4HH3A

Structure of the appa-ppsr2 core complex from rb. sphaeroides
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
251
structure length
251
Chain Sequence
LPSLAPDLVRDLIATAADISLLVSQEGVVREVMANPHHPSFGQLSEWEGRPLEEVLTAESVAKFRLRSEGLEPGRGSVAVELNHIDPRSFEFPIRYILHRLPADRSILMLGRDLRPIAEVQQQLVAAQLAMERDYETQREMETRYRVVLDVSRDPMVLVSMSTGRIVDLNSAAGLLLGGVRQDLLGAAIAQEFEGRRRGEFMETMTNLAATESAAPVEVLARRSQKRLLVVPRVFRAAGERLLLCQIDPAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A ternary AppA-PpsR-DNA complex mediates light regulation of photosynthesis-related gene expression.
pubmed doi rcsb
source organism Rhodobacter sphaeroides
molecule tags Flavoprotein/transcription
molecule keywords Transcriptional regulator, PpsR
total genus 82
structure length 251
sequence length 251
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13188 PAS_8 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4hh3A02
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4hh3A01
2PD8A 1S1YA 4PKYG 4KUKA 2JN7A 4L9FA 2QWSA 3UE6A 1JNUA 4RQ9A 1S4SA 3NJAA 2VV6A 3H7WB 1OJ5A 1LL8A 2YKHA 2L0WA 1XFQA 2PD7A 4HJ4A 1GSXA 1MZUA 3UB7A 3H82B 4F3LB 3EWKA 1OTDA 3D72A 3LICA 4BBUA 5J7EA 3HJKA 3EEHA 4GS9A 4HH3A 4LPZA 2VEAA 3ICYA 5KIZA 1UWNX 1BYWA 5F68A 4EXOA 1D7EA 4HI4A 4WLAA 1OTIA 3LI9A 3KX0X 1UGUA 2R78A 2PHYA 3MJQA 4JGPA 2L4RA 2V1AA 5F6AA 1XJ3A 4M4XA 1G28A 4HIAA 3C2WA 3CLOA 1GSVA 3LIAA 4L9GA 4EEUA 5HSQA 5AVEA 5HZHA 2V0WA 2B02A 2V0UA 1TS7A 3A0RA 3F1PB 4HH2A 4MN6A 1Y28A 2WKQA 2YKFA 4GHIA 1LSVA 3ULFA 2EA9A 4EW7A 5HWVA 2QHKA 3CWFA 1D06A 3C8CA 4R3AA 1F9IA 4I3IA 4R70A 3UB8A 4HHDA 3BY8A 2ZOIA 3IS2A 4GS9B 3FG8A 3UB9A 4E04A 3LUQA 1X0OA 4YWZA 3UMEA 1S1ZA 5DJTA 2PR5A 4H6JB 2VLGA 3SW1A 2KX6A 3E4OA 2PYRA 4I3JA 3A0VA 1S67L 3F1OB 4HP9A 2Z6DA 1S4RA 1OT9A 3BY9A 4EEPA 5G4YA 2PDRA 3MQQA 4B9OA 2W0NA 3LIFA 3LIBA 1V9ZA 4NXFA 4EETB 3FC7A 5AVFA 3H9WA 1OJGA 4EQ1A 3K3DA 2L1MA 4NXBA 1LT0A 2BASA 3H82A 4R38A 4F3LA 4KUOA 3K3CA 3OLOA 4HNBA 4WL9A 4HJ3A 4HP4A 4HQAA 3LI8A 2ZOHA 2A24B 1DP6A 2V1BA 1TS6A 4I39A 3LYXA 1WA9A 4DJ3A 3HJIA 4PKYA 3IS2B 5HD5A 2HV1A 3F1NB 3VE3A 2CMNA 2W27A 3MFXA 1P0ZA 5J4EA 3NOTC 2J80A 5HDDA 2P7JA 3VE4A 1V9YA 5TBMB 4GW9A 2VV7A 5DKKA 4WUJA 3RTYA 1NWZA 1TS0A 2KDKA 2WKPA 4LRYC 5HWTA 3PYPA 4LRXC 4EERA 3H7WA 1XJ6A 1LSXA 1OT6A 2QJ7A 3B33A 1GSWA 3F1PA 1T1AA 1DRMA 4NXGA 2INWA 3G6OA 5A8BA 1OTEA 4XT2A 4NXEA 5HDCA 3P7NA 2GJ3A 3IBRA 3LIDA 1N9OA 1XFNA 1EW0A 2M1CA 1KOUA 3T50A 1T1CA 1XJ2A 3MQOA 5HWWA 2A24A 2Z6CA 5DJUA 5IS1A 1TS8A 4HJ6A 2VV8A 1ODVA 2QKPA 3A0SA 5I5LA 1OTAA 1T1BA 5DKLA 4JGQA 1N9LA 4I3AA 2JHEA 2D02A 2PYPA 4R6LA 4EESA 2OWJA 2ZBBA 3E4QA 5F69A 5IU1A 5HD3A 4GCZA 2PR6A 4BBTA 1T18A 1UWPX 5F5YA 1XJ4A 3NOUC 3NHQA 2V9AA 5G4ZA 5EFWA 3LIEA 4LLOB 4HOIA 4I38A 4GHIB 1DP9A 3GDIA 4HY8A 4K08A 3UB6A 3UMDA 3CAXA 4L9EA 3PHYA 2QJ5A 4JGOA 4LRZE 4WF0A 4XT2B 2K7SA 3VOLA 5J3WA 3ZQ5A 4WN5A 3BWLA 4DJ2A 3E4PA 2D01A 1DP8A 4MN5A 1P97A 1OTBA 2OWHA 3F1NA 3NOPC 5HDSA 1LSWA 3GECA 1S66L 3RH8B 4H6JA 3MXQA 4BBVA 2H28A 2WKRA 1F98A 1N9NA 1VB6A 4KQDA 3MR0A 3F1OA 4JGRA 2I9VA 1T19A 5TBMA 4I5SA 2OOLA
chains in the Genus database with same CATH superfamily
1H8ZA 2PD8A 1S1YA 2O9AA 1H5XA 3PBSA 3I7JA 2PD7A 3K2NA 1K56D 3C7UA 3D72A 1SDNA 1MXOA 2ZD8A 5KIZA 1Q2PA 4Y3IA 2H5SA 1FSYA 2HDQA 3QP1A 4LENA 3BQ8A 3MXSA 3UPOA 1Z6FA 4ZJ1A 2LB5A 2UWXA 2PRFA 3OPRA 2EFXA 4I3IA 3Q82A 4YWZA 1J3WA 2G7UA 2EXAA 3E4OA 3Q7VB 3CHWP 2O9BA 1OT9A 1ESIA 3V50A 3PR6A 5G4YA 4DN0A 2BASA 4DXBA 1K55A 1HVBA 4FH4A 4A5RA 1TF1A 4QU3A 3LCEA 2XFTA 4LRYC 1KE3A 3G2ZA 4QJGA 1T1AA 2QMIA 3R7WA 4JKTA 4MCWA 1XFNA 3SS3A 2C6WB 2VGLS 4O0PA 3MF0A 4RX3A 1ODVA 4AFIA 1LL5A 5DKLA 1SKOB 2OWJA 5JYPA 5F5YA 4DDSA 3FWLA 5TFQA 4FUWA 1ERQA 5GHXA 1PI5A 4EUVA 4R4SA 4E3OA 1PW1A 5CGSA 3PBOA 4WN5A 2Q9MA 1YLTA 2OWHA 1W63Q 3GECA 4FD8A 3AGFA 1YSPA 2V20A 3KYEA 4JF5A 1VM1A 4GOGA 2HJEA 4R4RA 5L2FA 4B88A 3G30A 2JKTI 2W3EA 5F68A 4MMNA 5EVLA 1SZVA 3LI9A 3U4LP 3V3SA 3BJNA 1MPLA 3T4SA 3IX3A 5FQIA 1HD8A 1VEUA 4JXVA 1BLHA 1TS7A 5FASA 1CEFA 3E2KA 4LV1A 1K55C 3IS2A 1W79A 1LI9A 5KMWA 3FKWA 1G6OA 3WS5A 4CLCA 3UDIA 5AVFA 3H9WA 2PT7A 5IHVA 4HNBA 2ZQ7A 4IVKA 5FEGA 5GHYA 3MFXA 2WZXA 3IF6A 4PM7A 4GD6A 3RTYA 2FZ0A 3KYQA 2G2WA 4DE0A 1L2SA 4XT2A 3NCKA 1ES2A 3G2YA 1PRQA 3MZFA 2W3DA 4JF6A 4OOMA 2JKGA 3S7PA 2BG1A 5E2GA 1RGYA 5L07A 5FAPA 5CRFA 4S2JA 2P9VB 5EFWA 4UEYA 2H10A 4QY6A 1E3UA 3T4LA 1TDGA 4FH2A 1E3UD 3F1NA 5FATA 1S0WA 5K5BA 3PAEA 3C4OA 1VETB 3UE6A 1ES4A 4E3IA 3MQ0A 5IT5A 3H7WB 3IF6C 1ES3A 3S7NA 3P09A 1PWDA 4HH3A 3AGDA 3VFHA 3N4IA 1UGUA 3TSGA 3FZCA 2XK1A 3V5MA 5L09A 4G3KA 4L9GA 4C6YA 5HZHA 5EPHA 4KG6A 2EX8A 2LB9A 4GHIA 2VGKA 3ITBA 4HHDA 3N7WA 3MFDA 2ZM0A 3ZNTA 1RP5A 4JPMA 1DY6A 1L0DA 1K4EA 1S4RA 4GZBA 5FDSA 3MQQA 3IH9A 4NXFA 5GL9A 4MN7A 4R38A 2VJWA 2V1BA 3G34A 2W27A 4S2MA 3EEAA 4IJGA 4PM5A 2B18A 2QJ7A 1P9RA 2OLVA 5HDCA 5HAQA 2P04A 4U3TA 1T1CA 3MQOA 4GDNA 3LR5A 2P74A 3HLFA 2QKPA 1JWZA 1VETA 3M6HA 2H0YA 3Q81A 4UQIS 3LR3A 2XD1A 3IXBA 1MY8A 4XT2B 3D4FA 1HZOA 3NOPC 5FQQA 1S66L 1ES5A 4CJNA 2JN7A 2V8CA 4GKUA 2OV5A 3KO6A 4XUZA 4E6XA 4L0LA 2EX2A 3LO7A 3OCNA 4DXCA 3ZG9B 1XX2A 2R78A 2E8IA 2WAFA 4QPRA 3HCYA 2NUPC 4Q8IA 4BL3A 2B5RA 3FYZA 1MWTA 4N9LA 1FR6A 3A0RA 5FI7A 1JTGA 3OPPA 1C3BA 1S1ZA 4JXSA 3SZTA 1CK3A 2EXBA 3LR0A 4B93A 3DTIA 1W5DA 5FQJA 4S2IA 3T12B 4OOLA 2PU2A 4WEKA 1IKGA 3FC7A 5GLCA 4X68A 3CMZA 2Y79A 4OQHA 2Y59A 4BQMA 1MKIA 1WA9A 1ESUA 3VE3A 3T4OA 4O7DA 5HDDA 3PBQA 3VE4A 3CUEA 4OH0A 4LRXC 4S2NA 5FA7A 1H8YA 1NZOA 5A8BA 3WWXA 1NLZA 2Q9NA 1ZG6A 3MS6A 5IS1A 4CLCC 2JHEA 1PYYA 3CPTB 5F69A 1PFLA 3S22A 2K7SA 5CEBA 1P97A 1OTBA 1HLUP 3QP2A 1VQQA 4KG2A 4RA7A 3LY3A 2XQZA 1LL8A 1ZC2A 4YOFA 1GHPA 3IHBA 5FDHA 1OTDA 5FI6A 2ZQDA 4DRTA 1TVFA 4EXOA 1D7EA 4HI4A 3KX0X 1XJ3A 4M4XA 2OAP1 3UPPA 2B02A 3T4QA 5FQKA 1E4DA 2Y2MA 5HWVA 1D06A 2NUTC 3CZDA 3HLGA 2B95A 3UB5P 1SKOA 4JBFA 1YM1A 2P9VA 5FSRA 4MBKA 4P87A 3K3DA 3BRMA 1K6RA 1YPRA 3QP5A 4KUOA 2ZOHA 1D1JA 1K0KA 4PKYA 5LBRA 2QZ6A 4ETXA 1G68A 2VV7A 3Q1FA 4LCLA 1XXMA 4KZAA 4CLCE 4P0MA 3MBZA 4NXEA 3P7NA 1FR1A 5AJGA 4H8RA 4HESA 1TS8A 2Q0OA 3E2LA 3Q7ZA 4ETZA 3KSIA 4HBTA 2BLSA 2PYPA 5AQ7A 2X02A 1XJ4A 3BYDA 1AWIA 1BLPA 1SKFA 3MSHA 3T1SA 3CAXA 3ZQ5A 4DJ2A 3JPUA 1DP8A 1WYCA 4BBVA 4PHTA 3QP4A 1Q2QA 2H28A 3JYIA 4FSFA 4Y15A 4DMZA 2OOLA 5E43A 4KUKA 3W4QA 1XPBA 2O9CA 3IHAA 4ME4A 2WADA 3KSGA 3EEHA 1EWZA 2VEAA 4GNUA 3A3DA 3VP1A 4JGPA 4KZ9A 3WS2A 3C4PA 1GSVA 3G31A 2V0UA 2CC1A 3PBRA 1F9IA 4OQ0A 4GS9B 3QNCA 4ZJ2A 4IUKA 3SW1A 4DKIA 3SS4A 3SS5A 3SH9A 4EEPA 5CERA 2J7VA 5E2FA 4WL9A 4KENB 1FCOA 4S2LA 4DJ3A 2HV1A 2V2FF 1FCMA 3ZVTA 3LEZA 3FKVA 3S1YA 1BZAA 4Y0TA 1OTEA 1YAXA 5F82A 2O0YA 3PBTA 4ID4A 2HP5A 3BQAA 1L0GA 4ZJ3A 2XLNA 2IA2A 3NHQA 4WMCA 4BD0A 5A93A 3IX8A 3S7QA 4GN2A 2QJ5A 4WF0A 3HLDA 2D01A 4N1XA 5HDSA 4UA9A 4ZDXA 4NETA 5GLDA 5JYOA 5CECA 1PWCA 3HJKA 4MLLA 4QY5A 4WYYA 3Q07A 2ZC3B 4Q0IA 3UE0A 3BW6A 3BLSA 5FAQA 4UAAA 3CLOA 5F1FA 3N8RA 3L9KA 3OOVA 5KZHA 3IX4A 1NLYA 1O07A 1SHVA 2J9PA 1HTZA 1K57C 1GHMA 2PYRA 2PBDP 2PBYA 2JCHA 4RYEA 4B9OA 3JVUA 1Y4OA 4EETB 2G2UA 2L1MA 4HP4A 4I39A 3DAVA 3M2JA 2QPNA 1L0FA 4EV4A 4WUJA 5HW3A 1H0MA 1XJ6A 3B33A 4S2OA 2INWA 4MNRA 3IBRA 3LIDA 3S4XA 3GTCA 5FL3A 1ZG4A 2Y2IA 1KDSA 5FI2A 1ONGA 2GX5A 4FCFA 4BBTA 2Y91A 2WK0A 2EX9A 1YLJA 3A3IA 5HAIA 1CI9A 1DP9A 1YQSA 4KZ5A 1H8MA 1LHYA 4M3KA 4X69A 3WS0A 2W1TA 1IYQA 3OCLA 4PKYG 1BT5A 3CITA 5DF9A 1NYYA 3BFCA 4F3LB 1MC0A 4C3QA 3MZEA 4KG5A 1YLZA 2Y8HA 4IBRA 2XROA 4WZ4A 5CGWA 2VA0A 2DNSA 5F6AA 4UA7A 3WS4A 2XFSA 4N1HA 4EEUA 5HSQA 2EFUA 4CPKA 3F1PB 3EOIA 3GRJA 1STZA 3CWFA 4OQGA 3MMHA 5EVIA 1P9WA 5CTMA 4CQHA 5DJTA 3VSLA 4OP8A 5CHUA 2V8FA 4I3JA 4YINA 2J3WA 1U60A 1OJGA 3H82A 4UHUA 3IWQA 3QNBA 3OLOA 1DP6A 1FSWA 3NC8A 2ZC6B 1P0ZA 2WKIA 1BULA 1KVMA 2P7JA 1V9YA 5TBMB 2WZZA 5DKKA 3UE3A 5HWTA 5EVIC 3HUNA 4PM9A 2Y2HA 1XJ2A 1G6AA 3NECA 3C7VA 3A0SA 4JGQA 3TG9A 2WAEA 2RCXA 4CLCD 1EI5A 1NRFA 3ZG8B 5A91A 4B4XA 4GHIB 4OPRA 3CUEC 4OPZA 1N9NA 4KQDA 3O3VA 3O86A 3F1OA 3ZNYA 2XGNA 4ZAMA 3W4PA 3NJAA 1NRJA 2Z2MB 2YKHA 2L0WA 1L3LA 5DFXA 4Y17A 4X6TA 2DMWA 1IKIA 4BLMA 2JC7A 4HIAA 5DF8A 3C2WA 2ZL1A 4Y5FA 2Y2NA 3CJMA 2ZM2A 5AQ9A 1JWPA 3UMEA 3BFGA 4KQOA 3NI9A 4BWIA 2XR0A 1SCWA 3JVVA 4JF4A 2WYXA 4EQ1A 3WRZA 4NXBA 2C5WB 3K3CA 3IWIA 2WGVA 4KZ7A 3T4TA 3IS2B 3KSHA 3WRTA 4Z9QA 3A3JA 3HL9A 4WM9A 3C5AA 4OPYA 5HPIA 2ZQAA 3HUMA 4R1GA 3EQVA 5TGFA 2HDUA 1OT6A 4MDZA 3G6OA 2R9WA 1N9OA 4E3JA 2A24A 3UN7A 3HVFA 3VP2A 3N6IA 5E2HA 4EESA 1MWUA 4JXWA 3GQZA 5HD3A 2VK3A 4CLCB 4HOIA 4I38A 4F94A 3UB6A 3OC2A 2W3HA 5CTNA 3VOLA 3BWLA 4DE1A 3ZFZA 1LSWA 3A3FA 3MXQA 1PIOA 2Z2LB 3W4OA 3ULFA 1IYOA 3FPWA 4E6WA 2VKSA 1S4SA 4BJPA 3GMWA 1TDLA 1OJ5A 3IXDA 5F83A 4HJ4A 3T1XA 1FIKA 4KZ6A 4GS9A 1E25A 4K91A 4QWOA 1UWNX 3BFEA 3MZDA 3TOIA 1RGZA 5C5KA 1N4OA 3BLMA 1QMFA 5AVEA 4PMAA 2WGIA 2QHKA 4R70A 3FG8A 3WS1A 2K31A 2FFYA 4HEFA 4KZBA 1CI8A 3IT9A 3UO9A 4ZBEA 5EE8A 3LFVA 2W0NA 2I72A 3DBAA 3D9YA 3R7WB 1LT0A 4BENA 3DTEA 3W8KA 1GCEA 2JKFA 3RJUA 4BD1A 3IXGA 3LEQA 1YKDA 5HD5A 1LI0A 1YMSA 2A49A 4K0XA 1IELA 1FOFA 1GA0A 4OP5A 3F1PA 3OZHA 3FV7A 4DDYA 1A0KA 3EGDC 4MBFA 3IH8A 3UY6A 4I3AA 3PAGA 5CXWA 2UV0E 1MWRA 5HPFA 4C75A 5A90A 2ZLYA 4Y0OA 1PZOA 3E4PA 3RH8B 4H6JA 3HLCA 1VB6A 3TE8A 1I2WA 2WKQA 1K54A 3VFFA 4L9FA 4X25A 4ARZB 4OQIA 1IYPA 1GSXA 1MZUA 2JKTM 3DWZA 3R4KA 4N92A 3GV9A 4K0WA 2Y2QA 4NK3A 4OLDA 3GVBA 1BYWA 1IEMA 2BTFP 2W1RA 2W3GA 2EX6A 5EVID 5M18A 3ZVWA 1SDEA 1DJAA 1LSVA 3C8CA 1FILA 3VV4A 4Y7PA 3HLBA 2Y2JA 3DWKA 1ACFA 4HP9A 4OPQA 2XD5A 4D2OA 1VEUB 4X56A 3KSFA 1CF0A 3UB8A 5J8XA 4HQAA 4PAUA 1TS6A 3HJIA 1YLWA 1G5UA 4LV3A 2XH9A 2CMNA 1CQAA 4G3WA 2J80A 3T4KA 2MJ6A 1F5MA 5L10A 2KDKA 1OPXA 4EERA 2JBFA 3VSKA 2VGJA 3E0YA 4KZ8A 1LSXA 1YT4A 1DRMA 1Z09A 4S2NC 2KLIA 2W1TB 5CGXA 4Q0JA 5EM0A 3IF5A 1T1BA 1CJFA 4GCZA 4E3LA 1T18A 1UWPX 4S2KA 2V9AA 1LL9A 4DF6A 1YMXA 4IBXA 3IBJA 1IYSA 3UE1A 3Q7VA 3PTEA 2OAQ1 3N8SA 1K6SA 3UPNA 1IFQA 1XA7A 2E8JA 5CEDA 1JWVA 3H82B 5BOHA 5EVIB 3V67A 3VP4A 4ZRRA 3UDXA 2PHYA 5AQAA 4HH2A 4NEED 2ZJ9A 2EA9A 2J3TC 3HBRA 4LCMA 1ALQA 4EBPA 2IWDA 3BY8A 3L7HA 5DTKA 2X71A 4IUHA 4R23A 4Y13A 1NZUA 4OKPA 5GLBA 1PI4A 4RX2A 3U2AA 2HP9A 2OLUA 1YLPA 3HREA 4FOFA 3T1RA 3T4JA 4E3KA 4EWFA 1MKMA 3PXPA 4E3NA 5FQMA 2Y2PA 3EGXC 5DFYA 1XGIA 1M40A 3NOTC 4WZ5C 4S2PA 3HUOA 3SOIA 2WKPA 5EECA 4BL2A 3PYPA 4O01A 3C38A 1JVJA 2JKRI 1GSWA 5TJJA 2JKRM 2X01A 4IHQA 4JXGA 2KOIA 4KQRA 3TJZC 1N9LA 4R6LA 2D02A 2ZBBA 4FTXA 3C30A 5MC7A 1W8QA 3OPHA 3ZGAB 3S7OA 4GJ4A 4JGRA 4QD4A 4I5SA 3P01A 2RL3A 5HFOA 3VP3A 1CEGA 1BTLA 4RQ9A 1BSGA 3ZHHA 3RFBA 1KGGA 4EBNA 4MBHA 3ZCZA 4Z1WA 1GA9A 3MJQA 4JLFA 5EVEA 4B4ZA 4U0XA 4R3BA 4KZ3A 1WYBA 1OMEA 3BECA 4R3AA 3O87A 3UB9A 4EU0A 1K54C 2EWWA 2VGLM 5HL1A 2VLGA 2KX6A 4E3MA 1S67L 3N8LA 3DW0A 1ERMA 3SH8A 3CI6A 1DJCA 1RCJA 3IQAA 3LI8A 2A24B 2EWVA 1ZKJA 2ZMVA 3CPTA 2WGWB 1NWZA 4YFMA 5TR7A 2ZM8A 3KYZA 4WZ5A 1KDWA 1WE4A 2ZQ8A 4KQQA 4LGWA 3NULA 5DJUA 1IOUA 1H3QA 3ZYTA 2HDRA 5HX9A 5I5LA 4UQIM 3E4QA 2WUQA 4IEDA 2HJ9C 2K2NA 1PNEA 3OPLA 4HY8A 2Y2GA 2ZC4B 3PHYA 2J8YA 3BFDA 5HL6A 5DTSA 4R0QA 5L8MA 3G4PA 1BLSA 2HZ5A 5E2EA 5TBMA 3MXRA 2QWSA 2ACGA 2R9XA 1XFQA 2PU4A 3E98A 3UB7A 5FAOA 1MBLA 2Y2LA 2PAVP 2GZAA 4QHCA 1N9BA 1GHIA 1XA1A 1VHMA 3GSGA 3T1QB 1XKZA 3ISGA 1EROA 2WGWA 3W2ZA 4ESPA 3LIAA 4D60A 3UDFA 4MN6A 1DJBA 4EW7A 1ONHA 4UA6A 5HARA 1XP4A 2OSUA 3M2KA 2ZOIA 4OLGA 4R3JA 2WKEA 3NBLA 2HGVA 3TRCA 2GDNA 5HAPA 3F1OB 2Y55A 4WMCD 4KZ4A 4II7A 3LIFA 5EM1A 2XSSA 4P6ZM 3M6BA 1KVLA 3F1NB 2XF3A 2P08A 3V39A 5EUAA 3DTMA 4GW9A 5M19A 3PBNA 2Y2KA 5M1AA 2IWCA 3IWOA 2ZL1B 1KGEA 3H7WA 4EUZA 4WELA 3HLWA 2Y4AA 4NKPA 2M1CA 1KOUA 2AVXA 4P85A 5AQBA 2Z6CA 5CHJA 3B42A 2FH5A 1FCNA 1PWGA 1NY0A 3NOUC 5G4ZA 2HPBA 3LIEA 4LLOB 2HP6A 3D3OA 1ZTUA 4L9EA 5CX7A 2HF6A 1W63M 4MN5A 3LGOA 2ZQ9A 2A2LA 3QHYA 4WBGA 2I9VA 3QP6A 4LV2A 3UNWA 3ZG7B 4EQIA 3FPVA 3EQUA 3VMAA 3LICA 5J7EA 4Q0HA 4LPZA 2H0TA 1OTIA 1NXYA 2L4RA 4GDBA 4PPRA 1G28A 1TD5A 1TEMA 1YLYA 4OVDA 1ZHHB 1Y28A 1FQGA 3B47A 5F1GA 1BUEA 4E04A 3LUQA 1X0OA 2PR5A 4DE3A 3ZG5A 5FEFA 1W7FA 2XRNA 3A0VA 3G35A 2Z6DA 5FQ9A 3LR4A 2PDRA 4NG2A 4IVIA 1S6RA 3QP8A 1K56A 1K25A 4Y0UA 2XDMA 4F3LA 4X1MA 5D3OA 4ZTKA 5EOEA 2ZMAA 4GLQA 1J9MA 1M6KA 2ZC7A 3HLEA 2DRWA 3V3RA 2O99A 3OBFA 1TS0A 5DVAA 1PZPA 3DTKA 4BMWA 4XXRA 2VZWA 5EV0A 3AGEA 2GJ3A 1I5QA 1EW0A 5KSHA 4LV0A 1F2KA 3T50A 2VV8A 4GB7A 1KE0A 1I2SA 4DE2A 1OTAA 2V1ZA 1K57A 5EOOA 2Y2OA 3CG5A 4LFUA 1K38A 2W3FA 4JGOA 2ZQCA 3NY4A 3RXWA 3BFFA 4N9KA 4PM6A 2M7UA 4X1LA 5CHMA 2JE5A 4X55A 1JNUA 1AXBA 3O5YA 2VV6A 1XGJA 2FFFB 1NJ4A 2J9OA 2ZMFA 3EWKA 3A3EA 4BBUA 4OONA 3MKFA 3ICYA 4O8GA 4GD8A 4WLAA 3B3XA 3ZDJA 5KSCA 1L0EA 3IF6B 1MWSA 2V1AA 2XA7S 4P6BA 2M7VA 4G3VA 3LY4A 5DF7A 2V0WA 3VOYA 3IXHA 2YKFA 2WKHA 4XUXA 3O88A 1Y54A 4H6JB 2GNXA 3MKEA 2VX8A 3BY9A 4WEJA 1QMEA 1YSQA 3LIBA 3BM6A 4YNRA 5A92A 4ARZA 2J3TD 4QB8A 4HJ3A 5GLAA 5GHZA 3LYXA 4EBLA 1KGFA 3TW8A 5J4EA 2QYBA 3GR2A 2IWBA 3NDGA 4Y2FA 4RVAA 3ITAA 3G32A 3RXXA 1JTDA 1O7EA 4U0TA 1PW8A 4HBUA 5G18A 5HWWA 1BLCA 3SH7A 1K4FA 4HJ6A 2A3UA 3VOZA 3VP0A 4X53A 2ZC5B 4PM8A 5DTTA 3ZG0A 4MEZA 2HDSA 5IU1A 2XEPA 2PR6A 2XA7M 5U47A 3P98A 1W8YA 4K08A 3GDIA 3NDEA 4OOYA 3UMDA 4LRZE 1KE4A 2DCFA 5J3WA 3NIAA 5I94A 4P6ZS 1LLBA 2WKRA 1F98A 1NYMA 3BEBA 3MR0A 1V9ZA 1T19A 4NXGA
chains in the Genus database with same CATH topology
2PD8A 3P01A 1S1YA 2O9AA 3PBSA 4RQ9A 3NJAA 1NRJA 1LL8A 2YKHA 2L0WA 4YOFA 2PD7A 5DFXA 3K2NA 3RFBA 1OTDA 3D72A 2DMWA 5KIZA 4EXOA 1D7EA 4HI4A 4Z1WA 4Y3IA 3KX0X 3MJQA 3BQ8A 1XJ3A 4M4XA 2OAP1 4HIAA 3C2WA 2LB5A 2B02A 3T4QA 4Y5FA 5HWVA 1D06A 4R3AA 4I3IA 2NUTC 3UB9A 4EU0A 4YWZA 3UMEA 2G7UA 4KQOA 2EWWA 2VGLM 2VLGA 4BWIA 2KX6A 3E4OA 1S67L 2O9BA 1OT9A 3PR6A 5G4YA 3CI6A 3JVVA 4DN0A 4EQ1A 3K3DA 4NXBA 2BASA 4KUOA 3K3CA 3LI8A 2ZOHA 2A24B 3T4TA 4PKYA 3IS2B 5LBRA 3KSHA 4ETXA 2EWVA 1TF1A 2ZMVA 5HPIA 2VV7A 1NWZA 4LRYC 3EQVA 4CLCE 3KYZA 1OT6A 4MDZA 1T1AA 3G6OA 4NXEA 3R7WA 3P7NA 5AJGA 4MCWA 1N9OA 1XFNA 2VGLS 4O0PA 2A24A 5DJUA 1IOUA 1TS8A 3MF0A 1H3QA 3ZYTA 1ODVA 4AFIA 5I5LA 4ETZA 3KSIA 5DKLA 2PYPA 4UQIM 4EESA 2OWJA 3E4QA 5HD3A 5F5YA 1XJ4A 4CLCB 2HJ9C 4HOIA 2K2NA 4I38A 4HY8A 4EUVA 3UB6A 3OC2A 2W3HA 3CAXA 3PHYA 5HL6A 3VOLA 3ZQ5A 3PBOA 4WN5A 3BWLA 4DJ2A 1DP8A 2OWHA 5L8MA 4BBVA 1LSWA 1W63Q 3GECA 4PHTA 3MXQA 2H28A 4FSFA 4DMZA 5TBMA 2OOLA 1YSPA 3ULFA 4KUKA 2QWSA 3FPWA 2VKSA 1S4SA 4BJPA 1OJ5A 2O9CA 4HJ4A 1XFQA 3E98A 4ME4A 2HJEA 3UB7A 3KSGA 4GS9A 3EEHA 2GZAA 2JKTI 2VEAA 1UWNX 2W3EA 5F68A 4MMNA 3LI9A 5C5KA 3BJNA 1VHMA 4JGPA 3T4SA 3W2ZA 1GSVA 3LIAA 5AVEA 2V0UA 1TS7A 4MN6A 3PBRA 4EW7A 2QHKA 1F9IA 4R70A 2ZOIA 3IS2A 4GS9B 3FG8A 2K31A 4IUKA 3SW1A 2HGVA 3TRCA 1G6OA 3F1OB 4EEPA 4II7A 3LFVA 4CLCA 2W0NA 3LIFA 3DBAA 5AVFA 3H9WA 3R7WB 2XSSA 1LT0A 2PT7A 4HNBA 4WL9A 4P6ZM 4DJ3A 1YKDA 5HD5A 2HV1A 3F1NB 3MFXA 2P08A 4GW9A 3PBNA 3RTYA 2FZ0A 3H7WA 3KYQA 4WELA 3F1PA 4NKPA 1OTEA 4XT2A 2M1CA 1YAXA 1KOUA 3EGDC 2O0YA 3PBTA 2Z6CA 2W3DA 3BQAA 3B42A 4I3AA 4OOMA 3S7PA 2FH5A 2IA2A 3NOUC 5G4ZA 3NHQA 5EFWA 4UEYA 3LIEA 4LLOB 3S7QA 5HPFA 3D3OA 3T4LA 1ZTUA 4L9EA 2QJ5A 4WF0A 5CX7A 2HF6A 1W63M 3E4PA 2D01A 4MN5A 5HDSA 3RH8B 3F1NA 2A2LA 4H6JA 1VB6A 5K5BA 3TE8A 2I9VA 2WKQA 3UE6A 4L9FA 3MQ0A 5IT5A 3H7WB 3FPVA 3EQUA 4ARZB 3R4KA 1GSXA 1MZUA 2JKTM 3S7NA 3LICA 5J7EA 3HJKA 4Q0HA 4HH3A 4LPZA 1BYWA 4Q0IA 3BW6A 1OTIA 1UGUA 2L4RA 1G28A 1TD5A 2W1RA 2W3GA 3CLOA 4G3KA 4L9GA 5HZHA 1ZHHB 3OOVA 1Y28A 2LB9A 4GHIA 1LSVA 3B47A 3C8CA 1NLYA 4HHDA 3VV4A 4E04A 3LUQA 1X0OA 2PR5A 2PYRA 2XRNA 3A0VA 4HP9A 2Z6DA 1S4RA 3LR4A 2PDRA 3MQQA 4B9OA 3JVUA 4NXFA 4EETB 4MN7A 2L1MA 3KSFA 4R38A 4F3LA 3UB8A 2VJWA 4HQAA 4HP4A 4PAUA 2V1BA 4I39A 1TS6A 3HJIA 4GLQA 2CMNA 2W27A 4G3WA 2J80A 3T4KA 2MJ6A 3EEAA 2O99A 1F5MA 3OBFA 1TS0A 2KDKA 1OPXA 4IJGA 4WUJA 4EERA 2B18A 1XJ6A 3E0YA 4BMWA 1LSXA 2QJ7A 2VZWA 3B33A 1DRMA 2INWA 1P9RA 5HDCA 2GJ3A 3IBRA 3LIDA 2P04A 1EW0A 2KLIA 5KSHA 2W1TB 5FL3A 1T1CA 3MQOA 3T50A 3LR5A 4Q0JA 2VV8A 2QKPA 1OTAA 1T1BA 2GX5A 4GCZA 4BBTA 1T18A 1UWPX 2V9AA 4UQIS 3LR3A 1DP9A 2W3FA 4JGOA 4XT2B 1H8MA 3IBJA 2W1TA 3NOPC 2M7UA 1S66L 3OCLA 2OAQ1 4PKYG 2JN7A 3CITA 5DF9A 1JNUA 3O5YA 1IFQA 2VV6A 3KO6A 2ZMFA 3H82B 4L0LA 3EWKA 4F3LB 1MC0A 4BBUA 3V67A 4ZRRA 2Y8HA 3ICYA 3OCNA 2XROA 4O8GA 4WLAA 2VA0A 2R78A 2PHYA 2V1AA 4QPRA 5F6AA 2XA7S 3HCYA 2NUPC 2M7VA 4G3VA 5HSQA 4EEUA 2V0WA 3A0RA 3F1PB 4HH2A 4NEED 2YKFA 3EOIA 1STZA 2EA9A 2J3TC 3CWFA 3BY8A 3MMHA 1P9WA 4CQHA 1S1ZA 5DJTA 3LR0A 4IUHA 4B93A 4H6JB 2GNXA 4I3JA 3U2AA 2J3WA 4FOFA 2VX8A 3BY9A 3T4JA 4WEJA 1MKMA 4OOLA 4WEKA 1YSQA 3LIBA 4YNRA 3FC7A 4ARZA 1OJGA 2J3TD 3PXPA 3H82A 2Y79A 3OLOA 4HJ3A 1DP6A 3LYXA 1WA9A 3EGXC 5DFYA 3VE3A 3TW8A 5J4EA 1P0ZA 2QYBA 3NOTC 3T4OA 5HDDA 3PBQA 2P7JA 3VE4A 1V9YA 5TBMB 3CUEA 5DKKA 3UE3A 2WKPA 4Y2FA 5HWTA 3PYPA 4LRXC 4O01A 3C38A 2JKRI 1GSWA 5A8BA 1NLZA 5TJJA 2JKRM 4IHQA 1XJ2A 2KOIA 5HWWA 5IS1A 4HJ6A 3TJZC 3A0SA 4CLCC 4JGQA 1N9LA 2JHEA 2D02A 4R6LA 2ZBBA 3C30A 5F69A 5IU1A 2PR6A 4CLCD 2XA7M 5MC7A 4K08A 4GHIB 3GDIA 3UMDA 4LRZE 2K7SA 5J3WA 3CUEC 1P97A 1OTBA 4P6ZS 3S7OA 2WKRA 1F98A 1N9NA 4GJ4A 4KQDA 3MR0A 3F1OA 4JGRA 1V9ZA 1T19A 4I5SA 4NXGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PD8 A;  1S1Y A;  4PKY G;  4KUK A;  2JN7 A;  4L9F A;  2QWS A;  3UE6 A;  1JNU A;  4RQ9 A;  1S4S A;  3NJA A;  2VV6 A;  3H7W B;  1OJ5 A;  1LL8 A;  2YKH A;  2L0W A;  1XFQ A;  2PD7 A;  4HJ4 A;  1GSX A;  1MZU A;  3UB7 A;  3H82 B;  4F3L B;  3EWK A;  1OTD A;  3D72 A;  3LIC A;  4BBU A;  5J7E A;  3HJK A;  3EEH A;  4GS9 A;  4HH3 A;  4LPZ A;  2VEA A;  3ICY A;  5KIZ A;  1UWN X;  1BYW A;  5F68 A;  4EXO A;  1D7E A;  4HI4 A;  4WLA A;  1OTI A;  3LI9 A;  3KX0 X;  1UGU A;  2R78 A;  2PHY A;  3MJQ A;  4JGP A;  2L4R A;  2V1A A;  5F6A A;  1XJ3 A;  4M4X A;  1G28 A;  4HIA A;  3C2W A;  3CLO A;  1GSV A;  3LIA A;  4L9G A;  4EEU A;  5HSQ A;  5AVE A;  5HZH A;  2V0W A;  2B02 A;  2V0U A;  1TS7 A;  3A0R A;  3F1P B;  4HH2 A;  4MN6 A;  1Y28 A;  2WKQ A;  2YKF A;  4GHI A;  1LSV A;  3ULF A;  2EA9 A;  4EW7 A;  5HWV A;  2QHK A;  3CWF A;  1D06 A;  3C8C A;  4R3A A;  1F9I A;  4I3I A;  4R70 A;  3UB8 A;  4HHD A;  3BY8 A;  2ZOI A;  3IS2 A;  4GS9 B;  3FG8 A;  3UB9 A;  4E04 A;  3LUQ A;  1X0O A;  4YWZ A;  3UME A;  1S1Z A;  5DJT A;  2PR5 A;  4H6J B;  2VLG A;  3SW1 A;  2KX6 A;  3E4O A;  2PYR A;  4I3J A;  3A0V A;  1S67 L;  3F1O B;  4HP9 A;  2Z6D A;  1S4R A;  1OT9 A;  3BY9 A;  4EEP A;  5G4Y A;  2PDR A;  3MQQ A;  4B9O A;  2W0N A;  3LIF A;  3LIB A;  1V9Z A;  4NXF A;  4EET B;  3FC7 A;  5AVF A;  3H9W A;  1OJG A;  4EQ1 A;  3K3D A;  2L1M A;  4NXB A;  1LT0 A;  2BAS A;  3H82 A;  4R38 A;  4F3L A;  4KUO A;  3K3C A;  3OLO A;  4HNB A;  4WL9 A;  4HJ3 A;  4HP4 A;  4HQA A;  3LI8 A;  2ZOH A;  2A24 B;  1DP6 A;  2V1B A;  1TS6 A;  4I39 A;  3LYX A;  1WA9 A;  4DJ3 A;  3HJI A;  4PKY A;  3IS2 B;  5HD5 A;  2HV1 A;  3F1N B;  3VE3 A;  2CMN A;  2W27 A;  3MFX A;  1P0Z A;  5J4E A;  3NOT C;  2J80 A;  5HDD A;  2P7J A;  3VE4 A;  1V9Y A;  5TBM B;  4GW9 A;  2VV7 A;  5DKK A;  4WUJ A;  3RTY A;  1NWZ A;  1TS0 A;  2KDK A;  2WKP A;  4LRY C;  5HWT A;  3PYP A;  4LRX C;  4EER A;  3H7W A;  1XJ6 A;  1LSX A;  1OT6 A;  2QJ7 A;  3B33 A;  1GSW A;  3F1P A;  1T1A A;  1DRM A;  4NXG A;  2INW A;  3G6O A;  5A8B A;  1OTE A;  4XT2 A;  4NXE A;  5HDC A;  3P7N A;  2GJ3 A;  3IBR A;  3LID A;  1N9O A;  1XFN A;  1EW0 A;  2M1C A;  1KOU A;  3T50 A;  1T1C A;  1XJ2 A;  3MQO A;  5HWW A;  2A24 A;  2Z6C A;  5DJU A;  5IS1 A;  1TS8 A;  4HJ6 A;  2VV8 A;  1ODV A;  2QKP A;  3A0S A;  5I5L A;  1OTA A;  1T1B A;  5DKL A;  4JGQ A;  1N9L A;  4I3A A;  2JHE A;  2D02 A;  2PYP A;  4R6L A;  4EES A;  2OWJ A;  2ZBB A;  3E4Q A;  5F69 A;  5IU1 A;  5HD3 A;  4GCZ A;  2PR6 A;  4BBT A;  1T18 A;  1UWP X;  5F5Y A;  1XJ4 A;  3NOU C;  3NHQ A;  2V9A A;  5G4Z A;  5EFW A;  3LIE A;  4LLO B;  4HOI A;  4I38 A;  4GHI B;  1DP9 A;  3GDI A;  4HY8 A;  4K08 A;  3UB6 A;  3UMD A;  3CAX A;  4L9E A;  3PHY A;  2QJ5 A;  4JGO A;  4LRZ E;  4WF0 A;  4XT2 B;  2K7S A;  3VOL A;  5J3W A;  3ZQ5 A;  4WN5 A;  3BWL A;  4DJ2 A;  3E4P A;  2D01 A;  1DP8 A;  4MN5 A;  1P97 A;  1OTB A;  2OWH A;  3F1N A;  3NOP C;  5HDS A;  1LSW A;  3GEC A;  1S66 L;  3RH8 B;  4H6J A;  3MXQ A;  4BBV A;  2H28 A;  2WKR A;  1F98 A;  1N9N A;  1VB6 A;  4KQD A;  3MR0 A;  3F1O A;  4JGR A;  2I9V A;  1T19 A;  5TBM A;  4I5S A;  2OOL A; 
#chains in the Genus database with same CATH topology
 1H8Z A;  2PD8 A;  1S1Y A;  2O9A A;  1H5X A;  3PBS A;  3I7J A;  2PD7 A;  3K2N A;  1K56 D;  3C7U A;  3D72 A;  1SDN A;  1MXO A;  2ZD8 A;  5KIZ A;  1Q2P A;  4Y3I A;  2H5S A;  1FSY A;  2HDQ A;  3QP1 A;  4LEN A;  3BQ8 A;  3MXS A;  3UPO A;  1Z6F A;  4ZJ1 A;  2LB5 A;  2UWX A;  2PRF A;  3OPR A;  2EFX A;  4I3I A;  3Q82 A;  4YWZ A;  1J3W A;  2G7U A;  2EXA A;  3E4O A;  3Q7V B;  3CHW P;  2O9B A;  1OT9 A;  1ESI A;  3V50 A;  3PR6 A;  5G4Y A;  4DN0 A;  2BAS A;  4DXB A;  1K55 A;  1HVB A;  4FH4 A;  4A5R A;  1TF1 A;  4QU3 A;  3LCE A;  2XFT A;  4LRY C;  1KE3 A;  3G2Z A;  4QJG A;  1T1A A;  2QMI A;  3R7W A;  4JKT A;  4MCW A;  1XFN A;  3SS3 A;  2C6W B;  2VGL S;  4O0P A;  3MF0 A;  4RX3 A;  1ODV A;  4AFI A;  1LL5 A;  5DKL A;  1SKO B;  2OWJ A;  5JYP A;  5F5Y A;  4DDS A;  3FWL A;  5TFQ A;  4FUW A;  1ERQ A;  5GHX A;  1PI5 A;  4EUV A;  4R4S A;  4E3O A;  1PW1 A;  5CGS A;  3PBO A;  4WN5 A;  2Q9M A;  1YLT A;  2OWH A;  1W63 Q;  3GEC A;  4FD8 A;  3AGF A;  1YSP A;  2V20 A;  3KYE A;  4JF5 A;  1VM1 A;  4GOG A;  2HJE A;  4R4R A;  5L2F A;  4B88 A;  3G30 A;  2JKT I;  2W3E A;  5F68 A;  4MMN A;  5EVL A;  1SZV A;  3LI9 A;  3U4L P;  3V3S A;  3BJN A;  1MPL A;  3T4S A;  3IX3 A;  5FQI A;  1HD8 A;  1VEU A;  4JXV A;  1BLH A;  1TS7 A;  5FAS A;  1CEF A;  3E2K A;  4LV1 A;  1K55 C;  3IS2 A;  1W79 A;  1LI9 A;  5KMW A;  3FKW A;  1G6O A;  3WS5 A;  4CLC A;  3UDI A;  5AVF A;  3H9W A;  2PT7 A;  5IHV A;  4HNB A;  2ZQ7 A;  4IVK A;  5FEG A;  5GHY A;  3MFX A;  2WZX A;  3IF6 A;  4PM7 A;  4GD6 A;  3RTY A;  2FZ0 A;  3KYQ A;  2G2W A;  4DE0 A;  1L2S A;  4XT2 A;  3NCK A;  1ES2 A;  3G2Y A;  1PRQ A;  3MZF A;  2W3D A;  4JF6 A;  4OOM A;  2JKG A;  3S7P A;  2BG1 A;  5E2G A;  1RGY A;  5L07 A;  5FAP A;  5CRF A;  4S2J A;  2P9V B;  5EFW A;  4UEY A;  2H10 A;  4QY6 A;  1E3U A;  3T4L A;  1TDG A;  4FH2 A;  1E3U D;  3F1N A;  5FAT A;  1S0W A;  5K5B A;  3PAE A;  3C4O A;  1VET B;  3UE6 A;  1ES4 A;  4E3I A;  3MQ0 A;  5IT5 A;  3H7W B;  3IF6 C;  1ES3 A;  3S7N A;  3P09 A;  1PWD A;  4HH3 A;  3AGD A;  3VFH A;  3N4I A;  1UGU A;  3TSG A;  3FZC A;  2XK1 A;  3V5M A;  5L09 A;  4G3K A;  4L9G A;  4C6Y A;  5HZH A;  5EPH A;  4KG6 A;  2EX8 A;  2LB9 A;  4GHI A;  2VGK A;  3ITB A;  4HHD A;  3N7W A;  3MFD A;  2ZM0 A;  3ZNT A;  1RP5 A;  4JPM A;  1DY6 A;  1L0D A;  1K4E A;  1S4R A;  4GZB A;  5FDS A;  3MQQ A;  3IH9 A;  4NXF A;  5GL9 A;  4MN7 A;  4R38 A;  2VJW A;  2V1B A;  3G34 A;  2W27 A;  4S2M A;  3EEA A;  4IJG A;  4PM5 A;  2B18 A;  2QJ7 A;  1P9R A;  2OLV A;  5HDC A;  5HAQ A;  2P04 A;  4U3T A;  1T1C A;  3MQO A;  4GDN A;  3LR5 A;  2P74 A;  3HLF A;  2QKP A;  1JWZ A;  1VET A;  3M6H A;  2H0Y A;  3Q81 A;  4UQI S;  3LR3 A;  2XD1 A;  3IXB A;  1MY8 A;  4XT2 B;  3D4F A;  1HZO A;  3NOP C;  5FQQ A;  1S66 L;  1ES5 A;  4CJN A;  2JN7 A;  2V8C A;  4GKU A;  2OV5 A;  3KO6 A;  4XUZ A;  4E6X A;  4L0L A;  2EX2 A;  3LO7 A;  3OCN A;  4DXC A;  3ZG9 B;  1XX2 A;  2R78 A;  2E8I A;  2WAF A;  4QPR A;  3HCY A;  2NUP C;  4Q8I A;  4BL3 A;  2B5R A;  3FYZ A;  1MWT A;  4N9L A;  1FR6 A;  3A0R A;  5FI7 A;  1JTG A;  3OPP A;  1C3B A;  1S1Z A;  4JXS A;  3SZT A;  1CK3 A;  2EXB A;  3LR0 A;  4B93 A;  3DTI A;  1W5D A;  5FQJ A;  4S2I A;  3T12 B;  4OOL A;  2PU2 A;  4WEK A;  1IKG A;  3FC7 A;  5GLC A;  4X68 A;  3CMZ A;  2Y79 A;  4OQH A;  2Y59 A;  4BQM A;  1MKI A;  1WA9 A;  1ESU A;  3VE3 A;  3T4O A;  4O7D A;  5HDD A;  3PBQ A;  3VE4 A;  3CUE A;  4OH0 A;  4LRX C;  4S2N A;  5FA7 A;  1H8Y A;  1NZO A;  5A8B A;  3WWX A;  1NLZ A;  2Q9N A;  1ZG6 A;  3MS6 A;  5IS1 A;  4CLC C;  2JHE A;  1PYY A;  3CPT B;  5F69 A;  1PFL A;  3S22 A;  2K7S A;  5CEB A;  1P97 A;  1OTB A;  1HLU P;  3QP2 A;  1VQQ A;  4KG2 A;  4RA7 A;  3LY3 A;  2XQZ A;  1LL8 A;  1ZC2 A;  4YOF A;  1GHP A;  3IHB A;  5FDH A;  1OTD A;  5FI6 A;  2ZQD A;  4DRT A;  1TVF A;  4EXO A;  1D7E A;  4HI4 A;  3KX0 X;  1XJ3 A;  4M4X A;  2OAP 1;  3UPP A;  2B02 A;  3T4Q A;  5FQK A;  1E4D A;  2Y2M A;  5HWV A;  1D06 A;  2NUT C;  3CZD A;  3HLG A;  2B95 A;  3UB5 P;  1SKO A;  4JBF A;  1YM1 A;  2P9V A;  5FSR A;  4MBK A;  4P87 A;  3K3D A;  3BRM A;  1K6R A;  1YPR A;  3QP5 A;  4KUO A;  2ZOH A;  1D1J A;  1K0K A;  4PKY A;  5LBR A;  2QZ6 A;  4ETX A;  1G68 A;  2VV7 A;  3Q1F A;  4LCL A;  1XXM A;  4KZA A;  4CLC E;  4P0M A;  3MBZ A;  4NXE A;  3P7N A;  1FR1 A;  5AJG A;  4H8R A;  4HES A;  1TS8 A;  2Q0O A;  3E2L A;  3Q7Z A;  4ETZ A;  3KSI A;  4HBT A;  2BLS A;  2PYP A;  5AQ7 A;  2X02 A;  1XJ4 A;  3BYD A;  1AWI A;  1BLP A;  1SKF A;  3MSH A;  3T1S A;  3CAX A;  3ZQ5 A;  4DJ2 A;  3JPU A;  1DP8 A;  1WYC A;  4BBV A;  4PHT A;  3QP4 A;  1Q2Q A;  2H28 A;  3JYI A;  4FSF A;  4Y15 A;  4DMZ A;  2OOL A;  5E43 A;  4KUK A;  3W4Q A;  1XPB A;  2O9C A;  3IHA A;  4ME4 A;  2WAD A;  3KSG A;  3EEH A;  1EWZ A;  2VEA A;  4GNU A;  3A3D A;  3VP1 A;  4JGP A;  4KZ9 A;  3WS2 A;  3C4P A;  1GSV A;  3G31 A;  2V0U A;  2CC1 A;  3PBR A;  1F9I A;  4OQ0 A;  4GS9 B;  3QNC A;  4ZJ2 A;  4IUK A;  3SW1 A;  4DKI A;  3SS4 A;  3SS5 A;  3SH9 A;  4EEP A;  5CER A;  2J7V A;  5E2F A;  4WL9 A;  4KEN B;  1FCO A;  4S2L A;  4DJ3 A;  2HV1 A;  2V2F F;  1FCM A;  3ZVT A;  3LEZ A;  3FKV A;  3S1Y A;  1BZA A;  4Y0T A;  1OTE A;  1YAX A;  5F82 A;  2O0Y A;  3PBT A;  4ID4 A;  2HP5 A;  3BQA A;  1L0G A;  4ZJ3 A;  2XLN A;  2IA2 A;  3NHQ A;  4WMC A;  4BD0 A;  5A93 A;  3IX8 A;  3S7Q A;  4GN2 A;  2QJ5 A;  4WF0 A;  3HLD A;  2D01 A;  4N1X A;  5HDS A;  4UA9 A;  4ZDX A;  4NET A;  5GLD A;  5JYO A;  5CEC A;  1PWC A;  3HJK A;  4MLL A;  4QY5 A;  4WYY A;  3Q07 A;  2ZC3 B;  4Q0I A;  3UE0 A;  3BW6 A;  3BLS A;  5FAQ A;  4UAA A;  3CLO A;  5F1F A;  3N8R A;  3L9K A;  3OOV A;  5KZH A;  3IX4 A;  1NLY A;  1O07 A;  1SHV A;  2J9P A;  1HTZ A;  1K57 C;  1GHM A;  2PYR A;  2PBD P;  2PBY A;  2JCH A;  4RYE A;  4B9O A;  3JVU A;  1Y4O A;  4EET B;  2G2U A;  2L1M A;  4HP4 A;  4I39 A;  3DAV A;  3M2J A;  2QPN A;  1L0F A;  4EV4 A;  4WUJ A;  5HW3 A;  1H0M A;  1XJ6 A;  3B33 A;  4S2O A;  2INW A;  4MNR A;  3IBR A;  3LID A;  3S4X A;  3GTC A;  5FL3 A;  1ZG4 A;  2Y2I A;  1KDS A;  5FI2 A;  1ONG A;  2GX5 A;  4FCF A;  4BBT A;  2Y91 A;  2WK0 A;  2EX9 A;  1YLJ A;  3A3I A;  5HAI A;  1CI9 A;  1DP9 A;  1YQS A;  4KZ5 A;  1H8M A;  1LHY A;  4M3K A;  4X69 A;  3WS0 A;  2W1T A;  1IYQ A;  3OCL A;  4PKY G;  1BT5 A;  3CIT A;  5DF9 A;  1NYY A;  3BFC A;  4F3L B;  1MC0 A;  4C3Q A;  3MZE A;  4KG5 A;  1YLZ A;  2Y8H A;  4IBR A;  2XRO A;  4WZ4 A;  5CGW A;  2VA0 A;  2DNS A;  5F6A A;  4UA7 A;  3WS4 A;  2XFS A;  4N1H A;  4EEU A;  5HSQ A;  2EFU A;  4CPK A;  3F1P B;  3EOI A;  3GRJ A;  1STZ A;  3CWF A;  4OQG A;  3MMH A;  5EVI A;  1P9W A;  5CTM A;  4CQH A;  5DJT A;  3VSL A;  4OP8 A;  5CHU A;  2V8F A;  4I3J A;  4YIN A;  2J3W A;  1U60 A;  1OJG A;  3H82 A;  4UHU A;  3IWQ A;  3QNB A;  3OLO A;  1DP6 A;  1FSW A;  3NC8 A;  2ZC6 B;  1P0Z A;  2WKI A;  1BUL A;  1KVM A;  2P7J A;  1V9Y A;  5TBM B;  2WZZ A;  5DKK A;  3UE3 A;  5HWT A;  5EVI C;  3HUN A;  4PM9 A;  2Y2H A;  1XJ2 A;  1G6A A;  3NEC A;  3C7V A;  3A0S A;  4JGQ A;  3TG9 A;  2WAE A;  2RCX A;  4CLC D;  1EI5 A;  1NRF A;  3ZG8 B;  5A91 A;  4B4X A;  4GHI B;  4OPR A;  3CUE C;  4OPZ A;  1N9N A;  4KQD A;  3O3V A;  3O86 A;  3F1O A;  3ZNY A;  2XGN A;  4ZAM A;  3W4P A;  3NJA A;  1NRJ A;  2Z2M B;  2YKH A;  2L0W A;  1L3L A;  5DFX A;  4Y17 A;  4X6T A;  2DMW A;  1IKI A;  4BLM A;  2JC7 A;  4HIA A;  5DF8 A;  3C2W A;  2ZL1 A;  4Y5F A;  2Y2N A;  3CJM A;  2ZM2 A;  5AQ9 A;  1JWP A;  3UME A;  3BFG A;  4KQO A;  3NI9 A;  4BWI A;  2XR0 A;  1SCW A;  3JVV A;  4JF4 A;  2WYX A;  4EQ1 A;  3WRZ A;  4NXB A;  2C5W B;  3K3C A;  3IWI A;  2WGV A;  4KZ7 A;  3T4T A;  3IS2 B;  3KSH A;  3WRT A;  4Z9Q A;  3A3J A;  3HL9 A;  4WM9 A;  3C5A A;  4OPY A;  5HPI A;  2ZQA A;  3HUM A;  4R1G A;  3EQV A;  5TGF A;  2HDU A;  1OT6 A;  4MDZ A;  3G6O A;  2R9W A;  1N9O A;  4E3J A;  2A24 A;  3UN7 A;  3HVF A;  3VP2 A;  3N6I A;  5E2H A;  4EES A;  1MWU A;  4JXW A;  3GQZ A;  5HD3 A;  2VK3 A;  4CLC B;  4HOI A;  4I38 A;  4F94 A;  3UB6 A;  3OC2 A;  2W3H A;  5CTN A;  3VOL A;  3BWL A;  4DE1 A;  3ZFZ A;  1LSW A;  3A3F A;  3MXQ A;  1PIO A;  2Z2L B;  3W4O A;  3ULF A;  1IYO A;  3FPW A;  4E6W A;  2VKS A;  1S4S A;  4BJP A;  3GMW A;  1TDL A;  1OJ5 A;  3IXD A;  5F83 A;  4HJ4 A;  3T1X A;  1FIK A;  4KZ6 A;  4GS9 A;  1E25 A;  4K91 A;  4QWO A;  1UWN X;  3BFE A;  3MZD A;  3TOI A;  1RGZ A;  5C5K A;  1N4O A;  3BLM A;  1QMF A;  5AVE A;  4PMA A;  2WGI A;  2QHK A;  4R70 A;  3FG8 A;  3WS1 A;  2K31 A;  2FFY A;  4HEF A;  4KZB A;  1CI8 A;  3IT9 A;  3UO9 A;  4ZBE A;  5EE8 A;  3LFV A;  2W0N A;  2I72 A;  3DBA A;  3D9Y A;  3R7W B;  1LT0 A;  4BEN A;  3DTE A;  3W8K A;  1GCE A;  2JKF A;  3RJU A;  4BD1 A;  3IXG A;  3LEQ A;  1YKD A;  5HD5 A;  1LI0 A;  1YMS A;  2A49 A;  4K0X A;  1IEL A;  1FOF A;  1GA0 A;  4OP5 A;  3F1P A;  3OZH A;  3FV7 A;  4DDY A;  1A0K A;  3EGD C;  4MBF A;  3IH8 A;  3UY6 A;  4I3A A;  3PAG A;  5CXW A;  2UV0 E;  1MWR A;  5HPF A;  4C75 A;  5A90 A;  2ZLY A;  4Y0O A;  1PZO A;  3E4P A;  3RH8 B;  4H6J A;  3HLC A;  1VB6 A;  3TE8 A;  1I2W A;  2WKQ A;  1K54 A;  3VFF A;  4L9F A;  4X25 A;  4ARZ B;  4OQI A;  1IYP A;  1GSX A;  1MZU A;  2JKT M;  3DWZ A;  3R4K A;  4N92 A;  3GV9 A;  4K0W A;  2Y2Q A;  4NK3 A;  4OLD A;  3GVB A;  1BYW A;  1IEM A;  2BTF P;  2W1R A;  2W3G A;  2EX6 A;  5EVI D;  5M18 A;  3ZVW A;  1SDE A;  1DJA A;  1LSV A;  3C8C A;  1FIL A;  3VV4 A;  4Y7P A;  3HLB A;  2Y2J A;  3DWK A;  1ACF A;  4HP9 A;  4OPQ A;  2XD5 A;  4D2O A;  1VEU B;  4X56 A;  3KSF A;  1CF0 A;  3UB8 A;  5J8X A;  4HQA A;  4PAU A;  1TS6 A;  3HJI A;  1YLW A;  1G5U A;  4LV3 A;  2XH9 A;  2CMN A;  1CQA A;  4G3W A;  2J80 A;  3T4K A;  2MJ6 A;  1F5M A;  5L10 A;  2KDK A;  1OPX A;  4EER A;  2JBF A;  3VSK A;  2VGJ A;  3E0Y A;  4KZ8 A;  1LSX A;  1YT4 A;  1DRM A;  1Z09 A;  4S2N C;  2KLI A;  2W1T B;  5CGX A;  4Q0J A;  5EM0 A;  3IF5 A;  1T1B A;  1CJF A;  4GCZ A;  4E3L A;  1T18 A;  1UWP X;  4S2K A;  2V9A A;  1LL9 A;  4DF6 A;  1YMX A;  4IBX A;  3IBJ A;  1IYS A;  3UE1 A;  3Q7V A;  3PTE A;  2OAQ 1;  3N8S A;  1K6S A;  3UPN A;  1IFQ A;  1XA7 A;  2E8J A;  5CED A;  1JWV A;  3H82 B;  5BOH A;  5EVI B;  3V67 A;  3VP4 A;  4ZRR A;  3UDX A;  2PHY A;  5AQA A;  4HH2 A;  4NEE D;  2ZJ9 A;  2EA9 A;  2J3T C;  3HBR A;  4LCM A;  1ALQ A;  4EBP A;  2IWD A;  3BY8 A;  3L7H A;  5DTK A;  2X71 A;  4IUH A;  4R23 A;  4Y13 A;  1NZU A;  4OKP A;  5GLB A;  1PI4 A;  4RX2 A;  3U2A A;  2HP9 A;  2OLU A;  1YLP A;  3HRE A;  4FOF A;  3T1R A;  3T4J A;  4E3K A;  4EWF A;  1MKM A;  3PXP A;  4E3N A;  5FQM A;  2Y2P A;  3EGX C;  5DFY A;  1XGI A;  1M40 A;  3NOT C;  4WZ5 C;  4S2P A;  3HUO A;  3SOI A;  2WKP A;  5EEC A;  4BL2 A;  3PYP A;  4O01 A;  3C38 A;  1JVJ A;  2JKR I;  1GSW A;  5TJJ A;  2JKR M;  2X01 A;  4IHQ A;  4JXG A;  2KOI A;  4KQR A;  3TJZ C;  1N9L A;  4R6L A;  2D02 A;  2ZBB A;  4FTX A;  3C30 A;  5MC7 A;  1W8Q A;  3OPH A;  3ZGA B;  3S7O A;  4GJ4 A;  4JGR A;  4QD4 A;  4I5S A;  3P01 A;  2RL3 A;  5HFO A;  3VP3 A;  1CEG A;  1BTL A;  4RQ9 A;  1BSG A;  3ZHH A;  3RFB A;  1KGG A;  4EBN A;  4MBH A;  3ZCZ A;  4Z1W A;  1GA9 A;  3MJQ A;  4JLF A;  5EVE A;  4B4Z A;  4U0X A;  4R3B A;  4KZ3 A;  1WYB A;  1OME A;  3BEC A;  4R3A A;  3O87 A;  3UB9 A;  4EU0 A;  1K54 C;  2EWW A;  2VGL M;  5HL1 A;  2VLG A;  2KX6 A;  4E3M A;  1S67 L;  3N8L A;  3DW0 A;  1ERM A;  3SH8 A;  3CI6 A;  1DJC A;  1RCJ A;  3IQA A;  3LI8 A;  2A24 B;  2EWV A;  1ZKJ A;  2ZMV A;  3CPT A;  2WGW B;  1NWZ A;  4YFM A;  5TR7 A;  2ZM8 A;  3KYZ A;  4WZ5 A;  1KDW A;  1WE4 A;  2ZQ8 A;  4KQQ A;  4LGW A;  3NUL A;  5DJU A;  1IOU A;  1H3Q A;  3ZYT A;  2HDR A;  5HX9 A;  5I5L A;  4UQI M;  3E4Q A;  2WUQ A;  4IED A;  2HJ9 C;  2K2N A;  1PNE A;  3OPL A;  4HY8 A;  2Y2G A;  2ZC4 B;  3PHY A;  2J8Y A;  3BFD A;  5HL6 A;  5DTS A;  4R0Q A;  5L8M A;  3G4P A;  1BLS A;  2HZ5 A;  5E2E A;  5TBM A;  3MXR A;  2QWS A;  2ACG A;  2R9X A;  1XFQ A;  2PU4 A;  3E98 A;  3UB7 A;  5FAO A;  1MBL A;  2Y2L A;  2PAV P;  2GZA A;  4QHC A;  1N9B A;  1GHI A;  1XA1 A;  1VHM A;  3GSG A;  3T1Q B;  1XKZ A;  3ISG A;  1ERO A;  2WGW A;  3W2Z A;  4ESP A;  3LIA A;  4D60 A;  3UDF A;  4MN6 A;  1DJB A;  4EW7 A;  1ONH A;  4UA6 A;  5HAR A;  1XP4 A;  2OSU A;  3M2K A;  2ZOI A;  4OLG A;  4R3J A;  2WKE A;  3NBL A;  2HGV A;  3TRC A;  2GDN A;  5HAP A;  3F1O B;  2Y55 A;  4WMC D;  4KZ4 A;  4II7 A;  3LIF A;  5EM1 A;  2XSS A;  4P6Z M;  3M6B A;  1KVL A;  3F1N B;  2XF3 A;  2P08 A;  3V39 A;  5EUA A;  3DTM A;  4GW9 A;  5M19 A;  3PBN A;  2Y2K A;  5M1A A;  2IWC A;  3IWO A;  2ZL1 B;  1KGE A;  3H7W A;  4EUZ A;  4WEL A;  3HLW A;  2Y4A A;  4NKP A;  2M1C A;  1KOU A;  2AVX A;  4P85 A;  5AQB A;  2Z6C A;  5CHJ A;  3B42 A;  2FH5 A;  1FCN A;  1PWG A;  1NY0 A;  3NOU C;  5G4Z A;  2HPB A;  3LIE A;  4LLO B;  2HP6 A;  3D3O A;  1ZTU A;  4L9E A;  5CX7 A;  2HF6 A;  1W63 M;  4MN5 A;  3LGO A;  2ZQ9 A;  2A2L A;  3QHY A;  4WBG A;  2I9V A;  3QP6 A;  4LV2 A;  3UNW A;  3ZG7 B;  4EQI A;  3FPV A;  3EQU A;  3VMA A;  3LIC A;  5J7E A;  4Q0H A;  4LPZ A;  2H0T A;  1OTI A;  1NXY A;  2L4R A;  4GDB A;  4PPR A;  1G28 A;  1TD5 A;  1TEM A;  1YLY A;  4OVD A;  1ZHH B;  1Y28 A;  1FQG A;  3B47 A;  5F1G A;  1BUE A;  4E04 A;  3LUQ A;  1X0O A;  2PR5 A;  4DE3 A;  3ZG5 A;  5FEF A;  1W7F A;  2XRN A;  3A0V A;  3G35 A;  2Z6D A;  5FQ9 A;  3LR4 A;  2PDR A;  4NG2 A;  4IVI A;  1S6R A;  3QP8 A;  1K56 A;  1K25 A;  4Y0U A;  2XDM A;  4F3L A;  4X1M A;  5D3O A;  4ZTK A;  5EOE A;  2ZMA A;  4GLQ A;  1J9M A;  1M6K A;  2ZC7 A;  3HLE A;  2DRW A;  3V3R A;  2O99 A;  3OBF A;  1TS0 A;  5DVA A;  1PZP A;  3DTK A;  4BMW A;  4XXR A;  2VZW A;  5EV0 A;  3AGE A;  2GJ3 A;  1I5Q A;  1EW0 A;  5KSH A;  4LV0 A;  1F2K A;  3T50 A;  2VV8 A;  4GB7 A;  1KE0 A;  1I2S A;  4DE2 A;  1OTA A;  2V1Z A;  1K57 A;  5EOO A;  2Y2O A;  3CG5 A;  4LFU A;  1K38 A;  2W3F A;  4JGO A;  2ZQC A;  3NY4 A;  3RXW A;  3BFF A;  4N9K A;  4PM6 A;  2M7U A;  4X1L A;  5CHM A;  2JE5 A;  4X55 A;  1JNU A;  1AXB A;  3O5Y A;  2VV6 A;  1XGJ A;  2FFF B;  1NJ4 A;  2J9O A;  2ZMF A;  3EWK A;  3A3E A;  4BBU A;  4OON A;  3MKF A;  3ICY A;  4O8G A;  4GD8 A;  4WLA A;  3B3X A;  3ZDJ A;  5KSC A;  1L0E A;  3IF6 B;  1MWS A;  2V1A A;  2XA7 S;  4P6B A;  2M7V A;  4G3V A;  3LY4 A;  5DF7 A;  2V0W A;  3VOY A;  3IXH A;  2YKF A;  2WKH A;  4XUX A;  3O88 A;  1Y54 A;  4H6J B;  2GNX A;  3MKE A;  2VX8 A;  3BY9 A;  4WEJ A;  1QME A;  1YSQ A;  3LIB A;  3BM6 A;  4YNR A;  5A92 A;  4ARZ A;  2J3T D;  4QB8 A;  4HJ3 A;  5GLA A;  5GHZ A;  3LYX A;  4EBL A;  1KGF A;  3TW8 A;  5J4E A;  2QYB A;  3GR2 A;  2IWB A;  3NDG A;  4Y2F A;  4RVA A;  3ITA A;  3G32 A;  3RXX A;  1JTD A;  1O7E A;  4U0T A;  1PW8 A;  4HBU A;  5G18 A;  5HWW A;  1BLC A;  3SH7 A;  1K4F A;  4HJ6 A;  2A3U A;  3VOZ A;  3VP0 A;  4X53 A;  2ZC5 B;  4PM8 A;  5DTT A;  3ZG0 A;  4MEZ A;  2HDS A;  5IU1 A;  2XEP A;  2PR6 A;  2XA7 M;  5U47 A;  3P98 A;  1W8Y A;  4K08 A;  3GDI A;  3NDE A;  4OOY A;  3UMD A;  4LRZ E;  1KE4 A;  2DCF A;  5J3W A;  3NIA A;  5I94 A;  4P6Z S;  1LLB A;  2WKR A;  1F98 A;  1NYM A;  3BEB A;  3MR0 A;  1V9Z A;  1T19 A;  4NXG A; 
#chains in the Genus database with same CATH homology
 2PD8 A;  3P01 A;  1S1Y A;  2O9A A;  3PBS A;  4RQ9 A;  3NJA A;  1NRJ A;  1LL8 A;  2YKH A;  2L0W A;  4YOF A;  2PD7 A;  5DFX A;  3K2N A;  3RFB A;  1OTD A;  3D72 A;  2DMW A;  5KIZ A;  4EXO A;  1D7E A;  4HI4 A;  4Z1W A;  4Y3I A;  3KX0 X;  3MJQ A;  3BQ8 A;  1XJ3 A;  4M4X A;  2OAP 1;  4HIA A;  3C2W A;  2LB5 A;  2B02 A;  3T4Q A;  4Y5F A;  5HWV A;  1D06 A;  4R3A A;  4I3I A;  2NUT C;  3UB9 A;  4EU0 A;  4YWZ A;  3UME A;  2G7U A;  4KQO A;  2EWW A;  2VGL M;  2VLG A;  4BWI A;  2KX6 A;  3E4O A;  1S67 L;  2O9B A;  1OT9 A;  3PR6 A;  5G4Y A;  3CI6 A;  3JVV A;  4DN0 A;  4EQ1 A;  3K3D A;  4NXB A;  2BAS A;  4KUO A;  3K3C A;  3LI8 A;  2ZOH A;  2A24 B;  3T4T A;  4PKY A;  3IS2 B;  5LBR A;  3KSH A;  4ETX A;  2EWV A;  1TF1 A;  2ZMV A;  5HPI A;  2VV7 A;  1NWZ A;  4LRY C;  3EQV A;  4CLC E;  3KYZ A;  1OT6 A;  4MDZ A;  1T1A A;  3G6O A;  4NXE A;  3R7W A;  3P7N A;  5AJG A;  4MCW A;  1N9O A;  1XFN A;  2VGL S;  4O0P A;  2A24 A;  5DJU A;  1IOU A;  1TS8 A;  3MF0 A;  1H3Q A;  3ZYT A;  1ODV A;  4AFI A;  5I5L A;  4ETZ A;  3KSI A;  5DKL A;  2PYP A;  4UQI M;  4EES A;  2OWJ A;  3E4Q A;  5HD3 A;  5F5Y A;  1XJ4 A;  4CLC B;  2HJ9 C;  4HOI A;  2K2N A;  4I38 A;  4HY8 A;  4EUV A;  3UB6 A;  3OC2 A;  2W3H A;  3CAX A;  3PHY A;  5HL6 A;  3VOL A;  3ZQ5 A;  3PBO A;  4WN5 A;  3BWL A;  4DJ2 A;  1DP8 A;  2OWH A;  5L8M A;  4BBV A;  1LSW A;  1W63 Q;  3GEC A;  4PHT A;  3MXQ A;  2H28 A;  4FSF A;  4DMZ A;  5TBM A;  2OOL A;  1YSP A;  3ULF A;  4KUK A;  2QWS A;  3FPW A;  2VKS A;  1S4S A;  4BJP A;  1OJ5 A;  2O9C A;  4HJ4 A;  1XFQ A;  3E98 A;  4ME4 A;  2HJE A;  3UB7 A;  3KSG A;  4GS9 A;  3EEH A;  2GZA A;  2JKT I;  2VEA A;  1UWN X;  2W3E A;  5F68 A;  4MMN A;  3LI9 A;  5C5K A;  3BJN A;  1VHM A;  4JGP A;  3T4S A;  3W2Z A;  1GSV A;  3LIA A;  5AVE A;  2V0U A;  1TS7 A;  4MN6 A;  3PBR A;  4EW7 A;  2QHK A;  1F9I A;  4R70 A;  2ZOI A;  3IS2 A;  4GS9 B;  3FG8 A;  2K31 A;  4IUK A;  3SW1 A;  2HGV A;  3TRC A;  1G6O A;  3F1O B;  4EEP A;  4II7 A;  3LFV A;  4CLC A;  2W0N A;  3LIF A;  3DBA A;  5AVF A;  3H9W A;  3R7W B;  2XSS A;  1LT0 A;  2PT7 A;  4HNB A;  4WL9 A;  4P6Z M;  4DJ3 A;  1YKD A;  5HD5 A;  2HV1 A;  3F1N B;  3MFX A;  2P08 A;  4GW9 A;  3PBN A;  3RTY A;  2FZ0 A;  3H7W A;  3KYQ A;  4WEL A;  3F1P A;  4NKP A;  1OTE A;  4XT2 A;  2M1C A;  1YAX A;  1KOU A;  3EGD C;  2O0Y A;  3PBT A;  2Z6C A;  2W3D A;  3BQA A;  3B42 A;  4I3A A;  4OOM A;  3S7P A;  2FH5 A;  2IA2 A;  3NOU C;  5G4Z A;  3NHQ A;  5EFW A;  4UEY A;  3LIE A;  4LLO B;  3S7Q A;  5HPF A;  3D3O A;  3T4L A;  1ZTU A;  4L9E A;  2QJ5 A;  4WF0 A;  5CX7 A;  2HF6 A;  1W63 M;  3E4P A;  2D01 A;  4MN5 A;  5HDS A;  3RH8 B;  3F1N A;  2A2L A;  4H6J A;  1VB6 A;  5K5B A;  3TE8 A;  2I9V A;  2WKQ A;  3UE6 A;  4L9F A;  3MQ0 A;  5IT5 A;  3H7W B;  3FPV A;  3EQU A;  4ARZ B;  3R4K A;  1GSX A;  1MZU A;  2JKT M;  3S7N A;  3LIC A;  5J7E A;  3HJK A;  4Q0H A;  4HH3 A;  4LPZ A;  1BYW A;  4Q0I A;  3BW6 A;  1OTI A;  1UGU A;  2L4R A;  1G28 A;  1TD5 A;  2W1R A;  2W3G A;  3CLO A;  4G3K A;  4L9G A;  5HZH A;  1ZHH B;  3OOV A;  1Y28 A;  2LB9 A;  4GHI A;  1LSV A;  3B47 A;  3C8C A;  1NLY A;  4HHD A;  3VV4 A;  4E04 A;  3LUQ A;  1X0O A;  2PR5 A;  2PYR A;  2XRN A;  3A0V A;  4HP9 A;  2Z6D A;  1S4R A;  3LR4 A;  2PDR A;  3MQQ A;  4B9O A;  3JVU A;  4NXF A;  4EET B;  4MN7 A;  2L1M A;  3KSF A;  4R38 A;  4F3L A;  3UB8 A;  2VJW A;  4HQA A;  4HP4 A;  4PAU A;  2V1B A;  4I39 A;  1TS6 A;  3HJI A;  4GLQ A;  2CMN A;  2W27 A;  4G3W A;  2J80 A;  3T4K A;  2MJ6 A;  3EEA A;  2O99 A;  1F5M A;  3OBF A;  1TS0 A;  2KDK A;  1OPX A;  4IJG A;  4WUJ A;  4EER A;  2B18 A;  1XJ6 A;  3E0Y A;  4BMW A;  1LSX A;  2QJ7 A;  2VZW A;  3B33 A;  1DRM A;  2INW A;  1P9R A;  5HDC A;  2GJ3 A;  3IBR A;  3LID A;  2P04 A;  1EW0 A;  2KLI A;  5KSH A;  2W1T B;  5FL3 A;  1T1C A;  3MQO A;  3T50 A;  3LR5 A;  4Q0J A;  2VV8 A;  2QKP A;  1OTA A;  1T1B A;  2GX5 A;  4GCZ A;  4BBT A;  1T18 A;  1UWP X;  2V9A A;  4UQI S;  3LR3 A;  1DP9 A;  2W3F A;  4JGO A;  4XT2 B;  1H8M A;  3IBJ A;  2W1T A;  3NOP C;  2M7U A;  1S66 L;  3OCL A;  2OAQ 1;  4PKY G;  2JN7 A;  3CIT A;  5DF9 A;  1JNU A;  3O5Y A;  1IFQ A;  2VV6 A;  3KO6 A;  2ZMF A;  3H82 B;  4L0L A;  3EWK A;  4F3L B;  1MC0 A;  4BBU A;  3V67 A;  4ZRR A;  2Y8H A;  3ICY A;  3OCN A;  2XRO A;  4O8G A;  4WLA A;  2VA0 A;  2R78 A;  2PHY A;  2V1A A;  4QPR A;  5F6A A;  2XA7 S;  3HCY A;  2NUP C;  2M7V A;  4G3V A;  5HSQ A;  4EEU A;  2V0W A;  3A0R A;  3F1P B;  4HH2 A;  4NEE D;  2YKF A;  3EOI A;  1STZ A;  2EA9 A;  2J3T C;  3CWF A;  3BY8 A;  3MMH A;  1P9W A;  4CQH A;  1S1Z A;  5DJT A;  3LR0 A;  4IUH A;  4B93 A;  4H6J B;  2GNX A;  4I3J A;  3U2A A;  2J3W A;  4FOF A;  2VX8 A;  3BY9 A;  3T4J A;  4WEJ A;  1MKM A;  4OOL A;  4WEK A;  1YSQ A;  3LIB A;  4YNR A;  3FC7 A;  4ARZ A;  1OJG A;  2J3T D;  3PXP A;  3H82 A;  2Y79 A;  3OLO A;  4HJ3 A;  1DP6 A;  3LYX A;  1WA9 A;  3EGX C;  5DFY A;  3VE3 A;  3TW8 A;  5J4E A;  1P0Z A;  2QYB A;  3NOT C;  3T4O A;  5HDD A;  3PBQ A;  2P7J A;  3VE4 A;  1V9Y A;  5TBM B;  3CUE A;  5DKK A;  3UE3 A;  2WKP A;  4Y2F A;  5HWT A;  3PYP A;  4LRX C;  4O01 A;  3C38 A;  2JKR I;  1GSW A;  5A8B A;  1NLZ A;  5TJJ A;  2JKR M;  4IHQ A;  1XJ2 A;  2KOI A;  5HWW A;  5IS1 A;  4HJ6 A;  3TJZ C;  3A0S A;  4CLC C;  4JGQ A;  1N9L A;  2JHE A;  2D02 A;  4R6L A;  2ZBB A;  3C30 A;  5F69 A;  5IU1 A;  2PR6 A;  4CLC D;  2XA7 M;  5MC7 A;  4K08 A;  4GHI B;  3GDI A;  3UMD A;  4LRZ E;  2K7S A;  5J3W A;  3CUE C;  1P97 A;  1OTB A;  4P6Z S;  3S7O A;  2WKR A;  1F98 A;  1N9N A;  4GJ4 A;  4KQD A;  3MR0 A;  3F1O A;  4JGR A;  1V9Z A;  1T19 A;  4I5S A;  4NXG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...