1N9BA

Ultrahigh resolution structure of a class a beta-lactamase: on the mechanism and specificity of the extended-spectrum shv-2 enzyme
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
265
structure length
265
Chain Sequence
b'SPQPLEQIKLSESQLSGRVGMIEMDLASGRTLTAWRADERFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGELCAAAITMSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWETELNEALPGDARDTTTPASMAATLRKLLTSQRLSARSQRQLLQWMVDDRVAGPLIRSVLPAGWFIADKTGASERGARGIVALLGPNNKAERIVVIYLRDTPASMAERNQQIAGIGAALIEHWQR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-LACTAMASE SHV-2
molecule tags Hydrolase
source organism Klebsiella pneumoniae
publication title Ultrahigh resolution structure of a class A beta-lactamase: On the mechanism and specificity of the extended-spectrum SHV-2 enzyme
pubmed doi rcsb
total genus 101
structure length 265
sequence length 265
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2002-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1n9bA00
1IYSA 3D4FA 2WGWA 3UY6A 5GLBA 5KSHA 5EVIC 5HAQA 3QHYA 2C5WB 3GMWA 5F82A 4DXCA 5E2EA 4KQRA 3ZVWA 3HUNA 1BLSA 3IQAA 1E25A 1IKGA 2J7VA 5GHZA 3VFHA 4QY6A 2ZC7A 3HL9A 1MWSA 2IWBA 4DE1A 3PAGA 3G34A 3OZHA 4OQIA 4P6BA 2WZZA 1HZOA 3C5AA 4LENA 5FQJA 1BZAA 4KZ5A 3MZDA 1H8YA 3IXHA 3CZDA 3OPPA 2Y2GA 4PM5A 1KGFA 2Y59A 4U3TA 3GR2A 3HUOA 4P87A 3M2KA 1K56D 4FD8A 1IELA 4BQMA 1ES4A 4R4RA 5BOHA 4X68A 1KE3A 2P74A 3SS5A 3AGEA 3MZFA 1MBLA 3JYIA 2DNSA 3OPHA 1ESIA 3NCKA 4C3QA 5HW3A 2WZXA 3HLWA 4UA7A 1FSYA 4YFMA 5CGWA 4EUZA 5FATA 1K4FA 4WELA 4BL2A 3G32A 1MXOA 2HDQA 4OLDA 2Y4AA 4OH0A 3HLCA 5JYOA 1K6SA 4BLMA 4OVDA 2QMIA 4OPZA 2Q9NA 3BFGA 3VSLA 3A3FA 3IXBA 1ONGA 1M6KA 3HLFA 3BFDA 4S2KA 4A5RA 2Y2KA 3G30A 3NY4A 5DF9A 3A3DA 3HBRA 5HL1A 3UPNA 1MWUA 1YLPA 4JXSA 2ZJ9A 2XFSA 1FCMA 4QB8A 4XUXA 1EROA 3HLDA 4IBXA 3OPLA 3MZEA 4N1XA 1YT4A 5FQIA 3ZGAB 1DY6A 4ZDXA 1PI4A 1W5DA 4WEKA 3UPOA 2VGJA 2XLNA 5U47A 1EWZA 2PU2A 3FZCA 4FSFA 5E2FA 3S4XA 1PWCA 4KG5A 5FAQA 4EBPA 1G6AA 2H0TA 4IBRA 2A3UA 2Z2MB 4KZ9A 1JTGA 1BLCA 1JTDA 4KZ8A 2FFFB 3BEBA 3HLGA 2Y2LA 1FR6A 1LI9A 4YINA 4S2MA 4PMAA 5JYPA 4WZ5C 3LO7A 4PM9A 4HEFA 3OCLA 4ZJ1A 4GDNA 4JF6A 3RJUA 2Y2HA 1PIOA 4N9LA 3MBZA 2HP9A 5L2FA 2IWCA 4S2NA 1XGJA 3V3SA 3ZG7B 1BSGA 1JWZA 4RX2A 4QD4A 1XKZA 3ZHHA 1YM1A 2ZM0A 2Y91A 3IF5A 3M6BA 1G68A 1JWPA 4R1GA 1LLBA 1YQSA 3Q7VB 1YLWA 2ZQDA 4IVIA 5TGFA 3ZG8B 3HREA 2Y2QA 4U0XA 3WRZA 1ALQA 1PI5A 4UHUA 3WWXA 3PBRA 5EPHA 2V1ZA 5HX9A 5KSCA 1PYYA 2ZC3B 4XXRA 3PBQA 2WK0A 1XA7A 2XEPA 3MKFA 4RA7A 2ZM8A 3VP2A 3O86A 5E2HA 5CXWA 4WMCD 2OLVA 4JF4A 3Q1FA 1IKIA 4E6XA 2EXBA 1DJCA 1W8YA 4C75A 3IXGA 5CERA 3V5MA 2ZLYA 1H5XA 3UE0A 2R9WA 1I2WA 1C3BA 3GRJA 1GCEA 5A93A 3UDIA 4S2IA 3ZG0A 3UE1A 2P9VA 1FOFA 2ZMAA 4IEDA 3BLMA 2I72A 2XDMA 2P9VB 2J9OA 4ZJ3A 5DTKA 4KZAA 2RL3A 3DWZA 3V50A 4Q8IA 5EUAA 2B5RA 3ITBA 3UO9A 2EX6A 1YLZA 3IT9A 5CHJA 3P09A 3S22A 2H10A 3BFFA 3BRMA 1ESUA 1K57A 5E2GA 4M3KA 4WMCA 4Y0UA 4DF6A 4B4XA 5CEDA 1L0GA 1L2SA 2HP5A 2J9PA 3UDXA 3FKVA 5GL9A 2Y55A 1CEGA 3LEZA 3NIAA 4OONA 4BJPA 5M18A 1LL9A 1KE4A 3HVFA 1GA9A 2BLSA 5G18A 1K55C 2JBFA 1KVMA 2VGKA 2X71A 2J8YA 2Y2IA 4OP8A 1BTLA 2WGVA 4E3JA 4GNUA 2XK1A 1L0DA 5AQBA 3ZNYA 3TG9A 1NZUA 2FFYA 3GSGA 2EX9A 1NXYA 3VMAA 1VQQA 1QMEA 3TOIA 2WAEA 1XGIA 2PBYA 4JF5A 3NC8A 1RP5A 1E4DA 2X02A 4S2OA 1NYYA 1PWGA 2IWDA 5FQQA 4O7DA 3BYDA 3QNCA 4BENA 2ZD8A 3VP4A 1KDWA 3HLEA 3N8LA 1XA1A 4PPRA 1NYMA 4UA9A 2EXAA 2WAFA 1HVBA 4KG6A 3E2KA 4LCMA 5GLAA 3UE3A 2XGNA 2XQZA 1TVFA 3G2ZA 5FI2A 4ZJ2A 3C7UA 4D2OA 3HLBA 4P0MA 4KZ6A 5CEBA 4E6WA 1IYPA 1PZPA 1WYBA 2HPBA 4B4ZA 3Q07A 4WM9A 5FA7A 3BLSA 1ZG6A 2CC1A 4JXWA 1CEFA 1XX2A 1ES3A 3OC2A 4LV3A 3VP1A 1O7EA 2OSUA 3Q81A 2HDUA 3G4PA 2E8IA 4OOLA 5AQAA 4DXBA 2XF3A 3MKEA 1QMFA 4OOMA 4JKTA 4H8RA 1EI5A 2G2UA 3PTEA 4K0WA 3W4PA 3SH7A 2ZC4B 2C6WB 3O88A 4EBLA 5F1FA 3P98A 5GLDA 3WS2A 5CHMA 1H8ZA 3C4OA 1GHPA 4N9KA 4OP5A 3CJMA 2Y2PA 1ZKJA 4DRTA 4DE0A 4EWFA 3E2LA 3VSKA 3V3RA 3QNBA 2GDNA 2A49A 5HAIA 4BL3A 1HTZA 1CK3A 4GN2A 3IF6B 3ISGA 3BFCA 2Z2LB 1OMEA 3IF6A 4MLLA 5FQKA 5CECA 3M6HA 4OQ0A 3PBTA 5M1AA 4KQOA 4Z9QA 3Q7ZA 3NDGA 3I7JA 4GD8A 2R9XA 1SKFA 3ITAA 2DCFA 4EBNA 3LY4A 3PAEA 4S2JA 4Y7PA 1GHMA 3SS4A 1MWTA 5TR7A 4R3BA 1FSWA 1BT5A 3O87A 2HDRA 4WZ5A 5DTTA 2WKHA 3RXXA 5M19A 4RVAA 3SOIA 2HDSA 3GVBA 3O3VA 1W8QA 4QJGA 3SS3A 1ONHA 4OQHA 3UN7A 5E43A 1K38A 3ZCZA 1HD8A 2WGWB 4OPYA 4JXGA 1U60A 2ZC6B 3MXSA 4R23A 4KZ4A 4N92A 4PM7A 5FI6A 4MBFA 1FR1A 3IHAA 4UAAA 1PW8A 1XPBA 3ZNTA 2H5SA 2Q9MA 1GHIA 4HESA 5A90A 4JLFA 5A92A 1PWDA 4LV0A 4X56A 4Y0OA 1S0WA 2HP6A 2Y2OA 3FWLA 3N7WA 5EE8A 3AGFA 5EVLA 3SH8A 1FCOA 2ZC5B 3SH9A 2PU4A 5HAPA 4ID4A 4JPMA 1DJAA 1Y54A 1ERMA 1K56A 2RCXA 5DTSA 4FCFA 5GLCA 5F1GA 3A3EA 3UNWA 2H0YA 1ES5A 1MPLA 1BUEA 2JC7A 5D3OA 2G2WA 4WZ4A 2WKIA 3WS0A 1YLJA 3LY3A 1KGEA 2ZQCA 3WS4A 5FSRA 3FYZA 3GV9A 4GD6A 4QU3A 3S1YA 1LHYA 3DW0A 1VM1A 4BD1A 1I2SA 1Q2QA 4FH4A 4R4SA 4XUZA 5EECA 1RGYA 3AGDA 5CRFA 5AQ9A 2EFXA 2ZQ9A 4E3LA 2ZQ7A 1L0EA 1ZG4A 3A3JA 4KZ7A 3ZG5A 1SDNA 1I5QA 1K4EA 1N4OA 4LCLA 2BG1A 5FDHA 3CG5A 3IH9A 5EOEA 3B3XA 4PM6A 4WBGA 4X55A 5DF7A 3EQUA 3VFFA 1FCNA 4LV1A 1BULA 1BLHA 2UWXA 4C6YA 5DVAA 4X69A 3V39A 3WRTA 1NJ4A 1K54A 4NETA 3C4PA 2WGIA 1YMSA 2XFTA 1K57C 1PZOA 2EFUA 1S6RA 3RXWA 1W7FA 3NI9A 4X6TA 3IXDA 1DJBA 3HUMA 3N8SA 2QPNA 3VOYA 1KGGA 3IWIA 3UDFA 4LV2A 1SCWA 4K91A 2Y2NA 2Y2MA 5FASA 4JBFA 1MKIA 4QHCA 3IH8A 4K0XA 2XD5A 4UA6A 3ZDJA 1JVJA 3BM6A 4L0LA 4ZTKA 1WE4A 3OPRA 4OPRA 3MFDA 4OQGA 1RGZA 1TDLA 3IF6C 4S2PA 4OKPA 1ZC2A 5EVIA 2OLUA 1YMXA 3N6IA 4GOGA 2X01A 5KZHA 5J8XA 3EQVA 5FAPA 2WYXA 3IWQA 5A91A 4OLGA 1J9MA 3VOZA 1WYCA 4KG2A 5CTMA 4N1HA 4CPKA 1N9BA 1KE0A 1SHVA 2V20A 3G2YA 4DE2A 3G31A 2XD1A 3MXRA 1IYOA 1RCJA 5AQ7A 4OPQA 4DKIA 4DE3A 2ZM2A 1Q2PA 4S2LA 2EX2A 4KENB 4E3MA 3FV7A 3UPPA 5EOOA 3GQZA 1YLYA 2Y2JA 3FKWA 4WEJA 5EVIB 3TSGA 4S2NC 3NBLA 3M2JA 1MWRA 5CGSA 4X53A 3G35A 1SDEA 4KZBA 1O07A 2WUQA 1ES2A 1MY8A 3C7VA 3CMZA 1KDSA 5CTNA 3IWOA 5TFQA 2DRWA 1YLTA 1XXMA 2ZQAA 4E3OA 4ZAMA 1NZOA 4RYEA 3W8KA 1XP4A 5IHVA 2V2FF 1BLPA 4HBUA 3W4QA 1K55A 1IYQA 1Z6FA 2JCHA 5DF8A 3VP0A 1K54C 4GZBA 3DWKA 4MBKA 1CI8A 4GDBA 4R0QA 4KZ3A 4MNRA 5FQMA 1M40A 2ZQ8A 4BD0A 5KMWA 1K25A 1LL5A 3IHBA 3Q82A 1K6RA 1TDGA 1AXBA 3LCEA 3PBOA 3ZFZA 3N8RA 5CGXA 1L0FA 3Q7VA 3A3IA 4Y0TA 3DTMA 3BFEA 5CHUA 2JE5A 5EVID 3VP3A 1KVLA 1IEMA 2WADA 5FQ9A 4B88A 5F83A 1LI0A 4QY5A 4KQQA 4DDYA 3WS1A 4EV4A 4P85A 1NY0A 4GKUA 3PBNA 3WS5A 4CJNA 2OV5A 4FH2A 5FAOA 4MBHA 1FQGA 1CI9A 3GTCA 4WYYA 3ZVTA 4DDSA 4E3IA 1W79A 3BECA 4R3JA 4E3KA 4JXVA 1GA0A 1PW1A 4NK3A 4PM8A 4EQIA 3NDEA 5GHXA 3ZG9B 4OOYA 1NRFA 4ZBEA 3N4IA 5HFOA 4E3NA 5FI7A 2WKEA 4HBTA 3OCNA 4F94A 4IVKA 4GB7A 1ERQA 2EX8A 5GHYA 2XR0A 5I94A 5HARA 3PBSA 2QZ6A 1JWVA 4MEZA 1E3UD 2XH9A 1E3UA 4RX3A 1TEMA 4U0TA 3W4OA
chains in the Genus database with same CATH superfamily
2WGWA 3UB7A 2EA9A 5F82A 1LT0A 4Y15A 2DMWA 1YKDA 1MWSA 4DE1A 2JHEA 3PAGA 1S66L 3OZHA 1HZOA 3C5AA 4LENA 5FQJA 2VA0A 3OPPA 1T19A 2Y59A 3HUOA 4P87A 1YPRA 4R4RA 5BOHA 3BY8A 3SS5A 1MBLA 1VEUA 2M7UA 5HW3A 2WZXA 3HLWA 4YFMA 4EUZA 5FATA 4BL2A 3FPWA 3T1QB 4OH0A 1X0OA 2QMIA 3BFGA 3VSLA 5DF9A 3HBRA 4KUKA 3T4JA 1MWUA 4JXSA 4QB8A 4LRZE 4X1MA 4N1XA 1K0KA 5FQIA 4ZDXA 3EEAA 1PI4A 2FH5A 1EWZA 2PU2A 3FZCA 4FSFA 4II7A 1PWCA 1H8MA 1XJ3A 2H0TA 4KQDA 1BLCA 1LL8A 1T1BA 3BEBA 3HLGA 1LI9A 4S2MA 3LO7A 4HEFA 3OCLA 3IX3A 1Y4OA 2Y2HA 2HP9A 5L2FA 2IWCA 4KUOA 3V3SA 4IJGA 1LSWA 3ZG7B 1UGUA 4QD4A 3IS2A 1XKZA 2ZM0A 2Y91A 1JWPA 4R1GA 3K2NA 2JKFA 3HREA 4UHUA 4CQHA 5HX9A 1D7EA 4XXRA 4Q0JA 2WKQA 2PR5A 4WMCD 2G7UA 4JF4A 4ZRRA 4E6XA 3V5MA 2ZLYA 1H5XA 3UE0A 3DTKA 1GCEA 3UE1A 4IEDA 2I72A 1N9LA 3LICA 2V0WA 4KZAA 2RL3A 3DWZA 4Q8IA 2OAP1 2EX6A 5CHJA 4L9EA 2H10A 5DJTA 3BRMA 1K57A 4WMCA 4B4XA 1L2SA 2J9PA 3UDXA 3NIAA 2M7VA 2VGLM 2JBFA 5TBMA 1BTLA 3TG9A 2EX9A 5K5BA 2VGLS 1XGIA 4LPZA 5FQQA 3QNCA 4L9GA 4LRYC 4GCZA 1KDWA 4DJ2A 3UE3A 2XGNA 1TVFA 3C7UA 4P0MA 2HPBA 4B4ZA 3Q07A 2CC1A 4WL9A 1XX2A 4BBUA 4O0PA 4LV3A 2W1RA 2OSUA 3G4PA 3KSIA 4X25A 3MKEA 4Z1WA 5CX7A 4DMZA 2ZC4B 5F1FA 3P98A 5GLDA 3VE4A 4I3AA 4Y13A 3C4OA 4OP5A 5EM1A 2Y2PA 1ZKJA 4EWFA 3E4QA 3E2LA 3VSKA 3MJQA 1CK3A 4GN2A 5FQKA 5CECA 3PBTA 2R9XA 3LEQA 3ITAA 1PFLA 2PDRA 4S2JA 1GHMA 4X1LA 4R3BA 5EM0A 3GVBA 3SS3A 2GZAA 4B9OA 2JKRM 2QJ5A 2ZC6B 3MXSA 4R23A 4KZ4A 4N92A 4UAAA 1P0ZA 3JVVA 3ZNTA 2ZL1B 1GHIA 4HESA 3PR6A 1PWDA 4LV0A 4EW7A 1S0WA 3CLOA 1YAXA 5I5LA 1H0MA 4ID4A 1Y54A 1K56A 1LSVA 5DTSA 1S1YA 3VV4A 2PBDP 4QPRA 3IBJA 2LB5A 3WS0A 1KGEA 3FYZA 3S1YA 3U2AA 1I2SA 1UWPX 1RGYA 3LYXA 3AGDA 2VX8A 5HD3A 5AQ9A 4E3LA 3NJAA 3IH9A 4PM6A 4LV1A 1BULA 2UWXA 5DVAA 3WRTA 3LIAA 4NETA 3C4PA 2XFTA 1S6RA 3HUMA 5HPIA 3VOYA 3MQQA 3O5YA 4ESPA 4O8GA 2XD5A 2B95A 3BM6A 4L0LA 3MFDA 4NXBA 1P9RA 4OKPA 1V9YA 1T1AA 2QYBA 5L8MA 1T18A 3N6IA 1ZHHB 2PHYA 5J8XA 2WYXA 4LFUA 4KG2A 4CPKA 3G2YA 2PD8A 4BBVA 4UEYA 1IYOA 3HCYA 3JPUA 5AQ7A 4DE3A 3LIFA 4Y2FA 1YLYA 3KYZA 4JGRA 1Y28A 3M2JA 4R6LA 3MR0A 3G35A 3HJKA 2WUQA 2JN7A 3IWOA 5TFQA 1XXMA 2P08A 4ZAMA 4Q0HA 1BLPA 2JCHA 1TF1A 3LUQA 4GZBA 1CI8A 4MNRA 5FQMA 2ZQ8A 1LL5A 1HLUP 3Q82A 1AXBA 3T4QA 3PBOA 1CF0A 3Q7VA 4Y0TA 2D01A 3DTMA 3BFEA 5CHUA 1BYWA 3VP3A 1IEMA 2WADA 4B88A 2M1CA 2O9BA 2VKSA 4MBHA 1JNUA 3GTCA 4DDSA 3E98A 1W79A 4GLQA 4NK3A 1S1ZA 3NDEA 1ZTUA 4OOYA 3MF0A 3OCNA 1NLYA 3PXPA 4MDZA 1ERQA 5TBMB 2W3GA 5HARA 1JWVA 1OT6A 3MQOA 5AVEA 5F69A 5KSHA 4I39A 3GMWA 3DTIA 5E2EA 3EGDC 3IQAA 3TRCA 1IKGA 1NWZA 3HL9A 3EWKA 3G34A 4OQIA 4I3IA 1BZAA 4KZ5A 3MZDA 3IXHA 3CZDA 3CUEA 2R78A 1K56D 2GX5A 2P74A 4ETXA 3OPHA 1FSYA 4WELA 3G32A 1OTAA 2Y4AA 4EEPA 5JYOA 1K6SA 4BLMA 2K2NA 2Q9NA 3HLFA 3BFDA 4MN6A 2W3FA 3NY4A 4CLCD 1YLPA 2VV6A 5A8BA 4Q0IA 4YOFA 4XUXA 3ICYA 1VETA 4HIAA 3H7WA 4IHQA 3UMEA 1YT4A 3MFXA 3ZGAB 1DY6A 2ZMVA 1W5DA 3H9WA 4WEKA 2VGJA 2XLNA 4YNRA 3S4XA 5E2FA 2PR6A 4EBPA 2JKRI 3LR5A 4IBRA 1JTGA 3CPTA 4KZ8A 1NRJA 2FFFB 1FR6A 3E0YA 4GDNA 3RJUA 2PT7A 1PIOA 3BQ8A 3MBZA 2OWHA 3KSGA 4S2NA 1XGJA 1SZVA 1BSGA 4RX2A 3BW6A 3DBAA 4BWIA 2GNXA 4IUKA 1G6OA 1YQSA 2EWVA 1YLWA 3S7NA 3ZG8B 4CLCB 3PBQA 2WK0A 1XA7A 4F3LA 4RA7A 1EW0A 2ZM8A 3O86A 5CXWA 2OLVA 2VV8A 4HP9A 1DJCA 3V67A 5CERA 3LI8A 3S7OA 1I2WA 1C3BA 1XJ6A 3S7PA 3BLMA 2XDMA 3T1SA 3KSFA 5AVFA 3V50A 2B5RA 3UO9A 1YLZA 4ARZA 1OTEA 4ARZB 4Y3IA 2KX6A 5E2GA 4DF6A 5CEDA 3LEZA 4OONA 2V8CA 4BJPA 4PKYA 1KE4A 3HVFA 2BLSA 4IUHA 4P6ZM 4CLCE 2X71A 2Y2IA 5AQBA 1VQQA 3TOIA 3TJZC 4JF5A 3NC8A 4HJ6A 2QKPA 3MXQA 4XT2B 3EOIA 1PWGA 2IWDA 5J4EA 5IS1A 4BENA 1DRMA 3KYEA 3HLEA 3N8LA 4PPRA 2EXAA 4KG6A 4LCMA 5GLAA 3E2KA 2O0YA 2XQZA 5FI2A 1F98A 3LR4A 4KZ6A 2CMNA 3BLSA 2L4RA 5G4ZA 4HI4A 1CEFA 2PD7A 3OC2A 5FDSA 1O7EA 1OJGA 5EVEA 4OOLA 5AQAA 2XF3A 4OOMA 4H8RA 1EI5A 2G2UA 3PTEA 2C6WB 3O88A 4EBLA 3DTEA 4M4XA 1TS8A 4PAUA 3FPVA 1H8ZA 5LBRA 3F1PA 4DE0A 4MCWA 5HAIA 1HTZA 3ISGA 4H6JB 1WA9A 3ZYTA 3M6HA 4OQ0A 4EEUA 4Y5FA 1T1CA 4K08A 3T12B 3PAEA 3SS4A 5TR7A 1FSWA 1BT5A 3O87A 4WZ5A 5DTTA 3SOIA 2HDSA 1W8QA 3H82B 4OQHA 5E43A 2WGWB 4JXGA 1U60A 3QP6A 4PM7A 5FI6A 3IHAA 1XPBA 3SZTA 4HH2A 2MJ6A 4GS9A 2LB9A 3N7WA 5EE8A 3AGFA 2ZC5B 2XSSA 5HAPA 1DJAA 3A0SA 3ULFA 1ERMA 2RCXA 5FEGA 2H0YA 4GHIB 3NULA 2JC7A 2G2WA 4WZ4A 2H28A 4QU3A 1VM1A 2Y79A 4BD1A 4R4SA 4XUZA 5CRFA 3NHQA 2W27A 1L0EA 3ZG5A 1I5QA 3BY9A 5EOEA 1DP8A 4WBGA 3EQUA 4HH3A 1FCNA 1BLHA 1PNEA 1NJ4A 1K54A 2EFUA 2OOLA 4GS9B 3RXWA 1W7FA 3NOTC 3IXDA 3N8SA 2QPNA 1KGGA 1MZUA 1TD5A 5FASA 4HOIA 5FEFA 3LR3A 4K0XA 1JVJA 4HP4A 4GHIA 4OPRA 2VLGA 5EVIA 1ZC2A 2VEAA 4GOGA 5KZHA 3EQVA 3UMDA 4DE2A 5DKLA 4DJ3A 4OPQA 4DKIA 1Q2PA 4I38A 2XRNA 4JGQA 3FV7A 2HF6A 2Y2JA 4X53A 1O07A 3C7VA 4NG2A 1OPXA 1YLTA 5EFWA 1MKMA 1NZOA 4RYEA 3T4OA 3W8KA 5IHVA 3W4QA 5DF8A 2E8JA 4EUVA 4WUJA 1M40A 4FUWA 4BD0A 4G3VA 1K6RA 5CGXA 1L0FA 1VB6A 5F83A 4NKPA 1LI0A 3WS1A 4CLCC 1NY0A 3WS5A 3PBNA 4CJNA 2W1TB 5FAOA 1FQGA 1CI9A 4R3JA 1L3LA 4E3KA 1PW1A 4PM8A 2J3WA 2KDKA 5HFOA 3F1OA 5I94A 1E3UD 1TEMA 3QP5A 3KX0X 4U0TA 3W4OA 3D4FA 3UY6A 5GLBA 5EVIC 3QHYA 2C5WB 5HWWA 4O01A 1E25A 4UQIS 4QY6A 2IWBA 3T1XA 1KGFA 3GR2A 4LLOB 3M2KA 1OTBA 4FD8A 1IELA 4BQMA 4X68A 2V0UA 4MMNA 4EESA 3AGEA 4P6ZS 2DNSA 1ESIA 3NCKA 4UA7A 5CGWA 3VE3A 2WKRA 1K4FA 3R4KA 4L9FA 4GW9A 4OLDA 2QHKA 2L0WA 3F1PB 3IXBA 1ONGA 2WKPA 1XFNA 3A3DA 5HL1A 3UPNA 2ZJ9A 3D72A 1EROA 4IBXA 2Y8HA 3CITA 1YSQA 3OPLA 4PHTA 4BMWA 2ZL1A 3EEHA 5U47A 1N9NA 5HD5A 3B42A 5FAQA 2Z2MB 4KZ9A 3UB6A 2Y2LA 4YINA 4E04A 2VJWA 5JYPA 4PM9A 2PAVP 4ZJ1A 1IOUA 4JF6A 5F5YA 3HJIA 3L9KA 1NLZA 3KYQA 3LIEA 2OAQ1 1LLBA 5TGFA 2Y2QA 3WRZA 1ALQA 1PI5A 3WWXA 3PBRA 2BASA 1PYYA 2XROA 2ZMFA 5IT5A 2BTFP 3MKFA 3QP4A 1G28A 2P04A 5TJJA 3Q1FA 1IKIA 3IXGA 1PRQA 2R9WA 4FOFA 1AWIA 1YSPA 3ZG0A 2ZMAA 3GECA 4ZJ3A 4AFIA 3CHWP 3R7WB 3MSHA 5EUAA 2ACGA 3ITBA 4HJ4A 3IT9A 5DFYA 3P09A 3T4KA 3BFFA 4M3KA 5F68A 3OBFA 1L0GA 1S4RA 3IX8A 1CEGA 5M18A 1STZA 5G4YA 5G18A 1GA9A 1K55C 4OP8A 2XK1A 2FFYA 1NXYA 3BWLA 3LI9A 1QMEA 2JKTM 2V9AA 2PBYA 1RP5A 2X02A 4O7DA 3BYDA 2ZD8A 3VP4A 1NYMA 2OWJA 4UA9A 2WAFA 1HVBA 5C5KA 3RTYA 1P9WA 2KLIA 3A0VA 4ZJ2A 3HLBA 5CEBA 2NUPC 4WM9A 1ZG6A 4JXWA 3UE6A 1ES3A 3NOPC 3VP1A 3Q81A 2HDUA 2JKTI 2E8IA 4DXBA 1QMFA 3T4LA 3W4PA 3E4PA 3SH7A 3VOLA 5HDDA 4ETZA 3WS2A 1GHPA 4N9KA 3RH8B 3CJMA 1VHMA 2QWSA 3V3RA 4BL3A 2IA2A 3IF6B 1OMEA 3EGXC 3IF6A 4MN5A 1DP6A 5M1AA 4Z9QA 3NDGA 3NECA 3TE8A 1LSXA 3TW8A 5FL3A 3T4SA 5M19A 4RVAA 3O3VA 3T4TA 5HZHA 3UN7A 1K38A 1D1JA 2XA7S 4OPYA 1FR1A 1S67L 1PW8A 5HDSA 2H5SA 2Q9MA 2O99A 4JLFA 5A92A 4X56A 4Y0OA 2HP6A 3FWLA 5EVLA 2VK3A 4NEED 3SH9A 2PU4A 3F1NA 4JPMA 2J3TD 5AJGA 5GLCA 4FCFA 3UNWA 3H82A 2Q0OA 5D3OA 2WKIA 1G5UA 2ZQCA 3WS4A 5FSRA 3GV9A 3MQ0A 1XFQA 4GD6A 3P7NA 1LHYA 3DW0A 1Q2QA 5J3WA 2ZQ7A 3C8CA 3CUEC 1ZG4A 4KZ7A 1SDNA 1K4EA 1N4OA 2V8FA 4LCLA 3CG5A 3B3XA 4HY8A 5DF7A 2I9VA 1DP9A 1VETB 2QJ7A 2W3HA 2GJ3A 3BQAA 4X69A 3F1OB 2NUTC 2O9AA 2WGIA 4R38A 1K57C 1PZOA 1TS7A 3UDFA 3L7HA 3CPTB 4K91A 2Y2NA 3F1NB 3LFVA 1MKIA 4UQIM 4QHCA 3ZDJA 4ZTKA 1WE4A 3C30A 1RGZA 1TDLA 3IF6C 2JKGA 2OLUA 4LRXC 5FAPA 3IWQA 5A91A 1J9MA 3VOZA 5CTMA 4EQ1A 5L10A 1N9BA 1KE0A 1SHVA 2V20A 3G31A 4CLCA 3CAXA 1KOUA 1A0KA 2PYPA 4S2LA 4EU0A 4B93A 2ZOIA 2V1AA 4G3WA 4E3MA 1XJ2A 5EOOA 3GQZA 3CI6A 2VZWA 4WEJA 5EVIB 4S2NC 3NBLA 5CGSA 1SDEA 3CMZA 1ES2A 1MY8A 5CTNA 4BBTA 2A2LA 2DRWA 4HQAA 4E3OA 4HJ3A 3S7QA 1V9ZA 4HBUA 1K55A 4WLAA 3VP0A 1K54C 4MBKA 4R0QA 5KMWA 3GDIA 1CJFA 4WN5A 5IU1A 3JVUA 1GSXA 3ZFZA 3DAVA 2AVXA 3A3IA 4NXGA 3QP2A 2JE5A 4D60A 1KVLA 3C2WA 3SW1A 4EV4A 4KQQA 4F3LB 4GKUA 4ME4A 2PYRA 4WYYA 1GSWA 4JXVA 1GA0A 3PHYA 3D9YA 5GHXA 3ZG9B 4E3NA 2WKEA 4HBTA 5F6AA 4IVKA 4GB7A 2EX8A 2XR0A 3KO6A 3PBSA 2QZ6A 2XH9A 2HJ9C 3LGOA 1IYSA 2W0NA 5HAQA 4DXCA 4KQRA 3ZVWA 3HUNA 1BLSA 4HHDA 1OTIA 2J7VA 5GHZA 3VFHA 2ZC7A 4P6BA 2WZZA 3E4OA 1H8YA 4I3JA 5DFXA 2Y2GA 4PM5A 4U3TA 1SKOB 1ES4A 1KE3A 1SKOA 4XT2A 3MZFA 3JYIA 1FILA 4C3QA 5KIZA 3UB8A 2K31A 1MXOA 2HDQA 3HLCA 5DJUA 4OVDA 4OPZA 3A3FA 1M6KA 4S2KA 4A5RA 2Y2KA 3G30A 1S4SA 1OJ5A 2XFSA 1FCMA 3C38A 3HLDA 1FIKA 3MZEA 3G6OA 3UPOA 2O9CA 4KG5A 1G6AA 1ACFA 2A3UA 4YWZA 1F5MA 1JTDA 5L09A 1W63M 4PMAA 3UB5P 4JGPA 4WZ5C 4N9LA 2D02A 5HPFA 1JWZA 2Z6CA 3ZHHA 1YM1A 1OT9A 3IF5A 3M6BA 1G68A 4IVIA 3Q7VB 2ZQDA 3K3DA 4U0XA 5KSCA 5EPHA 2V1ZA 4DN0A 2ZC3B 2YKFA 2XEPA 4LGWA 3VP2A 5E2HA 2EXBA 1W8YA 4C75A 2ZOHA 4R70A 2XA7M 3GRJA 5A93A 3UDIA 4S2IA 5L07A 2P9VA 1FOFA 1CQAA 2PRFA 3IBRA 2P9VB 2B18A 4FTXA 2J9OA 5DTKA 3H7WB 2HGVA 3S22A 1ESUA 4H6JA 4Y0UA 1VEUB 3NOUC 2HP5A 5HWTA 3FKVA 5GL9A 2Y55A 1N9OA 1LL9A 2HZ5A 1KVMA 2VGKA 3QP1A 2J8YA 1W63Q 4E3JA 2WGVA 4GNUA 1L0DA 2FZ0A 3ZNYA 1NZUA 3VMAA 3GSGA 3T1RA 3KSHA 2WAEA 3K3CA 2ZBBA 1E4DA 4S2OA 1NYYA 1Z09A 1GSVA 2P7JA 1XA1A 1J3WA 3G2ZA 4D2OA 3P01A 4MN7A 4E6WA 1IYPA 1PZPA 1WYBA 3LIDA 5FA7A 5HWVA 2L1MA 2A24B 1XJ4A 2VV7A 4JKTA 4K0WA 5CHMA 4DRTA 3W2ZA 3QNBA 2GDNA 2A49A 2W1TA 3BFCA 4EETB 2W3EA 2Z2LB 5J7EA 4MLLA 1IFQA 4KQOA 3Q7ZA 5HSQA 3I7JA 4GD8A 1SKFA 4EBNA 2DCFA 3LY4A 2V1BA 4Y7PA 1MWTA 2B02A 3RXXA 2HDRA 2WKHA 1ODVA 4QJGA 1TS6A 1ONHA 1P97A 1HD8A 3ZCZA 2KOIA 2A24A 4MBFA 3ZQ5A 1H3QA 5A90A 3IS2B 2Y2OA 4HNBA 4I5SA 3SH8A 1FCOA 3LR0A 3FC7A 5F1GA 3A3EA 1ES5A 1MPLA 1BUEA 1YLJA 3LY3A 3T50A 4FH4A 4G3KA 5EECA 3OLOA 5EV0A 2EFXA 2ZQ9A 3A3JA 5DKKA 2BG1A 5FDHA 4X55A 3VFFA 2HJEA 3QP8A 4C6YA 4PKYG 3V39A 1YMSA 1D06A 5HDCA 2J80A 3NI9A 4X6TA 1DJBA 3IWIA 1F9IA 4LV2A 1SCWA 3OOVA 2Y2MA 4JBFA 3B33A 3IH8A 4UA6A 2K7SA 4OQGA 3OPRA 3CWFA 4S2PA 2W3DA 1TS0A 4QWOA 1YMXA 2X01A 2YKHA 3FG8A 4OLGA 1WYCA 4N1HA 3MMHA 4JGOA 2XD1A 3MXRA 4R3AA 1RCJA 2HV1A 2ZM2A 2EX2A 1MC0A 3U4LP 4KENB 3UPPA 4WF0A 3IX4A 3FKWA 3TSGA 4NXEA 1MWRA 4KZBA 1KDSA 1UWNX 2ZQAA 4GJ4A 4NXFA 1XP4A 2V2FF 1OTDA 4RQ9A 1IYQA 1Z6FA 3BJNA 3UB9A 3D3OA 3DWKA 2UV0E 4GDBA 4KZ3A 1K25A 3IHBA 3A0RA 4EXOA 1TDGA 3LCEA 2Z6DA 3N8RA 2J3TC 4EERA 5EVID 5MC7A 5FQ9A 3B47A 4QY5A 3PYPA 4DDYA 3MS6A 4P85A 5HL6A 2OV5A 4FH2A 3LIBA 4E3IA 3ZVTA 3BECA 4Y17A 3RFBA 4EQIA 1F2KA 1NRFA 4ZBEA 3N4IA 5FI7A 4F94A 5GHYA 2EWWA 4MEZA 2INWA 1E3UA 4RX3A 3R7WA
chains in the Genus database with same CATH topology
1IYSA 3D4FA 2WGWA 3UY6A 5GLBA 5KSHA 5EVIC 5HAQA 3QHYA 2C5WB 3GMWA 5F82A 4DXCA 5E2EA 4KQRA 3ZVWA 3HUNA 1BLSA 3IQAA 1E25A 1IKGA 2J7VA 5GHZA 3VFHA 4QY6A 2ZC7A 3HL9A 1MWSA 2IWBA 4DE1A 3PAGA 3G34A 3OZHA 4OQIA 4P6BA 2WZZA 1HZOA 3C5AA 4LENA 5FQJA 1BZAA 4KZ5A 3MZDA 1H8YA 3IXHA 3CZDA 3OPPA 2Y2GA 4PM5A 1KGFA 2Y59A 4U3TA 3GR2A 3HUOA 4P87A 3M2KA 1K56D 4FD8A 1IELA 4BQMA 1ES4A 4R4RA 5BOHA 4X68A 1KE3A 2P74A 3SS5A 3AGEA 3MZFA 1MBLA 3JYIA 2DNSA 3OPHA 1ESIA 3NCKA 4C3QA 5HW3A 2WZXA 3HLWA 4UA7A 1FSYA 4YFMA 5CGWA 4EUZA 5FATA 1K4FA 4WELA 4BL2A 3G32A 1MXOA 2HDQA 4OLDA 2Y4AA 4OH0A 3HLCA 5JYOA 1K6SA 4BLMA 4OVDA 2QMIA 4OPZA 2Q9NA 3BFGA 3VSLA 3A3FA 3IXBA 1ONGA 1M6KA 3HLFA 3BFDA 4S2KA 4A5RA 2Y2KA 3G30A 3NY4A 5DF9A 3A3DA 3HBRA 5HL1A 3UPNA 1MWUA 1YLPA 4JXSA 2ZJ9A 2XFSA 1FCMA 4QB8A 4XUXA 1EROA 3HLDA 4IBXA 3OPLA 3MZEA 4N1XA 1YT4A 5FQIA 3ZGAB 1DY6A 4ZDXA 1PI4A 1W5DA 4WEKA 3UPOA 2VGJA 2XLNA 5U47A 1EWZA 2PU2A 3FZCA 4FSFA 5E2FA 3S4XA 1PWCA 4KG5A 5FAQA 4EBPA 1G6AA 2H0TA 4IBRA 2A3UA 2Z2MB 4KZ9A 1JTGA 1BLCA 1JTDA 4KZ8A 2FFFB 3BEBA 3HLGA 2Y2LA 1FR6A 1LI9A 4YINA 4S2MA 4PMAA 5JYPA 4WZ5C 3LO7A 4PM9A 4HEFA 3OCLA 4ZJ1A 4GDNA 4JF6A 3RJUA 2Y2HA 1PIOA 4N9LA 3MBZA 2HP9A 5L2FA 2IWCA 4S2NA 1XGJA 3V3SA 3ZG7B 1BSGA 1JWZA 4RX2A 4QD4A 1XKZA 3ZHHA 1YM1A 2ZM0A 2Y91A 3IF5A 3M6BA 1G68A 1JWPA 4R1GA 1LLBA 1YQSA 3Q7VB 1YLWA 2ZQDA 4IVIA 5TGFA 3ZG8B 3HREA 2Y2QA 4U0XA 3WRZA 1ALQA 1PI5A 4UHUA 3WWXA 3PBRA 5EPHA 2V1ZA 5HX9A 5KSCA 1PYYA 2ZC3B 4XXRA 3PBQA 2WK0A 1XA7A 2XEPA 3MKFA 4RA7A 2ZM8A 3VP2A 3O86A 5E2HA 5CXWA 4WMCD 2OLVA 4JF4A 3Q1FA 1IKIA 4E6XA 2EXBA 1DJCA 1W8YA 4C75A 3IXGA 5CERA 3V5MA 2ZLYA 1H5XA 3UE0A 2R9WA 1I2WA 1C3BA 3GRJA 1GCEA 5A93A 3UDIA 4S2IA 3ZG0A 3UE1A 2P9VA 1FOFA 2ZMAA 4IEDA 3BLMA 2I72A 2XDMA 2P9VB 2J9OA 4ZJ3A 5DTKA 4KZAA 2RL3A 3DWZA 3V50A 4Q8IA 5EUAA 2B5RA 3ITBA 3UO9A 2EX6A 1YLZA 3IT9A 5CHJA 3P09A 3S22A 2H10A 3BFFA 3BRMA 1ESUA 1K57A 5E2GA 4M3KA 4WMCA 4Y0UA 4DF6A 4B4XA 5CEDA 1L0GA 1L2SA 2HP5A 2J9PA 3UDXA 3FKVA 5GL9A 2Y55A 1CEGA 3LEZA 3NIAA 4OONA 4BJPA 5M18A 1LL9A 1KE4A 3HVFA 1GA9A 2BLSA 5G18A 1K55C 2JBFA 1KVMA 2VGKA 2X71A 2J8YA 2Y2IA 4OP8A 1BTLA 2WGVA 4E3JA 4GNUA 2XK1A 1L0DA 5AQBA 3ZNYA 3TG9A 1NZUA 2FFYA 3GSGA 2EX9A 1NXYA 3VMAA 1VQQA 1QMEA 3TOIA 2WAEA 1XGIA 2PBYA 4JF5A 3NC8A 1RP5A 1E4DA 2X02A 4S2OA 1NYYA 1PWGA 2IWDA 5FQQA 4O7DA 3BYDA 3QNCA 4BENA 2ZD8A 3VP4A 1KDWA 3HLEA 3N8LA 1XA1A 4PPRA 1NYMA 4UA9A 2EXAA 2WAFA 1HVBA 4KG6A 3E2KA 4LCMA 5GLAA 3UE3A 2XGNA 2XQZA 1TVFA 3G2ZA 5FI2A 4ZJ2A 3C7UA 4D2OA 3HLBA 4P0MA 4KZ6A 5CEBA 4E6WA 1IYPA 1PZPA 1WYBA 2HPBA 4B4ZA 3Q07A 4WM9A 5FA7A 3BLSA 1ZG6A 2CC1A 4JXWA 1CEFA 1XX2A 1ES3A 3OC2A 4LV3A 3VP1A 1O7EA 2OSUA 3Q81A 2HDUA 3G4PA 2E8IA 4OOLA 5AQAA 4DXBA 2XF3A 3MKEA 1QMFA 4OOMA 4JKTA 4H8RA 1EI5A 2G2UA 3PTEA 4K0WA 3W4PA 3SH7A 2ZC4B 2C6WB 3O88A 4EBLA 5F1FA 3P98A 5GLDA 3WS2A 5CHMA 1H8ZA 3C4OA 1GHPA 4N9KA 4OP5A 3CJMA 2Y2PA 1ZKJA 4DRTA 4DE0A 4EWFA 3E2LA 3VSKA 3V3RA 3QNBA 2GDNA 2A49A 5HAIA 4BL3A 1HTZA 1CK3A 4GN2A 3IF6B 3ISGA 3BFCA 2Z2LB 1OMEA 3IF6A 4MLLA 5FQKA 5CECA 3M6HA 4OQ0A 3PBTA 5M1AA 4KQOA 4Z9QA 3Q7ZA 3NDGA 3I7JA 4GD8A 2R9XA 1SKFA 3ITAA 2DCFA 4EBNA 3LY4A 3PAEA 4S2JA 4Y7PA 1GHMA 3SS4A 1MWTA 5TR7A 4R3BA 1FSWA 1BT5A 3O87A 2HDRA 4WZ5A 5DTTA 2WKHA 3RXXA 5M19A 4RVAA 3SOIA 2HDSA 3GVBA 3O3VA 1W8QA 4QJGA 3SS3A 1ONHA 4OQHA 3UN7A 5E43A 1K38A 3ZCZA 1HD8A 2WGWB 4OPYA 4JXGA 1U60A 2ZC6B 3MXSA 4R23A 4KZ4A 4N92A 4PM7A 5FI6A 4MBFA 1FR1A 3IHAA 4UAAA 1PW8A 1XPBA 3ZNTA 2H5SA 2Q9MA 1GHIA 4HESA 5A90A 4JLFA 5A92A 1PWDA 4LV0A 4X56A 4Y0OA 1S0WA 2HP6A 2Y2OA 3FWLA 3N7WA 5EE8A 3AGFA 5EVLA 3SH8A 1FCOA 2ZC5B 3SH9A 2PU4A 5HAPA 4ID4A 4JPMA 1DJAA 1Y54A 1ERMA 1K56A 2RCXA 5DTSA 4FCFA 5GLCA 5F1GA 3A3EA 3UNWA 2H0YA 1ES5A 1MPLA 1BUEA 2JC7A 5D3OA 2G2WA 4WZ4A 2WKIA 3WS0A 1YLJA 3LY3A 1KGEA 2ZQCA 3WS4A 5FSRA 3FYZA 3GV9A 4GD6A 4QU3A 3S1YA 1LHYA 3DW0A 1VM1A 4BD1A 1I2SA 1Q2QA 4FH4A 4R4SA 4XUZA 5EECA 1RGYA 3AGDA 5CRFA 5AQ9A 2EFXA 2ZQ9A 4E3LA 2ZQ7A 1L0EA 1ZG4A 3A3JA 4KZ7A 3ZG5A 1SDNA 1I5QA 1K4EA 1N4OA 4LCLA 2BG1A 5FDHA 3CG5A 3IH9A 5EOEA 3B3XA 4PM6A 4WBGA 4X55A 5DF7A 3EQUA 3VFFA 1FCNA 4LV1A 1BULA 1BLHA 2UWXA 4C6YA 5DVAA 4X69A 3V39A 3WRTA 1NJ4A 1K54A 4NETA 3C4PA 2WGIA 1YMSA 2XFTA 1K57C 1PZOA 2EFUA 1S6RA 3RXWA 1W7FA 3NI9A 4X6TA 3IXDA 1DJBA 3HUMA 3N8SA 2QPNA 3VOYA 1KGGA 3IWIA 3UDFA 4LV2A 1SCWA 4K91A 2Y2NA 2Y2MA 5FASA 4JBFA 1MKIA 4QHCA 3IH8A 4K0XA 2XD5A 4UA6A 3ZDJA 1JVJA 3BM6A 4L0LA 4ZTKA 1WE4A 3OPRA 4OPRA 3MFDA 4OQGA 1RGZA 1TDLA 3IF6C 4S2PA 4OKPA 1ZC2A 5EVIA 2OLUA 1YMXA 3N6IA 4GOGA 2X01A 5KZHA 5J8XA 3EQVA 5FAPA 2WYXA 3IWQA 5A91A 4OLGA 1J9MA 3VOZA 1WYCA 4KG2A 5CTMA 4N1HA 4CPKA 1N9BA 1KE0A 1SHVA 2V20A 3G2YA 4DE2A 3G31A 2XD1A 3MXRA 1IYOA 1RCJA 5AQ7A 4OPQA 4DKIA 4DE3A 2ZM2A 1Q2PA 4S2LA 2EX2A 4KENB 4E3MA 3FV7A 3UPPA 5EOOA 3GQZA 1YLYA 2Y2JA 3FKWA 4WEJA 5EVIB 3TSGA 4S2NC 3NBLA 3M2JA 1MWRA 5CGSA 4X53A 3G35A 1SDEA 4KZBA 1O07A 2WUQA 1ES2A 1MY8A 3C7VA 3CMZA 1KDSA 5CTNA 3IWOA 5TFQA 2DRWA 1YLTA 1XXMA 2ZQAA 4E3OA 4ZAMA 1NZOA 4RYEA 3W8KA 1XP4A 5IHVA 2V2FF 1BLPA 4HBUA 3W4QA 1K55A 1IYQA 1Z6FA 2JCHA 5DF8A 3VP0A 1K54C 4GZBA 3DWKA 4MBKA 1CI8A 4GDBA 4R0QA 4KZ3A 4MNRA 5FQMA 1M40A 2ZQ8A 4BD0A 5KMWA 1K25A 1LL5A 3IHBA 3Q82A 1K6RA 1TDGA 1AXBA 3LCEA 3PBOA 3ZFZA 3N8RA 5CGXA 1L0FA 3Q7VA 3A3IA 4Y0TA 3DTMA 3BFEA 5CHUA 2JE5A 5EVID 3VP3A 1KVLA 1IEMA 2WADA 5FQ9A 4B88A 5F83A 1LI0A 4QY5A 4KQQA 4DDYA 3WS1A 4EV4A 4P85A 1NY0A 4GKUA 3PBNA 3WS5A 4CJNA 2OV5A 4FH2A 5FAOA 4MBHA 1FQGA 1CI9A 3GTCA 4WYYA 3ZVTA 4DDSA 4E3IA 1W79A 3BECA 4R3JA 4E3KA 4JXVA 1GA0A 1PW1A 4NK3A 4PM8A 4EQIA 3NDEA 5GHXA 3ZG9B 4OOYA 1NRFA 4ZBEA 3N4IA 5HFOA 4E3NA 5FI7A 2WKEA 4HBTA 3OCNA 4F94A 4IVKA 4GB7A 1ERQA 2EX8A 5GHYA 2XR0A 5I94A 5HARA 3PBSA 2QZ6A 1JWVA 4MEZA 1E3UD 2XH9A 1E3UA 4RX3A 1TEMA 4U0TA 3W4OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IYS A;  3D4F A;  2WGW A;  3UY6 A;  5GLB A;  5KSH A;  5EVI C;  5HAQ A;  3QHY A;  2C5W B;  3GMW A;  5F82 A;  4DXC A;  5E2E A;  4KQR A;  3ZVW A;  3HUN A;  1BLS A;  3IQA A;  1E25 A;  1IKG A;  2J7V A;  5GHZ A;  3VFH A;  4QY6 A;  2ZC7 A;  3HL9 A;  1MWS A;  2IWB A;  4DE1 A;  3PAG A;  3G34 A;  3OZH A;  4OQI A;  4P6B A;  2WZZ A;  1HZO A;  3C5A A;  4LEN A;  5FQJ A;  1BZA A;  4KZ5 A;  3MZD A;  1H8Y A;  3IXH A;  3CZD A;  3OPP A;  2Y2G A;  4PM5 A;  1KGF A;  2Y59 A;  4U3T A;  3GR2 A;  3HUO A;  4P87 A;  3M2K A;  1K56 D;  4FD8 A;  1IEL A;  4BQM A;  1ES4 A;  4R4R A;  5BOH A;  4X68 A;  1KE3 A;  2P74 A;  3SS5 A;  3AGE A;  3MZF A;  1MBL A;  3JYI A;  2DNS A;  3OPH A;  1ESI A;  3NCK A;  4C3Q A;  5HW3 A;  2WZX A;  3HLW A;  4UA7 A;  1FSY A;  4YFM A;  5CGW A;  4EUZ A;  5FAT A;  1K4F A;  4WEL A;  4BL2 A;  3G32 A;  1MXO A;  2HDQ A;  4OLD A;  2Y4A A;  4OH0 A;  3HLC A;  5JYO A;  1K6S A;  4BLM A;  4OVD A;  2QMI A;  4OPZ A;  2Q9N A;  3BFG A;  3VSL A;  3A3F A;  3IXB A;  1ONG A;  1M6K A;  3HLF A;  3BFD A;  4S2K A;  4A5R A;  2Y2K A;  3G30 A;  3NY4 A;  5DF9 A;  3A3D A;  3HBR A;  5HL1 A;  3UPN A;  1MWU A;  1YLP A;  4JXS A;  2ZJ9 A;  2XFS A;  1FCM A;  4QB8 A;  4XUX A;  1ERO A;  3HLD A;  4IBX A;  3OPL A;  3MZE A;  4N1X A;  1YT4 A;  5FQI A;  3ZGA B;  1DY6 A;  4ZDX A;  1PI4 A;  1W5D A;  4WEK A;  3UPO A;  2VGJ A;  2XLN A;  5U47 A;  1EWZ A;  2PU2 A;  3FZC A;  4FSF A;  5E2F A;  3S4X A;  1PWC A;  4KG5 A;  5FAQ A;  4EBP A;  1G6A A;  2H0T A;  4IBR A;  2A3U A;  2Z2M B;  4KZ9 A;  1JTG A;  1BLC A;  1JTD A;  4KZ8 A;  2FFF B;  3BEB A;  3HLG A;  2Y2L A;  1FR6 A;  1LI9 A;  4YIN A;  4S2M A;  4PMA A;  5JYP A;  4WZ5 C;  3LO7 A;  4PM9 A;  4HEF A;  3OCL A;  4ZJ1 A;  4GDN A;  4JF6 A;  3RJU A;  2Y2H A;  1PIO A;  4N9L A;  3MBZ A;  2HP9 A;  5L2F A;  2IWC A;  4S2N A;  1XGJ A;  3V3S A;  3ZG7 B;  1BSG A;  1JWZ A;  4RX2 A;  4QD4 A;  1XKZ A;  3ZHH A;  1YM1 A;  2ZM0 A;  2Y91 A;  3IF5 A;  3M6B A;  1G68 A;  1JWP A;  4R1G A;  1LLB A;  1YQS A;  3Q7V B;  1YLW A;  2ZQD A;  4IVI A;  5TGF A;  3ZG8 B;  3HRE A;  2Y2Q A;  4U0X A;  3WRZ A;  1ALQ A;  1PI5 A;  4UHU A;  3WWX A;  3PBR A;  5EPH A;  2V1Z A;  5HX9 A;  5KSC A;  1PYY A;  2ZC3 B;  4XXR A;  3PBQ A;  2WK0 A;  1XA7 A;  2XEP A;  3MKF A;  4RA7 A;  2ZM8 A;  3VP2 A;  3O86 A;  5E2H A;  5CXW A;  4WMC D;  2OLV A;  4JF4 A;  3Q1F A;  1IKI A;  4E6X A;  2EXB A;  1DJC A;  1W8Y A;  4C75 A;  3IXG A;  5CER A;  3V5M A;  2ZLY A;  1H5X A;  3UE0 A;  2R9W A;  1I2W A;  1C3B A;  3GRJ A;  1GCE A;  5A93 A;  3UDI A;  4S2I A;  3ZG0 A;  3UE1 A;  2P9V A;  1FOF A;  2ZMA A;  4IED A;  3BLM A;  2I72 A;  2XDM A;  2P9V B;  2J9O A;  4ZJ3 A;  5DTK A;  4KZA A;  2RL3 A;  3DWZ A;  3V50 A;  4Q8I A;  5EUA A;  2B5R A;  3ITB A;  3UO9 A;  2EX6 A;  1YLZ A;  3IT9 A;  5CHJ A;  3P09 A;  3S22 A;  2H10 A;  3BFF A;  3BRM A;  1ESU A;  1K57 A;  5E2G A;  4M3K A;  4WMC A;  4Y0U A;  4DF6 A;  4B4X A;  5CED A;  1L0G A;  1L2S A;  2HP5 A;  2J9P A;  3UDX A;  3FKV A;  5GL9 A;  2Y55 A;  1CEG A;  3LEZ A;  3NIA A;  4OON A;  4BJP A;  5M18 A;  1LL9 A;  1KE4 A;  3HVF A;  1GA9 A;  2BLS A;  5G18 A;  1K55 C;  2JBF A;  1KVM A;  2VGK A;  2X71 A;  2J8Y A;  2Y2I A;  4OP8 A;  1BTL A;  2WGV A;  4E3J A;  4GNU A;  2XK1 A;  1L0D A;  5AQB A;  3ZNY A;  3TG9 A;  1NZU A;  2FFY A;  3GSG A;  2EX9 A;  1NXY A;  3VMA A;  1VQQ A;  1QME A;  3TOI A;  2WAE A;  1XGI A;  2PBY A;  4JF5 A;  3NC8 A;  1RP5 A;  1E4D A;  2X02 A;  4S2O A;  1NYY A;  1PWG A;  2IWD A;  5FQQ A;  4O7D A;  3BYD A;  3QNC A;  4BEN A;  2ZD8 A;  3VP4 A;  1KDW A;  3HLE A;  3N8L A;  1XA1 A;  4PPR A;  1NYM A;  4UA9 A;  2EXA A;  2WAF A;  1HVB A;  4KG6 A;  3E2K A;  4LCM A;  5GLA A;  3UE3 A;  2XGN A;  2XQZ A;  1TVF A;  3G2Z A;  5FI2 A;  4ZJ2 A;  3C7U A;  4D2O A;  3HLB A;  4P0M A;  4KZ6 A;  5CEB A;  4E6W A;  1IYP A;  1PZP A;  1WYB A;  2HPB A;  4B4Z A;  3Q07 A;  4WM9 A;  5FA7 A;  3BLS A;  1ZG6 A;  2CC1 A;  4JXW A;  1CEF A;  1XX2 A;  1ES3 A;  3OC2 A;  4LV3 A;  3VP1 A;  1O7E A;  2OSU A;  3Q81 A;  2HDU A;  3G4P A;  2E8I A;  4OOL A;  5AQA A;  4DXB A;  2XF3 A;  3MKE A;  1QMF A;  4OOM A;  4JKT A;  4H8R A;  1EI5 A;  2G2U A;  3PTE A;  4K0W A;  3W4P A;  3SH7 A;  2ZC4 B;  2C6W B;  3O88 A;  4EBL A;  5F1F A;  3P98 A;  5GLD A;  3WS2 A;  5CHM A;  1H8Z A;  3C4O A;  1GHP A;  4N9K A;  4OP5 A;  3CJM A;  2Y2P A;  1ZKJ A;  4DRT A;  4DE0 A;  4EWF A;  3E2L A;  3VSK A;  3V3R A;  3QNB A;  2GDN A;  2A49 A;  5HAI A;  4BL3 A;  1HTZ A;  1CK3 A;  4GN2 A;  3IF6 B;  3ISG A;  3BFC A;  2Z2L B;  1OME A;  3IF6 A;  4MLL A;  5FQK A;  5CEC A;  3M6H A;  4OQ0 A;  3PBT A;  5M1A A;  4KQO A;  4Z9Q A;  3Q7Z A;  3NDG A;  3I7J A;  4GD8 A;  2R9X A;  1SKF A;  3ITA A;  2DCF A;  4EBN A;  3LY4 A;  3PAE A;  4S2J A;  4Y7P A;  1GHM A;  3SS4 A;  1MWT A;  5TR7 A;  4R3B A;  1FSW A;  1BT5 A;  3O87 A;  2HDR A;  4WZ5 A;  5DTT A;  2WKH A;  3RXX A;  5M19 A;  4RVA A;  3SOI A;  2HDS A;  3GVB A;  3O3V A;  1W8Q A;  4QJG A;  3SS3 A;  1ONH A;  4OQH A;  3UN7 A;  5E43 A;  1K38 A;  3ZCZ A;  1HD8 A;  2WGW B;  4OPY A;  4JXG A;  1U60 A;  2ZC6 B;  3MXS A;  4R23 A;  4KZ4 A;  4N92 A;  4PM7 A;  5FI6 A;  4MBF A;  1FR1 A;  3IHA A;  4UAA A;  1PW8 A;  1XPB A;  3ZNT A;  2H5S A;  2Q9M A;  1GHI A;  4HES A;  5A90 A;  4JLF A;  5A92 A;  1PWD A;  4LV0 A;  4X56 A;  4Y0O A;  1S0W A;  2HP6 A;  2Y2O A;  3FWL A;  3N7W A;  5EE8 A;  3AGF A;  5EVL A;  3SH8 A;  1FCO A;  2ZC5 B;  3SH9 A;  2PU4 A;  5HAP A;  4ID4 A;  4JPM A;  1DJA A;  1Y54 A;  1ERM A;  1K56 A;  2RCX A;  5DTS A;  4FCF A;  5GLC A;  5F1G A;  3A3E A;  3UNW A;  2H0Y A;  1ES5 A;  1MPL A;  1BUE A;  2JC7 A;  5D3O A;  2G2W A;  4WZ4 A;  2WKI A;  3WS0 A;  1YLJ A;  3LY3 A;  1KGE A;  2ZQC A;  3WS4 A;  5FSR A;  3FYZ A;  3GV9 A;  4GD6 A;  4QU3 A;  3S1Y A;  1LHY A;  3DW0 A;  1VM1 A;  4BD1 A;  1I2S A;  1Q2Q A;  4FH4 A;  4R4S A;  4XUZ A;  5EEC A;  1RGY A;  3AGD A;  5CRF A;  5AQ9 A;  2EFX A;  2ZQ9 A;  4E3L A;  2ZQ7 A;  1L0E A;  1ZG4 A;  3A3J A;  4KZ7 A;  3ZG5 A;  1SDN A;  1I5Q A;  1K4E A;  1N4O A;  4LCL A;  2BG1 A;  5FDH A;  3CG5 A;  3IH9 A;  5EOE A;  3B3X A;  4PM6 A;  4WBG A;  4X55 A;  5DF7 A;  3EQU A;  3VFF A;  1FCN A;  4LV1 A;  1BUL A;  1BLH A;  2UWX A;  4C6Y A;  5DVA A;  4X69 A;  3V39 A;  3WRT A;  1NJ4 A;  1K54 A;  4NET A;  3C4P A;  2WGI A;  1YMS A;  2XFT A;  1K57 C;  1PZO A;  2EFU A;  1S6R A;  3RXW A;  1W7F A;  3NI9 A;  4X6T A;  3IXD A;  1DJB A;  3HUM A;  3N8S A;  2QPN A;  3VOY A;  1KGG A;  3IWI A;  3UDF A;  4LV2 A;  1SCW A;  4K91 A;  2Y2N A;  2Y2M A;  5FAS A;  4JBF A;  1MKI A;  4QHC A;  3IH8 A;  4K0X A;  2XD5 A;  4UA6 A;  3ZDJ A;  1JVJ A;  3BM6 A;  4L0L A;  4ZTK A;  1WE4 A;  3OPR A;  4OPR A;  3MFD A;  4OQG A;  1RGZ A;  1TDL A;  3IF6 C;  4S2P A;  4OKP A;  1ZC2 A;  5EVI A;  2OLU A;  1YMX A;  3N6I A;  4GOG A;  2X01 A;  5KZH A;  5J8X A;  3EQV A;  5FAP A;  2WYX A;  3IWQ A;  5A91 A;  4OLG A;  1J9M A;  3VOZ A;  1WYC A;  4KG2 A;  5CTM A;  4N1H A;  4CPK A;  1N9B A;  1KE0 A;  1SHV A;  2V20 A;  3G2Y A;  4DE2 A;  3G31 A;  2XD1 A;  3MXR A;  1IYO A;  1RCJ A;  5AQ7 A;  4OPQ A;  4DKI A;  4DE3 A;  2ZM2 A;  1Q2P A;  4S2L A;  2EX2 A;  4KEN B;  4E3M A;  3FV7 A;  3UPP A;  5EOO A;  3GQZ A;  1YLY A;  2Y2J A;  3FKW A;  4WEJ A;  5EVI B;  3TSG A;  4S2N C;  3NBL A;  3M2J A;  1MWR A;  5CGS A;  4X53 A;  3G35 A;  1SDE A;  4KZB A;  1O07 A;  2WUQ A;  1ES2 A;  1MY8 A;  3C7V A;  3CMZ A;  1KDS A;  5CTN A;  3IWO A;  5TFQ A;  2DRW A;  1YLT A;  1XXM A;  2ZQA A;  4E3O A;  4ZAM A;  1NZO A;  4RYE A;  3W8K A;  1XP4 A;  5IHV A;  2V2F F;  1BLP A;  4HBU A;  3W4Q A;  1K55 A;  1IYQ A;  1Z6F A;  2JCH A;  5DF8 A;  3VP0 A;  1K54 C;  4GZB A;  3DWK A;  4MBK A;  1CI8 A;  4GDB A;  4R0Q A;  4KZ3 A;  4MNR A;  5FQM A;  1M40 A;  2ZQ8 A;  4BD0 A;  5KMW A;  1K25 A;  1LL5 A;  3IHB A;  3Q82 A;  1K6R A;  1TDG A;  1AXB A;  3LCE A;  3PBO A;  3ZFZ A;  3N8R A;  5CGX A;  1L0F A;  3Q7V A;  3A3I A;  4Y0T A;  3DTM A;  3BFE A;  5CHU A;  2JE5 A;  5EVI D;  3VP3 A;  1KVL A;  1IEM A;  2WAD A;  5FQ9 A;  4B88 A;  5F83 A;  1LI0 A;  4QY5 A;  4KQQ A;  4DDY A;  3WS1 A;  4EV4 A;  4P85 A;  1NY0 A;  4GKU A;  3PBN A;  3WS5 A;  4CJN A;  2OV5 A;  4FH2 A;  5FAO A;  4MBH A;  1FQG A;  1CI9 A;  3GTC A;  4WYY A;  3ZVT A;  4DDS A;  4E3I A;  1W79 A;  3BEC A;  4R3J A;  4E3K A;  4JXV A;  1GA0 A;  1PW1 A;  4NK3 A;  4PM8 A;  4EQI A;  3NDE A;  5GHX A;  3ZG9 B;  4OOY A;  1NRF A;  4ZBE A;  3N4I A;  5HFO A;  4E3N A;  5FI7 A;  2WKE A;  4HBT A;  3OCN A;  4F94 A;  4IVK A;  4GB7 A;  1ERQ A;  2EX8 A;  5GHY A;  2XR0 A;  5I94 A;  5HAR A;  3PBS A;  2QZ6 A;  1JWV A;  4MEZ A;  1E3U D;  2XH9 A;  1E3U A;  4RX3 A;  1TEM A;  4U0T A;  3W4O A; 
#chains in the Genus database with same CATH topology
 2WGW A;  3UB7 A;  2EA9 A;  5F82 A;  1LT0 A;  4Y15 A;  2DMW A;  1YKD A;  1MWS A;  4DE1 A;  2JHE A;  3PAG A;  1S66 L;  3OZH A;  1HZO A;  3C5A A;  4LEN A;  5FQJ A;  2VA0 A;  3OPP A;  1T19 A;  2Y59 A;  3HUO A;  4P87 A;  1YPR A;  4R4R A;  5BOH A;  3BY8 A;  3SS5 A;  1MBL A;  1VEU A;  2M7U A;  5HW3 A;  2WZX A;  3HLW A;  4YFM A;  4EUZ A;  5FAT A;  4BL2 A;  3FPW A;  3T1Q B;  4OH0 A;  1X0O A;  2QMI A;  3BFG A;  3VSL A;  5DF9 A;  3HBR A;  4KUK A;  3T4J A;  1MWU A;  4JXS A;  4QB8 A;  4LRZ E;  4X1M A;  4N1X A;  1K0K A;  5FQI A;  4ZDX A;  3EEA A;  1PI4 A;  2FH5 A;  1EWZ A;  2PU2 A;  3FZC A;  4FSF A;  4II7 A;  1PWC A;  1H8M A;  1XJ3 A;  2H0T A;  4KQD A;  1BLC A;  1LL8 A;  1T1B A;  3BEB A;  3HLG A;  1LI9 A;  4S2M A;  3LO7 A;  4HEF A;  3OCL A;  3IX3 A;  1Y4O A;  2Y2H A;  2HP9 A;  5L2F A;  2IWC A;  4KUO A;  3V3S A;  4IJG A;  1LSW A;  3ZG7 B;  1UGU A;  4QD4 A;  3IS2 A;  1XKZ A;  2ZM0 A;  2Y91 A;  1JWP A;  4R1G A;  3K2N A;  2JKF A;  3HRE A;  4UHU A;  4CQH A;  5HX9 A;  1D7E A;  4XXR A;  4Q0J A;  2WKQ A;  2PR5 A;  4WMC D;  2G7U A;  4JF4 A;  4ZRR A;  4E6X A;  3V5M A;  2ZLY A;  1H5X A;  3UE0 A;  3DTK A;  1GCE A;  3UE1 A;  4IED A;  2I72 A;  1N9L A;  3LIC A;  2V0W A;  4KZA A;  2RL3 A;  3DWZ A;  4Q8I A;  2OAP 1;  2EX6 A;  5CHJ A;  4L9E A;  2H10 A;  5DJT A;  3BRM A;  1K57 A;  4WMC A;  4B4X A;  1L2S A;  2J9P A;  3UDX A;  3NIA A;  2M7V A;  2VGL M;  2JBF A;  5TBM A;  1BTL A;  3TG9 A;  2EX9 A;  5K5B A;  2VGL S;  1XGI A;  4LPZ A;  5FQQ A;  3QNC A;  4L9G A;  4LRY C;  4GCZ A;  1KDW A;  4DJ2 A;  3UE3 A;  2XGN A;  1TVF A;  3C7U A;  4P0M A;  2HPB A;  4B4Z A;  3Q07 A;  2CC1 A;  4WL9 A;  1XX2 A;  4BBU A;  4O0P A;  4LV3 A;  2W1R A;  2OSU A;  3G4P A;  3KSI A;  4X25 A;  3MKE A;  4Z1W A;  5CX7 A;  4DMZ A;  2ZC4 B;  5F1F A;  3P98 A;  5GLD A;  3VE4 A;  4I3A A;  4Y13 A;  3C4O A;  4OP5 A;  5EM1 A;  2Y2P A;  1ZKJ A;  4EWF A;  3E4Q A;  3E2L A;  3VSK A;  3MJQ A;  1CK3 A;  4GN2 A;  5FQK A;  5CEC A;  3PBT A;  2R9X A;  3LEQ A;  3ITA A;  1PFL A;  2PDR A;  4S2J A;  1GHM A;  4X1L A;  4R3B A;  5EM0 A;  3GVB A;  3SS3 A;  2GZA A;  4B9O A;  2JKR M;  2QJ5 A;  2ZC6 B;  3MXS A;  4R23 A;  4KZ4 A;  4N92 A;  4UAA A;  1P0Z A;  3JVV A;  3ZNT A;  2ZL1 B;  1GHI A;  4HES A;  3PR6 A;  1PWD A;  4LV0 A;  4EW7 A;  1S0W A;  3CLO A;  1YAX A;  5I5L A;  1H0M A;  4ID4 A;  1Y54 A;  1K56 A;  1LSV A;  5DTS A;  1S1Y A;  3VV4 A;  2PBD P;  4QPR A;  3IBJ A;  2LB5 A;  3WS0 A;  1KGE A;  3FYZ A;  3S1Y A;  3U2A A;  1I2S A;  1UWP X;  1RGY A;  3LYX A;  3AGD A;  2VX8 A;  5HD3 A;  5AQ9 A;  4E3L A;  3NJA A;  3IH9 A;  4PM6 A;  4LV1 A;  1BUL A;  2UWX A;  5DVA A;  3WRT A;  3LIA A;  4NET A;  3C4P A;  2XFT A;  1S6R A;  3HUM A;  5HPI A;  3VOY A;  3MQQ A;  3O5Y A;  4ESP A;  4O8G A;  2XD5 A;  2B95 A;  3BM6 A;  4L0L A;  3MFD A;  4NXB A;  1P9R A;  4OKP A;  1V9Y A;  1T1A A;  2QYB A;  5L8M A;  1T18 A;  3N6I A;  1ZHH B;  2PHY A;  5J8X A;  2WYX A;  4LFU A;  4KG2 A;  4CPK A;  3G2Y A;  2PD8 A;  4BBV A;  4UEY A;  1IYO A;  3HCY A;  3JPU A;  5AQ7 A;  4DE3 A;  3LIF A;  4Y2F A;  1YLY A;  3KYZ A;  4JGR A;  1Y28 A;  3M2J A;  4R6L A;  3MR0 A;  3G35 A;  3HJK A;  2WUQ A;  2JN7 A;  3IWO A;  5TFQ A;  1XXM A;  2P08 A;  4ZAM A;  4Q0H A;  1BLP A;  2JCH A;  1TF1 A;  3LUQ A;  4GZB A;  1CI8 A;  4MNR A;  5FQM A;  2ZQ8 A;  1LL5 A;  1HLU P;  3Q82 A;  1AXB A;  3T4Q A;  3PBO A;  1CF0 A;  3Q7V A;  4Y0T A;  2D01 A;  3DTM A;  3BFE A;  5CHU A;  1BYW A;  3VP3 A;  1IEM A;  2WAD A;  4B88 A;  2M1C A;  2O9B A;  2VKS A;  4MBH A;  1JNU A;  3GTC A;  4DDS A;  3E98 A;  1W79 A;  4GLQ A;  4NK3 A;  1S1Z A;  3NDE A;  1ZTU A;  4OOY A;  3MF0 A;  3OCN A;  1NLY A;  3PXP A;  4MDZ A;  1ERQ A;  5TBM B;  2W3G A;  5HAR A;  1JWV A;  1OT6 A;  3MQO A;  5AVE A;  5F69 A;  5KSH A;  4I39 A;  3GMW A;  3DTI A;  5E2E A;  3EGD C;  3IQA A;  3TRC A;  1IKG A;  1NWZ A;  3HL9 A;  3EWK A;  3G34 A;  4OQI A;  4I3I A;  1BZA A;  4KZ5 A;  3MZD A;  3IXH A;  3CZD A;  3CUE A;  2R78 A;  1K56 D;  2GX5 A;  2P74 A;  4ETX A;  3OPH A;  1FSY A;  4WEL A;  3G32 A;  1OTA A;  2Y4A A;  4EEP A;  5JYO A;  1K6S A;  4BLM A;  2K2N A;  2Q9N A;  3HLF A;  3BFD A;  4MN6 A;  2W3F A;  3NY4 A;  4CLC D;  1YLP A;  2VV6 A;  5A8B A;  4Q0I A;  4YOF A;  4XUX A;  3ICY A;  1VET A;  4HIA A;  3H7W A;  4IHQ A;  3UME A;  1YT4 A;  3MFX A;  3ZGA B;  1DY6 A;  2ZMV A;  1W5D A;  3H9W A;  4WEK A;  2VGJ A;  2XLN A;  4YNR A;  3S4X A;  5E2F A;  2PR6 A;  4EBP A;  2JKR I;  3LR5 A;  4IBR A;  1JTG A;  3CPT A;  4KZ8 A;  1NRJ A;  2FFF B;  1FR6 A;  3E0Y A;  4GDN A;  3RJU A;  2PT7 A;  1PIO A;  3BQ8 A;  3MBZ A;  2OWH A;  3KSG A;  4S2N A;  1XGJ A;  1SZV A;  1BSG A;  4RX2 A;  3BW6 A;  3DBA A;  4BWI A;  2GNX A;  4IUK A;  1G6O A;  1YQS A;  2EWV A;  1YLW A;  3S7N A;  3ZG8 B;  4CLC B;  3PBQ A;  2WK0 A;  1XA7 A;  4F3L A;  4RA7 A;  1EW0 A;  2ZM8 A;  3O86 A;  5CXW A;  2OLV A;  2VV8 A;  4HP9 A;  1DJC A;  3V67 A;  5CER A;  3LI8 A;  3S7O A;  1I2W A;  1C3B A;  1XJ6 A;  3S7P A;  3BLM A;  2XDM A;  3T1S A;  3KSF A;  5AVF A;  3V50 A;  2B5R A;  3UO9 A;  1YLZ A;  4ARZ A;  1OTE A;  4ARZ B;  4Y3I A;  2KX6 A;  5E2G A;  4DF6 A;  5CED A;  3LEZ A;  4OON A;  2V8C A;  4BJP A;  4PKY A;  1KE4 A;  3HVF A;  2BLS A;  4IUH A;  4P6Z M;  4CLC E;  2X71 A;  2Y2I A;  5AQB A;  1VQQ A;  3TOI A;  3TJZ C;  4JF5 A;  3NC8 A;  4HJ6 A;  2QKP A;  3MXQ A;  4XT2 B;  3EOI A;  1PWG A;  2IWD A;  5J4E A;  5IS1 A;  4BEN A;  1DRM A;  3KYE A;  3HLE A;  3N8L A;  4PPR A;  2EXA A;  4KG6 A;  4LCM A;  5GLA A;  3E2K A;  2O0Y A;  2XQZ A;  5FI2 A;  1F98 A;  3LR4 A;  4KZ6 A;  2CMN A;  3BLS A;  2L4R A;  5G4Z A;  4HI4 A;  1CEF A;  2PD7 A;  3OC2 A;  5FDS A;  1O7E A;  1OJG A;  5EVE A;  4OOL A;  5AQA A;  2XF3 A;  4OOM A;  4H8R A;  1EI5 A;  2G2U A;  3PTE A;  2C6W B;  3O88 A;  4EBL A;  3DTE A;  4M4X A;  1TS8 A;  4PAU A;  3FPV A;  1H8Z A;  5LBR A;  3F1P A;  4DE0 A;  4MCW A;  5HAI A;  1HTZ A;  3ISG A;  4H6J B;  1WA9 A;  3ZYT A;  3M6H A;  4OQ0 A;  4EEU A;  4Y5F A;  1T1C A;  4K08 A;  3T12 B;  3PAE A;  3SS4 A;  5TR7 A;  1FSW A;  1BT5 A;  3O87 A;  4WZ5 A;  5DTT A;  3SOI A;  2HDS A;  1W8Q A;  3H82 B;  4OQH A;  5E43 A;  2WGW B;  4JXG A;  1U60 A;  3QP6 A;  4PM7 A;  5FI6 A;  3IHA A;  1XPB A;  3SZT A;  4HH2 A;  2MJ6 A;  4GS9 A;  2LB9 A;  3N7W A;  5EE8 A;  3AGF A;  2ZC5 B;  2XSS A;  5HAP A;  1DJA A;  3A0S A;  3ULF A;  1ERM A;  2RCX A;  5FEG A;  2H0Y A;  4GHI B;  3NUL A;  2JC7 A;  2G2W A;  4WZ4 A;  2H28 A;  4QU3 A;  1VM1 A;  2Y79 A;  4BD1 A;  4R4S A;  4XUZ A;  5CRF A;  3NHQ A;  2W27 A;  1L0E A;  3ZG5 A;  1I5Q A;  3BY9 A;  5EOE A;  1DP8 A;  4WBG A;  3EQU A;  4HH3 A;  1FCN A;  1BLH A;  1PNE A;  1NJ4 A;  1K54 A;  2EFU A;  2OOL A;  4GS9 B;  3RXW A;  1W7F A;  3NOT C;  3IXD A;  3N8S A;  2QPN A;  1KGG A;  1MZU A;  1TD5 A;  5FAS A;  4HOI A;  5FEF A;  3LR3 A;  4K0X A;  1JVJ A;  4HP4 A;  4GHI A;  4OPR A;  2VLG A;  5EVI A;  1ZC2 A;  2VEA A;  4GOG A;  5KZH A;  3EQV A;  3UMD A;  4DE2 A;  5DKL A;  4DJ3 A;  4OPQ A;  4DKI A;  1Q2P A;  4I38 A;  2XRN A;  4JGQ A;  3FV7 A;  2HF6 A;  2Y2J A;  4X53 A;  1O07 A;  3C7V A;  4NG2 A;  1OPX A;  1YLT A;  5EFW A;  1MKM A;  1NZO A;  4RYE A;  3T4O A;  3W8K A;  5IHV A;  3W4Q A;  5DF8 A;  2E8J A;  4EUV A;  4WUJ A;  1M40 A;  4FUW A;  4BD0 A;  4G3V A;  1K6R A;  5CGX A;  1L0F A;  1VB6 A;  5F83 A;  4NKP A;  1LI0 A;  3WS1 A;  4CLC C;  1NY0 A;  3WS5 A;  3PBN A;  4CJN A;  2W1T B;  5FAO A;  1FQG A;  1CI9 A;  4R3J A;  1L3L A;  4E3K A;  1PW1 A;  4PM8 A;  2J3W A;  2KDK A;  5HFO A;  3F1O A;  5I94 A;  1E3U D;  1TEM A;  3QP5 A;  3KX0 X;  4U0T A;  3W4O A;  3D4F A;  3UY6 A;  5GLB A;  5EVI C;  3QHY A;  2C5W B;  5HWW A;  4O01 A;  1E25 A;  4UQI S;  4QY6 A;  2IWB A;  3T1X A;  1KGF A;  3GR2 A;  4LLO B;  3M2K A;  1OTB A;  4FD8 A;  1IEL A;  4BQM A;  4X68 A;  2V0U A;  4MMN A;  4EES A;  3AGE A;  4P6Z S;  2DNS A;  1ESI A;  3NCK A;  4UA7 A;  5CGW A;  3VE3 A;  2WKR A;  1K4F A;  3R4K A;  4L9F A;  4GW9 A;  4OLD A;  2QHK A;  2L0W A;  3F1P B;  3IXB A;  1ONG A;  2WKP A;  1XFN A;  3A3D A;  5HL1 A;  3UPN A;  2ZJ9 A;  3D72 A;  1ERO A;  4IBX A;  2Y8H A;  3CIT A;  1YSQ A;  3OPL A;  4PHT A;  4BMW A;  2ZL1 A;  3EEH A;  5U47 A;  1N9N A;  5HD5 A;  3B42 A;  5FAQ A;  2Z2M B;  4KZ9 A;  3UB6 A;  2Y2L A;  4YIN A;  4E04 A;  2VJW A;  5JYP A;  4PM9 A;  2PAV P;  4ZJ1 A;  1IOU A;  4JF6 A;  5F5Y A;  3HJI A;  3L9K A;  1NLZ A;  3KYQ A;  3LIE A;  2OAQ 1;  1LLB A;  5TGF A;  2Y2Q A;  3WRZ A;  1ALQ A;  1PI5 A;  3WWX A;  3PBR A;  2BAS A;  1PYY A;  2XRO A;  2ZMF A;  5IT5 A;  2BTF P;  3MKF A;  3QP4 A;  1G28 A;  2P04 A;  5TJJ A;  3Q1F A;  1IKI A;  3IXG A;  1PRQ A;  2R9W A;  4FOF A;  1AWI A;  1YSP A;  3ZG0 A;  2ZMA A;  3GEC A;  4ZJ3 A;  4AFI A;  3CHW P;  3R7W B;  3MSH A;  5EUA A;  2ACG A;  3ITB A;  4HJ4 A;  3IT9 A;  5DFY A;  3P09 A;  3T4K A;  3BFF A;  4M3K A;  5F68 A;  3OBF A;  1L0G A;  1S4R A;  3IX8 A;  1CEG A;  5M18 A;  1STZ A;  5G4Y A;  5G18 A;  1GA9 A;  1K55 C;  4OP8 A;  2XK1 A;  2FFY A;  1NXY A;  3BWL A;  3LI9 A;  1QME A;  2JKT M;  2V9A A;  2PBY A;  1RP5 A;  2X02 A;  4O7D A;  3BYD A;  2ZD8 A;  3VP4 A;  1NYM A;  2OWJ A;  4UA9 A;  2WAF A;  1HVB A;  5C5K A;  3RTY A;  1P9W A;  2KLI A;  3A0V A;  4ZJ2 A;  3HLB A;  5CEB A;  2NUP C;  4WM9 A;  1ZG6 A;  4JXW A;  3UE6 A;  1ES3 A;  3NOP C;  3VP1 A;  3Q81 A;  2HDU A;  2JKT I;  2E8I A;  4DXB A;  1QMF A;  3T4L A;  3W4P A;  3E4P A;  3SH7 A;  3VOL A;  5HDD A;  4ETZ A;  3WS2 A;  1GHP A;  4N9K A;  3RH8 B;  3CJM A;  1VHM A;  2QWS A;  3V3R A;  4BL3 A;  2IA2 A;  3IF6 B;  1OME A;  3EGX C;  3IF6 A;  4MN5 A;  1DP6 A;  5M1A A;  4Z9Q A;  3NDG A;  3NEC A;  3TE8 A;  1LSX A;  3TW8 A;  5FL3 A;  3T4S A;  5M19 A;  4RVA A;  3O3V A;  3T4T A;  5HZH A;  3UN7 A;  1K38 A;  1D1J A;  2XA7 S;  4OPY A;  1FR1 A;  1S67 L;  1PW8 A;  5HDS A;  2H5S A;  2Q9M A;  2O99 A;  4JLF A;  5A92 A;  4X56 A;  4Y0O A;  2HP6 A;  3FWL A;  5EVL A;  2VK3 A;  4NEE D;  3SH9 A;  2PU4 A;  3F1N A;  4JPM A;  2J3T D;  5AJG A;  5GLC A;  4FCF A;  3UNW A;  3H82 A;  2Q0O A;  5D3O A;  2WKI A;  1G5U A;  2ZQC A;  3WS4 A;  5FSR A;  3GV9 A;  3MQ0 A;  1XFQ A;  4GD6 A;  3P7N A;  1LHY A;  3DW0 A;  1Q2Q A;  5J3W A;  2ZQ7 A;  3C8C A;  3CUE C;  1ZG4 A;  4KZ7 A;  1SDN A;  1K4E A;  1N4O A;  2V8F A;  4LCL A;  3CG5 A;  3B3X A;  4HY8 A;  5DF7 A;  2I9V A;  1DP9 A;  1VET B;  2QJ7 A;  2W3H A;  2GJ3 A;  3BQA A;  4X69 A;  3F1O B;  2NUT C;  2O9A A;  2WGI A;  4R38 A;  1K57 C;  1PZO A;  1TS7 A;  3UDF A;  3L7H A;  3CPT B;  4K91 A;  2Y2N A;  3F1N B;  3LFV A;  1MKI A;  4UQI M;  4QHC A;  3ZDJ A;  4ZTK A;  1WE4 A;  3C30 A;  1RGZ A;  1TDL A;  3IF6 C;  2JKG A;  2OLU A;  4LRX C;  5FAP A;  3IWQ A;  5A91 A;  1J9M A;  3VOZ A;  5CTM A;  4EQ1 A;  5L10 A;  1N9B A;  1KE0 A;  1SHV A;  2V20 A;  3G31 A;  4CLC A;  3CAX A;  1KOU A;  1A0K A;  2PYP A;  4S2L A;  4EU0 A;  4B93 A;  2ZOI A;  2V1A A;  4G3W A;  4E3M A;  1XJ2 A;  5EOO A;  3GQZ A;  3CI6 A;  2VZW A;  4WEJ A;  5EVI B;  4S2N C;  3NBL A;  5CGS A;  1SDE A;  3CMZ A;  1ES2 A;  1MY8 A;  5CTN A;  4BBT A;  2A2L A;  2DRW A;  4HQA A;  4E3O A;  4HJ3 A;  3S7Q A;  1V9Z A;  4HBU A;  1K55 A;  4WLA A;  3VP0 A;  1K54 C;  4MBK A;  4R0Q A;  5KMW A;  3GDI A;  1CJF A;  4WN5 A;  5IU1 A;  3JVU A;  1GSX A;  3ZFZ A;  3DAV A;  2AVX A;  3A3I A;  4NXG A;  3QP2 A;  2JE5 A;  4D60 A;  1KVL A;  3C2W A;  3SW1 A;  4EV4 A;  4KQQ A;  4F3L B;  4GKU A;  4ME4 A;  2PYR A;  4WYY A;  1GSW A;  4JXV A;  1GA0 A;  3PHY A;  3D9Y A;  5GHX A;  3ZG9 B;  4E3N A;  2WKE A;  4HBT A;  5F6A A;  4IVK A;  4GB7 A;  2EX8 A;  2XR0 A;  3KO6 A;  3PBS A;  2QZ6 A;  2XH9 A;  2HJ9 C;  3LGO A;  1IYS A;  2W0N A;  5HAQ A;  4DXC A;  4KQR A;  3ZVW A;  3HUN A;  1BLS A;  4HHD A;  1OTI A;  2J7V A;  5GHZ A;  3VFH A;  2ZC7 A;  4P6B A;  2WZZ A;  3E4O A;  1H8Y A;  4I3J A;  5DFX A;  2Y2G A;  4PM5 A;  4U3T A;  1SKO B;  1ES4 A;  1KE3 A;  1SKO A;  4XT2 A;  3MZF A;  3JYI A;  1FIL A;  4C3Q A;  5KIZ A;  3UB8 A;  2K31 A;  1MXO A;  2HDQ A;  3HLC A;  5DJU A;  4OVD A;  4OPZ A;  3A3F A;  1M6K A;  4S2K A;  4A5R A;  2Y2K A;  3G30 A;  1S4S A;  1OJ5 A;  2XFS A;  1FCM A;  3C38 A;  3HLD A;  1FIK A;  3MZE A;  3G6O A;  3UPO A;  2O9C A;  4KG5 A;  1G6A A;  1ACF A;  2A3U A;  4YWZ A;  1F5M A;  1JTD A;  5L09 A;  1W63 M;  4PMA A;  3UB5 P;  4JGP A;  4WZ5 C;  4N9L A;  2D02 A;  5HPF A;  1JWZ A;  2Z6C A;  3ZHH A;  1YM1 A;  1OT9 A;  3IF5 A;  3M6B A;  1G68 A;  4IVI A;  3Q7V B;  2ZQD A;  3K3D A;  4U0X A;  5KSC A;  5EPH A;  2V1Z A;  4DN0 A;  2ZC3 B;  2YKF A;  2XEP A;  4LGW A;  3VP2 A;  5E2H A;  2EXB A;  1W8Y A;  4C75 A;  2ZOH A;  4R70 A;  2XA7 M;  3GRJ A;  5A93 A;  3UDI A;  4S2I A;  5L07 A;  2P9V A;  1FOF A;  1CQA A;  2PRF A;  3IBR A;  2P9V B;  2B18 A;  4FTX A;  2J9O A;  5DTK A;  3H7W B;  2HGV A;  3S22 A;  1ESU A;  4H6J A;  4Y0U A;  1VEU B;  3NOU C;  2HP5 A;  5HWT A;  3FKV A;  5GL9 A;  2Y55 A;  1N9O A;  1LL9 A;  2HZ5 A;  1KVM A;  2VGK A;  3QP1 A;  2J8Y A;  1W63 Q;  4E3J A;  2WGV A;  4GNU A;  1L0D A;  2FZ0 A;  3ZNY A;  1NZU A;  3VMA A;  3GSG A;  3T1R A;  3KSH A;  2WAE A;  3K3C A;  2ZBB A;  1E4D A;  4S2O A;  1NYY A;  1Z09 A;  1GSV A;  2P7J A;  1XA1 A;  1J3W A;  3G2Z A;  4D2O A;  3P01 A;  4MN7 A;  4E6W A;  1IYP A;  1PZP A;  1WYB A;  3LID A;  5FA7 A;  5HWV A;  2L1M A;  2A24 B;  1XJ4 A;  2VV7 A;  4JKT A;  4K0W A;  5CHM A;  4DRT A;  3W2Z A;  3QNB A;  2GDN A;  2A49 A;  2W1T A;  3BFC A;  4EET B;  2W3E A;  2Z2L B;  5J7E A;  4MLL A;  1IFQ A;  4KQO A;  3Q7Z A;  5HSQ A;  3I7J A;  4GD8 A;  1SKF A;  4EBN A;  2DCF A;  3LY4 A;  2V1B A;  4Y7P A;  1MWT A;  2B02 A;  3RXX A;  2HDR A;  2WKH A;  1ODV A;  4QJG A;  1TS6 A;  1ONH A;  1P97 A;  1HD8 A;  3ZCZ A;  2KOI A;  2A24 A;  4MBF A;  3ZQ5 A;  1H3Q A;  5A90 A;  3IS2 B;  2Y2O A;  4HNB A;  4I5S A;  3SH8 A;  1FCO A;  3LR0 A;  3FC7 A;  5F1G A;  3A3E A;  1ES5 A;  1MPL A;  1BUE A;  1YLJ A;  3LY3 A;  3T50 A;  4FH4 A;  4G3K A;  5EEC A;  3OLO A;  5EV0 A;  2EFX A;  2ZQ9 A;  3A3J A;  5DKK A;  2BG1 A;  5FDH A;  4X55 A;  3VFF A;  2HJE A;  3QP8 A;  4C6Y A;  4PKY G;  3V39 A;  1YMS A;  1D06 A;  5HDC A;  2J80 A;  3NI9 A;  4X6T A;  1DJB A;  3IWI A;  1F9I A;  4LV2 A;  1SCW A;  3OOV A;  2Y2M A;  4JBF A;  3B33 A;  3IH8 A;  4UA6 A;  2K7S A;  4OQG A;  3OPR A;  3CWF A;  4S2P A;  2W3D A;  1TS0 A;  4QWO A;  1YMX A;  2X01 A;  2YKH A;  3FG8 A;  4OLG A;  1WYC A;  4N1H A;  3MMH A;  4JGO A;  2XD1 A;  3MXR A;  4R3A A;  1RCJ A;  2HV1 A;  2ZM2 A;  2EX2 A;  1MC0 A;  3U4L P;  4KEN B;  3UPP A;  4WF0 A;  3IX4 A;  3FKW A;  3TSG A;  4NXE A;  1MWR A;  4KZB A;  1KDS A;  1UWN X;  2ZQA A;  4GJ4 A;  4NXF A;  1XP4 A;  2V2F F;  1OTD A;  4RQ9 A;  1IYQ A;  1Z6F A;  3BJN A;  3UB9 A;  3D3O A;  3DWK A;  2UV0 E;  4GDB A;  4KZ3 A;  1K25 A;  3IHB A;  3A0R A;  4EXO A;  1TDG A;  3LCE A;  2Z6D A;  3N8R A;  2J3T C;  4EER A;  5EVI D;  5MC7 A;  5FQ9 A;  3B47 A;  4QY5 A;  3PYP A;  4DDY A;  3MS6 A;  4P85 A;  5HL6 A;  2OV5 A;  4FH2 A;  3LIB A;  4E3I A;  3ZVT A;  3BEC A;  4Y17 A;  3RFB A;  4EQI A;  1F2K A;  1NRF A;  4ZBE A;  3N4I A;  5FI7 A;  4F94 A;  5GHY A;  2EWW A;  4MEZ A;  2INW A;  1E3U A;  4RX3 A;  3R7W A; 
#chains in the Genus database with same CATH homology
 1IYS A;  3D4F A;  2WGW A;  3UY6 A;  5GLB A;  5KSH A;  5EVI C;  5HAQ A;  3QHY A;  2C5W B;  3GMW A;  5F82 A;  4DXC A;  5E2E A;  4KQR A;  3ZVW A;  3HUN A;  1BLS A;  3IQA A;  1E25 A;  1IKG A;  2J7V A;  5GHZ A;  3VFH A;  4QY6 A;  2ZC7 A;  3HL9 A;  1MWS A;  2IWB A;  4DE1 A;  3PAG A;  3G34 A;  3OZH A;  4OQI A;  4P6B A;  2WZZ A;  1HZO A;  3C5A A;  4LEN A;  5FQJ A;  1BZA A;  4KZ5 A;  3MZD A;  1H8Y A;  3IXH A;  3CZD A;  3OPP A;  2Y2G A;  4PM5 A;  1KGF A;  2Y59 A;  4U3T A;  3GR2 A;  3HUO A;  4P87 A;  3M2K A;  1K56 D;  4FD8 A;  1IEL A;  4BQM A;  1ES4 A;  4R4R A;  5BOH A;  4X68 A;  1KE3 A;  2P74 A;  3SS5 A;  3AGE A;  3MZF A;  1MBL A;  3JYI A;  2DNS A;  3OPH A;  1ESI A;  3NCK A;  4C3Q A;  5HW3 A;  2WZX A;  3HLW A;  4UA7 A;  1FSY A;  4YFM A;  5CGW A;  4EUZ A;  5FAT A;  1K4F A;  4WEL A;  4BL2 A;  3G32 A;  1MXO A;  2HDQ A;  4OLD A;  2Y4A A;  4OH0 A;  3HLC A;  5JYO A;  1K6S A;  4BLM A;  4OVD A;  2QMI A;  4OPZ A;  2Q9N A;  3BFG A;  3VSL A;  3A3F A;  3IXB A;  1ONG A;  1M6K A;  3HLF A;  3BFD A;  4S2K A;  4A5R A;  2Y2K A;  3G30 A;  3NY4 A;  5DF9 A;  3A3D A;  3HBR A;  5HL1 A;  3UPN A;  1MWU A;  1YLP A;  4JXS A;  2ZJ9 A;  2XFS A;  1FCM A;  4QB8 A;  4XUX A;  1ERO A;  3HLD A;  4IBX A;  3OPL A;  3MZE A;  4N1X A;  1YT4 A;  5FQI A;  3ZGA B;  1DY6 A;  4ZDX A;  1PI4 A;  1W5D A;  4WEK A;  3UPO A;  2VGJ A;  2XLN A;  5U47 A;  1EWZ A;  2PU2 A;  3FZC A;  4FSF A;  5E2F A;  3S4X A;  1PWC A;  4KG5 A;  5FAQ A;  4EBP A;  1G6A A;  2H0T A;  4IBR A;  2A3U A;  2Z2M B;  4KZ9 A;  1JTG A;  1BLC A;  1JTD A;  4KZ8 A;  2FFF B;  3BEB A;  3HLG A;  2Y2L A;  1FR6 A;  1LI9 A;  4YIN A;  4S2M A;  4PMA A;  5JYP A;  4WZ5 C;  3LO7 A;  4PM9 A;  4HEF A;  3OCL A;  4ZJ1 A;  4GDN A;  4JF6 A;  3RJU A;  2Y2H A;  1PIO A;  4N9L A;  3MBZ A;  2HP9 A;  5L2F A;  2IWC A;  4S2N A;  1XGJ A;  3V3S A;  3ZG7 B;  1BSG A;  1JWZ A;  4RX2 A;  4QD4 A;  1XKZ A;  3ZHH A;  1YM1 A;  2ZM0 A;  2Y91 A;  3IF5 A;  3M6B A;  1G68 A;  1JWP A;  4R1G A;  1LLB A;  1YQS A;  3Q7V B;  1YLW A;  2ZQD A;  4IVI A;  5TGF A;  3ZG8 B;  3HRE A;  2Y2Q A;  4U0X A;  3WRZ A;  1ALQ A;  1PI5 A;  4UHU A;  3WWX A;  3PBR A;  5EPH A;  2V1Z A;  5HX9 A;  5KSC A;  1PYY A;  2ZC3 B;  4XXR A;  3PBQ A;  2WK0 A;  1XA7 A;  2XEP A;  3MKF A;  4RA7 A;  2ZM8 A;  3VP2 A;  3O86 A;  5E2H A;  5CXW A;  4WMC D;  2OLV A;  4JF4 A;  3Q1F A;  1IKI A;  4E6X A;  2EXB A;  1DJC A;  1W8Y A;  4C75 A;  3IXG A;  5CER A;  3V5M A;  2ZLY A;  1H5X A;  3UE0 A;  2R9W A;  1I2W A;  1C3B A;  3GRJ A;  1GCE A;  5A93 A;  3UDI A;  4S2I A;  3ZG0 A;  3UE1 A;  2P9V A;  1FOF A;  2ZMA A;  4IED A;  3BLM A;  2I72 A;  2XDM A;  2P9V B;  2J9O A;  4ZJ3 A;  5DTK A;  4KZA A;  2RL3 A;  3DWZ A;  3V50 A;  4Q8I A;  5EUA A;  2B5R A;  3ITB A;  3UO9 A;  2EX6 A;  1YLZ A;  3IT9 A;  5CHJ A;  3P09 A;  3S22 A;  2H10 A;  3BFF A;  3BRM A;  1ESU A;  1K57 A;  5E2G A;  4M3K A;  4WMC A;  4Y0U A;  4DF6 A;  4B4X A;  5CED A;  1L0G A;  1L2S A;  2HP5 A;  2J9P A;  3UDX A;  3FKV A;  5GL9 A;  2Y55 A;  1CEG A;  3LEZ A;  3NIA A;  4OON A;  4BJP A;  5M18 A;  1LL9 A;  1KE4 A;  3HVF A;  1GA9 A;  2BLS A;  5G18 A;  1K55 C;  2JBF A;  1KVM A;  2VGK A;  2X71 A;  2J8Y A;  2Y2I A;  4OP8 A;  1BTL A;  2WGV A;  4E3J A;  4GNU A;  2XK1 A;  1L0D A;  5AQB A;  3ZNY A;  3TG9 A;  1NZU A;  2FFY A;  3GSG A;  2EX9 A;  1NXY A;  3VMA A;  1VQQ A;  1QME A;  3TOI A;  2WAE A;  1XGI A;  2PBY A;  4JF5 A;  3NC8 A;  1RP5 A;  1E4D A;  2X02 A;  4S2O A;  1NYY A;  1PWG A;  2IWD A;  5FQQ A;  4O7D A;  3BYD A;  3QNC A;  4BEN A;  2ZD8 A;  3VP4 A;  1KDW A;  3HLE A;  3N8L A;  1XA1 A;  4PPR A;  1NYM A;  4UA9 A;  2EXA A;  2WAF A;  1HVB A;  4KG6 A;  3E2K A;  4LCM A;  5GLA A;  3UE3 A;  2XGN A;  2XQZ A;  1TVF A;  3G2Z A;  5FI2 A;  4ZJ2 A;  3C7U A;  4D2O A;  3HLB A;  4P0M A;  4KZ6 A;  5CEB A;  4E6W A;  1IYP A;  1PZP A;  1WYB A;  2HPB A;  4B4Z A;  3Q07 A;  4WM9 A;  5FA7 A;  3BLS A;  1ZG6 A;  2CC1 A;  4JXW A;  1CEF A;  1XX2 A;  1ES3 A;  3OC2 A;  4LV3 A;  3VP1 A;  1O7E A;  2OSU A;  3Q81 A;  2HDU A;  3G4P A;  2E8I A;  4OOL A;  5AQA A;  4DXB A;  2XF3 A;  3MKE A;  1QMF A;  4OOM A;  4JKT A;  4H8R A;  1EI5 A;  2G2U A;  3PTE A;  4K0W A;  3W4P A;  3SH7 A;  2ZC4 B;  2C6W B;  3O88 A;  4EBL A;  5F1F A;  3P98 A;  5GLD A;  3WS2 A;  5CHM A;  1H8Z A;  3C4O A;  1GHP A;  4N9K A;  4OP5 A;  3CJM A;  2Y2P A;  1ZKJ A;  4DRT A;  4DE0 A;  4EWF A;  3E2L A;  3VSK A;  3V3R A;  3QNB A;  2GDN A;  2A49 A;  5HAI A;  4BL3 A;  1HTZ A;  1CK3 A;  4GN2 A;  3IF6 B;  3ISG A;  3BFC A;  2Z2L B;  1OME A;  3IF6 A;  4MLL A;  5FQK A;  5CEC A;  3M6H A;  4OQ0 A;  3PBT A;  5M1A A;  4KQO A;  4Z9Q A;  3Q7Z A;  3NDG A;  3I7J A;  4GD8 A;  2R9X A;  1SKF A;  3ITA A;  2DCF A;  4EBN A;  3LY4 A;  3PAE A;  4S2J A;  4Y7P A;  1GHM A;  3SS4 A;  1MWT A;  5TR7 A;  4R3B A;  1FSW A;  1BT5 A;  3O87 A;  2HDR A;  4WZ5 A;  5DTT A;  2WKH A;  3RXX A;  5M19 A;  4RVA A;  3SOI A;  2HDS A;  3GVB A;  3O3V A;  1W8Q A;  4QJG A;  3SS3 A;  1ONH A;  4OQH A;  3UN7 A;  5E43 A;  1K38 A;  3ZCZ A;  1HD8 A;  2WGW B;  4OPY A;  4JXG A;  1U60 A;  2ZC6 B;  3MXS A;  4R23 A;  4KZ4 A;  4N92 A;  4PM7 A;  5FI6 A;  4MBF A;  1FR1 A;  3IHA A;  4UAA A;  1PW8 A;  1XPB A;  3ZNT A;  2H5S A;  2Q9M A;  1GHI A;  4HES A;  5A90 A;  4JLF A;  5A92 A;  1PWD A;  4LV0 A;  4X56 A;  4Y0O A;  1S0W A;  2HP6 A;  2Y2O A;  3FWL A;  3N7W A;  5EE8 A;  3AGF A;  5EVL A;  3SH8 A;  1FCO A;  2ZC5 B;  3SH9 A;  2PU4 A;  5HAP A;  4ID4 A;  4JPM A;  1DJA A;  1Y54 A;  1ERM A;  1K56 A;  2RCX A;  5DTS A;  4FCF A;  5GLC A;  5F1G A;  3A3E A;  3UNW A;  2H0Y A;  1ES5 A;  1MPL A;  1BUE A;  2JC7 A;  5D3O A;  2G2W A;  4WZ4 A;  2WKI A;  3WS0 A;  1YLJ A;  3LY3 A;  1KGE A;  2ZQC A;  3WS4 A;  5FSR A;  3FYZ A;  3GV9 A;  4GD6 A;  4QU3 A;  3S1Y A;  1LHY A;  3DW0 A;  1VM1 A;  4BD1 A;  1I2S A;  1Q2Q A;  4FH4 A;  4R4S A;  4XUZ A;  5EEC A;  1RGY A;  3AGD A;  5CRF A;  5AQ9 A;  2EFX A;  2ZQ9 A;  4E3L A;  2ZQ7 A;  1L0E A;  1ZG4 A;  3A3J A;  4KZ7 A;  3ZG5 A;  1SDN A;  1I5Q A;  1K4E A;  1N4O A;  4LCL A;  2BG1 A;  5FDH A;  3CG5 A;  3IH9 A;  5EOE A;  3B3X A;  4PM6 A;  4WBG A;  4X55 A;  5DF7 A;  3EQU A;  3VFF A;  1FCN A;  4LV1 A;  1BUL A;  1BLH A;  2UWX A;  4C6Y A;  5DVA A;  4X69 A;  3V39 A;  3WRT A;  1NJ4 A;  1K54 A;  4NET A;  3C4P A;  2WGI A;  1YMS A;  2XFT A;  1K57 C;  1PZO A;  2EFU A;  1S6R A;  3RXW A;  1W7F A;  3NI9 A;  4X6T A;  3IXD A;  1DJB A;  3HUM A;  3N8S A;  2QPN A;  3VOY A;  1KGG A;  3IWI A;  3UDF A;  4LV2 A;  1SCW A;  4K91 A;  2Y2N A;  2Y2M A;  5FAS A;  4JBF A;  1MKI A;  4QHC A;  3IH8 A;  4K0X A;  2XD5 A;  4UA6 A;  3ZDJ A;  1JVJ A;  3BM6 A;  4L0L A;  4ZTK A;  1WE4 A;  3OPR A;  4OPR A;  3MFD A;  4OQG A;  1RGZ A;  1TDL A;  3IF6 C;  4S2P A;  4OKP A;  1ZC2 A;  5EVI A;  2OLU A;  1YMX A;  3N6I A;  4GOG A;  2X01 A;  5KZH A;  5J8X A;  3EQV A;  5FAP A;  2WYX A;  3IWQ A;  5A91 A;  4OLG A;  1J9M A;  3VOZ A;  1WYC A;  4KG2 A;  5CTM A;  4N1H A;  4CPK A;  1N9B A;  1KE0 A;  1SHV A;  2V20 A;  3G2Y A;  4DE2 A;  3G31 A;  2XD1 A;  3MXR A;  1IYO A;  1RCJ A;  5AQ7 A;  4OPQ A;  4DKI A;  4DE3 A;  2ZM2 A;  1Q2P A;  4S2L A;  2EX2 A;  4KEN B;  4E3M A;  3FV7 A;  3UPP A;  5EOO A;  3GQZ A;  1YLY A;  2Y2J A;  3FKW A;  4WEJ A;  5EVI B;  3TSG A;  4S2N C;  3NBL A;  3M2J A;  1MWR A;  5CGS A;  4X53 A;  3G35 A;  1SDE A;  4KZB A;  1O07 A;  2WUQ A;  1ES2 A;  1MY8 A;  3C7V A;  3CMZ A;  1KDS A;  5CTN A;  3IWO A;  5TFQ A;  2DRW A;  1YLT A;  1XXM A;  2ZQA A;  4E3O A;  4ZAM A;  1NZO A;  4RYE A;  3W8K A;  1XP4 A;  5IHV A;  2V2F F;  1BLP A;  4HBU A;  3W4Q A;  1K55 A;  1IYQ A;  1Z6F A;  2JCH A;  5DF8 A;  3VP0 A;  1K54 C;  4GZB A;  3DWK A;  4MBK A;  1CI8 A;  4GDB A;  4R0Q A;  4KZ3 A;  4MNR A;  5FQM A;  1M40 A;  2ZQ8 A;  4BD0 A;  5KMW A;  1K25 A;  1LL5 A;  3IHB A;  3Q82 A;  1K6R A;  1TDG A;  1AXB A;  3LCE A;  3PBO A;  3ZFZ A;  3N8R A;  5CGX A;  1L0F A;  3Q7V A;  3A3I A;  4Y0T A;  3DTM A;  3BFE A;  5CHU A;  2JE5 A;  5EVI D;  3VP3 A;  1KVL A;  1IEM A;  2WAD A;  5FQ9 A;  4B88 A;  5F83 A;  1LI0 A;  4QY5 A;  4KQQ A;  4DDY A;  3WS1 A;  4EV4 A;  4P85 A;  1NY0 A;  4GKU A;  3PBN A;  3WS5 A;  4CJN A;  2OV5 A;  4FH2 A;  5FAO A;  4MBH A;  1FQG A;  1CI9 A;  3GTC A;  4WYY A;  3ZVT A;  4DDS A;  4E3I A;  1W79 A;  3BEC A;  4R3J A;  4E3K A;  4JXV A;  1GA0 A;  1PW1 A;  4NK3 A;  4PM8 A;  4EQI A;  3NDE A;  5GHX A;  3ZG9 B;  4OOY A;  1NRF A;  4ZBE A;  3N4I A;  5HFO A;  4E3N A;  5FI7 A;  2WKE A;  4HBT A;  3OCN A;  4F94 A;  4IVK A;  4GB7 A;  1ERQ A;  2EX8 A;  5GHY A;  2XR0 A;  5I94 A;  5HAR A;  3PBS A;  2QZ6 A;  1JWV A;  4MEZ A;  1E3U D;  2XH9 A;  1E3U A;  4RX3 A;  1TEM A;  4U0T A;  3W4O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...