3FYZA

Oxa-24 beta-lactamase complex with sa4-17 inhibitor
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
244
structure length
243
Chain Sequence
HISSQQHEKAIKSYFDEAQTQGVIIIKEGKNLSTYGNALARANKEYVPASTFMLNALIGLENHKATTNEIFKWDGKKRTYPMWEKDMTLGEAMALSAVPVYQELARRTGLELMQKEVKRVNFGNTNIGTQVDNFWLVGPLKITPVQEVNFADDLAHNRLPFKLETQEEVKKMLLIKEVNGSKIYAKSGWGMGVTPQVGWLTGWVEQANGKKIPFSLNLEMKEGMSGSIRNEITYKSLENLGII
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Design, synthesis, and crystal structures of 6-alkylidene-2'-substituted penicillanic acid sulfones as potent inhibitors of Acinetobacter baumannii OXA-24 carbapenemase.
pubmed doi rcsb
source organism Acinetobacter baumannii
molecule tags Hydrolase
molecule keywords Beta-lactamase OXA-24
total genus 81
structure length 243
sequence length 244
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2009-01-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3fyzA00
3MXRA 4ZJ2A 4S2NC 4OONA 4XUXA 2V2FF 5JYOA 3IQAA 5I94A 4LCMA 2EXAA 2H5SA 4FH4A 4X69A 4JXWA 3DWKA 5HX9A 1HZOA 3GV9A 3N7WA 2QPNA 1JTGA 2XEPA 3MKFA 1O7EA 3BECA 4JF4A 4X55A 3UO9A 4E3MA 5CEDA 5CGWA 3UE0A 5EE8A 4ZTKA 4KZAA 2HDRA 5CERA 5EOEA 4RX2A 5F82A 4S2PA 1S0WA 3VFHA 3ITAA 2Y2IA 4ID4A 4BD1A 3IF5A 3Q82A 3HLWA 3A3DA 3N4IA 1K55A 3HLEA 5CECA 1BZAA 3HL9A 3W4OA 1RGZA 4KENB 5L2FA 3OC2A 3PBTA 3NY4A 5AQBA 2WZZA 3ISGA 2EX8A 1I2WA 2XFSA 1E4DA 1ESUA 4R3BA 3VMAA 1XXMA 4KZ8A 5KSCA 2J8YA 5AQ7A 4N9LA 3I7JA 2JBFA 4IVIA 1NJ4A 4RYEA 4K0XA 4JXGA 2C6WB 4JF5A 5FQMA 4MNRA 4DKIA 1RGYA 2FFYA 5EOOA 2IWDA 1XX2A 2HP6A 3G2YA 4X53A 5GHXA 5DVAA 3IHAA 3PAEA 2UWXA 2Y2GA 1FSWA 3PTEA 4IBRA 5A90A 3UPPA 1FCMA 1G68A 4B88A 1PW1A 1WYBA 3IXDA 4CJNA 5FAPA 1ALQA 1K57C 3V3SA 3DWZA 3HUOA 2P9VB 2CC1A 1H8YA 3PBNA 1E3UA 4WEJA 4HBUA 5A92A 1L0GA 2Y2QA 5JYPA 1JVJA 1K55C 3C4PA 3QNCA 3UNWA 1SHVA 1NY0A 4RX3A 1IYQA 1LI0A 2X02A 2WZXA 4XXRA 3HBRA 3PBOA 2BG1A 3IWIA 1KE3A 1O07A 1YLPA 2E8IA 4DXBA 1E25A 3ZG7B 2ZMAA 1ES3A 3OCLA 5TFQA 3NC8A 5CRFA 3RXWA 3VOZA 5DTTA 1LL5A 5AQ9A 5GLCA 3V50A 1DJAA 4RVAA 2WKEA 1ZC2A 2Y2OA 2Y2LA 4JF6A 3SOIA 2DRWA 4QJGA 1FCNA 4U0XA 2A3UA 5CGXA 5BOHA 3G4PA 3FKWA 4MEZA 4Z9QA 5FAOA 4EWFA 1M40A 5E43A 5G18A 3WRZA 3VOYA 2Z2LB 4JBFA 4ZDXA 3O3VA 5A91A 1I2SA 3CJMA 1KE0A 3M6HA 4EBNA 1YLYA 3TSGA 4OQ0A 2ZC5B 5GHZA 5HFOA 4MLLA 2X01A 3MKEA 3MZEA 4E3NA 4K91A 4OVDA 4O7DA 1TDLA 2Y4AA 3ZNTA 3ZVWA 1XGIA 1TVFA 2ZJ9A 3E2KA 3GR2A 2XR0A 4LV3A 2H0TA 4ZJ3A 2G2WA 1BULA 3M6BA 4H8RA 1L0EA 1PI5A 3BYDA 5FI7A 3HLDA 4C3QA 2H0YA 2R9XA 5CHUA 2WKHA 3CMZA 3D4FA 4R23A 1J9MA 3OPHA 1K56A 2PU2A 4P87A 1BLSA 1PYYA 3LEZA 1YMXA 2XK1A 5GL9A 4U0TA 1BSGA 1ZG4A 1L2SA 1YT4A 3NCKA 5F1FA 2OLVA 1ESIA 1AXBA 4HESA 4A5RA 4FH2A 1I5QA 4WM9A 3NIAA 1MY8A 3WS1A 3Q1FA 4KZBA 4E3LA 4E3KA 4QU3A 4MBKA 3ZHHA 2RL3A 2EX2A 5EVLA 3IWOA 3HUMA 1KVLA 1BLHA 1CI8A 3G32A 4N9KA 3UPOA 3Q81A 1G6AA 1PZOA 1XP4A 5GLBA 5U47A 1FR1A 3IXBA 4LENA 1VQQA 3BLSA 3RJUA 2Y2KA 4UA7A 1Q2PA 1GCEA 1W79A 2Y2NA 3B3XA 3GMWA 4OQHA 1PZPA 1RP5A 5E2HA 4LV0A 2EXBA 2Y91A 3BM6A 4KG6A 1FSYA 3FZCA 2HPBA 3SH7A 4YINA 2JCHA 2G2UA 2PU4A 4UHUA 1XGJA 5A93A 3VP0A 5HW3A 4GDNA 3HLCA 4S2JA 3G30A 5FAQA 1CK3A 5HL1A 3IF6B 3UDXA 3MXSA 2ZM8A 3OPRA 4X68A 5CTNA 2ZQ7A 3VSLA 2XH9A 3ZDJA 3A3JA 3HUNA 4JPMA 4ZBEA 3C7VA 2A49A 3SS3A 1W8YA 1SCWA 1L0DA 2X71A 4F94A 5FSRA 4OLDA 3A3FA 1YQSA 3AGDA 3PBRA 3DW0A 4K0WA 5DTKA 1XA7A 5TGFA 3SS4A 5FA7A 4GKUA 2ZM2A 4DE0A 4EV4A 4QY6A 1KGEA 5CEBA 2HDQA 4X6TA 1ZKJA 3V3RA 3S1YA 1XA1A 2Y59A 2ZLYA 3WS5A 2HDUA 2DNSA 3M2JA 1FOFA 3WRTA 1PIOA 4GD8A 2XGNA 3P98A 5EVIB 4DDSA 3C5AA 5EECA 2WGWA 3TOIA 4HEFA 4OQIA 3V39A 4JXSA 1MXOA 3G31A 1K54C 3O88A 1JWPA 4Q8IA 1HTZA 4UA6A 3UY6A 1CEFA 2ZM0A 3W8KA 1JWVA 4KZ7A 5E2FA 4GZBA 1C3BA 3O86A 1SKFA 3NDEA 2EFUA 4DDYA 5CHJA 3ZVTA 1XKZA 1PI4A 1QMEA 3Q07A 5FASA 4OQGA 3SS5A 2OSUA 1KDSA 2ZQ9A 2EX9A 4GD6A 4JKTA 4R1GA 4U3TA 5DF8A 5FI2A 4JLFA 4E3IA 4EBPA 4LV2A 5KMWA 1NXYA 5FQKA 4Y0TA 4OOMA 3LO7A 1M6KA 5FATA 2ZD8A 3PBSA 4Y7PA 2VGKA 2WKIA 1H5XA 4M3KA 4BQMA 3LY3A 4C6YA 3BFFA 5CTMA 4X56A 3V5MA 1W7FA 2B5RA 5GLAA 4FSFA 2ZQCA 4IBXA 1SDEA 5GLDA 1MWTA 1YM1A 1ES4A 4BL3A 3N8LA 4OPYA 4WEKA 3ZCZA 4WMCD 1K4EA 3GQZA 4EBLA 3UE3A 1K54A 1FCOA 1IEMA 2ZC3B 3VP1A 1N9BA 3Q7ZA 4LCLA 3SH8A 4DE2A 4JXVA 4R4SA 4CPKA 3WS4A 1NYYA 3G35A 4S2LA 2Y2HA 4OP8A 1CI9A 4NK3A 2JE5A 1SDNA 3N6IA 4KZ5A 4E6WA 4MBHA 4OLGA 3GVBA 3LY4A 1MBLA 1Z6FA 3CG5A 1GHMA 1YLWA 3Q7VA 4ZAMA 1BTLA 3IXHA 5CGSA 4P85A 1PW8A 4GB7A 3VFFA 1XPBA 3AGEA 4N92A 3NI9A 4GDBA 4S2OA 4WELA 1LLBA 3NBLA 4IEDA 2WGWB 5F83A 4E6XA 2HP9A 3IWQA 4ZJ1A 4GNUA 4Y0UA 1BUEA 3M2KA 2OV5A 4DE3A 1WE4A 3EQUA 2ZQ8A 3QNBA 3QHYA 1K6RA 2Q9MA 3BLMA 5D3OA 5FQJA 3BFDA 4OP5A 5AQAA 2EFXA 4QHCA 2BLSA 1IYPA 3FYZA 1IELA 2QZ6A 4LV1A 4PM6A 5HAQA 1LI9A 5M1AA 1ES2A 3N8SA 4KQQA 1N4OA 3G34A 4YFMA 2XD5A 4KQOA 4PPRA 3SH9A 1BT5A 3BFGA 3C4OA 1K6SA 3OCNA 4QY5A 3S22A 2XF3A 4NETA 5EUAA 1PWDA 5HAPA 3UN7A 5J8XA 4GN2A 4BL2A 3ITBA 3IF6A 5HAIA 4IVKA 3HREA 1TDGA 1PWGA 2VGJA 2WGVA 1HD8A 2V20A 3ZGAB 3P09A 1MWSA 1ES5A 2ZC6B 2EX6A 4KZ3A 4P0MA 1E3UD 1IYSA 1MPLA 5GHYA 2ZC4B 1GA9A 2J7VA 5DTSA 4S2IA 5TR7A 2WADA 2XFTA 1GHPA 3A3IA 4OPQA 2ZC7A 5CHMA 4N1XA 1FQGA 1IKGA 4WYYA 1BLPA 1BLCA 4FCFA 1VM1A 3MBZA 4N1HA 1Q2QA 3HVFA 4FD8A 3UPNA 1OMEA 2C5WB 2V1ZA 3BFEA 3BRMA 4KZ6A 1TEMA 1QMFA 2WYXA 2J9OA 2HDSA 1JTDA 1DJBA 5DF7A 5EVIC 4E3JA 3OZHA 1MKIA 3E2LA 4XUZA 3GRJA 1KGGA 3ZG8B 2Y2MA 1ZG6A 5EVIA 1EROA 4PM7A 2Y2JA 1WYCA 4WBGA 3IF6C 1YLJA 5DF9A 3HLFA 4KG2A 4S2KA 1IYOA 4R4RA 5KZHA 2J9PA 3HLBA 2I72A 4WZ5A 3GSGA 5E2GA 1LL9A 4L0LA 1GHIA 4MBFA 4KZ4A 3GTCA 5M18A 3IHBA 2WAEA 5EPHA 5FQIA 1RCJA 3WS0A 2WK0A 1PWCA 2RCXA 5FQ9A 2H10A 5IHVA 5E2EA 4B4ZA 4D2OA 4DRTA 3S4XA 4B4XA 3VSKA 1KGFA 1K4FA 3IH8A 3VP4A 5CXWA 3O87A 3IT9A 2XD1A 4PMAA 1ERMA 1ERQA 1NRFA 3RXXA 3W4PA 2WGIA 1EI5A 1ONHA 1K25A 4UAAA 1Y54A 4RA7A 3VP2A 3UDIA 4EQIA 5EVID 3JYIA 3ZG0A 2XLNA 4BLMA 4WZ4A 3PAGA 4DE1A 3AGFA 1H8ZA 1KVMA 1DY6A 4BENA 4C75A 5F1GA 1KDWA 3BFCA 3PBQA 4KZ9A 1YLZA 3EQVA 3N8RA 2ZQDA 3NDGA 4OOYA 2Y2PA 3UE1A 1YLTA 4DF6A 1FR6A 2R9WA 2XDMA 3IH9A 4PM9A 4PM5A 1CEGA 2WUQA 3BEBA 1K57A 3FWLA 2Q9NA 4QB8A 3TG9A 1MWRA 4EUZA 2Z2MB 1NZOA 3FV7A 1JWZA 3FKVA 1U60A 3IXGA 2OLUA 4E3OA 2JC7A 1IKIA 2HP5A 1MWUA 3C7UA 1NZUA 3A3EA 4OPZA 4GOGA 5HARA 2WAFA 5FI6A 4WZ5C 2ZQAA 1K38A 4BD0A 4BJPA 4DXCA 5KSHA 3ZG9B 3DTMA 3G2ZA 3OPPA 4OKPA 2Y55A 3W4QA 1S6RA 5FQQA 1LHYA 1EWZA 4R0QA 5M19A 3CZDA 4WMCA 1YMSA 4Y0OA 2PBYA 3MZFA 4OH0A 2P74A 3ZG5A 5FDHA 2IWBA 3UDFA 4S2MA 1HVBA 3ZNYA 4UA9A 2GDNA 1ONGA 3HLGA 4OPRA 4P6BA 1W8QA 3MZDA 4PM8A 3WS2A 4KQRA 1W5DA 1KE4A 4QD4A 2IWCA 3Q7VB 4HBTA 1L0FA 2QMIA 3MFDA 1NYMA 2XQZA 1DJCA 4KG5A 4R3JA 3ZFZA 2DCFA 3VP3A 2P9VA 2FFFB 3WWXA 1K56D 1GA0A 4S2NA 4OOLA 3LCEA 3OPLA
chains in the Genus database with same CATH superfamily
3VE3A 5AVFA 1VETB 4XUXA 5JYOA 3D9YA 1XFQA 5EVEA 3CHWP 4HP4A 1JTGA 4X55A 1O7EA 4E3MA 4JF4A 5CEDA 5EE8A 1YKDA 4EUVA 4PKYA 5EOEA 5F82A 4S2PA 2H28A 3Q82A 3MFXA 4HP9A 3W4OA 4UQIM 3NY4A 1FIKA 2WZZA 2L0WA 1I2WA 4R3BA 4Q0IA 2J8YA 5AQ7A 2JBFA 4JXGA 2C6WB 5FQMA 5HD3A 2ACGA 5GHXA 3IHAA 3PAEA 2UWXA 2Y2GA 4IBRA 3UPPA 4ESPA 3HUOA 1H8YA 3PBNA 1J3WA 1K55C 3LIBA 1SHVA 3B33A 4B93A 1IYQA 2X02A 2WZXA 1XJ6A 4GCZA 2ZMAA 3DTIA 3OCLA 1PFLA 3NC8A 5DTTA 5GLCA 3VE4A 1DJAA 3JPUA 5HWTA 2PYPA 4QPRA 3FKWA 4Y17A 4ZDXA 3O3VA 1I2SA 3M6HA 4H6JB 4YOFA 2ZC5B 4E3NA 4K91A 3ZNTA 2Y4AA 3T4JA 2EWWA 1YAXA 2ZL1A 3MQQA 4C3QA 2H0YA 3MR0A 3CI6A 3OPHA 1K56A 2HGVA 5DJUA 5F1FA 1LSVA 3UB9A 3CITA 3WS1A 4QU3A 2EX2A 5IS1A 3UPOA 1XP4A 1FR1A 3IXBA 4LENA 3BLSA 3DAVA 2Y2KA 3CLOA 4UA7A 5J7EA 1GCEA 3GMWA 2Y2NA 1PZPA 2XROA 3SH7A 4YINA 2JCHA 3SW1A 4EERA 5A93A 3VP0A 4I3IA 1CK3A 5HL1A 3IF6B 5CTNA 2XH9A 3HUNA 4JPMA 1S67L 3SS3A 5FSRA 3RTYA 3FPVA 3NOTC 3A3FA 4K0WA 1HLUP 5DTKA 1XA7A 5TGFA 3SS4A 1N9NA 4DE0A 4QY6A 1KGEA 2HDQA 3V3RA 3S1YA 3NOPC 3WS5A 3M2JA 3WRTA 2W3GA 1PIOA 4OQIA 1MXOA 3G31A 1K54C 4Q8IA 2ZM0A 1JWVA 4KZ7A 2VX8A 4MN5A 3CPTA 3EGXC 1G6OA 3O86A 3EOIA 2V8FA 3F1PA 2ZOHA 3SS5A 1KDSA 4JKTA 5DF8A 2EX9A 5G4ZA 4E3IA 1V9ZA 3PBSA 4Y7PA 2WKIA 2OWHA 4M3KA 3LY3A 1W7FA 4FSFA 3T4LA 1MWTA 4L9GA 4EBLA 1YPRA 3VP1A 3SH8A 3WS4A 1NYYA 4L9EA 4S2LA 4O0PA 4OP8A 3IS2B 3N6IA 3LICA 4OLGA 4EXOA 3CG5A 3T50A 4ZAMA 2Z6CA 3EEHA 1H8MA 3IBRA 4N92A 4WELA 1P9RA 4E6XA 2HP9A 1BUEA 1WE4A 3QHYA 2OOLA 4IUHA 3BFDA 3JVUA 1PRQA 1T18A 3FYZA 1IELA 4PM6A 1LI9A 1ES2A 5EM0A 1N4OA 4FTXA 1BT5A 3OCNA 2JKTI 4QY5A 2J3WA 5EM1A 5HAPA 4UQIS 4D60A 2FZ0A 3IF6A 4AFIA 1TDGA 3P09A 4HH3A 4HJ6A 2ZC4B 5DTSA 1WA9A 2YKFA 5CHMA 4E04A 5TJJA 1IKGA 4FCFA 3MBZA 1Q2QA 2C5WB 4Q0HA 1TEMA 3PHYA 2QJ5A 5HWWA 2J9OA 1DJBA 3GRJA 2M7UA 3ZG8B 1ZG6A 3BQ8A 5J4EA 3KYEA 3HLFA 4KG2A 3E4PA 2J9PA 2I72A 2PT7A 5L07A 5M18A 3GTCA 3LUQA 1NWZA 4DRTA 2MJ6A 1OJGA 3A0SA 2V0UA 4HJ3A 3W4PA 3RXXA 3LR5A 1EI5A 4MCWA 4RA7A 3PXPA 3VP2A 3JYIA 3KO6A 4MN7A 4BLMA 4DE1A 3AGFA 1KVMA 4BENA 4NXFA 2VJWA 4KZ9A 2ZBBA 3BY8A 1OT6A 3C30A 3QP8A 2PAVP 3L9KA 2XDMA 3IH9A 3TG9A 4EUZA 1NZOA 3DTEA 4PHTA 1F2KA 3E98A 2J80A 1IKIA 3GECA 2HP5A 3A3EA 5KSHA 5FI6A 4WZ5C 1K38A 4OKPA 5TBMB 2Y55A 1LHYA 3CZDA 4WMCA 1YMSA 2V8CA 3MZFA 4OH0A 4S2MA 1HVBA 4UA9A 3HLGA 4EEPA 4P6BA 1W8QA 3GDIA 4PM8A 4R70A 4G3KA 5CX7A 3Q7VB 1L0FA 1H3QA 2DCFA 1K56D 1FILA 1GA0A 2L1MA 4MDZA 4WL9A 5I94A 4LCMA 2EXAA 4JXWA 3DWKA 5HX9A 1OTAA 3S7PA 3UO9A 3EGDC 1S0WA 3VFHA 3ITAA 2Y2IA 2CMNA 1S4RA 1H0MA 2JKRM 3HLWA 1K55A 3HLEA 5CECA 1RGZA 2PRFA 4KENB 5L2FA 4JGOA 2B02A 3ISGA 1A0KA 2K31A 2A24A 4IVIA 4MNRA 2FFYA 2IWDA 2HP6A 3T1RA 1G68A 1WYBA 3IXDA 5EFWA 2V1BA 4CJNA 5FAPA 2INWA 2CC1A 3B42A 1E3UA 4HBUA 5A92A 3QP4A 1NY0A 3NOUC 3HBRA 1P0ZA 2BG1A 2HZ5A 4UEYA 3W2ZA 5TFQA 1LL5A 5AQ9A 4RVAA 2VV7A 1ZC2A 2Y2OA 2Y2LA 3SOIA 2JN7A 2DRWA 5FEFA 2A3UA 3G4PA 4KQDA 2O9BA 4Z9QA 1Y28A 3VOYA 2PR6A 4HQAA 1KE0A 3DBAA 4EBNA 3TJZC 1TF1A 3TSGA 4OQ0A 4EW7A 4HIAA 5GHZA 5HFOA 5HZHA 4O7DA 1TDLA 3ZVWA 1TVFA 3GR2A 4LV3A 2DMWA 2G2WA 1BULA 4CLCB 3A0RA 1L0EA 3BYDA 2WKRA 5FI7A 3PR6A 3K3CA 2WKHA 3D4FA 1CF0A 1G5UA 4R23A 1J9MA 4DJ2A 4P87A 1BLSA 1PYYA 5HDDA 5GL9A 4Y2FA 3NCKA 1YT4A 5HSQA 4HESA 4FH2A 1I5QA 3Q1FA 4E3LA 4E3KA 3IWOA 3ZQ5A 3G32A 4B9OA 2D02A 1PZOA 3H82B 1VQQA 2W3DA 1Q2PA 1VEUB 5E2HA 3VV4A 2Y91A 3BM6A 3JVVA 3FZCA 2HPBA 3V67A 4I3AA 1XGJA 3LI8A 3HLCA 4S2JA 3G30A 5FAQA 5HDCA 4DMZA 2PDRA 3MXSA 2PD8A 2Q0OA 4ZBEA 4WUJA 3E4QA 1W8YA 1N9LA 4OLDA 4LFUA 3UB6A 2WKQA 2YKHA 4I3JA 5FA7A 4GKUA 3UMEA 4WN5A 2B18A 4X1LA 3FC7A 1PNEA 4X6TA 1ZKJA 2ZOIA 2Y59A 2DNSA 1FOFA 1S66L 2KOIA 4GD8A 2XGNA 3P98A 3R7WA 3C5AA 5EECA 2WGWA 3TOIA 5IT5A 4HEFA 4UA6A 1CEFA 3W8KA 5E2FA 4LGWA 1XKZA 1QMEA 3Q07A 4OQGA 4Y5FA 5FI2A 4P6ZS 1ACFA 4L9FA 5KMWA 1NXYA 2GNXA 5FQKA 2VV6A 1M6KA 1ZHHB 4BQMA 1GSXA 5GLAA 2ZQCA 4IBXA 1YM1A 3ZCZA 1XFNA 3GQZA 3UE3A 1K54A 1FCOA 1XJ2A 4JXVA 4R4SA 3G35A 3C8CA 4EU0A 2Y2HA 4NK3A 2JE5A 4MBHA 1BTLA 5CGSA 1PW8A 4IEDA 1NRJA 3E4OA 3IWQA 4H6JA 2OV5A 2W3EA 3M2KA 4P6ZM 4DE3A 2ZQ8A 3H9WA 2Q9MA 3BLMA 5FQJA 1X0OA 4OP5A 1S1ZA 2BLSA 4LV1A 2JHEA 3N8SA 3G34A 3LR0A 5HD5A 3NHQA 4KQOA 4PPRA 2ZL1B 1K6SA 1VEUA 3T1SA 3S22A 2XF3A 4NETA 5EUAA 1PWDA 5HDSA 2LB9A 3NECA 4GHIA 3LR4A 2VGJA 2WGVA 2AVXA 4KZ3A 2ZC6B 4P0MA 1IYSA 2JKRI 1GA9A 4S2IA 2XFTA 4G3VA 3LIEA 3H7WB 2A2LA 2ZC7A 1BLPA 5HPFA 1VM1A 1YSQA 1OMEA 2HV1A 3BRMA 1OTBA 4KZ6A 4X1MA 5EVIC 2BTFP 1MKIA 2V9AA 2Y2MA 4I5SA 5FDSA 3QP1A 1WYCA 4R6LA 2J3TC 5C5KA 1YLJA 3RH8B 5KZHA 2JKFA 5E2GA 1LL9A 4L0LA 4NG2A 4MBFA 1GHIA 1STZA 2VV8A 4CQHA 3IHBA 5FQIA 3WS0A 3BJNA 1PWCA 5FQ9A 4B4ZA 5IHVA 3OBFA 3S4XA 2BASA 1KGFA 3IH8A 4X25A 5CXWA 3O87A 4JGPA 1ERQA 1JNUA 1Y54A 4EQIA 4PKYG 4LRZE 4DN0A 1NLYA 4WZ4A 3PAGA 3K3DA 2QYBA 4LRXC 1VETA 1KDWA 5HPIA 3BFCA 3PBQA 1YLZA 3N8RA 4PAUA 2WUQA 4QB8A 2Z2MB 5LBRA 1AWIA 3IXGA 4E3OA 1SKOA 4GS9B 2JC7A 3QP6A 1NZUA 4OPZA 1UWNX 4GOGA 4BJPA 2ZQAA 4DXCA 2P04A 2W27A 2B95A 4KUOA 1DRMA 4R0QA 5M19A 2PBYA 3ZG5A 3UDFA 1DP6A 1MZUA 1XJ3A 1ONGA 3T12B 3SZTA 4OPRA 2KX6A 3MZDA 1DP9A 1KE4A 4BMWA 4QD4A 3CAXA 3UB8A 1D06A 2QMIA 3UMDA 2W1TB 4KG5A 3VP3A 3WWXA 1OPXA 3LCEA 3MXRA 4ZJ2A 4OONA 3IQAA 2H5SA 4FH4A 3N7WA 2XEPA 3BECA 3CUEC 5CGWA 4ZTKA 2HDRA 4RX2A 2V1AA 3LIDA 4ID4A 3IF5A 2GZAA 2PR5A 1BZAA 4ARZB 3OC2A 4WLAA 3PBTA 5AQBA 3D72A 2EX8A 4KZ8A 2VEAA 4N9LA 2O9CA 4RYEA 3CWFA 4JF5A 4DKIA 2P08A 5EOOA 5DVAA 1FSWA 3PTEA 4B88A 1PW1A 1ALQA 1K57C 3DWZA 2P9VB 2Y2QA 1JVJA 3KX0X 2A24B 3UNWA 3MQ0A 5I5LA 4RX3A 5L09A 3IWIA 4DXBA 1YLPA 3MJQA 3ZG7B 4WF0A 3RXWA 3VOZA 3F1NA 3V50A 5KIZA 2JKGA 2WKEA 3LIAA 3D3OA 1OTDA 1LSXA 4RQ9A 4QJGA 4U0XA 2V0WA 5CGXA 4MEZA 1M40A 3WRZA 2Z2LB 2D01A 4EEUA 4GS9A 3UB5P 2NUTC 4HI4A 3MKEA 3MZEA 5J3WA 4HNBA 3KSFA 3M6BA 2LB5A 3LEQA 3HLDA 3C38A 1YMXA 2XK1A 3KSIA 4U0TA 3MS6A 1BSGA 1ZG4A 2OLVA 1AXBA 4WM9A 3KSHA 4HJ4A 3TW8A 1GSWA 1BLHA 4IJGA 4XT2A 4OQHA 3FPWA 2XA7S 4LV0A 2EXBA 3O5YA 4KG6A 1FSYA 2I9VA 4MN6A 4G3WA 3VSLA 2ZM8A 2XA7M 3ZDJA 3A3JA 4Y3IA 2A49A 4HOIA 1L0DA 2X71A 4F94A 3AGDA 3BY9A 3DW0A 2W3HA 2ZM2A 4O01A 5G4YA 5CEBA 1XA1A 5IU1A 2ZLYA 1MKMA 2HDUA 3MQOA 4DDSA 1NLZA 3V39A 1HTZA 2XSSA 3VOLA 3UY6A 3F1NB 4GZBA 1C3BA 3OLOA 3T1XA 3NDEA 2EFUA 4DDYA 3ZVTA 1PI4A 4CLCA 4U3TA 4R1GA 3G6OA 2QHKA 4EBPA 4Y0TA 4BBVA 1H5XA 2WKPA 3MXQA 3V5MA 1F5MA 2B5RA 1SDEA 4BL3A 1ZTUA 3N8LA 4OPYA 4ME4A 2Y79A 2ZC3B 2E8JA 1N9BA 3Q7ZA 1OTEA 4DE2A 3HJIA 2HF6A 1CI9A 4E6WA 3IS2A 3GVBA 3ICYA 1GHMA 1YLWA 3IXHA 3P7NA 3VFFA 3NI9A 4GDBA 4S2OA 1LLBA 5F83A 4ZJ1A 4GNUA 4Y0UA 3EEAA 4II7A 3KYQA 3QNBA 5D3OA 5F6AA 1S1YA 5AQAA 4QHCA 1IYPA 5HAQA 4YWZA 5M1AA 4LLOB 5F68A 4NKPA 5EV0A 3LFVA 3UE6A 3MF0A 1PWGA 1HD8A 2V20A 1ES5A 2EX6A 5GHYA 4FOFA 3LI9A 1GHPA 4OPQA 4NXBA 4O8GA 4N1XA 1FQGA 1BLCA 2HJEA 3ZYTA 4N1HA 3HVFA 4FD8A 5DFXA 3TE8A 3BFEA 1QMFA 1JTDA 5DF7A 3BWLA 1KGGA 1EROA 4PM7A 2Y2JA 1Y4OA 4XT2B 5DF9A 3NULA 4S2KA 1IYOA 3LIFA 4R4RA 2W1RA 3KSGA 4KZ4A 4LRYC 2QWSA 2WAEA 2IA2A 3T4KA 2H10A 2PBDP 5E2EA 4BBUA 3VSKA 3IT9A 3RFBA 4I38A 1VHMA 4JGQA 2J3TD 1ERMA 2FH5A 2WGIA 1K25A 5EVID 2OWJA 1D1JA 1GSVA 1DY6A 5F1GA 2EWVA 4GJ4A 3OPLA 2ZQDA 4OOYA 1YLTA 4PM9A 4PM5A 3T4OA 1CEGA 2Q9NA 1MWRA 3FV7A 4EQ1A 2Z6DA 2OLUA 1G28A 3C7UA 5L8MA 4GHIB 1TS7A 2WAFA 4BD0A 3QP5A 1UWPX 3G2ZA 3OPPA 1S6RA 5FQQA 1EWZA 2P74A 5FDHA 2IWBA 2GDNA 4IUKA 2KLIA 3WS2A 1XJ4A 4HBTA 3MFDA 1IOUA 1NYMA 2XQZA 1DJCA 3ZFZA 3PYPA 4NEED 4S2NA 3BQAA 4OOLA 4S2NC 5F5YA 1F9IA 2V2FF 4DJ3A 2G7UA 4X69A 1T1BA 1HZOA 3GV9A 2QPNA 2VGLS 4HY8A 3MKFA 3LYXA 3UE0A 4KZAA 5CERA 2VLGA 4BD1A 3U2AA 3A3DA 3N4IA 1YSPA 3HL9A 1BYWA 4GLQA 1LT0A 2XFSA 1E4DA 1ESUA 3VMAA 1XXMA 5KSCA 4F3LB 2GJ3A 5AVEA 3I7JA 1NJ4A 4K0XA 4BBTA 3ULFA 2R78A 3F1PB 1RGYA 1XX2A 3G2YA 4X53A 5A90A 1P97A 1FCMA 2VKSA 3V3SA 1SZVA 4WEJA 3T4TA 5JYPA 1L0GA 3C4PA 2M1CA 3QNCA 1LI0A 4XXRA 1SKOB 3PBOA 1KE3A 1O07A 2E8IA 1E25A 1ES3A 5CRFA 3CUEA 3K2NA 4NXEA 3H82A 4JF6A 3U4LP 1FCNA 2HJ9C 5BOHA 2O0YA 5DKKA 5FAOA 4EWFA 5E43A 5G18A 4JBFA 3UB7A 5A91A 3CJMA 5DKLA 1YLYA 3IBJA 2ZMVA 4MMNA 5K5BA 4MLLA 2X01A 4OVDA 1OJ5A 1XGIA 3QP2A 2ZJ9A 3E2KA 2XR0A 2H0TA 4ZJ3A 4Z1WA 3R4KA 4H8RA 2VK3A 1PI5A 1CJFA 2R9XA 5CHUA 3CMZA 1TS0A 2PU2A 3LEZA 2XRNA 1L2SA 1OTIA 4HHDA 1ESIA 1P9WA 3IX8A 4A5RA 3NIAA 1MY8A 4KZBA 4MBKA 3ZHHA 2RL3A 5EVLA 3HUMA 1KVLA 1CI8A 4N9KA 1TS8A 3Q81A 1G6AA 4K08A 3IX3A 2W3FA 5GLBA 5U47A 1N9OA 3L7HA 3RJUA 3T1QB 1W79A 3B3XA 3MSHA 1RP5A 3F1OA 4BWIA 5HWVA 4CLCD 2G2UA 2PU4A 4UHUA 3T4QA 5HW3A 4GDNA 1W63M 3LR3A 4LPZA 4ETXA 3UDXA 3OPRA 4X68A 2ZQ7A 4F3LA 4CLCE 4QWOA 3C7VA 2VA0A 2K2NA 1SCWA 3PBRA 1YQSA 2O99A 2W0NA 2QKPA 3CPTB 2QJ7A 4EV4A 5AJGA 2JKTM 3KYZA 1L3LA 2VZWA 1S4SA 4YNRA 5EVIB 4ARZA 1TD5A 3BW6A 4JXSA 3O88A 1JWPA 4R38A 1UGUA 4FUWA 4Y15A 2L4RA 1SKFA 4Y13A 5CHJA 5FASA 3FG8A 2OSUA 2ZQ9A 4GD6A 4ZRRA 4IHQA 4JLFA 4LV2A 2PD7A 4OOMA 3LO7A 5FATA 2ZD8A 2VGKA 4C6YA 2ZMFA 3BFFA 5CTMA 4X56A 3C2WA 5GLDA 1ES4A 1MC0A 4WEKA 4WMCD 1K4EA 3TRCA 1IEMA 2OAQ1 1KOUA 5L10A 4LCLA 4CPKA 3H7WA 1SDNA 4KZ5A 4CLCC 3HCYA 3DTKA 3LY4A 1MBLA 1Z6FA 3Q7VA 4P85A 2PHYA 4GB7A 4M4XA 1XPBA 3AGEA 3NBLA 3R7WB 2WGWB 1TS6A 4I39A 4R3AA 2EA9A 3EQUA 1K6RA 2EFXA 2K7SA 1ODVA 3EWKA 2QZ6A 4EESA 4KQQA 1T1AA 4YFMA 2XD5A 3SH9A 3BFGA 5DFYA 3C4OA 5A8BA 3UN7A 5J8XA 4GN2A 4BL2A 3ITBA 2KDKA 1IFQA 4IVKA 5HAIA 3HREA 4ETZA 1D7EA 2M7VA 3ZGAB 2Y8HA 5TBMA 1F98A 1MWSA 1E3UD 1MPLA 2J7VA 1OT9A 5TR7A 2WADA 4JGRA 2VGLM 4Q0JA 3A3IA 3E0YA 1K0KA 3MMHA 4WYYA 1CQAA 3UPNA 3T4SA 2P7JA 2V1ZA 2WYXA 2HDSA 3A0VA 4E3JA 3B47A 3OZHA 3E2LA 4XUZA 5FEGA 5EVIA 4WBGA 3IF6C 2OAP1 1Z09A 1T19A 1DP8A 3HLBA 3LGOA 4WZ5A 3GSGA 5HL6A 5EPHA 1RCJA 1LSWA 2WK0A 2NUPC 3F1OB 2RCXA 4EETB 4D2OA 3NJAA 4B4XA 1K4FA 3VP4A 2XD1A 4PMAA 3S7OA 1NRFA 3HJKA 4HH2A 5MC7A 1ONHA 4UAAA 2GX5A 1VB6A 3UDIA 3ZG0A 2XLNA 1H8ZA 4C75A 1EW0A 2O9AA 3EQVA 3S7NA 3NDGA 2Y2PA 3UE1A 4DF6A 1FR6A 2R9WA 3BEBA 1K57A 3FWLA 5F69A 1JWZA 3P01A 4NXGA 1LL8A 3FKVA 1U60A 1MWUA 2PYRA 5HARA 3ZG9B 3DTMA 3W4QA 4KUKA 4Y0OA 3ZNYA 3S7QA 2UV0E 4KQRA 1W5DA 1W63Q 2IWCA 3OOVA 5DJTA 4GW9A 4R3JA 2W1TA 2P9VA 2FFFB 1T1CA 3IX4A 1V9YA 5FL3A
chains in the Genus database with same CATH topology
3MXRA 4ZJ2A 4S2NC 4OONA 4XUXA 2V2FF 5JYOA 3IQAA 5I94A 4LCMA 2EXAA 2H5SA 4FH4A 4X69A 4JXWA 3DWKA 5HX9A 1HZOA 3GV9A 3N7WA 2QPNA 1JTGA 2XEPA 3MKFA 1O7EA 3BECA 4JF4A 4X55A 3UO9A 4E3MA 5CEDA 5CGWA 3UE0A 5EE8A 4ZTKA 4KZAA 2HDRA 5CERA 5EOEA 4RX2A 5F82A 4S2PA 1S0WA 3VFHA 3ITAA 2Y2IA 4ID4A 4BD1A 3IF5A 3Q82A 3HLWA 3A3DA 3N4IA 1K55A 3HLEA 5CECA 1BZAA 3HL9A 3W4OA 1RGZA 4KENB 5L2FA 3OC2A 3PBTA 3NY4A 5AQBA 2WZZA 3ISGA 2EX8A 1I2WA 2XFSA 1E4DA 1ESUA 4R3BA 3VMAA 1XXMA 4KZ8A 5KSCA 2J8YA 5AQ7A 4N9LA 3I7JA 2JBFA 4IVIA 1NJ4A 4RYEA 4K0XA 4JXGA 2C6WB 4JF5A 5FQMA 4MNRA 4DKIA 1RGYA 2FFYA 5EOOA 2IWDA 1XX2A 2HP6A 3G2YA 4X53A 5GHXA 5DVAA 3IHAA 3PAEA 2UWXA 2Y2GA 1FSWA 3PTEA 4IBRA 5A90A 3UPPA 1FCMA 1G68A 4B88A 1PW1A 1WYBA 3IXDA 4CJNA 5FAPA 1ALQA 1K57C 3V3SA 3DWZA 3HUOA 2P9VB 2CC1A 1H8YA 3PBNA 1E3UA 4WEJA 4HBUA 5A92A 1L0GA 2Y2QA 5JYPA 1JVJA 1K55C 3C4PA 3QNCA 3UNWA 1SHVA 1NY0A 4RX3A 1IYQA 1LI0A 2X02A 2WZXA 4XXRA 3HBRA 3PBOA 2BG1A 3IWIA 1KE3A 1O07A 1YLPA 2E8IA 4DXBA 1E25A 3ZG7B 2ZMAA 1ES3A 3OCLA 5TFQA 3NC8A 5CRFA 3RXWA 3VOZA 5DTTA 1LL5A 5AQ9A 5GLCA 3V50A 1DJAA 4RVAA 2WKEA 1ZC2A 2Y2OA 2Y2LA 4JF6A 3SOIA 2DRWA 4QJGA 1FCNA 4U0XA 2A3UA 5CGXA 5BOHA 3G4PA 3FKWA 4MEZA 4Z9QA 5FAOA 4EWFA 1M40A 5E43A 5G18A 3WRZA 3VOYA 2Z2LB 4JBFA 4ZDXA 3O3VA 5A91A 1I2SA 3CJMA 1KE0A 3M6HA 4EBNA 1YLYA 3TSGA 4OQ0A 2ZC5B 5GHZA 5HFOA 4MLLA 2X01A 3MKEA 3MZEA 4E3NA 4K91A 4OVDA 4O7DA 1TDLA 2Y4AA 3ZNTA 3ZVWA 1XGIA 1TVFA 2ZJ9A 3E2KA 3GR2A 2XR0A 4LV3A 2H0TA 4ZJ3A 2G2WA 1BULA 3M6BA 4H8RA 1L0EA 1PI5A 3BYDA 5FI7A 3HLDA 4C3QA 2H0YA 2R9XA 5CHUA 2WKHA 3CMZA 3D4FA 4R23A 1J9MA 3OPHA 1K56A 2PU2A 4P87A 1BLSA 1PYYA 3LEZA 1YMXA 2XK1A 5GL9A 4U0TA 1BSGA 1ZG4A 1L2SA 1YT4A 3NCKA 5F1FA 2OLVA 1ESIA 1AXBA 4HESA 4A5RA 4FH2A 1I5QA 4WM9A 3NIAA 1MY8A 3WS1A 3Q1FA 4KZBA 4E3LA 4E3KA 4QU3A 4MBKA 3ZHHA 2RL3A 2EX2A 5EVLA 3IWOA 3HUMA 1KVLA 1BLHA 1CI8A 3G32A 4N9KA 3UPOA 3Q81A 1G6AA 1PZOA 1XP4A 5GLBA 5U47A 1FR1A 3IXBA 4LENA 1VQQA 3BLSA 3RJUA 2Y2KA 4UA7A 1Q2PA 1GCEA 1W79A 2Y2NA 3B3XA 3GMWA 4OQHA 1PZPA 1RP5A 5E2HA 4LV0A 2EXBA 2Y91A 3BM6A 4KG6A 1FSYA 3FZCA 2HPBA 3SH7A 4YINA 2JCHA 2G2UA 2PU4A 4UHUA 1XGJA 5A93A 3VP0A 5HW3A 4GDNA 3HLCA 4S2JA 3G30A 5FAQA 1CK3A 5HL1A 3IF6B 3UDXA 3MXSA 2ZM8A 3OPRA 4X68A 5CTNA 2ZQ7A 3VSLA 2XH9A 3ZDJA 3A3JA 3HUNA 4JPMA 4ZBEA 3C7VA 2A49A 3SS3A 1W8YA 1SCWA 1L0DA 2X71A 4F94A 5FSRA 4OLDA 3A3FA 1YQSA 3AGDA 3PBRA 3DW0A 4K0WA 5DTKA 1XA7A 5TGFA 3SS4A 5FA7A 4GKUA 2ZM2A 4DE0A 4EV4A 4QY6A 1KGEA 5CEBA 2HDQA 4X6TA 1ZKJA 3V3RA 3S1YA 1XA1A 2Y59A 2ZLYA 3WS5A 2HDUA 2DNSA 3M2JA 1FOFA 3WRTA 1PIOA 4GD8A 2XGNA 3P98A 5EVIB 4DDSA 3C5AA 5EECA 2WGWA 3TOIA 4HEFA 4OQIA 3V39A 4JXSA 1MXOA 3G31A 1K54C 3O88A 1JWPA 4Q8IA 1HTZA 4UA6A 3UY6A 1CEFA 2ZM0A 3W8KA 1JWVA 4KZ7A 5E2FA 4GZBA 1C3BA 3O86A 1SKFA 3NDEA 2EFUA 4DDYA 5CHJA 3ZVTA 1XKZA 1PI4A 1QMEA 3Q07A 5FASA 4OQGA 3SS5A 2OSUA 1KDSA 2ZQ9A 2EX9A 4GD6A 4JKTA 4R1GA 4U3TA 5DF8A 5FI2A 4JLFA 4E3IA 4EBPA 4LV2A 5KMWA 1NXYA 5FQKA 4Y0TA 4OOMA 3LO7A 1M6KA 5FATA 2ZD8A 3PBSA 4Y7PA 2VGKA 2WKIA 1H5XA 4M3KA 4BQMA 3LY3A 4C6YA 3BFFA 5CTMA 4X56A 3V5MA 1W7FA 2B5RA 5GLAA 4FSFA 2ZQCA 4IBXA 1SDEA 5GLDA 1MWTA 1YM1A 1ES4A 4BL3A 3N8LA 4OPYA 4WEKA 3ZCZA 4WMCD 1K4EA 3GQZA 4EBLA 3UE3A 1K54A 1FCOA 1IEMA 2ZC3B 3VP1A 1N9BA 3Q7ZA 4LCLA 3SH8A 4DE2A 4JXVA 4R4SA 4CPKA 3WS4A 1NYYA 3G35A 4S2LA 2Y2HA 4OP8A 1CI9A 4NK3A 2JE5A 1SDNA 3N6IA 4KZ5A 4E6WA 4MBHA 4OLGA 3GVBA 3LY4A 1MBLA 1Z6FA 3CG5A 1GHMA 1YLWA 3Q7VA 4ZAMA 1BTLA 3IXHA 5CGSA 4P85A 1PW8A 4GB7A 3VFFA 1XPBA 3AGEA 4N92A 3NI9A 4GDBA 4S2OA 4WELA 1LLBA 3NBLA 4IEDA 2WGWB 5F83A 4E6XA 2HP9A 3IWQA 4ZJ1A 4GNUA 4Y0UA 1BUEA 3M2KA 2OV5A 4DE3A 1WE4A 3EQUA 2ZQ8A 3QNBA 3QHYA 1K6RA 2Q9MA 3BLMA 5D3OA 5FQJA 3BFDA 4OP5A 5AQAA 2EFXA 4QHCA 2BLSA 1IYPA 3FYZA 1IELA 2QZ6A 4LV1A 4PM6A 5HAQA 1LI9A 5M1AA 1ES2A 3N8SA 4KQQA 1N4OA 3G34A 4YFMA 2XD5A 4KQOA 4PPRA 3SH9A 1BT5A 3BFGA 3C4OA 1K6SA 3OCNA 4QY5A 3S22A 2XF3A 4NETA 5EUAA 1PWDA 5HAPA 3UN7A 5J8XA 4GN2A 4BL2A 3ITBA 3IF6A 5HAIA 4IVKA 3HREA 1TDGA 1PWGA 2VGJA 2WGVA 1HD8A 2V20A 3ZGAB 3P09A 1MWSA 1ES5A 2ZC6B 2EX6A 4KZ3A 4P0MA 1E3UD 1IYSA 1MPLA 5GHYA 2ZC4B 1GA9A 2J7VA 5DTSA 4S2IA 5TR7A 2WADA 2XFTA 1GHPA 3A3IA 4OPQA 2ZC7A 5CHMA 4N1XA 1FQGA 1IKGA 4WYYA 1BLPA 1BLCA 4FCFA 1VM1A 3MBZA 4N1HA 1Q2QA 3HVFA 4FD8A 3UPNA 1OMEA 2C5WB 2V1ZA 3BFEA 3BRMA 4KZ6A 1TEMA 1QMFA 2WYXA 2J9OA 2HDSA 1JTDA 1DJBA 5DF7A 5EVIC 4E3JA 3OZHA 1MKIA 3E2LA 4XUZA 3GRJA 1KGGA 3ZG8B 2Y2MA 1ZG6A 5EVIA 1EROA 4PM7A 2Y2JA 1WYCA 4WBGA 3IF6C 1YLJA 5DF9A 3HLFA 4KG2A 4S2KA 1IYOA 4R4RA 5KZHA 2J9PA 3HLBA 2I72A 4WZ5A 3GSGA 5E2GA 1LL9A 4L0LA 1GHIA 4MBFA 4KZ4A 3GTCA 5M18A 3IHBA 2WAEA 5EPHA 5FQIA 1RCJA 3WS0A 2WK0A 1PWCA 2RCXA 5FQ9A 2H10A 5IHVA 5E2EA 4B4ZA 4D2OA 4DRTA 3S4XA 4B4XA 3VSKA 1KGFA 1K4FA 3IH8A 3VP4A 5CXWA 3O87A 3IT9A 2XD1A 4PMAA 1ERMA 1ERQA 1NRFA 3RXXA 3W4PA 2WGIA 1EI5A 1ONHA 1K25A 4UAAA 1Y54A 4RA7A 3VP2A 3UDIA 4EQIA 5EVID 3JYIA 3ZG0A 2XLNA 4BLMA 4WZ4A 3PAGA 4DE1A 3AGFA 1H8ZA 1KVMA 1DY6A 4BENA 4C75A 5F1GA 1KDWA 3BFCA 3PBQA 4KZ9A 1YLZA 3EQVA 3N8RA 2ZQDA 3NDGA 4OOYA 2Y2PA 3UE1A 1YLTA 4DF6A 1FR6A 2R9WA 2XDMA 3IH9A 4PM9A 4PM5A 1CEGA 2WUQA 3BEBA 1K57A 3FWLA 2Q9NA 4QB8A 3TG9A 1MWRA 4EUZA 2Z2MB 1NZOA 3FV7A 1JWZA 3FKVA 1U60A 3IXGA 2OLUA 4E3OA 2JC7A 1IKIA 2HP5A 1MWUA 3C7UA 1NZUA 3A3EA 4OPZA 4GOGA 5HARA 2WAFA 5FI6A 4WZ5C 2ZQAA 1K38A 4BD0A 4BJPA 4DXCA 5KSHA 3ZG9B 3DTMA 3G2ZA 3OPPA 4OKPA 2Y55A 3W4QA 1S6RA 5FQQA 1LHYA 1EWZA 4R0QA 5M19A 3CZDA 4WMCA 1YMSA 4Y0OA 2PBYA 3MZFA 4OH0A 2P74A 3ZG5A 5FDHA 2IWBA 3UDFA 4S2MA 1HVBA 3ZNYA 4UA9A 2GDNA 1ONGA 3HLGA 4OPRA 4P6BA 1W8QA 3MZDA 4PM8A 3WS2A 4KQRA 1W5DA 1KE4A 4QD4A 2IWCA 3Q7VB 4HBTA 1L0FA 2QMIA 3MFDA 1NYMA 2XQZA 1DJCA 4KG5A 4R3JA 3ZFZA 2DCFA 3VP3A 2P9VA 2FFFB 3WWXA 1K56D 1GA0A 4S2NA 4OOLA 3LCEA 3OPLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MXR A;  4ZJ2 A;  4S2N C;  4OON A;  4XUX A;  2V2F F;  5JYO A;  3IQA A;  5I94 A;  4LCM A;  2EXA A;  2H5S A;  4FH4 A;  4X69 A;  4JXW A;  3DWK A;  5HX9 A;  1HZO A;  3GV9 A;  3N7W A;  2QPN A;  1JTG A;  2XEP A;  3MKF A;  1O7E A;  3BEC A;  4JF4 A;  4X55 A;  3UO9 A;  4E3M A;  5CED A;  5CGW A;  3UE0 A;  5EE8 A;  4ZTK A;  4KZA A;  2HDR A;  5CER A;  5EOE A;  4RX2 A;  5F82 A;  4S2P A;  1S0W A;  3VFH A;  3ITA A;  2Y2I A;  4ID4 A;  4BD1 A;  3IF5 A;  3Q82 A;  3HLW A;  3A3D A;  3N4I A;  1K55 A;  3HLE A;  5CEC A;  1BZA A;  3HL9 A;  3W4O A;  1RGZ A;  4KEN B;  5L2F A;  3OC2 A;  3PBT A;  3NY4 A;  5AQB A;  2WZZ A;  3ISG A;  2EX8 A;  1I2W A;  2XFS A;  1E4D A;  1ESU A;  4R3B A;  3VMA A;  1XXM A;  4KZ8 A;  5KSC A;  2J8Y A;  5AQ7 A;  4N9L A;  3I7J A;  2JBF A;  4IVI A;  1NJ4 A;  4RYE A;  4K0X A;  4JXG A;  2C6W B;  4JF5 A;  5FQM A;  4MNR A;  4DKI A;  1RGY A;  2FFY A;  5EOO A;  2IWD A;  1XX2 A;  2HP6 A;  3G2Y A;  4X53 A;  5GHX A;  5DVA A;  3IHA A;  3PAE A;  2UWX A;  2Y2G A;  1FSW A;  3PTE A;  4IBR A;  5A90 A;  3UPP A;  1FCM A;  1G68 A;  4B88 A;  1PW1 A;  1WYB A;  3IXD A;  4CJN A;  5FAP A;  1ALQ A;  1K57 C;  3V3S A;  3DWZ A;  3HUO A;  2P9V B;  2CC1 A;  1H8Y A;  3PBN A;  1E3U A;  4WEJ A;  4HBU A;  5A92 A;  1L0G A;  2Y2Q A;  5JYP A;  1JVJ A;  1K55 C;  3C4P A;  3QNC A;  3UNW A;  1SHV A;  1NY0 A;  4RX3 A;  1IYQ A;  1LI0 A;  2X02 A;  2WZX A;  4XXR A;  3HBR A;  3PBO A;  2BG1 A;  3IWI A;  1KE3 A;  1O07 A;  1YLP A;  2E8I A;  4DXB A;  1E25 A;  3ZG7 B;  2ZMA A;  1ES3 A;  3OCL A;  5TFQ A;  3NC8 A;  5CRF A;  3RXW A;  3VOZ A;  5DTT A;  1LL5 A;  5AQ9 A;  5GLC A;  3V50 A;  1DJA A;  4RVA A;  2WKE A;  1ZC2 A;  2Y2O A;  2Y2L A;  4JF6 A;  3SOI A;  2DRW A;  4QJG A;  1FCN A;  4U0X A;  2A3U A;  5CGX A;  5BOH A;  3G4P A;  3FKW A;  4MEZ A;  4Z9Q A;  5FAO A;  4EWF A;  1M40 A;  5E43 A;  5G18 A;  3WRZ A;  3VOY A;  2Z2L B;  4JBF A;  4ZDX A;  3O3V A;  5A91 A;  1I2S A;  3CJM A;  1KE0 A;  3M6H A;  4EBN A;  1YLY A;  3TSG A;  4OQ0 A;  2ZC5 B;  5GHZ A;  5HFO A;  4MLL A;  2X01 A;  3MKE A;  3MZE A;  4E3N A;  4K91 A;  4OVD A;  4O7D A;  1TDL A;  2Y4A A;  3ZNT A;  3ZVW A;  1XGI A;  1TVF A;  2ZJ9 A;  3E2K A;  3GR2 A;  2XR0 A;  4LV3 A;  2H0T A;  4ZJ3 A;  2G2W A;  1BUL A;  3M6B A;  4H8R A;  1L0E A;  1PI5 A;  3BYD A;  5FI7 A;  3HLD A;  4C3Q A;  2H0Y A;  2R9X A;  5CHU A;  2WKH A;  3CMZ A;  3D4F A;  4R23 A;  1J9M A;  3OPH A;  1K56 A;  2PU2 A;  4P87 A;  1BLS A;  1PYY A;  3LEZ A;  1YMX A;  2XK1 A;  5GL9 A;  4U0T A;  1BSG A;  1ZG4 A;  1L2S A;  1YT4 A;  3NCK A;  5F1F A;  2OLV A;  1ESI A;  1AXB A;  4HES A;  4A5R A;  4FH2 A;  1I5Q A;  4WM9 A;  3NIA A;  1MY8 A;  3WS1 A;  3Q1F A;  4KZB A;  4E3L A;  4E3K A;  4QU3 A;  4MBK A;  3ZHH A;  2RL3 A;  2EX2 A;  5EVL A;  3IWO A;  3HUM A;  1KVL A;  1BLH A;  1CI8 A;  3G32 A;  4N9K A;  3UPO A;  3Q81 A;  1G6A A;  1PZO A;  1XP4 A;  5GLB A;  5U47 A;  1FR1 A;  3IXB A;  4LEN A;  1VQQ A;  3BLS A;  3RJU A;  2Y2K A;  4UA7 A;  1Q2P A;  1GCE A;  1W79 A;  2Y2N A;  3B3X A;  3GMW A;  4OQH A;  1PZP A;  1RP5 A;  5E2H A;  4LV0 A;  2EXB A;  2Y91 A;  3BM6 A;  4KG6 A;  1FSY A;  3FZC A;  2HPB A;  3SH7 A;  4YIN A;  2JCH A;  2G2U A;  2PU4 A;  4UHU A;  1XGJ A;  5A93 A;  3VP0 A;  5HW3 A;  4GDN A;  3HLC A;  4S2J A;  3G30 A;  5FAQ A;  1CK3 A;  5HL1 A;  3IF6 B;  3UDX A;  3MXS A;  2ZM8 A;  3OPR A;  4X68 A;  5CTN A;  2ZQ7 A;  3VSL A;  2XH9 A;  3ZDJ A;  3A3J A;  3HUN A;  4JPM A;  4ZBE A;  3C7V A;  2A49 A;  3SS3 A;  1W8Y A;  1SCW A;  1L0D A;  2X71 A;  4F94 A;  5FSR A;  4OLD A;  3A3F A;  1YQS A;  3AGD A;  3PBR A;  3DW0 A;  4K0W A;  5DTK A;  1XA7 A;  5TGF A;  3SS4 A;  5FA7 A;  4GKU A;  2ZM2 A;  4DE0 A;  4EV4 A;  4QY6 A;  1KGE A;  5CEB A;  2HDQ A;  4X6T A;  1ZKJ A;  3V3R A;  3S1Y A;  1XA1 A;  2Y59 A;  2ZLY A;  3WS5 A;  2HDU A;  2DNS A;  3M2J A;  1FOF A;  3WRT A;  1PIO A;  4GD8 A;  2XGN A;  3P98 A;  5EVI B;  4DDS A;  3C5A A;  5EEC A;  2WGW A;  3TOI A;  4HEF A;  4OQI A;  3V39 A;  4JXS A;  1MXO A;  3G31 A;  1K54 C;  3O88 A;  1JWP A;  4Q8I A;  1HTZ A;  4UA6 A;  3UY6 A;  1CEF A;  2ZM0 A;  3W8K A;  1JWV A;  4KZ7 A;  5E2F A;  4GZB A;  1C3B A;  3O86 A;  1SKF A;  3NDE A;  2EFU A;  4DDY A;  5CHJ A;  3ZVT A;  1XKZ A;  1PI4 A;  1QME A;  3Q07 A;  5FAS A;  4OQG A;  3SS5 A;  2OSU A;  1KDS A;  2ZQ9 A;  2EX9 A;  4GD6 A;  4JKT A;  4R1G A;  4U3T A;  5DF8 A;  5FI2 A;  4JLF A;  4E3I A;  4EBP A;  4LV2 A;  5KMW A;  1NXY A;  5FQK A;  4Y0T A;  4OOM A;  3LO7 A;  1M6K A;  5FAT A;  2ZD8 A;  3PBS A;  4Y7P A;  2VGK A;  2WKI A;  1H5X A;  4M3K A;  4BQM A;  3LY3 A;  4C6Y A;  3BFF A;  5CTM A;  4X56 A;  3V5M A;  1W7F A;  2B5R A;  5GLA A;  4FSF A;  2ZQC A;  4IBX A;  1SDE A;  5GLD A;  1MWT A;  1YM1 A;  1ES4 A;  4BL3 A;  3N8L A;  4OPY A;  4WEK A;  3ZCZ A;  4WMC D;  1K4E A;  3GQZ A;  4EBL A;  3UE3 A;  1K54 A;  1FCO A;  1IEM A;  2ZC3 B;  3VP1 A;  1N9B A;  3Q7Z A;  4LCL A;  3SH8 A;  4DE2 A;  4JXV A;  4R4S A;  4CPK A;  3WS4 A;  1NYY A;  3G35 A;  4S2L A;  2Y2H A;  4OP8 A;  1CI9 A;  4NK3 A;  2JE5 A;  1SDN A;  3N6I A;  4KZ5 A;  4E6W A;  4MBH A;  4OLG A;  3GVB A;  3LY4 A;  1MBL A;  1Z6F A;  3CG5 A;  1GHM A;  1YLW A;  3Q7V A;  4ZAM A;  1BTL A;  3IXH A;  5CGS A;  4P85 A;  1PW8 A;  4GB7 A;  3VFF A;  1XPB A;  3AGE A;  4N92 A;  3NI9 A;  4GDB A;  4S2O A;  4WEL A;  1LLB A;  3NBL A;  4IED A;  2WGW B;  5F83 A;  4E6X A;  2HP9 A;  3IWQ A;  4ZJ1 A;  4GNU A;  4Y0U A;  1BUE A;  3M2K A;  2OV5 A;  4DE3 A;  1WE4 A;  3EQU A;  2ZQ8 A;  3QNB A;  3QHY A;  1K6R A;  2Q9M A;  3BLM A;  5D3O A;  5FQJ A;  3BFD A;  4OP5 A;  5AQA A;  2EFX A;  4QHC A;  2BLS A;  1IYP A;  3FYZ A;  1IEL A;  2QZ6 A;  4LV1 A;  4PM6 A;  5HAQ A;  1LI9 A;  5M1A A;  1ES2 A;  3N8S A;  4KQQ A;  1N4O A;  3G34 A;  4YFM A;  2XD5 A;  4KQO A;  4PPR A;  3SH9 A;  1BT5 A;  3BFG A;  3C4O A;  1K6S A;  3OCN A;  4QY5 A;  3S22 A;  2XF3 A;  4NET A;  5EUA A;  1PWD A;  5HAP A;  3UN7 A;  5J8X A;  4GN2 A;  4BL2 A;  3ITB A;  3IF6 A;  5HAI A;  4IVK A;  3HRE A;  1TDG A;  1PWG A;  2VGJ A;  2WGV A;  1HD8 A;  2V20 A;  3ZGA B;  3P09 A;  1MWS A;  1ES5 A;  2ZC6 B;  2EX6 A;  4KZ3 A;  4P0M A;  1E3U D;  1IYS A;  1MPL A;  5GHY A;  2ZC4 B;  1GA9 A;  2J7V A;  5DTS A;  4S2I A;  5TR7 A;  2WAD A;  2XFT A;  1GHP A;  3A3I A;  4OPQ A;  2ZC7 A;  5CHM A;  4N1X A;  1FQG A;  1IKG A;  4WYY A;  1BLP A;  1BLC A;  4FCF A;  1VM1 A;  3MBZ A;  4N1H A;  1Q2Q A;  3HVF A;  4FD8 A;  3UPN A;  1OME A;  2C5W B;  2V1Z A;  3BFE A;  3BRM A;  4KZ6 A;  1TEM A;  1QMF A;  2WYX A;  2J9O A;  2HDS A;  1JTD A;  1DJB A;  5DF7 A;  5EVI C;  4E3J A;  3OZH A;  1MKI A;  3E2L A;  4XUZ A;  3GRJ A;  1KGG A;  3ZG8 B;  2Y2M A;  1ZG6 A;  5EVI A;  1ERO A;  4PM7 A;  2Y2J A;  1WYC A;  4WBG A;  3IF6 C;  1YLJ A;  5DF9 A;  3HLF A;  4KG2 A;  4S2K A;  1IYO A;  4R4R A;  5KZH A;  2J9P A;  3HLB A;  2I72 A;  4WZ5 A;  3GSG A;  5E2G A;  1LL9 A;  4L0L A;  1GHI A;  4MBF A;  4KZ4 A;  3GTC A;  5M18 A;  3IHB A;  2WAE A;  5EPH A;  5FQI A;  1RCJ A;  3WS0 A;  2WK0 A;  1PWC A;  2RCX A;  5FQ9 A;  2H10 A;  5IHV A;  5E2E A;  4B4Z A;  4D2O A;  4DRT A;  3S4X A;  4B4X A;  3VSK A;  1KGF A;  1K4F A;  3IH8 A;  3VP4 A;  5CXW A;  3O87 A;  3IT9 A;  2XD1 A;  4PMA A;  1ERM A;  1ERQ A;  1NRF A;  3RXX A;  3W4P A;  2WGI A;  1EI5 A;  1ONH A;  1K25 A;  4UAA A;  1Y54 A;  4RA7 A;  3VP2 A;  3UDI A;  4EQI A;  5EVI D;  3JYI A;  3ZG0 A;  2XLN A;  4BLM A;  4WZ4 A;  3PAG A;  4DE1 A;  3AGF A;  1H8Z A;  1KVM A;  1DY6 A;  4BEN A;  4C75 A;  5F1G A;  1KDW A;  3BFC A;  3PBQ A;  4KZ9 A;  1YLZ A;  3EQV A;  3N8R A;  2ZQD A;  3NDG A;  4OOY A;  2Y2P A;  3UE1 A;  1YLT A;  4DF6 A;  1FR6 A;  2R9W A;  2XDM A;  3IH9 A;  4PM9 A;  4PM5 A;  1CEG A;  2WUQ A;  3BEB A;  1K57 A;  3FWL A;  2Q9N A;  4QB8 A;  3TG9 A;  1MWR A;  4EUZ A;  2Z2M B;  1NZO A;  3FV7 A;  1JWZ A;  3FKV A;  1U60 A;  3IXG A;  2OLU A;  4E3O A;  2JC7 A;  1IKI A;  2HP5 A;  1MWU A;  3C7U A;  1NZU A;  3A3E A;  4OPZ A;  4GOG A;  5HAR A;  2WAF A;  5FI6 A;  4WZ5 C;  2ZQA A;  1K38 A;  4BD0 A;  4BJP A;  4DXC A;  5KSH A;  3ZG9 B;  3DTM A;  3G2Z A;  3OPP A;  4OKP A;  2Y55 A;  3W4Q A;  1S6R A;  5FQQ A;  1LHY A;  1EWZ A;  4R0Q A;  5M19 A;  3CZD A;  4WMC A;  1YMS A;  4Y0O A;  2PBY A;  3MZF A;  4OH0 A;  2P74 A;  3ZG5 A;  5FDH A;  2IWB A;  3UDF A;  4S2M A;  1HVB A;  3ZNY A;  4UA9 A;  2GDN A;  1ONG A;  3HLG A;  4OPR A;  4P6B A;  1W8Q A;  3MZD A;  4PM8 A;  3WS2 A;  4KQR A;  1W5D A;  1KE4 A;  4QD4 A;  2IWC A;  3Q7V B;  4HBT A;  1L0F A;  2QMI A;  3MFD A;  1NYM A;  2XQZ A;  1DJC A;  4KG5 A;  4R3J A;  3ZFZ A;  2DCF A;  3VP3 A;  2P9V A;  2FFF B;  3WWX A;  1K56 D;  1GA0 A;  4S2N A;  4OOL A;  3LCE A;  3OPL A; 
#chains in the Genus database with same CATH topology
 3VE3 A;  5AVF A;  1VET B;  4XUX A;  5JYO A;  3D9Y A;  1XFQ A;  5EVE A;  3CHW P;  4HP4 A;  1JTG A;  4X55 A;  1O7E A;  4E3M A;  4JF4 A;  5CED A;  5EE8 A;  1YKD A;  4EUV A;  4PKY A;  5EOE A;  5F82 A;  4S2P A;  2H28 A;  3Q82 A;  3MFX A;  4HP9 A;  3W4O A;  4UQI M;  3NY4 A;  1FIK A;  2WZZ A;  2L0W A;  1I2W A;  4R3B A;  4Q0I A;  2J8Y A;  5AQ7 A;  2JBF A;  4JXG A;  2C6W B;  5FQM A;  5HD3 A;  2ACG A;  5GHX A;  3IHA A;  3PAE A;  2UWX A;  2Y2G A;  4IBR A;  3UPP A;  4ESP A;  3HUO A;  1H8Y A;  3PBN A;  1J3W A;  1K55 C;  3LIB A;  1SHV A;  3B33 A;  4B93 A;  1IYQ A;  2X02 A;  2WZX A;  1XJ6 A;  4GCZ A;  2ZMA A;  3DTI A;  3OCL A;  1PFL A;  3NC8 A;  5DTT A;  5GLC A;  3VE4 A;  1DJA A;  3JPU A;  5HWT A;  2PYP A;  4QPR A;  3FKW A;  4Y17 A;  4ZDX A;  3O3V A;  1I2S A;  3M6H A;  4H6J B;  4YOF A;  2ZC5 B;  4E3N A;  4K91 A;  3ZNT A;  2Y4A A;  3T4J A;  2EWW A;  1YAX A;  2ZL1 A;  3MQQ A;  4C3Q A;  2H0Y A;  3MR0 A;  3CI6 A;  3OPH A;  1K56 A;  2HGV A;  5DJU A;  5F1F A;  1LSV A;  3UB9 A;  3CIT A;  3WS1 A;  4QU3 A;  2EX2 A;  5IS1 A;  3UPO A;  1XP4 A;  1FR1 A;  3IXB A;  4LEN A;  3BLS A;  3DAV A;  2Y2K A;  3CLO A;  4UA7 A;  5J7E A;  1GCE A;  3GMW A;  2Y2N A;  1PZP A;  2XRO A;  3SH7 A;  4YIN A;  2JCH A;  3SW1 A;  4EER A;  5A93 A;  3VP0 A;  4I3I A;  1CK3 A;  5HL1 A;  3IF6 B;  5CTN A;  2XH9 A;  3HUN A;  4JPM A;  1S67 L;  3SS3 A;  5FSR A;  3RTY A;  3FPV A;  3NOT C;  3A3F A;  4K0W A;  1HLU P;  5DTK A;  1XA7 A;  5TGF A;  3SS4 A;  1N9N A;  4DE0 A;  4QY6 A;  1KGE A;  2HDQ A;  3V3R A;  3S1Y A;  3NOP C;  3WS5 A;  3M2J A;  3WRT A;  2W3G A;  1PIO A;  4OQI A;  1MXO A;  3G31 A;  1K54 C;  4Q8I A;  2ZM0 A;  1JWV A;  4KZ7 A;  2VX8 A;  4MN5 A;  3CPT A;  3EGX C;  1G6O A;  3O86 A;  3EOI A;  2V8F A;  3F1P A;  2ZOH A;  3SS5 A;  1KDS A;  4JKT A;  5DF8 A;  2EX9 A;  5G4Z A;  4E3I A;  1V9Z A;  3PBS A;  4Y7P A;  2WKI A;  2OWH A;  4M3K A;  3LY3 A;  1W7F A;  4FSF A;  3T4L A;  1MWT A;  4L9G A;  4EBL A;  1YPR A;  3VP1 A;  3SH8 A;  3WS4 A;  1NYY A;  4L9E A;  4S2L A;  4O0P A;  4OP8 A;  3IS2 B;  3N6I A;  3LIC A;  4OLG A;  4EXO A;  3CG5 A;  3T50 A;  4ZAM A;  2Z6C A;  3EEH A;  1H8M A;  3IBR A;  4N92 A;  4WEL A;  1P9R A;  4E6X A;  2HP9 A;  1BUE A;  1WE4 A;  3QHY A;  2OOL A;  4IUH A;  3BFD A;  3JVU A;  1PRQ A;  1T18 A;  3FYZ A;  1IEL A;  4PM6 A;  1LI9 A;  1ES2 A;  5EM0 A;  1N4O A;  4FTX A;  1BT5 A;  3OCN A;  2JKT I;  4QY5 A;  2J3W A;  5EM1 A;  5HAP A;  4UQI S;  4D60 A;  2FZ0 A;  3IF6 A;  4AFI A;  1TDG A;  3P09 A;  4HH3 A;  4HJ6 A;  2ZC4 B;  5DTS A;  1WA9 A;  2YKF A;  5CHM A;  4E04 A;  5TJJ A;  1IKG A;  4FCF A;  3MBZ A;  1Q2Q A;  2C5W B;  4Q0H A;  1TEM A;  3PHY A;  2QJ5 A;  5HWW A;  2J9O A;  1DJB A;  3GRJ A;  2M7U A;  3ZG8 B;  1ZG6 A;  3BQ8 A;  5J4E A;  3KYE A;  3HLF A;  4KG2 A;  3E4P A;  2J9P A;  2I72 A;  2PT7 A;  5L07 A;  5M18 A;  3GTC A;  3LUQ A;  1NWZ A;  4DRT A;  2MJ6 A;  1OJG A;  3A0S A;  2V0U A;  4HJ3 A;  3W4P A;  3RXX A;  3LR5 A;  1EI5 A;  4MCW A;  4RA7 A;  3PXP A;  3VP2 A;  3JYI A;  3KO6 A;  4MN7 A;  4BLM A;  4DE1 A;  3AGF A;  1KVM A;  4BEN A;  4NXF A;  2VJW A;  4KZ9 A;  2ZBB A;  3BY8 A;  1OT6 A;  3C30 A;  3QP8 A;  2PAV P;  3L9K A;  2XDM A;  3IH9 A;  3TG9 A;  4EUZ A;  1NZO A;  3DTE A;  4PHT A;  1F2K A;  3E98 A;  2J80 A;  1IKI A;  3GEC A;  2HP5 A;  3A3E A;  5KSH A;  5FI6 A;  4WZ5 C;  1K38 A;  4OKP A;  5TBM B;  2Y55 A;  1LHY A;  3CZD A;  4WMC A;  1YMS A;  2V8C A;  3MZF A;  4OH0 A;  4S2M A;  1HVB A;  4UA9 A;  3HLG A;  4EEP A;  4P6B A;  1W8Q A;  3GDI A;  4PM8 A;  4R70 A;  4G3K A;  5CX7 A;  3Q7V B;  1L0F A;  1H3Q A;  2DCF A;  1K56 D;  1FIL A;  1GA0 A;  2L1M A;  4MDZ A;  4WL9 A;  5I94 A;  4LCM A;  2EXA A;  4JXW A;  3DWK A;  5HX9 A;  1OTA A;  3S7P A;  3UO9 A;  3EGD C;  1S0W A;  3VFH A;  3ITA A;  2Y2I A;  2CMN A;  1S4R A;  1H0M A;  2JKR M;  3HLW A;  1K55 A;  3HLE A;  5CEC A;  1RGZ A;  2PRF A;  4KEN B;  5L2F A;  4JGO A;  2B02 A;  3ISG A;  1A0K A;  2K31 A;  2A24 A;  4IVI A;  4MNR A;  2FFY A;  2IWD A;  2HP6 A;  3T1R A;  1G68 A;  1WYB A;  3IXD A;  5EFW A;  2V1B A;  4CJN A;  5FAP A;  2INW A;  2CC1 A;  3B42 A;  1E3U A;  4HBU A;  5A92 A;  3QP4 A;  1NY0 A;  3NOU C;  3HBR A;  1P0Z A;  2BG1 A;  2HZ5 A;  4UEY A;  3W2Z A;  5TFQ A;  1LL5 A;  5AQ9 A;  4RVA A;  2VV7 A;  1ZC2 A;  2Y2O A;  2Y2L A;  3SOI A;  2JN7 A;  2DRW A;  5FEF A;  2A3U A;  3G4P A;  4KQD A;  2O9B A;  4Z9Q A;  1Y28 A;  3VOY A;  2PR6 A;  4HQA A;  1KE0 A;  3DBA A;  4EBN A;  3TJZ C;  1TF1 A;  3TSG A;  4OQ0 A;  4EW7 A;  4HIA A;  5GHZ A;  5HFO A;  5HZH A;  4O7D A;  1TDL A;  3ZVW A;  1TVF A;  3GR2 A;  4LV3 A;  2DMW A;  2G2W A;  1BUL A;  4CLC B;  3A0R A;  1L0E A;  3BYD A;  2WKR A;  5FI7 A;  3PR6 A;  3K3C A;  2WKH A;  3D4F A;  1CF0 A;  1G5U A;  4R23 A;  1J9M A;  4DJ2 A;  4P87 A;  1BLS A;  1PYY A;  5HDD A;  5GL9 A;  4Y2F A;  3NCK A;  1YT4 A;  5HSQ A;  4HES A;  4FH2 A;  1I5Q A;  3Q1F A;  4E3L A;  4E3K A;  3IWO A;  3ZQ5 A;  3G32 A;  4B9O A;  2D02 A;  1PZO A;  3H82 B;  1VQQ A;  2W3D A;  1Q2P A;  1VEU B;  5E2H A;  3VV4 A;  2Y91 A;  3BM6 A;  3JVV A;  3FZC A;  2HPB A;  3V67 A;  4I3A A;  1XGJ A;  3LI8 A;  3HLC A;  4S2J A;  3G30 A;  5FAQ A;  5HDC A;  4DMZ A;  2PDR A;  3MXS A;  2PD8 A;  2Q0O A;  4ZBE A;  4WUJ A;  3E4Q A;  1W8Y A;  1N9L A;  4OLD A;  4LFU A;  3UB6 A;  2WKQ A;  2YKH A;  4I3J A;  5FA7 A;  4GKU A;  3UME A;  4WN5 A;  2B18 A;  4X1L A;  3FC7 A;  1PNE A;  4X6T A;  1ZKJ A;  2ZOI A;  2Y59 A;  2DNS A;  1FOF A;  1S66 L;  2KOI A;  4GD8 A;  2XGN A;  3P98 A;  3R7W A;  3C5A A;  5EEC A;  2WGW A;  3TOI A;  5IT5 A;  4HEF A;  4UA6 A;  1CEF A;  3W8K A;  5E2F A;  4LGW A;  1XKZ A;  1QME A;  3Q07 A;  4OQG A;  4Y5F A;  5FI2 A;  4P6Z S;  1ACF A;  4L9F A;  5KMW A;  1NXY A;  2GNX A;  5FQK A;  2VV6 A;  1M6K A;  1ZHH B;  4BQM A;  1GSX A;  5GLA A;  2ZQC A;  4IBX A;  1YM1 A;  3ZCZ A;  1XFN A;  3GQZ A;  3UE3 A;  1K54 A;  1FCO A;  1XJ2 A;  4JXV A;  4R4S A;  3G35 A;  3C8C A;  4EU0 A;  2Y2H A;  4NK3 A;  2JE5 A;  4MBH A;  1BTL A;  5CGS A;  1PW8 A;  4IED A;  1NRJ A;  3E4O A;  3IWQ A;  4H6J A;  2OV5 A;  2W3E A;  3M2K A;  4P6Z M;  4DE3 A;  2ZQ8 A;  3H9W A;  2Q9M A;  3BLM A;  5FQJ A;  1X0O A;  4OP5 A;  1S1Z A;  2BLS A;  4LV1 A;  2JHE A;  3N8S A;  3G34 A;  3LR0 A;  5HD5 A;  3NHQ A;  4KQO A;  4PPR A;  2ZL1 B;  1K6S A;  1VEU A;  3T1S A;  3S22 A;  2XF3 A;  4NET A;  5EUA A;  1PWD A;  5HDS A;  2LB9 A;  3NEC A;  4GHI A;  3LR4 A;  2VGJ A;  2WGV A;  2AVX A;  4KZ3 A;  2ZC6 B;  4P0M A;  1IYS A;  2JKR I;  1GA9 A;  4S2I A;  2XFT A;  4G3V A;  3LIE A;  3H7W B;  2A2L A;  2ZC7 A;  1BLP A;  5HPF A;  1VM1 A;  1YSQ A;  1OME A;  2HV1 A;  3BRM A;  1OTB A;  4KZ6 A;  4X1M A;  5EVI C;  2BTF P;  1MKI A;  2V9A A;  2Y2M A;  4I5S A;  5FDS A;  3QP1 A;  1WYC A;  4R6L A;  2J3T C;  5C5K A;  1YLJ A;  3RH8 B;  5KZH A;  2JKF A;  5E2G A;  1LL9 A;  4L0L A;  4NG2 A;  4MBF A;  1GHI A;  1STZ A;  2VV8 A;  4CQH A;  3IHB A;  5FQI A;  3WS0 A;  3BJN A;  1PWC A;  5FQ9 A;  4B4Z A;  5IHV A;  3OBF A;  3S4X A;  2BAS A;  1KGF A;  3IH8 A;  4X25 A;  5CXW A;  3O87 A;  4JGP A;  1ERQ A;  1JNU A;  1Y54 A;  4EQI A;  4PKY G;  4LRZ E;  4DN0 A;  1NLY A;  4WZ4 A;  3PAG A;  3K3D A;  2QYB A;  4LRX C;  1VET A;  1KDW A;  5HPI A;  3BFC A;  3PBQ A;  1YLZ A;  3N8R A;  4PAU A;  2WUQ A;  4QB8 A;  2Z2M B;  5LBR A;  1AWI A;  3IXG A;  4E3O A;  1SKO A;  4GS9 B;  2JC7 A;  3QP6 A;  1NZU A;  4OPZ A;  1UWN X;  4GOG A;  4BJP A;  2ZQA A;  4DXC A;  2P04 A;  2W27 A;  2B95 A;  4KUO A;  1DRM A;  4R0Q A;  5M19 A;  2PBY A;  3ZG5 A;  3UDF A;  1DP6 A;  1MZU A;  1XJ3 A;  1ONG A;  3T12 B;  3SZT A;  4OPR A;  2KX6 A;  3MZD A;  1DP9 A;  1KE4 A;  4BMW A;  4QD4 A;  3CAX A;  3UB8 A;  1D06 A;  2QMI A;  3UMD A;  2W1T B;  4KG5 A;  3VP3 A;  3WWX A;  1OPX A;  3LCE A;  3MXR A;  4ZJ2 A;  4OON A;  3IQA A;  2H5S A;  4FH4 A;  3N7W A;  2XEP A;  3BEC A;  3CUE C;  5CGW A;  4ZTK A;  2HDR A;  4RX2 A;  2V1A A;  3LID A;  4ID4 A;  3IF5 A;  2GZA A;  2PR5 A;  1BZA A;  4ARZ B;  3OC2 A;  4WLA A;  3PBT A;  5AQB A;  3D72 A;  2EX8 A;  4KZ8 A;  2VEA A;  4N9L A;  2O9C A;  4RYE A;  3CWF A;  4JF5 A;  4DKI A;  2P08 A;  5EOO A;  5DVA A;  1FSW A;  3PTE A;  4B88 A;  1PW1 A;  1ALQ A;  1K57 C;  3DWZ A;  2P9V B;  2Y2Q A;  1JVJ A;  3KX0 X;  2A24 B;  3UNW A;  3MQ0 A;  5I5L A;  4RX3 A;  5L09 A;  3IWI A;  4DXB A;  1YLP A;  3MJQ A;  3ZG7 B;  4WF0 A;  3RXW A;  3VOZ A;  3F1N A;  3V50 A;  5KIZ A;  2JKG A;  2WKE A;  3LIA A;  3D3O A;  1OTD A;  1LSX A;  4RQ9 A;  4QJG A;  4U0X A;  2V0W A;  5CGX A;  4MEZ A;  1M40 A;  3WRZ A;  2Z2L B;  2D01 A;  4EEU A;  4GS9 A;  3UB5 P;  2NUT C;  4HI4 A;  3MKE A;  3MZE A;  5J3W A;  4HNB A;  3KSF A;  3M6B A;  2LB5 A;  3LEQ A;  3HLD A;  3C38 A;  1YMX A;  2XK1 A;  3KSI A;  4U0T A;  3MS6 A;  1BSG A;  1ZG4 A;  2OLV A;  1AXB A;  4WM9 A;  3KSH A;  4HJ4 A;  3TW8 A;  1GSW A;  1BLH A;  4IJG A;  4XT2 A;  4OQH A;  3FPW A;  2XA7 S;  4LV0 A;  2EXB A;  3O5Y A;  4KG6 A;  1FSY A;  2I9V A;  4MN6 A;  4G3W A;  3VSL A;  2ZM8 A;  2XA7 M;  3ZDJ A;  3A3J A;  4Y3I A;  2A49 A;  4HOI A;  1L0D A;  2X71 A;  4F94 A;  3AGD A;  3BY9 A;  3DW0 A;  2W3H A;  2ZM2 A;  4O01 A;  5G4Y A;  5CEB A;  1XA1 A;  5IU1 A;  2ZLY A;  1MKM A;  2HDU A;  3MQO A;  4DDS A;  1NLZ A;  3V39 A;  1HTZ A;  2XSS A;  3VOL A;  3UY6 A;  3F1N B;  4GZB A;  1C3B A;  3OLO A;  3T1X A;  3NDE A;  2EFU A;  4DDY A;  3ZVT A;  1PI4 A;  4CLC A;  4U3T A;  4R1G A;  3G6O A;  2QHK A;  4EBP A;  4Y0T A;  4BBV A;  1H5X A;  2WKP A;  3MXQ A;  3V5M A;  1F5M A;  2B5R A;  1SDE A;  4BL3 A;  1ZTU A;  3N8L A;  4OPY A;  4ME4 A;  2Y79 A;  2ZC3 B;  2E8J A;  1N9B A;  3Q7Z A;  1OTE A;  4DE2 A;  3HJI A;  2HF6 A;  1CI9 A;  4E6W A;  3IS2 A;  3GVB A;  3ICY A;  1GHM A;  1YLW A;  3IXH A;  3P7N A;  3VFF A;  3NI9 A;  4GDB A;  4S2O A;  1LLB A;  5F83 A;  4ZJ1 A;  4GNU A;  4Y0U A;  3EEA A;  4II7 A;  3KYQ A;  3QNB A;  5D3O A;  5F6A A;  1S1Y A;  5AQA A;  4QHC A;  1IYP A;  5HAQ A;  4YWZ A;  5M1A A;  4LLO B;  5F68 A;  4NKP A;  5EV0 A;  3LFV A;  3UE6 A;  3MF0 A;  1PWG A;  1HD8 A;  2V20 A;  1ES5 A;  2EX6 A;  5GHY A;  4FOF A;  3LI9 A;  1GHP A;  4OPQ A;  4NXB A;  4O8G A;  4N1X A;  1FQG A;  1BLC A;  2HJE A;  3ZYT A;  4N1H A;  3HVF A;  4FD8 A;  5DFX A;  3TE8 A;  3BFE A;  1QMF A;  1JTD A;  5DF7 A;  3BWL A;  1KGG A;  1ERO A;  4PM7 A;  2Y2J A;  1Y4O A;  4XT2 B;  5DF9 A;  3NUL A;  4S2K A;  1IYO A;  3LIF A;  4R4R A;  2W1R A;  3KSG A;  4KZ4 A;  4LRY C;  2QWS A;  2WAE A;  2IA2 A;  3T4K A;  2H10 A;  2PBD P;  5E2E A;  4BBU A;  3VSK A;  3IT9 A;  3RFB A;  4I38 A;  1VHM A;  4JGQ A;  2J3T D;  1ERM A;  2FH5 A;  2WGI A;  1K25 A;  5EVI D;  2OWJ A;  1D1J A;  1GSV A;  1DY6 A;  5F1G A;  2EWV A;  4GJ4 A;  3OPL A;  2ZQD A;  4OOY A;  1YLT A;  4PM9 A;  4PM5 A;  3T4O A;  1CEG A;  2Q9N A;  1MWR A;  3FV7 A;  4EQ1 A;  2Z6D A;  2OLU A;  1G28 A;  3C7U A;  5L8M A;  4GHI B;  1TS7 A;  2WAF A;  4BD0 A;  3QP5 A;  1UWP X;  3G2Z A;  3OPP A;  1S6R A;  5FQQ A;  1EWZ A;  2P74 A;  5FDH A;  2IWB A;  2GDN A;  4IUK A;  2KLI A;  3WS2 A;  1XJ4 A;  4HBT A;  3MFD A;  1IOU A;  1NYM A;  2XQZ A;  1DJC A;  3ZFZ A;  3PYP A;  4NEE D;  4S2N A;  3BQA A;  4OOL A;  4S2N C;  5F5Y A;  1F9I A;  2V2F F;  4DJ3 A;  2G7U A;  4X69 A;  1T1B A;  1HZO A;  3GV9 A;  2QPN A;  2VGL S;  4HY8 A;  3MKF A;  3LYX A;  3UE0 A;  4KZA A;  5CER A;  2VLG A;  4BD1 A;  3U2A A;  3A3D A;  3N4I A;  1YSP A;  3HL9 A;  1BYW A;  4GLQ A;  1LT0 A;  2XFS A;  1E4D A;  1ESU A;  3VMA A;  1XXM A;  5KSC A;  4F3L B;  2GJ3 A;  5AVE A;  3I7J A;  1NJ4 A;  4K0X A;  4BBT A;  3ULF A;  2R78 A;  3F1P B;  1RGY A;  1XX2 A;  3G2Y A;  4X53 A;  5A90 A;  1P97 A;  1FCM A;  2VKS A;  3V3S A;  1SZV A;  4WEJ A;  3T4T A;  5JYP A;  1L0G A;  3C4P A;  2M1C A;  3QNC A;  1LI0 A;  4XXR A;  1SKO B;  3PBO A;  1KE3 A;  1O07 A;  2E8I A;  1E25 A;  1ES3 A;  5CRF A;  3CUE A;  3K2N A;  4NXE A;  3H82 A;  4JF6 A;  3U4L P;  1FCN A;  2HJ9 C;  5BOH A;  2O0Y A;  5DKK A;  5FAO A;  4EWF A;  5E43 A;  5G18 A;  4JBF A;  3UB7 A;  5A91 A;  3CJM A;  5DKL A;  1YLY A;  3IBJ A;  2ZMV A;  4MMN A;  5K5B A;  4MLL A;  2X01 A;  4OVD A;  1OJ5 A;  1XGI A;  3QP2 A;  2ZJ9 A;  3E2K A;  2XR0 A;  2H0T A;  4ZJ3 A;  4Z1W A;  3R4K A;  4H8R A;  2VK3 A;  1PI5 A;  1CJF A;  2R9X A;  5CHU A;  3CMZ A;  1TS0 A;  2PU2 A;  3LEZ A;  2XRN A;  1L2S A;  1OTI A;  4HHD A;  1ESI A;  1P9W A;  3IX8 A;  4A5R A;  3NIA A;  1MY8 A;  4KZB A;  4MBK A;  3ZHH A;  2RL3 A;  5EVL A;  3HUM A;  1KVL A;  1CI8 A;  4N9K A;  1TS8 A;  3Q81 A;  1G6A A;  4K08 A;  3IX3 A;  2W3F A;  5GLB A;  5U47 A;  1N9O A;  3L7H A;  3RJU A;  3T1Q B;  1W79 A;  3B3X A;  3MSH A;  1RP5 A;  3F1O A;  4BWI A;  5HWV A;  4CLC D;  2G2U A;  2PU4 A;  4UHU A;  3T4Q A;  5HW3 A;  4GDN A;  1W63 M;  3LR3 A;  4LPZ A;  4ETX A;  3UDX A;  3OPR A;  4X68 A;  2ZQ7 A;  4F3L A;  4CLC E;  4QWO A;  3C7V A;  2VA0 A;  2K2N A;  1SCW A;  3PBR A;  1YQS A;  2O99 A;  2W0N A;  2QKP A;  3CPT B;  2QJ7 A;  4EV4 A;  5AJG A;  2JKT M;  3KYZ A;  1L3L A;  2VZW A;  1S4S A;  4YNR A;  5EVI B;  4ARZ A;  1TD5 A;  3BW6 A;  4JXS A;  3O88 A;  1JWP A;  4R38 A;  1UGU A;  4FUW A;  4Y15 A;  2L4R A;  1SKF A;  4Y13 A;  5CHJ A;  5FAS A;  3FG8 A;  2OSU A;  2ZQ9 A;  4GD6 A;  4ZRR A;  4IHQ A;  4JLF A;  4LV2 A;  2PD7 A;  4OOM A;  3LO7 A;  5FAT A;  2ZD8 A;  2VGK A;  4C6Y A;  2ZMF A;  3BFF A;  5CTM A;  4X56 A;  3C2W A;  5GLD A;  1ES4 A;  1MC0 A;  4WEK A;  4WMC D;  1K4E A;  3TRC A;  1IEM A;  2OAQ 1;  1KOU A;  5L10 A;  4LCL A;  4CPK A;  3H7W A;  1SDN A;  4KZ5 A;  4CLC C;  3HCY A;  3DTK A;  3LY4 A;  1MBL A;  1Z6F A;  3Q7V A;  4P85 A;  2PHY A;  4GB7 A;  4M4X A;  1XPB A;  3AGE A;  3NBL A;  3R7W B;  2WGW B;  1TS6 A;  4I39 A;  4R3A A;  2EA9 A;  3EQU A;  1K6R A;  2EFX A;  2K7S A;  1ODV A;  3EWK A;  2QZ6 A;  4EES A;  4KQQ A;  1T1A A;  4YFM A;  2XD5 A;  3SH9 A;  3BFG A;  5DFY A;  3C4O A;  5A8B A;  3UN7 A;  5J8X A;  4GN2 A;  4BL2 A;  3ITB A;  2KDK A;  1IFQ A;  4IVK A;  5HAI A;  3HRE A;  4ETZ A;  1D7E A;  2M7V A;  3ZGA B;  2Y8H A;  5TBM A;  1F98 A;  1MWS A;  1E3U D;  1MPL A;  2J7V A;  1OT9 A;  5TR7 A;  2WAD A;  4JGR A;  2VGL M;  4Q0J A;  3A3I A;  3E0Y A;  1K0K A;  3MMH A;  4WYY A;  1CQA A;  3UPN A;  3T4S A;  2P7J A;  2V1Z A;  2WYX A;  2HDS A;  3A0V A;  4E3J A;  3B47 A;  3OZH A;  3E2L A;  4XUZ A;  5FEG A;  5EVI A;  4WBG A;  3IF6 C;  2OAP 1;  1Z09 A;  1T19 A;  1DP8 A;  3HLB A;  3LGO A;  4WZ5 A;  3GSG A;  5HL6 A;  5EPH A;  1RCJ A;  1LSW A;  2WK0 A;  2NUP C;  3F1O B;  2RCX A;  4EET B;  4D2O A;  3NJA A;  4B4X A;  1K4F A;  3VP4 A;  2XD1 A;  4PMA A;  3S7O A;  1NRF A;  3HJK A;  4HH2 A;  5MC7 A;  1ONH A;  4UAA A;  2GX5 A;  1VB6 A;  3UDI A;  3ZG0 A;  2XLN A;  1H8Z A;  4C75 A;  1EW0 A;  2O9A A;  3EQV A;  3S7N A;  3NDG A;  2Y2P A;  3UE1 A;  4DF6 A;  1FR6 A;  2R9W A;  3BEB A;  1K57 A;  3FWL A;  5F69 A;  1JWZ A;  3P01 A;  4NXG A;  1LL8 A;  3FKV A;  1U60 A;  1MWU A;  2PYR A;  5HAR A;  3ZG9 B;  3DTM A;  3W4Q A;  4KUK A;  4Y0O A;  3ZNY A;  3S7Q A;  2UV0 E;  4KQR A;  1W5D A;  1W63 Q;  2IWC A;  3OOV A;  5DJT A;  4GW9 A;  4R3J A;  2W1T A;  2P9V A;  2FFF B;  1T1C A;  3IX4 A;  1V9Y A;  5FL3 A; 
#chains in the Genus database with same CATH homology
 3MXR A;  4ZJ2 A;  4S2N C;  4OON A;  4XUX A;  2V2F F;  5JYO A;  3IQA A;  5I94 A;  4LCM A;  2EXA A;  2H5S A;  4FH4 A;  4X69 A;  4JXW A;  3DWK A;  5HX9 A;  1HZO A;  3GV9 A;  3N7W A;  2QPN A;  1JTG A;  2XEP A;  3MKF A;  1O7E A;  3BEC A;  4JF4 A;  4X55 A;  3UO9 A;  4E3M A;  5CED A;  5CGW A;  3UE0 A;  5EE8 A;  4ZTK A;  4KZA A;  2HDR A;  5CER A;  5EOE A;  4RX2 A;  5F82 A;  4S2P A;  1S0W A;  3VFH A;  3ITA A;  2Y2I A;  4ID4 A;  4BD1 A;  3IF5 A;  3Q82 A;  3HLW A;  3A3D A;  3N4I A;  1K55 A;  3HLE A;  5CEC A;  1BZA A;  3HL9 A;  3W4O A;  1RGZ A;  4KEN B;  5L2F A;  3OC2 A;  3PBT A;  3NY4 A;  5AQB A;  2WZZ A;  3ISG A;  2EX8 A;  1I2W A;  2XFS A;  1E4D A;  1ESU A;  4R3B A;  3VMA A;  1XXM A;  4KZ8 A;  5KSC A;  2J8Y A;  5AQ7 A;  4N9L A;  3I7J A;  2JBF A;  4IVI A;  1NJ4 A;  4RYE A;  4K0X A;  4JXG A;  2C6W B;  4JF5 A;  5FQM A;  4MNR A;  4DKI A;  1RGY A;  2FFY A;  5EOO A;  2IWD A;  1XX2 A;  2HP6 A;  3G2Y A;  4X53 A;  5GHX A;  5DVA A;  3IHA A;  3PAE A;  2UWX A;  2Y2G A;  1FSW A;  3PTE A;  4IBR A;  5A90 A;  3UPP A;  1FCM A;  1G68 A;  4B88 A;  1PW1 A;  1WYB A;  3IXD A;  4CJN A;  5FAP A;  1ALQ A;  1K57 C;  3V3S A;  3DWZ A;  3HUO A;  2P9V B;  2CC1 A;  1H8Y A;  3PBN A;  1E3U A;  4WEJ A;  4HBU A;  5A92 A;  1L0G A;  2Y2Q A;  5JYP A;  1JVJ A;  1K55 C;  3C4P A;  3QNC A;  3UNW A;  1SHV A;  1NY0 A;  4RX3 A;  1IYQ A;  1LI0 A;  2X02 A;  2WZX A;  4XXR A;  3HBR A;  3PBO A;  2BG1 A;  3IWI A;  1KE3 A;  1O07 A;  1YLP A;  2E8I A;  4DXB A;  1E25 A;  3ZG7 B;  2ZMA A;  1ES3 A;  3OCL A;  5TFQ A;  3NC8 A;  5CRF A;  3RXW A;  3VOZ A;  5DTT A;  1LL5 A;  5AQ9 A;  5GLC A;  3V50 A;  1DJA A;  4RVA A;  2WKE A;  1ZC2 A;  2Y2O A;  2Y2L A;  4JF6 A;  3SOI A;  2DRW A;  4QJG A;  1FCN A;  4U0X A;  2A3U A;  5CGX A;  5BOH A;  3G4P A;  3FKW A;  4MEZ A;  4Z9Q A;  5FAO A;  4EWF A;  1M40 A;  5E43 A;  5G18 A;  3WRZ A;  3VOY A;  2Z2L B;  4JBF A;  4ZDX A;  3O3V A;  5A91 A;  1I2S A;  3CJM A;  1KE0 A;  3M6H A;  4EBN A;  1YLY A;  3TSG A;  4OQ0 A;  2ZC5 B;  5GHZ A;  5HFO A;  4MLL A;  2X01 A;  3MKE A;  3MZE A;  4E3N A;  4K91 A;  4OVD A;  4O7D A;  1TDL A;  2Y4A A;  3ZNT A;  3ZVW A;  1XGI A;  1TVF A;  2ZJ9 A;  3E2K A;  3GR2 A;  2XR0 A;  4LV3 A;  2H0T A;  4ZJ3 A;  2G2W A;  1BUL A;  3M6B A;  4H8R A;  1L0E A;  1PI5 A;  3BYD A;  5FI7 A;  3HLD A;  4C3Q A;  2H0Y A;  2R9X A;  5CHU A;  2WKH A;  3CMZ A;  3D4F A;  4R23 A;  1J9M A;  3OPH A;  1K56 A;  2PU2 A;  4P87 A;  1BLS A;  1PYY A;  3LEZ A;  1YMX A;  2XK1 A;  5GL9 A;  4U0T A;  1BSG A;  1ZG4 A;  1L2S A;  1YT4 A;  3NCK A;  5F1F A;  2OLV A;  1ESI A;  1AXB A;  4HES A;  4A5R A;  4FH2 A;  1I5Q A;  4WM9 A;  3NIA A;  1MY8 A;  3WS1 A;  3Q1F A;  4KZB A;  4E3L A;  4E3K A;  4QU3 A;  4MBK A;  3ZHH A;  2RL3 A;  2EX2 A;  5EVL A;  3IWO A;  3HUM A;  1KVL A;  1BLH A;  1CI8 A;  3G32 A;  4N9K A;  3UPO A;  3Q81 A;  1G6A A;  1PZO A;  1XP4 A;  5GLB A;  5U47 A;  1FR1 A;  3IXB A;  4LEN A;  1VQQ A;  3BLS A;  3RJU A;  2Y2K A;  4UA7 A;  1Q2P A;  1GCE A;  1W79 A;  2Y2N A;  3B3X A;  3GMW A;  4OQH A;  1PZP A;  1RP5 A;  5E2H A;  4LV0 A;  2EXB A;  2Y91 A;  3BM6 A;  4KG6 A;  1FSY A;  3FZC A;  2HPB A;  3SH7 A;  4YIN A;  2JCH A;  2G2U A;  2PU4 A;  4UHU A;  1XGJ A;  5A93 A;  3VP0 A;  5HW3 A;  4GDN A;  3HLC A;  4S2J A;  3G30 A;  5FAQ A;  1CK3 A;  5HL1 A;  3IF6 B;  3UDX A;  3MXS A;  2ZM8 A;  3OPR A;  4X68 A;  5CTN A;  2ZQ7 A;  3VSL A;  2XH9 A;  3ZDJ A;  3A3J A;  3HUN A;  4JPM A;  4ZBE A;  3C7V A;  2A49 A;  3SS3 A;  1W8Y A;  1SCW A;  1L0D A;  2X71 A;  4F94 A;  5FSR A;  4OLD A;  3A3F A;  1YQS A;  3AGD A;  3PBR A;  3DW0 A;  4K0W A;  5DTK A;  1XA7 A;  5TGF A;  3SS4 A;  5FA7 A;  4GKU A;  2ZM2 A;  4DE0 A;  4EV4 A;  4QY6 A;  1KGE A;  5CEB A;  2HDQ A;  4X6T A;  1ZKJ A;  3V3R A;  3S1Y A;  1XA1 A;  2Y59 A;  2ZLY A;  3WS5 A;  2HDU A;  2DNS A;  3M2J A;  1FOF A;  3WRT A;  1PIO A;  4GD8 A;  2XGN A;  3P98 A;  5EVI B;  4DDS A;  3C5A A;  5EEC A;  2WGW A;  3TOI A;  4HEF A;  4OQI A;  3V39 A;  4JXS A;  1MXO A;  3G31 A;  1K54 C;  3O88 A;  1JWP A;  4Q8I A;  1HTZ A;  4UA6 A;  3UY6 A;  1CEF A;  2ZM0 A;  3W8K A;  1JWV A;  4KZ7 A;  5E2F A;  4GZB A;  1C3B A;  3O86 A;  1SKF A;  3NDE A;  2EFU A;  4DDY A;  5CHJ A;  3ZVT A;  1XKZ A;  1PI4 A;  1QME A;  3Q07 A;  5FAS A;  4OQG A;  3SS5 A;  2OSU A;  1KDS A;  2ZQ9 A;  2EX9 A;  4GD6 A;  4JKT A;  4R1G A;  4U3T A;  5DF8 A;  5FI2 A;  4JLF A;  4E3I A;  4EBP A;  4LV2 A;  5KMW A;  1NXY A;  5FQK A;  4Y0T A;  4OOM A;  3LO7 A;  1M6K A;  5FAT A;  2ZD8 A;  3PBS A;  4Y7P A;  2VGK A;  2WKI A;  1H5X A;  4M3K A;  4BQM A;  3LY3 A;  4C6Y A;  3BFF A;  5CTM A;  4X56 A;  3V5M A;  1W7F A;  2B5R A;  5GLA A;  4FSF A;  2ZQC A;  4IBX A;  1SDE A;  5GLD A;  1MWT A;  1YM1 A;  1ES4 A;  4BL3 A;  3N8L A;  4OPY A;  4WEK A;  3ZCZ A;  4WMC D;  1K4E A;  3GQZ A;  4EBL A;  3UE3 A;  1K54 A;  1FCO A;  1IEM A;  2ZC3 B;  3VP1 A;  1N9B A;  3Q7Z A;  4LCL A;  3SH8 A;  4DE2 A;  4JXV A;  4R4S A;  4CPK A;  3WS4 A;  1NYY A;  3G35 A;  4S2L A;  2Y2H A;  4OP8 A;  1CI9 A;  4NK3 A;  2JE5 A;  1SDN A;  3N6I A;  4KZ5 A;  4E6W A;  4MBH A;  4OLG A;  3GVB A;  3LY4 A;  1MBL A;  1Z6F A;  3CG5 A;  1GHM A;  1YLW A;  3Q7V A;  4ZAM A;  1BTL A;  3IXH A;  5CGS A;  4P85 A;  1PW8 A;  4GB7 A;  3VFF A;  1XPB A;  3AGE A;  4N92 A;  3NI9 A;  4GDB A;  4S2O A;  4WEL A;  1LLB A;  3NBL A;  4IED A;  2WGW B;  5F83 A;  4E6X A;  2HP9 A;  3IWQ A;  4ZJ1 A;  4GNU A;  4Y0U A;  1BUE A;  3M2K A;  2OV5 A;  4DE3 A;  1WE4 A;  3EQU A;  2ZQ8 A;  3QNB A;  3QHY A;  1K6R A;  2Q9M A;  3BLM A;  5D3O A;  5FQJ A;  3BFD A;  4OP5 A;  5AQA A;  2EFX A;  4QHC A;  2BLS A;  1IYP A;  3FYZ A;  1IEL A;  2QZ6 A;  4LV1 A;  4PM6 A;  5HAQ A;  1LI9 A;  5M1A A;  1ES2 A;  3N8S A;  4KQQ A;  1N4O A;  3G34 A;  4YFM A;  2XD5 A;  4KQO A;  4PPR A;  3SH9 A;  1BT5 A;  3BFG A;  3C4O A;  1K6S A;  3OCN A;  4QY5 A;  3S22 A;  2XF3 A;  4NET A;  5EUA A;  1PWD A;  5HAP A;  3UN7 A;  5J8X A;  4GN2 A;  4BL2 A;  3ITB A;  3IF6 A;  5HAI A;  4IVK A;  3HRE A;  1TDG A;  1PWG A;  2VGJ A;  2WGV A;  1HD8 A;  2V20 A;  3ZGA B;  3P09 A;  1MWS A;  1ES5 A;  2ZC6 B;  2EX6 A;  4KZ3 A;  4P0M A;  1E3U D;  1IYS A;  1MPL A;  5GHY A;  2ZC4 B;  1GA9 A;  2J7V A;  5DTS A;  4S2I A;  5TR7 A;  2WAD A;  2XFT A;  1GHP A;  3A3I A;  4OPQ A;  2ZC7 A;  5CHM A;  4N1X A;  1FQG A;  1IKG A;  4WYY A;  1BLP A;  1BLC A;  4FCF A;  1VM1 A;  3MBZ A;  4N1H A;  1Q2Q A;  3HVF A;  4FD8 A;  3UPN A;  1OME A;  2C5W B;  2V1Z A;  3BFE A;  3BRM A;  4KZ6 A;  1TEM A;  1QMF A;  2WYX A;  2J9O A;  2HDS A;  1JTD A;  1DJB A;  5DF7 A;  5EVI C;  4E3J A;  3OZH A;  1MKI A;  3E2L A;  4XUZ A;  3GRJ A;  1KGG A;  3ZG8 B;  2Y2M A;  1ZG6 A;  5EVI A;  1ERO A;  4PM7 A;  2Y2J A;  1WYC A;  4WBG A;  3IF6 C;  1YLJ A;  5DF9 A;  3HLF A;  4KG2 A;  4S2K A;  1IYO A;  4R4R A;  5KZH A;  2J9P A;  3HLB A;  2I72 A;  4WZ5 A;  3GSG A;  5E2G A;  1LL9 A;  4L0L A;  1GHI A;  4MBF A;  4KZ4 A;  3GTC A;  5M18 A;  3IHB A;  2WAE A;  5EPH A;  5FQI A;  1RCJ A;  3WS0 A;  2WK0 A;  1PWC A;  2RCX A;  5FQ9 A;  2H10 A;  5IHV A;  5E2E A;  4B4Z A;  4D2O A;  4DRT A;  3S4X A;  4B4X A;  3VSK A;  1KGF A;  1K4F A;  3IH8 A;  3VP4 A;  5CXW A;  3O87 A;  3IT9 A;  2XD1 A;  4PMA A;  1ERM A;  1ERQ A;  1NRF A;  3RXX A;  3W4P A;  2WGI A;  1EI5 A;  1ONH A;  1K25 A;  4UAA A;  1Y54 A;  4RA7 A;  3VP2 A;  3UDI A;  4EQI A;  5EVI D;  3JYI A;  3ZG0 A;  2XLN A;  4BLM A;  4WZ4 A;  3PAG A;  4DE1 A;  3AGF A;  1H8Z A;  1KVM A;  1DY6 A;  4BEN A;  4C75 A;  5F1G A;  1KDW A;  3BFC A;  3PBQ A;  4KZ9 A;  1YLZ A;  3EQV A;  3N8R A;  2ZQD A;  3NDG A;  4OOY A;  2Y2P A;  3UE1 A;  1YLT A;  4DF6 A;  1FR6 A;  2R9W A;  2XDM A;  3IH9 A;  4PM9 A;  4PM5 A;  1CEG A;  2WUQ A;  3BEB A;  1K57 A;  3FWL A;  2Q9N A;  4QB8 A;  3TG9 A;  1MWR A;  4EUZ A;  2Z2M B;  1NZO A;  3FV7 A;  1JWZ A;  3FKV A;  1U60 A;  3IXG A;  2OLU A;  4E3O A;  2JC7 A;  1IKI A;  2HP5 A;  1MWU A;  3C7U A;  1NZU A;  3A3E A;  4OPZ A;  4GOG A;  5HAR A;  2WAF A;  5FI6 A;  4WZ5 C;  2ZQA A;  1K38 A;  4BD0 A;  4BJP A;  4DXC A;  5KSH A;  3ZG9 B;  3DTM A;  3G2Z A;  3OPP A;  4OKP A;  2Y55 A;  3W4Q A;  1S6R A;  5FQQ A;  1LHY A;  1EWZ A;  4R0Q A;  5M19 A;  3CZD A;  4WMC A;  1YMS A;  4Y0O A;  2PBY A;  3MZF A;  4OH0 A;  2P74 A;  3ZG5 A;  5FDH A;  2IWB A;  3UDF A;  4S2M A;  1HVB A;  3ZNY A;  4UA9 A;  2GDN A;  1ONG A;  3HLG A;  4OPR A;  4P6B A;  1W8Q A;  3MZD A;  4PM8 A;  3WS2 A;  4KQR A;  1W5D A;  1KE4 A;  4QD4 A;  2IWC A;  3Q7V B;  4HBT A;  1L0F A;  2QMI A;  3MFD A;  1NYM A;  2XQZ A;  1DJC A;  4KG5 A;  4R3J A;  3ZFZ A;  2DCF A;  3VP3 A;  2P9V A;  2FFF B;  3WWX A;  1K56 D;  1GA0 A;  4S2N A;  4OOL A;  3LCE A;  3OPL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...