3FYZA

Oxa-24 beta-lactamase complex with sa4-17 inhibitor
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
244
structure length
243
Chain Sequence
HISSQQHEKAIKSYFDEAQTQGVIIIKEGKNLSTYGNALARANKEYVPASTFMLNALIGLENHKATTNEIFKWDGKKRTYPMWEKDMTLGEAMALSAVPVYQELARRTGLELMQKEVKRVNFGNTNIGTQVDNFWLVGPLKITPVQEVNFADDLAHNRLPFKLETQEEVKKMLLIKEVNGSKIYAKSGWGMGVTPQVGWLTGWVEQANGKKIPFSLNLEMKEGMSGSIRNEITYKSLENLGII
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Beta-lactamase OXA-24
publication title Design, synthesis, and crystal structures of 6-alkylidene-2'-substituted penicillanic acid sulfones as potent inhibitors of Acinetobacter baumannii OXA-24 carbapenemase.
pubmed doi rcsb
source organism Acinetobacter baumannii
total genus 81
structure length 243
sequence length 244
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2009-01-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3fyzA00
3IH8A 2Q9MA 4N1HA 3ZHHA 4BD1A 3VMAA 2DCFA 4UA6A 4BL3A 5EPHA 1KE0A 1ES5A 2Y2LA 3BFDA 4ZJ3A 3IF6C 1SDNA 4KQQA 5EOOA 5FQIA 4S2OA 5CERA 4LV3A 2Y2PA 4QU3A 3QNCA 4KG6A 2PBYA 1HD8A 1CEFA 1MBLA 3QHYA 1XA1A 4WYYA 4JBFA 3OCLA 3IXBA 3GV9A 3BEBA 2J9OA 3Q07A 4E6XA 3DWZA 4WM9A 3HUOA 4R4SA 1OMEA 5IHVA 2V20A 1YT4A 2ZQ8A 5AQAA 5HW3A 2ZD8A 1VM1A 3GQZA 5JYOA 3OPPA 1W79A 4P6BA 3LCEA 5EECA 4PM5A 2OLUA 3BLSA 4WMCA 4C6YA 3NDGA 4PMAA 5KMWA 3UO9A 3TOIA 4OPQA 1K6SA 1MKIA 3ITBA 5E43A 5EVIB 4OPRA 5KSHA 3C4OA 3HLCA 4JF4A 4S2NA 4RX3A 4N92A 3OPRA 2ZJ9A 2ZQAA 3SOIA 3SH9A 3Q7VA 4X53A 3LY4A 4WMCD 5A93A 5GHYA 1PI4A 1PW8A 1KDSA 4WBGA 3MKEA 3BFEA 4ZDXA 3BM6A 4R3BA 3GSGA 3PBOA 5HAPA 3AGEA 4DE0A 1IYOA 4OLDA 1SHVA 3NI9A 4YFMA 5F1GA 4DXCA 2ZLYA 4GN2A 2B5RA 4EQIA 5GLDA 3SS5A 4EUZA 4C3QA 5AQ9A 4RVAA 5EOEA 1LHYA 3EQVA 3RJUA 4E3OA 1BLPA 2Y2GA 4RYEA 1ZG6A 2XD5A 4OQGA 1XX2A 4RX2A 5KSCA 5BOHA 4UHUA 4JKTA 1ONHA 1NJ4A 2ZMAA 3G2YA 1WYBA 2PU4A 1S0WA 4KQOA 4N9KA 5HFOA 2XQZA 3IWIA 1EWZA 1WE4A 4OLGA 4OPZA 3SH7A 3ZFZA 3NBLA 1FCOA 1JVJA 5G18A 1ES4A 2WKIA 1K55C 4LV0A 4KZ9A 2ZM8A 3TG9A 3UPPA 3M6HA 2ZC6B 5FI2A 3SH8A 4WZ5A 4K91A 2C6WB 2WAEA 1IYPA 3VOYA 4EV4A 3IH9A 2WKHA 4DE3A 1I2WA 2HDQA 1CK3A 3N7WA 4OPYA 3VP1A 3FKWA 3HREA 2PU2A 3UDFA 5M18A 1PZPA 2FFYA 2FFFB 3A3IA 1MXOA 1GA0A 2HP9A 5DF9A 2XK1A 1N9BA 2Y2OA 1PWCA 3B3XA 3N6IA 4KZ6A 5A91A 4C75A 3G31A 4FH2A 2H10A 4DE2A 1IYQA 5FQJA 2Y59A 3MKFA 1GHMA 3S22A 2XEPA 3IXDA 3UE1A 2BG1A 1XGIA 5FDHA 4Y0OA 3UE3A 1G68A 2EXBA 4KZAA 5HX9A 1RCJA 3UDXA 5DVAA 5FASA 2OV5A 3WS4A 4FH4A 3PAGA 2ZC3B 4JPMA 4PPRA 3ZG0A 3MFDA 3G35A 3HUNA 3PBNA 4S2NC 5GHZA 1G6AA 2OLVA 4UA7A 4ZJ2A 4GKUA 1W7FA 5DTKA 1KE3A 3CJMA 4X6TA 3A3JA 1YLTA 1MPLA 1L0EA 3VP2A 5KZHA 1BTLA 2Y2QA 4GNUA 3FZCA 4IBRA 3NDEA 2XFTA 4QY5A 3CG5A 2QZ6A 1Z6FA 2R9WA 1K54C 3IWQA 2OSUA 4MBHA 1CI9A 3FV7A 1LL5A 4KZ7A 2BLSA 1XP4A 1BLHA 2CC1A 2R9XA 4M3KA 1XXMA 5CEBA 3AGFA 4KZ3A 4Q8IA 4GB7A 4HEFA 2Y2IA 4D2OA 3UY6A 4DXBA 1EI5A 4KZ5A 4S2KA 4WEKA 1QMFA 1Q2QA 1ERMA 1XKZA 1RGYA 4P0MA 5CGSA 1XPBA 1ESUA 3C7VA 5JYPA 4S2IA 1I2SA 2JE5A 4IBXA 1LI0A 4R0QA 1JTGA 1K25A 1K4EA 1YLPA 1ZKJA 3A3EA 4OOLA 4ZJ1A 3ZGAB 3O86A 2VGKA 5CHUA 1ZC2A 1DJCA 4PM7A 4XUXA 4KG5A 5E2GA 5FAPA 5E2FA 2P9VB 2WADA 3C4PA 1M40A 4UAAA 3HLGA 4U3TA 2HP5A 2ZC5B 3FKVA 3ITAA 3UPOA 3ZCZA 4JXWA 1MWTA 1SCWA 4JF6A 4PM9A 3WWXA 3V3SA 3VP3A 3PAEA 3IF6B 3LEZA 4WZ5C 3SS4A 4B88A 1I5QA 4KQRA 4OONA 3IHAA 3NY4A 3UN7A 5F1FA 4Y7PA 1MY8A 3MZDA 1JWZA 3WS0A 4S2MA 3D4FA 1KVLA 5FATA 1BLSA 4DDYA 5CTMA 1YQSA 3HLBA 2EXAA 1TEMA 3E2LA 4JF5A 3PBRA 3VOZA 2EFXA 4JXVA 1NZUA 1S6RA 1FSWA 3HUMA 3PBSA 5FAOA 2WUQA 4JXGA 3V50A 2WGWB 1EROA 4H8RA 4KZ4A 5A90A 2DNSA 4MEZA 3GTCA 5EVIA 3PTEA 3ZVTA 5FAQA 2HDRA 1GHIA 3LO7A 5GHXA 3BECA 1LLBA 1MWSA 1YLYA 3GR2A 3VP0A 3FWLA 5F82A 3WRTA 3RXWA 3WS2A 5M1AA 1XGJA 5CGWA 2H0YA 1ONGA 1L2SA 2ZQCA 4OVDA 1FCMA 3C7UA 3G32A 1KE4A 3VFFA 2JCHA 5DTSA 3FYZA 5EVID 1O07A 4GDBA 5DF7A 4UA9A 4MNRA 5TR7A 5HAQA 2Y2MA 4R3JA 4ZBEA 3BFGA 1CEGA 2WZXA 2EX6A 4U0TA 1U60A 3BFCA 3MXSA 3S4XA 1GCEA 1JWPA 1RGZA 2XLNA 3VFHA 1IELA 2G2UA 4FD8A 4FCFA 1PZOA 5FQ9A 1ESIA 3VSKA 1K56A 1W8QA 2Y91A 3HBRA 3WS1A 5CEDA 1N4OA 4QY6A 4F94A 1BSGA 1LI9A 3W4PA 2WZZA 4JXSA 1BZAA 4GZBA 4Y0UA 3JYIA 3Q1FA 5DF8A 1W8YA 1Y54A 5CHJA 3UNWA 2H5SA 3DWKA 4OP5A 5CRFA 1NRFA 2ZM2A 4LCMA 1K56D 1DJAA 3ZG7B 3ZG5A 4KZBA 1GA9A 4KG2A 3LY3A 4WELA 1HTZA 4CPKA 4E3IA 4E6WA 1ES3A 2QMIA 4OOMA 4DDSA 2VGJA 5TGFA 3ZDJA 3N8SA 1YM1A 2WYXA 5E2EA 5HL1A 2ZQ7A 3I7JA 4EBPA 4QJGA 2IWCA 2QPNA 2X02A 2X01A 5J8XA 1DY6A 1PW1A 1TVFA 3UPNA 2XD1A 5GLAA 2WGIA 1BT5A 5FA7A 2X71A 1Q2PA 3C5AA 3O88A 5U47A 3G4PA 3NIAA 1PYYA 3OCNA 1YLJA 1ZG4A 3GRJA 4WZ4A 5FSRA 3WRZA 4LV2A 4OKPA 3S1YA 3ZNYA 3HL9A 4NK3A 4OH0A 1BUEA 2WGVA 4K0WA 5EUAA 5FQQA 4ZTKA 2ZC4B 2ZC7A 4OOYA 4P85A 1YMXA 3HLWA 5HARA 2EX9A 3IXGA 2J8YA 3IXHA 1QMEA 3OPLA 4OQ0A 4E3JA 2IWDA 3P98A 5EE8A 4A5RA 2JC7A 5AQBA 4QHCA 5FQKA 1K55A 4OP8A 3ZG8B 4K0XA 4DF6A 1C3BA 1L0DA 1KGGA 4O7DA 4IVKA 4Z9QA 3DW0A 3V39A 4DKIA 4PM6A 4QD4A 1FR6A 2GDNA 4L0LA 5HAIA 1ES2A 5A92A 3W4OA 1HVBA 2J9PA 3Q7VB 1TDLA 1PIOA 5CGXA 3IQAA 5FQMA 3WS5A 1CI8A 1BULA 3OZHA 3N8LA 4R23A 4IVIA 3P09A 4MBFA 4OQIA 2H0TA 4S2JA 3A3DA 1O7EA 1KGEA 1M6KA 3BYDA 4HESA 4YINA 2IWBA 4E3MA 1L0GA 2HPBA 4EWFA 3O87A 1H8ZA 3N4IA 4QB8A 1FOFA 4XXRA 1K57A 2UWXA 1IKIA 4GDNA 5I94A 1H5XA 3PBTA 3OPHA 3PBQA 4X68A 1YMSA 4IEDA 3G34A 3A3FA 3GVBA 3O3VA 2P9VA 4GOGA 1MWUA 3M2KA 3ZG9B 4BQMA 5FI6A 3IWOA 2G2WA 2EX2A 3TSGA 5CTNA 1BLCA 5TFQA 3HLDA 4R1GA 4S2LA 1JTDA 4ZAMA 2A3UA 4LV1A 4DRTA 5CXWA 3ZVWA 1ERQA 2XDMA 4B4ZA 1E3UA 3GMWA 3IF6A 3DTMA 1ALQA 2V2FF 1E25A 1TDGA 3G2ZA 1KDWA 5M19A 1NYYA 4ID4A 5L2FA 1K54A 5D3OA 4PM8A 4MLLA 2V1ZA 2WAFA 3BRMA 3CZDA 3Q82A 2DRWA 2HP6A 4LCLA 3W4QA 4EBLA 4XUZA 4BLMA 2C5WB 4KENB 2RL3A 5DTTA 1GHPA 1YLZA 3QNBA 1IKGA 2P74A 4DE1A 1E3UD 3HLFA 4CJNA 2Q9NA 2WGWA 1PWDA 5FI7A 1YLWA 2A49A 2XR0A 1KGFA 2EX8A 2EFUA 2XFSA 1K4FA 3E2KA 2HDSA 4NETA 3M2JA 4JLFA 2E8IA 3VP4A 4WEJA 2Y2KA 2Y2JA 4BL2A 2Z2LB 4KZ8A 1FQGA 5CHMA 1NY0A 3G30A 2Y55A 5GLCA 5CECA 4E3LA 1SDEA 3SS3A 5E2HA 4U0XA 4MBKA 1SKFA 3IT9A 2XGNA 3ISGA 4GD8A 4EBNA 3RXXA 2ZQDA 4BJPA 4X69A 1K6RA 1L0FA 1J9MA 2Y4AA 1NZOA 1K38A 1H8YA 3Q81A 4HBTA 4N1XA 5GL9A 1PI5A 2J7VA 4E3NA 4Y0TA 3MBZA 1LL9A 2RCXA 2ZM0A 1PWGA 4E3KA 3ZNTA 3AGDA 3HVFA 4R4RA 2I72A 1IEMA 1JWVA 1MWRA 1NYMA 1RP5A 3IHBA 3N8RA 3OC2A 3Q7ZA 2WKEA 1NXYA 4RA7A 2WK0A 1DJBA 2Y2NA 1IYSA 3UE0A 5F83A 3NCKA 4N9LA 4LENA 4X56A 5GLBA 4GD6A 3V5MA 1FCNA 4P87A 2HDUA 2Y2HA 4OQHA 3NC8A 3EQUA 4S2PA 1XA7A 1HZOA 1FR1A 3BFFA 3M6BA 3W8KA 1KVMA 1VQQA 3MZEA 4X55A 3VSLA 2JBFA 1K57C 2Z2MB 1AXBA 1W5DA 1WYCA 3IF5A 4FSFA 1FSYA 5EVLA 4B4XA 3UDIA 2XF3A 2ZQ9A 3MZFA 3BLMA 2XH9A 4BENA 1E4DA 3CMZA 3MXRA 5AQ7A 3HLEA 3V3RA 4BD0A 4HBUA 5EVIC
chains in the Genus database with same CATH superfamily
4Z1WA 3DTKA 3VMAA 4UA6A 1ES5A 4ZJ3A 3DAVA 3IF6C 1YSQA 4Y17A 2VGLM 5F5YA 3T1XA 1Y28A 5CERA 2PBYA 1HD8A 2V8CA 3IXBA 3DWZA 4FOFA 4WM9A 3HUOA 4R4SA 5AQAA 5HW3A 5G4ZA 2KLIA 1X0OA 5EECA 4OPQA 1K6SA 5E43A 4OPRA 1TS8A 1TF1A 5KSHA 3ZYTA 3MMHA 1GSWA 3Q7VA 4JGQA 1OTAA 2O9CA 3LY4A 3NOTC 1PNEA 3B47A 3R7WB 3BM6A 4ZRRA 4IUKA 5HAPA 1LSXA 2HF6A 1IYOA 2OWJA 3CI6A 4DXCA 4GN2A 4CLCD 4EQIA 5GLDA 2JHEA 2K2NA 1Z09A 1GSXA 4E3OA 3MJQA 3UB7A 5KSCA 2W0NA 3NULA 2EA9A 4EW7A 2V0UA 3SH7A 5L09A 1T19A 1FCOA 5G18A 3A0SA 4I3IA 1ES4A 1OTBA 3T4QA 3UPPA 2ZC6B 3SH8A 4WZ5A 4EV4A 3VP1A 3K3DA 5M18A 4GW9A 1FILA 2FFFB 1GSVA 4Y2FA 3NJAA 2XK1A 1N9BA 3N6IA 1PWCA 4KZ6A 1IYQA 2Y59A 4I39A 1D1JA 3VE3A 1G68A 3E4OA 4KZAA 3P7NA 3P01A 3HUNA 3PYPA 3BW6A 5HPIA 4HIAA 4ZJ2A 5DTKA 1YLTA 1MPLA 3LI8A 3MFXA 3KYQA 4IBRA 4QY5A 2QZ6A 3S7QA 4KZ7A 1XP4A 1BLHA 2CC1A 5KIZA 4EXOA 3T1QB 4S2KA 1QMFA 1Q2QA 4P0MA 1XPBA 4B9OA 1XJ3A 1I2SA 1JTGA 1ZKJA 3ZGAB 4PAUA 2VGKA 4I3AA 4KG5A 5FAPA 1M40A 3HLGA 4U3TA 3FKVA 5DFXA 1MWTA 4Q0IA 3UB6A 3VP3A 5EM1A 4LRXC 3IBRA 4WZ5C 4E04A 4X1MA 4WLAA 2BTFP 1MY8A 3D4FA 1BLSA 5CTMA 3T12B 3JVUA 3PBRA 1F9IA 1NZUA 5F69A 3V50A 1EROA 3A0RA 2DNSA 3F1PB 3GTCA 3LR5A 5FAQA 2HDRA 4BBUA 3UE6A 4M4XA 3LO7A 5F82A 3E0YA 2M7VA 3RXWA 3WS2A 1HLUP 4GHIA 2ZQCA 3MR0A 3FYZA 5DTSA 3R7WA 5EVID 3RFBA 4UA9A 5TR7A 2Y2MA 2J80A 1J3WA 4DMZA 3NHQA 1TS6A 2WZXA 3UB8A 1G6OA 3BFCA 1JWPA 2XLNA 1IELA 5K5BA 2L1MA 5FQ9A 1N4OA 3O5YA 3W4PA 1BZAA 3JYIA 4BBTA 4HNBA 2QKPA 5CRFA 4KZBA 5L10A 2B95A 4OOMA 2VZWA 3ZDJA 2VV6A 1YM1A 2WYXA 2ZQ7A 3LFVA 1PW1A 3UPNA 4YNRA 5FA7A 2X71A 3C5AA 3G4PA 5HL6A 5HWTA 4P6ZS 5L07A 3WRZA 3DTIA 2MJ6A 4NK3A 3KX0X 4OH0A 1PRQA 4ZTKA 2ZC4B 4OOYA 3IXHA 4OQ0A 3OPLA 1QMEA 2PR6A 3IX4A 2JC7A 5AQBA 3MQQA 1K55A 4DF6A 1L0DA 2QJ5A 4DKIA 4PM6A 4QD4A 3EGXC 2J9PA 4O01A 3IQAA 5FQMA 2ZMFA 2BASA 4OQIA 5EV0A 3A3DA 1KGEA 3BYDA 4EWFA 2HPBA 1DRMA 2V1BA 2V1AA 3N4IA 1FOFA 4GDNA 3D72A 3LIBA 3PBQA 3G34A 3GVBA 2EX2A 1OJ5A 1BLCA 1OTIA 3HLDA 2A3UA 4LV1A 5CXWA 1ERQA 3T4LA 2W3HA 1ALQA 1KDWA 1CJFA 5L2FA 1K54A 5D3OA 3ULFA 2V1ZA 2WAFA 3BRMA 1S66L 3KSGA 5DTTA 2JKTI 1VETB 1YLZA 3QNBA 1E3UD 2Q9NA 3F1OA 2XR0A 1KGFA 4PKYG 2E8IA 1TS7A 4WEJA 4BL2A 4KZ8A 3ZQ5A 1CF0A 3G30A 3F1NB 3HCYA 2Y55A 5CECA 4E3LA 2VA0A 3SS3A 5E2HA 3BQ8A 4Y3IA 1L0FA 1J9MA 2Y4AA 5J3WA 1H8YA 3ICYA 4E3KA 2ZM0A 4HH3A 3RH8B 5HDCA 3E98A 1IEMA 3OC2A 2PR5A 2VK3A 1DJBA 4LENA 4EU0A 1XJ2A 4S2PA 1XA7A 3BFFA 3M6BA 3W8KA 4X55A 2JBFA 4FSFA 1WYCA 4BWIA 4MN7A 1FSYA 4B4XA 2OAP1 3UDIA 4HP9A 1LSWA 2ZQ9A 2GNXA 3HLEA 4HBUA 3IH8A 5EPHA 3KYZA 4EUVA 3E4PA 1SDNA 5EOOA 5FQIA 2M1CA 3T1SA 2Y2PA 4KG6A 1MBLA 1VEUB 3BEBA 2J9OA 3MF0A 4P6ZM 4E6XA 1FIKA 1YT4A 1LT0A 2ZQ8A 3T50A 2ZD8A 1VM1A 4I3JA 5JYOA 3LCEA 1NLYA 2ZMVA 3D3OA 4HOIA 5EVIB 3C38A 3H7WA 3H82A 3SH9A 2V0WA 4CLCA 5GHYA 2VJWA 1PI4A 3MKEA 4ZDXA 4R3BA 4F3LB 4YWZA 3T1RA 3GSGA 2HZ5A 3SS5A 4EUZA 5AQ9A 3QP4A 1LHYA 1BLPA 3LYXA 4RYEA 2XD5A 4Y15A 2D01A 3L9KA 2PU4A 1KOUA 5HFOA 4OPZA 3NBLA 2WKIA 1VETA 3TG9A 5DJTA 2C6WB 3VOYA 2HDQA 1CK3A 3N7WA 3HREA 4WL9A 1G5UA 1MXOA 2Y2OA 4C75A 3G31A 3F1NA 3S22A 5CX7A 5FQJA 3MKFA 1GHMA 3C30A 4EEPA 2BG1A 3UE3A 2PD8A 1S4RA 5FASA 5DVAA 1UWPX 2OV5A 4FH4A 4PPRA 2ZC3B 3MFDA 2Z6CA 4GKUA 1KE3A 4PKYA 2O99A 1H0MA 4MN5A 3NDEA 3CITA 2V8FA 3IWQA 2JKRM 3FV7A 5CEBA 5HPFA 4KZ3A 4HEFA 2Y2IA 1P9RA 4KZ5A 1YSPA 4S2IA 4IBXA 1LI0A 4R0QA 3A3EA 1K4EA 1YLPA 4PM7A 4XUXA 3QP5A 2P9VB 4UAAA 3ZCZA 4JXWA 3QP1A 4PM9A 3V3SA 1VEUA 3PAEA 4ME4A 5FEGA 4B88A 4KQRA 1I5QA 3MSHA 4LRYC 3NY4A 3IX3A 4OONA 4GHIB 3UN7A 1KVLA 4DDYA 1T1BA 3HJKA 4JF5A 2EXAA 3E2LA 5AVFA 4JXVA 3HUMA 3PBSA 2O9BA 4JXGA 2WGWB 2CMNA 5HD3A 4H8RA 4NXBA 4MEZA 5EVIA 3PTEA 1GHIA 1UWNX 5GHXA 3BECA 1LLBA 1YLYA 4HJ4A 3WRTA 5CGWA 2H0YA 1L2SA 4OVDA 3U2AA 3VFFA 2JCHA 1O07A 5DF7A 4F3LA 4ZBEA 3BFGA 1CEGA 2VV8A 1U60A 1MC0A 1RGZA 4ESPA 4FD8A 4FCFA 1PZOA 1W8QA 5CEDA 4QY6A 4GZBA 2XSSA 3Q1FA 1W8YA 5AJGA 1Y54A 3UNWA 2H5SA 2ZM2A 1DJAA 1GA9A 1W63M 4Q0HA 2IA2A 2VGJA 3N8SA 3I7JA 4EBPA 4QJGA 2QPNA 2X02A 4MCWA 3S7NA 1TVFA 2FZ0A 2KOIA 4HI4A 3E4QA 2J3WA 1Q2PA 3DTEA 4QPRA 3NIAA 1PYYA 5FDSA 5FSRA 4OKPA 3ZNYA 3HL9A 2WGVA 5EUAA 2A24B 4QWOA 1YMXA 4EEUA 2J8YA 5EE8A 2WKRA 2QWSA 4OP8A 4K0XA 4KUKA 1KGGA 4O7DA 3DW0A 2GDNA 5CGXA 3WS5A 4RQ9A 1N9NA 4WUJA 4IVIA 4HESA 1L0GA 3O87A 2HGVA 4QB8A 3CUEA 4XXRA 3BY9A 5I94A 3PBTA 4L9FA 3A3FA 3O3VA 2P9VA 3F1OB 4GOGA 2G2WA 5CTNA 2HJEA 3T4OA 4ZAMA 2XDMA 1E3UA 3DTMA 3T4SA 1TDGA 1NYYA 4ID4A 4UEYA 2DRWA 2J3TD 1VHMA 4BLMA 1T1CA 4G3WA 4R6LA 3EGDC 1DP9A 2P74A 4DE1A 3HLFA 5TBMB 2KDKA 2WGWA 1PWDA 5FI7A 1YLWA 2A49A 2EX8A 2EFUA 1K4FA 3KSIA 4JLFA 1NY0A 1OT6A 4MMNA 4X25A 2W3FA 3PR6A 3JPUA 3CPTB 1SKFA 4GD8A 5DJUA 4BJPA 3NOPC 4N1XA 5GL9A 3UMEA 1PI5A 2J7VA 1IFQA 2O0YA 4R4RA 3DBAA 3B33A 2I72A 1JWVA 4YOFA 3B42A 3N8RA 2WKEA 1NXYA 4RA7A 1SZVA 3UE0A 2KX6A 1FCNA 2HDUA 3NC8A 1FR1A 1KVMA 3CUEC 3MZEA 1W5DA 3IF5A 5EVLA 4HHDA 2O9AA 3JVVA 4BENA 3CMZA 3MXRA 3V3RA 4BD0A 5GHZA 2Q9MA 4N1HA 3ZHHA 2DCFA 2WKQA 3R4KA 3MXQA 2P08A 4LV3A 3VE4A 4QU3A 3QNCA 3KSHA 3H7WB 3H82B 4JBFA 3OCLA 3GV9A 2JKTM 4CLCB 2A24A 5IHVA 2LB9A 3T4TA 3EEHA 4X1LA 1ODVA 1YKDA 2QJ7A 3NDGA 5KMWA 3TOIA 4FUWA 1MKIA 3C4OA 3HLCA 3S7OA 4S2NA 4RX3A 3OPRA 2ZJ9A 2ZQAA 2K31A 4ETZA 4X53A 4WMCD 5A93A 2W3EA 1PW8A 3OLOA 1KDSA 3LR3A 4WBGA 3BFEA 1N9OA 4DN0A 3PBOA 1CQAA 4DE0A 1SKOA 1SHVA 3NI9A 1PFLA 4C3QA 1NRJA 3IBJA 3EQVA 3RJUA 3FG8A 3IX8A 2Y2GA 1ZG6A 1S67L 4RX2A 4DJ2A 2GX5A 4UHUA 1NJ4A 1WYBA 1S0WA 4EERA 4N9KA 2XQZA 4OLGA 2YKHA 5HWVA 1D7EA 1JVJA 3KYEA 4II7A 1K55C 4LV0A 2ZM8A 3M6HA 5FI2A 2WAEA 1IYPA 5TBMA 4DE3A 1I2WA 4ETXA 3LGOA 3FKWA 1PZPA 2FFYA 4XT2A 1LSVA 2HP9A 5DF9A 4I38A 3PXPA 4DE2A 2XEPA 3IXDA 3CPTA 5FDHA 4Y0OA 4MDZA 2EXBA 5HX9A 3TE8A 3UDXA 4H6JA 1T1AA 4JPMA 2Z6DA 3PBNA 4S2NC 1TD5A 2OLVA 1W7FA 3QP8A 3CJMA 3A3JA 1UGUA 5KZHA 1BTLA 5I5LA 2Y2QA 4GNUA 2EWWA 4EESA 2XFTA 3CG5A 3MQ0A 2B18A 1Z6FA 1K54C 4MBHA 3GDIA 3UMDA 1XJ4A 1OJGA 4M3KA 3AGFA 4D2OA 3UY6A 1EI5A 4WEKA 4LLOB 1ERMA 2VKSA 5CGSA 5JYPA 1K25A 4NXEA 1AWIA 5CHUA 1ZC2A 5E2GA 5E2FA 3C4PA 3LIEA 3UB9A 3GECA 4AFIA 1SCWA 1DP8A 4JF6A 1S1YA 3D9YA 5FEFA 2GZAA 3LICA 2L0WA 3IHAA 5F1FA 5DKKA 4Y7PA 2NUPC 1JWZA 4S2MA 2W3GA 3HLBA 2VX8A 4CLCE 1S6RA 4HQAA 2WUQA 4KZ4A 4Y13A 2YKFA 3KSFA 3VP0A 3GR2A 3FWLA 1DP6A 1F2KA 3C8CA 1IOUA 4NXGA 1FCMA 4GDBA 5HAQA 2EX6A 5HWWA 4U0TA 3MXSA 3S4XA 1GCEA 3VFHA 1S4SA 2JKGA 5DKLA 4G3VA 3IS2B 3HBRA 4NEED 3WS1A 4F94A 1BSGA 1P97A 2WZZA 2XRNA 1XFQA 3W2ZA 5DF8A 1Y4OA 5CHJA 3DWKA 3ZG7B 4LCMA 1K56D 5DFYA 3ZG5A 4WELA 4E6WA 5HSQA 4DDSA 1P0ZA 5TGFA 5E2EA 3HJIA 2QHKA 5AVEA 3TRCA 1A0KA 5HDDA 2ZL1A 5J8XA 2XD1A 3C2WA 5GLAA 2WGIA 3BJNA 1BT5A 4CLCC 4LRZE 5U47A 5IT5A 4WZ4A 1W63Q 3S1YA 2E8JA 4K0WA 5FQQA 2ZC7A 1NWZA 3HLWA 5HARA 4E3JA 2ZBBA 5F68A 4A5RA 4QHCA 2R78A 3V39A 3TJZC 4EETB 1ES2A 5A92A 5A8BA 1PIOA 1MZUA 1CI8A 4R23A 2G7UA 4MBFA 4S2JA 2H0TA 1P9WA 1H3QA 1M6KA 4B93A 4YINA 4E3MA 4LFUA 1MKMA 1H8ZA 5TJJA 1K57A 1IKIA 4IEDA 4NXFA 3ZG9B 1MWUA 4BQMA 5G4YA 2H28A 1OTDA 5TFQA 1F5MA 3ZVWA 4B4ZA 4LPZA 2JKFA 3GMWA 2JKRI 2OAQ1 2V2FF 1E25A 2PAVP 3CZDA 2HP6A 3W4QA 3BWLA 4XUZA 2RL3A 4R38A 4JGPA 1T18A 1IKGA 3BQAA 2ZOIA 1VB6A 2DMWA 2HDSA 4G3KA 4L9GA 2Y2KA 2Y2JA 4I5SA 4BMWA 2GJ3A 3A0VA 5CHMA 5GLCA 2P04A 4MBKA 3IT9A 2XGNA 3ISGA 3OOVA 1K38A 3KO6A 4E3NA 3MBZA 2RCXA 1PWGA 4O8GA 1MWRA 1NYMA 1RP5A 3Q7ZA 2Y2NA 1IYSA 3NCKA 4N9LA 3IS2A 4X56A 3V5MA 4P87A 2W27A 2Y2HA 4OQHA 1HZOA 5IS1A 3VSLA 1K57C 4D60A 4JGOA 3MZFA 3BLMA 1OTEA 5AQ7A 2AVXA 2J3TC 4EBLA 1D06A 3UB5P 5EVIC 3H9WA 1XJ6A 4BD1A 4K08A 3LR0A 4BL3A 1KE0A 2Y2LA 3BFDA 2M7UA 4KQQA 2W1RA 4HJ6A 4GS9B 2W3DA 4S2OA 4IHQA 1V9ZA 1XFNA 1CEFA 3QHYA 1XA1A 4WYYA 2VEAA 2Y8HA 3Q07A 3LI9A 1OMEA 2V20A 4L9EA 3FPWA 2B02A 3GQZA 4BBVA 3OPPA 4ARZB 2W1TB 1W79A 4P6BA 1SKOB 4PM5A 2OLUA 3BLSA 4WMCA 4C6YA 2NUTC 4PMAA 2PDRA 3K3CA 3UO9A 3ITBA 2JN7A 4JF4A 4N92A 3SOIA 2OOLA 2XROA 2HJ9C 2P7JA 3QP6A 4HJ3A 4KQDA 3AGEA 3NOUC 4OLDA 4FTXA 2ACGA 4YFMA 5F1GA 2ZLYA 5F6AA 2B5RA 4RVAA 5EOEA 2QYBA 5IU1A 4OQGA 1XX2A 3LIFA 4XT2B 2LB5A 5BOHA 4JKTA 1ONHA 2EWVA 2ZMAA 3G2YA 4KQOA 3IWIA 1EWZA 1WE4A 3ZFZA 2D02A 4KZ9A 4K91A 4H6JB 2VV7A 3IH9A 4MN6A 2WKHA 3EWKA 4OPYA 3V67A 3UDFA 2PU2A 4IJGA 3EEAA 3A3IA 1GA0A 2A2LA 3B3XA 5A91A 4FH2A 1L3LA 2H10A 3UE1A 1XGIA 3VOLA 1BYWA 1RCJA 3WS4A 5LBRA 3PAGA 3ZG0A 1NLZA 2XA7S 2OWHA 3G35A 1OPXA 1G6AA 4UA7A 4UQIS 4X6TA 1L0EA 3VP2A 3FZCA 4IUHA 2R9WA 2OSUA 1K0KA 1CI9A 1LL5A 2BLSA 2ZOHA 4EQ1A 3FPVA 2R9XA 1XXMA 4Q8IA 5HZHA 4GB7A 4DXBA 3RTYA 2PYRA 4KUOA 1XKZA 1RGYA 1ESUA 3C7VA 5EFWA 3VV4A 2JE5A 4OOLA 2K7SA 4ZJ1A 3O86A 3EOIA 1DJCA 1S1ZA 4NKPA 2WADA 1ACFA 2HP5A 2ZC5B 3ITAA 4GS9A 3UPOA 2Q0OA 3WWXA 1G28A 3IF6B 3LEZA 2HV1A 3SS4A 2Y79A 3MZDA 3WS0A 5FATA 5J7EA 1YQSA 5EVEA 3NECA 1TEMA 3VOZA 2EFXA 2W1TA 4R3AA 4ARZA 5FAOA 1FSWA 3G6OA 3CLOA 3QP2A 5A90A 2VLGA 3ZVTA 1MWSA 2I9VA 5EM0A 2PT7A 3CAXA 5M1AA 1XGJA 1ONGA 3C7UA 3G32A 1KE4A 1EW0A 1F98A 4MNRA 4NG2A 4R3JA 3LIDA 5FL3A 4LGWA 2V9AA 3F1PA 2G2UA 1ESIA 3VSKA 1K56A 2Y91A 2ZL1B 1ZHHB 1LI9A 4JXSA 4Y0UA 4OP5A 1NRFA 4HP4A 4WN5A 1LL8A 2PD7A 4KG2A 3LY3A 1HTZA 4CPKA 4E3IA 1ES3A 2QMIA 2VGLS 5HL1A 2IWCA 1V9YA 3LR4A 2X01A 3MS6A 1DY6A 5C5KA 3O88A 3LUQA 1JNUA 3LEQA 3OCNA 1YLJA 1ZG4A 3GRJA 4LV2A 1BUEA 4DJ3A 1OT9A 4P85A 2EX9A 3IXGA 4GLQA 2IWDA 3P98A 2UV0E 5FQKA 3ZG8B 1C3BA 2XA7M 4IVKA 4Z9QA 4UQIM 1FR6A 3SW1A 4L0LA 5HAIA 3W4OA 1HVBA 3Q7VB 3OBFA 1TDLA 4WF0A 3TW8A 3S7PA 1BULA 3OZHA 3N8LA 4JGRA 3P09A 1O7EA 2IWBA 4GCZA 3CHWP 3BY8A 2UWXA 2INWA 1H5XA 3OPHA 4X68A 1WA9A 1YMSA 2PBDP 1STZA 3M2KA 5FI6A 3IWOA 3T4JA 3TSGA 2PYPA 3LIAA 4R1GA 4S2LA 4Y5FA 1JTDA 4DRTA 2WKPA 1TS0A 3IF6A 4HH2A 2FH5A 3G2ZA 5M19A 4PM8A 4MLLA 3Q82A 4R70A 4LCLA 5J4EA 2C5WB 4KENB 3U4LP 1GHPA 4O0PA 3CWFA 3SZTA 4CJNA 3FC7A 2L4RA 3E2KA 2XFSA 3K2NA 4NETA 3M2JA 3VP4A 2Z2LB 1YPRA 1FQGA 4HY8A 1SDEA 3PHYA 2PRFA 4U0XA 5HD5A 4EBNA 3RXXA 4CQHA 2ZQDA 3L7HA 4X69A 5HDSA 1K6RA 1ZTUA 1NZOA 3Q81A 4HBTA 4Y0TA 1LL9A 3ZNTA 3AGDA 3HVFA 1N9LA 5L8MA 3IHBA 4Q0JA 2WK0A 5F83A 3T4KA 5GLBA 4GD6A 3MQOA 3EQUA 1VQQA 2Z2MB 1AXBA 2PHYA 1H8MA 2XF3A 2XH9A 4PHTA 1E4DA 5MC7A 1YAXA 4GJ4A
chains in the Genus database with same CATH topology
3IH8A 2Q9MA 4N1HA 3ZHHA 4BD1A 3VMAA 2DCFA 4UA6A 4BL3A 5EPHA 1KE0A 1ES5A 2Y2LA 3BFDA 4ZJ3A 3IF6C 1SDNA 4KQQA 5EOOA 5FQIA 4S2OA 5CERA 4LV3A 2Y2PA 4QU3A 3QNCA 4KG6A 2PBYA 1HD8A 1CEFA 1MBLA 3QHYA 1XA1A 4WYYA 4JBFA 3OCLA 3IXBA 3GV9A 3BEBA 2J9OA 3Q07A 4E6XA 3DWZA 4WM9A 3HUOA 4R4SA 1OMEA 5IHVA 2V20A 1YT4A 2ZQ8A 5AQAA 5HW3A 2ZD8A 1VM1A 3GQZA 5JYOA 3OPPA 1W79A 4P6BA 3LCEA 5EECA 4PM5A 2OLUA 3BLSA 4WMCA 4C6YA 3NDGA 4PMAA 5KMWA 3UO9A 3TOIA 4OPQA 1K6SA 1MKIA 3ITBA 5E43A 5EVIB 4OPRA 5KSHA 3C4OA 3HLCA 4JF4A 4S2NA 4RX3A 4N92A 3OPRA 2ZJ9A 2ZQAA 3SOIA 3SH9A 3Q7VA 4X53A 3LY4A 4WMCD 5A93A 5GHYA 1PI4A 1PW8A 1KDSA 4WBGA 3MKEA 3BFEA 4ZDXA 3BM6A 4R3BA 3GSGA 3PBOA 5HAPA 3AGEA 4DE0A 1IYOA 4OLDA 1SHVA 3NI9A 4YFMA 5F1GA 4DXCA 2ZLYA 4GN2A 2B5RA 4EQIA 5GLDA 3SS5A 4EUZA 4C3QA 5AQ9A 4RVAA 5EOEA 1LHYA 3EQVA 3RJUA 4E3OA 1BLPA 2Y2GA 4RYEA 1ZG6A 2XD5A 4OQGA 1XX2A 4RX2A 5KSCA 5BOHA 4UHUA 4JKTA 1ONHA 1NJ4A 2ZMAA 3G2YA 1WYBA 2PU4A 1S0WA 4KQOA 4N9KA 5HFOA 2XQZA 3IWIA 1EWZA 1WE4A 4OLGA 4OPZA 3SH7A 3ZFZA 3NBLA 1FCOA 1JVJA 5G18A 1ES4A 2WKIA 1K55C 4LV0A 4KZ9A 2ZM8A 3TG9A 3UPPA 3M6HA 2ZC6B 5FI2A 3SH8A 4WZ5A 4K91A 2C6WB 2WAEA 1IYPA 3VOYA 4EV4A 3IH9A 2WKHA 4DE3A 1I2WA 2HDQA 1CK3A 3N7WA 4OPYA 3VP1A 3FKWA 3HREA 2PU2A 3UDFA 5M18A 1PZPA 2FFYA 2FFFB 3A3IA 1MXOA 1GA0A 2HP9A 5DF9A 2XK1A 1N9BA 2Y2OA 1PWCA 3B3XA 3N6IA 4KZ6A 5A91A 4C75A 3G31A 4FH2A 2H10A 4DE2A 1IYQA 5FQJA 2Y59A 3MKFA 1GHMA 3S22A 2XEPA 3IXDA 3UE1A 2BG1A 1XGIA 5FDHA 4Y0OA 3UE3A 1G68A 2EXBA 4KZAA 5HX9A 1RCJA 3UDXA 5DVAA 5FASA 2OV5A 3WS4A 4FH4A 3PAGA 2ZC3B 4JPMA 4PPRA 3ZG0A 3MFDA 3G35A 3HUNA 3PBNA 4S2NC 5GHZA 1G6AA 2OLVA 4UA7A 4ZJ2A 4GKUA 1W7FA 5DTKA 1KE3A 3CJMA 4X6TA 3A3JA 1YLTA 1MPLA 1L0EA 3VP2A 5KZHA 1BTLA 2Y2QA 4GNUA 3FZCA 4IBRA 3NDEA 2XFTA 4QY5A 3CG5A 2QZ6A 1Z6FA 2R9WA 1K54C 3IWQA 2OSUA 4MBHA 1CI9A 3FV7A 1LL5A 4KZ7A 2BLSA 1XP4A 1BLHA 2CC1A 2R9XA 4M3KA 1XXMA 5CEBA 3AGFA 4KZ3A 4Q8IA 4GB7A 4HEFA 2Y2IA 4D2OA 3UY6A 4DXBA 1EI5A 4KZ5A 4S2KA 4WEKA 1QMFA 1Q2QA 1ERMA 1XKZA 1RGYA 4P0MA 5CGSA 1XPBA 1ESUA 3C7VA 5JYPA 4S2IA 1I2SA 2JE5A 4IBXA 1LI0A 4R0QA 1JTGA 1K25A 1K4EA 1YLPA 1ZKJA 3A3EA 4OOLA 4ZJ1A 3ZGAB 3O86A 2VGKA 5CHUA 1ZC2A 1DJCA 4PM7A 4XUXA 4KG5A 5E2GA 5FAPA 5E2FA 2P9VB 2WADA 3C4PA 1M40A 4UAAA 3HLGA 4U3TA 2HP5A 2ZC5B 3FKVA 3ITAA 3UPOA 3ZCZA 4JXWA 1MWTA 1SCWA 4JF6A 4PM9A 3WWXA 3V3SA 3VP3A 3PAEA 3IF6B 3LEZA 4WZ5C 3SS4A 4B88A 1I5QA 4KQRA 4OONA 3IHAA 3NY4A 3UN7A 5F1FA 4Y7PA 1MY8A 3MZDA 1JWZA 3WS0A 4S2MA 3D4FA 1KVLA 5FATA 1BLSA 4DDYA 5CTMA 1YQSA 3HLBA 2EXAA 1TEMA 3E2LA 4JF5A 3PBRA 3VOZA 2EFXA 4JXVA 1NZUA 1S6RA 1FSWA 3HUMA 3PBSA 5FAOA 2WUQA 4JXGA 3V50A 2WGWB 1EROA 4H8RA 4KZ4A 5A90A 2DNSA 4MEZA 3GTCA 5EVIA 3PTEA 3ZVTA 5FAQA 2HDRA 1GHIA 3LO7A 5GHXA 3BECA 1LLBA 1MWSA 1YLYA 3GR2A 3VP0A 3FWLA 5F82A 3WRTA 3RXWA 3WS2A 5M1AA 1XGJA 5CGWA 2H0YA 1ONGA 1L2SA 2ZQCA 4OVDA 1FCMA 3C7UA 3G32A 1KE4A 3VFFA 2JCHA 5DTSA 3FYZA 5EVID 1O07A 4GDBA 5DF7A 4UA9A 4MNRA 5TR7A 5HAQA 2Y2MA 4R3JA 4ZBEA 3BFGA 1CEGA 2WZXA 2EX6A 4U0TA 1U60A 3BFCA 3MXSA 3S4XA 1GCEA 1JWPA 1RGZA 2XLNA 3VFHA 1IELA 2G2UA 4FD8A 4FCFA 1PZOA 5FQ9A 1ESIA 3VSKA 1K56A 1W8QA 2Y91A 3HBRA 3WS1A 5CEDA 1N4OA 4QY6A 4F94A 1BSGA 1LI9A 3W4PA 2WZZA 4JXSA 1BZAA 4GZBA 4Y0UA 3JYIA 3Q1FA 5DF8A 1W8YA 1Y54A 5CHJA 3UNWA 2H5SA 3DWKA 4OP5A 5CRFA 1NRFA 2ZM2A 4LCMA 1K56D 1DJAA 3ZG7B 3ZG5A 4KZBA 1GA9A 4KG2A 3LY3A 4WELA 1HTZA 4CPKA 4E3IA 4E6WA 1ES3A 2QMIA 4OOMA 4DDSA 2VGJA 5TGFA 3ZDJA 3N8SA 1YM1A 2WYXA 5E2EA 5HL1A 2ZQ7A 3I7JA 4EBPA 4QJGA 2IWCA 2QPNA 2X02A 2X01A 5J8XA 1DY6A 1PW1A 1TVFA 3UPNA 2XD1A 5GLAA 2WGIA 1BT5A 5FA7A 2X71A 1Q2PA 3C5AA 3O88A 5U47A 3G4PA 3NIAA 1PYYA 3OCNA 1YLJA 1ZG4A 3GRJA 4WZ4A 5FSRA 3WRZA 4LV2A 4OKPA 3S1YA 3ZNYA 3HL9A 4NK3A 4OH0A 1BUEA 2WGVA 4K0WA 5EUAA 5FQQA 4ZTKA 2ZC4B 2ZC7A 4OOYA 4P85A 1YMXA 3HLWA 5HARA 2EX9A 3IXGA 2J8YA 3IXHA 1QMEA 3OPLA 4OQ0A 4E3JA 2IWDA 3P98A 5EE8A 4A5RA 2JC7A 5AQBA 4QHCA 5FQKA 1K55A 4OP8A 3ZG8B 4K0XA 4DF6A 1C3BA 1L0DA 1KGGA 4O7DA 4IVKA 4Z9QA 3DW0A 3V39A 4DKIA 4PM6A 4QD4A 1FR6A 2GDNA 4L0LA 5HAIA 1ES2A 5A92A 3W4OA 1HVBA 2J9PA 3Q7VB 1TDLA 1PIOA 5CGXA 3IQAA 5FQMA 3WS5A 1CI8A 1BULA 3OZHA 3N8LA 4R23A 4IVIA 3P09A 4MBFA 4OQIA 2H0TA 4S2JA 3A3DA 1O7EA 1KGEA 1M6KA 3BYDA 4HESA 4YINA 2IWBA 4E3MA 1L0GA 2HPBA 4EWFA 3O87A 1H8ZA 3N4IA 4QB8A 1FOFA 4XXRA 1K57A 2UWXA 1IKIA 4GDNA 5I94A 1H5XA 3PBTA 3OPHA 3PBQA 4X68A 1YMSA 4IEDA 3G34A 3A3FA 3GVBA 3O3VA 2P9VA 4GOGA 1MWUA 3M2KA 3ZG9B 4BQMA 5FI6A 3IWOA 2G2WA 2EX2A 3TSGA 5CTNA 1BLCA 5TFQA 3HLDA 4R1GA 4S2LA 1JTDA 4ZAMA 2A3UA 4LV1A 4DRTA 5CXWA 3ZVWA 1ERQA 2XDMA 4B4ZA 1E3UA 3GMWA 3IF6A 3DTMA 1ALQA 2V2FF 1E25A 1TDGA 3G2ZA 1KDWA 5M19A 1NYYA 4ID4A 5L2FA 1K54A 5D3OA 4PM8A 4MLLA 2V1ZA 2WAFA 3BRMA 3CZDA 3Q82A 2DRWA 2HP6A 4LCLA 3W4QA 4EBLA 4XUZA 4BLMA 2C5WB 4KENB 2RL3A 5DTTA 1GHPA 1YLZA 3QNBA 1IKGA 2P74A 4DE1A 1E3UD 3HLFA 4CJNA 2Q9NA 2WGWA 1PWDA 5FI7A 1YLWA 2A49A 2XR0A 1KGFA 2EX8A 2EFUA 2XFSA 1K4FA 3E2KA 2HDSA 4NETA 3M2JA 4JLFA 2E8IA 3VP4A 4WEJA 2Y2KA 2Y2JA 4BL2A 2Z2LB 4KZ8A 1FQGA 5CHMA 1NY0A 3G30A 2Y55A 5GLCA 5CECA 4E3LA 1SDEA 3SS3A 5E2HA 4U0XA 4MBKA 1SKFA 3IT9A 2XGNA 3ISGA 4GD8A 4EBNA 3RXXA 2ZQDA 4BJPA 4X69A 1K6RA 1L0FA 1J9MA 2Y4AA 1NZOA 1K38A 1H8YA 3Q81A 4HBTA 4N1XA 5GL9A 1PI5A 2J7VA 4E3NA 4Y0TA 3MBZA 1LL9A 2RCXA 2ZM0A 1PWGA 4E3KA 3ZNTA 3AGDA 3HVFA 4R4RA 2I72A 1IEMA 1JWVA 1MWRA 1NYMA 1RP5A 3IHBA 3N8RA 3OC2A 3Q7ZA 2WKEA 1NXYA 4RA7A 2WK0A 1DJBA 2Y2NA 1IYSA 3UE0A 5F83A 3NCKA 4N9LA 4LENA 4X56A 5GLBA 4GD6A 3V5MA 1FCNA 4P87A 2HDUA 2Y2HA 4OQHA 3NC8A 3EQUA 4S2PA 1XA7A 1HZOA 1FR1A 3BFFA 3M6BA 3W8KA 1KVMA 1VQQA 3MZEA 4X55A 3VSLA 2JBFA 1K57C 2Z2MB 1AXBA 1W5DA 1WYCA 3IF5A 4FSFA 1FSYA 5EVLA 4B4XA 3UDIA 2XF3A 2ZQ9A 3MZFA 3BLMA 2XH9A 4BENA 1E4DA 3CMZA 3MXRA 5AQ7A 3HLEA 3V3RA 4BD0A 4HBUA 5EVIC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IH8 A;  2Q9M A;  4N1H A;  3ZHH A;  4BD1 A;  3VMA A;  2DCF A;  4UA6 A;  4BL3 A;  5EPH A;  1KE0 A;  1ES5 A;  2Y2L A;  3BFD A;  4ZJ3 A;  3IF6 C;  1SDN A;  4KQQ A;  5EOO A;  5FQI A;  4S2O A;  5CER A;  4LV3 A;  2Y2P A;  4QU3 A;  3QNC A;  4KG6 A;  2PBY A;  1HD8 A;  1CEF A;  1MBL A;  3QHY A;  1XA1 A;  4WYY A;  4JBF A;  3OCL A;  3IXB A;  3GV9 A;  3BEB A;  2J9O A;  3Q07 A;  4E6X A;  3DWZ A;  4WM9 A;  3HUO A;  4R4S A;  1OME A;  5IHV A;  2V20 A;  1YT4 A;  2ZQ8 A;  5AQA A;  5HW3 A;  2ZD8 A;  1VM1 A;  3GQZ A;  5JYO A;  3OPP A;  1W79 A;  4P6B A;  3LCE A;  5EEC A;  4PM5 A;  2OLU A;  3BLS A;  4WMC A;  4C6Y A;  3NDG A;  4PMA A;  5KMW A;  3UO9 A;  3TOI A;  4OPQ A;  1K6S A;  1MKI A;  3ITB A;  5E43 A;  5EVI B;  4OPR A;  5KSH A;  3C4O A;  3HLC A;  4JF4 A;  4S2N A;  4RX3 A;  4N92 A;  3OPR A;  2ZJ9 A;  2ZQA A;  3SOI A;  3SH9 A;  3Q7V A;  4X53 A;  3LY4 A;  4WMC D;  5A93 A;  5GHY A;  1PI4 A;  1PW8 A;  1KDS A;  4WBG A;  3MKE A;  3BFE A;  4ZDX A;  3BM6 A;  4R3B A;  3GSG A;  3PBO A;  5HAP A;  3AGE A;  4DE0 A;  1IYO A;  4OLD A;  1SHV A;  3NI9 A;  4YFM A;  5F1G A;  4DXC A;  2ZLY A;  4GN2 A;  2B5R A;  4EQI A;  5GLD A;  3SS5 A;  4EUZ A;  4C3Q A;  5AQ9 A;  4RVA A;  5EOE A;  1LHY A;  3EQV A;  3RJU A;  4E3O A;  1BLP A;  2Y2G A;  4RYE A;  1ZG6 A;  2XD5 A;  4OQG A;  1XX2 A;  4RX2 A;  5KSC A;  5BOH A;  4UHU A;  4JKT A;  1ONH A;  1NJ4 A;  2ZMA A;  3G2Y A;  1WYB A;  2PU4 A;  1S0W A;  4KQO A;  4N9K A;  5HFO A;  2XQZ A;  3IWI A;  1EWZ A;  1WE4 A;  4OLG A;  4OPZ A;  3SH7 A;  3ZFZ A;  3NBL A;  1FCO A;  1JVJ A;  5G18 A;  1ES4 A;  2WKI A;  1K55 C;  4LV0 A;  4KZ9 A;  2ZM8 A;  3TG9 A;  3UPP A;  3M6H A;  2ZC6 B;  5FI2 A;  3SH8 A;  4WZ5 A;  4K91 A;  2C6W B;  2WAE A;  1IYP A;  3VOY A;  4EV4 A;  3IH9 A;  2WKH A;  4DE3 A;  1I2W A;  2HDQ A;  1CK3 A;  3N7W A;  4OPY A;  3VP1 A;  3FKW A;  3HRE A;  2PU2 A;  3UDF A;  5M18 A;  1PZP A;  2FFY A;  2FFF B;  3A3I A;  1MXO A;  1GA0 A;  2HP9 A;  5DF9 A;  2XK1 A;  1N9B A;  2Y2O A;  1PWC A;  3B3X A;  3N6I A;  4KZ6 A;  5A91 A;  4C75 A;  3G31 A;  4FH2 A;  2H10 A;  4DE2 A;  1IYQ A;  5FQJ A;  2Y59 A;  3MKF A;  1GHM A;  3S22 A;  2XEP A;  3IXD A;  3UE1 A;  2BG1 A;  1XGI A;  5FDH A;  4Y0O A;  3UE3 A;  1G68 A;  2EXB A;  4KZA A;  5HX9 A;  1RCJ A;  3UDX A;  5DVA A;  5FAS A;  2OV5 A;  3WS4 A;  4FH4 A;  3PAG A;  2ZC3 B;  4JPM A;  4PPR A;  3ZG0 A;  3MFD A;  3G35 A;  3HUN A;  3PBN A;  4S2N C;  5GHZ A;  1G6A A;  2OLV A;  4UA7 A;  4ZJ2 A;  4GKU A;  1W7F A;  5DTK A;  1KE3 A;  3CJM A;  4X6T A;  3A3J A;  1YLT A;  1MPL A;  1L0E A;  3VP2 A;  5KZH A;  1BTL A;  2Y2Q A;  4GNU A;  3FZC A;  4IBR A;  3NDE A;  2XFT A;  4QY5 A;  3CG5 A;  2QZ6 A;  1Z6F A;  2R9W A;  1K54 C;  3IWQ A;  2OSU A;  4MBH A;  1CI9 A;  3FV7 A;  1LL5 A;  4KZ7 A;  2BLS A;  1XP4 A;  1BLH A;  2CC1 A;  2R9X A;  4M3K A;  1XXM A;  5CEB A;  3AGF A;  4KZ3 A;  4Q8I A;  4GB7 A;  4HEF A;  2Y2I A;  4D2O A;  3UY6 A;  4DXB A;  1EI5 A;  4KZ5 A;  4S2K A;  4WEK A;  1QMF A;  1Q2Q A;  1ERM A;  1XKZ A;  1RGY A;  4P0M A;  5CGS A;  1XPB A;  1ESU A;  3C7V A;  5JYP A;  4S2I A;  1I2S A;  2JE5 A;  4IBX A;  1LI0 A;  4R0Q A;  1JTG A;  1K25 A;  1K4E A;  1YLP A;  1ZKJ A;  3A3E A;  4OOL A;  4ZJ1 A;  3ZGA B;  3O86 A;  2VGK A;  5CHU A;  1ZC2 A;  1DJC A;  4PM7 A;  4XUX A;  4KG5 A;  5E2G A;  5FAP A;  5E2F A;  2P9V B;  2WAD A;  3C4P A;  1M40 A;  4UAA A;  3HLG A;  4U3T A;  2HP5 A;  2ZC5 B;  3FKV A;  3ITA A;  3UPO A;  3ZCZ A;  4JXW A;  1MWT A;  1SCW A;  4JF6 A;  4PM9 A;  3WWX A;  3V3S A;  3VP3 A;  3PAE A;  3IF6 B;  3LEZ A;  4WZ5 C;  3SS4 A;  4B88 A;  1I5Q A;  4KQR A;  4OON A;  3IHA A;  3NY4 A;  3UN7 A;  5F1F A;  4Y7P A;  1MY8 A;  3MZD A;  1JWZ A;  3WS0 A;  4S2M A;  3D4F A;  1KVL A;  5FAT A;  1BLS A;  4DDY A;  5CTM A;  1YQS A;  3HLB A;  2EXA A;  1TEM A;  3E2L A;  4JF5 A;  3PBR A;  3VOZ A;  2EFX A;  4JXV A;  1NZU A;  1S6R A;  1FSW A;  3HUM A;  3PBS A;  5FAO A;  2WUQ A;  4JXG A;  3V50 A;  2WGW B;  1ERO A;  4H8R A;  4KZ4 A;  5A90 A;  2DNS A;  4MEZ A;  3GTC A;  5EVI A;  3PTE A;  3ZVT A;  5FAQ A;  2HDR A;  1GHI A;  3LO7 A;  5GHX A;  3BEC A;  1LLB A;  1MWS A;  1YLY A;  3GR2 A;  3VP0 A;  3FWL A;  5F82 A;  3WRT A;  3RXW A;  3WS2 A;  5M1A A;  1XGJ A;  5CGW A;  2H0Y A;  1ONG A;  1L2S A;  2ZQC A;  4OVD A;  1FCM A;  3C7U A;  3G32 A;  1KE4 A;  3VFF A;  2JCH A;  5DTS A;  3FYZ A;  5EVI D;  1O07 A;  4GDB A;  5DF7 A;  4UA9 A;  4MNR A;  5TR7 A;  5HAQ A;  2Y2M A;  4R3J A;  4ZBE A;  3BFG A;  1CEG A;  2WZX A;  2EX6 A;  4U0T A;  1U60 A;  3BFC A;  3MXS A;  3S4X A;  1GCE A;  1JWP A;  1RGZ A;  2XLN A;  3VFH A;  1IEL A;  2G2U A;  4FD8 A;  4FCF A;  1PZO A;  5FQ9 A;  1ESI A;  3VSK A;  1K56 A;  1W8Q A;  2Y91 A;  3HBR A;  3WS1 A;  5CED A;  1N4O A;  4QY6 A;  4F94 A;  1BSG A;  1LI9 A;  3W4P A;  2WZZ A;  4JXS A;  1BZA A;  4GZB A;  4Y0U A;  3JYI A;  3Q1F A;  5DF8 A;  1W8Y A;  1Y54 A;  5CHJ A;  3UNW A;  2H5S A;  3DWK A;  4OP5 A;  5CRF A;  1NRF A;  2ZM2 A;  4LCM A;  1K56 D;  1DJA A;  3ZG7 B;  3ZG5 A;  4KZB A;  1GA9 A;  4KG2 A;  3LY3 A;  4WEL A;  1HTZ A;  4CPK A;  4E3I A;  4E6W A;  1ES3 A;  2QMI A;  4OOM A;  4DDS A;  2VGJ A;  5TGF A;  3ZDJ A;  3N8S A;  1YM1 A;  2WYX A;  5E2E A;  5HL1 A;  2ZQ7 A;  3I7J A;  4EBP A;  4QJG A;  2IWC A;  2QPN A;  2X02 A;  2X01 A;  5J8X A;  1DY6 A;  1PW1 A;  1TVF A;  3UPN A;  2XD1 A;  5GLA A;  2WGI A;  1BT5 A;  5FA7 A;  2X71 A;  1Q2P A;  3C5A A;  3O88 A;  5U47 A;  3G4P A;  3NIA A;  1PYY A;  3OCN A;  1YLJ A;  1ZG4 A;  3GRJ A;  4WZ4 A;  5FSR A;  3WRZ A;  4LV2 A;  4OKP A;  3S1Y A;  3ZNY A;  3HL9 A;  4NK3 A;  4OH0 A;  1BUE A;  2WGV A;  4K0W A;  5EUA A;  5FQQ A;  4ZTK A;  2ZC4 B;  2ZC7 A;  4OOY A;  4P85 A;  1YMX A;  3HLW A;  5HAR A;  2EX9 A;  3IXG A;  2J8Y A;  3IXH A;  1QME A;  3OPL A;  4OQ0 A;  4E3J A;  2IWD A;  3P98 A;  5EE8 A;  4A5R A;  2JC7 A;  5AQB A;  4QHC A;  5FQK A;  1K55 A;  4OP8 A;  3ZG8 B;  4K0X A;  4DF6 A;  1C3B A;  1L0D A;  1KGG A;  4O7D A;  4IVK A;  4Z9Q A;  3DW0 A;  3V39 A;  4DKI A;  4PM6 A;  4QD4 A;  1FR6 A;  2GDN A;  4L0L A;  5HAI A;  1ES2 A;  5A92 A;  3W4O A;  1HVB A;  2J9P A;  3Q7V B;  1TDL A;  1PIO A;  5CGX A;  3IQA A;  5FQM A;  3WS5 A;  1CI8 A;  1BUL A;  3OZH A;  3N8L A;  4R23 A;  4IVI A;  3P09 A;  4MBF A;  4OQI A;  2H0T A;  4S2J A;  3A3D A;  1O7E A;  1KGE A;  1M6K A;  3BYD A;  4HES A;  4YIN A;  2IWB A;  4E3M A;  1L0G A;  2HPB A;  4EWF A;  3O87 A;  1H8Z A;  3N4I A;  4QB8 A;  1FOF A;  4XXR A;  1K57 A;  2UWX A;  1IKI A;  4GDN A;  5I94 A;  1H5X A;  3PBT A;  3OPH A;  3PBQ A;  4X68 A;  1YMS A;  4IED A;  3G34 A;  3A3F A;  3GVB A;  3O3V A;  2P9V A;  4GOG A;  1MWU A;  3M2K A;  3ZG9 B;  4BQM A;  5FI6 A;  3IWO A;  2G2W A;  2EX2 A;  3TSG A;  5CTN A;  1BLC A;  5TFQ A;  3HLD A;  4R1G A;  4S2L A;  1JTD A;  4ZAM A;  2A3U A;  4LV1 A;  4DRT A;  5CXW A;  3ZVW A;  1ERQ A;  2XDM A;  4B4Z A;  1E3U A;  3GMW A;  3IF6 A;  3DTM A;  1ALQ A;  2V2F F;  1E25 A;  1TDG A;  3G2Z A;  1KDW A;  5M19 A;  1NYY A;  4ID4 A;  5L2F A;  1K54 A;  5D3O A;  4PM8 A;  4MLL A;  2V1Z A;  2WAF A;  3BRM A;  3CZD A;  3Q82 A;  2DRW A;  2HP6 A;  4LCL A;  3W4Q A;  4EBL A;  4XUZ A;  4BLM A;  2C5W B;  4KEN B;  2RL3 A;  5DTT A;  1GHP A;  1YLZ A;  3QNB A;  1IKG A;  2P74 A;  4DE1 A;  1E3U D;  3HLF A;  4CJN A;  2Q9N A;  2WGW A;  1PWD A;  5FI7 A;  1YLW A;  2A49 A;  2XR0 A;  1KGF A;  2EX8 A;  2EFU A;  2XFS A;  1K4F A;  3E2K A;  2HDS A;  4NET A;  3M2J A;  4JLF A;  2E8I A;  3VP4 A;  4WEJ A;  2Y2K A;  2Y2J A;  4BL2 A;  2Z2L B;  4KZ8 A;  1FQG A;  5CHM A;  1NY0 A;  3G30 A;  2Y55 A;  5GLC A;  5CEC A;  4E3L A;  1SDE A;  3SS3 A;  5E2H A;  4U0X A;  4MBK A;  1SKF A;  3IT9 A;  2XGN A;  3ISG A;  4GD8 A;  4EBN A;  3RXX A;  2ZQD A;  4BJP A;  4X69 A;  1K6R A;  1L0F A;  1J9M A;  2Y4A A;  1NZO A;  1K38 A;  1H8Y A;  3Q81 A;  4HBT A;  4N1X A;  5GL9 A;  1PI5 A;  2J7V A;  4E3N A;  4Y0T A;  3MBZ A;  1LL9 A;  2RCX A;  2ZM0 A;  1PWG A;  4E3K A;  3ZNT A;  3AGD A;  3HVF A;  4R4R A;  2I72 A;  1IEM A;  1JWV A;  1MWR A;  1NYM A;  1RP5 A;  3IHB A;  3N8R A;  3OC2 A;  3Q7Z A;  2WKE A;  1NXY A;  4RA7 A;  2WK0 A;  1DJB A;  2Y2N A;  1IYS A;  3UE0 A;  5F83 A;  3NCK A;  4N9L A;  4LEN A;  4X56 A;  5GLB A;  4GD6 A;  3V5M A;  1FCN A;  4P87 A;  2HDU A;  2Y2H A;  4OQH A;  3NC8 A;  3EQU A;  4S2P A;  1XA7 A;  1HZO A;  1FR1 A;  3BFF A;  3M6B A;  3W8K A;  1KVM A;  1VQQ A;  3MZE A;  4X55 A;  3VSL A;  2JBF A;  1K57 C;  2Z2M B;  1AXB A;  1W5D A;  1WYC A;  3IF5 A;  4FSF A;  1FSY A;  5EVL A;  4B4X A;  3UDI A;  2XF3 A;  2ZQ9 A;  3MZF A;  3BLM A;  2XH9 A;  4BEN A;  1E4D A;  3CMZ A;  3MXR A;  5AQ7 A;  3HLE A;  3V3R A;  4BD0 A;  4HBU A;  5EVI C; 
#chains in the Genus database with same CATH topology
 4Z1W A;  3DTK A;  3VMA A;  4UA6 A;  1ES5 A;  4ZJ3 A;  3DAV A;  3IF6 C;  1YSQ A;  4Y17 A;  2VGL M;  5F5Y A;  3T1X A;  1Y28 A;  5CER A;  2PBY A;  1HD8 A;  2V8C A;  3IXB A;  3DWZ A;  4FOF A;  4WM9 A;  3HUO A;  4R4S A;  5AQA A;  5HW3 A;  5G4Z A;  2KLI A;  1X0O A;  5EEC A;  4OPQ A;  1K6S A;  5E43 A;  4OPR A;  1TS8 A;  1TF1 A;  5KSH A;  3ZYT A;  3MMH A;  1GSW A;  3Q7V A;  4JGQ A;  1OTA A;  2O9C A;  3LY4 A;  3NOT C;  1PNE A;  3B47 A;  3R7W B;  3BM6 A;  4ZRR A;  4IUK A;  5HAP A;  1LSX A;  2HF6 A;  1IYO A;  2OWJ A;  3CI6 A;  4DXC A;  4GN2 A;  4CLC D;  4EQI A;  5GLD A;  2JHE A;  2K2N A;  1Z09 A;  1GSX A;  4E3O A;  3MJQ A;  3UB7 A;  5KSC A;  2W0N A;  3NUL A;  2EA9 A;  4EW7 A;  2V0U A;  3SH7 A;  5L09 A;  1T19 A;  1FCO A;  5G18 A;  3A0S A;  4I3I A;  1ES4 A;  1OTB A;  3T4Q A;  3UPP A;  2ZC6 B;  3SH8 A;  4WZ5 A;  4EV4 A;  3VP1 A;  3K3D A;  5M18 A;  4GW9 A;  1FIL A;  2FFF B;  1GSV A;  4Y2F A;  3NJA A;  2XK1 A;  1N9B A;  3N6I A;  1PWC A;  4KZ6 A;  1IYQ A;  2Y59 A;  4I39 A;  1D1J A;  3VE3 A;  1G68 A;  3E4O A;  4KZA A;  3P7N A;  3P01 A;  3HUN A;  3PYP A;  3BW6 A;  5HPI A;  4HIA A;  4ZJ2 A;  5DTK A;  1YLT A;  1MPL A;  3LI8 A;  3MFX A;  3KYQ A;  4IBR A;  4QY5 A;  2QZ6 A;  3S7Q A;  4KZ7 A;  1XP4 A;  1BLH A;  2CC1 A;  5KIZ A;  4EXO A;  3T1Q B;  4S2K A;  1QMF A;  1Q2Q A;  4P0M A;  1XPB A;  4B9O A;  1XJ3 A;  1I2S A;  1JTG A;  1ZKJ A;  3ZGA B;  4PAU A;  2VGK A;  4I3A A;  4KG5 A;  5FAP A;  1M40 A;  3HLG A;  4U3T A;  3FKV A;  5DFX A;  1MWT A;  4Q0I A;  3UB6 A;  3VP3 A;  5EM1 A;  4LRX C;  3IBR A;  4WZ5 C;  4E04 A;  4X1M A;  4WLA A;  2BTF P;  1MY8 A;  3D4F A;  1BLS A;  5CTM A;  3T12 B;  3JVU A;  3PBR A;  1F9I A;  1NZU A;  5F69 A;  3V50 A;  1ERO A;  3A0R A;  2DNS A;  3F1P B;  3GTC A;  3LR5 A;  5FAQ A;  2HDR A;  4BBU A;  3UE6 A;  4M4X A;  3LO7 A;  5F82 A;  3E0Y A;  2M7V A;  3RXW A;  3WS2 A;  1HLU P;  4GHI A;  2ZQC A;  3MR0 A;  3FYZ A;  5DTS A;  3R7W A;  5EVI D;  3RFB A;  4UA9 A;  5TR7 A;  2Y2M A;  2J80 A;  1J3W A;  4DMZ A;  3NHQ A;  1TS6 A;  2WZX A;  3UB8 A;  1G6O A;  3BFC A;  1JWP A;  2XLN A;  1IEL A;  5K5B A;  2L1M A;  5FQ9 A;  1N4O A;  3O5Y A;  3W4P A;  1BZA A;  3JYI A;  4BBT A;  4HNB A;  2QKP A;  5CRF A;  4KZB A;  5L10 A;  2B95 A;  4OOM A;  2VZW A;  3ZDJ A;  2VV6 A;  1YM1 A;  2WYX A;  2ZQ7 A;  3LFV A;  1PW1 A;  3UPN A;  4YNR A;  5FA7 A;  2X71 A;  3C5A A;  3G4P A;  5HL6 A;  5HWT A;  4P6Z S;  5L07 A;  3WRZ A;  3DTI A;  2MJ6 A;  4NK3 A;  3KX0 X;  4OH0 A;  1PRQ A;  4ZTK A;  2ZC4 B;  4OOY A;  3IXH A;  4OQ0 A;  3OPL A;  1QME A;  2PR6 A;  3IX4 A;  2JC7 A;  5AQB A;  3MQQ A;  1K55 A;  4DF6 A;  1L0D A;  2QJ5 A;  4DKI A;  4PM6 A;  4QD4 A;  3EGX C;  2J9P A;  4O01 A;  3IQA A;  5FQM A;  2ZMF A;  2BAS A;  4OQI A;  5EV0 A;  3A3D A;  1KGE A;  3BYD A;  4EWF A;  2HPB A;  1DRM A;  2V1B A;  2V1A A;  3N4I A;  1FOF A;  4GDN A;  3D72 A;  3LIB A;  3PBQ A;  3G34 A;  3GVB A;  2EX2 A;  1OJ5 A;  1BLC A;  1OTI A;  3HLD A;  2A3U A;  4LV1 A;  5CXW A;  1ERQ A;  3T4L A;  2W3H A;  1ALQ A;  1KDW A;  1CJF A;  5L2F A;  1K54 A;  5D3O A;  3ULF A;  2V1Z A;  2WAF A;  3BRM A;  1S66 L;  3KSG A;  5DTT A;  2JKT I;  1VET B;  1YLZ A;  3QNB A;  1E3U D;  2Q9N A;  3F1O A;  2XR0 A;  1KGF A;  4PKY G;  2E8I A;  1TS7 A;  4WEJ A;  4BL2 A;  4KZ8 A;  3ZQ5 A;  1CF0 A;  3G30 A;  3F1N B;  3HCY A;  2Y55 A;  5CEC A;  4E3L A;  2VA0 A;  3SS3 A;  5E2H A;  3BQ8 A;  4Y3I A;  1L0F A;  1J9M A;  2Y4A A;  5J3W A;  1H8Y A;  3ICY A;  4E3K A;  2ZM0 A;  4HH3 A;  3RH8 B;  5HDC A;  3E98 A;  1IEM A;  3OC2 A;  2PR5 A;  2VK3 A;  1DJB A;  4LEN A;  4EU0 A;  1XJ2 A;  4S2P A;  1XA7 A;  3BFF A;  3M6B A;  3W8K A;  4X55 A;  2JBF A;  4FSF A;  1WYC A;  4BWI A;  4MN7 A;  1FSY A;  4B4X A;  2OAP 1;  3UDI A;  4HP9 A;  1LSW A;  2ZQ9 A;  2GNX A;  3HLE A;  4HBU A;  3IH8 A;  5EPH A;  3KYZ A;  4EUV A;  3E4P A;  1SDN A;  5EOO A;  5FQI A;  2M1C A;  3T1S A;  2Y2P A;  4KG6 A;  1MBL A;  1VEU B;  3BEB A;  2J9O A;  3MF0 A;  4P6Z M;  4E6X A;  1FIK A;  1YT4 A;  1LT0 A;  2ZQ8 A;  3T50 A;  2ZD8 A;  1VM1 A;  4I3J A;  5JYO A;  3LCE A;  1NLY A;  2ZMV A;  3D3O A;  4HOI A;  5EVI B;  3C38 A;  3H7W A;  3H82 A;  3SH9 A;  2V0W A;  4CLC A;  5GHY A;  2VJW A;  1PI4 A;  3MKE A;  4ZDX A;  4R3B A;  4F3L B;  4YWZ A;  3T1R A;  3GSG A;  2HZ5 A;  3SS5 A;  4EUZ A;  5AQ9 A;  3QP4 A;  1LHY A;  1BLP A;  3LYX A;  4RYE A;  2XD5 A;  4Y15 A;  2D01 A;  3L9K A;  2PU4 A;  1KOU A;  5HFO A;  4OPZ A;  3NBL A;  2WKI A;  1VET A;  3TG9 A;  5DJT A;  2C6W B;  3VOY A;  2HDQ A;  1CK3 A;  3N7W A;  3HRE A;  4WL9 A;  1G5U A;  1MXO A;  2Y2O A;  4C75 A;  3G31 A;  3F1N A;  3S22 A;  5CX7 A;  5FQJ A;  3MKF A;  1GHM A;  3C30 A;  4EEP A;  2BG1 A;  3UE3 A;  2PD8 A;  1S4R A;  5FAS A;  5DVA A;  1UWP X;  2OV5 A;  4FH4 A;  4PPR A;  2ZC3 B;  3MFD A;  2Z6C A;  4GKU A;  1KE3 A;  4PKY A;  2O99 A;  1H0M A;  4MN5 A;  3NDE A;  3CIT A;  2V8F A;  3IWQ A;  2JKR M;  3FV7 A;  5CEB A;  5HPF A;  4KZ3 A;  4HEF A;  2Y2I A;  1P9R A;  4KZ5 A;  1YSP A;  4S2I A;  4IBX A;  1LI0 A;  4R0Q A;  3A3E A;  1K4E A;  1YLP A;  4PM7 A;  4XUX A;  3QP5 A;  2P9V B;  4UAA A;  3ZCZ A;  4JXW A;  3QP1 A;  4PM9 A;  3V3S A;  1VEU A;  3PAE A;  4ME4 A;  5FEG A;  4B88 A;  4KQR A;  1I5Q A;  3MSH A;  4LRY C;  3NY4 A;  3IX3 A;  4OON A;  4GHI B;  3UN7 A;  1KVL A;  4DDY A;  1T1B A;  3HJK A;  4JF5 A;  2EXA A;  3E2L A;  5AVF A;  4JXV A;  3HUM A;  3PBS A;  2O9B A;  4JXG A;  2WGW B;  2CMN A;  5HD3 A;  4H8R A;  4NXB A;  4MEZ A;  5EVI A;  3PTE A;  1GHI A;  1UWN X;  5GHX A;  3BEC A;  1LLB A;  1YLY A;  4HJ4 A;  3WRT A;  5CGW A;  2H0Y A;  1L2S A;  4OVD A;  3U2A A;  3VFF A;  2JCH A;  1O07 A;  5DF7 A;  4F3L A;  4ZBE A;  3BFG A;  1CEG A;  2VV8 A;  1U60 A;  1MC0 A;  1RGZ A;  4ESP A;  4FD8 A;  4FCF A;  1PZO A;  1W8Q A;  5CED A;  4QY6 A;  4GZB A;  2XSS A;  3Q1F A;  1W8Y A;  5AJG A;  1Y54 A;  3UNW A;  2H5S A;  2ZM2 A;  1DJA A;  1GA9 A;  1W63 M;  4Q0H A;  2IA2 A;  2VGJ A;  3N8S A;  3I7J A;  4EBP A;  4QJG A;  2QPN A;  2X02 A;  4MCW A;  3S7N A;  1TVF A;  2FZ0 A;  2KOI A;  4HI4 A;  3E4Q A;  2J3W A;  1Q2P A;  3DTE A;  4QPR A;  3NIA A;  1PYY A;  5FDS A;  5FSR A;  4OKP A;  3ZNY A;  3HL9 A;  2WGV A;  5EUA A;  2A24 B;  4QWO A;  1YMX A;  4EEU A;  2J8Y A;  5EE8 A;  2WKR A;  2QWS A;  4OP8 A;  4K0X A;  4KUK A;  1KGG A;  4O7D A;  3DW0 A;  2GDN A;  5CGX A;  3WS5 A;  4RQ9 A;  1N9N A;  4WUJ A;  4IVI A;  4HES A;  1L0G A;  3O87 A;  2HGV A;  4QB8 A;  3CUE A;  4XXR A;  3BY9 A;  5I94 A;  3PBT A;  4L9F A;  3A3F A;  3O3V A;  2P9V A;  3F1O B;  4GOG A;  2G2W A;  5CTN A;  2HJE A;  3T4O A;  4ZAM A;  2XDM A;  1E3U A;  3DTM A;  3T4S A;  1TDG A;  1NYY A;  4ID4 A;  4UEY A;  2DRW A;  2J3T D;  1VHM A;  4BLM A;  1T1C A;  4G3W A;  4R6L A;  3EGD C;  1DP9 A;  2P74 A;  4DE1 A;  3HLF A;  5TBM B;  2KDK A;  2WGW A;  1PWD A;  5FI7 A;  1YLW A;  2A49 A;  2EX8 A;  2EFU A;  1K4F A;  3KSI A;  4JLF A;  1NY0 A;  1OT6 A;  4MMN A;  4X25 A;  2W3F A;  3PR6 A;  3JPU A;  3CPT B;  1SKF A;  4GD8 A;  5DJU A;  4BJP A;  3NOP C;  4N1X A;  5GL9 A;  3UME A;  1PI5 A;  2J7V A;  1IFQ A;  2O0Y A;  4R4R A;  3DBA A;  3B33 A;  2I72 A;  1JWV A;  4YOF A;  3B42 A;  3N8R A;  2WKE A;  1NXY A;  4RA7 A;  1SZV A;  3UE0 A;  2KX6 A;  1FCN A;  2HDU A;  3NC8 A;  1FR1 A;  1KVM A;  3CUE C;  3MZE A;  1W5D A;  3IF5 A;  5EVL A;  4HHD A;  2O9A A;  3JVV A;  4BEN A;  3CMZ A;  3MXR A;  3V3R A;  4BD0 A;  5GHZ A;  2Q9M A;  4N1H A;  3ZHH A;  2DCF A;  2WKQ A;  3R4K A;  3MXQ A;  2P08 A;  4LV3 A;  3VE4 A;  4QU3 A;  3QNC A;  3KSH A;  3H7W B;  3H82 B;  4JBF A;  3OCL A;  3GV9 A;  2JKT M;  4CLC B;  2A24 A;  5IHV A;  2LB9 A;  3T4T A;  3EEH A;  4X1L A;  1ODV A;  1YKD A;  2QJ7 A;  3NDG A;  5KMW A;  3TOI A;  4FUW A;  1MKI A;  3C4O A;  3HLC A;  3S7O A;  4S2N A;  4RX3 A;  3OPR A;  2ZJ9 A;  2ZQA A;  2K31 A;  4ETZ A;  4X53 A;  4WMC D;  5A93 A;  2W3E A;  1PW8 A;  3OLO A;  1KDS A;  3LR3 A;  4WBG A;  3BFE A;  1N9O A;  4DN0 A;  3PBO A;  1CQA A;  4DE0 A;  1SKO A;  1SHV A;  3NI9 A;  1PFL A;  4C3Q A;  1NRJ A;  3IBJ A;  3EQV A;  3RJU A;  3FG8 A;  3IX8 A;  2Y2G A;  1ZG6 A;  1S67 L;  4RX2 A;  4DJ2 A;  2GX5 A;  4UHU A;  1NJ4 A;  1WYB A;  1S0W A;  4EER A;  4N9K A;  2XQZ A;  4OLG A;  2YKH A;  5HWV A;  1D7E A;  1JVJ A;  3KYE A;  4II7 A;  1K55 C;  4LV0 A;  2ZM8 A;  3M6H A;  5FI2 A;  2WAE A;  1IYP A;  5TBM A;  4DE3 A;  1I2W A;  4ETX A;  3LGO A;  3FKW A;  1PZP A;  2FFY A;  4XT2 A;  1LSV A;  2HP9 A;  5DF9 A;  4I38 A;  3PXP A;  4DE2 A;  2XEP A;  3IXD A;  3CPT A;  5FDH A;  4Y0O A;  4MDZ A;  2EXB A;  5HX9 A;  3TE8 A;  3UDX A;  4H6J A;  1T1A A;  4JPM A;  2Z6D A;  3PBN A;  4S2N C;  1TD5 A;  2OLV A;  1W7F A;  3QP8 A;  3CJM A;  3A3J A;  1UGU A;  5KZH A;  1BTL A;  5I5L A;  2Y2Q A;  4GNU A;  2EWW A;  4EES A;  2XFT A;  3CG5 A;  3MQ0 A;  2B18 A;  1Z6F A;  1K54 C;  4MBH A;  3GDI A;  3UMD A;  1XJ4 A;  1OJG A;  4M3K A;  3AGF A;  4D2O A;  3UY6 A;  1EI5 A;  4WEK A;  4LLO B;  1ERM A;  2VKS A;  5CGS A;  5JYP A;  1K25 A;  4NXE A;  1AWI A;  5CHU A;  1ZC2 A;  5E2G A;  5E2F A;  3C4P A;  3LIE A;  3UB9 A;  3GEC A;  4AFI A;  1SCW A;  1DP8 A;  4JF6 A;  1S1Y A;  3D9Y A;  5FEF A;  2GZA A;  3LIC A;  2L0W A;  3IHA A;  5F1F A;  5DKK A;  4Y7P A;  2NUP C;  1JWZ A;  4S2M A;  2W3G A;  3HLB A;  2VX8 A;  4CLC E;  1S6R A;  4HQA A;  2WUQ A;  4KZ4 A;  4Y13 A;  2YKF A;  3KSF A;  3VP0 A;  3GR2 A;  3FWL A;  1DP6 A;  1F2K A;  3C8C A;  1IOU A;  4NXG A;  1FCM A;  4GDB A;  5HAQ A;  2EX6 A;  5HWW A;  4U0T A;  3MXS A;  3S4X A;  1GCE A;  3VFH A;  1S4S A;  2JKG A;  5DKL A;  4G3V A;  3IS2 B;  3HBR A;  4NEE D;  3WS1 A;  4F94 A;  1BSG A;  1P97 A;  2WZZ A;  2XRN A;  1XFQ A;  3W2Z A;  5DF8 A;  1Y4O A;  5CHJ A;  3DWK A;  3ZG7 B;  4LCM A;  1K56 D;  5DFY A;  3ZG5 A;  4WEL A;  4E6W A;  5HSQ A;  4DDS A;  1P0Z A;  5TGF A;  5E2E A;  3HJI A;  2QHK A;  5AVE A;  3TRC A;  1A0K A;  5HDD A;  2ZL1 A;  5J8X A;  2XD1 A;  3C2W A;  5GLA A;  2WGI A;  3BJN A;  1BT5 A;  4CLC C;  4LRZ E;  5U47 A;  5IT5 A;  4WZ4 A;  1W63 Q;  3S1Y A;  2E8J A;  4K0W A;  5FQQ A;  2ZC7 A;  1NWZ A;  3HLW A;  5HAR A;  4E3J A;  2ZBB A;  5F68 A;  4A5R A;  4QHC A;  2R78 A;  3V39 A;  3TJZ C;  4EET B;  1ES2 A;  5A92 A;  5A8B A;  1PIO A;  1MZU A;  1CI8 A;  4R23 A;  2G7U A;  4MBF A;  4S2J A;  2H0T A;  1P9W A;  1H3Q A;  1M6K A;  4B93 A;  4YIN A;  4E3M A;  4LFU A;  1MKM A;  1H8Z A;  5TJJ A;  1K57 A;  1IKI A;  4IED A;  4NXF A;  3ZG9 B;  1MWU A;  4BQM A;  5G4Y A;  2H28 A;  1OTD A;  5TFQ A;  1F5M A;  3ZVW A;  4B4Z A;  4LPZ A;  2JKF A;  3GMW A;  2JKR I;  2OAQ 1;  2V2F F;  1E25 A;  2PAV P;  3CZD A;  2HP6 A;  3W4Q A;  3BWL A;  4XUZ A;  2RL3 A;  4R38 A;  4JGP A;  1T18 A;  1IKG A;  3BQA A;  2ZOI A;  1VB6 A;  2DMW A;  2HDS A;  4G3K A;  4L9G A;  2Y2K A;  2Y2J A;  4I5S A;  4BMW A;  2GJ3 A;  3A0V A;  5CHM A;  5GLC A;  2P04 A;  4MBK A;  3IT9 A;  2XGN A;  3ISG A;  3OOV A;  1K38 A;  3KO6 A;  4E3N A;  3MBZ A;  2RCX A;  1PWG A;  4O8G A;  1MWR A;  1NYM A;  1RP5 A;  3Q7Z A;  2Y2N A;  1IYS A;  3NCK A;  4N9L A;  3IS2 A;  4X56 A;  3V5M A;  4P87 A;  2W27 A;  2Y2H A;  4OQH A;  1HZO A;  5IS1 A;  3VSL A;  1K57 C;  4D60 A;  4JGO A;  3MZF A;  3BLM A;  1OTE A;  5AQ7 A;  2AVX A;  2J3T C;  4EBL A;  1D06 A;  3UB5 P;  5EVI C;  3H9W A;  1XJ6 A;  4BD1 A;  4K08 A;  3LR0 A;  4BL3 A;  1KE0 A;  2Y2L A;  3BFD A;  2M7U A;  4KQQ A;  2W1R A;  4HJ6 A;  4GS9 B;  2W3D A;  4S2O A;  4IHQ A;  1V9Z A;  1XFN A;  1CEF A;  3QHY A;  1XA1 A;  4WYY A;  2VEA A;  2Y8H A;  3Q07 A;  3LI9 A;  1OME A;  2V20 A;  4L9E A;  3FPW A;  2B02 A;  3GQZ A;  4BBV A;  3OPP A;  4ARZ B;  2W1T B;  1W79 A;  4P6B A;  1SKO B;  4PM5 A;  2OLU A;  3BLS A;  4WMC A;  4C6Y A;  2NUT C;  4PMA A;  2PDR A;  3K3C A;  3UO9 A;  3ITB A;  2JN7 A;  4JF4 A;  4N92 A;  3SOI A;  2OOL A;  2XRO A;  2HJ9 C;  2P7J A;  3QP6 A;  4HJ3 A;  4KQD A;  3AGE A;  3NOU C;  4OLD A;  4FTX A;  2ACG A;  4YFM A;  5F1G A;  2ZLY A;  5F6A A;  2B5R A;  4RVA A;  5EOE A;  2QYB A;  5IU1 A;  4OQG A;  1XX2 A;  3LIF A;  4XT2 B;  2LB5 A;  5BOH A;  4JKT A;  1ONH A;  2EWV A;  2ZMA A;  3G2Y A;  4KQO A;  3IWI A;  1EWZ A;  1WE4 A;  3ZFZ A;  2D02 A;  4KZ9 A;  4K91 A;  4H6J B;  2VV7 A;  3IH9 A;  4MN6 A;  2WKH A;  3EWK A;  4OPY A;  3V67 A;  3UDF A;  2PU2 A;  4IJG A;  3EEA A;  3A3I A;  1GA0 A;  2A2L A;  3B3X A;  5A91 A;  4FH2 A;  1L3L A;  2H10 A;  3UE1 A;  1XGI A;  3VOL A;  1BYW A;  1RCJ A;  3WS4 A;  5LBR A;  3PAG A;  3ZG0 A;  1NLZ A;  2XA7 S;  2OWH A;  3G35 A;  1OPX A;  1G6A A;  4UA7 A;  4UQI S;  4X6T A;  1L0E A;  3VP2 A;  3FZC A;  4IUH A;  2R9W A;  2OSU A;  1K0K A;  1CI9 A;  1LL5 A;  2BLS A;  2ZOH A;  4EQ1 A;  3FPV A;  2R9X A;  1XXM A;  4Q8I A;  5HZH A;  4GB7 A;  4DXB A;  3RTY A;  2PYR A;  4KUO A;  1XKZ A;  1RGY A;  1ESU A;  3C7V A;  5EFW A;  3VV4 A;  2JE5 A;  4OOL A;  2K7S A;  4ZJ1 A;  3O86 A;  3EOI A;  1DJC A;  1S1Z A;  4NKP A;  2WAD A;  1ACF A;  2HP5 A;  2ZC5 B;  3ITA A;  4GS9 A;  3UPO A;  2Q0O A;  3WWX A;  1G28 A;  3IF6 B;  3LEZ A;  2HV1 A;  3SS4 A;  2Y79 A;  3MZD A;  3WS0 A;  5FAT A;  5J7E A;  1YQS A;  5EVE A;  3NEC A;  1TEM A;  3VOZ A;  2EFX A;  2W1T A;  4R3A A;  4ARZ A;  5FAO A;  1FSW A;  3G6O A;  3CLO A;  3QP2 A;  5A90 A;  2VLG A;  3ZVT A;  1MWS A;  2I9V A;  5EM0 A;  2PT7 A;  3CAX A;  5M1A A;  1XGJ A;  1ONG A;  3C7U A;  3G32 A;  1KE4 A;  1EW0 A;  1F98 A;  4MNR A;  4NG2 A;  4R3J A;  3LID A;  5FL3 A;  4LGW A;  2V9A A;  3F1P A;  2G2U A;  1ESI A;  3VSK A;  1K56 A;  2Y91 A;  2ZL1 B;  1ZHH B;  1LI9 A;  4JXS A;  4Y0U A;  4OP5 A;  1NRF A;  4HP4 A;  4WN5 A;  1LL8 A;  2PD7 A;  4KG2 A;  3LY3 A;  1HTZ A;  4CPK A;  4E3I A;  1ES3 A;  2QMI A;  2VGL S;  5HL1 A;  2IWC A;  1V9Y A;  3LR4 A;  2X01 A;  3MS6 A;  1DY6 A;  5C5K A;  3O88 A;  3LUQ A;  1JNU A;  3LEQ A;  3OCN A;  1YLJ A;  1ZG4 A;  3GRJ A;  4LV2 A;  1BUE A;  4DJ3 A;  1OT9 A;  4P85 A;  2EX9 A;  3IXG A;  4GLQ A;  2IWD A;  3P98 A;  2UV0 E;  5FQK A;  3ZG8 B;  1C3B A;  2XA7 M;  4IVK A;  4Z9Q A;  4UQI M;  1FR6 A;  3SW1 A;  4L0L A;  5HAI A;  3W4O A;  1HVB A;  3Q7V B;  3OBF A;  1TDL A;  4WF0 A;  3TW8 A;  3S7P A;  1BUL A;  3OZH A;  3N8L A;  4JGR A;  3P09 A;  1O7E A;  2IWB A;  4GCZ A;  3CHW P;  3BY8 A;  2UWX A;  2INW A;  1H5X A;  3OPH A;  4X68 A;  1WA9 A;  1YMS A;  2PBD P;  1STZ A;  3M2K A;  5FI6 A;  3IWO A;  3T4J A;  3TSG A;  2PYP A;  3LIA A;  4R1G A;  4S2L A;  4Y5F A;  1JTD A;  4DRT A;  2WKP A;  1TS0 A;  3IF6 A;  4HH2 A;  2FH5 A;  3G2Z A;  5M19 A;  4PM8 A;  4MLL A;  3Q82 A;  4R70 A;  4LCL A;  5J4E A;  2C5W B;  4KEN B;  3U4L P;  1GHP A;  4O0P A;  3CWF A;  3SZT A;  4CJN A;  3FC7 A;  2L4R A;  3E2K A;  2XFS A;  3K2N A;  4NET A;  3M2J A;  3VP4 A;  2Z2L B;  1YPR A;  1FQG A;  4HY8 A;  1SDE A;  3PHY A;  2PRF A;  4U0X A;  5HD5 A;  4EBN A;  3RXX A;  4CQH A;  2ZQD A;  3L7H A;  4X69 A;  5HDS A;  1K6R A;  1ZTU A;  1NZO A;  3Q81 A;  4HBT A;  4Y0T A;  1LL9 A;  3ZNT A;  3AGD A;  3HVF A;  1N9L A;  5L8M A;  3IHB A;  4Q0J A;  2WK0 A;  5F83 A;  3T4K A;  5GLB A;  4GD6 A;  3MQO A;  3EQU A;  1VQQ A;  2Z2M B;  1AXB A;  2PHY A;  1H8M A;  2XF3 A;  2XH9 A;  4PHT A;  1E4D A;  5MC7 A;  1YAX A;  4GJ4 A; 
#chains in the Genus database with same CATH homology
 3IH8 A;  2Q9M A;  4N1H A;  3ZHH A;  4BD1 A;  3VMA A;  2DCF A;  4UA6 A;  4BL3 A;  5EPH A;  1KE0 A;  1ES5 A;  2Y2L A;  3BFD A;  4ZJ3 A;  3IF6 C;  1SDN A;  4KQQ A;  5EOO A;  5FQI A;  4S2O A;  5CER A;  4LV3 A;  2Y2P A;  4QU3 A;  3QNC A;  4KG6 A;  2PBY A;  1HD8 A;  1CEF A;  1MBL A;  3QHY A;  1XA1 A;  4WYY A;  4JBF A;  3OCL A;  3IXB A;  3GV9 A;  3BEB A;  2J9O A;  3Q07 A;  4E6X A;  3DWZ A;  4WM9 A;  3HUO A;  4R4S A;  1OME A;  5IHV A;  2V20 A;  1YT4 A;  2ZQ8 A;  5AQA A;  5HW3 A;  2ZD8 A;  1VM1 A;  3GQZ A;  5JYO A;  3OPP A;  1W79 A;  4P6B A;  3LCE A;  5EEC A;  4PM5 A;  2OLU A;  3BLS A;  4WMC A;  4C6Y A;  3NDG A;  4PMA A;  5KMW A;  3UO9 A;  3TOI A;  4OPQ A;  1K6S A;  1MKI A;  3ITB A;  5E43 A;  5EVI B;  4OPR A;  5KSH A;  3C4O A;  3HLC A;  4JF4 A;  4S2N A;  4RX3 A;  4N92 A;  3OPR A;  2ZJ9 A;  2ZQA A;  3SOI A;  3SH9 A;  3Q7V A;  4X53 A;  3LY4 A;  4WMC D;  5A93 A;  5GHY A;  1PI4 A;  1PW8 A;  1KDS A;  4WBG A;  3MKE A;  3BFE A;  4ZDX A;  3BM6 A;  4R3B A;  3GSG A;  3PBO A;  5HAP A;  3AGE A;  4DE0 A;  1IYO A;  4OLD A;  1SHV A;  3NI9 A;  4YFM A;  5F1G A;  4DXC A;  2ZLY A;  4GN2 A;  2B5R A;  4EQI A;  5GLD A;  3SS5 A;  4EUZ A;  4C3Q A;  5AQ9 A;  4RVA A;  5EOE A;  1LHY A;  3EQV A;  3RJU A;  4E3O A;  1BLP A;  2Y2G A;  4RYE A;  1ZG6 A;  2XD5 A;  4OQG A;  1XX2 A;  4RX2 A;  5KSC A;  5BOH A;  4UHU A;  4JKT A;  1ONH A;  1NJ4 A;  2ZMA A;  3G2Y A;  1WYB A;  2PU4 A;  1S0W A;  4KQO A;  4N9K A;  5HFO A;  2XQZ A;  3IWI A;  1EWZ A;  1WE4 A;  4OLG A;  4OPZ A;  3SH7 A;  3ZFZ A;  3NBL A;  1FCO A;  1JVJ A;  5G18 A;  1ES4 A;  2WKI A;  1K55 C;  4LV0 A;  4KZ9 A;  2ZM8 A;  3TG9 A;  3UPP A;  3M6H A;  2ZC6 B;  5FI2 A;  3SH8 A;  4WZ5 A;  4K91 A;  2C6W B;  2WAE A;  1IYP A;  3VOY A;  4EV4 A;  3IH9 A;  2WKH A;  4DE3 A;  1I2W A;  2HDQ A;  1CK3 A;  3N7W A;  4OPY A;  3VP1 A;  3FKW A;  3HRE A;  2PU2 A;  3UDF A;  5M18 A;  1PZP A;  2FFY A;  2FFF B;  3A3I A;  1MXO A;  1GA0 A;  2HP9 A;  5DF9 A;  2XK1 A;  1N9B A;  2Y2O A;  1PWC A;  3B3X A;  3N6I A;  4KZ6 A;  5A91 A;  4C75 A;  3G31 A;  4FH2 A;  2H10 A;  4DE2 A;  1IYQ A;  5FQJ A;  2Y59 A;  3MKF A;  1GHM A;  3S22 A;  2XEP A;  3IXD A;  3UE1 A;  2BG1 A;  1XGI A;  5FDH A;  4Y0O A;  3UE3 A;  1G68 A;  2EXB A;  4KZA A;  5HX9 A;  1RCJ A;  3UDX A;  5DVA A;  5FAS A;  2OV5 A;  3WS4 A;  4FH4 A;  3PAG A;  2ZC3 B;  4JPM A;  4PPR A;  3ZG0 A;  3MFD A;  3G35 A;  3HUN A;  3PBN A;  4S2N C;  5GHZ A;  1G6A A;  2OLV A;  4UA7 A;  4ZJ2 A;  4GKU A;  1W7F A;  5DTK A;  1KE3 A;  3CJM A;  4X6T A;  3A3J A;  1YLT A;  1MPL A;  1L0E A;  3VP2 A;  5KZH A;  1BTL A;  2Y2Q A;  4GNU A;  3FZC A;  4IBR A;  3NDE A;  2XFT A;  4QY5 A;  3CG5 A;  2QZ6 A;  1Z6F A;  2R9W A;  1K54 C;  3IWQ A;  2OSU A;  4MBH A;  1CI9 A;  3FV7 A;  1LL5 A;  4KZ7 A;  2BLS A;  1XP4 A;  1BLH A;  2CC1 A;  2R9X A;  4M3K A;  1XXM A;  5CEB A;  3AGF A;  4KZ3 A;  4Q8I A;  4GB7 A;  4HEF A;  2Y2I A;  4D2O A;  3UY6 A;  4DXB A;  1EI5 A;  4KZ5 A;  4S2K A;  4WEK A;  1QMF A;  1Q2Q A;  1ERM A;  1XKZ A;  1RGY A;  4P0M A;  5CGS A;  1XPB A;  1ESU A;  3C7V A;  5JYP A;  4S2I A;  1I2S A;  2JE5 A;  4IBX A;  1LI0 A;  4R0Q A;  1JTG A;  1K25 A;  1K4E A;  1YLP A;  1ZKJ A;  3A3E A;  4OOL A;  4ZJ1 A;  3ZGA B;  3O86 A;  2VGK A;  5CHU A;  1ZC2 A;  1DJC A;  4PM7 A;  4XUX A;  4KG5 A;  5E2G A;  5FAP A;  5E2F A;  2P9V B;  2WAD A;  3C4P A;  1M40 A;  4UAA A;  3HLG A;  4U3T A;  2HP5 A;  2ZC5 B;  3FKV A;  3ITA A;  3UPO A;  3ZCZ A;  4JXW A;  1MWT A;  1SCW A;  4JF6 A;  4PM9 A;  3WWX A;  3V3S A;  3VP3 A;  3PAE A;  3IF6 B;  3LEZ A;  4WZ5 C;  3SS4 A;  4B88 A;  1I5Q A;  4KQR A;  4OON A;  3IHA A;  3NY4 A;  3UN7 A;  5F1F A;  4Y7P A;  1MY8 A;  3MZD A;  1JWZ A;  3WS0 A;  4S2M A;  3D4F A;  1KVL A;  5FAT A;  1BLS A;  4DDY A;  5CTM A;  1YQS A;  3HLB A;  2EXA A;  1TEM A;  3E2L A;  4JF5 A;  3PBR A;  3VOZ A;  2EFX A;  4JXV A;  1NZU A;  1S6R A;  1FSW A;  3HUM A;  3PBS A;  5FAO A;  2WUQ A;  4JXG A;  3V50 A;  2WGW B;  1ERO A;  4H8R A;  4KZ4 A;  5A90 A;  2DNS A;  4MEZ A;  3GTC A;  5EVI A;  3PTE A;  3ZVT A;  5FAQ A;  2HDR A;  1GHI A;  3LO7 A;  5GHX A;  3BEC A;  1LLB A;  1MWS A;  1YLY A;  3GR2 A;  3VP0 A;  3FWL A;  5F82 A;  3WRT A;  3RXW A;  3WS2 A;  5M1A A;  1XGJ A;  5CGW A;  2H0Y A;  1ONG A;  1L2S A;  2ZQC A;  4OVD A;  1FCM A;  3C7U A;  3G32 A;  1KE4 A;  3VFF A;  2JCH A;  5DTS A;  3FYZ A;  5EVI D;  1O07 A;  4GDB A;  5DF7 A;  4UA9 A;  4MNR A;  5TR7 A;  5HAQ A;  2Y2M A;  4R3J A;  4ZBE A;  3BFG A;  1CEG A;  2WZX A;  2EX6 A;  4U0T A;  1U60 A;  3BFC A;  3MXS A;  3S4X A;  1GCE A;  1JWP A;  1RGZ A;  2XLN A;  3VFH A;  1IEL A;  2G2U A;  4FD8 A;  4FCF A;  1PZO A;  5FQ9 A;  1ESI A;  3VSK A;  1K56 A;  1W8Q A;  2Y91 A;  3HBR A;  3WS1 A;  5CED A;  1N4O A;  4QY6 A;  4F94 A;  1BSG A;  1LI9 A;  3W4P A;  2WZZ A;  4JXS A;  1BZA A;  4GZB A;  4Y0U A;  3JYI A;  3Q1F A;  5DF8 A;  1W8Y A;  1Y54 A;  5CHJ A;  3UNW A;  2H5S A;  3DWK A;  4OP5 A;  5CRF A;  1NRF A;  2ZM2 A;  4LCM A;  1K56 D;  1DJA A;  3ZG7 B;  3ZG5 A;  4KZB A;  1GA9 A;  4KG2 A;  3LY3 A;  4WEL A;  1HTZ A;  4CPK A;  4E3I A;  4E6W A;  1ES3 A;  2QMI A;  4OOM A;  4DDS A;  2VGJ A;  5TGF A;  3ZDJ A;  3N8S A;  1YM1 A;  2WYX A;  5E2E A;  5HL1 A;  2ZQ7 A;  3I7J A;  4EBP A;  4QJG A;  2IWC A;  2QPN A;  2X02 A;  2X01 A;  5J8X A;  1DY6 A;  1PW1 A;  1TVF A;  3UPN A;  2XD1 A;  5GLA A;  2WGI A;  1BT5 A;  5FA7 A;  2X71 A;  1Q2P A;  3C5A A;  3O88 A;  5U47 A;  3G4P A;  3NIA A;  1PYY A;  3OCN A;  1YLJ A;  1ZG4 A;  3GRJ A;  4WZ4 A;  5FSR A;  3WRZ A;  4LV2 A;  4OKP A;  3S1Y A;  3ZNY A;  3HL9 A;  4NK3 A;  4OH0 A;  1BUE A;  2WGV A;  4K0W A;  5EUA A;  5FQQ A;  4ZTK A;  2ZC4 B;  2ZC7 A;  4OOY A;  4P85 A;  1YMX A;  3HLW A;  5HAR A;  2EX9 A;  3IXG A;  2J8Y A;  3IXH A;  1QME A;  3OPL A;  4OQ0 A;  4E3J A;  2IWD A;  3P98 A;  5EE8 A;  4A5R A;  2JC7 A;  5AQB A;  4QHC A;  5FQK A;  1K55 A;  4OP8 A;  3ZG8 B;  4K0X A;  4DF6 A;  1C3B A;  1L0D A;  1KGG A;  4O7D A;  4IVK A;  4Z9Q A;  3DW0 A;  3V39 A;  4DKI A;  4PM6 A;  4QD4 A;  1FR6 A;  2GDN A;  4L0L A;  5HAI A;  1ES2 A;  5A92 A;  3W4O A;  1HVB A;  2J9P A;  3Q7V B;  1TDL A;  1PIO A;  5CGX A;  3IQA A;  5FQM A;  3WS5 A;  1CI8 A;  1BUL A;  3OZH A;  3N8L A;  4R23 A;  4IVI A;  3P09 A;  4MBF A;  4OQI A;  2H0T A;  4S2J A;  3A3D A;  1O7E A;  1KGE A;  1M6K A;  3BYD A;  4HES A;  4YIN A;  2IWB A;  4E3M A;  1L0G A;  2HPB A;  4EWF A;  3O87 A;  1H8Z A;  3N4I A;  4QB8 A;  1FOF A;  4XXR A;  1K57 A;  2UWX A;  1IKI A;  4GDN A;  5I94 A;  1H5X A;  3PBT A;  3OPH A;  3PBQ A;  4X68 A;  1YMS A;  4IED A;  3G34 A;  3A3F A;  3GVB A;  3O3V A;  2P9V A;  4GOG A;  1MWU A;  3M2K A;  3ZG9 B;  4BQM A;  5FI6 A;  3IWO A;  2G2W A;  2EX2 A;  3TSG A;  5CTN A;  1BLC A;  5TFQ A;  3HLD A;  4R1G A;  4S2L A;  1JTD A;  4ZAM A;  2A3U A;  4LV1 A;  4DRT A;  5CXW A;  3ZVW A;  1ERQ A;  2XDM A;  4B4Z A;  1E3U A;  3GMW A;  3IF6 A;  3DTM A;  1ALQ A;  2V2F F;  1E25 A;  1TDG A;  3G2Z A;  1KDW A;  5M19 A;  1NYY A;  4ID4 A;  5L2F A;  1K54 A;  5D3O A;  4PM8 A;  4MLL A;  2V1Z A;  2WAF A;  3BRM A;  3CZD A;  3Q82 A;  2DRW A;  2HP6 A;  4LCL A;  3W4Q A;  4EBL A;  4XUZ A;  4BLM A;  2C5W B;  4KEN B;  2RL3 A;  5DTT A;  1GHP A;  1YLZ A;  3QNB A;  1IKG A;  2P74 A;  4DE1 A;  1E3U D;  3HLF A;  4CJN A;  2Q9N A;  2WGW A;  1PWD A;  5FI7 A;  1YLW A;  2A49 A;  2XR0 A;  1KGF A;  2EX8 A;  2EFU A;  2XFS A;  1K4F A;  3E2K A;  2HDS A;  4NET A;  3M2J A;  4JLF A;  2E8I A;  3VP4 A;  4WEJ A;  2Y2K A;  2Y2J A;  4BL2 A;  2Z2L B;  4KZ8 A;  1FQG A;  5CHM A;  1NY0 A;  3G30 A;  2Y55 A;  5GLC A;  5CEC A;  4E3L A;  1SDE A;  3SS3 A;  5E2H A;  4U0X A;  4MBK A;  1SKF A;  3IT9 A;  2XGN A;  3ISG A;  4GD8 A;  4EBN A;  3RXX A;  2ZQD A;  4BJP A;  4X69 A;  1K6R A;  1L0F A;  1J9M A;  2Y4A A;  1NZO A;  1K38 A;  1H8Y A;  3Q81 A;  4HBT A;  4N1X A;  5GL9 A;  1PI5 A;  2J7V A;  4E3N A;  4Y0T A;  3MBZ A;  1LL9 A;  2RCX A;  2ZM0 A;  1PWG A;  4E3K A;  3ZNT A;  3AGD A;  3HVF A;  4R4R A;  2I72 A;  1IEM A;  1JWV A;  1MWR A;  1NYM A;  1RP5 A;  3IHB A;  3N8R A;  3OC2 A;  3Q7Z A;  2WKE A;  1NXY A;  4RA7 A;  2WK0 A;  1DJB A;  2Y2N A;  1IYS A;  3UE0 A;  5F83 A;  3NCK A;  4N9L A;  4LEN A;  4X56 A;  5GLB A;  4GD6 A;  3V5M A;  1FCN A;  4P87 A;  2HDU A;  2Y2H A;  4OQH A;  3NC8 A;  3EQU A;  4S2P A;  1XA7 A;  1HZO A;  1FR1 A;  3BFF A;  3M6B A;  3W8K A;  1KVM A;  1VQQ A;  3MZE A;  4X55 A;  3VSL A;  2JBF A;  1K57 C;  2Z2M B;  1AXB A;  1W5D A;  1WYC A;  3IF5 A;  4FSF A;  1FSY A;  5EVL A;  4B4X A;  3UDI A;  2XF3 A;  2ZQ9 A;  3MZF A;  3BLM A;  2XH9 A;  4BEN A;  1E4D A;  3CMZ A;  3MXR A;  5AQ7 A;  3HLE A;  3V3R A;  4BD0 A;  4HBU A;  5EVI C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...