZC4B 5GHYA 4N9KA 5FQMA 1KGEA 4U3TA 4DE3A 3HL9A 5FQQA 3BECA 4DF6A 5A93A 5FA7A 4RX3A 3Q1FA 3IQAA 3DW0A 3MZFA 4S2MA 1FR1A 1ZG4A 1DJAA 1EI5A 1H5XA 4KZBA 4NK3A 3S1YA 4IEDA 1BLCA 4QU3A 5CEBA 5CXWA 3C4PA 3AGEA 2V1ZA 4EUZA 3SS5A 3WS2A 4OQ0A 1MXOA 4OP5A 3VP3A 1GA0A 4OONA 4JXGA 4KZ3A 4WEKA 1YLWA 5E43A 4Q8IA 5FAPA 1PWGA 2V20A 3EQVA 3CZDA 4OP8A 1BTLA 3LCEA 4UAAA 5DF8A 5D3OA 4WM9A 2Y2OA 3O86A 1K6RA 4E3NA 5F82A 4S2NC 3G31A 1G68A 1XX2A 3HLCA 4HBTA 4ZDXA 3A3JA 3M6HA 1E3UD 2BG1A 4EBPA 1GHPA 3GRJA 5HAPA 3NBLA 2XH9A 3BM6A 5FQKA 5HFOA 1CI8A 5F1GA 3MFDA 1LHYA 1NYMA 3BLMA 2ZC3B 5CHJA 3SOIA 1AXBA 4R0QA 4P87A 1VM1A 4Y7PA 4E3OA 2WADA 2Y2GA 4QD4A 1PZOA 2Z2MB 3PBQA 2WUQA 2XLNA 3PBTA 3QHYA 4LV3A 1L0EA 4KZ6A 1RGZA 2ZQ9A 1Y54A 4OPQA 2ZC6B 2FFYA 4E3JA 1MWTA 3N4IA 5FAOA 4DE0A 4FD8A 3ZDJA 1W8QA 2H0TA 3IH9A 5M19A 4KZ9A 3ZNYA 4S2JA 5CGSA 3WRTA 2WZXA 1ES2A 1K6SA 1SCWA 5HW3A 3O87A 4HESA 4M3KA 1O07A 3PTEA 1TVFA 5G18A 2Y2NA 3BLSA 4C6YA 1JWZA 4JLFA 2ZQDA 3G34A 4LV1A 3UN7A 4Y0OA 2Y4AA 3AGDA 5CRFA 5KZHA 3MZEA 1XKZA 1NRFA 1CEFA 1OMEA 1YQSA 3HUOA 4E3MA 3FZCA 4S2KA 5GLDA 1IYPA 1ES5A 1PI5A 1PIOA 4ID4A 4LENA 3W4OA 1GHMA 1K57C 2OV5A 3V50A 2B5RA 1E4DA 2EFXA 3N8RA 3N8LA 2ZJ9A 3I7JA 4WMCD 1S0WA 2DCFA 5EECA 3GR2A 4JXWA 3N7WA 2WAEA 1IEMA 1WYCA 1M6KA 1NXYA 1BSGA 2EFUA 4BL2A 4K0XA 2EX2A 3OCLA 4WZ5A 3VFHA 4E3IA 1W8YA 4R4SA 1K25A 3UE3A 3WWXA 1Q2QA 3LO7A 4HEFA 4OPYA 5F83A 1KDWA 2HPBA 5GL9A 2RL3A 4OQGA 4R3JA 3Q82A 5AQBA 4ZJ1A 5DF7A 3PBSA 2P9VA 1N9BA 1PWDA 2HDSA 2J9PA 4KZ5A 4U0XA 1K55C 5FI2A 2PU4A 1IYOA 3NC8A 3UE0A 3PAGA 4X53A 4A5RA 3C7VA 4GZBA 5FDHA 5EOOA 2OLUA 1XGJA 4JF6A 1GA9A 2WGWB 3VMAA 2CC1A 3HUMA 3WRZA 2J9OA 4DKIA 4FH4A 4X6TA 3M2JA 2IWCA 3RXXA 3ZG7B 5TFQA 5EVID 3GVBA 3Q7ZA 3UPNA 4OPZA 5EUAA 1DY6A 1FCOA 2ZM8A 4MEZA 3HLGA 3TOIA 3VFFA 5F1FA 5KSHA 3BFEA 3IHAA 2OSUA 1ERQA 4GNUA 5AQAA 4UA9A 4DDSA 3BYDA 3P09A 4OLDA 5GLCA 3DWZA 4PM5A 2ZM0A 1CI9A 5FASA 1LI9A 3UPOA 4OOMA 4ZBEA 2ZQ8A 2XF3A 2DNSA 4GDNA 4OKPA 1LL9A 5CTMA 4R23A 3UDXA 2A3UA 1JTGA 1L0GA 4EBNA 4R3BA 3RXWA 4WELA 1BLPA 1ESUA 4K0WA 4CPKA 4E3LA 3V3SA 3W4PA 1EWZA 1MBLA 3HLDA 5IHVA 4K91A 3HLFA 3ITBA 1IYSA 1KGFA 3QNBA 3Q7VB 1RP5A 3G2YA 3WS4A 3UPPA 1PWCA 3BFDA 3SH8A 3V5MA 4WYYA 1E3UA 4N1HA 3O3VA 2A49A 2PBYA 4JF4A 5DTKA 3VP4A 3GV9A 3NIAA 1GCEA 2P9VB 4EV4A 3IXHA 1K54A 4KG5A 3CG5A 1XA1A 4R1GA 2HP5A 3ZVTA 1KE3A 4B88A 1FCNA 4LV0A 4R4RA 3G30A 4YINA 4BLMA 2XR0A 2ZC5B 1PW1A 5EE8A 5HAIA 2Y2MA 3QNCA 3VP0A 1I2WA 2X71A 4PMAA 1ALQA 2I72A 3A3FA 3ISGA 3ITAA 2WZZA 1KE0A 4PM8A 2Q9NA 5A91A 1ZG6A 2EXBA 4Z9QA 4LV2A 3VOZA 2Y2LA 1QMEA 4E6XA 1ES3A 2XDMA 1K56D 3IXDA 3OPRA 3PBRA 4OOYA 4WZ5C 1SDNA 4X56A 3BFCA 1NJ4A 1HD8A 1MPLA 3DTMA 4O7DA 5FI6A 4C75A 4FH2A 4RA7A 3C4OA 1L0DA 1K4EA 3TG9A 3ZCZA 1YLZA 4P0MA 4XXRA 5EVLA 2JBFA 1L2SA 4EWFA 3GQZA 1SKFA 1LL5A 1GHIA 1K4FA 1SDEA 1YMXA 2WGIA 1DJCA 4MBKA 2ZLYA 3A3IA 1KGGA 1CEGA 5CHMA 3MKEA 4DXBA 1FSWA 1ONHA 3G2ZA 3VSKA 3VOYA 4L0LA 3VP2A 4WMCA 4N1XA 2Y2JA 3MXSA 4X69A 5GHXA 5I94A 2ZQAA 5CGXA 3NCKA 2EXAA 4QHCA 2XD5A 2H5SA 5AQ9A 3IXBA 1YLPA 4IVKA 3OPHA 1BUEA 1HZOA 1YM1A 4PPRA 1KE4A 2QZ6A 4MBFA 1ONGA 1ERMA 2X01A 1BT5A 3N8SA 5CERA 1PI4A 4RYEA 4GB7A 5CEDA 5KMWA 4BQMA 3MZDA 3E2LA 3PBNA 4QY5A 2Y91A 2ZC7A 4IBXA 1L0FA 2IWBA 2WAFA 5HX9A 4QJGA 3EQUA 2C5WB 4PM6A 3IH8A 5TR7A 1XGIA 3E2KA 5FSRA 1O7EA 3N6IA 2Y55A 1HVBA 3Q07A 1KDSA 3SS4A 4JF5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P6B A;  2XEP A;  1XA7 A;  4OQI A;  3WS1 A;  2C6W B;  5CHU A;  2EX9 A;  3ZNT A;  4E6W A;  2JC7 A;  4MLL A;  5EVI A;  3IWI A;  1RCJ A;  3ZG5 A;  3A3D A;  3HBR A;  2H10 A;  2BLS A;  5EPH A;  1BZA A;  3PAE A;  3G35 A;  1ERO A;  3NI9 A;  1LLB A;  4QB8 A;  5AQ7 A;  2WYX A;  3NY4 A;  4Y0T A;  3WS0 A;  1E25 A;  2XD1 A;  4KG2 A;  1ZKJ A;  2R9X A;  4KQQ A;  1TDL A;  3ZG0 A;  2X02 A;  1K54 C;  1IYQ A;  4KZA A;  4YFM A;  2ZD8 A;  2PU2 A;  5U47 A;  3LEZ A;  1SHV A;  4IBR A;  1IEL A;  1WE4 A;  3ZG9 B;  3BFG A;  3DWK A;  2VGJ A;  1KVL A;  2XK1 A;  2ZQ7 A;  1H8Z A;  4Y0U A;  3FWL A;  4GD8 A;  2JCH A;  1TDG A;  5GHZ A;  4DXC A;  2HDQ A;  1FSY A;  1C3B A;  4S2I A;  3W8K A;  1IKI A;  5M18 A;  3JYI A;  3NDE A;  2HDR A;  4JKT A;  1JWP A;  3OZH A;  4OOL A;  3CMZ A;  3GSG A;  1NZO A;  3LY4 A;  1FCM A;  4BL3 A;  4P85 A;  3W4Q A;  5E2E A;  1JWV A;  5HAR A;  3PBO A;  4JPM A;  4UA6 A;  2J8Y A;  4X55 A;  1NY0 A;  3OCN A;  2OLV A;  1U60 A;  4FSF A;  5JYP A;  4DRT A;  3HLE A;  1XXM A;  5E2H A;  1J9M A;  3ZFZ A;  4BD1 A;  4GD6 A;  4N9L A;  4S2P A;  5J8X A;  5A92 A;  5DF9 A;  1I2S A;  1WYB A;  4S2L A;  1Q2P A;  5CGW A;  4GDB A;  2XFT A;  2J7V A;  3IF6 A;  5CTN A;  1YLJ A;  4KG6 A;  3C5A A;  3A3E A;  3UDF A;  3FYZ A;  5CEC A;  1K55 A;  1ES4 A;  1G6A A;  3SH9 A;  4WZ4 A;  1K38 A;  3ZHH A;  4KZ4 A;  3BFF A;  4H8R A;  4BJP A;  3MKF A;  3ZG8 B;  3GTC A;  1PZP A;  5EVI B;  2R9W A;  2Y59 A;  1H8Y A;  4MNR A;  1PW8 A;  3IXG A;  1YT4 A;  2IWD A;  5FQ9 A;  4F94 A;  4ZTK A;  2G2W A;  1K56 A;  2GDN A;  4DE1 A;  4BD0 A;  2JE5 A;  1NYY A;  2WKH A;  1S6R A;  1NZU A;  3IWQ A;  1I5Q A;  4B4Z A;  1MWU A;  1ZC2 A;  4UHU A;  2WKE A;  1XP4 A;  3CJM A;  4GOG A;  1W7F A;  1BLS A;  3ZVW A;  1Z6F A;  4GKU A;  3ZGA B;  2EX8 A;  2P74 A;  3S22 A;  4DDY A;  4ZJ2 A;  2WGV A;  3VP1 A;  1HTZ A;  5A90 A;  2Y2K A;  2RCX A;  4PM9 A;  4MBH A;  5FI7 A;  4EQI A;  1ESI A;  4HBU A;  3IF5 A;  4KQR A;  2Y2I A;  2V2F F;  4N92 A;  3HVF A;  3RJU A;  1MWS A;  5KSC A;  3UO9 A;  5FAT A;  1YLY A;  3HUN A;  2WKI A;  3IT9 A;  1YLT A;  3GMW A;  5EVI C;  3OPL A;  3OPP A;  2WGW A;  3HLB A;  3IHB A;  1YMS A;  3M6B A;  4OLG A;  3OC2 A;  3UE1 A;  2EX6 A;  2ZQC A;  1RGY A;  3TSG A;  1W5D A;  3Q81 A;  4B4X A;  5L2F A;  4S2N A;  3NDG A;  2Y2Q A;  3O88 A;  3V3R A;  3UDI A;  3AGF A;  5GLB A;  3UNW A;  1FR6 A;  3IWO A;  3C7U A;  3IF6 B;  1JVJ A;  5DTT A;  2FFF B;  2VGK A;  2QMI A;  4IVI A;  4KZ8 A;  3HRE A;  1VQQ A;  1BUL A;  1DJB A;  5TGF A;  4U0T A;  3UY6 A;  4QY6 A;  5FAQ A;  1KVM A;  4KEN B;  4S2O A;  5DTS A;  3D4F A;  3VSL A;  4OVD A;  4CJN A;  4OH0 A;  5GLA A;  3M2K A;  2HP6 A;  2DRW A;  2HDU A;  2ZMA A;  2HP9 A;  5FQJ A;  4E3K A;  3SH7 A;  5JYO A;  1LI0 A;  3LY3 A;  4D2O A;  5E2G A;  4ZJ3 A;  4X68 A;  3HLW A;  4UA7 A;  2G2U A;  4WBG A;  4WEJ A;  4EBL A;  4OQH A;  2XFS A;  3BEB A;  5BOH A;  4JXS A;  1IKG A;  1N4O A;  2Q9M A;  5DVA A;  2WK0 A;  3Q7V A;  4JBF A;  1MY8 A;  2XGN A;  4NET A;  3V39 A;  3G32 A;  2Y2P A;  1CK3 A;  4C3Q A;  4LCM A;  3B3X A;  1TEM A;  5HL1 A;  3IF6 C;  4KZ7 A;  5HAQ A;  3G4P A;  1BLH A;  2H0Y A;  4LCL A;  1MKI A;  2Z2L B;  3FV7 A;  1MWR A;  1PYY A;  1XPB A;  1JTD A;  4FCF A;  5FQI A;  1FQG A;  3FKW A;  4KQO A;  4OPR A;  2UWX A;  1FOF A;  1W79 A;  4RX2 A;  3SS3 A;  1M40 A;  5E2F A;  3WS5 A;  4DE2 A;  3FKV A;  3S4X A;  1QMF A;  2E8I A;  4XUZ A;  3P98 A;  4BEN A;  2QPN A;  5M1A A;  4XUX A;  2Y2H A;  3MXR A;  2ZM2 A;  4JXV A;  4PM7 A;  4ZAM A;  3MBZ A;  4RVA A;  1K57 A;  5EOE A;  4GN2 A;  2XQZ A;  3BRM A;  2ZC4 B;  5GHY A;  4N9K A;  5FQM A;  1KGE A;  4U3T A;  4DE3 A;  3HL9 A;  5FQQ A;  3BEC A;  4DF6 A;  5A93 A;  5FA7 A;  4RX3 A;  3Q1F A;  3IQA A;  3DW0 A;  3MZF A;  4S2M A;  1FR1 A;  1ZG4 A;  1DJA A;  1EI5 A;  1H5X A;  4KZB A;  4NK3 A;  3S1Y A;  4IED A;  1BLC A;  4QU3 A;  5CEB A;  5CXW A;  3C4P A;  3AGE A;  2V1Z A;  4EUZ A;  3SS5 A;  3WS2 A;  4OQ0 A;  1MXO A;  4OP5 A;  3VP3 A;  1GA0 A;  4OON A;  4JXG A;  4KZ3 A;  4WEK A;  1YLW A;  5E43 A;  4Q8I A;  5FAP A;  1PWG A;  2V20 A;  3EQV A;  3CZD A;  4OP8 A;  1BTL A;  3LCE A;  4UAA A;  5DF8 A;  5D3O A;  4WM9 A;  2Y2O A;  3O86 A;  1K6R A;  4E3N A;  5F82 A;  4S2N C;  3G31 A;  1G68 A;  1XX2 A;  3HLC A;  4HBT A;  4ZDX A;  3A3J A;  3M6H A;  1E3U D;  2BG1 A;  4EBP A;  1GHP A;  3GRJ A;  5HAP A;  3NBL A;  2XH9 A;  3BM6 A;  5FQK A;  5HFO A;  1CI8 A;  5F1G A;  3MFD A;  1LHY A;  1NYM A;  3BLM A;  2ZC3 B;  5CHJ A;  3SOI A;  1AXB A;  4R0Q A;  4P87 A;  1VM1 A;  4Y7P A;  4E3O A;  2WAD A;  2Y2G A;  4QD4 A;  1PZO A;  2Z2M B;  3PBQ A;  2WUQ A;  2XLN A;  3PBT A;  3QHY A;  4LV3 A;  1L0E A;  4KZ6 A;  1RGZ A;  2ZQ9 A;  1Y54 A;  4OPQ A;  2ZC6 B;  2FFY A;  4E3J A;  1MWT A;  3N4I A;  5FAO A;  4DE0 A;  4FD8 A;  3ZDJ A;  1W8Q A;  2H0T A;  3IH9 A;  5M19 A;  4KZ9 A;  3ZNY A;  4S2J A;  5CGS A;  3WRT A;  2WZX A;  1ES2 A;  1K6S A;  1SCW A;  5HW3 A;  3O87 A;  4HES A;  4M3K A;  1O07 A;  3PTE A;  1TVF A;  5G18 A;  2Y2N A;  3BLS A;  4C6Y A;  1JWZ A;  4JLF A;  2ZQD A;  3G34 A;  4LV1 A;  3UN7 A;  4Y0O A;  2Y4A A;  3AGD A;  5CRF A;  5KZH A;  3MZE A;  1XKZ A;  1NRF A;  1CEF A;  1OME A;  1YQS A;  3HUO A;  4E3M A;  3FZC A;  4S2K A;  5GLD A;  1IYP A;  1ES5 A;  1PI5 A;  1PIO A;  4ID4 A;  4LEN A;  3W4O A;  1GHM A;  1K57 C;  2OV5 A;  3V50 A;  2B5R A;  1E4D A;  2EFX A;  3N8R A;  3N8L A;  2ZJ9 A;  3I7J A;  4WMC D;  1S0W A;  2DCF A;  5EEC A;  3GR2 A;  4JXW A;  3N7W A;  2WAE A;  1IEM A;  1WYC A;  1M6K A;  1NXY A;  1BSG A;  2EFU A;  4BL2 A;  4K0X A;  2EX2 A;  3OCL A;  4WZ5 A;  3VFH A;  4E3I A;  1W8Y A;  4R4S A;  1K25 A;  3UE3 A;  3WWX A;  1Q2Q A;  3LO7 A;  4HEF A;  4OPY A;  5F83 A;  1KDW A;  2HPB A;  5GL9 A;  2RL3 A;  4OQG A;  4R3J A;  3Q82 A;  5AQB A;  4ZJ1 A;  5DF7 A;  3PBS A;  2P9V A;  1N9B A;  1PWD A;  2HDS A;  2J9P A;  4KZ5 A;  4U0X A;  1K55 C;  5FI2 A;  2PU4 A;  1IYO A;  3NC8 A;  3UE0 A;  3PAG A;  4X53 A;  4A5R A;  3C7V A;  4GZB A;  5FDH A;  5EOO A;  2OLU A;  1XGJ A;  4JF6 A;  1GA9 A;  2WGW B;  3VMA A;  2CC1 A;  3HUM A;  3WRZ A;  2J9O A;  4DKI A;  4FH4 A;  4X6T A;  3M2J A;  2IWC A;  3RXX A;  3ZG7 B;  5TFQ A;  5EVI D;  3GVB A;  3Q7Z A;  3UPN A;  4OPZ A;  5EUA A;  1DY6 A;  1FCO A;  2ZM8 A;  4MEZ A;  3HLG A;  3TOI A;  3VFF A;  5F1F A;  5KSH A;  3BFE A;  3IHA A;  2OSU A;  1ERQ A;  4GNU A;  5AQA A;  4UA9 A;  4DDS A;  3BYD A;  3P09 A;  4OLD A;  5GLC A;  3DWZ A;  4PM5 A;  2ZM0 A;  1CI9 A;  5FAS A;  1LI9 A;  3UPO A;  4OOM A;  4ZBE A;  2ZQ8 A;  2XF3 A;  2DNS A;  4GDN A;  4OKP A;  1LL9 A;  5CTM A;  4R23 A;  3UDX A;  2A3U A;  1JTG A;  1L0G A;  4EBN A;  4R3B A;  3RXW A;  4WEL A;  1BLP A;  1ESU A;  4K0W A;  4CPK A;  4E3L A;  3V3S A;  3W4P A;  1EWZ A;  1MBL A;  3HLD A;  5IHV A;  4K91 A;  3HLF A;  3ITB A;  1IYS A;  1KGF A;  3QNB A;  3Q7V B;  1RP5 A;  3G2Y A;  3WS4 A;  3UPP A;  1PWC A;  3BFD A;  3SH8 A;  3V5M A;  4WYY A;  1E3U A;  4N1H A;  3O3V A;  2A49 A;  2PBY A;  4JF4 A;  5DTK A;  3VP4 A;  3GV9 A;  3NIA A;  1GCE A;  2P9V B;  4EV4 A;  3IXH A;  1K54 A;  4KG5 A;  3CG5 A;  1XA1 A;  4R1G A;  2HP5 A;  3ZVT A;  1KE3 A;  4B88 A;  1FCN A;  4LV0 A;  4R4R A;  3G30 A;  4YIN A;  4BLM A;  2XR0 A;  2ZC5 B;  1PW1 A;  5EE8 A;  5HAI A;  2Y2M A;  3QNC A;  3VP0 A;  1I2W A;  2X71 A;  4PMA A;  1ALQ A;  2I72 A;  3A3F A;  3ISG A;  3ITA A;  2WZZ A;  1KE0 A;  4PM8 A;  2Q9N A;  5A91 A;  1ZG6 A;  2EXB A;  4Z9Q A;  4LV2 A;  3VOZ A;  2Y2L A;  1QME A;  4E6X A;  1ES3 A;  2XDM A;  1K56 D;  3IXD A;  3OPR A;  3PBR A;  4OOY A;  4WZ5 C;  1SDN A;  4X56 A;  3BFC A;  1NJ4 A;  1HD8 A;  1MPL A;  3DTM A;  4O7D A;  5FI6 A;  4C75 A;  4FH2 A;  4RA7 A;  3C4O A;  1L0D A;  1K4E A;  3TG9 A;  3ZCZ A;  1YLZ A;  4P0M A;  4XXR A;  5EVL A;  2JBF A;  1L2S A;  4EWF A;  3GQZ A;  1SKF A;  1LL5 A;  1GHI A;  1K4F A;  1SDE A;  1YMX A;  2WGI A;  1DJC A;  4MBK A;  2ZLY A;  3A3I A;  1KGG A;  1CEG A;  5CHM A;  3MKE A;  4DXB A;  1FSW A;  1ONH A;  3G2Z A;  3VSK A;  3VOY A;  4L0L A;  3VP2 A;  4WMC A;  4N1X A;  2Y2J A;  3MXS A;  4X69 A;  5GHX A;  5I94 A;  2ZQA A;  5CGX A;  3NCK A;  2EXA A;  4QHC A;  2XD5 A;  2H5S A;  5AQ9 A;  3IXB A;  1YLP A;  4IVK A;  3OPH A;  1BUE A;  1HZO A;  1YM1 A;  4PPR A;  1KE4 A;  2QZ6 A;  4MBF A;  1ONG A;  1ERM A;  2X01 A;  1BT5 A;  3N8S A;  5CER A;  1PI4 A;  4RYE A;  4GB7 A;  5CED A;  5KMW A;  4BQM A;  3MZD A;  3E2L A;  3PBN A;  4QY5 A;  2Y91 A;  2ZC7 A;  4IBX A;  1L0F A;  2IWB A;  2WAF A;  5HX9 A;  4QJG A;  3EQU A;  2C5W B;  4PM6 A;  3IH8 A;  5TR7 A;  1XGI A;  3E2K A;  5FSR A;  1O7E A;  3N6I A;  2Y55 A;  1HVB A;  3Q07 A;  1KDS A;  3SS4 A;  4JF5 A; 
#chains in the Genus database with same CATH topology
 4P6Z M;  5CHU A;  4E6W A;  4MLL A;  5EVI A;  4IHQ A;  3HJI A;  2V1B A;  3RH8 B;  4EXO A;  1E25 A;  1TDL A;  2V9A A;  2XA7 S;  4KZA A;  1A0K A;  2ZD8 A;  2ZOI A;  1SHV A;  1IEL A;  1MKM A;  1KVL A;  1H8Z A;  4GD8 A;  2JCH A;  1FSY A;  1IKI A;  2HDR A;  2QYB A;  5HAR A;  3PBO A;  3NEC A;  4X55 A;  3OCN A;  2W27 A;  1J9M A;  1KDS A;  3ZFZ A;  1I2S A;  2O0Y A;  1Q2P A;  4GDB A;  1YLJ A;  1LT0 A;  3UDF A;  5CEC A;  3P01 A;  3SH9 A;  3DBA A;  4WZ4 A;  1VEU A;  2R78 A;  3UB7 A;  3CAX A;  1YKD A;  2R9W A;  2Y59 A;  1H8Y A;  3G6O A;  2IWD A;  4F94 A;  2WKR A;  4DE1 A;  4BD0 A;  1STZ A;  3IWQ A;  1I5Q A;  4B4Z A;  3B47 A;  3ZVW A;  5HWW A;  4CLC B;  2P74 A;  4K08 A;  1HTZ A;  2Y2K A;  1DP8 A;  5FI7 A;  3PHY A;  5HPI A;  4KUK A;  5IS1 A;  2W0N A;  3RJU A;  5HWT A;  5FAT A;  3IT9 A;  3OPL A;  3NHQ A;  3HLB A;  3M6B A;  5F5Y A;  5J3W A;  2HGV A;  2ZQC A;  3Q81 A;  5L2F A;  3V3R A;  3UDI A;  3AGF A;  3IWO A;  5DTT A;  2FFF B;  2VGK A;  4KZ8 A;  1BUL A;  1KVM A;  1LSV A;  3D4F A;  4OH0 A;  3M2K A;  3TJZ C;  5FQJ A;  4HH2 A;  4ZJ3 A;  3HLW A;  2G2U A;  3BEB A;  1OTE A;  1H8M A;  3UE6 A;  2Y2P A;  4O8G A;  3EEH A;  3BWL A;  3B3X A;  5A8B A;  3IF6 C;  1P9W A;  3KYQ A;  4EU0 A;  2GJ3 A;  3MFX A;  1MWR A;  2UWX A;  3SS3 A;  3FKV A;  3S4X A;  4XUZ A;  3DTI A;  3P98 A;  5HDD A;  3U4L P;  4XUX A;  2Y2H A;  3MXR A;  4ZAM A;  3MBZ A;  3R7W A;  1OT9 A;  2GNX A;  3GEC A;  1UGU A;  2QJ5 A;  4N9K A;  4DF6 A;  3BEC A;  3GDI A;  3Q1F A;  3IQA A;  3LYX A;  1FR1 A;  3O5Y A;  4HJ4 A;  1ZG4 A;  1S67 L;  1EI5 A;  1TF1 A;  3MMH A;  2D01 A;  3T4Q A;  3LR3 A;  5I5L A;  2V1Z A;  3SZT A;  3VE4 A;  3SS5 A;  2B02 A;  2A2L A;  4OQ0 A;  1MXO A;  5DKK A;  3VP3 A;  1DP9 A;  4KZ3 A;  2A24 B;  5FAP A;  3CUE A;  1MZU A;  2V20 A;  5G4Z A;  4B9O A;  4L9G A;  3O86 A;  4E3N A;  3L9K A;  3CWF A;  2IA2 A;  4ZDX A;  2XA7 M;  3IS2 B;  1E3U D;  1AWI A;  4EBP A;  3GRJ A;  5HAP A;  5FQK A;  1KOU A;  2HF6 A;  5CHJ A;  1AXB A;  4EET B;  2GX5 A;  4Y7P A;  4E3O A;  4ETZ A;  4QD4 A;  2WUQ A;  3PBT A;  3DTK A;  4KZ6 A;  1S1Y A;  1RGZ A;  4OPQ A;  2W1T A;  2D02 A;  4GS9 B;  3BY8 A;  3VV4 A;  3N4I A;  5FAO A;  4EQ1 A;  4B93 A;  3ZDJ A;  4S2J A;  3LIE A;  5CGS A;  3WRT A;  4FOF A;  3T1Q B;  5HW3 A;  4M3K A;  3PTE A;  2V1A A;  1TVF A;  5G18 A;  3BLS A;  1JWZ A;  4JLF A;  2ZQD A;  4WF0 A;  3AGD A;  5KZH A;  4WLA A;  1CEF A;  3KO6 A;  1S66 L;  4E3M A;  4S2K A;  4WUJ A;  1IYP A;  1PI5 A;  1K57 C;  2OV5 A;  3KYZ A;  3N8R A;  2ZJ9 A;  5FDS A;  1P0Z A;  1IEM A;  1WYC A;  1OPX A;  1M6K A;  3F1N A;  2KX6 A;  4BL2 A;  3OCL A;  3UE3 A;  4FTX A;  3C2W A;  2HPB A;  2RL3 A;  3Q82 A;  4ZJ1 A;  3H7W A;  2HDS A;  3PAG A;  3MR0 A;  1XGJ A;  2EWW A;  3HUM A;  3M2J A;  3RXX A;  1X0O A;  5EVI D;  4YNR A;  1VET B;  1DY6 A;  1LSX A;  2VJW A;  3HLG A;  3TOI A;  3VFF A;  5KSH A;  4GNU A;  5G4Y A;  1NLY A;  2L4R A;  4MN5 A;  3UPO A;  3QP6 A;  4GDN A;  5CTM A;  2A3U A;  4KQD A;  1JTG A;  4Q0J A;  2PR5 A;  3NOU C;  4R3B A;  1MC0 A;  4K0W A;  2PT7 A;  3W4P A;  4EUV A;  5HWV A;  4H6J A;  1RP5 A;  2J3W A;  3WS4 A;  3UPP A;  3T1S A;  4WYY A;  5HZH A;  3LR5 A;  5AVF A;  3VP4 A;  3KSI A;  3QP2 A;  1FCN A;  1S1Z A;  4LV0 A;  4YIN A;  4BLM A;  2XR0 A;  5EE8 A;  5HAI A;  3QNC A;  3S7N A;  2X71 A;  1UWP X;  2WZZ A;  4PM8 A;  4EES A;  3DAV A;  3IXD A;  3OPR A;  4WZ5 C;  4OOY A;  4BBT A;  4FH2 A;  4I39 A;  3C4O A;  1YLZ A;  5EVL A;  1SKF A;  1GHI A;  1CQA A;  1SDE A;  1SKO A;  3KSH A;  3F1P B;  1PNE A;  3G2Z A;  4LRX C;  3VOY A;  4WMC A;  1ODV A;  3JVU A;  2Y2J A;  3MXS A;  4X69 A;  2ZQA A;  5CGX A;  4QHC A;  2H5S A;  3CIT A;  4IVK A;  4HOI A;  2P7J A;  4MBF A;  5AJG A;  1CF0 A;  4RYE A;  1GSX A;  1L0F A;  2WAF A;  4QJG A;  5TR7 A;  3CHW P;  2KOI A;  2C6W B;  3ZNT A;  2JC7 A;  4BBV A;  2BAS A;  1T19 A;  1RCJ A;  4HHD A;  3A3D A;  1BZA A;  4G3W A;  1LLB A;  5AQ7 A;  2WYX A;  3NY4 A;  2ZMF A;  2W3E A;  5DFY A;  4KQQ A;  3ZG0 A;  1K54 C;  2I9V A;  2PU2 A;  5U47 A;  1V9Y A;  3LEZ A;  1WE4 A;  3MQO A;  1GSW A;  3BFG A;  1NWZ A;  5EFW A;  3FWL A;  1TDG A;  5GHZ A;  2VZW A;  4BBU A;  3JYI A;  3H82 B;  4JKT A;  1JWP A;  3OZH A;  3EGX C;  1NZO A;  1SZV A;  4P85 A;  3W4Q A;  1D1J A;  2OLV A;  5JYP A;  3HLE A;  2PBD P;  4DMZ A;  2XRN A;  5J8X A;  3LID A;  1VHM A;  4D60 A;  1WYB A;  5CGW A;  2EWV A;  5CTN A;  4KG6 A;  2J80 A;  3R4K A;  3ZHH A;  1YSQ A;  4H8R A;  4BJP A;  3MKF A;  1P97 A;  3GTC A;  1PZP A;  3PYP A;  5EVI B;  3ZQ5 A;  2Y79 A;  4LRZ E;  3BQA A;  4ZTK A;  2G2W A;  1K56 A;  4Y2F A;  1XFN A;  1NZU A;  1MWU A;  1ZC2 A;  3FPW A;  4UHU A;  1BLS A;  2EX8 A;  1XJ4 A;  3VP1 A;  2RCX A;  4PM9 A;  4MBH A;  4HP4 A;  2KDK A;  4N92 A;  3HVF A;  1MWS A;  3UO9 A;  1OJG A;  1YPR A;  3UME A;  2W3G A;  3IHB A;  1VB6 A;  5L8M A;  3OC2 A;  3UE1 A;  2EX6 A;  3TSG A;  5K5B A;  4S2N A;  4HP9 A;  3O88 A;  5GLB A;  4CLC C;  5TGF A;  2GZA A;  4QY6 A;  5CX7 A;  5FAQ A;  4KEN B;  4S2O A;  5DKL A;  1VEU B;  3VSL A;  4CJN A;  3DTE A;  2HP6 A;  2HJ9 C;  1LI0 A;  1OTI A;  3FPV A;  1V9Z A;  4NXB A;  4WEJ A;  2XFS A;  5BOH A;  2JHE A;  1N4O A;  2Q9M A;  5DVA A;  2WK0 A;  3Q7V A;  4JBF A;  1MY8 A;  4DN0 A;  3S7P A;  3IX8 A;  1TEM A;  2ZL1 A;  5HL1 A;  4KZ7 A;  5HAQ A;  3G4P A;  4YOF A;  4LCL A;  1IFQ A;  5FQI A;  1JTD A;  1FQG A;  4KQO A;  3EOI A;  4RQ9 A;  1FOF A;  3WS5 A;  1M40 A;  2HZ5 A;  4NXF A;  3TRC A;  2E8I A;  4PHT A;  4RVA A;  2JKF A;  2XQZ A;  2QHK A;  5LBR A;  2PHY A;  1KGE A;  4DE3 A;  5A93 A;  4GJ4 A;  3DW0 A;  4S2M A;  1XFQ A;  4QU3 A;  3AGE A;  4O0P A;  2E8J A;  1XJ3 A;  1YLW A;  4UAA A;  5D3O A;  5MC7 A;  2JKG A;  3LR0 A;  1G68 A;  1Z09 A;  2INW A;  4HBT A;  2BG1 A;  1NLZ A;  3E0Y A;  3BM6 A;  2PR6 A;  5HFO A;  1CI8 A;  5F1G A;  3BLM A;  4R0Q A;  3JPU A;  4P87 A;  3RFB A;  2Y2G A;  3R7W B;  2XLN A;  3QHY A;  1Y54 A;  2ZC6 B;  3LIC A;  2OOL A;  2H0T A;  3IH9 A;  4KZ9 A;  4MMN A;  5F69 A;  3LUQ A;  3O87 A;  4L9F A;  5HDC A;  4GLQ A;  3UN7 A;  2Y4A A;  5CRF A;  4YWZ A;  1NRF A;  1DRM A;  1W63 M;  1YQS A;  2V0U A;  4ID4 A;  3V50 A;  2EFX A;  1E4D A;  3VOL A;  4WMC D;  2DCF A;  3JVV A;  3N7W A;  2PD7 A;  4LPZ A;  4G3V A;  5FEG A;  1NXY A;  2JKT I;  4E3I A;  4R4S A;  3S7O A;  5GL9 A;  5DF7 A;  4UEY A;  2V8F A;  1H3Q A;  2J9P A;  5FI2 A;  3C7V A;  5FDH A;  5EOO A;  2PDR A;  4JF6 A;  2W1T B;  2WGW B;  2CC1 A;  3WRZ A;  4XT2 A;  2J9O A;  4DKI A;  4QPR A;  2VGL S;  4X6T A;  2IWC A;  3EEA A;  2JN7 A;  1ZTU A;  2PYR A;  3GVB A;  2Z6C A;  4OPZ A;  5EUA A;  4I38 A;  5IU1 A;  4NKP A;  3IHA A;  5AQA A;  4DDS A;  4G3K A;  2YKF A;  3BYD A;  4OLD A;  5GLC A;  2ZM0 A;  1CI9 A;  2J3T D;  2DNS A;  4OKP A;  3T4J A;  3KX0 X;  2VV7 A;  3UDX A;  4F3L A;  1EW0 A;  4E3L A;  3V3S A;  1EWZ A;  2W3D A;  3HLD A;  5TBM A;  4PAU A;  1T1A A;  3G2Y A;  3F1N B;  3UB6 A;  3ULF A;  2K2N A;  4JF4 A;  3H7W B;  3GV9 A;  1YAX A;  3NIA A;  2VK3 A;  3CG5 A;  2PYP A;  4Y17 A;  3ZVT A;  4B88 A;  2W3H A;  4R4R A;  3G30 A;  1PW1 A;  2Y2M A;  3W2Z A;  1KE0 A;  2Q9N A;  3QP5 A;  2EXB A;  2ZBB A;  3VOZ A;  1S4S A;  1ES3 A;  2XDM A;  1K56 D;  2H28 A;  1SDN A;  1NJ4 A;  4X1L A;  3DTM A;  5EM0 A;  1L0D A;  5AVE A;  3PXP A;  3TG9 A;  4XXR A;  4P0M A;  4EWF A;  2UV0 E;  3HCY A;  1KGG A;  1CEG A;  2OAQ 1;  5CHM A;  5EV0 A;  4L0L A;  4I3J A;  3CI6 A;  5GHX A;  4H6J B;  3NCK A;  1YLP A;  4ETX A;  3F1O A;  3N8S A;  5CED A;  3OOV A;  4BQM A;  3E2L A;  2JKT M;  4IBX A;  5DJU A;  2WKP A;  5EM1 A;  1N9L A;  1XGI A;  1HVB A;  4YFM A;  3SS4 A;  4BWI A;  2EX9 A;  2V8C A;  4ESP A;  1BYW A;  2BLS A;  5EPH A;  3PAE A;  3NI9 A;  4NXG A;  5FL3 A;  2XD1 A;  3E4Q A;  2ZMV A;  3LFV A;  3ZG9 B;  3DWK A;  2VGJ A;  4Y0U A;  4DXC A;  2HDQ A;  1PFL A;  3W8K A;  4ARZ A;  4MCW A;  3RTY A;  4JGR A;  1T1C A;  3LIF A;  3LGO A;  3LY4 A;  1FCM A;  1H0M A;  3UB5 P;  5E2E A;  4EEU A;  4GS9 A;  1JWV A;  4JPM A;  4UA6 A;  2PRF A;  1NY0 A;  1U60 A;  3UB8 A;  1XXM A;  2NUP C;  4GD6 A;  3LIA A;  4N9L A;  4X1M A;  5DF9 A;  2XFT A;  3IF6 A;  4IUH A;  3C5A A;  3EWK A;  3K2N A;  3A3E A;  4LFU A;  2M7V A;  3FYZ A;  3FG8 A;  1K38 A;  2NUT C;  3BFF A;  2XSS A;  3ZG8 B;  2VEA A;  3T4S A;  4PKY A;  1PW8 A;  4JGO A;  3IXG A;  1YT4 A;  5FQ9 A;  4WL9 A;  2WKQ A;  2VGL M;  1K0K A;  1NYY A;  2WKH A;  1W7F A;  1Z6F A;  3S22 A;  4R70 A;  4FUW A;  4ZJ2 A;  4HH3 A;  5IT5 A;  4I3I A;  2Y2I A;  3UMD A;  3HUN A;  5EVI C;  3T4L A;  3OPP A;  1DP6 A;  4OLG A;  5J4E A;  4R38 A;  1Y4O A;  5DJT A;  1OTB A;  1VET A;  1W5D A;  3T4T A;  4EEP A;  3C30 A;  2EA9 A;  2Y2Q A;  3UNW A;  3C7U A;  4IVI A;  1VQQ A;  1DJB A;  4U0T A;  1CJF A;  5DTS A;  4OVD A;  3ICY A;  3BJN A;  5GLA A;  3TW8 A;  2DRW A;  2ZMA A;  2HP9 A;  5JYO A;  4UA7 A;  4WBG A;  1TD5 A;  4EBL A;  1IKG A;  4Y13 A;  4WN5 A;  3NOP C;  2XGN A;  4NET A;  3V39 A;  3G32 A;  4EW7 A;  1F2K A;  4C3Q A;  2Z6D A;  1J3W A;  3MXQ A;  4LCM A;  4M4X A;  2H0Y A;  1XPB A;  4FCF A;  1W79 A;  5E2F A;  4ZRR A;  4DE2 A;  3CLO A;  4GHI A;  4IUK A;  2QPN A;  5M1A A;  2ZM2 A;  4JXV A;  3MF0 A;  1K57 A;  5EOE A;  4GN2 A;  3BRM A;  1F9I A;  1F5M A;  5FQM A;  3HL9 A;  5FQQ A;  4CQH A;  3MZF A;  3LR4 A;  1DJA A;  3S1Y A;  4KZB A;  4EUZ A;  3F1P A;  3WS2 A;  4OP5 A;  4OON A;  5E43 A;  3B42 A;  3EQV A;  3L7H A;  3LCE A;  1PRQ A;  2Y2O A;  5F82 A;  1XX2 A;  2O9C A;  1HLU P;  4R6L A;  3CPT A;  1OT6 A;  3D3O A;  3M6H A;  1GHP A;  3NBL A;  1ZHH B;  4NG2 A;  3SW1 A;  2QJ7 A;  3MFD A;  2ZC3 B;  2CMN A;  3SOI A;  1VM1 A;  2W1R A;  2WAD A;  1PZO A;  3PBQ A;  4LV3 A;  1L0E A;  3BY9 A;  2ZQ9 A;  4E3J A;  1MWT A;  3KYE A;  2M1C A;  2WZX A;  1ES2 A;  3T4O A;  1SCW A;  2FZ0 A;  3B33 A;  4HES A;  2Y2N A;  1XJ6 A;  4LV1 A;  2Q0O A;  3MZE A;  1XKZ A;  3FZC A;  5GLD A;  1ES5 A;  3W4O A;  1GHM A;  3E98 A;  2B5R A;  3I7J A;  1S0W A;  5EEC A;  2V0W A;  3GR2 A;  4JXW A;  5J7E A;  3QP1 A;  1BSG A;  4HJ3 A;  4K0X A;  4WZ5 A;  3LI8 A;  3WWX A;  3T50 A;  4R3J A;  3PBS A;  4L9E A;  2DMW A;  2P9V A;  4KZ5 A;  4U0X A;  1K55 C;  2PAV P;  4A5R A;  4Q0I A;  3LEQ A;  4LLO B;  2OLU A;  3CUE C;  4Z1W A;  3UB9 A;  4FH4 A;  3ZG7 B;  1G5U A;  5TFQ A;  2L0W A;  2O99 A;  3NUL A;  3UPN A;  3Q7Z A;  4MEZ A;  1FCO A;  2VV8 A;  4Y3I A;  1F98 A;  1T1B A;  3BFE A;  4MN7 A;  4JGQ A;  4UA9 A;  5FAS A;  1LI9 A;  4OOM A;  4ZBE A;  2ZQ8 A;  2XF3 A;  1LL9 A;  1L0G A;  3H9W A;  5HSQ A;  4Q0H A;  2AVX A;  5IHV A;  3HLF A;  3ITB A;  1KGF A;  4CLC E;  1ACF A;  3IX3 A;  4N1H A;  4LGW A;  1T18 A;  4EV4 A;  3IXH A;  1K54 A;  4KG5 A;  4E04 A;  1KE3 A;  4ME4 A;  3D72 A;  1NRJ A;  4AFI A;  4PKY G;  2ZC5 B;  4PMA A;  1ALQ A;  4XT2 B;  3ISG A;  4QWO A;  3ITA A;  5A91 A;  1ZG6 A;  4EER A;  4Z9Q A;  4E6X A;  3PBR A;  5FI6 A;  3BFC A;  1HD8 A;  1MPL A;  3OLO A;  3A0S A;  5KIZ A;  4RA7 A;  3ZCZ A;  2JBF A;  1L2S A;  3GQZ A;  3P7N A;  1LSW A;  4F3L B;  1DJC A;  3A3I A;  3E4P A;  5HL6 A;  4DXB A;  1FSW A;  1ONH A;  3VSK A;  3VP2 A;  4N1X A;  5TBM B;  5I94 A;  5DFX A;  2EXA A;  2XD5 A;  5AQ9 A;  1GSV A;  1BUE A;  2P08 A;  1YM1 A;  4PPR A;  2X01 A;  1BT5 A;  2B18 A;  5CER A;  4O01 A;  1PI4 A;  5L07 A;  3TE8 A;  3PBN A;  2Y91 A;  2ZC7 A;  3QP8 A;  2IWB A;  2FH5 A;  3EQU A;  2C5W B;  4PM6 A;  1S4R A;  1O7E A;  3N6I A;  4JF5 A;  1L3L A;  2OWJ A;  4P6B A;  2XEP A;  1XA7 A;  3C38 A;  4OQI A;  3WS1 A;  1OTA A;  3IWI A;  3ZG5 A;  4HY8 A;  3HBR A;  2H10 A;  4I3A A;  3G35 A;  1ERO A;  4QB8 A;  1D7E A;  5TJJ A;  4Y0T A;  3WS0 A;  3MQQ A;  4KG2 A;  1ZKJ A;  2R9X A;  2X02 A;  4CLC A;  1IYQ A;  4IBR A;  2K31 A;  2XK1 A;  2ZQ7 A;  4HJ6 A;  1P9R A;  2HV1 A;  1C3B A;  4S2I A;  5M18 A;  3NDE A;  4OOL A;  3CMZ A;  3GSG A;  3HJK A;  4BL3 A;  2HJE A;  3F1O B;  2J8Y A;  4FSF A;  4DRT A;  5E2H A;  4BD1 A;  4S2P A;  5A92 A;  2LB9 A;  1N9O A;  4S2L A;  5EVE A;  2JKR I;  2J7V A;  4DJ2 A;  1K55 A;  1ES4 A;  1G6A A;  5F6A A;  4KZ4 A;  4NXE A;  1FIL A;  4MNR A;  2ACG A;  4HQA A;  3IBJ A;  2GDN A;  2JE5 A;  2OWH A;  1S6R A;  3KSF A;  2WKE A;  1XP4 A;  3CJM A;  4GOG A;  4GKU A;  3BW6 A;  3ZGA B;  4BMW A;  4DDY A;  2WGV A;  5A90 A;  4EQI A;  1ESI A;  4HBU A;  3IF5 A;  4KQR A;  4ARZ B;  2W3F A;  2V2F F;  5KSC A;  1YLY A;  1IOU A;  2WKI A;  2VLG A;  1YLT A;  3GMW A;  2L1M A;  2WGW A;  2XRO A;  1YMS A;  4I5S A;  2Y8H A;  1RGY A;  3T12 B;  4X25 A;  3K3D A;  4B4X A;  2BTF P;  3NDG A;  3BQ8 A;  2J3T C;  1FR6 A;  3IF6 B;  1JVJ A;  4UQI S;  4MDZ A;  2QMI A;  3HRE A;  3UY6 A;  3MS6 A;  2HDU A;  4E3K A;  3SH7 A;  3LY3 A;  4D2O A;  5HD3 A;  5E2G A;  4X68 A;  1FIK A;  4HIA A;  4OQH A;  4JXS A;  5HDS A;  2A24 A;  3V67 A;  2G7U A;  1CK3 A;  3MQ0 A;  2YKH A;  4II7 A;  1Y28 A;  1BLH A;  1MKI A;  3FV7 A;  3IS2 A;  1PYY A;  3FKW A;  4OPR A;  4RX2 A;  3MSH A;  3T4K A;  1SKO B;  1QMF A;  1XJ2 A;  5L10 A;  5HPF A;  4BEN A;  4PM7 A;  2ZOH A;  2ZC4 B;  1TS7 A;  5GHY A;  4U3T A;  3ZYT A;  5FA7 A;  4RX3 A;  4LRY C;  2VA0 A;  1H5X A;  4IJG A;  4NK3 A;  4IED A;  1BLC A;  5CEB A;  5CXW A;  3C4P A;  2JKR M;  3D9Y A;  2OAP 1;  1GA0 A;  4JXG A;  4WEK A;  4Q8I A;  2VKS A;  1PWG A;  3QP4 A;  1TS0 A;  3CZD A;  4OP8 A;  3K3C A;  3IX4 A;  1BTL A;  5DF8 A;  4WM9 A;  1K6R A;  4MN6 A;  4S2N C;  3G31 A;  3HLC A;  2M7U A;  3A3J A;  2XH9 A;  1OJ5 A;  2PD8 A;  1LHY A;  1NYM A;  4GHI B;  4P6Z S;  2Z2M B;  2KLI A;  3A0V A;  2FFY A;  3C8C A;  4DE0 A;  4FD8 A;  1W8Q A;  2MJ6 A;  5M19 A;  3ZNY A;  1K6S A;  1O07 A;  4NEE D;  2B95 A;  4C6Y A;  3G34 A;  4Y0O A;  3PR6 A;  1OME A;  4R3A A;  3HUO A;  4JGP A;  5F68 A;  1JNU A;  4LEN A;  1LL8 A;  1PIO A;  3EGD C;  2VV6 A;  3N8L A;  5FEF A;  2WAE A;  3CPT B;  2EFU A;  3VFH A;  2EX2 A;  1W8Y A;  1K25 A;  1Q2Q A;  1TS8 A;  3LO7 A;  4HEF A;  4OPY A;  5F83 A;  1KDW A;  4OQG A;  5AQB A;  3LI9 A;  1N9B A;  1PWD A;  2PU4 A;  3KSG A;  1IYO A;  3NC8 A;  3UE0 A;  4X53 A;  4GZB A;  2QWS A;  2P04 A;  1GA9 A;  3VMA A;  3LIB A;  3U2A A;  2VX8 A;  4Y15 A;  3MJQ A;  2ZM8 A;  2O9B A;  5F1F A;  2QKP A;  4GW9 A;  2OSU A;  1ERQ A;  4UQI M;  3P09 A;  2K7S A;  4HNB A;  3DWZ A;  4PM5 A;  3IBR A;  4CLC D;  4R23 A;  1N9N A;  4EBN A;  3RXW A;  4WEL A;  1BLP A;  1ESU A;  5C5K A;  4CPK A;  2O9A A;  1MBL A;  4K91 A;  3A0R A;  1WA9 A;  1IYS A;  3QNB A;  5HD5 A;  3Q7V B;  1PWC A;  3BFD A;  3SH8 A;  3V5M A;  1E3U A;  3NJA A;  3O3V A;  2A49 A;  2ZL1 B;  2PBY A;  5DTK A;  1GCE A;  2P9V B;  1XA1 A;  2LB5 A;  1TS6 A;  4R1G A;  2HP5 A;  1OTD A;  3VP0 A;  1I2W A;  2I72 A;  3A3F A;  4LV2 A;  4Y5F A;  2Y2L A;  1QME A;  3OBF A;  4X56 A;  4O7D A;  4C75 A;  3FC7 A;  1K4E A;  1G28 A;  1LL5 A;  3T1X A;  1K4F A;  1UWN X;  1YMX A;  2WGI A;  4MBK A;  2ZLY A;  4KUO A;  1D06 A;  3MKE A;  1G6O A;  4GCZ A;  4HI4 A;  4DJ3 A;  3H82 A;  3E4O A;  3T1R A;  3IXB A;  3S7Q A;  3OPH A;  1HZO A;  1YSP A;  1KE4 A;  2QZ6 A;  3NOT C;  1ONG A;  1ERM A;  4GB7 A;  5KMW A;  1W63 Q;  3MZD A;  3VE3 A;  4QY5 A;  5HX9 A;  5L09 A;  3IH8 A;  3E2K A;  5FSR A;  2Y55 A;  3Q07 A;  2Z2L B; 
#chains in the Genus database with same CATH homology
 4P6B A;  2XEP A;  1XA7 A;  4OQI A;  3WS1 A;  2C6W B;  5CHU A;  2EX9 A;  3ZNT A;  4E6W A;  2JC7 A;  4MLL A;  5EVI A;  3IWI A;  1RCJ A;  3ZG5 A;  3A3D A;  3HBR A;  2H10 A;  2BLS A;  5EPH A;  1BZA A;  3PAE A;  3G35 A;  1ERO A;  3NI9 A;  1LLB A;  4QB8 A;  5AQ7 A;  2WYX A;  3NY4 A;  4Y0T A;  3WS0 A;  1E25 A;  2XD1 A;  4KG2 A;  1ZKJ A;  2R9X A;  4KQQ A;  1TDL A;  3ZG0 A;  2X02 A;  1K54 C;  1IYQ A;  4KZA A;  4YFM A;  2ZD8 A;  2PU2 A;  5U47 A;  3LEZ A;  1SHV A;  4IBR A;  1IEL A;  1WE4 A;  3ZG9 B;  3BFG A;  3DWK A;  2VGJ A;  1KVL A;  2XK1 A;  2ZQ7 A;  1H8Z A;  4Y0U A;  3FWL A;  4GD8 A;  2JCH A;  1TDG A;  5GHZ A;  4DXC A;  2HDQ A;  1FSY A;  1C3B A;  4S2I A;  3W8K A;  1IKI A;  5M18 A;  3JYI A;  3NDE A;  2HDR A;  4JKT A;  1JWP A;  3OZH A;  4OOL A;  3CMZ A;  3GSG A;  1NZO A;  3LY4 A;  1FCM A;  4BL3 A;  4P85 A;  3W4Q A;  5E2E A;  1JWV A;  5HAR A;  3PBO A;  4JPM A;  4UA6 A;  2J8Y A;  4X55 A;  1NY0 A;  3OCN A;  2OLV A;  1U60 A;  4FSF A;  5JYP A;  4DRT A;  3HLE A;  1XXM A;  5E2H A;  1J9M A;  3ZFZ A;  4BD1 A;  4GD6 A;  4N9L A;  4S2P A;  5J8X A;  5A92 A;  5DF9 A;  1I2S A;  1WYB A;  4S2L A;  1Q2P A;  5CGW A;  4GDB A;  2XFT A;  2J7V A;  3IF6 A;  5CTN A;  1YLJ A;  4KG6 A;  3C5A A;  3A3E A;  3UDF A;  3FYZ A;  5CEC A;  1K55 A;  1ES4 A;  1G6A A;  3SH9 A;  4WZ4 A;  1K38 A;  3ZHH A;  4KZ4 A;  3BFF A;  4H8R A;  4BJP A;  3MKF A;  3ZG8 B;  3GTC A;  1PZP A;  5EVI B;  2R9W A;  2Y59 A;  1H8Y A;  4MNR A;  1PW8 A;  3IXG A;  1YT4 A;  2IWD A;  5FQ9 A;  4F94 A;  4ZTK A;  2G2W A;  1K56 A;  2GDN A;  4DE1 A;  4BD0 A;  2JE5 A;  1NYY A;  2WKH A;  1S6R A;  1NZU A;  3IWQ A;  1I5Q A;  4B4Z A;  1MWU A;  1ZC2 A;  4UHU A;  2WKE A;  1XP4 A;  3CJM A;  4GOG A;  1W7F A;  1BLS A;  3ZVW A;  1Z6F A;  4GKU A;  3ZGA B;  2EX8 A;  2P74 A;  3S22 A;  4DDY A;  4ZJ2 A;  2WGV A;  3VP1 A;  1HTZ A;  5A90 A;  2Y2K A;  2RCX A;  4PM9 A;  4MBH A;  5FI7 A;  4EQI A;  1ESI A;  4HBU A;  3IF5 A;  4KQR A;  2Y2I A;  2V2F F;  4N92 A;  3HVF A;  3RJU A;  1MWS A;  5KSC A;  3UO9 A;  5FAT A;  1YLY A;  3HUN A;  2WKI A;  3IT9 A;  1YLT A;  3GMW A;  5EVI C;  3OPL A;  3OPP A;  2WGW A;  3HLB A;  3IHB A;  1YMS A;  3M6B A;  4OLG A;  3OC2 A;  3UE1 A;  2EX6 A;  2ZQC A;  1RGY A;  3TSG A;  1W5D A;  3Q81 A;  4B4X A;  5L2F A;  4S2N A;  3NDG A;  2Y2Q A;  3O88 A;  3V3R A;  3UDI A;  3AGF A;  5GLB A;  3UNW A;  1FR6 A;  3IWO A;  3C7U A;  3IF6 B;  1JVJ A;  5DTT A;  2FFF B;  2VGK A;  2QMI A;  4IVI A;  4KZ8 A;  3HRE A;  1VQQ A;  1BUL A;  1DJB A;  5TGF A;  4U0T A;  3UY6 A;  4QY6 A;  5FAQ A;  1KVM A;  4KEN B;  4S2O A;  5DTS A;  3D4F A;  3VSL A;  4OVD A;  4CJN A;  4OH0 A;  5GLA A;  3M2K A;  2HP6 A;  2DRW A;  2HDU A;  2ZMA A;  2HP9 A;  5FQJ A;  4E3K A;  3SH7 A;  5JYO A;  1LI0 A;  3LY3 A;  4D2O A;  5E2G A;  4ZJ3 A;  4X68 A;  3HLW A;  4UA7 A;  2G2U A;  4WBG A;  4WEJ A;  4EBL A;  4OQH A;  2XFS A;  3BEB A;  5BOH A;  4JXS A;  1IKG A;  1N4O A;  2Q9M A;  5DVA A;  2WK0 A;  3Q7V A;  4JBF A;  1MY8 A;  2XGN A;  4NET A;  3V39 A;  3G32 A;  2Y2P A;  1CK3 A;  4C3Q A;  4LCM A;  3B3X A;  1TEM A;  5HL1 A;  3IF6 C;  4KZ7 A;  5HAQ A;  3G4P A;  1BLH A;  2H0Y A;  4LCL A;  1MKI A;  2Z2L B;  3FV7 A;  1MWR A;  1PYY A;  1XPB A;  1JTD A;  4FCF A;  5FQI A;  1FQG A;  3FKW A;  4KQO A;  4OPR A;  2UWX A;  1FOF A;  1W79 A;  4RX2 A;  3SS3 A;  1M40 A;  5E2F A;  3WS5 A;  4DE2 A;  3FKV A;  3S4X A;  1QMF A;  2E8I A;  4XUZ A;  3P98 A;  4BEN A;  2QPN A;  5M1A A;  4XUX A;  2Y2H A;  3MXR A;  2ZM2 A;  4JXV A;  4PM7 A;  4ZAM A;  3MBZ A;  4RVA A;  1K57 A;  5EOE A;  4GN2 A;  2XQZ A;  3BRM A;  2ZC4 B;  5GHY A;  4N9K A;  5FQM A;  1KGE A;  4U3T A;  4DE3 A;  3HL9 A;  5FQQ A;  3BEC A;  4DF6 A;  5A93 A;  5FA7 A;  4RX3 A;  3Q1F A;  3IQA A;  3DW0 A;  3MZF A;  4S2M A;  1FR1 A;  1ZG4 A;  1DJA A;  1EI5 A;  1H5X A;  4KZB A;  4NK3 A;  3S1Y A;  4IED A;  1BLC A;  4QU3 A;  5CEB A;  5CXW A;  3C4P A;  3AGE A;  2V1Z A;  4EUZ A;  3SS5 A;  3WS2 A;  4OQ0 A;  1MXO A;  4OP5 A;  3VP3 A;  1GA0 A;  4OON A;  4JXG A;  4KZ3 A;  4WEK A;  1YLW A;  5E43 A;  4Q8I A;  5FAP A;  1PWG A;  2V20 A;  3EQV A;  3CZD A;  4OP8 A;  1BTL A;  3LCE A;  4UAA A;  5DF8 A;  5D3O A;  4WM9 A;  2Y2O A;  3O86 A;  1K6R A;  4E3N A;  5F82 A;  4S2N C;  3G31 A;  1G68 A;  1XX2 A;  3HLC A;  4HBT A;  4ZDX A;  3A3J A;  3M6H A;  1E3U D;  2BG1 A;  4EBP A;  1GHP A;  3GRJ A;  5HAP A;  3NBL A;  2XH9 A;  3BM6 A;  5FQK A;  5HFO A;  1CI8 A;  5F1G A;  3MFD A;  1LHY A;  1NYM A;  3BLM A;  2ZC3 B;  5CHJ A;  3SOI A;  1AXB A;  4R0Q A;  4P87 A;  1VM1 A;  4Y7P A;  4E3O A;  2WAD A;  2Y2G A;  4QD4 A;  1PZO A;  2Z2M B;  3PBQ A;  2WUQ A;  2XLN A;  3PBT A;  3QHY A;  4LV3 A;  1L0E A;  4KZ6 A;  1RGZ A;  2ZQ9 A;  1Y54 A;  4OPQ A;  2ZC6 B;  2FFY A;  4E3J A;  1MWT A;  3N4I A;  5FAO A;  4DE0 A;  4FD8 A;  3ZDJ A;  1W8Q A;  2H0T A;  3IH9 A;  5M19 A;  4KZ9 A;  3ZNY A;  4S2J A;  5CGS A;  3WRT A;  2WZX A;  1ES2 A;  1K6S A;  1SCW A;  5HW3 A;  3O87 A;  4HES A;  4M3K A;  1O07 A;  3PTE A;  1TVF A;  5G18 A;  2Y2N A;  3BLS A;  4C6Y A;  1JWZ A;  4JLF A;  2ZQD A;  3G34 A;  4LV1 A;  3UN7 A;  4Y0O A;  2Y4A A;  3AGD A;  5CRF A;  5KZH A;  3MZE A;  1XKZ A;  1NRF A;  1CEF A;  1OME A;  1YQS A;  3HUO A;  4E3M A;  3FZC A;  4S2K A;  5GLD A;  1IYP A;  1ES5 A;  1PI5 A;  1PIO A;  4ID4 A;  4LEN A;  3W4O A;  1GHM A;  1K57 C;  2OV5 A;  3V50 A;  2B5R A;  1E4D A;  2EFX A;  3N8R A;  3N8L A;  2ZJ9 A;  3I7J A;  4WMC D;  1S0W A;  2DCF A;  5EEC A;  3GR2 A;  4JXW A;  3N7W A;  2WAE A;  1IEM A;  1WYC A;  1M6K A;  1NXY A;  1BSG A;  2EFU A;  4BL2 A;  4K0X A;  2EX2 A;  3OCL A;  4WZ5 A;  3VFH A;  4E3I A;  1W8Y A;  4R4S A;  1K25 A;  3UE3 A;  3WWX A;  1Q2Q A;  3LO7 A;  4HEF A;  4OPY A;  5F83 A;  1KDW A;  2HPB A;  5GL9 A;  2RL3 A;  4OQG A;  4R3J A;  3Q82 A;  5AQB A;  4ZJ1 A;  5DF7 A;  3PBS A;  2P9V A;  1N9B A;  1PWD A;  2HDS A;  2J9P A;  4KZ5 A;  4U0X A;  1K55 C;  5FI2 A;  2PU4 A;  1IYO A;  3NC8 A;  3UE0 A;  3PAG A;  4X53 A;  4A5R A;  3C7V A;  4GZB A;  5FDH A;  5EOO A;  2OLU A;  1XGJ A;  4JF6 A;  1GA9 A;  2WGW B;  3VMA A;  2CC1 A;  3HUM A;  3WRZ A;  2J9O A;  4DKI A;  4FH4 A;  4X6T A;  3M2J A;  2IWC A;  3RXX A;  3ZG7 B;  5TFQ A;  5EVI D;  3GVB A;  3Q7Z A;  3UPN A;  4OPZ A;  5EUA A;  1DY6 A;  1FCO A;  2ZM8 A;  4MEZ A;  3HLG A;  3TOI A;  3VFF A;  5F1F A;  5KSH A;  3BFE A;  3IHA A;  2OSU A;  1ERQ A;  4GNU A;  5AQA A;  4UA9 A;  4DDS A;  3BYD A;  3P09 A;  4OLD A;  5GLC A;  3DWZ A;  4PM5 A;  2ZM0 A;  1CI9 A;  5FAS A;  1LI9 A;  3UPO A;  4OOM A;  4ZBE A;  2ZQ8 A;  2XF3 A;  2DNS A;  4GDN A;  4OKP A;  1LL9 A;  5CTM A;  4R23 A;  3UDX A;  2A3U A;  1JTG A;  1L0G A;  4EBN A;  4R3B A;  3RXW A;  4WEL A;  1BLP A;  1ESU A;  4K0W A;  4CPK A;  4E3L A;  3V3S A;  3W4P A;  1EWZ A;  1MBL A;  3HLD A;  5IHV A;  4K91 A;  3HLF A;  3ITB A;  1IYS A;  1KGF A;  3QNB A;  3Q7V B;  1RP5 A;  3G2Y A;  3WS4 A;  3UPP A;  1PWC A;  3BFD A;  3SH8 A;  3V5M A;  4WYY A;  1E3U A;  4N1H A;  3O3V A;  2A49 A;  2PBY A;  4JF4 A;  5DTK A;  3VP4 A;  3GV9 A;  3NIA A;  1GCE A;  2P9V B;  4EV4 A;  3IXH A;  1K54 A;  4KG5 A;  3CG5 A;  1XA1 A;  4R1G A;  2HP5 A;  3ZVT A;  1KE3 A;  4B88 A;  1FCN A;  4LV0 A;  4R4R A;  3G30 A;  4YIN A;  4BLM A;  2XR0 A;  2ZC5 B;  1PW1 A;  5EE8 A;  5HAI A;  2Y2M A;  3QNC A;  3VP0 A;  1I2W A;  2X71 A;  4PMA A;  1ALQ A;  2I72 A;  3A3F A;  3ISG A;  3ITA A;  2WZZ A;  1KE0 A;  4PM8 A;  2Q9N A;  5A91 A;  1ZG6 A;  2EXB A;  4Z9Q A;  4LV2 A;  3VOZ A;  2Y2L A;  1QME A;  4E6X A;  1ES3 A;  2XDM A;  1K56 D;  3IXD A;  3OPR A;  3PBR A;  4OOY A;  4WZ5 C;  1SDN A;  4X56 A;  3BFC A;  1NJ4 A;  1HD8 A;  1MPL A;  3DTM A;  4O7D A;  5FI6 A;  4C75 A;  4FH2 A;  4RA7 A;  3C4O A;  1L0D A;  1K4E A;  3TG9 A;  3ZCZ A;  1YLZ A;  4P0M A;  4XXR A;  5EVL A;  2JBF A;  1L2S A;  4EWF A;  3GQZ A;  1SKF A;  1LL5 A;  1GHI A;  1K4F A;  1SDE A;  1YMX A;  2WGI A;  1DJC A;  4MBK A;  2ZLY A;  3A3I A;  1KGG A;  1CEG A;  5CHM A;  3MKE A;  4DXB A;  1FSW A;  1ONH A;  3G2Z A;  3VSK A;  3VOY A;  4L0L A;  3VP2 A;  4WMC A;  4N1X A;  2Y2J A;  3MXS A;  4X69 A;  5GHX A;  5I94 A;  2ZQA A;  5CGX A;  3NCK A;  2EXA A;  4QHC A;  2XD5 A;  2H5S A;  5AQ9 A;  3IXB A;  1YLP A;  4IVK A;  3OPH A;  1BUE A;  1HZO A;  1YM1 A;  4PPR A;  1KE4 A;  2QZ6 A;  4MBF A;  1ONG A;  1ERM A;  2X01 A;  1BT5 A;  3N8S A;  5CER A;  1PI4 A;  4RYE A;  4GB7 A;  5CED A;  5KMW A;  4BQM A;  3MZD A;  3E2L A;  3PBN A;  4QY5 A;  2Y91 A;  2ZC7 A;  4IBX A;  1L0F A;  2IWB A;  2WAF A;  5HX9 A;  4QJG A;  3EQU A;  2C5W B;  4PM6 A;  3IH8 A;  5TR7 A;  1XGI A;  3E2K A;  5FSR A;  1O7E A;  3N6I A;  2Y55 A;  1HVB A;  3Q07 A;  1KDS A;  3SS4 A;  4JF5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...