3FYZA

Oxa-24 beta-lactamase complex with sa4-17 inhibitor
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
244
structure length
243
Chain Sequence
HISSQQHEKAIKSYFDEAQTQGVIIIKEGKNLSTYGNALARANKEYVPASTFMLNALIGLENHKATTNEIFKWDGKKRTYPMWEKDMTLGEAMALSAVPVYQELARRTGLELMQKEVKRVNFGNTNIGTQVDNFWLVGPLKITPVQEVNFADDLAHNRLPFKLETQEEVKKMLLIKEVNGSKIYAKSGWGMGVTPQVGWLTGWVEQANGKKIPFSLNLEMKEGMSGSIRNEITYKSLENLGII
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase OXA-24
publication title Design, synthesis, and crystal structures of 6-alkylidene-2'-substituted penicillanic acid sulfones as potent inhibitors of Acinetobacter baumannii OXA-24 carbapenemase.
pubmed doi rcsb
source organism Acinetobacter baumannii
molecule tags Hydrolase
total genus 81
structure length 243
sequence length 244
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2009-01-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3fyzA00
1I5QA 4UAAA 3IWIA 1CI9A 3BEBA 4K0XA 4RA7A 1YLTA 3N7WA 4S2JA 5FAQA 2C5WB 1ES3A 3M2JA 1L2SA 4F94A 3OPRA 2HDRA 4EUZA 4EV4A 1BUEA 4OPQA 4OPYA 2EFXA 4OLDA 5AQ9A 3ZG7B 3G30A 1NY0A 1S6RA 2JCHA 3O88A 3C7VA 2Y2HA 3IXDA 5EOOA 3AGEA 2WKEA 2Z2MB 3HUMA 5CTNA 3G4PA 2B5RA 2EX9A 2E8IA 2VGJA 4JBFA 1YLPA 5FAPA 3ZG5A 3ZNYA 1GHMA 3CG5A 4CJNA 1BLSA 4R0QA 1MXOA 2XR0A 4DKIA 4P6BA 5EVLA 2ZM8A 4MBHA 3ZG8B 5CECA 1O07A 1XX2A 1YMSA 1YLZA 5TFQA 1I2SA 1LLBA 1IYSA 2Y2GA 3M6HA 5CHMA 4JF6A 1PWCA 4WEKA 3ZFZA 1PI4A 4GD6A 2PU2A 1G68A 3UY6A 5DF7A 2V1ZA 3BLSA 4Y0UA 2OLUA 1XKZA 3EQVA 1LL9A 1G6AA 1K6SA 2WYXA 5F83A 4UA9A 2H5SA 4JXVA 4BQMA 3PTEA 3HLGA 4E6WA 5CGSA 3TG9A 5D3OA 1Z6FA 3MZFA 4GB7A 2Y2PA 3G31A 4N1HA 5DTTA 4PM8A 5E2FA 5GHZA 2Y2NA 3PBQA 3HLEA 2R9XA 3UPNA 5HAPA 4K0WA 2XFTA 4BD0A 5BOHA 3IF6C 1CI8A 3IXGA 5GL9A 3ZCZA 3PBOA 3OZHA 1DY6A 3QNCA 5M18A 4MEZA 3ZVWA 4BLMA 4KG2A 4FH4A 1I2WA 1LL5A 1E3UD 3BFCA 3A3IA 4DDSA 2ZQ9A 4X56A 4WMCD 3VOZA 1CK3A 4EBNA 4PM5A 3C7UA 5FA7A 4L0LA 3QHYA 3IF6A 3DWKA 1LHYA 4DE0A 2WUQA 2G2WA 2HP6A 2IWDA 4N9LA 3NIAA 1MWRA 1YLWA 3ITBA 4GDNA 4UHUA 4XUXA 4BL2A 5HW3A 3OPPA 4EBLA 4OQHA 1ZG4A 3PBRA 5FI6A 4OP5A 4QY5A 3TOIA 3V3RA 4N92A 3MZDA 1KE4A 2ZQ7A 1FR1A 1KDWA 2Q9MA 3BFDA 4ID4A 1ONHA 1GA0A 1KVLA 3E2LA 3A3DA 2FFYA 3N4IA 2I72A 3V5MA 1IELA 1YMXA 3TSGA 4R1GA 4C6YA 3ZGAB 3FV7A 3FKWA 1Q2PA 1CEFA 4B88A 2IWBA 3W8KA 3SH9A 2FFFB 3WRZA 4GKUA 4DE1A 2IWCA 5E2EA 5FAOA 1W5DA 3BLMA 3PBNA 3WRTA 4E3JA 4BD1A 3Q7ZA 4JF4A 2WKIA 1BZAA 3RXWA 1E25A 2EX2A 4E3KA 1DJBA 3C4PA 5DVAA 4Z9QA 3OCNA 1XPBA 2WAFA 5GLBA 1TEMA 3A3JA 1ERMA 4E3IA 3SH8A 4UA7A 1FCMA 2ZMAA 5IHVA 4ZDXA 3UE3A 5A90A 3LO7A 1KDSA 1BSGA 3LEZA 1IYOA 2P9VB 2J9OA 2RL3A 4ZAMA 5CRFA 3E2KA 5CERA 1NXYA 2A3UA 4WBGA 3HLBA 4EBPA 3HUOA 2QPNA 3V3SA 4YINA 1QMFA 5AQBA 3P09A 2WGVA 3MKEA 2Y2OA 3NI9A 3FWLA 5EPHA 4ZTKA 4JKTA 3VSLA 3UPOA 3NY4A 1K4FA 4LCLA 3G35A 1KGEA 3RXXA 3A3FA 5KSHA 4EQIA 4P0MA 5DF9A 5FI7A 4DE2A 3O86A 2ZC3B 2J7VA 4R4SA 4QU3A 4S2PA 2P9VA 3MFDA 1ZC2A 4KG6A 4LV2A 3MZEA 2XQZA 3IQAA 4OQ0A 4KZ9A 3N8LA 1KVMA 5EE8A 3UE0A 3WS0A 1WYCA 3SH7A 1K56D 1QMEA 4ZJ1A 4R3JA 3I7JA 1ERQA 4KQOA 5CGXA 4BL3A 1NRFA 3G2YA 1VM1A 3MXRA 4S2LA 3LY4A 5DTKA 3PBSA 4S2NC 1J9MA 5J8XA 3Q81A 3LCEA 1PZPA 5EVIB 5F82A 4DF6A 2JBFA 3SS5A 2R9WA 3OC2A 2UWXA 4D2OA 4OKPA 5JYOA 3VOYA 3NBLA 3OCLA 4GN2A 5FSRA 3WS4A 4C75A 3WS1A 3BFEA 1E3UA 4S2NA 3HLDA 4P87A 5GLDA 2BLSA 4WMCA 3D4FA 1FCNA 2OSUA 3FKVA 4Y0OA 3OPLA 4FH2A 4E6XA 1MKIA 1IYQA 5HAQA 4JF5A 3NDGA 4DRTA 4HBUA 4KZAA 3HUNA 4U3TA 1ES2A 5GHYA 1FCOA 4KZ8A 4ZJ3A 4KZ7A 5GLAA 4Y7PA 2X02A 1HZOA 4CPKA 1IYPA 2ZJ9A 4KZ3A 1M6KA 3W4PA 1KE3A 3G2ZA 1ALQA 3VSKA 1IKIA 4WZ5C 1EWZA 2ZC6B 3GMWA 4QY6A 5E43A 4FCFA 5CHUA 3IHBA 3BFGA 4WZ4A 2Y59A 2HPBA 2X71A 4X55A 1LI0A 3UN7A 4PPRA 1K55A 3ZG9B 5GLCA 3IXHA 3BM6A 5KMWA 3OPHA 1SDNA 1XA7A 5EVID 4OP8A 1NYYA 3IH9A 4QJGA 2H0YA 3IF5A 4WZ5A 4KZBA 3IT9A 1MWTA 1H8ZA 4U0XA 4C3QA 2EX6A 4E3OA 2VGKA 4FD8A 1JVJA 1JWPA 2X01A 1NZUA 1RGYA 2Y55A 4S2OA 1L0DA 2C6WB 1HVBA 2HP5A 3AGDA 1NYMA 3BYDA 4B4ZA 4U0TA 3C5AA 3VFHA 3VP3A 4GOGA 1TVFA 2CC1A 1L0EA 4LENA 3VP0A 3HLCA 5FQ9A 5CHJA 2Y2KA 3NCKA 2ZD8A 4O7DA 4LCMA 3G32A 1PW1A 2J8YA 5HL1A 4Y0TA 1XGIA 2HP9A 4OVDA 5FATA 4E3NA 2QMIA 1BT5A 3UDIA 5HFOA 1TDLA 1S0WA 1DJAA 1FQGA 4IVIA 4IVKA 3UE1A 1L0GA 3ZHHA 1EI5A 3IWQA 4JXSA 4S2IA 2XD5A 4RX3A 2JE5A 5A91A 1ZG6A 3M2KA 4JLFA 3HLWA 4JXWA 4OQIA 4GZBA 4OQGA 4PM6A 4OOLA 3VP4A 1WYBA 2JC7A 1YLYA 1K54C 1Q2QA 1SKFA 4A5RA 2Y2JA 4OPZA 4WEJA 2WGIA 3ITAA 5CXWA 2ZC7A 1Y54A 3EQUA 4B4XA 2XF3A 4KZ6A 3LY3A 3FYZA 3A3EA 1GCEA 3M6BA 1E4DA 3Q7VB 4E3MA 2ZQDA 4X68A 5G18A 3SOIA 3ZG0A 2OV5A 5M19A 1HTZA 4HEFA 4IBXA 1FSWA 1K54A 2Y2LA 1GHPA 1W8YA 4PM9A 3G34A 1JTGA 2Y4AA 1MBLA 1OMEA 1SHVA 3SS3A 2V2FF 1K38A 2ZLYA 4WYYA 1TDGA 3GVBA 1PZOA 4M3KA 3IH8A 4P85A 1W7FA 3N8SA 1K56A 3GR2A 4EWFA 1KE0A 3VFFA 1YLJA 5I94A 4PM7A 1FSYA 3IHAA 4MBKA 4KQRA 2H0TA 4FSFA 4X6TA 3VP1A 2EX8A 1PYYA 3FZCA 4OOMA 5DF8A 3W4OA 2Y91A 5EOEA 2ZC5B 2Q9NA 4WM9A 3UNWA 3QNBA 4GD8A 1NZOA 2BG1A 5KSCA 1ESIA 4MNRA 4ZJ2A 1W79A 1VQQA 1PI5A 4IBRA 3ZNTA 4BENA 4JPMA 1H8YA 4MBFA 1BLPA 3WS2A 5KZHA 4OONA 2J9PA 1BLHA 3JYIA 3Q07A 4OOYA 3N6IA 5EUAA 5F1GA 3UO9A 1FR6A 2EXBA 2Y2IA 2WK0A 3HVFA 1RGZA 4QD4A 3DTMA 3MBZA 5EVIC 3VMAA 2ZQCA 3O3VA 3DWZA 3PAEA 4NK3A 4BJPA 2V20A 1JWVA 3GRJA 2DNSA 1JTDA 1C3BA 4RVAA 3W4QA 4GDBA 4KZ5A 5FQJA 1M40A 1LI9A 3GQZA 4DXBA 4XXRA 3S4XA 1RP5A 3IWOA 5FQQA 5M1AA 3S22A 4OPRA 4KQQA 5EVIA 1K55C 1DJCA 3Q82A 5CEDA 1SDEA 1BTLA 4NETA 5HX9A 4KZ4A 5TR7A 2HDSA 3C4OA 2QZ6A 1K57C 1XXMA 2H10A 2WKHA 1KGGA 4IEDA 1PWGA 3UPPA 1KGFA 2WADA 2XFSA 3VP2A 2ZM0A 4JXGA 5L2FA 5AQ7A 2PBYA 4MLLA 3HL9A 1ZKJA 3Q1FA 2XLNA 3DW0A 3V50A 1L0FA 3CMZA 3BFFA 3NC8A 4LV1A 4X53A 4RYEA 2HDUA 5FQIA 1W8QA 3IF6B 4E3LA 3GTCA 4DXCA 3PAGA 1K57A 1AXBA 1N9BA 3V39A 1XP4A 5EECA 2GDNA 3RJUA 2HDQA 4KG5A 5JYPA 2Z2LB 2P74A 1GA9A 2WZZA 3MKFA 4LV0A 4LV3A 4KENB 5U47A 5F1FA 4ZBEA 1NJ4A 1H5XA 4WELA 1GHIA 1RCJA 5A92A 5FDHA 3N8RA 4DE3A 2ZM2A 3HLFA 4UA6A 1K4EA 1ESUA 1U60A 3CZDA 5AQAA 2XD1A 4OLGA 1MY8A 2ZQ8A 2XH9A 4R4RA 4GNUA 1N4OA 1K25A 1ONGA 3O87A 3ISGA 5TGFA 4YFMA 5FQMA 1MPLA 3WWXA 3HREA 2ZQAA 1BLCA 3B3XA 5HAIA 4S2MA 5CGWA 5FASA 2EXAA 4DDYA 2PU4A 3BRMA 3ZDJA 2WAEA 4HESA 2XGNA 3PBTA 1ES5A 1YM1A 5DTSA 1XA1A 4QHCA 1PWDA 1PW8A 1SCWA 2DCFA 4QB8A 5FQKA 5GHXA 5CEBA 4H8RA 3GV9A 2A49A 2WGWB 2XEPA 5FI2A 1PIOA 2XK1A 1O7EA 3BECA 1MWUA 4S2KA 3UDXA 2DRWA 2ZC4B 1ES4A 4X69A 2Y2QA 1IEMA 2WZXA 3SS4A 1YQSA 3UDFA 2RCXA 3IXBA 1HD8A 3P98A 2EFUA 5A93A 1XGJA 5CTMA 1MWSA 4K91A 1WE4A 4PMAA 2OLVA 2G2UA 3ZVTA 1K6RA 3NDEA 4N1XA 1YT4A 3HBRA 1EROA 2WGWA 4N9KA 4R23A 5HARA 1CEGA 4Q8IA 3WS5A 4RX2A 4XUZA 4HBTA 5E2GA 2Y2MA 3GSGA 3MXSA 4OH0A 3S1YA 3CJMA 1BULA 1IKGA 1FOFA 1JWZA 3Q7VA 3AGFA 2XDMA 5E2HA 4R3BA
chains in the Genus database with same CATH superfamily
3IWIA 3BEBA 3U4LP 1ES3A 3KSGA 2HDRA 1BUEA 2KOIA 1NY0A 1S6RA 3IXDA 4PAUA 2WKEA 2ZL1A 2Z2MB 1LT0A 3D72A 1TS0A 5FAPA 5DJUA 2PHYA 2P08A 3CG5A 1BLSA 1MXOA 3ZG8B 5TFQA 3QP1A 1I2SA 3A0VA 1WA9A 2O9BA 3UY6A 1DP9A 3VE4A 4Y0UA 3SZTA 3EQVA 1G6AA 1K6SA 2WYXA 1PNEA 1XFNA 3FG8A 5CGSA 1T19A 1Z6FA 3LIEA 4EUVA 2Y2PA 2CMNA 3G31A 5AVEA 1IOUA 3PBQA 3UPNA 1OTBA 5IU1A 2GNXA 1T1AA 4FH4A 1E3UD 3A3IA 4WMCD 1CK3A 4L0LA 3DAVA 3IF6A 2WUQA 2HP6A 4NG2A 2A2LA 4UHUA 4XUXA 5HW3A 4GW9A 3PBRA 4II7A 4OP5A 3V3RA 5HD5A 2Q9MA 3BFDA 4ID4A 1KVLA 3IX4A 3T1RA 2P04A 5HD3A 3V5MA 2BTFP 1IELA 1YMXA 4CLCD 3TSGA 4R1GA 4C6YA 1F9IA 1N9NA 3SH9A 4DE1A 2HGVA 5E2EA 3PBNA 2MJ6A 3Q7ZA 3RXWA 1E25A 3C4PA 1LSVA 4Z9QA 4NKPA 1TEMA 4E3IA 4UA7A 3HCYA 3LEZA 2P9VB 5CERA 3D3OA 3MS6A 4WBGA 4EBPA 3V3SA 3VSLA 1K4FA 3G35A 1KGEA 5KSHA 4P0MA 5DF9A 3KSFA 4QPRA 1MKMA 2J7VA 4WLAA 4R4SA 4D60A 1ZC2A 4KG6A 3MZEA 2XQZA 4OQ0A 3UE6A 1TD5A 3SH7A 3I7JA 1ERQA 5CGXA 1CQAA 2PDRA 5DTKA 4S2NC 3T4OA 2QJ7A 3F1PB 5F82A 3FPWA 4DF6A 2JBFA 3SS5A 2UWXA 3T12B 2HZ5A 3WS4A 3DTKA 3HLDA 3D4FA 1FCNA 2OSUA 1PRQA 4GHIB 4Y3IA 4U3TA 4KZ7A 4Y7PA 4I3JA 1IYPA 1ALQA 3F1NB 2JKTI 4CLCE 4WZ4A 2Y59A 2HPBA 2X71A 4X55A 4I3IA 3UN7A 4PPRA 1K55A 5GLCA 3OPHA 4JGPA 1XA7A 4LRXC 2INWA 4EESA 2EX6A 1JVJA 2Y79A 1NZUA 4S2OA 5FEGA 4KQDA 4U0TA 2D01A 1DP6A 1TVFA 3C38A 4GOGA 1L0EA 4LENA 5FQ9A 5CHJA 5EM1A 4OVDA 5FATA 3UDIA 4HNBA 5HFOA 2KLIA 1S0WA 4IVIA 4IVKA 3UE1A 2H28A 4S2IA 4JGRA 3M2KA 3H82A 5AVFA 4GZBA 5G4YA 4DMZA 2JC7A 1YLYA 1Q2QA 4WEJA 2ZC7A 3EQUA 4KZ6A 3FYZA 3M6BA 3Q7VB 4E3MA 2ZQDA 3SOIA 3RTYA 2Y2LA 1GHPA 3F1OB 1NRJA 1MBLA 1SHVA 2V2FF 1TDGA 4P85A 1N9OA 1K56A 3GR2A 4EWFA 4PM7A 1FSYA 1VB6A 3FZCA 2Y91A 5EOEA 4WM9A 1YAXA 3IX8A 5I5LA 3UNWA 3QNBA 4UEYA 5KSCA 5KIZA 4ZJ2A 1VQQA 2VEAA 4JPMA 1BLPA 4GS9B 4OONA 2VA0A 4OOYA 3N6IA 4P6ZS 4MN7A 4AFIA 3KYZA 1S66L 2Y2IA 4NXGA 4QD4A 3QP8A 3T1QB 4HH2A 3PAEA 2DNSA 1C3BA 5FQJA 2ZMFA 1YSQA 1DJCA 4HIAA 4NETA 1K57C 1KGGA 4ARZA 2ZOIA 4KUKA 4Y15A 3V50A 3CMZA 4LV1A 3NC8A 4X53A 4RYEA 2HDUA 1CJFA 4YOFA 1J3WA 3TE8A 3LUQA 4HY8A 5EECA 3MQ0A 1GSWA 3RJUA 1Z09A 5JYPA 2Z2LB 2P74A 1GA9A 1TS8A 1W63M 3HLFA 1K4EA 4HOIA 2XD1A 3BW6A 2ZQ8A 2AVXA 2XH9A 4R4RA 2Y8HA 5J3WA 1NWZA 3LYXA 4Y13A 3B3XA 5HAIA 2PU4A 3LI9A 3MQQA 1YM1A 4QHCA 1PWDA 1K0KA 3K2NA 4O01A 5FQKA 5GHXA 5CEBA 1PIOA 5CX7A 2DRWA 2ZC4B 4JGQA 2Y2QA 1IEMA 2IA2A 1YQSA 2LB5A 1XGJA 1VEUB 4K91A 3S7PA 4R38A 4X1MA 1OTDA 4Y2FA 4DN0A 5MC7A 5HARA 3KSIA 3WS5A 2QKPA 2Y2MA 3S1YA 3CJMA 1BULA 1IKGA 1JWZA 1P97A 2ZOHA 1OT6A 2XDMA 3R7WA 3S7NA 2JKRM 1I5QA 4EETB 4UAAA 1CI9A 1S4SA 3HJIA 2M7VA 3BQ8A 2C5WB 1L2SA 4EV4A 4FOFA 4I3AA 3O88A 2Y2HA 3FPVA 3AGEA 2EX9A 2VGJA 3IS2A 3ZNYA 1GHMA 4G3KA 3BQAA 5EVLA 5CECA 1YLZA 1XX2A 1STZA 5DKKA 2Y2GA 5CHMA 4WEKA 5DKLA 2PU2A 1P0ZA 2QHKA 1X0OA 2V1ZA 2OLUA 1XKZA 4HQAA 1LL9A 1XJ4A 5F83A 3P01A 4JXVA 4BQMA 3KYEA 4BMWA 4E6WA 3H7WA 1TF1A 3OBFA 4N1HA 5E2FA 2Y2NA 3TJZC 2R9XA 5BOHA 3MMHA 5GL9A 3PBOA 1DY6A 3QNCA 3GDIA 5M18A 1LL5A 4DDSA 2ZQ9A 3VOZA 4PM5A 3S7OA 3C7UA 4LRZE 5FA7A 3QHYA 3E4PA 3B42A 4DE0A 2G2WA 4HJ3A 1L3LA 4N9LA 1YLWA 4BL2A 3DTIA 3OPPA 3H9WA 4OQHA 3MZDA 1ONHA 3E2LA 2L4RA 3CWFA 1YKDA 1OPXA 4EERA 5HSQA 3EWKA 2O99A 4B93A 3ZGAB 1Q2PA 1CEFA 4GKUA 5TJJA 5FAOA 4BD1A 4JF4A 3NOTC 4H6JB 1F5MA 2DMWA 2W3HA 2GZAA 4F3LA 1JNUA 5GLBA 4X25A 4PKYG 1FIKA 1FCMA 2ZMAA 5IHVA 5HDDA 4ETZA 3UE3A 5A90A 3E4OA 3LO7A 1BSGA 3UMEA 4WL9A 2PD7A 2RL3A 3E2KA 3T4TA 2A3UA 3HLBA 3CAXA 5TBMA 1QMFA 3P09A 2WGVA 3FWLA 2B18A 5EPHA 4Y17A 2G7UA 3EEHA 1BYWA 2K31A 3UB6A 4QU3A 2VV7A 2P9VA 3MFDA 3NULA 3IQAA 4KZ9A 2HF6A 5L07A 4BL3A 2M7UA 3B33A 1VM1A 3MXRA 3TW8A 3PBSA 5J8XA 3LCEA 2R9WA 4D2OA 2PAVP 3WS1A 3BFEA 3DTEA 4Y0OA 4FH2A 1MKIA 1IYQA 4DRTA 4HBUA 4KZAA 3HUNA 4ZJ3A 4KZ8A 4CLCB 2ZJ9A 3T4SA 1M6KA 4R3AA 4NXFA 4QY6A 4FCFA 3CPTB 1MZUA 3ZG9B 2XA7M 4GHIA 3BM6A 1SDNA 2W0NA 3IF5A 4WZ5A 3T4LA 3UB7A 4C3QA 2VGKA 1JWPA 1FILA 2C6WB 2HP5A 3AGDA 4EXOA 3C5AA 3VFHA 3VP0A 3JVUA 1W63Q 2W27A 4X1LA 2ZD8A 5L8MA 4Y0TA 1XGIA 4UQIM 2WKRA 2L0WA 1DJAA 3IWQA 2R78A 2XD5A 5K5BA 1XFQA 3HLWA 3VP4A 1WYBA 2Y2JA 3ITAA 3VOLA 1YPRA 3A3EA 1GCEA 1UWPX 1E4DA 3O5YA 5G18A 3ZG0A 2OV5A 1K54A 4CQHA 2OWJA 3CITA 2Y4AA 1OMEA 3ULFA 4WYYA 3GVBA 1PZOA 4M3KA 1W7FA 3N8SA 1LL8A 5I94A 4MBKA 4KQRA 4FSFA 2VGLS 4OOMA 2BG1A 3C30A 4HHDA 1PI5A 1H8YA 3WS2A 2J9PA 3JYIA 2B02A 3HVFA 3O3VA 4BJPA 3LEQA 4RVAA 2XRNA 4DXBA 4KZ5A 2EWVA 3GQZA 4GS9A 1RP5A 4LRYC 4OPRA 5EVIA 3PHYA 5TR7A 2QZ6A 5A8BA 1XXMA 2H10A 2WKHA 1KGFA 4CLCC 4Q0IA 3VP2A 4JXGA 1H3QA 1T1BA 4MLLA 1ZKJA 3DW0A 2HV1A 1W8QA 3IF6B 3K3CA 3PAGA 1XP4A 2GDNA 1LSXA 3MKFA 4LV3A 5U47A 1NJ4A 4WELA 5FDHA 2ZM2A 4UA6A 5DFYA 1TS6A 5AQAA 4ETXA 5J4EA 3RFBA 1ONGA 3O87A 5FQMA 3WWXA 2ZQAA 2EXAA 3BRMA 3ZDJA 2XGNA 3PBTA 1ES5A 2O9CA 5DTSA 1XA1A 2DCFA 4H8RA 3GV9A 2WGWB 5FI2A 2XK1A 1O7EA 2YKHA 3BECA 1MWUA 4HI4A 3LR3A 4X69A 2WZXA 3UDFA 2VLGA 3IXBA 3MJQA 3LIAA 2EFUA 5A93A 1WE4A 4PMAA 3ZVTA 3VE3A 5EM0A 4N1XA 1YT4A 4R23A 1CEGA 4RX2A 2D02A 1D06A 4OH0A 2P7JA 1FOFA 3AGFA 5E2HA 3FC7A 1VEUA 2PD8A 3K3DA 3N7WA 1DRMA 4G3WA 3OPRA 4EUZA 4OPYA 4OPQA 1ODVA 3T4KA 3ZG7B 3G6OA 2JCHA 4WN5A 5EOOA 3ZQ5A 5HPIA 3HUMA 3G4PA 2B5RA 4JBFA 1YLPA 3ZG5A 4CJNA 4DKIA 2ZM8A 1O07A 1YMSA 1F2KA 2QWSA 3M6HA 3GECA 1Y28A 1S4RA 1V9YA 4I5SA 2E8JA 4UA9A 3HLGA 3TG9A 3VV4A 1OTIA 2A24A 3CHWP 3MZFA 4GB7A 4HP9A 5GHZA 2PRFA 3BY8A 4XT2A 1Y4OA 4K0WA 2XFTA 3IF6C 1CI8A 3OZHA 4NXBA 4BLMA 2VJWA 4KG2A 5LBRA 4BWIA 2VX8A 1UGUA 3BFCA 1P9WA 4X56A 4EBNA 2EA9A 2VV8A 3DWKA 1LHYA 3LI8A 2IWDA 3NIAA 4ZRRA 2VZWA 4GDNA 1G6OA 3CUEC 4EBLA 4QY5A 3NOUC 1FR1A 1XJ6A 2FFYA 3QP5A 1XJ2A 2OWHA 3SW1A 1VETA 4O8GA 3PYPA 3FV7A 3IX3A 3LICA 3FKWA 3MFXA 2YKFA 3WRZA 4GLQA 2IWCA 3BLMA 4K08A 4I39A 3WRTA 3KO6A 2FH5A 1BZAA 4E3KA 2V1AA 2UV0E 3OCNA 4E04A 1XPBA 2WAFA 3A3JA 2O9AA 4M4XA 1ERMA 4JGOA 3SH8A 4ZDXA 3BWLA 3MQOA 1KDSA 1IYOA 5IT5A 5CRFA 4MN5A 5F69A 2ZMVA 4H6JA 1S1YA 3HUOA 2QPNA 4YINA 1ZTUA 2Y2OA 4JKTA 4LCLA 4EQIA 1OJGA 5HWVA 5FI7A 3O86A 5C5KA 4LV2A 3N8LA 1KVMA 3UE0A 1WYCA 1K56D 4ZJ1A 4R3JA 2I9VA 2M1CA 4S2LA 3LY4A 1J9MA 3Q81A 4HJ4A 1PZPA 2OOLA 3RH8B 3OC2A 3EGDC 4L9GA 4OKPA 5JYOA 3VOYA 3NJAA 4ARZB 4GN2A 2VKSA 5FSRA 1S1ZA 1E3UA 4S2NA 5GLDA 4WMCA 3FKVA 4HJ6A 1UWNX 1YSPA 3NDGA 1ES2A 5GHYA 1FCOA 1HZOA 1SKOB 4KZ3A 2OAP1 2PR5A 1IKIA 4MMNA 1EWZA 2ZC6B 3E98A 3IHBA 3BFGA 2EWWA 1CF0A 3ZYTA 4YWZA 4OP8A 4EW7A 4QJGA 2H0YA 2K7SA 4CLCA 3L9KA 4U0XA 4E3OA 3EOIA 4MN6A 3UMDA 1N9LA 2X01A 2V8CA 1RGYA 4RQ9A 2XSSA 1HVBA 4B4ZA 1ACFA 2NUPC 2CC1A 1XJ3A 3KYQA 1G5UA 3CLOA 3P7NA 4LCMA 3G32A 5HL1A 1OTEA 3UB5P 4E3NA 2QMIA 5DFXA 1TDLA 1FQGA 1EI5A 2JE5A 5A91A 4JLFA 4JXWA 4OQIA 4OQGA 2VK3A 1SKFA 5CXWA 5AJGA 2WGIA 1AWIA 1Y54A 5HWWA 3LY3A 3MF0A 4X68A 3C8CA 4QWOA 4HEFA 3LR5A 4PM9A 1W8YA 1MC0A 1JTGA 4Y5FA 2V0WA 3IH8A 3LGOA 1DP8A 3VFFA 1YLJA 2PR6A 2H0TA 4X6TA 1PYYA 3IS2B 2ZC5B 2Q9NA 2JKFA 3IBJA 2W3EA 4GD8A 5EFWA 4MNRA 2JN7A 1W79A 4IBRA 3OOVA 5HPFA 1BLHA 3MXQA 3BY9A 5EUAA 3V67A 1FR6A 1RGZA 3DTMA 2ZQCA 1JWVA 3H7WB 4GDBA 1M40A 1LI9A 4XXRA 3S4XA 5M1AA 2J3WA 3S22A 3F1PA 4KQQA 1SDEA 3NOPC 4KZ4A 2B95A 3C4OA 4IEDA 1PWGA 2LB9A 2ZM0A 5AQ7A 3HL9A 1F98A 1HLUP 1V9ZA 2XLNA 3BFFA 4P6ZM 2V8FA 4DXCA 2QYBA 1K57A 1AXBA 1N9BA 2HDQA 2WZZA 5F1FA 3F1NA 4ZBEA 1H5XA 1GHIA 5L10A 1PFLA 3N8RA 4EU0A 4IHQA 3U2AA 3DBAA 3CZDA 4OLGA 1MY8A 4GNUA 2O0YA 1N4OA 1D7EA 5TGFA 1MPLA 2ACGA 3HREA 3T4QA 1KOUA 4S2MA 5FASA 4DDYA 4GJ4A 2KDKA 1SCWA 4BBTA 2OAQ1 2W1TB 2A49A 3CUEA 2XEPA 2Q0OA 3UDXA 4F3LB 1ES4A 3SS4A 2RCXA 3P98A 5CTMA 1MWSA 1K6RA 4HP4A 4EEPA 4O0PA 3HBRA 1ZHHB 4KUOA 1EROA 2WGWA 4Q8IA 2GJ3A 3OLOA 4XUZA 5TBMB 4HBTA 3MXSA 1IFQA 2ZL1B 3Q7VA 4IUKA 4R3BA 3IBRA 3KSHA 5HWTA 4K0XA 4PKYA 4RA7A 1YLTA 4S2JA 5FAQA 3M2JA 3F1OA 4F94A 4L9EA 5FEFA 2EFXA 4OLDA 5AQ9A 1D1JA 3G30A 3C7VA 2PYPA 3NECA 3LR4A 5CTNA 2PT7A 2E8IA 4NXEA 4R0QA 2XR0A 4P6BA 4MBHA 3EGXC 1LLBA 1IYSA 4JF6A 1PWCA 3MR0A 3ZFZA 1PI4A 4GD6A 1GSVA 5EV0A 1G68A 5DF7A 3T1SA 4PHTA 3BLSA 2H5SA 2W1RA 3PTEA 2ZBBA 5D3OA 4FTXA 4ME4A 5DTTA 4PM8A 5L09A 3E0YA 3HLEA 5HAPA 4BD0A 5HDSA 3IXGA 3ZCZA 1OJ5A 4EQ1A 3R4KA 4MEZA 3ZVWA 2BASA 1I2WA 2JHEA 3CI6A 3MSHA 4IJGA 3T50A 1NLYA 1G28A 4DJ3A 5F5YA 2PBDP 1MWRA 3ITBA 1NLZA 4BBVA 1ZG4A 5FI6A 1GSXA 3TOIA 4N92A 3T4JA 1KE4A 2ZQ7A 1KDWA 3LIFA 1GA0A 3A3DA 3N4IA 1H8MA 2I72A 4GCZA 3T1XA 2HJ9C 4R70A 4B88A 2IWBA 3W8KA 3ICYA 2FFFB 1OT9A 2W3FA 1W5DA 4E3JA 3C2WA 4B9OA 2WKIA 4YNRA 5EVEA 2EX2A 4MCWA 1DJBA 5DVAA 3LFVA 3NHQA 2JKRI 3A0SA 3LIBA 2J9OA 2JKGA 3JVVA 1A0KA 4ZAMA 1NXYA 5AQBA 3MKEA 3NI9A 4ZTKA 3UPOA 3NY4A 3RXXA 3A3FA 5HL6A 2L1MA 4DE2A 2ZC3B 4S2PA 3WS0A 2NUTC 5EE8A 1QMEA 4KQOA 1NRFA 3G2YA 2XA7S 4R6LA 5EVIB 5J7EA 4WUJA 5F68A 4BBUA 3TRCA 5HDCA 2FZ0A 3NBLA 3OCLA 4C75A 5FL3A 4P87A 2BLSA 3OPLA 4E6XA 5HAQA 4JF5A 3B47A 2Z6DA 5GLAA 2X02A 3UB9A 4CPKA 3W4PA 3S7QA 2J3TD 1KE3A 3G2ZA 3VSKA 4UQIS 2JKTM 4WZ5C 3GMWA 5E43A 5CHUA 1LI0A 4G3VA 3IXHA 5KMWA 5EVID 1NYYA 3IH9A 2WKPA 4KZBA 1SKOA 3IT9A 1MWTA 1H8ZA 1SZVA 2GX5A 4FD8A 3D9YA 2Y55A 1L0DA 3BYDA 4FUWA 1NYMA 4MDZA 3VP3A 3H82B 3HLCA 5DJTA 3LIDA 2Y2KA 3NCKA 4O7DA 2Z6CA 3PR6A 1PW1A 2J8YA 3A0RA 2W3DA 2HP9A 1BT5A 4LPZA 1L0GA 3ZHHA 4JXSA 4RX3A 1ZG6A 4PM6A 1K54C 4A5RA 4OPZA 4B4XA 2W3GA 2XF3A 4I38A 3QP6A 2XROA 5M19A 1HTZA 4IBXA 1FSWA 3G34A 3JPUA 4ESPA 3SS3A 1K38A 2ZLYA 4LLOB 2V1BA 1KE0A 4EEUA 3IHAA 3VP1A 2EX8A 3UB8A 5DF8A 3W4OA 1H0MA 4L9FA 4Q0JA 1NZOA 1ESIA 2J3TC 3ZNTA 4BENA 4MBFA 2K2NA 4NEED 3EEAA 5KZHA 2HJEA 3BJNA 3Q07A 5F1GA 3LR0A 3UO9A 2EXBA 2WK0A 5EVIC 3VMAA 3MBZA 2V0UA 4IUHA 3DWZA 4NK3A 2V20A 3GRJA 5IS1A 1JTDA 1P9RA 2A24B 3W4QA 3IWOA 5FQQA 2VV6A 3E4QA 4XT2B 5FDSA 1K55C 2VGLM 3Q82A 5CEDA 1BTLA 5HX9A 4WF0A 2PYRA 2HDSA 3UPPA 5HZHA 2WADA 2XFSA 5L2FA 1EW0A 2PBYA 3Q1FA 3PXPA 1L0FA 5FQIA 4E3LA 3GTCA 3V39A 4KG5A 4LV0A 4KENB 1T18A 1RCJA 3CPTA 5A92A 4DE3A 4LGWA 1ESUA 1U60A 2KX6A 4Z1WA 2WKQA 1VETB 1K25A 3ISGA 3W2ZA 4YFMA 1BLCA 5CGWA 1VHMA 3L7HA 2WAEA 4HESA 3KX0X 1PW8A 1LSWA 4QB8A 1TS7A 2QJ5A 4S2KA 5F6AA 5G4ZA 3R7WB 1HD8A 3QP4A 3HJKA 2OLVA 4LFUA 4HH3A 2G2UA 2V9AA 3NDEA 2J80A 2W1TA 4N9KA 1T1CA 1S67L 4DJ2A 4Q0HA 5E2GA 1OTAA 3GSGA 4OOLA 3QP2A
chains in the Genus database with same CATH topology
1I5QA 4UAAA 3IWIA 1CI9A 3BEBA 4K0XA 4RA7A 1YLTA 3N7WA 4S2JA 5FAQA 2C5WB 1ES3A 3M2JA 1L2SA 4F94A 3OPRA 2HDRA 4EUZA 4EV4A 1BUEA 4OPQA 4OPYA 2EFXA 4OLDA 5AQ9A 3ZG7B 3G30A 1NY0A 1S6RA 2JCHA 3O88A 3C7VA 2Y2HA 3IXDA 5EOOA 3AGEA 2WKEA 2Z2MB 3HUMA 5CTNA 3G4PA 2B5RA 2EX9A 2E8IA 2VGJA 4JBFA 1YLPA 5FAPA 3ZG5A 3ZNYA 1GHMA 3CG5A 4CJNA 1BLSA 4R0QA 1MXOA 2XR0A 4DKIA 4P6BA 5EVLA 2ZM8A 4MBHA 3ZG8B 5CECA 1O07A 1XX2A 1YMSA 1YLZA 5TFQA 1I2SA 1LLBA 1IYSA 2Y2GA 3M6HA 5CHMA 4JF6A 1PWCA 4WEKA 3ZFZA 1PI4A 4GD6A 2PU2A 1G68A 3UY6A 5DF7A 2V1ZA 3BLSA 4Y0UA 2OLUA 1XKZA 3EQVA 1LL9A 1G6AA 1K6SA 2WYXA 5F83A 4UA9A 2H5SA 4JXVA 4BQMA 3PTEA 3HLGA 4E6WA 5CGSA 3TG9A 5D3OA 1Z6FA 3MZFA 4GB7A 2Y2PA 3G31A 4N1HA 5DTTA 4PM8A 5E2FA 5GHZA 2Y2NA 3PBQA 3HLEA 2R9XA 3UPNA 5HAPA 4K0WA 2XFTA 4BD0A 5BOHA 3IF6C 1CI8A 3IXGA 5GL9A 3ZCZA 3PBOA 3OZHA 1DY6A 3QNCA 5M18A 4MEZA 3ZVWA 4BLMA 4KG2A 4FH4A 1I2WA 1LL5A 1E3UD 3BFCA 3A3IA 4DDSA 2ZQ9A 4X56A 4WMCD 3VOZA 1CK3A 4EBNA 4PM5A 3C7UA 5FA7A 4L0LA 3QHYA 3IF6A 3DWKA 1LHYA 4DE0A 2WUQA 2G2WA 2HP6A 2IWDA 4N9LA 3NIAA 1MWRA 1YLWA 3ITBA 4GDNA 4UHUA 4XUXA 4BL2A 5HW3A 3OPPA 4EBLA 4OQHA 1ZG4A 3PBRA 5FI6A 4OP5A 4QY5A 3TOIA 3V3RA 4N92A 3MZDA 1KE4A 2ZQ7A 1FR1A 1KDWA 2Q9MA 3BFDA 4ID4A 1ONHA 1GA0A 1KVLA 3E2LA 3A3DA 2FFYA 3N4IA 2I72A 3V5MA 1IELA 1YMXA 3TSGA 4R1GA 4C6YA 3ZGAB 3FV7A 3FKWA 1Q2PA 1CEFA 4B88A 2IWBA 3W8KA 3SH9A 2FFFB 3WRZA 4GKUA 4DE1A 2IWCA 5E2EA 5FAOA 1W5DA 3BLMA 3PBNA 3WRTA 4E3JA 4BD1A 3Q7ZA 4JF4A 2WKIA 1BZAA 3RXWA 1E25A 2EX2A 4E3KA 1DJBA 3C4PA 5DVAA 4Z9QA 3OCNA 1XPBA 2WAFA 5GLBA 1TEMA 3A3JA 1ERMA 4E3IA 3SH8A 4UA7A 1FCMA 2ZMAA 5IHVA 4ZDXA 3UE3A 5A90A 3LO7A 1KDSA 1BSGA 3LEZA 1IYOA 2P9VB 2J9OA 2RL3A 4ZAMA 5CRFA 3E2KA 5CERA 1NXYA 2A3UA 4WBGA 3HLBA 4EBPA 3HUOA 2QPNA 3V3SA 4YINA 1QMFA 5AQBA 3P09A 2WGVA 3MKEA 2Y2OA 3NI9A 3FWLA 5EPHA 4ZTKA 4JKTA 3VSLA 3UPOA 3NY4A 1K4FA 4LCLA 3G35A 1KGEA 3RXXA 3A3FA 5KSHA 4EQIA 4P0MA 5DF9A 5FI7A 4DE2A 3O86A 2ZC3B 2J7VA 4R4SA 4QU3A 4S2PA 2P9VA 3MFDA 1ZC2A 4KG6A 4LV2A 3MZEA 2XQZA 3IQAA 4OQ0A 4KZ9A 3N8LA 1KVMA 5EE8A 3UE0A 3WS0A 1WYCA 3SH7A 1K56D 1QMEA 4ZJ1A 4R3JA 3I7JA 1ERQA 4KQOA 5CGXA 4BL3A 1NRFA 3G2YA 1VM1A 3MXRA 4S2LA 3LY4A 5DTKA 3PBSA 4S2NC 1J9MA 5J8XA 3Q81A 3LCEA 1PZPA 5EVIB 5F82A 4DF6A 2JBFA 3SS5A 2R9WA 3OC2A 2UWXA 4D2OA 4OKPA 5JYOA 3VOYA 3NBLA 3OCLA 4GN2A 5FSRA 3WS4A 4C75A 3WS1A 3BFEA 1E3UA 4S2NA 3HLDA 4P87A 5GLDA 2BLSA 4WMCA 3D4FA 1FCNA 2OSUA 3FKVA 4Y0OA 3OPLA 4FH2A 4E6XA 1MKIA 1IYQA 5HAQA 4JF5A 3NDGA 4DRTA 4HBUA 4KZAA 3HUNA 4U3TA 1ES2A 5GHYA 1FCOA 4KZ8A 4ZJ3A 4KZ7A 5GLAA 4Y7PA 2X02A 1HZOA 4CPKA 1IYPA 2ZJ9A 4KZ3A 1M6KA 3W4PA 1KE3A 3G2ZA 1ALQA 3VSKA 1IKIA 4WZ5C 1EWZA 2ZC6B 3GMWA 4QY6A 5E43A 4FCFA 5CHUA 3IHBA 3BFGA 4WZ4A 2Y59A 2HPBA 2X71A 4X55A 1LI0A 3UN7A 4PPRA 1K55A 3ZG9B 5GLCA 3IXHA 3BM6A 5KMWA 3OPHA 1SDNA 1XA7A 5EVID 4OP8A 1NYYA 3IH9A 4QJGA 2H0YA 3IF5A 4WZ5A 4KZBA 3IT9A 1MWTA 1H8ZA 4U0XA 4C3QA 2EX6A 4E3OA 2VGKA 4FD8A 1JVJA 1JWPA 2X01A 1NZUA 1RGYA 2Y55A 4S2OA 1L0DA 2C6WB 1HVBA 2HP5A 3AGDA 1NYMA 3BYDA 4B4ZA 4U0TA 3C5AA 3VFHA 3VP3A 4GOGA 1TVFA 2CC1A 1L0EA 4LENA 3VP0A 3HLCA 5FQ9A 5CHJA 2Y2KA 3NCKA 2ZD8A 4O7DA 4LCMA 3G32A 1PW1A 2J8YA 5HL1A 4Y0TA 1XGIA 2HP9A 4OVDA 5FATA 4E3NA 2QMIA 1BT5A 3UDIA 5HFOA 1TDLA 1S0WA 1DJAA 1FQGA 4IVIA 4IVKA 3UE1A 1L0GA 3ZHHA 1EI5A 3IWQA 4JXSA 4S2IA 2XD5A 4RX3A 2JE5A 5A91A 1ZG6A 3M2KA 4JLFA 3HLWA 4JXWA 4OQIA 4GZBA 4OQGA 4PM6A 4OOLA 3VP4A 1WYBA 2JC7A 1YLYA 1K54C 1Q2QA 1SKFA 4A5RA 2Y2JA 4OPZA 4WEJA 2WGIA 3ITAA 5CXWA 2ZC7A 1Y54A 3EQUA 4B4XA 2XF3A 4KZ6A 3LY3A 3FYZA 3A3EA 1GCEA 3M6BA 1E4DA 3Q7VB 4E3MA 2ZQDA 4X68A 5G18A 3SOIA 3ZG0A 2OV5A 5M19A 1HTZA 4HEFA 4IBXA 1FSWA 1K54A 2Y2LA 1GHPA 1W8YA 4PM9A 3G34A 1JTGA 2Y4AA 1MBLA 1OMEA 1SHVA 3SS3A 2V2FF 1K38A 2ZLYA 4WYYA 1TDGA 3GVBA 1PZOA 4M3KA 3IH8A 4P85A 1W7FA 3N8SA 1K56A 3GR2A 4EWFA 1KE0A 3VFFA 1YLJA 5I94A 4PM7A 1FSYA 3IHAA 4MBKA 4KQRA 2H0TA 4FSFA 4X6TA 3VP1A 2EX8A 1PYYA 3FZCA 4OOMA 5DF8A 3W4OA 2Y91A 5EOEA 2ZC5B 2Q9NA 4WM9A 3UNWA 3QNBA 4GD8A 1NZOA 2BG1A 5KSCA 1ESIA 4MNRA 4ZJ2A 1W79A 1VQQA 1PI5A 4IBRA 3ZNTA 4BENA 4JPMA 1H8YA 4MBFA 1BLPA 3WS2A 5KZHA 4OONA 2J9PA 1BLHA 3JYIA 3Q07A 4OOYA 3N6IA 5EUAA 5F1GA 3UO9A 1FR6A 2EXBA 2Y2IA 2WK0A 3HVFA 1RGZA 4QD4A 3DTMA 3MBZA 5EVIC 3VMAA 2ZQCA 3O3VA 3DWZA 3PAEA 4NK3A 4BJPA 2V20A 1JWVA 3GRJA 2DNSA 1JTDA 1C3BA 4RVAA 3W4QA 4GDBA 4KZ5A 5FQJA 1M40A 1LI9A 3GQZA 4DXBA 4XXRA 3S4XA 1RP5A 3IWOA 5FQQA 5M1AA 3S22A 4OPRA 4KQQA 5EVIA 1K55C 1DJCA 3Q82A 5CEDA 1SDEA 1BTLA 4NETA 5HX9A 4KZ4A 5TR7A 2HDSA 3C4OA 2QZ6A 1K57C 1XXMA 2H10A 2WKHA 1KGGA 4IEDA 1PWGA 3UPPA 1KGFA 2WADA 2XFSA 3VP2A 2ZM0A 4JXGA 5L2FA 5AQ7A 2PBYA 4MLLA 3HL9A 1ZKJA 3Q1FA 2XLNA 3DW0A 3V50A 1L0FA 3CMZA 3BFFA 3NC8A 4LV1A 4X53A 4RYEA 2HDUA 5FQIA 1W8QA 3IF6B 4E3LA 3GTCA 4DXCA 3PAGA 1K57A 1AXBA 1N9BA 3V39A 1XP4A 5EECA 2GDNA 3RJUA 2HDQA 4KG5A 5JYPA 2Z2LB 2P74A 1GA9A 2WZZA 3MKFA 4LV0A 4LV3A 4KENB 5U47A 5F1FA 4ZBEA 1NJ4A 1H5XA 4WELA 1GHIA 1RCJA 5A92A 5FDHA 3N8RA 4DE3A 2ZM2A 3HLFA 4UA6A 1K4EA 1ESUA 1U60A 3CZDA 5AQAA 2XD1A 4OLGA 1MY8A 2ZQ8A 2XH9A 4R4RA 4GNUA 1N4OA 1K25A 1ONGA 3O87A 3ISGA 5TGFA 4YFMA 5FQMA 1MPLA 3WWXA 3HREA 2ZQAA 1BLCA 3B3XA 5HAIA 4S2MA 5CGWA 5FASA 2EXAA 4DDYA 2PU4A 3BRMA 3ZDJA 2WAEA 4HESA 2XGNA 3PBTA 1ES5A 1YM1A 5DTSA 1XA1A 4QHCA 1PWDA 1PW8A 1SCWA 2DCFA 4QB8A 5FQKA 5GHXA 5CEBA 4H8RA 3GV9A 2A49A 2WGWB 2XEPA 5FI2A 1PIOA 2XK1A 1O7EA 3BECA 1MWUA 4S2KA 3UDXA 2DRWA 2ZC4B 1ES4A 4X69A 2Y2QA 1IEMA 2WZXA 3SS4A 1YQSA 3UDFA 2RCXA 3IXBA 1HD8A 3P98A 2EFUA 5A93A 1XGJA 5CTMA 1MWSA 4K91A 1WE4A 4PMAA 2OLVA 2G2UA 3ZVTA 1K6RA 3NDEA 4N1XA 1YT4A 3HBRA 1EROA 2WGWA 4N9KA 4R23A 5HARA 1CEGA 4Q8IA 3WS5A 4RX2A 4XUZA 4HBTA 5E2GA 2Y2MA 3GSGA 3MXSA 4OH0A 3S1YA 3CJMA 1BULA 1IKGA 1FOFA 1JWZA 3Q7VA 3AGFA 2XDMA 5E2HA 4R3BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I5Q A;  4UAA A;  3IWI A;  1CI9 A;  3BEB A;  4K0X A;  4RA7 A;  1YLT A;  3N7W A;  4S2J A;  5FAQ A;  2C5W B;  1ES3 A;  3M2J A;  1L2S A;  4F94 A;  3OPR A;  2HDR A;  4EUZ A;  4EV4 A;  1BUE A;  4OPQ A;  4OPY A;  2EFX A;  4OLD A;  5AQ9 A;  3ZG7 B;  3G30 A;  1NY0 A;  1S6R A;  2JCH A;  3O88 A;  3C7V A;  2Y2H A;  3IXD A;  5EOO A;  3AGE A;  2WKE A;  2Z2M B;  3HUM A;  5CTN A;  3G4P A;  2B5R A;  2EX9 A;  2E8I A;  2VGJ A;  4JBF A;  1YLP A;  5FAP A;  3ZG5 A;  3ZNY A;  1GHM A;  3CG5 A;  4CJN A;  1BLS A;  4R0Q A;  1MXO A;  2XR0 A;  4DKI A;  4P6B A;  5EVL A;  2ZM8 A;  4MBH A;  3ZG8 B;  5CEC A;  1O07 A;  1XX2 A;  1YMS A;  1YLZ A;  5TFQ A;  1I2S A;  1LLB A;  1IYS A;  2Y2G A;  3M6H A;  5CHM A;  4JF6 A;  1PWC A;  4WEK A;  3ZFZ A;  1PI4 A;  4GD6 A;  2PU2 A;  1G68 A;  3UY6 A;  5DF7 A;  2V1Z A;  3BLS A;  4Y0U A;  2OLU A;  1XKZ A;  3EQV A;  1LL9 A;  1G6A A;  1K6S A;  2WYX A;  5F83 A;  4UA9 A;  2H5S A;  4JXV A;  4BQM A;  3PTE A;  3HLG A;  4E6W A;  5CGS A;  3TG9 A;  5D3O A;  1Z6F A;  3MZF A;  4GB7 A;  2Y2P A;  3G31 A;  4N1H A;  5DTT A;  4PM8 A;  5E2F A;  5GHZ A;  2Y2N A;  3PBQ A;  3HLE A;  2R9X A;  3UPN A;  5HAP A;  4K0W A;  2XFT A;  4BD0 A;  5BOH A;  3IF6 C;  1CI8 A;  3IXG A;  5GL9 A;  3ZCZ A;  3PBO A;  3OZH A;  1DY6 A;  3QNC A;  5M18 A;  4MEZ A;  3ZVW A;  4BLM A;  4KG2 A;  4FH4 A;  1I2W A;  1LL5 A;  1E3U D;  3BFC A;  3A3I A;  4DDS A;  2ZQ9 A;  4X56 A;  4WMC D;  3VOZ A;  1CK3 A;  4EBN A;  4PM5 A;  3C7U A;  5FA7 A;  4L0L A;  3QHY A;  3IF6 A;  3DWK A;  1LHY A;  4DE0 A;  2WUQ A;  2G2W A;  2HP6 A;  2IWD A;  4N9L A;  3NIA A;  1MWR A;  1YLW A;  3ITB A;  4GDN A;  4UHU A;  4XUX A;  4BL2 A;  5HW3 A;  3OPP A;  4EBL A;  4OQH A;  1ZG4 A;  3PBR A;  5FI6 A;  4OP5 A;  4QY5 A;  3TOI A;  3V3R A;  4N92 A;  3MZD A;  1KE4 A;  2ZQ7 A;  1FR1 A;  1KDW A;  2Q9M A;  3BFD A;  4ID4 A;  1ONH A;  1GA0 A;  1KVL A;  3E2L A;  3A3D A;  2FFY A;  3N4I A;  2I72 A;  3V5M A;  1IEL A;  1YMX A;  3TSG A;  4R1G A;  4C6Y A;  3ZGA B;  3FV7 A;  3FKW A;  1Q2P A;  1CEF A;  4B88 A;  2IWB A;  3W8K A;  3SH9 A;  2FFF B;  3WRZ A;  4GKU A;  4DE1 A;  2IWC A;  5E2E A;  5FAO A;  1W5D A;  3BLM A;  3PBN A;  3WRT A;  4E3J A;  4BD1 A;  3Q7Z A;  4JF4 A;  2WKI A;  1BZA A;  3RXW A;  1E25 A;  2EX2 A;  4E3K A;  1DJB A;  3C4P A;  5DVA A;  4Z9Q A;  3OCN A;  1XPB A;  2WAF A;  5GLB A;  1TEM A;  3A3J A;  1ERM A;  4E3I A;  3SH8 A;  4UA7 A;  1FCM A;  2ZMA A;  5IHV A;  4ZDX A;  3UE3 A;  5A90 A;  3LO7 A;  1KDS A;  1BSG A;  3LEZ A;  1IYO A;  2P9V B;  2J9O A;  2RL3 A;  4ZAM A;  5CRF A;  3E2K A;  5CER A;  1NXY A;  2A3U A;  4WBG A;  3HLB A;  4EBP A;  3HUO A;  2QPN A;  3V3S A;  4YIN A;  1QMF A;  5AQB A;  3P09 A;  2WGV A;  3MKE A;  2Y2O A;  3NI9 A;  3FWL A;  5EPH A;  4ZTK A;  4JKT A;  3VSL A;  3UPO A;  3NY4 A;  1K4F A;  4LCL A;  3G35 A;  1KGE A;  3RXX A;  3A3F A;  5KSH A;  4EQI A;  4P0M A;  5DF9 A;  5FI7 A;  4DE2 A;  3O86 A;  2ZC3 B;  2J7V A;  4R4S A;  4QU3 A;  4S2P A;  2P9V A;  3MFD A;  1ZC2 A;  4KG6 A;  4LV2 A;  3MZE A;  2XQZ A;  3IQA A;  4OQ0 A;  4KZ9 A;  3N8L A;  1KVM A;  5EE8 A;  3UE0 A;  3WS0 A;  1WYC A;  3SH7 A;  1K56 D;  1QME A;  4ZJ1 A;  4R3J A;  3I7J A;  1ERQ A;  4KQO A;  5CGX A;  4BL3 A;  1NRF A;  3G2Y A;  1VM1 A;  3MXR A;  4S2L A;  3LY4 A;  5DTK A;  3PBS A;  4S2N C;  1J9M A;  5J8X A;  3Q81 A;  3LCE A;  1PZP A;  5EVI B;  5F82 A;  4DF6 A;  2JBF A;  3SS5 A;  2R9W A;  3OC2 A;  2UWX A;  4D2O A;  4OKP A;  5JYO A;  3VOY A;  3NBL A;  3OCL A;  4GN2 A;  5FSR A;  3WS4 A;  4C75 A;  3WS1 A;  3BFE A;  1E3U A;  4S2N A;  3HLD A;  4P87 A;  5GLD A;  2BLS A;  4WMC A;  3D4F A;  1FCN A;  2OSU A;  3FKV A;  4Y0O A;  3OPL A;  4FH2 A;  4E6X A;  1MKI A;  1IYQ A;  5HAQ A;  4JF5 A;  3NDG A;  4DRT A;  4HBU A;  4KZA A;  3HUN A;  4U3T A;  1ES2 A;  5GHY A;  1FCO A;  4KZ8 A;  4ZJ3 A;  4KZ7 A;  5GLA A;  4Y7P A;  2X02 A;  1HZO A;  4CPK A;  1IYP A;  2ZJ9 A;  4KZ3 A;  1M6K A;  3W4P A;  1KE3 A;  3G2Z A;  1ALQ A;  3VSK A;  1IKI A;  4WZ5 C;  1EWZ A;  2ZC6 B;  3GMW A;  4QY6 A;  5E43 A;  4FCF A;  5CHU A;  3IHB A;  3BFG A;  4WZ4 A;  2Y59 A;  2HPB A;  2X71 A;  4X55 A;  1LI0 A;  3UN7 A;  4PPR A;  1K55 A;  3ZG9 B;  5GLC A;  3IXH A;  3BM6 A;  5KMW A;  3OPH A;  1SDN A;  1XA7 A;  5EVI D;  4OP8 A;  1NYY A;  3IH9 A;  4QJG A;  2H0Y A;  3IF5 A;  4WZ5 A;  4KZB A;  3IT9 A;  1MWT A;  1H8Z A;  4U0X A;  4C3Q A;  2EX6 A;  4E3O A;  2VGK A;  4FD8 A;  1JVJ A;  1JWP A;  2X01 A;  1NZU A;  1RGY A;  2Y55 A;  4S2O A;  1L0D A;  2C6W B;  1HVB A;  2HP5 A;  3AGD A;  1NYM A;  3BYD A;  4B4Z A;  4U0T A;  3C5A A;  3VFH A;  3VP3 A;  4GOG A;  1TVF A;  2CC1 A;  1L0E A;  4LEN A;  3VP0 A;  3HLC A;  5FQ9 A;  5CHJ A;  2Y2K A;  3NCK A;  2ZD8 A;  4O7D A;  4LCM A;  3G32 A;  1PW1 A;  2J8Y A;  5HL1 A;  4Y0T A;  1XGI A;  2HP9 A;  4OVD A;  5FAT A;  4E3N A;  2QMI A;  1BT5 A;  3UDI A;  5HFO A;  1TDL A;  1S0W A;  1DJA A;  1FQG A;  4IVI A;  4IVK A;  3UE1 A;  1L0G A;  3ZHH A;  1EI5 A;  3IWQ A;  4JXS A;  4S2I A;  2XD5 A;  4RX3 A;  2JE5 A;  5A91 A;  1ZG6 A;  3M2K A;  4JLF A;  3HLW A;  4JXW A;  4OQI A;  4GZB A;  4OQG A;  4PM6 A;  4OOL A;  3VP4 A;  1WYB A;  2JC7 A;  1YLY A;  1K54 C;  1Q2Q A;  1SKF A;  4A5R A;  2Y2J A;  4OPZ A;  4WEJ A;  2WGI A;  3ITA A;  5CXW A;  2ZC7 A;  1Y54 A;  3EQU A;  4B4X A;  2XF3 A;  4KZ6 A;  3LY3 A;  3FYZ A;  3A3E A;  1GCE A;  3M6B A;  1E4D A;  3Q7V B;  4E3M A;  2ZQD A;  4X68 A;  5G18 A;  3SOI A;  3ZG0 A;  2OV5 A;  5M19 A;  1HTZ A;  4HEF A;  4IBX A;  1FSW A;  1K54 A;  2Y2L A;  1GHP A;  1W8Y A;  4PM9 A;  3G34 A;  1JTG A;  2Y4A A;  1MBL A;  1OME A;  1SHV A;  3SS3 A;  2V2F F;  1K38 A;  2ZLY A;  4WYY A;  1TDG A;  3GVB A;  1PZO A;  4M3K A;  3IH8 A;  4P85 A;  1W7F A;  3N8S A;  1K56 A;  3GR2 A;  4EWF A;  1KE0 A;  3VFF A;  1YLJ A;  5I94 A;  4PM7 A;  1FSY A;  3IHA A;  4MBK A;  4KQR A;  2H0T A;  4FSF A;  4X6T A;  3VP1 A;  2EX8 A;  1PYY A;  3FZC A;  4OOM A;  5DF8 A;  3W4O A;  2Y91 A;  5EOE A;  2ZC5 B;  2Q9N A;  4WM9 A;  3UNW A;  3QNB A;  4GD8 A;  1NZO A;  2BG1 A;  5KSC A;  1ESI A;  4MNR A;  4ZJ2 A;  1W79 A;  1VQQ A;  1PI5 A;  4IBR A;  3ZNT A;  4BEN A;  4JPM A;  1H8Y A;  4MBF A;  1BLP A;  3WS2 A;  5KZH A;  4OON A;  2J9P A;  1BLH A;  3JYI A;  3Q07 A;  4OOY A;  3N6I A;  5EUA A;  5F1G A;  3UO9 A;  1FR6 A;  2EXB A;  2Y2I A;  2WK0 A;  3HVF A;  1RGZ A;  4QD4 A;  3DTM A;  3MBZ A;  5EVI C;  3VMA A;  2ZQC A;  3O3V A;  3DWZ A;  3PAE A;  4NK3 A;  4BJP A;  2V20 A;  1JWV A;  3GRJ A;  2DNS A;  1JTD A;  1C3B A;  4RVA A;  3W4Q A;  4GDB A;  4KZ5 A;  5FQJ A;  1M40 A;  1LI9 A;  3GQZ A;  4DXB A;  4XXR A;  3S4X A;  1RP5 A;  3IWO A;  5FQQ A;  5M1A A;  3S22 A;  4OPR A;  4KQQ A;  5EVI A;  1K55 C;  1DJC A;  3Q82 A;  5CED A;  1SDE A;  1BTL A;  4NET A;  5HX9 A;  4KZ4 A;  5TR7 A;  2HDS A;  3C4O A;  2QZ6 A;  1K57 C;  1XXM A;  2H10 A;  2WKH A;  1KGG A;  4IED A;  1PWG A;  3UPP A;  1KGF A;  2WAD A;  2XFS A;  3VP2 A;  2ZM0 A;  4JXG A;  5L2F A;  5AQ7 A;  2PBY A;  4MLL A;  3HL9 A;  1ZKJ A;  3Q1F A;  2XLN A;  3DW0 A;  3V50 A;  1L0F A;  3CMZ A;  3BFF A;  3NC8 A;  4LV1 A;  4X53 A;  4RYE A;  2HDU A;  5FQI A;  1W8Q A;  3IF6 B;  4E3L A;  3GTC A;  4DXC A;  3PAG A;  1K57 A;  1AXB A;  1N9B A;  3V39 A;  1XP4 A;  5EEC A;  2GDN A;  3RJU A;  2HDQ A;  4KG5 A;  5JYP A;  2Z2L B;  2P74 A;  1GA9 A;  2WZZ A;  3MKF A;  4LV0 A;  4LV3 A;  4KEN B;  5U47 A;  5F1F A;  4ZBE A;  1NJ4 A;  1H5X A;  4WEL A;  1GHI A;  1RCJ A;  5A92 A;  5FDH A;  3N8R A;  4DE3 A;  2ZM2 A;  3HLF A;  4UA6 A;  1K4E A;  1ESU A;  1U60 A;  3CZD A;  5AQA A;  2XD1 A;  4OLG A;  1MY8 A;  2ZQ8 A;  2XH9 A;  4R4R A;  4GNU A;  1N4O A;  1K25 A;  1ONG A;  3O87 A;  3ISG A;  5TGF A;  4YFM A;  5FQM A;  1MPL A;  3WWX A;  3HRE A;  2ZQA A;  1BLC A;  3B3X A;  5HAI A;  4S2M A;  5CGW A;  5FAS A;  2EXA A;  4DDY A;  2PU4 A;  3BRM A;  3ZDJ A;  2WAE A;  4HES A;  2XGN A;  3PBT A;  1ES5 A;  1YM1 A;  5DTS A;  1XA1 A;  4QHC A;  1PWD A;  1PW8 A;  1SCW A;  2DCF A;  4QB8 A;  5FQK A;  5GHX A;  5CEB A;  4H8R A;  3GV9 A;  2A49 A;  2WGW B;  2XEP A;  5FI2 A;  1PIO A;  2XK1 A;  1O7E A;  3BEC A;  1MWU A;  4S2K A;  3UDX A;  2DRW A;  2ZC4 B;  1ES4 A;  4X69 A;  2Y2Q A;  1IEM A;  2WZX A;  3SS4 A;  1YQS A;  3UDF A;  2RCX A;  3IXB A;  1HD8 A;  3P98 A;  2EFU A;  5A93 A;  1XGJ A;  5CTM A;  1MWS A;  4K91 A;  1WE4 A;  4PMA A;  2OLV A;  2G2U A;  3ZVT A;  1K6R A;  3NDE A;  4N1X A;  1YT4 A;  3HBR A;  1ERO A;  2WGW A;  4N9K A;  4R23 A;  5HAR A;  1CEG A;  4Q8I A;  3WS5 A;  4RX2 A;  4XUZ A;  4HBT A;  5E2G A;  2Y2M A;  3GSG A;  3MXS A;  4OH0 A;  3S1Y A;  3CJM A;  1BUL A;  1IKG A;  1FOF A;  1JWZ A;  3Q7V A;  3AGF A;  2XDM A;  5E2H A;  4R3B A; 
#chains in the Genus database with same CATH topology
 3IWI A;  3BEB A;  3U4L P;  1ES3 A;  3KSG A;  2HDR A;  1BUE A;  2KOI A;  1NY0 A;  1S6R A;  3IXD A;  4PAU A;  2WKE A;  2ZL1 A;  2Z2M B;  1LT0 A;  3D72 A;  1TS0 A;  5FAP A;  5DJU A;  2PHY A;  2P08 A;  3CG5 A;  1BLS A;  1MXO A;  3ZG8 B;  5TFQ A;  3QP1 A;  1I2S A;  3A0V A;  1WA9 A;  2O9B A;  3UY6 A;  1DP9 A;  3VE4 A;  4Y0U A;  3SZT A;  3EQV A;  1G6A A;  1K6S A;  2WYX A;  1PNE A;  1XFN A;  3FG8 A;  5CGS A;  1T19 A;  1Z6F A;  3LIE A;  4EUV A;  2Y2P A;  2CMN A;  3G31 A;  5AVE A;  1IOU A;  3PBQ A;  3UPN A;  1OTB A;  5IU1 A;  2GNX A;  1T1A A;  4FH4 A;  1E3U D;  3A3I A;  4WMC D;  1CK3 A;  4L0L A;  3DAV A;  3IF6 A;  2WUQ A;  2HP6 A;  4NG2 A;  2A2L A;  4UHU A;  4XUX A;  5HW3 A;  4GW9 A;  3PBR A;  4II7 A;  4OP5 A;  3V3R A;  5HD5 A;  2Q9M A;  3BFD A;  4ID4 A;  1KVL A;  3IX4 A;  3T1R A;  2P04 A;  5HD3 A;  3V5M A;  2BTF P;  1IEL A;  1YMX A;  4CLC D;  3TSG A;  4R1G A;  4C6Y A;  1F9I A;  1N9N A;  3SH9 A;  4DE1 A;  2HGV A;  5E2E A;  3PBN A;  2MJ6 A;  3Q7Z A;  3RXW A;  1E25 A;  3C4P A;  1LSV A;  4Z9Q A;  4NKP A;  1TEM A;  4E3I A;  4UA7 A;  3HCY A;  3LEZ A;  2P9V B;  5CER A;  3D3O A;  3MS6 A;  4WBG A;  4EBP A;  3V3S A;  3VSL A;  1K4F A;  3G35 A;  1KGE A;  5KSH A;  4P0M A;  5DF9 A;  3KSF A;  4QPR A;  1MKM A;  2J7V A;  4WLA A;  4R4S A;  4D60 A;  1ZC2 A;  4KG6 A;  3MZE A;  2XQZ A;  4OQ0 A;  3UE6 A;  1TD5 A;  3SH7 A;  3I7J A;  1ERQ A;  5CGX A;  1CQA A;  2PDR A;  5DTK A;  4S2N C;  3T4O A;  2QJ7 A;  3F1P B;  5F82 A;  3FPW A;  4DF6 A;  2JBF A;  3SS5 A;  2UWX A;  3T12 B;  2HZ5 A;  3WS4 A;  3DTK A;  3HLD A;  3D4F A;  1FCN A;  2OSU A;  1PRQ A;  4GHI B;  4Y3I A;  4U3T A;  4KZ7 A;  4Y7P A;  4I3J A;  1IYP A;  1ALQ A;  3F1N B;  2JKT I;  4CLC E;  4WZ4 A;  2Y59 A;  2HPB A;  2X71 A;  4X55 A;  4I3I A;  3UN7 A;  4PPR A;  1K55 A;  5GLC A;  3OPH A;  4JGP A;  1XA7 A;  4LRX C;  2INW A;  4EES A;  2EX6 A;  1JVJ A;  2Y79 A;  1NZU A;  4S2O A;  5FEG A;  4KQD A;  4U0T A;  2D01 A;  1DP6 A;  1TVF A;  3C38 A;  4GOG A;  1L0E A;  4LEN A;  5FQ9 A;  5CHJ A;  5EM1 A;  4OVD A;  5FAT A;  3UDI A;  4HNB A;  5HFO A;  2KLI A;  1S0W A;  4IVI A;  4IVK A;  3UE1 A;  2H28 A;  4S2I A;  4JGR A;  3M2K A;  3H82 A;  5AVF A;  4GZB A;  5G4Y A;  4DMZ A;  2JC7 A;  1YLY A;  1Q2Q A;  4WEJ A;  2ZC7 A;  3EQU A;  4KZ6 A;  3FYZ A;  3M6B A;  3Q7V B;  4E3M A;  2ZQD A;  3SOI A;  3RTY A;  2Y2L A;  1GHP A;  3F1O B;  1NRJ A;  1MBL A;  1SHV A;  2V2F F;  1TDG A;  4P85 A;  1N9O A;  1K56 A;  3GR2 A;  4EWF A;  4PM7 A;  1FSY A;  1VB6 A;  3FZC A;  2Y91 A;  5EOE A;  4WM9 A;  1YAX A;  3IX8 A;  5I5L A;  3UNW A;  3QNB A;  4UEY A;  5KSC A;  5KIZ A;  4ZJ2 A;  1VQQ A;  2VEA A;  4JPM A;  1BLP A;  4GS9 B;  4OON A;  2VA0 A;  4OOY A;  3N6I A;  4P6Z S;  4MN7 A;  4AFI A;  3KYZ A;  1S66 L;  2Y2I A;  4NXG A;  4QD4 A;  3QP8 A;  3T1Q B;  4HH2 A;  3PAE A;  2DNS A;  1C3B A;  5FQJ A;  2ZMF A;  1YSQ A;  1DJC A;  4HIA A;  4NET A;  1K57 C;  1KGG A;  4ARZ A;  2ZOI A;  4KUK A;  4Y15 A;  3V50 A;  3CMZ A;  4LV1 A;  3NC8 A;  4X53 A;  4RYE A;  2HDU A;  1CJF A;  4YOF A;  1J3W A;  3TE8 A;  3LUQ A;  4HY8 A;  5EEC A;  3MQ0 A;  1GSW A;  3RJU A;  1Z09 A;  5JYP A;  2Z2L B;  2P74 A;  1GA9 A;  1TS8 A;  1W63 M;  3HLF A;  1K4E A;  4HOI A;  2XD1 A;  3BW6 A;  2ZQ8 A;  2AVX A;  2XH9 A;  4R4R A;  2Y8H A;  5J3W A;  1NWZ A;  3LYX A;  4Y13 A;  3B3X A;  5HAI A;  2PU4 A;  3LI9 A;  3MQQ A;  1YM1 A;  4QHC A;  1PWD A;  1K0K A;  3K2N A;  4O01 A;  5FQK A;  5GHX A;  5CEB A;  1PIO A;  5CX7 A;  2DRW A;  2ZC4 B;  4JGQ A;  2Y2Q A;  1IEM A;  2IA2 A;  1YQS A;  2LB5 A;  1XGJ A;  1VEU B;  4K91 A;  3S7P A;  4R38 A;  4X1M A;  1OTD A;  4Y2F A;  4DN0 A;  5MC7 A;  5HAR A;  3KSI A;  3WS5 A;  2QKP A;  2Y2M A;  3S1Y A;  3CJM A;  1BUL A;  1IKG A;  1JWZ A;  1P97 A;  2ZOH A;  1OT6 A;  2XDM A;  3R7W A;  3S7N A;  2JKR M;  1I5Q A;  4EET B;  4UAA A;  1CI9 A;  1S4S A;  3HJI A;  2M7V A;  3BQ8 A;  2C5W B;  1L2S A;  4EV4 A;  4FOF A;  4I3A A;  3O88 A;  2Y2H A;  3FPV A;  3AGE A;  2EX9 A;  2VGJ A;  3IS2 A;  3ZNY A;  1GHM A;  4G3K A;  3BQA A;  5EVL A;  5CEC A;  1YLZ A;  1XX2 A;  1STZ A;  5DKK A;  2Y2G A;  5CHM A;  4WEK A;  5DKL A;  2PU2 A;  1P0Z A;  2QHK A;  1X0O A;  2V1Z A;  2OLU A;  1XKZ A;  4HQA A;  1LL9 A;  1XJ4 A;  5F83 A;  3P01 A;  4JXV A;  4BQM A;  3KYE A;  4BMW A;  4E6W A;  3H7W A;  1TF1 A;  3OBF A;  4N1H A;  5E2F A;  2Y2N A;  3TJZ C;  2R9X A;  5BOH A;  3MMH A;  5GL9 A;  3PBO A;  1DY6 A;  3QNC A;  3GDI A;  5M18 A;  1LL5 A;  4DDS A;  2ZQ9 A;  3VOZ A;  4PM5 A;  3S7O A;  3C7U A;  4LRZ E;  5FA7 A;  3QHY A;  3E4P A;  3B42 A;  4DE0 A;  2G2W A;  4HJ3 A;  1L3L A;  4N9L A;  1YLW A;  4BL2 A;  3DTI A;  3OPP A;  3H9W A;  4OQH A;  3MZD A;  1ONH A;  3E2L A;  2L4R A;  3CWF A;  1YKD A;  1OPX A;  4EER A;  5HSQ A;  3EWK A;  2O99 A;  4B93 A;  3ZGA B;  1Q2P A;  1CEF A;  4GKU A;  5TJJ A;  5FAO A;  4BD1 A;  4JF4 A;  3NOT C;  4H6J B;  1F5M A;  2DMW A;  2W3H A;  2GZA A;  4F3L A;  1JNU A;  5GLB A;  4X25 A;  4PKY G;  1FIK A;  1FCM A;  2ZMA A;  5IHV A;  5HDD A;  4ETZ A;  3UE3 A;  5A90 A;  3E4O A;  3LO7 A;  1BSG A;  3UME A;  4WL9 A;  2PD7 A;  2RL3 A;  3E2K A;  3T4T A;  2A3U A;  3HLB A;  3CAX A;  5TBM A;  1QMF A;  3P09 A;  2WGV A;  3FWL A;  2B18 A;  5EPH A;  4Y17 A;  2G7U A;  3EEH A;  1BYW A;  2K31 A;  3UB6 A;  4QU3 A;  2VV7 A;  2P9V A;  3MFD A;  3NUL A;  3IQA A;  4KZ9 A;  2HF6 A;  5L07 A;  4BL3 A;  2M7U A;  3B33 A;  1VM1 A;  3MXR A;  3TW8 A;  3PBS A;  5J8X A;  3LCE A;  2R9W A;  4D2O A;  2PAV P;  3WS1 A;  3BFE A;  3DTE A;  4Y0O A;  4FH2 A;  1MKI A;  1IYQ A;  4DRT A;  4HBU A;  4KZA A;  3HUN A;  4ZJ3 A;  4KZ8 A;  4CLC B;  2ZJ9 A;  3T4S A;  1M6K A;  4R3A A;  4NXF A;  4QY6 A;  4FCF A;  3CPT B;  1MZU A;  3ZG9 B;  2XA7 M;  4GHI A;  3BM6 A;  1SDN A;  2W0N A;  3IF5 A;  4WZ5 A;  3T4L A;  3UB7 A;  4C3Q A;  2VGK A;  1JWP A;  1FIL A;  2C6W B;  2HP5 A;  3AGD A;  4EXO A;  3C5A A;  3VFH A;  3VP0 A;  3JVU A;  1W63 Q;  2W27 A;  4X1L A;  2ZD8 A;  5L8M A;  4Y0T A;  1XGI A;  4UQI M;  2WKR A;  2L0W A;  1DJA A;  3IWQ A;  2R78 A;  2XD5 A;  5K5B A;  1XFQ A;  3HLW A;  3VP4 A;  1WYB A;  2Y2J A;  3ITA A;  3VOL A;  1YPR A;  3A3E A;  1GCE A;  1UWP X;  1E4D A;  3O5Y A;  5G18 A;  3ZG0 A;  2OV5 A;  1K54 A;  4CQH A;  2OWJ A;  3CIT A;  2Y4A A;  1OME A;  3ULF A;  4WYY A;  3GVB A;  1PZO A;  4M3K A;  1W7F A;  3N8S A;  1LL8 A;  5I94 A;  4MBK A;  4KQR A;  4FSF A;  2VGL S;  4OOM A;  2BG1 A;  3C30 A;  4HHD A;  1PI5 A;  1H8Y A;  3WS2 A;  2J9P A;  3JYI A;  2B02 A;  3HVF A;  3O3V A;  4BJP A;  3LEQ A;  4RVA A;  2XRN A;  4DXB A;  4KZ5 A;  2EWV A;  3GQZ A;  4GS9 A;  1RP5 A;  4LRY C;  4OPR A;  5EVI A;  3PHY A;  5TR7 A;  2QZ6 A;  5A8B A;  1XXM A;  2H10 A;  2WKH A;  1KGF A;  4CLC C;  4Q0I A;  3VP2 A;  4JXG A;  1H3Q A;  1T1B A;  4MLL A;  1ZKJ A;  3DW0 A;  2HV1 A;  1W8Q A;  3IF6 B;  3K3C A;  3PAG A;  1XP4 A;  2GDN A;  1LSX A;  3MKF A;  4LV3 A;  5U47 A;  1NJ4 A;  4WEL A;  5FDH A;  2ZM2 A;  4UA6 A;  5DFY A;  1TS6 A;  5AQA A;  4ETX A;  5J4E A;  3RFB A;  1ONG A;  3O87 A;  5FQM A;  3WWX A;  2ZQA A;  2EXA A;  3BRM A;  3ZDJ A;  2XGN A;  3PBT A;  1ES5 A;  2O9C A;  5DTS A;  1XA1 A;  2DCF A;  4H8R A;  3GV9 A;  2WGW B;  5FI2 A;  2XK1 A;  1O7E A;  2YKH A;  3BEC A;  1MWU A;  4HI4 A;  3LR3 A;  4X69 A;  2WZX A;  3UDF A;  2VLG A;  3IXB A;  3MJQ A;  3LIA A;  2EFU A;  5A93 A;  1WE4 A;  4PMA A;  3ZVT A;  3VE3 A;  5EM0 A;  4N1X A;  1YT4 A;  4R23 A;  1CEG A;  4RX2 A;  2D02 A;  1D06 A;  4OH0 A;  2P7J A;  1FOF A;  3AGF A;  5E2H A;  3FC7 A;  1VEU A;  2PD8 A;  3K3D A;  3N7W A;  1DRM A;  4G3W A;  3OPR A;  4EUZ A;  4OPY A;  4OPQ A;  1ODV A;  3T4K A;  3ZG7 B;  3G6O A;  2JCH A;  4WN5 A;  5EOO A;  3ZQ5 A;  5HPI A;  3HUM A;  3G4P A;  2B5R A;  4JBF A;  1YLP A;  3ZG5 A;  4CJN A;  4DKI A;  2ZM8 A;  1O07 A;  1YMS A;  1F2K A;  2QWS A;  3M6H A;  3GEC A;  1Y28 A;  1S4R A;  1V9Y A;  4I5S A;  2E8J A;  4UA9 A;  3HLG A;  3TG9 A;  3VV4 A;  1OTI A;  2A24 A;  3CHW P;  3MZF A;  4GB7 A;  4HP9 A;  5GHZ A;  2PRF A;  3BY8 A;  4XT2 A;  1Y4O A;  4K0W A;  2XFT A;  3IF6 C;  1CI8 A;  3OZH A;  4NXB A;  4BLM A;  2VJW A;  4KG2 A;  5LBR A;  4BWI A;  2VX8 A;  1UGU A;  3BFC A;  1P9W A;  4X56 A;  4EBN A;  2EA9 A;  2VV8 A;  3DWK A;  1LHY A;  3LI8 A;  2IWD A;  3NIA A;  4ZRR A;  2VZW A;  4GDN A;  1G6O A;  3CUE C;  4EBL A;  4QY5 A;  3NOU C;  1FR1 A;  1XJ6 A;  2FFY A;  3QP5 A;  1XJ2 A;  2OWH A;  3SW1 A;  1VET A;  4O8G A;  3PYP A;  3FV7 A;  3IX3 A;  3LIC A;  3FKW A;  3MFX A;  2YKF A;  3WRZ A;  4GLQ A;  2IWC A;  3BLM A;  4K08 A;  4I39 A;  3WRT A;  3KO6 A;  2FH5 A;  1BZA A;  4E3K A;  2V1A A;  2UV0 E;  3OCN A;  4E04 A;  1XPB A;  2WAF A;  3A3J A;  2O9A A;  4M4X A;  1ERM A;  4JGO A;  3SH8 A;  4ZDX A;  3BWL A;  3MQO A;  1KDS A;  1IYO A;  5IT5 A;  5CRF A;  4MN5 A;  5F69 A;  2ZMV A;  4H6J A;  1S1Y A;  3HUO A;  2QPN A;  4YIN A;  1ZTU A;  2Y2O A;  4JKT A;  4LCL A;  4EQI A;  1OJG A;  5HWV A;  5FI7 A;  3O86 A;  5C5K A;  4LV2 A;  3N8L A;  1KVM A;  3UE0 A;  1WYC A;  1K56 D;  4ZJ1 A;  4R3J A;  2I9V A;  2M1C A;  4S2L A;  3LY4 A;  1J9M A;  3Q81 A;  4HJ4 A;  1PZP A;  2OOL A;  3RH8 B;  3OC2 A;  3EGD C;  4L9G A;  4OKP A;  5JYO A;  3VOY A;  3NJA A;  4ARZ B;  4GN2 A;  2VKS A;  5FSR A;  1S1Z A;  1E3U A;  4S2N A;  5GLD A;  4WMC A;  3FKV A;  4HJ6 A;  1UWN X;  1YSP A;  3NDG A;  1ES2 A;  5GHY A;  1FCO A;  1HZO A;  1SKO B;  4KZ3 A;  2OAP 1;  2PR5 A;  1IKI A;  4MMN A;  1EWZ A;  2ZC6 B;  3E98 A;  3IHB A;  3BFG A;  2EWW A;  1CF0 A;  3ZYT A;  4YWZ A;  4OP8 A;  4EW7 A;  4QJG A;  2H0Y A;  2K7S A;  4CLC A;  3L9K A;  4U0X A;  4E3O A;  3EOI A;  4MN6 A;  3UMD A;  1N9L A;  2X01 A;  2V8C A;  1RGY A;  4RQ9 A;  2XSS A;  1HVB A;  4B4Z A;  1ACF A;  2NUP C;  2CC1 A;  1XJ3 A;  3KYQ A;  1G5U A;  3CLO A;  3P7N A;  4LCM A;  3G32 A;  5HL1 A;  1OTE A;  3UB5 P;  4E3N A;  2QMI A;  5DFX A;  1TDL A;  1FQG A;  1EI5 A;  2JE5 A;  5A91 A;  4JLF A;  4JXW A;  4OQI A;  4OQG A;  2VK3 A;  1SKF A;  5CXW A;  5AJG A;  2WGI A;  1AWI A;  1Y54 A;  5HWW A;  3LY3 A;  3MF0 A;  4X68 A;  3C8C A;  4QWO A;  4HEF A;  3LR5 A;  4PM9 A;  1W8Y A;  1MC0 A;  1JTG A;  4Y5F A;  2V0W A;  3IH8 A;  3LGO A;  1DP8 A;  3VFF A;  1YLJ A;  2PR6 A;  2H0T A;  4X6T A;  1PYY A;  3IS2 B;  2ZC5 B;  2Q9N A;  2JKF A;  3IBJ A;  2W3E A;  4GD8 A;  5EFW A;  4MNR A;  2JN7 A;  1W79 A;  4IBR A;  3OOV A;  5HPF A;  1BLH A;  3MXQ A;  3BY9 A;  5EUA A;  3V67 A;  1FR6 A;  1RGZ A;  3DTM A;  2ZQC A;  1JWV A;  3H7W B;  4GDB A;  1M40 A;  1LI9 A;  4XXR A;  3S4X A;  5M1A A;  2J3W A;  3S22 A;  3F1P A;  4KQQ A;  1SDE A;  3NOP C;  4KZ4 A;  2B95 A;  3C4O A;  4IED A;  1PWG A;  2LB9 A;  2ZM0 A;  5AQ7 A;  3HL9 A;  1F98 A;  1HLU P;  1V9Z A;  2XLN A;  3BFF A;  4P6Z M;  2V8F A;  4DXC A;  2QYB A;  1K57 A;  1AXB A;  1N9B A;  2HDQ A;  2WZZ A;  5F1F A;  3F1N A;  4ZBE A;  1H5X A;  1GHI A;  5L10 A;  1PFL A;  3N8R A;  4EU0 A;  4IHQ A;  3U2A A;  3DBA A;  3CZD A;  4OLG A;  1MY8 A;  4GNU A;  2O0Y A;  1N4O A;  1D7E A;  5TGF A;  1MPL A;  2ACG A;  3HRE A;  3T4Q A;  1KOU A;  4S2M A;  5FAS A;  4DDY A;  4GJ4 A;  2KDK A;  1SCW A;  4BBT A;  2OAQ 1;  2W1T B;  2A49 A;  3CUE A;  2XEP A;  2Q0O A;  3UDX A;  4F3L B;  1ES4 A;  3SS4 A;  2RCX A;  3P98 A;  5CTM A;  1MWS A;  1K6R A;  4HP4 A;  4EEP A;  4O0P A;  3HBR A;  1ZHH B;  4KUO A;  1ERO A;  2WGW A;  4Q8I A;  2GJ3 A;  3OLO A;  4XUZ A;  5TBM B;  4HBT A;  3MXS A;  1IFQ A;  2ZL1 B;  3Q7V A;  4IUK A;  4R3B A;  3IBR A;  3KSH A;  5HWT A;  4K0X A;  4PKY A;  4RA7 A;  1YLT A;  4S2J A;  5FAQ A;  3M2J A;  3F1O A;  4F94 A;  4L9E A;  5FEF A;  2EFX A;  4OLD A;  5AQ9 A;  1D1J A;  3G30 A;  3C7V A;  2PYP A;  3NEC A;  3LR4 A;  5CTN A;  2PT7 A;  2E8I A;  4NXE A;  4R0Q A;  2XR0 A;  4P6B A;  4MBH A;  3EGX C;  1LLB A;  1IYS A;  4JF6 A;  1PWC A;  3MR0 A;  3ZFZ A;  1PI4 A;  4GD6 A;  1GSV A;  5EV0 A;  1G68 A;  5DF7 A;  3T1S A;  4PHT A;  3BLS A;  2H5S A;  2W1R A;  3PTE A;  2ZBB A;  5D3O A;  4FTX A;  4ME4 A;  5DTT A;  4PM8 A;  5L09 A;  3E0Y A;  3HLE A;  5HAP A;  4BD0 A;  5HDS A;  3IXG A;  3ZCZ A;  1OJ5 A;  4EQ1 A;  3R4K A;  4MEZ A;  3ZVW A;  2BAS A;  1I2W A;  2JHE A;  3CI6 A;  3MSH A;  4IJG A;  3T50 A;  1NLY A;  1G28 A;  4DJ3 A;  5F5Y A;  2PBD P;  1MWR A;  3ITB A;  1NLZ A;  4BBV A;  1ZG4 A;  5FI6 A;  1GSX A;  3TOI A;  4N92 A;  3T4J A;  1KE4 A;  2ZQ7 A;  1KDW A;  3LIF A;  1GA0 A;  3A3D A;  3N4I A;  1H8M A;  2I72 A;  4GCZ A;  3T1X A;  2HJ9 C;  4R70 A;  4B88 A;  2IWB A;  3W8K A;  3ICY A;  2FFF B;  1OT9 A;  2W3F A;  1W5D A;  4E3J A;  3C2W A;  4B9O A;  2WKI A;  4YNR A;  5EVE A;  2EX2 A;  4MCW A;  1DJB A;  5DVA A;  3LFV A;  3NHQ A;  2JKR I;  3A0S A;  3LIB A;  2J9O A;  2JKG A;  3JVV A;  1A0K A;  4ZAM A;  1NXY A;  5AQB A;  3MKE A;  3NI9 A;  4ZTK A;  3UPO A;  3NY4 A;  3RXX A;  3A3F A;  5HL6 A;  2L1M A;  4DE2 A;  2ZC3 B;  4S2P A;  3WS0 A;  2NUT C;  5EE8 A;  1QME A;  4KQO A;  1NRF A;  3G2Y A;  2XA7 S;  4R6L A;  5EVI B;  5J7E A;  4WUJ A;  5F68 A;  4BBU A;  3TRC A;  5HDC A;  2FZ0 A;  3NBL A;  3OCL A;  4C75 A;  5FL3 A;  4P87 A;  2BLS A;  3OPL A;  4E6X A;  5HAQ A;  4JF5 A;  3B47 A;  2Z6D A;  5GLA A;  2X02 A;  3UB9 A;  4CPK A;  3W4P A;  3S7Q A;  2J3T D;  1KE3 A;  3G2Z A;  3VSK A;  4UQI S;  2JKT M;  4WZ5 C;  3GMW A;  5E43 A;  5CHU A;  1LI0 A;  4G3V A;  3IXH A;  5KMW A;  5EVI D;  1NYY A;  3IH9 A;  2WKP A;  4KZB A;  1SKO A;  3IT9 A;  1MWT A;  1H8Z A;  1SZV A;  2GX5 A;  4FD8 A;  3D9Y A;  2Y55 A;  1L0D A;  3BYD A;  4FUW A;  1NYM A;  4MDZ A;  3VP3 A;  3H82 B;  3HLC A;  5DJT A;  3LID A;  2Y2K A;  3NCK A;  4O7D A;  2Z6C A;  3PR6 A;  1PW1 A;  2J8Y A;  3A0R A;  2W3D A;  2HP9 A;  1BT5 A;  4LPZ A;  1L0G A;  3ZHH A;  4JXS A;  4RX3 A;  1ZG6 A;  4PM6 A;  1K54 C;  4A5R A;  4OPZ A;  4B4X A;  2W3G A;  2XF3 A;  4I38 A;  3QP6 A;  2XRO A;  5M19 A;  1HTZ A;  4IBX A;  1FSW A;  3G34 A;  3JPU A;  4ESP A;  3SS3 A;  1K38 A;  2ZLY A;  4LLO B;  2V1B A;  1KE0 A;  4EEU A;  3IHA A;  3VP1 A;  2EX8 A;  3UB8 A;  5DF8 A;  3W4O A;  1H0M A;  4L9F A;  4Q0J A;  1NZO A;  1ESI A;  2J3T C;  3ZNT A;  4BEN A;  4MBF A;  2K2N A;  4NEE D;  3EEA A;  5KZH A;  2HJE A;  3BJN A;  3Q07 A;  5F1G A;  3LR0 A;  3UO9 A;  2EXB A;  2WK0 A;  5EVI C;  3VMA A;  3MBZ A;  2V0U A;  4IUH A;  3DWZ A;  4NK3 A;  2V20 A;  3GRJ A;  5IS1 A;  1JTD A;  1P9R A;  2A24 B;  3W4Q A;  3IWO A;  5FQQ A;  2VV6 A;  3E4Q A;  4XT2 B;  5FDS A;  1K55 C;  2VGL M;  3Q82 A;  5CED A;  1BTL A;  5HX9 A;  4WF0 A;  2PYR A;  2HDS A;  3UPP A;  5HZH A;  2WAD A;  2XFS A;  5L2F A;  1EW0 A;  2PBY A;  3Q1F A;  3PXP A;  1L0F A;  5FQI A;  4E3L A;  3GTC A;  3V39 A;  4KG5 A;  4LV0 A;  4KEN B;  1T18 A;  1RCJ A;  3CPT A;  5A92 A;  4DE3 A;  4LGW A;  1ESU A;  1U60 A;  2KX6 A;  4Z1W A;  2WKQ A;  1VET B;  1K25 A;  3ISG A;  3W2Z A;  4YFM A;  1BLC A;  5CGW A;  1VHM A;  3L7H A;  2WAE A;  4HES A;  3KX0 X;  1PW8 A;  1LSW A;  4QB8 A;  1TS7 A;  2QJ5 A;  4S2K A;  5F6A A;  5G4Z A;  3R7W B;  1HD8 A;  3QP4 A;  3HJK A;  2OLV A;  4LFU A;  4HH3 A;  2G2U A;  2V9A A;  3NDE A;  2J80 A;  2W1T A;  4N9K A;  1T1C A;  1S67 L;  4DJ2 A;  4Q0H A;  5E2G A;  1OTA A;  3GSG A;  4OOL A;  3QP2 A; 
#chains in the Genus database with same CATH homology
 1I5Q A;  4UAA A;  3IWI A;  1CI9 A;  3BEB A;  4K0X A;  4RA7 A;  1YLT A;  3N7W A;  4S2J A;  5FAQ A;  2C5W B;  1ES3 A;  3M2J A;  1L2S A;  4F94 A;  3OPR A;  2HDR A;  4EUZ A;  4EV4 A;  1BUE A;  4OPQ A;  4OPY A;  2EFX A;  4OLD A;  5AQ9 A;  3ZG7 B;  3G30 A;  1NY0 A;  1S6R A;  2JCH A;  3O88 A;  3C7V A;  2Y2H A;  3IXD A;  5EOO A;  3AGE A;  2WKE A;  2Z2M B;  3HUM A;  5CTN A;  3G4P A;  2B5R A;  2EX9 A;  2E8I A;  2VGJ A;  4JBF A;  1YLP A;  5FAP A;  3ZG5 A;  3ZNY A;  1GHM A;  3CG5 A;  4CJN A;  1BLS A;  4R0Q A;  1MXO A;  2XR0 A;  4DKI A;  4P6B A;  5EVL A;  2ZM8 A;  4MBH A;  3ZG8 B;  5CEC A;  1O07 A;  1XX2 A;  1YMS A;  1YLZ A;  5TFQ A;  1I2S A;  1LLB A;  1IYS A;  2Y2G A;  3M6H A;  5CHM A;  4JF6 A;  1PWC A;  4WEK A;  3ZFZ A;  1PI4 A;  4GD6 A;  2PU2 A;  1G68 A;  3UY6 A;  5DF7 A;  2V1Z A;  3BLS A;  4Y0U A;  2OLU A;  1XKZ A;  3EQV A;  1LL9 A;  1G6A A;  1K6S A;  2WYX A;  5F83 A;  4UA9 A;  2H5S A;  4JXV A;  4BQM A;  3PTE A;  3HLG A;  4E6W A;  5CGS A;  3TG9 A;  5D3O A;  1Z6F A;  3MZF A;  4GB7 A;  2Y2P A;  3G31 A;  4N1H A;  5DTT A;  4PM8 A;  5E2F A;  5GHZ A;  2Y2N A;  3PBQ A;  3HLE A;  2R9X A;  3UPN A;  5HAP A;  4K0W A;  2XFT A;  4BD0 A;  5BOH A;  3IF6 C;  1CI8 A;  3IXG A;  5GL9 A;  3ZCZ A;  3PBO A;  3OZH A;  1DY6 A;  3QNC A;  5M18 A;  4MEZ A;  3ZVW A;  4BLM A;  4KG2 A;  4FH4 A;  1I2W A;  1LL5 A;  1E3U D;  3BFC A;  3A3I A;  4DDS A;  2ZQ9 A;  4X56 A;  4WMC D;  3VOZ A;  1CK3 A;  4EBN A;  4PM5 A;  3C7U A;  5FA7 A;  4L0L A;  3QHY A;  3IF6 A;  3DWK A;  1LHY A;  4DE0 A;  2WUQ A;  2G2W A;  2HP6 A;  2IWD A;  4N9L A;  3NIA A;  1MWR A;  1YLW A;  3ITB A;  4GDN A;  4UHU A;  4XUX A;  4BL2 A;  5HW3 A;  3OPP A;  4EBL A;  4OQH A;  1ZG4 A;  3PBR A;  5FI6 A;  4OP5 A;  4QY5 A;  3TOI A;  3V3R A;  4N92 A;  3MZD A;  1KE4 A;  2ZQ7 A;  1FR1 A;  1KDW A;  2Q9M A;  3BFD A;  4ID4 A;  1ONH A;  1GA0 A;  1KVL A;  3E2L A;  3A3D A;  2FFY A;  3N4I A;  2I72 A;  3V5M A;  1IEL A;  1YMX A;  3TSG A;  4R1G A;  4C6Y A;  3ZGA B;  3FV7 A;  3FKW A;  1Q2P A;  1CEF A;  4B88 A;  2IWB A;  3W8K A;  3SH9 A;  2FFF B;  3WRZ A;  4GKU A;  4DE1 A;  2IWC A;  5E2E A;  5FAO A;  1W5D A;  3BLM A;  3PBN A;  3WRT A;  4E3J A;  4BD1 A;  3Q7Z A;  4JF4 A;  2WKI A;  1BZA A;  3RXW A;  1E25 A;  2EX2 A;  4E3K A;  1DJB A;  3C4P A;  5DVA A;  4Z9Q A;  3OCN A;  1XPB A;  2WAF A;  5GLB A;  1TEM A;  3A3J A;  1ERM A;  4E3I A;  3SH8 A;  4UA7 A;  1FCM A;  2ZMA A;  5IHV A;  4ZDX A;  3UE3 A;  5A90 A;  3LO7 A;  1KDS A;  1BSG A;  3LEZ A;  1IYO A;  2P9V B;  2J9O A;  2RL3 A;  4ZAM A;  5CRF A;  3E2K A;  5CER A;  1NXY A;  2A3U A;  4WBG A;  3HLB A;  4EBP A;  3HUO A;  2QPN A;  3V3S A;  4YIN A;  1QMF A;  5AQB A;  3P09 A;  2WGV A;  3MKE A;  2Y2O A;  3NI9 A;  3FWL A;  5EPH A;  4ZTK A;  4JKT A;  3VSL A;  3UPO A;  3NY4 A;  1K4F A;  4LCL A;  3G35 A;  1KGE A;  3RXX A;  3A3F A;  5KSH A;  4EQI A;  4P0M A;  5DF9 A;  5FI7 A;  4DE2 A;  3O86 A;  2ZC3 B;  2J7V A;  4R4S A;  4QU3 A;  4S2P A;  2P9V A;  3MFD A;  1ZC2 A;  4KG6 A;  4LV2 A;  3MZE A;  2XQZ A;  3IQA A;  4OQ0 A;  4KZ9 A;  3N8L A;  1KVM A;  5EE8 A;  3UE0 A;  3WS0 A;  1WYC A;  3SH7 A;  1K56 D;  1QME A;  4ZJ1 A;  4R3J A;  3I7J A;  1ERQ A;  4KQO A;  5CGX A;  4BL3 A;  1NRF A;  3G2Y A;  1VM1 A;  3MXR A;  4S2L A;  3LY4 A;  5DTK A;  3PBS A;  4S2N C;  1J9M A;  5J8X A;  3Q81 A;  3LCE A;  1PZP A;  5EVI B;  5F82 A;  4DF6 A;  2JBF A;  3SS5 A;  2R9W A;  3OC2 A;  2UWX A;  4D2O A;  4OKP A;  5JYO A;  3VOY A;  3NBL A;  3OCL A;  4GN2 A;  5FSR A;  3WS4 A;  4C75 A;  3WS1 A;  3BFE A;  1E3U A;  4S2N A;  3HLD A;  4P87 A;  5GLD A;  2BLS A;  4WMC A;  3D4F A;  1FCN A;  2OSU A;  3FKV A;  4Y0O A;  3OPL A;  4FH2 A;  4E6X A;  1MKI A;  1IYQ A;  5HAQ A;  4JF5 A;  3NDG A;  4DRT A;  4HBU A;  4KZA A;  3HUN A;  4U3T A;  1ES2 A;  5GHY A;  1FCO A;  4KZ8 A;  4ZJ3 A;  4KZ7 A;  5GLA A;  4Y7P A;  2X02 A;  1HZO A;  4CPK A;  1IYP A;  2ZJ9 A;  4KZ3 A;  1M6K A;  3W4P A;  1KE3 A;  3G2Z A;  1ALQ A;  3VSK A;  1IKI A;  4WZ5 C;  1EWZ A;  2ZC6 B;  3GMW A;  4QY6 A;  5E43 A;  4FCF A;  5CHU A;  3IHB A;  3BFG A;  4WZ4 A;  2Y59 A;  2HPB A;  2X71 A;  4X55 A;  1LI0 A;  3UN7 A;  4PPR A;  1K55 A;  3ZG9 B;  5GLC A;  3IXH A;  3BM6 A;  5KMW A;  3OPH A;  1SDN A;  1XA7 A;  5EVI D;  4OP8 A;  1NYY A;  3IH9 A;  4QJG A;  2H0Y A;  3IF5 A;  4WZ5 A;  4KZB A;  3IT9 A;  1MWT A;  1H8Z A;  4U0X A;  4C3Q A;  2EX6 A;  4E3O A;  2VGK A;  4FD8 A;  1JVJ A;  1JWP A;  2X01 A;  1NZU A;  1RGY A;  2Y55 A;  4S2O A;  1L0D A;  2C6W B;  1HVB A;  2HP5 A;  3AGD A;  1NYM A;  3BYD A;  4B4Z A;  4U0T A;  3C5A A;  3VFH A;  3VP3 A;  4GOG A;  1TVF A;  2CC1 A;  1L0E A;  4LEN A;  3VP0 A;  3HLC A;  5FQ9 A;  5CHJ A;  2Y2K A;  3NCK A;  2ZD8 A;  4O7D A;  4LCM A;  3G32 A;  1PW1 A;  2J8Y A;  5HL1 A;  4Y0T A;  1XGI A;  2HP9 A;  4OVD A;  5FAT A;  4E3N A;  2QMI A;  1BT5 A;  3UDI A;  5HFO A;  1TDL A;  1S0W A;  1DJA A;  1FQG A;  4IVI A;  4IVK A;  3UE1 A;  1L0G A;  3ZHH A;  1EI5 A;  3IWQ A;  4JXS A;  4S2I A;  2XD5 A;  4RX3 A;  2JE5 A;  5A91 A;  1ZG6 A;  3M2K A;  4JLF A;  3HLW A;  4JXW A;  4OQI A;  4GZB A;  4OQG A;  4PM6 A;  4OOL A;  3VP4 A;  1WYB A;  2JC7 A;  1YLY A;  1K54 C;  1Q2Q A;  1SKF A;  4A5R A;  2Y2J A;  4OPZ A;  4WEJ A;  2WGI A;  3ITA A;  5CXW A;  2ZC7 A;  1Y54 A;  3EQU A;  4B4X A;  2XF3 A;  4KZ6 A;  3LY3 A;  3FYZ A;  3A3E A;  1GCE A;  3M6B A;  1E4D A;  3Q7V B;  4E3M A;  2ZQD A;  4X68 A;  5G18 A;  3SOI A;  3ZG0 A;  2OV5 A;  5M19 A;  1HTZ A;  4HEF A;  4IBX A;  1FSW A;  1K54 A;  2Y2L A;  1GHP A;  1W8Y A;  4PM9 A;  3G34 A;  1JTG A;  2Y4A A;  1MBL A;  1OME A;  1SHV A;  3SS3 A;  2V2F F;  1K38 A;  2ZLY A;  4WYY A;  1TDG A;  3GVB A;  1PZO A;  4M3K A;  3IH8 A;  4P85 A;  1W7F A;  3N8S A;  1K56 A;  3GR2 A;  4EWF A;  1KE0 A;  3VFF A;  1YLJ A;  5I94 A;  4PM7 A;  1FSY A;  3IHA A;  4MBK A;  4KQR A;  2H0T A;  4FSF A;  4X6T A;  3VP1 A;  2EX8 A;  1PYY A;  3FZC A;  4OOM A;  5DF8 A;  3W4O A;  2Y91 A;  5EOE A;  2ZC5 B;  2Q9N A;  4WM9 A;  3UNW A;  3QNB A;  4GD8 A;  1NZO A;  2BG1 A;  5KSC A;  1ESI A;  4MNR A;  4ZJ2 A;  1W79 A;  1VQQ A;  1PI5 A;  4IBR A;  3ZNT A;  4BEN A;  4JPM A;  1H8Y A;  4MBF A;  1BLP A;  3WS2 A;  5KZH A;  4OON A;  2J9P A;  1BLH A;  3JYI A;  3Q07 A;  4OOY A;  3N6I A;  5EUA A;  5F1G A;  3UO9 A;  1FR6 A;  2EXB A;  2Y2I A;  2WK0 A;  3HVF A;  1RGZ A;  4QD4 A;  3DTM A;  3MBZ A;  5EVI C;  3VMA A;  2ZQC A;  3O3V A;  3DWZ A;  3PAE A;  4NK3 A;  4BJP A;  2V20 A;  1JWV A;  3GRJ A;  2DNS A;  1JTD A;  1C3B A;  4RVA A;  3W4Q A;  4GDB A;  4KZ5 A;  5FQJ A;  1M40 A;  1LI9 A;  3GQZ A;  4DXB A;  4XXR A;  3S4X A;  1RP5 A;  3IWO A;  5FQQ A;  5M1A A;  3S22 A;  4OPR A;  4KQQ A;  5EVI A;  1K55 C;  1DJC A;  3Q82 A;  5CED A;  1SDE A;  1BTL A;  4NET A;  5HX9 A;  4KZ4 A;  5TR7 A;  2HDS A;  3C4O A;  2QZ6 A;  1K57 C;  1XXM A;  2H10 A;  2WKH A;  1KGG A;  4IED A;  1PWG A;  3UPP A;  1KGF A;  2WAD A;  2XFS A;  3VP2 A;  2ZM0 A;  4JXG A;  5L2F A;  5AQ7 A;  2PBY A;  4MLL A;  3HL9 A;  1ZKJ A;  3Q1F A;  2XLN A;  3DW0 A;  3V50 A;  1L0F A;  3CMZ A;  3BFF A;  3NC8 A;  4LV1 A;  4X53 A;  4RYE A;  2HDU A;  5FQI A;  1W8Q A;  3IF6 B;  4E3L A;  3GTC A;  4DXC A;  3PAG A;  1K57 A;  1AXB A;  1N9B A;  3V39 A;  1XP4 A;  5EEC A;  2GDN A;  3RJU A;  2HDQ A;  4KG5 A;  5JYP A;  2Z2L B;  2P74 A;  1GA9 A;  2WZZ A;  3MKF A;  4LV0 A;  4LV3 A;  4KEN B;  5U47 A;  5F1F A;  4ZBE A;  1NJ4 A;  1H5X A;  4WEL A;  1GHI A;  1RCJ A;  5A92 A;  5FDH A;  3N8R A;  4DE3 A;  2ZM2 A;  3HLF A;  4UA6 A;  1K4E A;  1ESU A;  1U60 A;  3CZD A;  5AQA A;  2XD1 A;  4OLG A;  1MY8 A;  2ZQ8 A;  2XH9 A;  4R4R A;  4GNU A;  1N4O A;  1K25 A;  1ONG A;  3O87 A;  3ISG A;  5TGF A;  4YFM A;  5FQM A;  1MPL A;  3WWX A;  3HRE A;  2ZQA A;  1BLC A;  3B3X A;  5HAI A;  4S2M A;  5CGW A;  5FAS A;  2EXA A;  4DDY A;  2PU4 A;  3BRM A;  3ZDJ A;  2WAE A;  4HES A;  2XGN A;  3PBT A;  1ES5 A;  1YM1 A;  5DTS A;  1XA1 A;  4QHC A;  1PWD A;  1PW8 A;  1SCW A;  2DCF A;  4QB8 A;  5FQK A;  5GHX A;  5CEB A;  4H8R A;  3GV9 A;  2A49 A;  2WGW B;  2XEP A;  5FI2 A;  1PIO A;  2XK1 A;  1O7E A;  3BEC A;  1MWU A;  4S2K A;  3UDX A;  2DRW A;  2ZC4 B;  1ES4 A;  4X69 A;  2Y2Q A;  1IEM A;  2WZX A;  3SS4 A;  1YQS A;  3UDF A;  2RCX A;  3IXB A;  1HD8 A;  3P98 A;  2EFU A;  5A93 A;  1XGJ A;  5CTM A;  1MWS A;  4K91 A;  1WE4 A;  4PMA A;  2OLV A;  2G2U A;  3ZVT A;  1K6R A;  3NDE A;  4N1X A;  1YT4 A;  3HBR A;  1ERO A;  2WGW A;  4N9K A;  4R23 A;  5HAR A;  1CEG A;  4Q8I A;  3WS5 A;  4RX2 A;  4XUZ A;  4HBT A;  5E2G A;  2Y2M A;  3GSG A;  3MXS A;  4OH0 A;  3S1Y A;  3CJM A;  1BUL A;  1IKG A;  1FOF A;  1JWZ A;  3Q7V A;  3AGF A;  2XDM A;  5E2H A;  4R3B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...