1N9BA

Ultrahigh resolution structure of a class a beta-lactamase: on the mechanism and specificity of the extended-spectrum shv-2 enzyme
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
265
structure length
265
Chain Sequence
SPQPLEQIKLSESQLSGRVGMIEMDLASGRTLTAWRADERFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGELCAAAITMSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWETELNEALPGDARDTTTPASMAATLRKLLTSQRLSARSQRQLLQWMVDDRVAGPLIRSVLPAGWFIADKTGASERGARGIVALLGPNNKAERIVVIYLRDTPASMAERNQQIAGIGAALIEHWQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords BETA-LACTAMASE SHV-2
publication title Ultrahigh resolution structure of a class A beta-lactamase: On the mechanism and specificity of the extended-spectrum SHV-2 enzyme
pubmed doi rcsb
source organism Klebsiella pneumoniae
total genus 101
structure length 265
sequence length 265
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2002-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1n9bA00
2J9PA 4ZJ3A 5FSRA 4JXSA 4XUXA 2XDMA 4KZ9A 3QHYA 5FI7A 1EROA 5HAIA 4KZAA 3I7JA 1PWGA 3HLEA 4OQGA 1H8YA 3Q1FA 1I2WA 3MBZA 5F1FA 5EVID 4E3NA 4P87A 1H8ZA 2X02A 5CGXA 3E2LA 4EBLA 2H5SA 1MY8A 1PZOA 3A3DA 2HDUA 5D3OA 1BSGA 3DTMA 3V39A 4QJGA 4KG2A 2WAFA 3IHAA 1M40A 3PBSA 5EE8A 5FQQA 4DDSA 5KZHA 1W5DA 1CEGA 1K4FA 4FD8A 2EXBA 2VGKA 1CI8A 3WS4A 3HLWA 4KQOA 2HDRA 5DF8A 5EVIA 3VFFA 3V3RA 2ZLYA 3NI9A 3V5MA 3DWKA 3GSGA 1LI0A 3PBTA 2Y2KA 5FAPA 3WS0A 1YQSA 1YT4A 1K55C 1CEFA 1GA0A 2J7VA 4BD1A 4DE3A 4GNUA 1QMEA 4DXBA 4E3IA 4LV0A 3VOZA 1YLYA 4KQRA 4C75A 1KVMA 3V3SA 3O86A 3ZFZA 4BL2A 4EQIA 2Q9MA 3ISGA 3G2YA 1PWCA 3G32A 1LLBA 4E6WA 5CECA 1L0FA 3BRMA 3GV9A 2ZJ9A 3MZEA 4P6BA 4WEKA 4JKTA 4WZ5A 3FZCA 1K4EA 2EFXA 2XFTA 5FI2A 2EX2A 4DXCA 3GR2A 3SS4A 2OSUA 1FCNA 3WRTA 4EV4A 5JYPA 4N92A 5DTTA 1YLPA 4R4RA 1VM1A 2HDSA 1K57C 4MNRA 1I2SA 2R9WA 3IHBA 3C5AA 1FSYA 1MXOA 2Y2LA 4NETA 4S2JA 3PAEA 4C3QA 5M1AA 1O7EA 1K57A 5TGFA 3WS5A 5A90A 2FFYA 3BM6A 4X68A 3W4OA 2GDNA 4Y7PA 3NCKA 5FQJA 1EI5A 2Y2JA 5A93A 4S2NA 3UO9A 2ZQDA 4S2IA 5CEDA 1OMEA 1MWTA 2WKIA 1NZUA 3PAGA 1BULA 2C5WB 2RCXA 3O87A 4N1XA 4OOMA 3B3XA 3GVBA 1NYYA 1JTGA 2JE5A 4GB7A 5L2FA 3NIAA 3AGFA 3OCLA 4QY6A 4DRTA 4EBPA 5GLCA 2Y2IA 3JYIA 3N6IA 1L0GA 3QNBA 3NY4A 1HZOA 4RX2A 4ZJ1A 4S2LA 3HLGA 3NC8A 4OQHA 5J8XA 2EX8A 4GZBA 1HTZA 3IXGA 5I94A 1FCOA 4A5RA 2XK1A 1TVFA 4LV1A 3OPHA 4OPYA 1YMXA 2DNSA 3ZG0A 4BL3A 4JBFA 5FA7A 4OPZA 1TEMA 2Y2NA 2Y2PA 5EVIB 4EUZA 1XX2A 5GHZA 2BLSA 4N1HA 4M3KA 3BFGA 1WYBA 2Y2OA 3RJUA 4RYEA 2VGJA 3WWXA 4GD6A 4B4XA 4B4ZA 1ZG6A 4GDNA 3HREA 5FASA 5CEBA 2XFSA 1BLPA 3G34A 1U60A 4CPKA 4UHUA 1KGGA 1K54C 2Y2QA 2JCHA 1KGEA 5CTNA 5AQAA 4FH4A 1W7FA 4OH0A 3AGEA 3ZDJA 3BFFA 4MLLA 2P9VB 2WAEA 2WADA 4X53A 2WUQA 2WZZA 3VMAA 1MBLA 3PBNA 1QMFA 2Z2MB 3HUOA 1GA9A 3IWQA 3IH9A 3O88A 4XXRA 1FOFA 3VOYA 2Y4AA 3N8RA 1ESUA 2Y59A 2Y91A 2WK0A 4OONA 4OPQA 1GHMA 2A3UA 5GHYA 4S2KA 5EECA 2Z2LB 4BLMA 2Y55A 4K0XA 1DY6A 2Y2GA 3UPOA 3G31A 4JF6A 2I72A 5KSHA 1YLJA 5DVAA 4PM9A 2XGNA 3QNCA 1MWRA 3HLFA 1WYCA 1IKGA 3FYZA 4Y0OA 4R0QA 1J9MA 4C6YA 4Y0TA 3IWOA 2Y2HA 2ZD8A 4E3JA 1LHYA 1JTDA 4X56A 4RVAA 4GN2A 1XGIA 4NK3A 5M19A 3IXDA 3P98A 4ID4A 1XXMA 2IWCA 4K0WA 4EWFA 5HW3A 3MZFA 3SS5A 1JWVA 3Q7ZA 4MEZA 4JF5A 5EVIC 3WS1A 4WZ4A 1SHVA 2XQZA 3ZG8B 3IT9A 3CZDA 3UDIA 4HBTA 1XPBA 1MWSA 1SKFA 4BJPA 2HP6A 3LY4A 2V2FF 3N4IA 4OP8A 1DJCA 1IELA 3HL9A 2V1ZA 3UDXA 3IWIA 3SH8A 1E3UD 4OOLA 2WKEA 5GL9A 5JYOA 1HVBA 1K56D 4WZ5C 2IWBA 2ZC4B 2HP9A 2QZ6A 3MKFA 4ZDXA 3PBQA 1NYMA 1WE4A 4QD4A 4KZ7A 4N9KA 4LCMA 1AXBA 5AQBA 3IXBA 4KZ3A 1ALQA 1GHPA 4IVKA 5F1GA 3ZCZA 3DWZA 1K6SA 5CHUA 4QU3A 3RXXA 3E2KA 1NY0A 3G30A 5CERA 4OP5A 3C7VA 1E3UA 3IQAA 4PMAA 3TOIA 1K56A 4H8RA 1W8YA 2WGIA 1ONHA 4JXWA 3PTEA 3CJMA 4ZTKA 5FQ9A 3ZNTA 4UA9A 1FR6A 3VP1A 2P74A 4S2NC 3HBRA 5GLDA 3OC2A 4FSFA 4B88A 4K91A 4IBXA 1EWZA 1LI9A 1S6RA 4D2OA 3Q07A 3LY3A 3TSGA 2XR0A 1ZKJA 3W4QA 3OPPA 2WGVA 5FAQA 2J9OA 1JWZA 1VQQA 1NZOA 1KVLA 2C6WB 3A3JA 3MKEA 1BUEA 4BQMA 1ZG4A 3HLDA 4UA7A 4JF4A 5G18A 1O07A 2OLUA 4IBRA 4WYYA 1XA1A 1SDNA 1BT5A 1PYYA 3OCNA 3OZHA 4DDYA 2JBFA 1E4DA 4HEFA 4U3TA 1MPLA 2V20A 2ZC7A 5FQKA 2WGWA 1ES4A 2BG1A 3IH8A 2DCFA 2RL3A 3N8LA 1SDEA 3UDFA 5CGWA 4DKIA 1K25A 1MWUA 1LL9A 1KE4A 1RGZA 2FFFB 3MXSA 3PBRA 1L0EA 1ZC2A 3HVFA 1RP5A 3NDGA 3D4FA 3ITAA 2UWXA 4X6TA 5HARA 3VSKA 3ZHHA 4HESA 3BLSA 4GKUA 2CC1A 3G2ZA 3ZNYA 4FH2A 4X55A 5EUAA 4R4SA 3O3VA 4DF6A 3EQVA 4LV2A 1Y54A 3M6HA 4P0MA 1IYQA 1KDSA 4RX3A 1SCWA 4S2MA 1Q2PA 3LEZA 3LO7A 4U0TA 4WEJA 2X71A 5CHMA 3C4PA 1G6AA 4MBKA 4ZBEA 3P09A 4S2OA 5A91A 5HAPA 4JLFA 1YLWA 1BTLA 1C3BA 1ONGA 1YLTA 3SS3A 1BZAA 4E6XA 1K6RA 4R3JA 4X69A 3A3IA 5CXWA 3LCEA 4R1GA 3W4PA 1YM1A 4UA6A 4JPMA 4R23A 4UAAA 2PU4A 4KQQA 2EX9A 1HD8A 5GLAA 2WYXA 4DE0A 3N8SA 1ERMA 4HBUA 5CGSA 5EPHA 1M6KA 5A92A 4KG5A 4L0LA 5E2EA 3VSLA 4E3KA 1K38A 3IF6A 5CHJA 4EBNA 2WZXA 1IYPA 1IYOA 3BFCA 3FKVA 4PM6A 3W8KA 3NDEA 2ZC5B 1N9BA 2HP5A 4BD0A 2PU2A 4KZ4A 2Q9NA 3ZVWA 4MBFA 2XF3A 4KZBA 3M2KA 5KMWA 3Q81A 2ZQ7A 4XUZA 3BEBA 3WRZA 4OOYA 1Z6FA 1W79A 1DJBA 2JC7A 4OLGA 5CRFA 2EFUA 3GRJA 3S4XA 2PBYA 2EX6A 5KSCA 4OLDA 2E8IA 3UE1A 1PZPA 4MBHA 2ZMAA 3PBOA 1CI9A 4QHCA 3IF5A 2WGWB 1FQGA 3MFDA 4OQIA 3EQUA 1FSWA 1RGYA 2ZM8A 5IHVA 3ZVTA 2HDQA 1KE0A 3M2JA 4WMCA 2ZQ8A 3FWLA 3S22A 4GOGA 3ZG5A 1ES3A 1CK3A 4PM7A 2XD1A 4KZ8A 3HUNA 4OQ0A 1MKIA 4O7DA 4WM9A 3FKWA 4FCFA 5AQ7A 5CTMA 5F83A 2ZQAA 4E3MA 3ZG9B 3DW0A 5TFQA 1I5QA 4R3BA 3BYDA 3CG5A 3C7UA 1NJ4A 1XP4A 2ZC6B 3BLMA 1FCMA 1H5XA 1NXYA 3M6BA 4WELA 4ZAMA 4IEDA 3VP2A 1W8QA 4LENA 4P85A 3BECA 5FQMA 4QB8A 4BENA 4LCLA 3OPRA 4KENB 1KDWA 3OPLA 1PI5A 3FV7A 2A49A 3SH9A 3C4OA 4Z9QA 1PW8A 5DF7A 2XEPA 5EVLA 3WS2A 1ERQA 1K55A 3VP0A 1PWDA 3Q7VA 1BLSA 2OLVA 2P9VA 2ZQ9A 4YINA 5TR7A 3ZGAB 5FQIA 4JXVA 3IXHA 2XD5A 1KE3A 2ZQCA 4CJNA 3IF6B 4PM8A 3MZDA 2J8YA 3VP4A 3UY6A 1NRFA 1ESIA 2H0YA 2DRWA 1TDGA 3MXRA 5FI6A 1YLZA 1TDLA 3BFEA 4N9LA 4KZ6A 5EOEA 5M18A 3SOIA 3V50A 3GTCA 4LV3A 4S2PA 5FATA 1RCJA 3S1YA 3A3FA 5AQ9A 3ITBA 1ES5A 1GHIA 4Y0UA 5DTSA 1GCEA 4E3OA 5FDHA 1XGJA 5DF9A 2B5RA 4DE1A 3ZG7B 4WBGA 2WKHA 4F94A 1YMSA 3N7WA 3CMZA 4Q8IA 4QY5A 4OKPA 1BLHA 5E2HA 5GLBA 3RXWA 4PM5A 4YFMA 5HX9A 1IYSA 2G2UA 1JWPA 3VFHA 3VP3A 4OPRA 4U0XA 1XKZA 1IKIA 1PIOA 1ES2A 2H10A 1E25A 3GQZA 3UE3A 4GDBA 5DTKA 2OV5A 1DJAA 4ZJ2A 1KGFA 1G68A 5HL1A 4IVIA 3BFDA 3Q82A 2Y2MA 2EXAA 2ZM0A 3UPPA 5HAQA 3NBLA 3IF6C 2XH9A 3UE0A 1PW1A 2ZM2A 3GMWA 1Q2QA 2QPNA 3HUMA 3Q7VB 5FAOA 5F82A 2R9XA 4OVDA 1IEMA 5HFOA 5BOHA 1XA7A 4KZ5A 5E2GA 2XLNA 4E3LA 1K54A 5GHXA 5E43A 2H0TA 1JVJA 4PPRA 3HLBA 2G2WA 3UPNA 3G35A 3A3EA 2IWDA 4JXGA 2QMIA 3HLCA 3UNWA 3G4PA 4GD8A 2HPBA 4DE2A 3UN7A 2ZC3B 1PI4A 1BLCA 4WMCD 2X01A 4RA7A 1LL5A 3AGDA 3TG9A 5E2FA 1FR1A 5EOOA 1N4OA 1S0WA 4KG6A 1L2SA 5U47A 3SH7A 1L0DA
chains in the Genus database with same CATH superfamily
2ZL1B 1Y4OA 2J9PA 4Y3IA 4KZ9A 3QHYA 5FI7A 3I7JA 1VEUB 3HLEA 4XT2B 5CGXA 4EBLA 2H5SA 3F1NA 3DTMA 4KG2A 3IHAA 3PBSA 3ULFA 1A0KA 5FQQA 5KZHA 1OT9A 2HDRA 3V3RA 2ZLYA 2GX5A 2Y2KA 3PBTA 1K55C 1CEFA 4GNUA 4E3IA 4LV0A 4C75A 3ZFZA 3ISGA 3G2YA 5J7EA 5CECA 1L0FA 4P6BA 1VETA 4WZ5A 4ARZA 2PR6A 2HF6A 1FCNA 3QP8A 4N92A 3SW1A 3IHBA 2JKTM 4NETA 4S2JA 3PAEA 1O7EA 5TGFA 3WS5A 3BM6A 3W4OA 4X68A 4Y7PA 2W27A 3CPTA 1EI5A 4NXFA 1S4RA 3UO9A 4H6JB 5CEDA 1WA9A 1OMEA 1MWTA 2WKIA 5DKKA 3L9KA 3B3XA 3AGFA 4LRXC 3JYIA 3QNBA 4RX2A 4ZJ1A 3HLGA 1HTZA 1J3WA 1XFNA 1YAXA 1OTIA 3OPHA 4UEYA 2DMWA 1OJ5A 5FA7A 4OPZA 3BW6A 2Y2PA 1XX2A 5GHZA 2BLSA 3WWXA 4RYEA 4GD6A 1V9ZA 2KOIA 5HL6A 2Y2QA 1KGEA 4FH4A 4PKYG 4MLLA 4EXOA 2WADA 1VETB 4ARZB 2VLGA 1D7EA 3N8RA 2Y91A 5EECA 1DY6A 2Y2GA 3G31A 4WF0A 5KSHA 1YLJA 4YNRA 5J3WA 3QNCA 3CPTB 3IX8A 1IKGA 2JKTI 3FYZA 4C6YA 2Y2HA 4KUOA 3T4SA 1LHYA 5IT5A 4RVAA 4BMWA 4GN2A 3P98A 2ACGA 2IWCA 3IS2A 4EWFA 5HW3A 2FH5A 3E4QA 3WS1A 3U2AA 1PFLA 3G6OA 4LPZA 3UDIA 1XJ2A 2OWHA 4II7A 2HP6A 3N4IA 1DJCA 1XJ4A 1YSQA 3IBRA 1VHMA 3SH8A 4Y5FA 5JYOA 4L9GA 4PKYA 2IWBA 1PNEA 2HP9A 4ZDXA 1NYMA 1WE4A 4ETXA 3MS6A 1GHPA 1Z09A 2Q0OA 4IVKA 3E4OA 4QU3A 3G30A 5CERA 4OP5A 3A0RA 4NXEA 4H8RA 2P7JA 5FQ9A 3VP1A 1ZTUA 3HBRA 3LR0A 3P01A 4K91A 1EWZA 4LRZE 3VOLA 1ZHHB 2WGVA 3JPUA 1VQQA 5EM1A 2C6WB 3A3JA 3GECA 4BBTA 3CI6A 1ZG4A 3ZYTA 4GW9A 4IJGA 5HZHA 3OZHA 4I5SA 1LSXA 4U3TA 1MPLA 2ZC7A 5FQKA 1ES4A 4HY8A 2BG1A 4EW7A 2Y8HA 3N8LA 5CGWA 4BBUA 1RGZA 4GHIB 4R3AA 3LYXA 3VSKA 3ZHHA 4HESA 3BLSA 2D01A 1CJFA 5L8MA 4X55A 2NUTC 5EUAA 4DF6A 3O3VA 4LV2A 3M6HA 5C5KA 2QYBA 1Q2PA 1V9YA 3LO7A 3TJZC 4U0TA 3EEHA 3MQ0A 2K31A 3C4PA 4YOFA 2VV6A 4MN6A 1BZAA 4E6XA 4UA6A 3LR5A 3B47A 4KQQA 3N8SA 4PHTA 5EPHA 4JGPA 5E2EA 5CHJA 2HGVA 1IYPA 2WZXA 3NDEA 2ZC5B 2INWA 3UB9A 3LICA 1N9NA 3Q81A 3BEBA 1DJBA 4OLGA 5HPFA 2PBYA 1NLZA 2EX6A 5KSCA 1PZPA 2ZMAA 2XA7S 4QHCA 2FZ0A 3EQUA 2O9BA 2V8FA 3ZVTA 1KE0A 3U4LP 4K08A 3FWLA 1T1BA 4KZ8A 3HUNA 2QJ5A 4KUKA 3FKWA 5F83A 5F6AA 3ZG9B 3DW0A 3BYDA 1NXYA 5TBMA 1KDWA 5HWWA 2A49A 3SH9A 4LGWA 1PW8A 5TJJA 4E04A 1ERQA 3T4TA 1PWDA 2P9VA 3E98A 5FQIA 3D72A 1S66L 3MZDA 1YPRA 1ESIA 2H0YA 2V9AA 2DRWA 1YLZA 3BFEA 4MDZA 5M18A 2PBDP 3GTCA 4S2PA 1RCJA 4LFUA 3LIFA 5DTSA 4QPRA 2JKRM 3T4LA 2LB5A 1YMSA 3N7WA 5FEGA 3CMZA 4OKPA 1BLHA 5GLBA 1IYSA 1MC0A 4OPRA 1E25A 2AVXA 2VGLM 5TBMB 1G68A 5HL1A 3S7QA 3BFDA 2W3GA 1K0KA 3UPPA 5HAQA 1UWNX 2ZM2A 2QPNA 1G6OA 4OVDA 4O8GA 4KZ5A 2XLNA 3LUQA 4HJ4A 3D3OA 1JVJA 2G2WA 4GS9A 3A3EA 2IWDA 3UNWA 4DE2A 3UN7A 3H82A 2X01A 3AGDA 3TG9A 5EOOA 1S0WA 4KG6A 2VA0A 1L2SA 1L0DA 1AWIA 4JXSA 4XUXA 2XDMA 4KZAA 1P9RA 4OQGA 1I2WA 5HSQA 3IX3A 5EVID 4P87A 5FEFA 1MY8A 1PZOA 3A3DA 3DBAA 2A24A 2J3TD 4QJGA 4FTXA 4I3JA 2WAFA 5EE8A 2O99A 4DDSA 2JKRI 4FD8A 2VGKA 4I3IA 2J3TC 3WS4A 4KQOA 5EVIA 2CMNA 5FAPA 1YT4A 2J7VA 4BD1A 4Y13A 3FPVA 3V3SA 3O86A 4BL2A 2Q9MA 1PWCA 4E6WA 3GV9A 2ZJ9A 4WEKA 3FZCA 5FI2A 2EX2A 4DXCA 3GR2A 4EEPA 3LFVA 2HDSA 1K57C 3EOIA 2NUPC 2VEAA 4WUJA 1FSYA 2Y2LA 1H0MA 1K57A 3H82B 2FFYA 2GDNA 5FQJA 3NCKA 5A93A 4S2NA 4IUKA 3O87A 2RCXA 2O9CA 4O0PA 3F1OA 1JTGA 5L2FA 4EBPA 2Y2IA 1L0GA 1KOUA 2A24B 4OQHA 5J8XA 2EX8A 3BWLA 1F5MA 2XK1A 4LV1A 4OPYA 1OTAA 1TEMA 5EVIB 4N1HA 3EGDC 4M3KA 1WYBA 4B4ZA 1ZG6A 4GDNA 5CEBA 1MKMA 2R78A 4UHUA 1K54C 3T1SA 3T1QB 3ZDJA 2WUQA 2WZZA 1LL8A 3VMAA 3HUOA 3NOTC 3IWQA 3O88A 2OOLA 4HH3A 1NWZA 4OPQA 4K0XA 4JF6A 3NECA 2EWVA 5DVAA 4PM9A 5L09A 5F68A 1WYCA 4R0QA 1J9MA 1BYWA 2ZD8A 3C30A 3CUEC 3IXDA 1XXMA 3SS5A 3F1OB 3VE4A 4Y2FA 4WN5A 3CUEA 4MEZA 3HCYA 4JF5A 4QWOA 4WZ4A 1CF0A 4Y17A 1PRQA 1SHVA 3ZG8B 2PDRA 3CZDA 3A0SA 1SKFA 5HDSA 3BJNA 3UDXA 3OLOA 1E3UD 4OOLA 2WKEA 1K56D 4WZ5C 2ZC4B 4N9KA 4LCMA 5AQBA 2PD8A 5F1GA 1K6SA 3E2KA 1NY0A 1T1CA 1E3UA 3IQAA 3S7OA 1K56A 2WGIA 3ZNTA 2P74A 5DJUA 3LIAA 3OC2A 5AVEA 5HDCA 1ZKJA 3OPPA 1D1JA 4I3AA 2PR5A 3MKEA 1BUEA 3IBJA 4JF4A 4EQ1A 2OLUA 1G5UA 3FG8A 1JNUA 4HEFA 3NOPC 2V20A 3F1NB 3IH8A 2HJEA 4Z1WA 3UDFA 3DTIA 3KO6A 1KE4A 2FFFB 1T1AA 1RP5A 3D4FA 2VZWA 4X6TA 4GKUA 4MN7A 2CC1A 3G2ZA 2J80A 3H9WA 3EQVA 3E0YA 3T12B 1IYQA 1KDSA 4HOIA 4S2MA 3LEZA 2OWJA 4WEJA 4ZBEA 4S2OA 5A91A 5HAPA 4JLFA 1BTLA 1ONGA 1YLTA 2BTFP 1K6RA 4R3JA 3LCEA 5GLAA 4HIAA 1ERMA 4HBUA 5A92A 1M6KA 3RTYA 4E3KA 1K38A 1Y28A 4PM6A 3W8KA 3PHYA 2PU2A 2Q9NA 3ZVWA 3QP1A 2ZQ7A 4XUZA 1GSVA 3WRZA 1Z6FA 2EFUA 3GRJA 3UE1A 5L07A 4MBHA 1CI9A 3B42A 3IF5A 4WLAA 4G3KA 3M2JA 5F69A 2ZQ8A 1CK3A 4O7DA 4WM9A 4E3MA 4R3BA 4D60A 2D02A 3C7UA 4WELA 3VP2A 4ZAMA 1TS7A 5FQMA 2JN7A 2P04A 3OPLA 4EETB 2MJ6A 3C4OA 3Q7VA 1BLSA 2OLVA 2ZQ9A 5TR7A 3ZGAB 4I39A 4JXVA 3IXHA 3LR3A 2XD5A 1KE3A 4JGRA 1TDGA 5FI6A 2OAQ1 3KYEA 4JGOA 3IS2B 2PYPA 3V50A 1F9IA 4LV3A 4LRYC 2V8CA 4BWIA 2PYRA 3A3FA 3VE3A 3ITBA 1GHIA 4Y0UA 1T18A 4E3OA 5FDHA 1XGJA 4DE1A 3ZG7B 1IOUA 4WBGA 4F94A 4X1LA 2M7VA 1LSVA 4DN0A 4Q8IA 3RXWA 1OTBA 3MFXA 2A2LA 1JWPA 3VFHA 2WKRA 1PIOA 3GQZA 2W1TA 5DTKA 1KGFA 4HP4A 5DFXA 3P7NA 4KQDA 4P6ZM 1FILA 2Y2MA 3NULA 2ZM0A 2B02A 2XH9A 3MQOA 3UE0A 3LIEA 3Q7VB 2W3DA 5E2GA 2IA2A 5FDSA 5E43A 1UGUA 2PRFA 4PPRA 2GZAA 3DTEA 4LLOB 2VV7A 4JXGA 2Z6DA 4RA7A 1LL5A 2W0NA 2LB9A 1FR1A 4DJ3A 4ZJ3A 5FSRA 2K7SA 1EROA 4R70A 3MSHA 3BY8A 3MBZA 3L7HA 2X02A 1N9OA 2VX8A 3V39A 2O0YA 1M40A 1G28A 2UV0E 1W5DA 1CEGA 2ZBBA 2EXBA 4UQIM 1CI8A 3HLWA 3VFFA 5DF8A 2JKGA 3MQQA 2L4RA 3DWKA 5FL3A 1LI0A 3WS0A 3E4PA 1YQSA 2W1TB 1HLUP 5LBRA 1QMEA 4DXBA 2VKSA 1YLYA 4KQRA 1KVMA 3G32A 3NHQA 3MZEA 4EEUA 3MJQA 1K4EA 2XFTA 4EV4A 5JYPA 4MNRA 1I2SA 2R9WA 3C5AA 4C3QA 5M1AA 3F1PA 3T4JA 3LI9A 2Y2JA 5DFYA 2ZQDA 4S2IA 2VJWA 3O5YA 1NZUA 3PAGA 4OOMA 3GVBA 2JE5A 3HJKA 4QY6A 4DRTA 3N6IA 3NY4A 1HZOA 4S2LA 3NC8A 4GZBA 1XFQA 1FCOA 4A5RA 1TS0A 4DJ2A 2E8JA 2DNSA 3ZG0A 4JBFA 3R7WA 3R4KA 4B93A 3LIDA 2Y2OA 4B4XA 5FASA 1BLPA 2XFSA 1NLYA 1U60A 1OTEA 3QP2A 2ZOIA 5CTNA 4EESA 3FPWA 5AQAA 5MC7A 1W7FA 3BFFA 2P9VB 2WAEA 4DMZA 3PBNA 2Z2MB 4GLQA 3IH9A 4GJ4A 3SZTA 1FOFA 3VOYA 2Y4AA 3MR0A 1ESUA 2M7UA 2WK0A 3MF0A 2A3UA 3S7PA 4EU0A 3LIBA 2Z2LB 4BLMA 2I72A 3F1PB 1S1YA 4AFIA 4Y0OA 5EM0A 4Y0TA 4E3JA 3GDIA 1XGIA 4NK3A 3C2WA 3KSHA 3MZFA 4CLCA 1JWVA 3EWKA 5EVIC 3K2NA 3TW8A 1UWPX 4BBVA 1XPBA 3LR4A 1MWSA 3KYZA 4BJPA 3R7WB 3LY4A 2QJ7A 5HD5A 4G3VA 5GL9A 3OOVA 1HVBA 3MKFA 3PBQA 4KZ7A 1AXBA 5HPIA 3C7VA 1W8YA 1ONHA 3EEAA 2W3HA 3PTEA 3A0VA 4JXWA 1DP8A 4GS9B 1FR6A 4ZRRA 4S2NC 4Y15A 3UB6A 4FSFA 2YKFA 4B88A 2Y79A 1LI9A 3C38A 3Q07A 3LY3A 2XR0A 3W4QA 1D06A 2YKHA 2J9OA 1JWZA 1KVLA 5AJGA 3LEQA 5DKLA 4BQMA 1O07A 4IBRA 4WYYA 2HZ5A 1SDNA 1BT5A 4DDYA 3OCNA 4NXBA 1YSPA 2JBFA 2VGLS 3T4OA 2WGWA 2RL3A 1SDEA 3K3DA 1LL9A 3MXSA 3PBRA 1L0EA 5HARA 5IS1A 3IX4A 3ZNYA 4FH2A 4R4SA 2XSSA 4IHQA 2GJ3A 3T1RA 2Z6CA 2VK3A 5IU1A 1SCWA 2X71A 3UB7A 1G6AA 1OJGA 4MBKA 5HDDA 2P08A 3SS3A 3HJIA 4X69A 5CXWA 3W4PA 1YM1A 4UAAA 4HI4A 2W3EA 2WYXA 5CGSA 2VV8A 4KG5A 4L0LA 3IF6A 4EBNA 1IYOA 3BFCA 2L1MA 1N9BA 2HP5A 4CLCE 4KZ4A 3VV4A 2XF3A 4KZBA 4OOYA 1W79A 5CRFA 2OAP1 5DJTA 2WKPA 5G4ZA 3S4XA 4OLDA 2E8IA 5EV0A 3B33A 3PBOA 2WGWB 4B9OA 3MFDA 4OQIA 5AVFA 1FSWA 1RGYA 2HDQA 4WMCA 4GOGA 3ZG5A 1ES3A 4L9EA 4PM7A 2XD1A 4OQ0A 1MKIA 2PAVP 3CG5A 1NJ4A 3BLMA 2ZC6B 3BECA 1STZA 4NXGA 4LCLA 3OPRA 4KENB 1F98A 1PI5A 3JVUA 1K55A 2K2NA 1XJ3A 2KDKA 3CHWP 2KLIA 3TE8A 3IF6B 4PM8A 3UY6A 2B95A 2W1RA 4NKPA 3KSIA 3MXRA 1TDLA 4EERA 2PHYA 1FIKA 3SOIA 3ZQ5A 3EGXC 1TS8A 1DP6A 5DF9A 1LT0A 3W2ZA 2WKHA 5EFWA 3BQAA 3JVVA 1W63Q 4QY5A 4YFMA 5HX9A 3VP3A 4U0XA 3D9YA 1IKIA 1ES2A 3UE3A 3BY9A 4GDBA 2OV5A 1DJAA 2KX6A 3QP5A 3Q82A 1OPXA 1TF1A 3OBFA 1PW1A 3GMWA 4X25A 3HUMA 5F82A 1OTDA 3KSFA 2R9XA 4X1MA 1IEMA 1XA7A 4E3LA 5F5YA 4Q0IA 3MXQA 2M1CA 4PAUA 2QMIA 1S67L 3G4PA 2HPBA 2W3FA 2ZC3B 1PI4A 5E2FA 3FC7A 4R6LA 5HAIA 1PWGA 1H8YA 3Q1FA 3T1XA 5F1FA 4E3NA 1H8ZA 3E2LA 1P97A 3QP4A 2HDUA 5D3OA 1DP9A 1BSGA 4HHDA 1K4FA 4GHIA 2EA9A 3NI9A 3V5MA 3GSGA 5EVEA 2QWSA 1GA0A 2XA7M 4DE3A 3VOZA 4EQIA 4F3LA 3UMDA 1LLBA 3BRMA 2GNXA 4NG2A 1DRMA 4JKTA 2EFXA 2EWWA 3SS4A 2OSUA 3WRTA 5DTTA 1YLPA 4R4RA 1VM1A 1MXOA 5A90A 5I5LA 3UE6A 4MMNA 4FOFA 1BULA 2C5WB 4N1XA 1NYYA 4GB7A 3NIAA 3CLOA 3OCLA 5GLCA 3IXGA 5I94A 2G7UA 1TVFA 1F2KA 1YMXA 4BL3A 5L10A 5KIZA 2Y2NA 3K3CA 4EUZA 2QHKA 3T4KA 3BFGA 3BQ8A 3RJUA 2VGJA 3UMEA 3HREA 3G34A 4CPKA 4HP9A 1KGGA 4F3LB 2JCHA 3QP6A 4OH0A 3AGEA 4FUWA 4X53A 4CQHA 4MN5A 1MBLA 1QMFA 1GA9A 2HJ9C 3LI8A 4XXRA 2Y59A 4OONA 1GHMA 5GHYA 4S2KA 2Y55A 3UPOA 4GCZA 3V67A 3PXPA 2XGNA 4IUHA 1MWRA 3HLFA 4HNBA 3T4QA 3IWOA 3CITA 1JTDA 4X56A 5M19A 4ID4A 4K0WA 3Q7ZA 1OT6A 2XQZA 1SZVA 3IT9A 4HBTA 2V2FF 2B18A 4OP8A 1IELA 1N9LA 3HL9A 2V1ZA 4MCWA 3IWIA 4L9FA 2WKQA 2QZ6A 4QD4A 4ETZA 3IXBA 4KZ3A 1ALQA 1VB6A 3ICYA 3ZCZA 3DWZA 5CHUA 4HQAA 3RXXA 3TOIA 4PMAA 1XJ6A 3RH8B 2PT7A 5G4YA 3CJMA 4ZTKA 4UA9A 2L0WA 3RFBA 5GLDA 4Q0JA 3PYPA 4IBXA 4D2OA 1S6RA 5K5BA 3KSGA 3TSGA 4HJ3A 4O01A 5FAQA 1NZOA 2JHEA 3HLDA 4UA7A 4NEED 5G18A 2XROA 1XA1A 1PYYA 1E4DA 1MZUA 1ACFA 2DCFA 3LGOA 3KX0X 3TRCA 3C8CA 1YKDA 4DKIA 1S4SA 1K25A 1MWUA 2O9AA 4P6ZS 1ZC2A 3HVFA 3NDGA 3ITAA 2UWXA 1GSWA 4RQ9A 4ME4A 2HV1A 1NRJA 1Y54A 4P0MA 4RX3A 3S7NA 5CHMA 3P09A 3H7WA 1YLWA 1C3BA 1W63M 3A3IA 1T19A 4R1GA 4JPMA 4R23A 2PU4A 2EX9A 1HD8A 2J3WA 4DE0A 4CLCD 3VSLA 3FKVA 4BD0A 3PR6A 4CLCC 4MBFA 1TD5A 3M2KA 5KMWA 4UQIS 2JC7A 2ZMVA 1X0OA 1EW0A 1FQGA 2ZM8A 5HWVA 5IHVA 1IFQA 3MMHA 1S1ZA 2V1BA 2I9VA 3S22A 2ZOHA 1L3LA 3NOUC 4FCFA 5AQ7A 5CTMA 2ZQAA 5TFQA 1I5QA 1XP4A 3M6BA 1FCMA 1H5XA 4IEDA 1W8QA 4LENA 4P85A 4HH2A 1H8MA 4R38A 2ZMFA 4QB8A 3DTKA 4BENA 3NJAA 3FV7A 5HD3A 3H7WB 1CQAA 4Z9QA 3KYQA 4EUVA 5DF7A 2XEPA 4Q0HA 5EVLA 3WS2A 4YWZA 3VP0A 4YINA 3CWFA 4HJ6A 3DAVA 1LSWA 2ZQCA 4JGQA 4I38A 4CJNA 3VP4A 2J8YA 1NRFA 1P0ZA 4ESPA 1SKOA 2XRNA 4N9LA 4KZ6A 5EOEA 5FATA 4CLCB 2ZL1A 3S1YA 5AQ9A 1ES5A 1VEUA 1GCEA 3T50A 4XT2A 2B5RA 5CX7A 5A8BA 1GSXA 4PM5A 5E2HA 1P9WA 2G2UA 1ODVA 1XKZA 4WL9A 2H10A 3UB5P 3UB8A 2V0UA 4ZJ2A 4IVIA 2V0WA 2QKPA 2EXAA 4G3WA 3NBLA 3IF6C 2V1AA 1Q2QA 5FAOA 1H3QA 5HFOA 5BOHA 5J4EA 1K54A 2BASA 5GHXA 1TS6A 2H0TA 3HLBA 3UPNA 3G35A 3CAXA 2H28A 3HLCA 4GD8A 5HWTA 1SKOB 1BLCA 4WMCD 2PD7A 4H6JA 1N4OA 4M4XA 5U47A 3SH7A 2JKFA
chains in the Genus database with same CATH topology
2J9PA 4ZJ3A 5FSRA 4JXSA 4XUXA 2XDMA 4KZ9A 3QHYA 5FI7A 1EROA 5HAIA 4KZAA 3I7JA 1PWGA 3HLEA 4OQGA 1H8YA 3Q1FA 1I2WA 3MBZA 5F1FA 5EVID 4E3NA 4P87A 1H8ZA 2X02A 5CGXA 3E2LA 4EBLA 2H5SA 1MY8A 1PZOA 3A3DA 2HDUA 5D3OA 1BSGA 3DTMA 3V39A 4QJGA 4KG2A 2WAFA 3IHAA 1M40A 3PBSA 5EE8A 5FQQA 4DDSA 5KZHA 1W5DA 1CEGA 1K4FA 4FD8A 2EXBA 2VGKA 1CI8A 3WS4A 3HLWA 4KQOA 2HDRA 5DF8A 5EVIA 3VFFA 3V3RA 2ZLYA 3NI9A 3V5MA 3DWKA 3GSGA 1LI0A 3PBTA 2Y2KA 5FAPA 3WS0A 1YQSA 1YT4A 1K55C 1CEFA 1GA0A 2J7VA 4BD1A 4DE3A 4GNUA 1QMEA 4DXBA 4E3IA 4LV0A 3VOZA 1YLYA 4KQRA 4C75A 1KVMA 3V3SA 3O86A 3ZFZA 4BL2A 4EQIA 2Q9MA 3ISGA 3G2YA 1PWCA 3G32A 1LLBA 4E6WA 5CECA 1L0FA 3BRMA 3GV9A 2ZJ9A 3MZEA 4P6BA 4WEKA 4JKTA 4WZ5A 3FZCA 1K4EA 2EFXA 2XFTA 5FI2A 2EX2A 4DXCA 3GR2A 3SS4A 2OSUA 1FCNA 3WRTA 4EV4A 5JYPA 4N92A 5DTTA 1YLPA 4R4RA 1VM1A 2HDSA 1K57C 4MNRA 1I2SA 2R9WA 3IHBA 3C5AA 1FSYA 1MXOA 2Y2LA 4NETA 4S2JA 3PAEA 4C3QA 5M1AA 1O7EA 1K57A 5TGFA 3WS5A 5A90A 2FFYA 3BM6A 4X68A 3W4OA 2GDNA 4Y7PA 3NCKA 5FQJA 1EI5A 2Y2JA 5A93A 4S2NA 3UO9A 2ZQDA 4S2IA 5CEDA 1OMEA 1MWTA 2WKIA 1NZUA 3PAGA 1BULA 2C5WB 2RCXA 3O87A 4N1XA 4OOMA 3B3XA 3GVBA 1NYYA 1JTGA 2JE5A 4GB7A 5L2FA 3NIAA 3AGFA 3OCLA 4QY6A 4DRTA 4EBPA 5GLCA 2Y2IA 3JYIA 3N6IA 1L0GA 3QNBA 3NY4A 1HZOA 4RX2A 4ZJ1A 4S2LA 3HLGA 3NC8A 4OQHA 5J8XA 2EX8A 4GZBA 1HTZA 3IXGA 5I94A 1FCOA 4A5RA 2XK1A 1TVFA 4LV1A 3OPHA 4OPYA 1YMXA 2DNSA 3ZG0A 4BL3A 4JBFA 5FA7A 4OPZA 1TEMA 2Y2NA 2Y2PA 5EVIB 4EUZA 1XX2A 5GHZA 2BLSA 4N1HA 4M3KA 3BFGA 1WYBA 2Y2OA 3RJUA 4RYEA 2VGJA 3WWXA 4GD6A 4B4XA 4B4ZA 1ZG6A 4GDNA 3HREA 5FASA 5CEBA 2XFSA 1BLPA 3G34A 1U60A 4CPKA 4UHUA 1KGGA 1K54C 2Y2QA 2JCHA 1KGEA 5CTNA 5AQAA 4FH4A 1W7FA 4OH0A 3AGEA 3ZDJA 3BFFA 4MLLA 2P9VB 2WAEA 2WADA 4X53A 2WUQA 2WZZA 3VMAA 1MBLA 3PBNA 1QMFA 2Z2MB 3HUOA 1GA9A 3IWQA 3IH9A 3O88A 4XXRA 1FOFA 3VOYA 2Y4AA 3N8RA 1ESUA 2Y59A 2Y91A 2WK0A 4OONA 4OPQA 1GHMA 2A3UA 5GHYA 4S2KA 5EECA 2Z2LB 4BLMA 2Y55A 4K0XA 1DY6A 2Y2GA 3UPOA 3G31A 4JF6A 2I72A 5KSHA 1YLJA 5DVAA 4PM9A 2XGNA 3QNCA 1MWRA 3HLFA 1WYCA 1IKGA 3FYZA 4Y0OA 4R0QA 1J9MA 4C6YA 4Y0TA 3IWOA 2Y2HA 2ZD8A 4E3JA 1LHYA 1JTDA 4X56A 4RVAA 4GN2A 1XGIA 4NK3A 5M19A 3IXDA 3P98A 4ID4A 1XXMA 2IWCA 4K0WA 4EWFA 5HW3A 3MZFA 3SS5A 1JWVA 3Q7ZA 4MEZA 4JF5A 5EVIC 3WS1A 4WZ4A 1SHVA 2XQZA 3ZG8B 3IT9A 3CZDA 3UDIA 4HBTA 1XPBA 1MWSA 1SKFA 4BJPA 2HP6A 3LY4A 2V2FF 3N4IA 4OP8A 1DJCA 1IELA 3HL9A 2V1ZA 3UDXA 3IWIA 3SH8A 1E3UD 4OOLA 2WKEA 5GL9A 5JYOA 1HVBA 1K56D 4WZ5C 2IWBA 2ZC4B 2HP9A 2QZ6A 3MKFA 4ZDXA 3PBQA 1NYMA 1WE4A 4QD4A 4KZ7A 4N9KA 4LCMA 1AXBA 5AQBA 3IXBA 4KZ3A 1ALQA 1GHPA 4IVKA 5F1GA 3ZCZA 3DWZA 1K6SA 5CHUA 4QU3A 3RXXA 3E2KA 1NY0A 3G30A 5CERA 4OP5A 3C7VA 1E3UA 3IQAA 4PMAA 3TOIA 1K56A 4H8RA 1W8YA 2WGIA 1ONHA 4JXWA 3PTEA 3CJMA 4ZTKA 5FQ9A 3ZNTA 4UA9A 1FR6A 3VP1A 2P74A 4S2NC 3HBRA 5GLDA 3OC2A 4FSFA 4B88A 4K91A 4IBXA 1EWZA 1LI9A 1S6RA 4D2OA 3Q07A 3LY3A 3TSGA 2XR0A 1ZKJA 3W4QA 3OPPA 2WGVA 5FAQA 2J9OA 1JWZA 1VQQA 1NZOA 1KVLA 2C6WB 3A3JA 3MKEA 1BUEA 4BQMA 1ZG4A 3HLDA 4UA7A 4JF4A 5G18A 1O07A 2OLUA 4IBRA 4WYYA 1XA1A 1SDNA 1BT5A 1PYYA 3OCNA 3OZHA 4DDYA 2JBFA 1E4DA 4HEFA 4U3TA 1MPLA 2V20A 2ZC7A 5FQKA 2WGWA 1ES4A 2BG1A 3IH8A 2DCFA 2RL3A 3N8LA 1SDEA 3UDFA 5CGWA 4DKIA 1K25A 1MWUA 1LL9A 1KE4A 1RGZA 2FFFB 3MXSA 3PBRA 1L0EA 1ZC2A 3HVFA 1RP5A 3NDGA 3D4FA 3ITAA 2UWXA 4X6TA 5HARA 3VSKA 3ZHHA 4HESA 3BLSA 4GKUA 2CC1A 3G2ZA 3ZNYA 4FH2A 4X55A 5EUAA 4R4SA 3O3VA 4DF6A 3EQVA 4LV2A 1Y54A 3M6HA 4P0MA 1IYQA 1KDSA 4RX3A 1SCWA 4S2MA 1Q2PA 3LEZA 3LO7A 4U0TA 4WEJA 2X71A 5CHMA 3C4PA 1G6AA 4MBKA 4ZBEA 3P09A 4S2OA 5A91A 5HAPA 4JLFA 1YLWA 1BTLA 1C3BA 1ONGA 1YLTA 3SS3A 1BZAA 4E6XA 1K6RA 4R3JA 4X69A 3A3IA 5CXWA 3LCEA 4R1GA 3W4PA 1YM1A 4UA6A 4JPMA 4R23A 4UAAA 2PU4A 4KQQA 2EX9A 1HD8A 5GLAA 2WYXA 4DE0A 3N8SA 1ERMA 4HBUA 5CGSA 5EPHA 1M6KA 5A92A 4KG5A 4L0LA 5E2EA 3VSLA 4E3KA 1K38A 3IF6A 5CHJA 4EBNA 2WZXA 1IYPA 1IYOA 3BFCA 3FKVA 4PM6A 3W8KA 3NDEA 2ZC5B 1N9BA 2HP5A 4BD0A 2PU2A 4KZ4A 2Q9NA 3ZVWA 4MBFA 2XF3A 4KZBA 3M2KA 5KMWA 3Q81A 2ZQ7A 4XUZA 3BEBA 3WRZA 4OOYA 1Z6FA 1W79A 1DJBA 2JC7A 4OLGA 5CRFA 2EFUA 3GRJA 3S4XA 2PBYA 2EX6A 5KSCA 4OLDA 2E8IA 3UE1A 1PZPA 4MBHA 2ZMAA 3PBOA 1CI9A 4QHCA 3IF5A 2WGWB 1FQGA 3MFDA 4OQIA 3EQUA 1FSWA 1RGYA 2ZM8A 5IHVA 3ZVTA 2HDQA 1KE0A 3M2JA 4WMCA 2ZQ8A 3FWLA 3S22A 4GOGA 3ZG5A 1ES3A 1CK3A 4PM7A 2XD1A 4KZ8A 3HUNA 4OQ0A 1MKIA 4O7DA 4WM9A 3FKWA 4FCFA 5AQ7A 5CTMA 5F83A 2ZQAA 4E3MA 3ZG9B 3DW0A 5TFQA 1I5QA 4R3BA 3BYDA 3CG5A 3C7UA 1NJ4A 1XP4A 2ZC6B 3BLMA 1FCMA 1H5XA 1NXYA 3M6BA 4WELA 4ZAMA 4IEDA 3VP2A 1W8QA 4LENA 4P85A 3BECA 5FQMA 4QB8A 4BENA 4LCLA 3OPRA 4KENB 1KDWA 3OPLA 1PI5A 3FV7A 2A49A 3SH9A 3C4OA 4Z9QA 1PW8A 5DF7A 2XEPA 5EVLA 3WS2A 1ERQA 1K55A 3VP0A 1PWDA 3Q7VA 1BLSA 2OLVA 2P9VA 2ZQ9A 4YINA 5TR7A 3ZGAB 5FQIA 4JXVA 3IXHA 2XD5A 1KE3A 2ZQCA 4CJNA 3IF6B 4PM8A 3MZDA 2J8YA 3VP4A 3UY6A 1NRFA 1ESIA 2H0YA 2DRWA 1TDGA 3MXRA 5FI6A 1YLZA 1TDLA 3BFEA 4N9LA 4KZ6A 5EOEA 5M18A 3SOIA 3V50A 3GTCA 4LV3A 4S2PA 5FATA 1RCJA 3S1YA 3A3FA 5AQ9A 3ITBA 1ES5A 1GHIA 4Y0UA 5DTSA 1GCEA 4E3OA 5FDHA 1XGJA 5DF9A 2B5RA 4DE1A 3ZG7B 4WBGA 2WKHA 4F94A 1YMSA 3N7WA 3CMZA 4Q8IA 4QY5A 4OKPA 1BLHA 5E2HA 5GLBA 3RXWA 4PM5A 4YFMA 5HX9A 1IYSA 2G2UA 1JWPA 3VFHA 3VP3A 4OPRA 4U0XA 1XKZA 1IKIA 1PIOA 1ES2A 2H10A 1E25A 3GQZA 3UE3A 4GDBA 5DTKA 2OV5A 1DJAA 4ZJ2A 1KGFA 1G68A 5HL1A 4IVIA 3BFDA 3Q82A 2Y2MA 2EXAA 2ZM0A 3UPPA 5HAQA 3NBLA 3IF6C 2XH9A 3UE0A 1PW1A 2ZM2A 3GMWA 1Q2QA 2QPNA 3HUMA 3Q7VB 5FAOA 5F82A 2R9XA 4OVDA 1IEMA 5HFOA 5BOHA 1XA7A 4KZ5A 5E2GA 2XLNA 4E3LA 1K54A 5GHXA 5E43A 2H0TA 1JVJA 4PPRA 3HLBA 2G2WA 3UPNA 3G35A 3A3EA 2IWDA 4JXGA 2QMIA 3HLCA 3UNWA 3G4PA 4GD8A 2HPBA 4DE2A 3UN7A 2ZC3B 1PI4A 1BLCA 4WMCD 2X01A 4RA7A 1LL5A 3AGDA 3TG9A 5E2FA 1FR1A 5EOOA 1N4OA 1S0WA 4KG6A 1L2SA 5U47A 3SH7A 1L0DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J9P A;  4ZJ3 A;  5FSR A;  4JXS A;  4XUX A;  2XDM A;  4KZ9 A;  3QHY A;  5FI7 A;  1ERO A;  5HAI A;  4KZA A;  3I7J A;  1PWG A;  3HLE A;  4OQG A;  1H8Y A;  3Q1F A;  1I2W A;  3MBZ A;  5F1F A;  5EVI D;  4E3N A;  4P87 A;  1H8Z A;  2X02 A;  5CGX A;  3E2L A;  4EBL A;  2H5S A;  1MY8 A;  1PZO A;  3A3D A;  2HDU A;  5D3O A;  1BSG A;  3DTM A;  3V39 A;  4QJG A;  4KG2 A;  2WAF A;  3IHA A;  1M40 A;  3PBS A;  5EE8 A;  5FQQ A;  4DDS A;  5KZH A;  1W5D A;  1CEG A;  1K4F A;  4FD8 A;  2EXB A;  2VGK A;  1CI8 A;  3WS4 A;  3HLW A;  4KQO A;  2HDR A;  5DF8 A;  5EVI A;  3VFF A;  3V3R A;  2ZLY A;  3NI9 A;  3V5M A;  3DWK A;  3GSG A;  1LI0 A;  3PBT A;  2Y2K A;  5FAP A;  3WS0 A;  1YQS A;  1YT4 A;  1K55 C;  1CEF A;  1GA0 A;  2J7V A;  4BD1 A;  4DE3 A;  4GNU A;  1QME A;  4DXB A;  4E3I A;  4LV0 A;  3VOZ A;  1YLY A;  4KQR A;  4C75 A;  1KVM A;  3V3S A;  3O86 A;  3ZFZ A;  4BL2 A;  4EQI A;  2Q9M A;  3ISG A;  3G2Y A;  1PWC A;  3G32 A;  1LLB A;  4E6W A;  5CEC A;  1L0F A;  3BRM A;  3GV9 A;  2ZJ9 A;  3MZE A;  4P6B A;  4WEK A;  4JKT A;  4WZ5 A;  3FZC A;  1K4E A;  2EFX A;  2XFT A;  5FI2 A;  2EX2 A;  4DXC A;  3GR2 A;  3SS4 A;  2OSU A;  1FCN A;  3WRT A;  4EV4 A;  5JYP A;  4N92 A;  5DTT A;  1YLP A;  4R4R A;  1VM1 A;  2HDS A;  1K57 C;  4MNR A;  1I2S A;  2R9W A;  3IHB A;  3C5A A;  1FSY A;  1MXO A;  2Y2L A;  4NET A;  4S2J A;  3PAE A;  4C3Q A;  5M1A A;  1O7E A;  1K57 A;  5TGF A;  3WS5 A;  5A90 A;  2FFY A;  3BM6 A;  4X68 A;  3W4O A;  2GDN A;  4Y7P A;  3NCK A;  5FQJ A;  1EI5 A;  2Y2J A;  5A93 A;  4S2N A;  3UO9 A;  2ZQD A;  4S2I A;  5CED A;  1OME A;  1MWT A;  2WKI A;  1NZU A;  3PAG A;  1BUL A;  2C5W B;  2RCX A;  3O87 A;  4N1X A;  4OOM A;  3B3X A;  3GVB A;  1NYY A;  1JTG A;  2JE5 A;  4GB7 A;  5L2F A;  3NIA A;  3AGF A;  3OCL A;  4QY6 A;  4DRT A;  4EBP A;  5GLC A;  2Y2I A;  3JYI A;  3N6I A;  1L0G A;  3QNB A;  3NY4 A;  1HZO A;  4RX2 A;  4ZJ1 A;  4S2L A;  3HLG A;  3NC8 A;  4OQH A;  5J8X A;  2EX8 A;  4GZB A;  1HTZ A;  3IXG A;  5I94 A;  1FCO A;  4A5R A;  2XK1 A;  1TVF A;  4LV1 A;  3OPH A;  4OPY A;  1YMX A;  2DNS A;  3ZG0 A;  4BL3 A;  4JBF A;  5FA7 A;  4OPZ A;  1TEM A;  2Y2N A;  2Y2P A;  5EVI B;  4EUZ A;  1XX2 A;  5GHZ A;  2BLS A;  4N1H A;  4M3K A;  3BFG A;  1WYB A;  2Y2O A;  3RJU A;  4RYE A;  2VGJ A;  3WWX A;  4GD6 A;  4B4X A;  4B4Z A;  1ZG6 A;  4GDN A;  3HRE A;  5FAS A;  5CEB A;  2XFS A;  1BLP A;  3G34 A;  1U60 A;  4CPK A;  4UHU A;  1KGG A;  1K54 C;  2Y2Q A;  2JCH A;  1KGE A;  5CTN A;  5AQA A;  4FH4 A;  1W7F A;  4OH0 A;  3AGE A;  3ZDJ A;  3BFF A;  4MLL A;  2P9V B;  2WAE A;  2WAD A;  4X53 A;  2WUQ A;  2WZZ A;  3VMA A;  1MBL A;  3PBN A;  1QMF A;  2Z2M B;  3HUO A;  1GA9 A;  3IWQ A;  3IH9 A;  3O88 A;  4XXR A;  1FOF A;  3VOY A;  2Y4A A;  3N8R A;  1ESU A;  2Y59 A;  2Y91 A;  2WK0 A;  4OON A;  4OPQ A;  1GHM A;  2A3U A;  5GHY A;  4S2K A;  5EEC A;  2Z2L B;  4BLM A;  2Y55 A;  4K0X A;  1DY6 A;  2Y2G A;  3UPO A;  3G31 A;  4JF6 A;  2I72 A;  5KSH A;  1YLJ A;  5DVA A;  4PM9 A;  2XGN A;  3QNC A;  1MWR A;  3HLF A;  1WYC A;  1IKG A;  3FYZ A;  4Y0O A;  4R0Q A;  1J9M A;  4C6Y A;  4Y0T A;  3IWO A;  2Y2H A;  2ZD8 A;  4E3J A;  1LHY A;  1JTD A;  4X56 A;  4RVA A;  4GN2 A;  1XGI A;  4NK3 A;  5M19 A;  3IXD A;  3P98 A;  4ID4 A;  1XXM A;  2IWC A;  4K0W A;  4EWF A;  5HW3 A;  3MZF A;  3SS5 A;  1JWV A;  3Q7Z A;  4MEZ A;  4JF5 A;  5EVI C;  3WS1 A;  4WZ4 A;  1SHV A;  2XQZ A;  3ZG8 B;  3IT9 A;  3CZD A;  3UDI A;  4HBT A;  1XPB A;  1MWS A;  1SKF A;  4BJP A;  2HP6 A;  3LY4 A;  2V2F F;  3N4I A;  4OP8 A;  1DJC A;  1IEL A;  3HL9 A;  2V1Z A;  3UDX A;  3IWI A;  3SH8 A;  1E3U D;  4OOL A;  2WKE A;  5GL9 A;  5JYO A;  1HVB A;  1K56 D;  4WZ5 C;  2IWB A;  2ZC4 B;  2HP9 A;  2QZ6 A;  3MKF A;  4ZDX A;  3PBQ A;  1NYM A;  1WE4 A;  4QD4 A;  4KZ7 A;  4N9K A;  4LCM A;  1AXB A;  5AQB A;  3IXB A;  4KZ3 A;  1ALQ A;  1GHP A;  4IVK A;  5F1G A;  3ZCZ A;  3DWZ A;  1K6S A;  5CHU A;  4QU3 A;  3RXX A;  3E2K A;  1NY0 A;  3G30 A;  5CER A;  4OP5 A;  3C7V A;  1E3U A;  3IQA A;  4PMA A;  3TOI A;  1K56 A;  4H8R A;  1W8Y A;  2WGI A;  1ONH A;  4JXW A;  3PTE A;  3CJM A;  4ZTK A;  5FQ9 A;  3ZNT A;  4UA9 A;  1FR6 A;  3VP1 A;  2P74 A;  4S2N C;  3HBR A;  5GLD A;  3OC2 A;  4FSF A;  4B88 A;  4K91 A;  4IBX A;  1EWZ A;  1LI9 A;  1S6R A;  4D2O A;  3Q07 A;  3LY3 A;  3TSG A;  2XR0 A;  1ZKJ A;  3W4Q A;  3OPP A;  2WGV A;  5FAQ A;  2J9O A;  1JWZ A;  1VQQ A;  1NZO A;  1KVL A;  2C6W B;  3A3J A;  3MKE A;  1BUE A;  4BQM A;  1ZG4 A;  3HLD A;  4UA7 A;  4JF4 A;  5G18 A;  1O07 A;  2OLU A;  4IBR A;  4WYY A;  1XA1 A;  1SDN A;  1BT5 A;  1PYY A;  3OCN A;  3OZH A;  4DDY A;  2JBF A;  1E4D A;  4HEF A;  4U3T A;  1MPL A;  2V20 A;  2ZC7 A;  5FQK A;  2WGW A;  1ES4 A;  2BG1 A;  3IH8 A;  2DCF A;  2RL3 A;  3N8L A;  1SDE A;  3UDF A;  5CGW A;  4DKI A;  1K25 A;  1MWU A;  1LL9 A;  1KE4 A;  1RGZ A;  2FFF B;  3MXS A;  3PBR A;  1L0E A;  1ZC2 A;  3HVF A;  1RP5 A;  3NDG A;  3D4F A;  3ITA A;  2UWX A;  4X6T A;  5HAR A;  3VSK A;  3ZHH A;  4HES A;  3BLS A;  4GKU A;  2CC1 A;  3G2Z A;  3ZNY A;  4FH2 A;  4X55 A;  5EUA A;  4R4S A;  3O3V A;  4DF6 A;  3EQV A;  4LV2 A;  1Y54 A;  3M6H A;  4P0M A;  1IYQ A;  1KDS A;  4RX3 A;  1SCW A;  4S2M A;  1Q2P A;  3LEZ A;  3LO7 A;  4U0T A;  4WEJ A;  2X71 A;  5CHM A;  3C4P A;  1G6A A;  4MBK A;  4ZBE A;  3P09 A;  4S2O A;  5A91 A;  5HAP A;  4JLF A;  1YLW A;  1BTL A;  1C3B A;  1ONG A;  1YLT A;  3SS3 A;  1BZA A;  4E6X A;  1K6R A;  4R3J A;  4X69 A;  3A3I A;  5CXW A;  3LCE A;  4R1G A;  3W4P A;  1YM1 A;  4UA6 A;  4JPM A;  4R23 A;  4UAA A;  2PU4 A;  4KQQ A;  2EX9 A;  1HD8 A;  5GLA A;  2WYX A;  4DE0 A;  3N8S A;  1ERM A;  4HBU A;  5CGS A;  5EPH A;  1M6K A;  5A92 A;  4KG5 A;  4L0L A;  5E2E A;  3VSL A;  4E3K A;  1K38 A;  3IF6 A;  5CHJ A;  4EBN A;  2WZX A;  1IYP A;  1IYO A;  3BFC A;  3FKV A;  4PM6 A;  3W8K A;  3NDE A;  2ZC5 B;  1N9B A;  2HP5 A;  4BD0 A;  2PU2 A;  4KZ4 A;  2Q9N A;  3ZVW A;  4MBF A;  2XF3 A;  4KZB A;  3M2K A;  5KMW A;  3Q81 A;  2ZQ7 A;  4XUZ A;  3BEB A;  3WRZ A;  4OOY A;  1Z6F A;  1W79 A;  1DJB A;  2JC7 A;  4OLG A;  5CRF A;  2EFU A;  3GRJ A;  3S4X A;  2PBY A;  2EX6 A;  5KSC A;  4OLD A;  2E8I A;  3UE1 A;  1PZP A;  4MBH A;  2ZMA A;  3PBO A;  1CI9 A;  4QHC A;  3IF5 A;  2WGW B;  1FQG A;  3MFD A;  4OQI A;  3EQU A;  1FSW A;  1RGY A;  2ZM8 A;  5IHV A;  3ZVT A;  2HDQ A;  1KE0 A;  3M2J A;  4WMC A;  2ZQ8 A;  3FWL A;  3S22 A;  4GOG A;  3ZG5 A;  1ES3 A;  1CK3 A;  4PM7 A;  2XD1 A;  4KZ8 A;  3HUN A;  4OQ0 A;  1MKI A;  4O7D A;  4WM9 A;  3FKW A;  4FCF A;  5AQ7 A;  5CTM A;  5F83 A;  2ZQA A;  4E3M A;  3ZG9 B;  3DW0 A;  5TFQ A;  1I5Q A;  4R3B A;  3BYD A;  3CG5 A;  3C7U A;  1NJ4 A;  1XP4 A;  2ZC6 B;  3BLM A;  1FCM A;  1H5X A;  1NXY A;  3M6B A;  4WEL A;  4ZAM A;  4IED A;  3VP2 A;  1W8Q A;  4LEN A;  4P85 A;  3BEC A;  5FQM A;  4QB8 A;  4BEN A;  4LCL A;  3OPR A;  4KEN B;  1KDW A;  3OPL A;  1PI5 A;  3FV7 A;  2A49 A;  3SH9 A;  3C4O A;  4Z9Q A;  1PW8 A;  5DF7 A;  2XEP A;  5EVL A;  3WS2 A;  1ERQ A;  1K55 A;  3VP0 A;  1PWD A;  3Q7V A;  1BLS A;  2OLV A;  2P9V A;  2ZQ9 A;  4YIN A;  5TR7 A;  3ZGA B;  5FQI A;  4JXV A;  3IXH A;  2XD5 A;  1KE3 A;  2ZQC A;  4CJN A;  3IF6 B;  4PM8 A;  3MZD A;  2J8Y A;  3VP4 A;  3UY6 A;  1NRF A;  1ESI A;  2H0Y A;  2DRW A;  1TDG A;  3MXR A;  5FI6 A;  1YLZ A;  1TDL A;  3BFE A;  4N9L A;  4KZ6 A;  5EOE A;  5M18 A;  3SOI A;  3V50 A;  3GTC A;  4LV3 A;  4S2P A;  5FAT A;  1RCJ A;  3S1Y A;  3A3F A;  5AQ9 A;  3ITB A;  1ES5 A;  1GHI A;  4Y0U A;  5DTS A;  1GCE A;  4E3O A;  5FDH A;  1XGJ A;  5DF9 A;  2B5R A;  4DE1 A;  3ZG7 B;  4WBG A;  2WKH A;  4F94 A;  1YMS A;  3N7W A;  3CMZ A;  4Q8I A;  4QY5 A;  4OKP A;  1BLH A;  5E2H A;  5GLB A;  3RXW A;  4PM5 A;  4YFM A;  5HX9 A;  1IYS A;  2G2U A;  1JWP A;  3VFH A;  3VP3 A;  4OPR A;  4U0X A;  1XKZ A;  1IKI A;  1PIO A;  1ES2 A;  2H10 A;  1E25 A;  3GQZ A;  3UE3 A;  4GDB A;  5DTK A;  2OV5 A;  1DJA A;  4ZJ2 A;  1KGF A;  1G68 A;  5HL1 A;  4IVI A;  3BFD A;  3Q82 A;  2Y2M A;  2EXA A;  2ZM0 A;  3UPP A;  5HAQ A;  3NBL A;  3IF6 C;  2XH9 A;  3UE0 A;  1PW1 A;  2ZM2 A;  3GMW A;  1Q2Q A;  2QPN A;  3HUM A;  3Q7V B;  5FAO A;  5F82 A;  2R9X A;  4OVD A;  1IEM A;  5HFO A;  5BOH A;  1XA7 A;  4KZ5 A;  5E2G A;  2XLN A;  4E3L A;  1K54 A;  5GHX A;  5E43 A;  2H0T A;  1JVJ A;  4PPR A;  3HLB A;  2G2W A;  3UPN A;  3G35 A;  3A3E A;  2IWD A;  4JXG A;  2QMI A;  3HLC A;  3UNW A;  3G4P A;  4GD8 A;  2HPB A;  4DE2 A;  3UN7 A;  2ZC3 B;  1PI4 A;  1BLC A;  4WMC D;  2X01 A;  4RA7 A;  1LL5 A;  3AGD A;  3TG9 A;  5E2F A;  1FR1 A;  5EOO A;  1N4O A;  1S0W A;  4KG6 A;  1L2S A;  5U47 A;  3SH7 A;  1L0D A; 
#chains in the Genus database with same CATH topology
 2ZL1 B;  1Y4O A;  2J9P A;  4Y3I A;  4KZ9 A;  3QHY A;  5FI7 A;  3I7J A;  1VEU B;  3HLE A;  4XT2 B;  5CGX A;  4EBL A;  2H5S A;  3F1N A;  3DTM A;  4KG2 A;  3IHA A;  3PBS A;  3ULF A;  1A0K A;  5FQQ A;  5KZH A;  1OT9 A;  2HDR A;  3V3R A;  2ZLY A;  2GX5 A;  2Y2K A;  3PBT A;  1K55 C;  1CEF A;  4GNU A;  4E3I A;  4LV0 A;  4C75 A;  3ZFZ A;  3ISG A;  3G2Y A;  5J7E A;  5CEC A;  1L0F A;  4P6B A;  1VET A;  4WZ5 A;  4ARZ A;  2PR6 A;  2HF6 A;  1FCN A;  3QP8 A;  4N92 A;  3SW1 A;  3IHB A;  2JKT M;  4NET A;  4S2J A;  3PAE A;  1O7E A;  5TGF A;  3WS5 A;  3BM6 A;  3W4O A;  4X68 A;  4Y7P A;  2W27 A;  3CPT A;  1EI5 A;  4NXF A;  1S4R A;  3UO9 A;  4H6J B;  5CED A;  1WA9 A;  1OME A;  1MWT A;  2WKI A;  5DKK A;  3L9K A;  3B3X A;  3AGF A;  4LRX C;  3JYI A;  3QNB A;  4RX2 A;  4ZJ1 A;  3HLG A;  1HTZ A;  1J3W A;  1XFN A;  1YAX A;  1OTI A;  3OPH A;  4UEY A;  2DMW A;  1OJ5 A;  5FA7 A;  4OPZ A;  3BW6 A;  2Y2P A;  1XX2 A;  5GHZ A;  2BLS A;  3WWX A;  4RYE A;  4GD6 A;  1V9Z A;  2KOI A;  5HL6 A;  2Y2Q A;  1KGE A;  4FH4 A;  4PKY G;  4MLL A;  4EXO A;  2WAD A;  1VET B;  4ARZ B;  2VLG A;  1D7E A;  3N8R A;  2Y91 A;  5EEC A;  1DY6 A;  2Y2G A;  3G31 A;  4WF0 A;  5KSH A;  1YLJ A;  4YNR A;  5J3W A;  3QNC A;  3CPT B;  3IX8 A;  1IKG A;  2JKT I;  3FYZ A;  4C6Y A;  2Y2H A;  4KUO A;  3T4S A;  1LHY A;  5IT5 A;  4RVA A;  4BMW A;  4GN2 A;  3P98 A;  2ACG A;  2IWC A;  3IS2 A;  4EWF A;  5HW3 A;  2FH5 A;  3E4Q A;  3WS1 A;  3U2A A;  1PFL A;  3G6O A;  4LPZ A;  3UDI A;  1XJ2 A;  2OWH A;  4II7 A;  2HP6 A;  3N4I A;  1DJC A;  1XJ4 A;  1YSQ A;  3IBR A;  1VHM A;  3SH8 A;  4Y5F A;  5JYO A;  4L9G A;  4PKY A;  2IWB A;  1PNE A;  2HP9 A;  4ZDX A;  1NYM A;  1WE4 A;  4ETX A;  3MS6 A;  1GHP A;  1Z09 A;  2Q0O A;  4IVK A;  3E4O A;  4QU3 A;  3G30 A;  5CER A;  4OP5 A;  3A0R A;  4NXE A;  4H8R A;  2P7J A;  5FQ9 A;  3VP1 A;  1ZTU A;  3HBR A;  3LR0 A;  3P01 A;  4K91 A;  1EWZ A;  4LRZ E;  3VOL A;  1ZHH B;  2WGV A;  3JPU A;  1VQQ A;  5EM1 A;  2C6W B;  3A3J A;  3GEC A;  4BBT A;  3CI6 A;  1ZG4 A;  3ZYT A;  4GW9 A;  4IJG A;  5HZH A;  3OZH A;  4I5S A;  1LSX A;  4U3T A;  1MPL A;  2ZC7 A;  5FQK A;  1ES4 A;  4HY8 A;  2BG1 A;  4EW7 A;  2Y8H A;  3N8L A;  5CGW A;  4BBU A;  1RGZ A;  4GHI B;  4R3A A;  3LYX A;  3VSK A;  3ZHH A;  4HES A;  3BLS A;  2D01 A;  1CJF A;  5L8M A;  4X55 A;  2NUT C;  5EUA A;  4DF6 A;  3O3V A;  4LV2 A;  3M6H A;  5C5K A;  2QYB A;  1Q2P A;  1V9Y A;  3LO7 A;  3TJZ C;  4U0T A;  3EEH A;  3MQ0 A;  2K31 A;  3C4P A;  4YOF A;  2VV6 A;  4MN6 A;  1BZA A;  4E6X A;  4UA6 A;  3LR5 A;  3B47 A;  4KQQ A;  3N8S A;  4PHT A;  5EPH A;  4JGP A;  5E2E A;  5CHJ A;  2HGV A;  1IYP A;  2WZX A;  3NDE A;  2ZC5 B;  2INW A;  3UB9 A;  3LIC A;  1N9N A;  3Q81 A;  3BEB A;  1DJB A;  4OLG A;  5HPF A;  2PBY A;  1NLZ A;  2EX6 A;  5KSC A;  1PZP A;  2ZMA A;  2XA7 S;  4QHC A;  2FZ0 A;  3EQU A;  2O9B A;  2V8F A;  3ZVT A;  1KE0 A;  3U4L P;  4K08 A;  3FWL A;  1T1B A;  4KZ8 A;  3HUN A;  2QJ5 A;  4KUK A;  3FKW A;  5F83 A;  5F6A A;  3ZG9 B;  3DW0 A;  3BYD A;  1NXY A;  5TBM A;  1KDW A;  5HWW A;  2A49 A;  3SH9 A;  4LGW A;  1PW8 A;  5TJJ A;  4E04 A;  1ERQ A;  3T4T A;  1PWD A;  2P9V A;  3E98 A;  5FQI A;  3D72 A;  1S66 L;  3MZD A;  1YPR A;  1ESI A;  2H0Y A;  2V9A A;  2DRW A;  1YLZ A;  3BFE A;  4MDZ A;  5M18 A;  2PBD P;  3GTC A;  4S2P A;  1RCJ A;  4LFU A;  3LIF A;  5DTS A;  4QPR A;  2JKR M;  3T4L A;  2LB5 A;  1YMS A;  3N7W A;  5FEG A;  3CMZ A;  4OKP A;  1BLH A;  5GLB A;  1IYS A;  1MC0 A;  4OPR A;  1E25 A;  2AVX A;  2VGL M;  5TBM B;  1G68 A;  5HL1 A;  3S7Q A;  3BFD A;  2W3G A;  1K0K A;  3UPP A;  5HAQ A;  1UWN X;  2ZM2 A;  2QPN A;  1G6O A;  4OVD A;  4O8G A;  4KZ5 A;  2XLN A;  3LUQ A;  4HJ4 A;  3D3O A;  1JVJ A;  2G2W A;  4GS9 A;  3A3E A;  2IWD A;  3UNW A;  4DE2 A;  3UN7 A;  3H82 A;  2X01 A;  3AGD A;  3TG9 A;  5EOO A;  1S0W A;  4KG6 A;  2VA0 A;  1L2S A;  1L0D A;  1AWI A;  4JXS A;  4XUX A;  2XDM A;  4KZA A;  1P9R A;  4OQG A;  1I2W A;  5HSQ A;  3IX3 A;  5EVI D;  4P87 A;  5FEF A;  1MY8 A;  1PZO A;  3A3D A;  3DBA A;  2A24 A;  2J3T D;  4QJG A;  4FTX A;  4I3J A;  2WAF A;  5EE8 A;  2O99 A;  4DDS A;  2JKR I;  4FD8 A;  2VGK A;  4I3I A;  2J3T C;  3WS4 A;  4KQO A;  5EVI A;  2CMN A;  5FAP A;  1YT4 A;  2J7V A;  4BD1 A;  4Y13 A;  3FPV A;  3V3S A;  3O86 A;  4BL2 A;  2Q9M A;  1PWC A;  4E6W A;  3GV9 A;  2ZJ9 A;  4WEK A;  3FZC A;  5FI2 A;  2EX2 A;  4DXC A;  3GR2 A;  4EEP A;  3LFV A;  2HDS A;  1K57 C;  3EOI A;  2NUP C;  2VEA A;  4WUJ A;  1FSY A;  2Y2L A;  1H0M A;  1K57 A;  3H82 B;  2FFY A;  2GDN A;  5FQJ A;  3NCK A;  5A93 A;  4S2N A;  4IUK A;  3O87 A;  2RCX A;  2O9C A;  4O0P A;  3F1O A;  1JTG A;  5L2F A;  4EBP A;  2Y2I A;  1L0G A;  1KOU A;  2A24 B;  4OQH A;  5J8X A;  2EX8 A;  3BWL A;  1F5M A;  2XK1 A;  4LV1 A;  4OPY A;  1OTA A;  1TEM A;  5EVI B;  4N1H A;  3EGD C;  4M3K A;  1WYB A;  4B4Z A;  1ZG6 A;  4GDN A;  5CEB A;  1MKM A;  2R78 A;  4UHU A;  1K54 C;  3T1S A;  3T1Q B;  3ZDJ A;  2WUQ A;  2WZZ A;  1LL8 A;  3VMA A;  3HUO A;  3NOT C;  3IWQ A;  3O88 A;  2OOL A;  4HH3 A;  1NWZ A;  4OPQ A;  4K0X A;  4JF6 A;  3NEC A;  2EWV A;  5DVA A;  4PM9 A;  5L09 A;  5F68 A;  1WYC A;  4R0Q A;  1J9M A;  1BYW A;  2ZD8 A;  3C30 A;  3CUE C;  3IXD A;  1XXM A;  3SS5 A;  3F1O B;  3VE4 A;  4Y2F A;  4WN5 A;  3CUE A;  4MEZ A;  3HCY A;  4JF5 A;  4QWO A;  4WZ4 A;  1CF0 A;  4Y17 A;  1PRQ A;  1SHV A;  3ZG8 B;  2PDR A;  3CZD A;  3A0S A;  1SKF A;  5HDS A;  3BJN A;  3UDX A;  3OLO A;  1E3U D;  4OOL A;  2WKE A;  1K56 D;  4WZ5 C;  2ZC4 B;  4N9K A;  4LCM A;  5AQB A;  2PD8 A;  5F1G A;  1K6S A;  3E2K A;  1NY0 A;  1T1C A;  1E3U A;  3IQA A;  3S7O A;  1K56 A;  2WGI A;  3ZNT A;  2P74 A;  5DJU A;  3LIA A;  3OC2 A;  5AVE A;  5HDC A;  1ZKJ A;  3OPP A;  1D1J A;  4I3A A;  2PR5 A;  3MKE A;  1BUE A;  3IBJ A;  4JF4 A;  4EQ1 A;  2OLU A;  1G5U A;  3FG8 A;  1JNU A;  4HEF A;  3NOP C;  2V20 A;  3F1N B;  3IH8 A;  2HJE A;  4Z1W A;  3UDF A;  3DTI A;  3KO6 A;  1KE4 A;  2FFF B;  1T1A A;  1RP5 A;  3D4F A;  2VZW A;  4X6T A;  4GKU A;  4MN7 A;  2CC1 A;  3G2Z A;  2J80 A;  3H9W A;  3EQV A;  3E0Y A;  3T12 B;  1IYQ A;  1KDS A;  4HOI A;  4S2M A;  3LEZ A;  2OWJ A;  4WEJ A;  4ZBE A;  4S2O A;  5A91 A;  5HAP A;  4JLF A;  1BTL A;  1ONG A;  1YLT A;  2BTF P;  1K6R A;  4R3J A;  3LCE A;  5GLA A;  4HIA A;  1ERM A;  4HBU A;  5A92 A;  1M6K A;  3RTY A;  4E3K A;  1K38 A;  1Y28 A;  4PM6 A;  3W8K A;  3PHY A;  2PU2 A;  2Q9N A;  3ZVW A;  3QP1 A;  2ZQ7 A;  4XUZ A;  1GSV A;  3WRZ A;  1Z6F A;  2EFU A;  3GRJ A;  3UE1 A;  5L07 A;  4MBH A;  1CI9 A;  3B42 A;  3IF5 A;  4WLA A;  4G3K A;  3M2J A;  5F69 A;  2ZQ8 A;  1CK3 A;  4O7D A;  4WM9 A;  4E3M A;  4R3B A;  4D60 A;  2D02 A;  3C7U A;  4WEL A;  3VP2 A;  4ZAM A;  1TS7 A;  5FQM A;  2JN7 A;  2P04 A;  3OPL A;  4EET B;  2MJ6 A;  3C4O A;  3Q7V A;  1BLS A;  2OLV A;  2ZQ9 A;  5TR7 A;  3ZGA B;  4I39 A;  4JXV A;  3IXH A;  3LR3 A;  2XD5 A;  1KE3 A;  4JGR A;  1TDG A;  5FI6 A;  2OAQ 1;  3KYE A;  4JGO A;  3IS2 B;  2PYP A;  3V50 A;  1F9I A;  4LV3 A;  4LRY C;  2V8C A;  4BWI A;  2PYR A;  3A3F A;  3VE3 A;  3ITB A;  1GHI A;  4Y0U A;  1T18 A;  4E3O A;  5FDH A;  1XGJ A;  4DE1 A;  3ZG7 B;  1IOU A;  4WBG A;  4F94 A;  4X1L A;  2M7V A;  1LSV A;  4DN0 A;  4Q8I A;  3RXW A;  1OTB A;  3MFX A;  2A2L A;  1JWP A;  3VFH A;  2WKR A;  1PIO A;  3GQZ A;  2W1T A;  5DTK A;  1KGF A;  4HP4 A;  5DFX A;  3P7N A;  4KQD A;  4P6Z M;  1FIL A;  2Y2M A;  3NUL A;  2ZM0 A;  2B02 A;  2XH9 A;  3MQO A;  3UE0 A;  3LIE A;  3Q7V B;  2W3D A;  5E2G A;  2IA2 A;  5FDS A;  5E43 A;  1UGU A;  2PRF A;  4PPR A;  2GZA A;  3DTE A;  4LLO B;  2VV7 A;  4JXG A;  2Z6D A;  4RA7 A;  1LL5 A;  2W0N A;  2LB9 A;  1FR1 A;  4DJ3 A;  4ZJ3 A;  5FSR A;  2K7S A;  1ERO A;  4R70 A;  3MSH A;  3BY8 A;  3MBZ A;  3L7H A;  2X02 A;  1N9O A;  2VX8 A;  3V39 A;  2O0Y A;  1M40 A;  1G28 A;  2UV0 E;  1W5D A;  1CEG A;  2ZBB A;  2EXB A;  4UQI M;  1CI8 A;  3HLW A;  3VFF A;  5DF8 A;  2JKG A;  3MQQ A;  2L4R A;  3DWK A;  5FL3 A;  1LI0 A;  3WS0 A;  3E4P A;  1YQS A;  2W1T B;  1HLU P;  5LBR A;  1QME A;  4DXB A;  2VKS A;  1YLY A;  4KQR A;  1KVM A;  3G32 A;  3NHQ A;  3MZE A;  4EEU A;  3MJQ A;  1K4E A;  2XFT A;  4EV4 A;  5JYP A;  4MNR A;  1I2S A;  2R9W A;  3C5A A;  4C3Q A;  5M1A A;  3F1P A;  3T4J A;  3LI9 A;  2Y2J A;  5DFY A;  2ZQD A;  4S2I A;  2VJW A;  3O5Y A;  1NZU A;  3PAG A;  4OOM A;  3GVB A;  2JE5 A;  3HJK A;  4QY6 A;  4DRT A;  3N6I A;  3NY4 A;  1HZO A;  4S2L A;  3NC8 A;  4GZB A;  1XFQ A;  1FCO A;  4A5R A;  1TS0 A;  4DJ2 A;  2E8J A;  2DNS A;  3ZG0 A;  4JBF A;  3R7W A;  3R4K A;  4B93 A;  3LID A;  2Y2O A;  4B4X A;  5FAS A;  1BLP A;  2XFS A;  1NLY A;  1U60 A;  1OTE A;  3QP2 A;  2ZOI A;  5CTN A;  4EES A;  3FPW A;  5AQA A;  5MC7 A;  1W7F A;  3BFF A;  2P9V B;  2WAE A;  4DMZ A;  3PBN A;  2Z2M B;  4GLQ A;  3IH9 A;  4GJ4 A;  3SZT A;  1FOF A;  3VOY A;  2Y4A A;  3MR0 A;  1ESU A;  2M7U A;  2WK0 A;  3MF0 A;  2A3U A;  3S7P A;  4EU0 A;  3LIB A;  2Z2L B;  4BLM A;  2I72 A;  3F1P B;  1S1Y A;  4AFI A;  4Y0O A;  5EM0 A;  4Y0T A;  4E3J A;  3GDI A;  1XGI A;  4NK3 A;  3C2W A;  3KSH A;  3MZF A;  4CLC A;  1JWV A;  3EWK A;  5EVI C;  3K2N A;  3TW8 A;  1UWP X;  4BBV A;  1XPB A;  3LR4 A;  1MWS A;  3KYZ A;  4BJP A;  3R7W B;  3LY4 A;  2QJ7 A;  5HD5 A;  4G3V A;  5GL9 A;  3OOV A;  1HVB A;  3MKF A;  3PBQ A;  4KZ7 A;  1AXB A;  5HPI A;  3C7V A;  1W8Y A;  1ONH A;  3EEA A;  2W3H A;  3PTE A;  3A0V A;  4JXW A;  1DP8 A;  4GS9 B;  1FR6 A;  4ZRR A;  4S2N C;  4Y15 A;  3UB6 A;  4FSF A;  2YKF A;  4B88 A;  2Y79 A;  1LI9 A;  3C38 A;  3Q07 A;  3LY3 A;  2XR0 A;  3W4Q A;  1D06 A;  2YKH A;  2J9O A;  1JWZ A;  1KVL A;  5AJG A;  3LEQ A;  5DKL A;  4BQM A;  1O07 A;  4IBR A;  4WYY A;  2HZ5 A;  1SDN A;  1BT5 A;  4DDY A;  3OCN A;  4NXB A;  1YSP A;  2JBF A;  2VGL S;  3T4O A;  2WGW A;  2RL3 A;  1SDE A;  3K3D A;  1LL9 A;  3MXS A;  3PBR A;  1L0E A;  5HAR A;  5IS1 A;  3IX4 A;  3ZNY A;  4FH2 A;  4R4S A;  2XSS A;  4IHQ A;  2GJ3 A;  3T1R A;  2Z6C A;  2VK3 A;  5IU1 A;  1SCW A;  2X71 A;  3UB7 A;  1G6A A;  1OJG A;  4MBK A;  5HDD A;  2P08 A;  3SS3 A;  3HJI A;  4X69 A;  5CXW A;  3W4P A;  1YM1 A;  4UAA A;  4HI4 A;  2W3E A;  2WYX A;  5CGS A;  2VV8 A;  4KG5 A;  4L0L A;  3IF6 A;  4EBN A;  1IYO A;  3BFC A;  2L1M A;  1N9B A;  2HP5 A;  4CLC E;  4KZ4 A;  3VV4 A;  2XF3 A;  4KZB A;  4OOY A;  1W79 A;  5CRF A;  2OAP 1;  5DJT A;  2WKP A;  5G4Z A;  3S4X A;  4OLD A;  2E8I A;  5EV0 A;  3B33 A;  3PBO A;  2WGW B;  4B9O A;  3MFD A;  4OQI A;  5AVF A;  1FSW A;  1RGY A;  2HDQ A;  4WMC A;  4GOG A;  3ZG5 A;  1ES3 A;  4L9E A;  4PM7 A;  2XD1 A;  4OQ0 A;  1MKI A;  2PAV P;  3CG5 A;  1NJ4 A;  3BLM A;  2ZC6 B;  3BEC A;  1STZ A;  4NXG A;  4LCL A;  3OPR A;  4KEN B;  1F98 A;  1PI5 A;  3JVU A;  1K55 A;  2K2N A;  1XJ3 A;  2KDK A;  3CHW P;  2KLI A;  3TE8 A;  3IF6 B;  4PM8 A;  3UY6 A;  2B95 A;  2W1R A;  4NKP A;  3KSI A;  3MXR A;  1TDL A;  4EER A;  2PHY A;  1FIK A;  3SOI A;  3ZQ5 A;  3EGX C;  1TS8 A;  1DP6 A;  5DF9 A;  1LT0 A;  3W2Z A;  2WKH A;  5EFW A;  3BQA A;  3JVV A;  1W63 Q;  4QY5 A;  4YFM A;  5HX9 A;  3VP3 A;  4U0X A;  3D9Y A;  1IKI A;  1ES2 A;  3UE3 A;  3BY9 A;  4GDB A;  2OV5 A;  1DJA A;  2KX6 A;  3QP5 A;  3Q82 A;  1OPX A;  1TF1 A;  3OBF A;  1PW1 A;  3GMW A;  4X25 A;  3HUM A;  5F82 A;  1OTD A;  3KSF A;  2R9X A;  4X1M A;  1IEM A;  1XA7 A;  4E3L A;  5F5Y A;  4Q0I A;  3MXQ A;  2M1C A;  4PAU A;  2QMI A;  1S67 L;  3G4P A;  2HPB A;  2W3F A;  2ZC3 B;  1PI4 A;  5E2F A;  3FC7 A;  4R6L A;  5HAI A;  1PWG A;  1H8Y A;  3Q1F A;  3T1X A;  5F1F A;  4E3N A;  1H8Z A;  3E2L A;  1P97 A;  3QP4 A;  2HDU A;  5D3O A;  1DP9 A;  1BSG A;  4HHD A;  1K4F A;  4GHI A;  2EA9 A;  3NI9 A;  3V5M A;  3GSG A;  5EVE A;  2QWS A;  1GA0 A;  2XA7 M;  4DE3 A;  3VOZ A;  4EQI A;  4F3L A;  3UMD A;  1LLB A;  3BRM A;  2GNX A;  4NG2 A;  1DRM A;  4JKT A;  2EFX A;  2EWW A;  3SS4 A;  2OSU A;  3WRT A;  5DTT A;  1YLP A;  4R4R A;  1VM1 A;  1MXO A;  5A90 A;  5I5L A;  3UE6 A;  4MMN A;  4FOF A;  1BUL A;  2C5W B;  4N1X A;  1NYY A;  4GB7 A;  3NIA A;  3CLO A;  3OCL A;  5GLC A;  3IXG A;  5I94 A;  2G7U A;  1TVF A;  1F2K A;  1YMX A;  4BL3 A;  5L10 A;  5KIZ A;  2Y2N A;  3K3C A;  4EUZ A;  2QHK A;  3T4K A;  3BFG A;  3BQ8 A;  3RJU A;  2VGJ A;  3UME A;  3HRE A;  3G34 A;  4CPK A;  4HP9 A;  1KGG A;  4F3L B;  2JCH A;  3QP6 A;  4OH0 A;  3AGE A;  4FUW A;  4X53 A;  4CQH A;  4MN5 A;  1MBL A;  1QMF A;  1GA9 A;  2HJ9 C;  3LI8 A;  4XXR A;  2Y59 A;  4OON A;  1GHM A;  5GHY A;  4S2K A;  2Y55 A;  3UPO A;  4GCZ A;  3V67 A;  3PXP A;  2XGN A;  4IUH A;  1MWR A;  3HLF A;  4HNB A;  3T4Q A;  3IWO A;  3CIT A;  1JTD A;  4X56 A;  5M19 A;  4ID4 A;  4K0W A;  3Q7Z A;  1OT6 A;  2XQZ A;  1SZV A;  3IT9 A;  4HBT A;  2V2F F;  2B18 A;  4OP8 A;  1IEL A;  1N9L A;  3HL9 A;  2V1Z A;  4MCW A;  3IWI A;  4L9F A;  2WKQ A;  2QZ6 A;  4QD4 A;  4ETZ A;  3IXB A;  4KZ3 A;  1ALQ A;  1VB6 A;  3ICY A;  3ZCZ A;  3DWZ A;  5CHU A;  4HQA A;  3RXX A;  3TOI A;  4PMA A;  1XJ6 A;  3RH8 B;  2PT7 A;  5G4Y A;  3CJM A;  4ZTK A;  4UA9 A;  2L0W A;  3RFB A;  5GLD A;  4Q0J A;  3PYP A;  4IBX A;  4D2O A;  1S6R A;  5K5B A;  3KSG A;  3TSG A;  4HJ3 A;  4O01 A;  5FAQ A;  1NZO A;  2JHE A;  3HLD A;  4UA7 A;  4NEE D;  5G18 A;  2XRO A;  1XA1 A;  1PYY A;  1E4D A;  1MZU A;  1ACF A;  2DCF A;  3LGO A;  3KX0 X;  3TRC A;  3C8C A;  1YKD A;  4DKI A;  1S4S A;  1K25 A;  1MWU A;  2O9A A;  4P6Z S;  1ZC2 A;  3HVF A;  3NDG A;  3ITA A;  2UWX A;  1GSW A;  4RQ9 A;  4ME4 A;  2HV1 A;  1NRJ A;  1Y54 A;  4P0M A;  4RX3 A;  3S7N A;  5CHM A;  3P09 A;  3H7W A;  1YLW A;  1C3B A;  1W63 M;  3A3I A;  1T19 A;  4R1G A;  4JPM A;  4R23 A;  2PU4 A;  2EX9 A;  1HD8 A;  2J3W A;  4DE0 A;  4CLC D;  3VSL A;  3FKV A;  4BD0 A;  3PR6 A;  4CLC C;  4MBF A;  1TD5 A;  3M2K A;  5KMW A;  4UQI S;  2JC7 A;  2ZMV A;  1X0O A;  1EW0 A;  1FQG A;  2ZM8 A;  5HWV A;  5IHV A;  1IFQ A;  3MMH A;  1S1Z A;  2V1B A;  2I9V A;  3S22 A;  2ZOH A;  1L3L A;  3NOU C;  4FCF A;  5AQ7 A;  5CTM A;  2ZQA A;  5TFQ A;  1I5Q A;  1XP4 A;  3M6B A;  1FCM A;  1H5X A;  4IED A;  1W8Q A;  4LEN A;  4P85 A;  4HH2 A;  1H8M A;  4R38 A;  2ZMF A;  4QB8 A;  3DTK A;  4BEN A;  3NJA A;  3FV7 A;  5HD3 A;  3H7W B;  1CQA A;  4Z9Q A;  3KYQ A;  4EUV A;  5DF7 A;  2XEP A;  4Q0H A;  5EVL A;  3WS2 A;  4YWZ A;  3VP0 A;  4YIN A;  3CWF A;  4HJ6 A;  3DAV A;  1LSW A;  2ZQC A;  4JGQ A;  4I38 A;  4CJN A;  3VP4 A;  2J8Y A;  1NRF A;  1P0Z A;  4ESP A;  1SKO A;  2XRN A;  4N9L A;  4KZ6 A;  5EOE A;  5FAT A;  4CLC B;  2ZL1 A;  3S1Y A;  5AQ9 A;  1ES5 A;  1VEU A;  1GCE A;  3T50 A;  4XT2 A;  2B5R A;  5CX7 A;  5A8B A;  1GSX A;  4PM5 A;  5E2H A;  1P9W A;  2G2U A;  1ODV A;  1XKZ A;  4WL9 A;  2H10 A;  3UB5 P;  3UB8 A;  2V0U A;  4ZJ2 A;  4IVI A;  2V0W A;  2QKP A;  2EXA A;  4G3W A;  3NBL A;  3IF6 C;  2V1A A;  1Q2Q A;  5FAO A;  1H3Q A;  5HFO A;  5BOH A;  5J4E A;  1K54 A;  2BAS A;  5GHX A;  1TS6 A;  2H0T A;  3HLB A;  3UPN A;  3G35 A;  3CAX A;  2H28 A;  3HLC A;  4GD8 A;  5HWT A;  1SKO B;  1BLC A;  4WMC D;  2PD7 A;  4H6J A;  1N4O A;  4M4X A;  5U47 A;  3SH7 A;  2JKF A; 
#chains in the Genus database with same CATH homology
 2J9P A;  4ZJ3 A;  5FSR A;  4JXS A;  4XUX A;  2XDM A;  4KZ9 A;  3QHY A;  5FI7 A;  1ERO A;  5HAI A;  4KZA A;  3I7J A;  1PWG A;  3HLE A;  4OQG A;  1H8Y A;  3Q1F A;  1I2W A;  3MBZ A;  5F1F A;  5EVI D;  4E3N A;  4P87 A;  1H8Z A;  2X02 A;  5CGX A;  3E2L A;  4EBL A;  2H5S A;  1MY8 A;  1PZO A;  3A3D A;  2HDU A;  5D3O A;  1BSG A;  3DTM A;  3V39 A;  4QJG A;  4KG2 A;  2WAF A;  3IHA A;  1M40 A;  3PBS A;  5EE8 A;  5FQQ A;  4DDS A;  5KZH A;  1W5D A;  1CEG A;  1K4F A;  4FD8 A;  2EXB A;  2VGK A;  1CI8 A;  3WS4 A;  3HLW A;  4KQO A;  2HDR A;  5DF8 A;  5EVI A;  3VFF A;  3V3R A;  2ZLY A;  3NI9 A;  3V5M A;  3DWK A;  3GSG A;  1LI0 A;  3PBT A;  2Y2K A;  5FAP A;  3WS0 A;  1YQS A;  1YT4 A;  1K55 C;  1CEF A;  1GA0 A;  2J7V A;  4BD1 A;  4DE3 A;  4GNU A;  1QME A;  4DXB A;  4E3I A;  4LV0 A;  3VOZ A;  1YLY A;  4KQR A;  4C75 A;  1KVM A;  3V3S A;  3O86 A;  3ZFZ A;  4BL2 A;  4EQI A;  2Q9M A;  3ISG A;  3G2Y A;  1PWC A;  3G32 A;  1LLB A;  4E6W A;  5CEC A;  1L0F A;  3BRM A;  3GV9 A;  2ZJ9 A;  3MZE A;  4P6B A;  4WEK A;  4JKT A;  4WZ5 A;  3FZC A;  1K4E A;  2EFX A;  2XFT A;  5FI2 A;  2EX2 A;  4DXC A;  3GR2 A;  3SS4 A;  2OSU A;  1FCN A;  3WRT A;  4EV4 A;  5JYP A;  4N92 A;  5DTT A;  1YLP A;  4R4R A;  1VM1 A;  2HDS A;  1K57 C;  4MNR A;  1I2S A;  2R9W A;  3IHB A;  3C5A A;  1FSY A;  1MXO A;  2Y2L A;  4NET A;  4S2J A;  3PAE A;  4C3Q A;  5M1A A;  1O7E A;  1K57 A;  5TGF A;  3WS5 A;  5A90 A;  2FFY A;  3BM6 A;  4X68 A;  3W4O A;  2GDN A;  4Y7P A;  3NCK A;  5FQJ A;  1EI5 A;  2Y2J A;  5A93 A;  4S2N A;  3UO9 A;  2ZQD A;  4S2I A;  5CED A;  1OME A;  1MWT A;  2WKI A;  1NZU A;  3PAG A;  1BUL A;  2C5W B;  2RCX A;  3O87 A;  4N1X A;  4OOM A;  3B3X A;  3GVB A;  1NYY A;  1JTG A;  2JE5 A;  4GB7 A;  5L2F A;  3NIA A;  3AGF A;  3OCL A;  4QY6 A;  4DRT A;  4EBP A;  5GLC A;  2Y2I A;  3JYI A;  3N6I A;  1L0G A;  3QNB A;  3NY4 A;  1HZO A;  4RX2 A;  4ZJ1 A;  4S2L A;  3HLG A;  3NC8 A;  4OQH A;  5J8X A;  2EX8 A;  4GZB A;  1HTZ A;  3IXG A;  5I94 A;  1FCO A;  4A5R A;  2XK1 A;  1TVF A;  4LV1 A;  3OPH A;  4OPY A;  1YMX A;  2DNS A;  3ZG0 A;  4BL3 A;  4JBF A;  5FA7 A;  4OPZ A;  1TEM A;  2Y2N A;  2Y2P A;  5EVI B;  4EUZ A;  1XX2 A;  5GHZ A;  2BLS A;  4N1H A;  4M3K A;  3BFG A;  1WYB A;  2Y2O A;  3RJU A;  4RYE A;  2VGJ A;  3WWX A;  4GD6 A;  4B4X A;  4B4Z A;  1ZG6 A;  4GDN A;  3HRE A;  5FAS A;  5CEB A;  2XFS A;  1BLP A;  3G34 A;  1U60 A;  4CPK A;  4UHU A;  1KGG A;  1K54 C;  2Y2Q A;  2JCH A;  1KGE A;  5CTN A;  5AQA A;  4FH4 A;  1W7F A;  4OH0 A;  3AGE A;  3ZDJ A;  3BFF A;  4MLL A;  2P9V B;  2WAE A;  2WAD A;  4X53 A;  2WUQ A;  2WZZ A;  3VMA A;  1MBL A;  3PBN A;  1QMF A;  2Z2M B;  3HUO A;  1GA9 A;  3IWQ A;  3IH9 A;  3O88 A;  4XXR A;  1FOF A;  3VOY A;  2Y4A A;  3N8R A;  1ESU A;  2Y59 A;  2Y91 A;  2WK0 A;  4OON A;  4OPQ A;  1GHM A;  2A3U A;  5GHY A;  4S2K A;  5EEC A;  2Z2L B;  4BLM A;  2Y55 A;  4K0X A;  1DY6 A;  2Y2G A;  3UPO A;  3G31 A;  4JF6 A;  2I72 A;  5KSH A;  1YLJ A;  5DVA A;  4PM9 A;  2XGN A;  3QNC A;  1MWR A;  3HLF A;  1WYC A;  1IKG A;  3FYZ A;  4Y0O A;  4R0Q A;  1J9M A;  4C6Y A;  4Y0T A;  3IWO A;  2Y2H A;  2ZD8 A;  4E3J A;  1LHY A;  1JTD A;  4X56 A;  4RVA A;  4GN2 A;  1XGI A;  4NK3 A;  5M19 A;  3IXD A;  3P98 A;  4ID4 A;  1XXM A;  2IWC A;  4K0W A;  4EWF A;  5HW3 A;  3MZF A;  3SS5 A;  1JWV A;  3Q7Z A;  4MEZ A;  4JF5 A;  5EVI C;  3WS1 A;  4WZ4 A;  1SHV A;  2XQZ A;  3ZG8 B;  3IT9 A;  3CZD A;  3UDI A;  4HBT A;  1XPB A;  1MWS A;  1SKF A;  4BJP A;  2HP6 A;  3LY4 A;  2V2F F;  3N4I A;  4OP8 A;  1DJC A;  1IEL A;  3HL9 A;  2V1Z A;  3UDX A;  3IWI A;  3SH8 A;  1E3U D;  4OOL A;  2WKE A;  5GL9 A;  5JYO A;  1HVB A;  1K56 D;  4WZ5 C;  2IWB A;  2ZC4 B;  2HP9 A;  2QZ6 A;  3MKF A;  4ZDX A;  3PBQ A;  1NYM A;  1WE4 A;  4QD4 A;  4KZ7 A;  4N9K A;  4LCM A;  1AXB A;  5AQB A;  3IXB A;  4KZ3 A;  1ALQ A;  1GHP A;  4IVK A;  5F1G A;  3ZCZ A;  3DWZ A;  1K6S A;  5CHU A;  4QU3 A;  3RXX A;  3E2K A;  1NY0 A;  3G30 A;  5CER A;  4OP5 A;  3C7V A;  1E3U A;  3IQA A;  4PMA A;  3TOI A;  1K56 A;  4H8R A;  1W8Y A;  2WGI A;  1ONH A;  4JXW A;  3PTE A;  3CJM A;  4ZTK A;  5FQ9 A;  3ZNT A;  4UA9 A;  1FR6 A;  3VP1 A;  2P74 A;  4S2N C;  3HBR A;  5GLD A;  3OC2 A;  4FSF A;  4B88 A;  4K91 A;  4IBX A;  1EWZ A;  1LI9 A;  1S6R A;  4D2O A;  3Q07 A;  3LY3 A;  3TSG A;  2XR0 A;  1ZKJ A;  3W4Q A;  3OPP A;  2WGV A;  5FAQ A;  2J9O A;  1JWZ A;  1VQQ A;  1NZO A;  1KVL A;  2C6W B;  3A3J A;  3MKE A;  1BUE A;  4BQM A;  1ZG4 A;  3HLD A;  4UA7 A;  4JF4 A;  5G18 A;  1O07 A;  2OLU A;  4IBR A;  4WYY A;  1XA1 A;  1SDN A;  1BT5 A;  1PYY A;  3OCN A;  3OZH A;  4DDY A;  2JBF A;  1E4D A;  4HEF A;  4U3T A;  1MPL A;  2V20 A;  2ZC7 A;  5FQK A;  2WGW A;  1ES4 A;  2BG1 A;  3IH8 A;  2DCF A;  2RL3 A;  3N8L A;  1SDE A;  3UDF A;  5CGW A;  4DKI A;  1K25 A;  1MWU A;  1LL9 A;  1KE4 A;  1RGZ A;  2FFF B;  3MXS A;  3PBR A;  1L0E A;  1ZC2 A;  3HVF A;  1RP5 A;  3NDG A;  3D4F A;  3ITA A;  2UWX A;  4X6T A;  5HAR A;  3VSK A;  3ZHH A;  4HES A;  3BLS A;  4GKU A;  2CC1 A;  3G2Z A;  3ZNY A;  4FH2 A;  4X55 A;  5EUA A;  4R4S A;  3O3V A;  4DF6 A;  3EQV A;  4LV2 A;  1Y54 A;  3M6H A;  4P0M A;  1IYQ A;  1KDS A;  4RX3 A;  1SCW A;  4S2M A;  1Q2P A;  3LEZ A;  3LO7 A;  4U0T A;  4WEJ A;  2X71 A;  5CHM A;  3C4P A;  1G6A A;  4MBK A;  4ZBE A;  3P09 A;  4S2O A;  5A91 A;  5HAP A;  4JLF A;  1YLW A;  1BTL A;  1C3B A;  1ONG A;  1YLT A;  3SS3 A;  1BZA A;  4E6X A;  1K6R A;  4R3J A;  4X69 A;  3A3I A;  5CXW A;  3LCE A;  4R1G A;  3W4P A;  1YM1 A;  4UA6 A;  4JPM A;  4R23 A;  4UAA A;  2PU4 A;  4KQQ A;  2EX9 A;  1HD8 A;  5GLA A;  2WYX A;  4DE0 A;  3N8S A;  1ERM A;  4HBU A;  5CGS A;  5EPH A;  1M6K A;  5A92 A;  4KG5 A;  4L0L A;  5E2E A;  3VSL A;  4E3K A;  1K38 A;  3IF6 A;  5CHJ A;  4EBN A;  2WZX A;  1IYP A;  1IYO A;  3BFC A;  3FKV A;  4PM6 A;  3W8K A;  3NDE A;  2ZC5 B;  1N9B A;  2HP5 A;  4BD0 A;  2PU2 A;  4KZ4 A;  2Q9N A;  3ZVW A;  4MBF A;  2XF3 A;  4KZB A;  3M2K A;  5KMW A;  3Q81 A;  2ZQ7 A;  4XUZ A;  3BEB A;  3WRZ A;  4OOY A;  1Z6F A;  1W79 A;  1DJB A;  2JC7 A;  4OLG A;  5CRF A;  2EFU A;  3GRJ A;  3S4X A;  2PBY A;  2EX6 A;  5KSC A;  4OLD A;  2E8I A;  3UE1 A;  1PZP A;  4MBH A;  2ZMA A;  3PBO A;  1CI9 A;  4QHC A;  3IF5 A;  2WGW B;  1FQG A;  3MFD A;  4OQI A;  3EQU A;  1FSW A;  1RGY A;  2ZM8 A;  5IHV A;  3ZVT A;  2HDQ A;  1KE0 A;  3M2J A;  4WMC A;  2ZQ8 A;  3FWL A;  3S22 A;  4GOG A;  3ZG5 A;  1ES3 A;  1CK3 A;  4PM7 A;  2XD1 A;  4KZ8 A;  3HUN A;  4OQ0 A;  1MKI A;  4O7D A;  4WM9 A;  3FKW A;  4FCF A;  5AQ7 A;  5CTM A;  5F83 A;  2ZQA A;  4E3M A;  3ZG9 B;  3DW0 A;  5TFQ A;  1I5Q A;  4R3B A;  3BYD A;  3CG5 A;  3C7U A;  1NJ4 A;  1XP4 A;  2ZC6 B;  3BLM A;  1FCM A;  1H5X A;  1NXY A;  3M6B A;  4WEL A;  4ZAM A;  4IED A;  3VP2 A;  1W8Q A;  4LEN A;  4P85 A;  3BEC A;  5FQM A;  4QB8 A;  4BEN A;  4LCL A;  3OPR A;  4KEN B;  1KDW A;  3OPL A;  1PI5 A;  3FV7 A;  2A49 A;  3SH9 A;  3C4O A;  4Z9Q A;  1PW8 A;  5DF7 A;  2XEP A;  5EVL A;  3WS2 A;  1ERQ A;  1K55 A;  3VP0 A;  1PWD A;  3Q7V A;  1BLS A;  2OLV A;  2P9V A;  2ZQ9 A;  4YIN A;  5TR7 A;  3ZGA B;  5FQI A;  4JXV A;  3IXH A;  2XD5 A;  1KE3 A;  2ZQC A;  4CJN A;  3IF6 B;  4PM8 A;  3MZD A;  2J8Y A;  3VP4 A;  3UY6 A;  1NRF A;  1ESI A;  2H0Y A;  2DRW A;  1TDG A;  3MXR A;  5FI6 A;  1YLZ A;  1TDL A;  3BFE A;  4N9L A;  4KZ6 A;  5EOE A;  5M18 A;  3SOI A;  3V50 A;  3GTC A;  4LV3 A;  4S2P A;  5FAT A;  1RCJ A;  3S1Y A;  3A3F A;  5AQ9 A;  3ITB A;  1ES5 A;  1GHI A;  4Y0U A;  5DTS A;  1GCE A;  4E3O A;  5FDH A;  1XGJ A;  5DF9 A;  2B5R A;  4DE1 A;  3ZG7 B;  4WBG A;  2WKH A;  4F94 A;  1YMS A;  3N7W A;  3CMZ A;  4Q8I A;  4QY5 A;  4OKP A;  1BLH A;  5E2H A;  5GLB A;  3RXW A;  4PM5 A;  4YFM A;  5HX9 A;  1IYS A;  2G2U A;  1JWP A;  3VFH A;  3VP3 A;  4OPR A;  4U0X A;  1XKZ A;  1IKI A;  1PIO A;  1ES2 A;  2H10 A;  1E25 A;  3GQZ A;  3UE3 A;  4GDB A;  5DTK A;  2OV5 A;  1DJA A;  4ZJ2 A;  1KGF A;  1G68 A;  5HL1 A;  4IVI A;  3BFD A;  3Q82 A;  2Y2M A;  2EXA A;  2ZM0 A;  3UPP A;  5HAQ A;  3NBL A;  3IF6 C;  2XH9 A;  3UE0 A;  1PW1 A;  2ZM2 A;  3GMW A;  1Q2Q A;  2QPN A;  3HUM A;  3Q7V B;  5FAO A;  5F82 A;  2R9X A;  4OVD A;  1IEM A;  5HFO A;  5BOH A;  1XA7 A;  4KZ5 A;  5E2G A;  2XLN A;  4E3L A;  1K54 A;  5GHX A;  5E43 A;  2H0T A;  1JVJ A;  4PPR A;  3HLB A;  2G2W A;  3UPN A;  3G35 A;  3A3E A;  2IWD A;  4JXG A;  2QMI A;  3HLC A;  3UNW A;  3G4P A;  4GD8 A;  2HPB A;  4DE2 A;  3UN7 A;  2ZC3 B;  1PI4 A;  1BLC A;  4WMC D;  2X01 A;  4RA7 A;  1LL5 A;  3AGD A;  3TG9 A;  5E2F A;  1FR1 A;  5EOO A;  1N4O A;  1S0W A;  4KG6 A;  1L2S A;  5U47 A;  3SH7 A;  1L0D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...