4HH3A

Structure of the appa-ppsr2 core complex from rb. sphaeroides
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
251
structure length
251
Chain Sequence
LPSLAPDLVRDLIATAADISLLVSQEGVVREVMANPHHPSFGQLSEWEGRPLEEVLTAESVAKFRLRSEGLEPGRGSVAVELNHIDPRSFEFPIRYILHRLPADRSILMLGRDLRPIAEVQQQLVAAQLAMERDYETQREMETRYRVVLDVSRDPMVLVSMSTGRIVDLNSAAGLLLGGVRQDLLGAAIAQEFEGRRRGEFMETMTNLAATESAAPVEVLARRSQKRLLVVPRVFRAAGERLLLCQIDPAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Flavoprotein/transcription
molecule keywords Transcriptional regulator, PpsR
publication title A ternary AppA-PpsR-DNA complex mediates light regulation of photosynthesis-related gene expression.
pubmed doi rcsb
source organism Rhodobacter sphaeroides
total genus 82
structure length 251
sequence length 251
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13188 PAS_8 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4hh3A02
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4hh3A01
4EQ1A 4NXBA 2ZOIA 1OTIA 1OTDA 4DJ3A 4GS9A 1S4RA 4KUOA 4LRYC 1UWPX 5TBMA 3UMDA 1TS0A 3HJKA 2WKPA 2B02A 2P7JA 3LUQA 3KX0X 2Z6CA 3F1NA 2V0WA 1XJ3A 3LIEA 3MR0A 4L9GA 3E4OA 1V9ZA 3LIFA 1BYWA 2M1CA 1N9OA 1F98A 4KQDA 4GHIA 4HP4A 4EXOA 5HWTA 3F1PA 3F1OA 4HJ4A 3H82A 4R6LA 3VE3A 1T1AA 4HI4A 1OT9A 4L9EA 3IS2B 2QJ5A 4I3JA 3LIBA 1D7EA 4LRXC 4BBTA 4HIAA 4GCZA 2PHYA 3VOLA 1UGUA 1XFQA 4LPZA 1GSXA 1VB6A 2PYPA 4BBVA 4R38A 4NXFA 2PYRA 3C2WA 5I5LA 4K08A 4JGQA 1XFNA 2EA9A 4I39A 3UB6A 1LSVA 5J7EA 1OJ5A 4HOIA 4M4XA 3PHYA 3K3DA 5AVFA 3C8CA 2D01A 2KX6A 2QJ7A 4JGPA 3E4PA 4EERA 4EW7A 3NJAA 3MQQA 4HJ3A 3MJQA 1ODVA 3HJIA 5G4ZA 4WF0A 2A24B 3UMEA 1DP6A 3P7NA 2L0WA 3G6OA 3A0VA 5HZHA 1OT6A 2JN7A 3E4QA 3EEHA 3IS2A 4I3AA 2W27A 1JNUA 4EEPA 5DKLA 5J3WA 4R70A 2V1AA 3CAXA 1S1YA 1X0OA 1Y28A 3H7WB 2WKQA 1XJ6A 1N9LA 2VEAA 2JHEA 2PDRA 1P97A 4I38A 1GSVA 1WA9A 2YKHA 3VE4A 1T1CA 3K3CA 3RTYA 1GSWA 4WUJA 5F69A 4WLAA 5AVEA 5G4YA 3D72A 1UWNX 3LICA 3FC7A 1T19A 1LSWA 3ULFA 3LI9A 2PR5A 4H6JB 5HDDA 4YWZA 2INWA 4F3LB 5HSQA 5DJTA 1V9YA 4LRZE 3A0RA 5F6AA 2QKPA 4R3AA 3ZQ5A 2A24A 1KOUA 3A0SA 2PR6A 1F9IA 1S67L 2ZOHA 2OOLA 1S66L 3OLOA 4EESA 4DJ2A 2J80A 2YKFA 4BBUA 1DP8A 1S1ZA 5KIZA 4NXEA 5HD3A 2I9VA 1P0ZA 3BWLA 1S4SA 3LIAA 2HV1A 1DRMA 2VLGA 4I3IA 4MN5A 4EETB 4I5SA 2BASA 4L9FA 5IS1A 2CMNA 3H7WA 3ICYA 4HY8A 4LLOB 4B9OA 1OTEA 1TS8A 3GDIA 4EEUA 2PD8A 3UB9A 4MN6A 2V0UA 3BY9A 2WKRA 4PKYG 2K7SA 5DKKA 1LSXA 5J4EA 3CWFA 5DJUA 3T50A 3EWKA 3MFXA 4JGRA 2OWHA 4RQ9A 5HDCA 5HWWA 4H6JA 3B33A 3MQOA 5HDSA 4F3LA 1MZUA 1XJ4A 5EFWA 2L1MA 2OWJA 4JGOA 5HD5A 2QHKA 2V9AA 4PKYA 4XT2B 4NXGA 3LYXA 3UE6A 4HNBA 2QWSA 3CLOA 2V1BA 1OTAA 1TS6A 3NOPC 2H28A 4WN5A 5IU1A 4HJ6A 5F5YA 2PD7A 3NOUC 4GS9B 2VV8A 5TBMB 3FG8A 3NOTC 1T18A 3LI8A 4HHDA 2L4RA 2Z6DA 3F1NB 4KUKA 1N9NA 5F68A 5A8BA 1OJGA 1G28A 1LL8A 2D02A 2ZBBA 1LT0A 1T1BA 4GHIB 2VV6A 3MXQA 3F1PB 2GJ3A 3F1OB 3H82B 4GW9A 4E04A 4HP9A 1TS7A 1OTBA 4HQAA 3LIDA 3BY8A 3GECA 3UB8A 4WL9A 2VV7A 1D06A 3UB7A 1DP9A 2W0NA 2R78A 3SW1A 3NHQA 5HWVA 1XJ2A 1NWZA 3PYPA 4HH2A 4XT2A 2KDKA 3IBRA 4HH3A 3RH8B 3H9WA 1EW0A
chains in the Genus database with same CATH superfamily
5CGXA 1YM1A 1PW1A 4EQ1A 4NXBA 1PZOA 2ZOIA 3MSHA 2JKGA 1BLPA 3OPLA 2XROA 4DJ3A 2W3EA 4C6YA 4Y0TA 2DMWA 3HCYA 4LRYC 1DY6A 1JVJA 5TBMA 3ZNYA 1TS0A 2J9PA 3IWIA 2WKPA 5EOOA 1ZG4A 1MWUA 3F1NA 2V0WA 5EECA 2HDSA 3E4OA 1VQQA 1V9ZA 1BYWA 1N9OA 1NRFA 3G31A 4JXGA 3WS4A 3F1OA 4HJ4A 1G6AA 5CXWA 3ZNTA 4HI4A 1NLYA 2HJEA 3V3RA 3IS2B 2QJ5A 1W63M 2WKIA 5HARA 3WRZA 1YQSA 3G30A 3V67A 1FR6A 4JF6A 1D7EA 2XQZA 5EVIC 1KGGA 5F1FA 3UNWA 2PU4A 3O88A 1XXMA 2XSSA 4ME4A 2RL3A 3PBSA 3CI6A 4WELA 1HZOA 4KZ8A 1MKIA 1AXBA 5IHVA 4NXFA 5I5LA 1L2SA 4JXSA 2ZC7A 5FAQA 2HP6A 3KSIA 3SS3A 1XFNA 3M6BA 2P04A 5HFOA 3I7JA 2J7VA 4MBKA 1LSVA 4JXVA 5EVID 2GX5A 3K3DA 3TOIA 4Y0OA 2D01A 2KX6A 2QJ7A 3QP5A 4JGPA 2C6WB 4Y15A 3MQQA 5A93A 2VGLM 3IHAA 4PM9A 4OQ0A 1PFLA 2ZM2A 1DP6A 2XLNA 2ZJ9A 4UQIM 4ZDXA 1SHVA 2L0WA 3RFBA 3G35A 2E8IA 1H8ZA 2P08A 3A0VA 1OT6A 2V2FF 1SDEA 2M7UA 2JKTM 1JNUA 3OCNA 4EEPA 5DKLA 3T4TA 4ZBEA 3IF6C 1TD5A 4DKIA 3TRCA 5J3WA 4C3QA 4R70A 2Q9MA 2V1AA 3WWXA 1ZKJA 3A3EA 2PBDP 3ZDJA 1S1YA 1L0GA 2WKQA 2ZMVA 3A3IA 4CLCB 4MBFA 2Z2LB 3P01A 3T1XA 4S2KA 2EX9A 2JHEA 1P97A 1A0KA 4I38A 1GSVA 2YKHA 2VZWA 4DDSA 4E3JA 1GSWA 4UAAA 1FCNA 3MZDA 3VSLA 2OSUA 5F69A 4EWFA 1AWIA 5D3OA 1IYQA 3T4JA 3T4QA 3SH7A 3FC7A 5CEDA 4GDBA 4X68A 1T19A 3ULFA 3UDXA 5A92A 5FSRA 3OOVA 4WEJA 3ISGA 1W79A 3E0YA 2ZQCA 2QKPA 5F6AA 4U0XA 3IT9A 2W3FA 2PR6A 1F9IA 2ZOHA 1P9RA 1S0WA 3ZCZA 2WADA 3N4IA 2CC1A 5GHXA 2J80A 1KVLA 2YKFA 1S1ZA 3M2KA 5KIZA 5U47A 2WGIA 3O5YA 4PAUA 5HAQA 2I9VA 4NKPA 1MWRA 1E3UA 3EOIA 2Y2GA 1DRMA 2VLGA 3QP1A 4QWOA 2XK1A 4L9FA 5IS1A 3LO7A 3ZG5A 4B9OA 5KSCA 2GNXA 5HPIA 3C38A 2FFFB 2PD8A 4HESA 2Y59A 3T12B 2B95A 2K7SA 4Q8IA 4BD0A 5DJUA 1ZC2A 4EUZA 2WZXA 4DXCA 3NBLA 5E2EA 4KG5A 3WS0A 1RGYA 2Y2HA 4F3LA 1IKGA 1TEMA 2OWJA 4EBLA 4O7DA 4E3LA 2PU2A 1ONGA 4ZJ1A 3LYXA 4Y17A 1K55C 1BTLA 2HDUA 3UE6A 2IWCA 1ZHHB 2ZQ8A 3QHYA 3CLOA 2R9WA 1M40A 4DMZA 3BRMA 3FPWA 3NOPC 2XDMA 4HJ6A 3E2KA 1XA1A 5F5YA 2PD7A 1GA0A 4GS9B 1QMFA 2VV8A 4LCLA 1KDWA 1T18A 4BD1A 3UN7A 3C4OA 2W3HA 1K54A 5HPFA 3O3VA 5G18A 5EOEA 2Z6DA 4II7A 3NC8A 1WE4A 1YLTA 1TVFA 1N9NA 3BFGA 5F68A 1H8YA 1K38A 5E2GA 1W8YA 2IWDA 1G28A 2D02A 1LHYA 3BFCA 1T1BA 3TJZC 5TGFA 3UDIA 4OPZA 1YSPA 4X55A 2M7VA 2Y2IA 1BULA 3NDGA 4GW9A 1TS7A 4WBGA 3QP4A 1YLZA 1OTBA 5I94A 4HQAA 3VMAA 3LIDA 4L0LA 5DF9A 1NRJA 3EGDC 4UA7A 3GECA 1LI9A 4WL9A 2VV7A 2XEPA 4YOFA 3UB7A 1H5XA 1DP9A 4MEZA 3VP0A 5KSHA 2W0NA 4XUZA 2R78A 2P9VB 2HPBA 4OOLA 3SW1A 4OQHA 1K6SA 5DTSA 4BWIA 2FFYA 2J3TD 1VETA 4AFIA 4B93A 2ZLYA 2V20A 4WYYA 4JF4A 1OTDA 4DE0A 1XGIA 3ZFZA 4KUOA 3B3XA 4CJNA 2HP5A 4N92A 5EV0A 3M6HA 5DFYA 2VKSA 5HAPA 3HJKA 1U60A 3LUQA 3A3DA 3KX0X 3NY4A 1SZVA 1XJ3A 5FQIA 3LIEA 3R7WA 5DTKA 2HGVA 3LIFA 2ZL1B 2ZQAA 4P6ZM 2PT7A 4P6BA 1I5QA 4HP4A 2A2LA 4EXOA 5HWTA 4OOMA 4Y3IA 3WRTA 4R6LA 3VE3A 1T1AA 4UHUA 3IX4A 2HDQA 1WYCA 3IH9A 5DVAA 2H0TA 3IX3A 3VOLA 2Y91A 2WK0A 2Y2KA 3IH8A 4OP8A 3NECA 2PYPA 3FYZA 2BG1A 2NUPC 4JGQA 2LB5A 5MC7A 3G34A 3MXSA 2V1ZA 3V5MA 4FSFA 4KG6A 2WKEA 3ZYTA 3PTEA 1PIOA 4HOIA 4M4XA 2OLUA 3IX8A 1FIKA 1K54C 4E3KA 1L3LA 4KQRA 1CI9A 1YMXA 3OPPA 3Q07A 1BUEA 1DJBA 3E4PA 4EW7A 4EBNA 3D9YA 3N8RA 1ODVA 1K6RA 3LR4A 3GSGA 3HLBA 2R9XA 4R3JA 3HJIA 2C5WB 3FPVA 5AQ9A 1K25A 1PI4A 3GMWA 4HBUA 2AVXA 1ACFA 3SS5A 3IXBA 3IF5A 3D3OA 5L07A 3MF0A 2XD5A 3NULA 2Q9NA 2I72A 5HZHA 4S2JA 5JYPA 4BMWA 5FA7A 3DWZA 3G2ZA 3IS2A 4FH4A 1PWDA 4DE3A 3HLFA 4IVKA 3UPOA 5GHYA 1G68A 5GLBA 4QU3A 2A3UA 3OCLA 4JPMA 4IUHA 1BT5A 1ZG6A 2G2UA 3GVBA 1X0OA 2O99A 4OVDA 1N9LA 3OPHA 5TJJA 4N1XA 3G4PA 5TFQA 4OQIA 5L09A 4QY6A 1WA9A 4OOYA 3MMHA 3VE4A 2QPNA 4IEDA 1ES2A 1PRQA 2VJWA 3C4PA 2VGKA 2IA2A 4WUJA 2VGJA 5M18A 5F82A 3CG5A 5FI2A 5EM0A 4WLAA 3U2AA 1EROA 1MPLA 2HDRA 3D72A 3NCKA 4O0PA 1N9BA 3LI9A 3DTKA 4NEED 2PR5A 4WM9A 4N9KA 5DJTA 3W8KA 4LRZE 4Z1WA 3GTCA 4MDZA 2W1TB 2Y2LA 4R3AA 1K57A 3ZQ5A 1BLSA 3C5AA 1I2SA 3UPNA 4BL2A 3PXPA 4KZ5A 3ZG7B 4OKPA 3BLSA 3OLOA 1YLJA 3K2NA 4X56A 2O9AA 1XX2A 1KGEA 4B4XA 4BBUA 1CJFA 1D1JA 1I2WA 3VSKA 1C3BA 5CGWA 2JKFA 5E2FA 1S4SA 3LIAA 3C7VA 1S6RA 1YLPA 4I3IA 4NETA 4OP5A 2BASA 2Y2OA 1L0FA 2CMNA 5FQ9A 3ICYA 4CLCA 3CZDA 3LEQA 4Q0HA 1TS8A 2EFUA 3BECA 3GDIA 3QP8A 4EEUA 3UB9A 2B5RA 4MN6A 4BENA 2V0UA 1NYYA 1FSYA 1ESIA 4P85A 5AQ7A 2E8JA 1PNEA 4PKYG 2ACGA 5J4EA 1NLZA 3CWFA 4QHCA 3DBAA 4MCWA 3RXXA 2J9OA 4F94A 2OWHA 3O87A 1PYYA 2OV5A 1FCOA 5M19A 5EFWA 1GA9A 1K56D 2UV0E 1Z6FA 3BFFA 4JLFA 3MKEA 4QD4A 2OAP1 5FQKA 1E25A 2V9AA 2ZQDA 1RCJA 3AGDA 3BEBA 4RVAA 4XT2B 3Q82A 1L0EA 3BQAA 3EGXC 4E3OA 4MN7A 4R23A 4HNBA 1HVBA 4LENA 1ES5A 3S7NA 5FQQA 3CMZA 3OZHA 2H28A 4WN5A 4X25A 2EWWA 1H0MA 3NOUC 3T4SA 5FAOA 4ZAMA 3LY3A 1IOUA 1PI5A 3PAGA 2G2WA 4Y5FA 3BQ8A 3HUNA 4YINA 3FV7A 3LI8A 4HHDA 2L4RA 5EPHA 4FD8A 4KUKA 2OLVA 3PBQA 1OJGA 4YFMA 1LT0A 4DRTA 1Q2PA 4GHIB 2VV6A 3E98A 3SS4A 3RXWA 3F1PB 5CHJA 3WS1A 3H82B 2VA0A 4E04A 3CITA 2XD1A 4BL3A 2EXAA 3UB8A 2XRNA 1D06A 4GD6A 4IUKA 2MJ6A 4ARZB 1RGZA 4WZ5A 4Q0JA 5CX7A 3VP1A 4IHQA 4X6TA 4HH2A 3TW8A 1SKOB 4MLLA 4R4RA 4OQGA 4S2LA 2ZM8A 2XA7M 2ZQ7A 4IVIA 2FH5A 3IBRA 5AQBA 5F83A 1SDNA 1IKIA 2H0YA 4KZ3A 4JF5A 2BTFP 4UA6A 1OTIA 1CEFA 2ZMFA 3M2JA 4G3KA 1XPBA 4GS9A 1UWPX 3IXGA 4CLCC 3SZTA 2LB9A 1LL9A 1HD8A 3C7UA 1LI0A 3QNCA 3CPTB 2B02A 2P7JA 3IBJA 2BLSA 4C75A 1NJ4A 2Z6CA 1NYMA 4PM6A 1F5MA 3UO9A 1NZOA 3Q81A 4S2NA 3QNBA 2M1CA 4Z9QA 4XUXA 2W3GA 1YSQA 2GDNA 2XGNA 4KQDA 1Y4OA 2VX8A 2W1RA 4OPYA 4A5RA 1O07A 4CLCD 3MZEA 1XA7A 4NK3A 5A90A 4I3JA 2ZD8A 3MXRA 4JXWA 4LV3A 2KOIA 1MC0A 3LGOA 5EVEA 3OC2A 3CHWP 2P9VA 3DWKA 4BLMA 1FSWA 4GCZA 1YLYA 2PHYA 3VP3A 4S2MA 1ERMA 3KYEA 4OPQA 5FL3A 1GCEA 3FKVA 2J3TC 4Y7PA 3WS2A 1JTGA 3GR2A 3LY4A 2V8CA 4R38A 3C2WA 4B88A 4K08A 5DF8A 2KLIA 3Q7VB 2Y2NA 3UB6A 5J7EA 1ALQA 5HL6A 1OJ5A 3PHYA 1GHMA 3CJMA 3UY6A 3KSHA 1ONHA 4RA7A 2JC7A 2X02A 1Q2QA 1HLUP 4JBFA 4XXRA 5E2HA 3SH9A 4GDNA 1TDLA 1QMEA 4MMNA 3KO6A 4EERA 3NJAA 3MJQA 1SKFA 3S7PA 4Q0IA 3NI9A 3ZG0A 2WGVA 5K5BA 1PW8A 2ZL1A 3BYDA 4WF0A 1VEUB 2A24B 3UMEA 2VGLS 3W4OA 3VV4A 1ERQA 2NUTC 3G6OA 4DDYA 4UQIS 3OBFA 2JN7A 3E4QA 4UEYA 1BLCA 3EEAA 5J8XA 2HZ5A 4JKTA 2W27A 3HBRA 1P9WA 1PZPA 4G3WA 4KZ4A 3CAXA 4MNRA 1ES3A 3B47A 3BLMA 3H7WB 4OH0A 2A49A 1XJ6A 1H3QA 4X53A 1BLHA 2VEAA 2PDRA 3QP6A 1JTDA 4IJGA 3MS6A 1J3WA 4HBTA 2XFTA 4R3BA 1FQGA 5FDSA 4WMCD 2EX2A 2WKHA 1FR1A 3RTYA 3N7WA 2O9BA 4NG2A 3A3JA 1LL5A 1Y54A 4S2PA 2FZ0A 2K2NA 5AVEA 3ZG9B 5A91A 4LGWA 2Y2QA 3LICA 4RX2A 2P74A 3T1RA 4H6JB 4YWZA 5GHZA 2JCHA 2INWA 1XGJA 2Y55A 1IYSA 4GB7A 1KGFA 4GKUA 2K31A 1YT4A 5GLAA 5LBRA 3SH8A 4ZJ2A 1KOUA 3ZG8B 3A0SA 5EVIB 2WAEA 3W2ZA 2WGWB 1DJAA 1K56A 4E6XA 2OOLA 3TSGA 1S66L 4M3KA 4ZJ3A 4ETZA 3EQUA 1YMSA 4ESPA 3HLGA 3DW0A 4NXEA 3P09A 2QYBA 5HD3A 1P0ZA 2ZC5B 2HV1A 1M6KA 3GRJA 4D2OA 1Z09A 3JYIA 4E3IA 1KE0A 3JPUA 4MN5A 3GV9A 3IQAA 1GHPA 3ZVTA 5EVLA 1E4DA 4HY8A 2HF6A 1OTEA 1G6OA 5GLCA 1KE3A 3CUEA 5HW3A 3BY9A 1IYOA 3VFFA 5KMWA 3LR3A 3BFDA 3T50A 3EWKA 3MFXA 3HLCA 2RCXA 5HWWA 2VK3A 1FOFA 4KG2A 5HL1A 2EFXA 4FOFA 4PM8A 5HDSA 4K0WA 3HLWA 1YPRA 5CGSA 1XJ4A 2Y2JA 2W1TA 1FCMA 2WZZA 4LV0A 1MXOA 2QHKA 2Y2MA 3IXDA 3IF6B 3NDEA 1CEGA 4NXGA 1MKMA 3HVFA 2V1BA 3DTMA 2J8YA 3ZHHA 1OTAA 3UPPA 5IU1A 2EX8A 3UDFA 3IXHA 1NZUA 5E43A 5FI6A 5TBMB 1NXYA 4IBXA 5FQMA 1YAXA 2ZMAA 3FZCA 1KVMA 1CQAA 2DNSA 2O9CA 3F1NB 4QB8A 1H8MA 3MKFA 4RYEA 4D60A 1LL8A 1W8QA 3DTIA 1NY0A 3V50A 4X69A 3F1OB 2X01A 4RX3A 4S2IA 3PBRA 4U0TA 3JVVA 3PBNA 3W4QA 4EQIA 1PWCA 3BM6A 5M1AA 3MBZA 1TDGA 2H5SA 3LCEA 3VP4A 1K0KA 4B4ZA 4QJGA 5HWVA 1XJ2A 3O86A 1NWZA 4DF6A 3IWOA 5CHUA 2Y8HA 3UE1A 4XT2A 2KDKA 2EXBA 3UE0A 3VOZA 3Q1FA 2ZC6B 4HH3A 1EWZA 3RH8B 4PHTA 5IT5A 5HAIA 5JYOA 4UA9A 4P87A 3U4LP 1EW0A 3N8LA 3KSGA 3MFDA 4E6WA 4FUWA 3RJUA 1S4RA 3LR0A 1K55A 3G2YA 5L10A 3UMDA 3S4XA 3ITAA 1GHIA 3CUEC 4K0XA 3UB5P 3W4PA 2WUQA 3FWLA 3MR0A 4GLQA 3PBTA 4L9GA 3HUMA 4QPRA 3IHBA 1MY8A 1F98A 3S1YA 4GHIA 5L2FA 4P6ZS 1TF1A 2UWXA 3F1PA 1N4OA 3H82A 3R4KA 4LCMA 4WEKA 2HP9A 3HL9A 2JBFA 4ZRRA 1BSGA 1OT9A 4L9EA 1XP4A 2X71A 5FEGA 4EUVA 3LIBA 3KYQA 3V39A 4LRXC 4KZ7A 4ARZA 4BBTA 2WYXA 4HIAA 2W3DA 5DTTA 2XF3A 4ZTKA 1UGUA 4OONA 1XFQA 1SKOA 4LPZA 5BOHA 5CERA 1GSXA 1ZTUA 1VB6A 4BBVA 4Y0UA 1PWGA 3MQ0A 5FAPA 2PYRA 2GZAA 2JKRI 5FI7A 3LFVA 5AJGA 4PMAA 4DXBA 2ZC4B 2EA9A 3DAVA 5F1GA 4I39A 4EV4A 1K57C 1EI5A 4WMCA 4FCFA 3N6IA 2XFSA 1MWTA 2PRFA 5AVFA 1IYPA 4G3VA 3C8CA 3CPTA 5HX9A 4HJ3A 4YNRA 5CTNA 3ZGAB 1G5UA 2DRWA 5G4ZA 1W5DA 2OAQ1 2PAVP 4O01A 4PPRA 2B18A 3NIAA 3P7NA 4IBRA 1KDSA 4KZBA 3EEHA 3IWQA 3EQVA 3Q7ZA 4DN0A 3LR5A 4I3AA 1HTZA 4LV2A 1L0DA 4KQOA 3L9KA 1XKZA 4KQQA 4ETXA 2ZC3B 1J9MA 3AGEA 1IFQA 3BW6A 4KZ6A 3HREA 1JWVA 4N1HA 1Y28A 3TE8A 5EE8A 1VM1A 2IWBA 5AQAA 4R1GA 4S2OA 4R4SA 1T1CA 3K3CA 1K4EA 5DFXA 4GNUA 5CECA 3Q7VA 1K4FA 2H10A 1SCWA 3FKWA 5EM1A 4KZAA 1CI8A 4E3MA 5G4YA 1FILA 1UWNX 3HLDA 1LSWA 3T4KA 5HDDA 4E3NA 4MBHA 4CLCE 4F3LB 1O7EA 5HSQA 5FQJA 1V9YA 4DE2A 3A0RA 4DE1A 2HJ9C 5FASA 1VEUA 2A24A 4BJPA 2WAFA 3MZFA 4GN2A 4CPKA 3P98A 4P0MA 1S67L 3AGFA 3C30A 3S7OA 3E2LA 3LEZA 1ES4A 2Y2PA 2Q0OA 4EESA 4DJ2A 4GD8A 4WZ4A 1IELA 3GQZA 4QY5A 1DP8A 5CTMA 4N9LA 3T1QB 3BWLA 3SOIA 4PM7A 4FH2A 2V8FA 4X1LA 3QP2A 1JWZA 4EETB 4I5SA 3T4LA 1CK3A 2ZQ9A 4LV1A 3H7WA 1STZA 2JKTI 3VP2A 3UE3A 4LLOB 4LFUA 3PAEA 1W63Q 3HUOA 4EU0A 3T4OA 4EBPA 3A3FA 1IEMA 4ID4A 5CHMA 5FEFA 3ITBA 5FDHA 2WKRA 5DKKA 1LSXA 3VFHA 4O8GA 4JGRA 4GZBA 3DTEA 4WZ5C 2O0YA 4RQ9A 5HDCA 1OMEA 1VHMA 3BFEA 4H6JA 4OPRA 2DCFA 3B33A 3MQOA 1MZUA 1OPXA 4PM5A 3KSFA 4OLDA 1F2KA 2L1MA 3OPRA 4JGOA 5HD5A 1RP5A 5EVIA 4HEFA 2WGWA 3KYZA 4PKYA 1VETB 1WYBA 3T1SA 1MWSA 2QWSA 1E3UD 1W7FA 1TS6A 1MBLA 2EX6A 3PR6A 5FATA 5KZHA 4Y13A 4S2NC 5CRFA 2ZM0A 4BQMA 2Z2MB 2Y4AA 3BJNA 5GLDA 3FG8A 5CEBA 3NOTC 5GL9A 2PBYA 3B42A 4OLGA 2EWVA 3R7WB 4FTXA 4Y2FA 2QZ6A 5A8BA 5L8MA 1YKDA 5C5KA 2ZBBA 1ESUA 1CF0A 2Y79A 3WS5A 3PBOA 3D4FA 4KZ9A 3V3SA 2JE5A 3MXQA 1DJCA 4GJ4A 3N8SA 3S22A 2GJ3A 2G7UA 1JWPA 4X1MA 4HP9A 5DF7A 1KE4A 2XH9A 3BY8A 4H8RA 1LLBA 4KENB 3G32A 1YLWA 3L7HA 3NHQA 3VOYA 3JVUA 4GOGA 2JKRM 3IF6A 3PYPA 4U3TA 3S7QA 5EUAA 4CQHA 4R0QA 3HLEA 2J3WA 4K91A 3ZVWA 5TR7A 1BZAA 2XA7S 3TG9A 2QMIA 2XR0A 3H9WA
chains in the Genus database with same CATH topology
4EQ1A 4NXBA 2ZOIA 3KSGA 1OTIA 1OTDA 2XROA 2ZMFA 4DJ3A 2W3EA 4G3KA 4GS9A 2DMWA 1S4RA 3HCYA 4KUOA 4LRYC 1UWPX 5TBMA 3LR0A 4CLCC 3UMDA 1TS0A 2LB9A 5DFYA 2VKSA 3HJKA 2WKPA 2B02A 2P7JA 3IBJA 3LUQA 3KX0X 2Z6CA 3CUEC 3F1NA 2V0WA 1F5MA 1XJ3A 3LIEA 3R7WA 4GLQA 3MR0A 3PBTA 4L9GA 2HGVA 3E4OA 1V9ZA 3LIFA 1BYWA 2M1CA 1N9OA 4P6ZM 4QPRA 2PT7A 2W3GA 1F98A 1YSQA 4KQDA 4GHIA 4HP4A 4P6ZS 2A2LA 1TF1A 4EXOA 2VX8A 5HWTA 3F1PA 3F1OA 4OOMA 4HJ4A 3H82A 2W1RA 3R4KA 4Y3IA 4WEKA 4R6LA 3VE3A 1T1AA 4CLCD 4ZRRA 4HI4A 1NLYA 1OT9A 2HJEA 4L9EA 3IS2B 2QJ5A 1W63M 3V67A 4I3JA 2KOIA 4EUVA 3LIBA 3KYQA 1MC0A 1D7EA 3OC2A 4LRXC 4ARZA 4BBTA 4HIAA 2W3DA 4GCZA 2PHYA 3VOLA 1UGUA 2XSSA 4ME4A 1XFQA 3PBSA 3CI6A 4WELA 5FL3A 4LPZA 2J3TC 1GSXA 1ZTUA 1VB6A 2PYPA 4BBVA 3MQ0A 4R38A 4NXFA 2PYRA 2GZAA 3C2WA 5I5LA 2JKRI 4K08A 2NUPC 4JGQA 2LB5A 3KSIA 5MC7A 2KLIA 3LFVA 5AJGA 1XFNA 2EA9A 2P04A 4FSFA 4I39A 3ZYTA 3UB6A 1LSVA 5HL6A 5J7EA 1OJ5A 4HOIA 4M4XA 3PHYA 2GX5A 3KSHA 3K3DA 5AVFA 4G3VA 3C8CA 2D01A 2KX6A 2QJ7A 4MMNA 4JGPA 3KO6A 3E4PA 4EERA 4EW7A 3NJAA 3MQQA 4HJ3A 3MJQA 3S7PA 1ODVA 3LR4A 4Q0IA 4YNRA 3HJIA 3FPVA 5G4ZA 2VGLM 5K5BA 2OAQ1 4WF0A 4O01A 2B18A 2A24B 3UMEA 2VGLS 1DP6A 3VV4A 4UQIM 3D3OA 3P7NA 2L0WA 2NUTC 3RFBA 3G6OA 3MF0A 4UQIS 3OBFA 3A0VA 2P08A 5HZHA 1OT6A 2JN7A 3E4QA 4UEYA 3EEAA 3EEHA 4BMWA 3EQVA 2M7UA 4DN0A 3LR5A 3IS2A 4I3AA 2W27A 4KQOA 1P9WA 2JKTM 1JNUA 3OCNA 4EEPA 5DKLA 4ETXA 3T4TA 4G3WA 1TD5A 3TRCA 1IFQA 5J3WA 3BW6A 4R70A 3OCLA 4IUHA 2V1AA 3CAXA 1S1YA 1X0OA 3B47A 1Y28A 3TE8A 2O99A 3H7WB 2WKQA 1XJ6A 2ZMVA 1H3QA 1N9LA 4CLCB 2VEAA 3P01A 5TJJA 2JHEA 2PDRA 1P97A 4IJGA 4I38A 1GSVA 1WA9A 2YKHA 2VZWA 3MMHA 3VE4A 1T1CA 3K3CA 3RTYA 1GSWA 5DFXA 2VJWA 2O9BA 2IA2A 4WUJA 5F69A 2FZ0A 2K2NA 4WLAA 5AVEA 3U2AA 5G4YA 3T4JA 3D72A 3T4QA 1UWNX 3LICA 3FC7A 4O0PA 1T19A 1LSWA 3ULFA 3LI9A 4NEED 2PR5A 3T4KA 4H6JB 5HDDA 4YWZA 4CLCE 2INWA 4F3LB 5HSQA 5DJTA 1V9YA 3OOVA 4LRZE 4WEJA 4Z1WA 4MDZA 3E0YA 3A0RA 2W1TB 5F6AA 2QKPA 2K31A 4R3AA 2HJ9C 3ZQ5A 5LBRA 2A24A 4BJPA 1KOUA 3A0SA 2W3FA 2PR6A 3W2ZA 3PXPA 1F9IA 1S67L 2ZOHA 1P9RA 3C30A 3S7OA 2OOLA 1S66L 3OLOA 3K2NA 4EESA 4ETZA 4DJ2A 2O9AA 2J80A 3EQUA 2YKFA 4BBUA 1DP8A 1S1ZA 5KIZA 4NXEA 2QYBA 3O5YA 4PAUA 5HD3A 2I9VA 1P0ZA 3BWLA 1S4SA 3LIAA 4NKPA 2HV1A 3EOIA 1DRMA 2VLGA 4I3IA 4MN5A 4EETB 4I5SA 2BASA 3T4LA 4L9FA 5IS1A 2CMNA 3H7WA 1STZA 2JKTI 3ICYA 4HY8A 4LLOB 3UE3A 4CLCA 4B9OA 2HF6A 4Q0HA 2GNXA 5HPIA 1OTEA 1TS8A 1G6OA 3C38A 1W63Q 3GDIA 4EEUA 4EU0A 3T4OA 2PD8A 3UB9A 4MN6A 3CUEA 2V0UA 3BY9A 2WKRA 4PKYG 2K7SA 3LR3A 5DKKA 1LSXA 5J4EA 1NLZA 3CWFA 3DBAA 5DJUA 4MCWA 3T50A 3EWKA 4O8GA 3MFXA 4JGRA 2OWHA 2O0YA 4RQ9A 5HDCA 5HWWA 1VHMA 4H6JA 3B33A 3MQOA 4FOFA 5HDSA 4F3LA 1MZUA 1OPXA 3KSFA 1XJ4A 5EFWA 2W1TA 2L1MA 2OWJA 4JGOA 5HD5A 2QHKA 2OAP1 2V9AA 4PKYA 3KYZA 4XT2B 4NXGA 1MKMA 3BQAA 3LYXA 3EGXC 3UE6A 4MN7A 4HNBA 1ZHHB 3S7NA 2QWSA 3CLOA 2V1BA 4DMZA 3FPWA 1OTAA 1TS6A 3PR6A 3NOPC 2H28A 4WN5A 5IU1A 2EWWA 4HJ6A 5F5YA 2PD7A 3NOUC 4GS9B 3T4SA 3BJNA 2VV8A 5TBMB 3FG8A 3NOTC 1IOUA 1T18A 3B42A 1YAXA 2W3HA 4Y5FA 3BQ8A 5HPFA 3LI8A 4HHDA 2L4RA 2O9CA 2Z6DA 4II7A 3F1NB 4KUKA 2EWVA 1H8MA 3R7WB 1N9NA 4Y2FA 5F68A 3PBQA 5A8BA 1OJGA 5L8MA 1G28A 1LL8A 1YKDA 5C5KA 2D02A 2ZBBA 1LT0A 2Y79A 3PBOA 1T1BA 4GHIB 2VV6A 3TJZC 3E98A 3MXQA 4GJ4A 1YSPA 3F1PB 2GJ3A 3F1OB 2M7VA 3H82B 2VA0A 2G7UA 4GW9A 4E04A 4HP9A 1TS7A 1OTBA 3CITA 4HQAA 3LIDA 3PBRA 4L0LA 5DF9A 1NRJA 3BY8A 3EGDC 3JVVA 3PBNA 3GECA 3UB8A 2XRNA 4WL9A 2VV7A 1D06A 4YOFA 3UB7A 4IUKA 1DP9A 5KSHA 2W0NA 2R78A 2MJ6A 4ARZB 4OOLA 3NHQA 5HWVA 3SW1A 3JVUA 1XJ2A 1NWZA 4Q0JA 5CX7A 4BWIA 2JKRM 3PYPA 2Y8HA 4IHQA 3TW8A 4HH2A 4XT2A 2J3TD 2KDKA 3S7QA 4CQHA 2XA7M 2J3WA 4AFIA 2FH5A 3IBRA 4B93A 4HH3A 3RH8B 4PHTA 5IT5A 2XA7S 3H9WA 1EW0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EQ1 A;  4NXB A;  2ZOI A;  1OTI A;  1OTD A;  4DJ3 A;  4GS9 A;  1S4R A;  4KUO A;  4LRY C;  1UWP X;  5TBM A;  3UMD A;  1TS0 A;  3HJK A;  2WKP A;  2B02 A;  2P7J A;  3LUQ A;  3KX0 X;  2Z6C A;  3F1N A;  2V0W A;  1XJ3 A;  3LIE A;  3MR0 A;  4L9G A;  3E4O A;  1V9Z A;  3LIF A;  1BYW A;  2M1C A;  1N9O A;  1F98 A;  4KQD A;  4GHI A;  4HP4 A;  4EXO A;  5HWT A;  3F1P A;  3F1O A;  4HJ4 A;  3H82 A;  4R6L A;  3VE3 A;  1T1A A;  4HI4 A;  1OT9 A;  4L9E A;  3IS2 B;  2QJ5 A;  4I3J A;  3LIB A;  1D7E A;  4LRX C;  4BBT A;  4HIA A;  4GCZ A;  2PHY A;  3VOL A;  1UGU A;  1XFQ A;  4LPZ A;  1GSX A;  1VB6 A;  2PYP A;  4BBV A;  4R38 A;  4NXF A;  2PYR A;  3C2W A;  5I5L A;  4K08 A;  4JGQ A;  1XFN A;  2EA9 A;  4I39 A;  3UB6 A;  1LSV A;  5J7E A;  1OJ5 A;  4HOI A;  4M4X A;  3PHY A;  3K3D A;  5AVF A;  3C8C A;  2D01 A;  2KX6 A;  2QJ7 A;  4JGP A;  3E4P A;  4EER A;  4EW7 A;  3NJA A;  3MQQ A;  4HJ3 A;  3MJQ A;  1ODV A;  3HJI A;  5G4Z A;  4WF0 A;  2A24 B;  3UME A;  1DP6 A;  3P7N A;  2L0W A;  3G6O A;  3A0V A;  5HZH A;  1OT6 A;  2JN7 A;  3E4Q A;  3EEH A;  3IS2 A;  4I3A A;  2W27 A;  1JNU A;  4EEP A;  5DKL A;  5J3W A;  4R70 A;  2V1A A;  3CAX A;  1S1Y A;  1X0O A;  1Y28 A;  3H7W B;  2WKQ A;  1XJ6 A;  1N9L A;  2VEA A;  2JHE A;  2PDR A;  1P97 A;  4I38 A;  1GSV A;  1WA9 A;  2YKH A;  3VE4 A;  1T1C A;  3K3C A;  3RTY A;  1GSW A;  4WUJ A;  5F69 A;  4WLA A;  5AVE A;  5G4Y A;  3D72 A;  1UWN X;  3LIC A;  3FC7 A;  1T19 A;  1LSW A;  3ULF A;  3LI9 A;  2PR5 A;  4H6J B;  5HDD A;  4YWZ A;  2INW A;  4F3L B;  5HSQ A;  5DJT A;  1V9Y A;  4LRZ E;  3A0R A;  5F6A A;  2QKP A;  4R3A A;  3ZQ5 A;  2A24 A;  1KOU A;  3A0S A;  2PR6 A;  1F9I A;  1S67 L;  2ZOH A;  2OOL A;  1S66 L;  3OLO A;  4EES A;  4DJ2 A;  2J80 A;  2YKF A;  4BBU A;  1DP8 A;  1S1Z A;  5KIZ A;  4NXE A;  5HD3 A;  2I9V A;  1P0Z A;  3BWL A;  1S4S A;  3LIA A;  2HV1 A;  1DRM A;  2VLG A;  4I3I A;  4MN5 A;  4EET B;  4I5S A;  2BAS A;  4L9F A;  5IS1 A;  2CMN A;  3H7W A;  3ICY A;  4HY8 A;  4LLO B;  4B9O A;  1OTE A;  1TS8 A;  3GDI A;  4EEU A;  2PD8 A;  3UB9 A;  4MN6 A;  2V0U A;  3BY9 A;  2WKR A;  4PKY G;  2K7S A;  5DKK A;  1LSX A;  5J4E A;  3CWF A;  5DJU A;  3T50 A;  3EWK A;  3MFX A;  4JGR A;  2OWH A;  4RQ9 A;  5HDC A;  5HWW A;  4H6J A;  3B33 A;  3MQO A;  5HDS A;  4F3L A;  1MZU A;  1XJ4 A;  5EFW A;  2L1M A;  2OWJ A;  4JGO A;  5HD5 A;  2QHK A;  2V9A A;  4PKY A;  4XT2 B;  4NXG A;  3LYX A;  3UE6 A;  4HNB A;  2QWS A;  3CLO A;  2V1B A;  1OTA A;  1TS6 A;  3NOP C;  2H28 A;  4WN5 A;  5IU1 A;  4HJ6 A;  5F5Y A;  2PD7 A;  3NOU C;  4GS9 B;  2VV8 A;  5TBM B;  3FG8 A;  3NOT C;  1T18 A;  3LI8 A;  4HHD A;  2L4R A;  2Z6D A;  3F1N B;  4KUK A;  1N9N A;  5F68 A;  5A8B A;  1OJG A;  1G28 A;  1LL8 A;  2D02 A;  2ZBB A;  1LT0 A;  1T1B A;  4GHI B;  2VV6 A;  3MXQ A;  3F1P B;  2GJ3 A;  3F1O B;  3H82 B;  4GW9 A;  4E04 A;  4HP9 A;  1TS7 A;  1OTB A;  4HQA A;  3LID A;  3BY8 A;  3GEC A;  3UB8 A;  4WL9 A;  2VV7 A;  1D06 A;  3UB7 A;  1DP9 A;  2W0N A;  2R78 A;  3SW1 A;  3NHQ A;  5HWV A;  1XJ2 A;  1NWZ A;  3PYP A;  4HH2 A;  4XT2 A;  2KDK A;  3IBR A;  4HH3 A;  3RH8 B;  3H9W A;  1EW0 A; 
#chains in the Genus database with same CATH topology
 5CGX A;  1YM1 A;  1PW1 A;  4EQ1 A;  4NXB A;  1PZO A;  2ZOI A;  3MSH A;  2JKG A;  1BLP A;  3OPL A;  2XRO A;  4DJ3 A;  2W3E A;  4C6Y A;  4Y0T A;  2DMW A;  3HCY A;  4LRY C;  1DY6 A;  1JVJ A;  5TBM A;  3ZNY A;  1TS0 A;  2J9P A;  3IWI A;  2WKP A;  5EOO A;  1ZG4 A;  1MWU A;  3F1N A;  2V0W A;  5EEC A;  2HDS A;  3E4O A;  1VQQ A;  1V9Z A;  1BYW A;  1N9O A;  1NRF A;  3G31 A;  4JXG A;  3WS4 A;  3F1O A;  4HJ4 A;  1G6A A;  5CXW A;  3ZNT A;  4HI4 A;  1NLY A;  2HJE A;  3V3R A;  3IS2 B;  2QJ5 A;  1W63 M;  2WKI A;  5HAR A;  3WRZ A;  1YQS A;  3G30 A;  3V67 A;  1FR6 A;  4JF6 A;  1D7E A;  2XQZ A;  5EVI C;  1KGG A;  5F1F A;  3UNW A;  2PU4 A;  3O88 A;  1XXM A;  2XSS A;  4ME4 A;  2RL3 A;  3PBS A;  3CI6 A;  4WEL A;  1HZO A;  4KZ8 A;  1MKI A;  1AXB A;  5IHV A;  4NXF A;  5I5L A;  1L2S A;  4JXS A;  2ZC7 A;  5FAQ A;  2HP6 A;  3KSI A;  3SS3 A;  1XFN A;  3M6B A;  2P04 A;  5HFO A;  3I7J A;  2J7V A;  4MBK A;  1LSV A;  4JXV A;  5EVI D;  2GX5 A;  3K3D A;  3TOI A;  4Y0O A;  2D01 A;  2KX6 A;  2QJ7 A;  3QP5 A;  4JGP A;  2C6W B;  4Y15 A;  3MQQ A;  5A93 A;  2VGL M;  3IHA A;  4PM9 A;  4OQ0 A;  1PFL A;  2ZM2 A;  1DP6 A;  2XLN A;  2ZJ9 A;  4UQI M;  4ZDX A;  1SHV A;  2L0W A;  3RFB A;  3G35 A;  2E8I A;  1H8Z A;  2P08 A;  3A0V A;  1OT6 A;  2V2F F;  1SDE A;  2M7U A;  2JKT M;  1JNU A;  3OCN A;  4EEP A;  5DKL A;  3T4T A;  4ZBE A;  3IF6 C;  1TD5 A;  4DKI A;  3TRC A;  5J3W A;  4C3Q A;  4R70 A;  2Q9M A;  2V1A A;  3WWX A;  1ZKJ A;  3A3E A;  2PBD P;  3ZDJ A;  1S1Y A;  1L0G A;  2WKQ A;  2ZMV A;  3A3I A;  4CLC B;  4MBF A;  2Z2L B;  3P01 A;  3T1X A;  4S2K A;  2EX9 A;  2JHE A;  1P97 A;  1A0K A;  4I38 A;  1GSV A;  2YKH A;  2VZW A;  4DDS A;  4E3J A;  1GSW A;  4UAA A;  1FCN A;  3MZD A;  3VSL A;  2OSU A;  5F69 A;  4EWF A;  1AWI A;  5D3O A;  1IYQ A;  3T4J A;  3T4Q A;  3SH7 A;  3FC7 A;  5CED A;  4GDB A;  4X68 A;  1T19 A;  3ULF A;  3UDX A;  5A92 A;  5FSR A;  3OOV A;  4WEJ A;  3ISG A;  1W79 A;  3E0Y A;  2ZQC A;  2QKP A;  5F6A A;  4U0X A;  3IT9 A;  2W3F A;  2PR6 A;  1F9I A;  2ZOH A;  1P9R A;  1S0W A;  3ZCZ A;  2WAD A;  3N4I A;  2CC1 A;  5GHX A;  2J80 A;  1KVL A;  2YKF A;  1S1Z A;  3M2K A;  5KIZ A;  5U47 A;  2WGI A;  3O5Y A;  4PAU A;  5HAQ A;  2I9V A;  4NKP A;  1MWR A;  1E3U A;  3EOI A;  2Y2G A;  1DRM A;  2VLG A;  3QP1 A;  4QWO A;  2XK1 A;  4L9F A;  5IS1 A;  3LO7 A;  3ZG5 A;  4B9O A;  5KSC A;  2GNX A;  5HPI A;  3C38 A;  2FFF B;  2PD8 A;  4HES A;  2Y59 A;  3T12 B;  2B95 A;  2K7S A;  4Q8I A;  4BD0 A;  5DJU A;  1ZC2 A;  4EUZ A;  2WZX A;  4DXC A;  3NBL A;  5E2E A;  4KG5 A;  3WS0 A;  1RGY A;  2Y2H A;  4F3L A;  1IKG A;  1TEM A;  2OWJ A;  4EBL A;  4O7D A;  4E3L A;  2PU2 A;  1ONG A;  4ZJ1 A;  3LYX A;  4Y17 A;  1K55 C;  1BTL A;  2HDU A;  3UE6 A;  2IWC A;  1ZHH B;  2ZQ8 A;  3QHY A;  3CLO A;  2R9W A;  1M40 A;  4DMZ A;  3BRM A;  3FPW A;  3NOP C;  2XDM A;  4HJ6 A;  3E2K A;  1XA1 A;  5F5Y A;  2PD7 A;  1GA0 A;  4GS9 B;  1QMF A;  2VV8 A;  4LCL A;  1KDW A;  1T18 A;  4BD1 A;  3UN7 A;  3C4O A;  2W3H A;  1K54 A;  5HPF A;  3O3V A;  5G18 A;  5EOE A;  2Z6D A;  4II7 A;  3NC8 A;  1WE4 A;  1YLT A;  1TVF A;  1N9N A;  3BFG A;  5F68 A;  1H8Y A;  1K38 A;  5E2G A;  1W8Y A;  2IWD A;  1G28 A;  2D02 A;  1LHY A;  3BFC A;  1T1B A;  3TJZ C;  5TGF A;  3UDI A;  4OPZ A;  1YSP A;  4X55 A;  2M7V A;  2Y2I A;  1BUL A;  3NDG A;  4GW9 A;  1TS7 A;  4WBG A;  3QP4 A;  1YLZ A;  1OTB A;  5I94 A;  4HQA A;  3VMA A;  3LID A;  4L0L A;  5DF9 A;  1NRJ A;  3EGD C;  4UA7 A;  3GEC A;  1LI9 A;  4WL9 A;  2VV7 A;  2XEP A;  4YOF A;  3UB7 A;  1H5X A;  1DP9 A;  4MEZ A;  3VP0 A;  5KSH A;  2W0N A;  4XUZ A;  2R78 A;  2P9V B;  2HPB A;  4OOL A;  3SW1 A;  4OQH A;  1K6S A;  5DTS A;  4BWI A;  2FFY A;  2J3T D;  1VET A;  4AFI A;  4B93 A;  2ZLY A;  2V20 A;  4WYY A;  4JF4 A;  1OTD A;  4DE0 A;  1XGI A;  3ZFZ A;  4KUO A;  3B3X A;  4CJN A;  2HP5 A;  4N92 A;  5EV0 A;  3M6H A;  5DFY A;  2VKS A;  5HAP A;  3HJK A;  1U60 A;  3LUQ A;  3A3D A;  3KX0 X;  3NY4 A;  1SZV A;  1XJ3 A;  5FQI A;  3LIE A;  3R7W A;  5DTK A;  2HGV A;  3LIF A;  2ZL1 B;  2ZQA A;  4P6Z M;  2PT7 A;  4P6B A;  1I5Q A;  4HP4 A;  2A2L A;  4EXO A;  5HWT A;  4OOM A;  4Y3I A;  3WRT A;  4R6L A;  3VE3 A;  1T1A A;  4UHU A;  3IX4 A;  2HDQ A;  1WYC A;  3IH9 A;  5DVA A;  2H0T A;  3IX3 A;  3VOL A;  2Y91 A;  2WK0 A;  2Y2K A;  3IH8 A;  4OP8 A;  3NEC A;  2PYP A;  3FYZ A;  2BG1 A;  2NUP C;  4JGQ A;  2LB5 A;  5MC7 A;  3G34 A;  3MXS A;  2V1Z A;  3V5M A;  4FSF A;  4KG6 A;  2WKE A;  3ZYT A;  3PTE A;  1PIO A;  4HOI A;  4M4X A;  2OLU A;  3IX8 A;  1FIK A;  1K54 C;  4E3K A;  1L3L A;  4KQR A;  1CI9 A;  1YMX A;  3OPP A;  3Q07 A;  1BUE A;  1DJB A;  3E4P A;  4EW7 A;  4EBN A;  3D9Y A;  3N8R A;  1ODV A;  1K6R A;  3LR4 A;  3GSG A;  3HLB A;  2R9X A;  4R3J A;  3HJI A;  2C5W B;  3FPV A;  5AQ9 A;  1K25 A;  1PI4 A;  3GMW A;  4HBU A;  2AVX A;  1ACF A;  3SS5 A;  3IXB A;  3IF5 A;  3D3O A;  5L07 A;  3MF0 A;  2XD5 A;  3NUL A;  2Q9N A;  2I72 A;  5HZH A;  4S2J A;  5JYP A;  4BMW A;  5FA7 A;  3DWZ A;  3G2Z A;  3IS2 A;  4FH4 A;  1PWD A;  4DE3 A;  3HLF A;  4IVK A;  3UPO A;  5GHY A;  1G68 A;  5GLB A;  4QU3 A;  2A3U A;  3OCL A;  4JPM A;  4IUH A;  1BT5 A;  1ZG6 A;  2G2U A;  3GVB A;  1X0O A;  2O99 A;  4OVD A;  1N9L A;  3OPH A;  5TJJ A;  4N1X A;  3G4P A;  5TFQ A;  4OQI A;  5L09 A;  4QY6 A;  1WA9 A;  4OOY A;  3MMH A;  3VE4 A;  2QPN A;  4IED A;  1ES2 A;  1PRQ A;  2VJW A;  3C4P A;  2VGK A;  2IA2 A;  4WUJ A;  2VGJ A;  5M18 A;  5F82 A;  3CG5 A;  5FI2 A;  5EM0 A;  4WLA A;  3U2A A;  1ERO A;  1MPL A;  2HDR A;  3D72 A;  3NCK A;  4O0P A;  1N9B A;  3LI9 A;  3DTK A;  4NEE D;  2PR5 A;  4WM9 A;  4N9K A;  5DJT A;  3W8K A;  4LRZ E;  4Z1W A;  3GTC A;  4MDZ A;  2W1T B;  2Y2L A;  4R3A A;  1K57 A;  3ZQ5 A;  1BLS A;  3C5A A;  1I2S A;  3UPN A;  4BL2 A;  3PXP A;  4KZ5 A;  3ZG7 B;  4OKP A;  3BLS A;  3OLO A;  1YLJ A;  3K2N A;  4X56 A;  2O9A A;  1XX2 A;  1KGE A;  4B4X A;  4BBU A;  1CJF A;  1D1J A;  1I2W A;  3VSK A;  1C3B A;  5CGW A;  2JKF A;  5E2F A;  1S4S A;  3LIA A;  3C7V A;  1S6R A;  1YLP A;  4I3I A;  4NET A;  4OP5 A;  2BAS A;  2Y2O A;  1L0F A;  2CMN A;  5FQ9 A;  3ICY A;  4CLC A;  3CZD A;  3LEQ A;  4Q0H A;  1TS8 A;  2EFU A;  3BEC A;  3GDI A;  3QP8 A;  4EEU A;  3UB9 A;  2B5R A;  4MN6 A;  4BEN A;  2V0U A;  1NYY A;  1FSY A;  1ESI A;  4P85 A;  5AQ7 A;  2E8J A;  1PNE A;  4PKY G;  2ACG A;  5J4E A;  1NLZ A;  3CWF A;  4QHC A;  3DBA A;  4MCW A;  3RXX A;  2J9O A;  4F94 A;  2OWH A;  3O87 A;  1PYY A;  2OV5 A;  1FCO A;  5M19 A;  5EFW A;  1GA9 A;  1K56 D;  2UV0 E;  1Z6F A;  3BFF A;  4JLF A;  3MKE A;  4QD4 A;  2OAP 1;  5FQK A;  1E25 A;  2V9A A;  2ZQD A;  1RCJ A;  3AGD A;  3BEB A;  4RVA A;  4XT2 B;  3Q82 A;  1L0E A;  3BQA A;  3EGX C;  4E3O A;  4MN7 A;  4R23 A;  4HNB A;  1HVB A;  4LEN A;  1ES5 A;  3S7N A;  5FQQ A;  3CMZ A;  3OZH A;  2H28 A;  4WN5 A;  4X25 A;  2EWW A;  1H0M A;  3NOU C;  3T4S A;  5FAO A;  4ZAM A;  3LY3 A;  1IOU A;  1PI5 A;  3PAG A;  2G2W A;  4Y5F A;  3BQ8 A;  3HUN A;  4YIN A;  3FV7 A;  3LI8 A;  4HHD A;  2L4R A;  5EPH A;  4FD8 A;  4KUK A;  2OLV A;  3PBQ A;  1OJG A;  4YFM A;  1LT0 A;  4DRT A;  1Q2P A;  4GHI B;  2VV6 A;  3E98 A;  3SS4 A;  3RXW A;  3F1P B;  5CHJ A;  3WS1 A;  3H82 B;  2VA0 A;  4E04 A;  3CIT A;  2XD1 A;  4BL3 A;  2EXA A;  3UB8 A;  2XRN A;  1D06 A;  4GD6 A;  4IUK A;  2MJ6 A;  4ARZ B;  1RGZ A;  4WZ5 A;  4Q0J A;  5CX7 A;  3VP1 A;  4IHQ A;  4X6T A;  4HH2 A;  3TW8 A;  1SKO B;  4MLL A;  4R4R A;  4OQG A;  4S2L A;  2ZM8 A;  2XA7 M;  2ZQ7 A;  4IVI A;  2FH5 A;  3IBR A;  5AQB A;  5F83 A;  1SDN A;  1IKI A;  2H0Y A;  4KZ3 A;  4JF5 A;  2BTF P;  4UA6 A;  1OTI A;  1CEF A;  2ZMF A;  3M2J A;  4G3K A;  1XPB A;  4GS9 A;  1UWP X;  3IXG A;  4CLC C;  3SZT A;  2LB9 A;  1LL9 A;  1HD8 A;  3C7U A;  1LI0 A;  3QNC A;  3CPT B;  2B02 A;  2P7J A;  3IBJ A;  2BLS A;  4C75 A;  1NJ4 A;  2Z6C A;  1NYM A;  4PM6 A;  1F5M A;  3UO9 A;  1NZO A;  3Q81 A;  4S2N A;  3QNB A;  2M1C A;  4Z9Q A;  4XUX A;  2W3G A;  1YSQ A;  2GDN A;  2XGN A;  4KQD A;  1Y4O A;  2VX8 A;  2W1R A;  4OPY A;  4A5R A;  1O07 A;  4CLC D;  3MZE A;  1XA7 A;  4NK3 A;  5A90 A;  4I3J A;  2ZD8 A;  3MXR A;  4JXW A;  4LV3 A;  2KOI A;  1MC0 A;  3LGO A;  5EVE A;  3OC2 A;  3CHW P;  2P9V A;  3DWK A;  4BLM A;  1FSW A;  4GCZ A;  1YLY A;  2PHY A;  3VP3 A;  4S2M A;  1ERM A;  3KYE A;  4OPQ A;  5FL3 A;  1GCE A;  3FKV A;  2J3T C;  4Y7P A;  3WS2 A;  1JTG A;  3GR2 A;  3LY4 A;  2V8C A;  4R38 A;  3C2W A;  4B88 A;  4K08 A;  5DF8 A;  2KLI A;  3Q7V B;  2Y2N A;  3UB6 A;  5J7E A;  1ALQ A;  5HL6 A;  1OJ5 A;  3PHY A;  1GHM A;  3CJM A;  3UY6 A;  3KSH A;  1ONH A;  4RA7 A;  2JC7 A;  2X02 A;  1Q2Q A;  1HLU P;  4JBF A;  4XXR A;  5E2H A;  3SH9 A;  4GDN A;  1TDL A;  1QME A;  4MMN A;  3KO6 A;  4EER A;  3NJA A;  3MJQ A;  1SKF A;  3S7P A;  4Q0I A;  3NI9 A;  3ZG0 A;  2WGV A;  5K5B A;  1PW8 A;  2ZL1 A;  3BYD A;  4WF0 A;  1VEU B;  2A24 B;  3UME A;  2VGL S;  3W4O A;  3VV4 A;  1ERQ A;  2NUT C;  3G6O A;  4DDY A;  4UQI S;  3OBF A;  2JN7 A;  3E4Q A;  4UEY A;  1BLC A;  3EEA A;  5J8X A;  2HZ5 A;  4JKT A;  2W27 A;  3HBR A;  1P9W A;  1PZP A;  4G3W A;  4KZ4 A;  3CAX A;  4MNR A;  1ES3 A;  3B47 A;  3BLM A;  3H7W B;  4OH0 A;  2A49 A;  1XJ6 A;  1H3Q A;  4X53 A;  1BLH A;  2VEA A;  2PDR A;  3QP6 A;  1JTD A;  4IJG A;  3MS6 A;  1J3W A;  4HBT A;  2XFT A;  4R3B A;  1FQG A;  5FDS A;  4WMC D;  2EX2 A;  2WKH A;  1FR1 A;  3RTY A;  3N7W A;  2O9B A;  4NG2 A;  3A3J A;  1LL5 A;  1Y54 A;  4S2P A;  2FZ0 A;  2K2N A;  5AVE A;  3ZG9 B;  5A91 A;  4LGW A;  2Y2Q A;  3LIC A;  4RX2 A;  2P74 A;  3T1R A;  4H6J B;  4YWZ A;  5GHZ A;  2JCH A;  2INW A;  1XGJ A;  2Y55 A;  1IYS A;  4GB7 A;  1KGF A;  4GKU A;  2K31 A;  1YT4 A;  5GLA A;  5LBR A;  3SH8 A;  4ZJ2 A;  1KOU A;  3ZG8 B;  3A0S A;  5EVI B;  2WAE A;  3W2Z A;  2WGW B;  1DJA A;  1K56 A;  4E6X A;  2OOL A;  3TSG A;  1S66 L;  4M3K A;  4ZJ3 A;  4ETZ A;  3EQU A;  1YMS A;  4ESP A;  3HLG A;  3DW0 A;  4NXE A;  3P09 A;  2QYB A;  5HD3 A;  1P0Z A;  2ZC5 B;  2HV1 A;  1M6K A;  3GRJ A;  4D2O A;  1Z09 A;  3JYI A;  4E3I A;  1KE0 A;  3JPU A;  4MN5 A;  3GV9 A;  3IQA A;  1GHP A;  3ZVT A;  5EVL A;  1E4D A;  4HY8 A;  2HF6 A;  1OTE A;  1G6O A;  5GLC A;  1KE3 A;  3CUE A;  5HW3 A;  3BY9 A;  1IYO A;  3VFF A;  5KMW A;  3LR3 A;  3BFD A;  3T50 A;  3EWK A;  3MFX A;  3HLC A;  2RCX A;  5HWW A;  2VK3 A;  1FOF A;  4KG2 A;  5HL1 A;  2EFX A;  4FOF A;  4PM8 A;  5HDS A;  4K0W A;  3HLW A;  1YPR A;  5CGS A;  1XJ4 A;  2Y2J A;  2W1T A;  1FCM A;  2WZZ A;  4LV0 A;  1MXO A;  2QHK A;  2Y2M A;  3IXD A;  3IF6 B;  3NDE A;  1CEG A;  4NXG A;  1MKM A;  3HVF A;  2V1B A;  3DTM A;  2J8Y A;  3ZHH A;  1OTA A;  3UPP A;  5IU1 A;  2EX8 A;  3UDF A;  3IXH A;  1NZU A;  5E43 A;  5FI6 A;  5TBM B;  1NXY A;  4IBX A;  5FQM A;  1YAX A;  2ZMA A;  3FZC A;  1KVM A;  1CQA A;  2DNS A;  2O9C A;  3F1N B;  4QB8 A;  1H8M A;  3MKF A;  4RYE A;  4D60 A;  1LL8 A;  1W8Q A;  3DTI A;  1NY0 A;  3V50 A;  4X69 A;  3F1O B;  2X01 A;  4RX3 A;  4S2I A;  3PBR A;  4U0T A;  3JVV A;  3PBN A;  3W4Q A;  4EQI A;  1PWC A;  3BM6 A;  5M1A A;  3MBZ A;  1TDG A;  2H5S A;  3LCE A;  3VP4 A;  1K0K A;  4B4Z A;  4QJG A;  5HWV A;  1XJ2 A;  3O86 A;  1NWZ A;  4DF6 A;  3IWO A;  5CHU A;  2Y8H A;  3UE1 A;  4XT2 A;  2KDK A;  2EXB A;  3UE0 A;  3VOZ A;  3Q1F A;  2ZC6 B;  4HH3 A;  1EWZ A;  3RH8 B;  4PHT A;  5IT5 A;  5HAI A;  5JYO A;  4UA9 A;  4P87 A;  3U4L P;  1EW0 A;  3N8L A;  3KSG A;  3MFD A;  4E6W A;  4FUW A;  3RJU A;  1S4R A;  3LR0 A;  1K55 A;  3G2Y A;  5L10 A;  3UMD A;  3S4X A;  3ITA A;  1GHI A;  3CUE C;  4K0X A;  3UB5 P;  3W4P A;  2WUQ A;  3FWL A;  3MR0 A;  4GLQ A;  3PBT A;  4L9G A;  3HUM A;  4QPR A;  3IHB A;  1MY8 A;  1F98 A;  3S1Y A;  4GHI A;  5L2F A;  4P6Z S;  1TF1 A;  2UWX A;  3F1P A;  1N4O A;  3H82 A;  3R4K A;  4LCM A;  4WEK A;  2HP9 A;  3HL9 A;  2JBF A;  4ZRR A;  1BSG A;  1OT9 A;  4L9E A;  1XP4 A;  2X71 A;  5FEG A;  4EUV A;  3LIB A;  3KYQ A;  3V39 A;  4LRX C;  4KZ7 A;  4ARZ A;  4BBT A;  2WYX A;  4HIA A;  2W3D A;  5DTT A;  2XF3 A;  4ZTK A;  1UGU A;  4OON A;  1XFQ A;  1SKO A;  4LPZ A;  5BOH A;  5CER A;  1GSX A;  1ZTU A;  1VB6 A;  4BBV A;  4Y0U A;  1PWG A;  3MQ0 A;  5FAP A;  2PYR A;  2GZA A;  2JKR I;  5FI7 A;  3LFV A;  5AJG A;  4PMA A;  4DXB A;  2ZC4 B;  2EA9 A;  3DAV A;  5F1G A;  4I39 A;  4EV4 A;  1K57 C;  1EI5 A;  4WMC A;  4FCF A;  3N6I A;  2XFS A;  1MWT A;  2PRF A;  5AVF A;  1IYP A;  4G3V A;  3C8C A;  3CPT A;  5HX9 A;  4HJ3 A;  4YNR A;  5CTN A;  3ZGA B;  1G5U A;  2DRW A;  5G4Z A;  1W5D A;  2OAQ 1;  2PAV P;  4O01 A;  4PPR A;  2B18 A;  3NIA A;  3P7N A;  4IBR A;  1KDS A;  4KZB A;  3EEH A;  3IWQ A;  3EQV A;  3Q7Z A;  4DN0 A;  3LR5 A;  4I3A A;  1HTZ A;  4LV2 A;  1L0D A;  4KQO A;  3L9K A;  1XKZ A;  4KQQ A;  4ETX A;  2ZC3 B;  1J9M A;  3AGE A;  1IFQ A;  3BW6 A;  4KZ6 A;  3HRE A;  1JWV A;  4N1H A;  1Y28 A;  3TE8 A;  5EE8 A;  1VM1 A;  2IWB A;  5AQA A;  4R1G A;  4S2O A;  4R4S A;  1T1C A;  3K3C A;  1K4E A;  5DFX A;  4GNU A;  5CEC A;  3Q7V A;  1K4F A;  2H10 A;  1SCW A;  3FKW A;  5EM1 A;  4KZA A;  1CI8 A;  4E3M A;  5G4Y A;  1FIL A;  1UWN X;  3HLD A;  1LSW A;  3T4K A;  5HDD A;  4E3N A;  4MBH A;  4CLC E;  4F3L B;  1O7E A;  5HSQ A;  5FQJ A;  1V9Y A;  4DE2 A;  3A0R A;  4DE1 A;  2HJ9 C;  5FAS A;  1VEU A;  2A24 A;  4BJP A;  2WAF A;  3MZF A;  4GN2 A;  4CPK A;  3P98 A;  4P0M A;  1S67 L;  3AGF A;  3C30 A;  3S7O A;  3E2L A;  3LEZ A;  1ES4 A;  2Y2P A;  2Q0O A;  4EES A;  4DJ2 A;  4GD8 A;  4WZ4 A;  1IEL A;  3GQZ A;  4QY5 A;  1DP8 A;  5CTM A;  4N9L A;  3T1Q B;  3BWL A;  3SOI A;  4PM7 A;  4FH2 A;  2V8F A;  4X1L A;  3QP2 A;  1JWZ A;  4EET B;  4I5S A;  3T4L A;  1CK3 A;  2ZQ9 A;  4LV1 A;  3H7W A;  1STZ A;  2JKT I;  3VP2 A;  3UE3 A;  4LLO B;  4LFU A;  3PAE A;  1W63 Q;  3HUO A;  4EU0 A;  3T4O A;  4EBP A;  3A3F A;  1IEM A;  4ID4 A;  5CHM A;  5FEF A;  3ITB A;  5FDH A;  2WKR A;  5DKK A;  1LSX A;  3VFH A;  4O8G A;  4JGR A;  4GZB A;  3DTE A;  4WZ5 C;  2O0Y A;  4RQ9 A;  5HDC A;  1OME A;  1VHM A;  3BFE A;  4H6J A;  4OPR A;  2DCF A;  3B33 A;  3MQO A;  1MZU A;  1OPX A;  4PM5 A;  3KSF A;  4OLD A;  1F2K A;  2L1M A;  3OPR A;  4JGO A;  5HD5 A;  1RP5 A;  5EVI A;  4HEF A;  2WGW A;  3KYZ A;  4PKY A;  1VET B;  1WYB A;  3T1S A;  1MWS A;  2QWS A;  1E3U D;  1W7F A;  1TS6 A;  1MBL A;  2EX6 A;  3PR6 A;  5FAT A;  5KZH A;  4Y13 A;  4S2N C;  5CRF A;  2ZM0 A;  4BQM A;  2Z2M B;  2Y4A A;  3BJN A;  5GLD A;  3FG8 A;  5CEB A;  3NOT C;  5GL9 A;  2PBY A;  3B42 A;  4OLG A;  2EWV A;  3R7W B;  4FTX A;  4Y2F A;  2QZ6 A;  5A8B A;  5L8M A;  1YKD A;  5C5K A;  2ZBB A;  1ESU A;  1CF0 A;  2Y79 A;  3WS5 A;  3PBO A;  3D4F A;  4KZ9 A;  3V3S A;  2JE5 A;  3MXQ A;  1DJC A;  4GJ4 A;  3N8S A;  3S22 A;  2GJ3 A;  2G7U A;  1JWP A;  4X1M A;  4HP9 A;  5DF7 A;  1KE4 A;  2XH9 A;  3BY8 A;  4H8R A;  1LLB A;  4KEN B;  3G32 A;  1YLW A;  3L7H A;  3NHQ A;  3VOY A;  3JVU A;  4GOG A;  2JKR M;  3IF6 A;  3PYP A;  4U3T A;  3S7Q A;  5EUA A;  4CQH A;  4R0Q A;  3HLE A;  2J3W A;  4K91 A;  3ZVW A;  5TR7 A;  1BZA A;  2XA7 S;  3TG9 A;  2QMI A;  2XR0 A;  3H9W A; 
#chains in the Genus database with same CATH homology
 4EQ1 A;  4NXB A;  2ZOI A;  3KSG A;  1OTI A;  1OTD A;  2XRO A;  2ZMF A;  4DJ3 A;  2W3E A;  4G3K A;  4GS9 A;  2DMW A;  1S4R A;  3HCY A;  4KUO A;  4LRY C;  1UWP X;  5TBM A;  3LR0 A;  4CLC C;  3UMD A;  1TS0 A;  2LB9 A;  5DFY A;  2VKS A;  3HJK A;  2WKP A;  2B02 A;  2P7J A;  3IBJ A;  3LUQ A;  3KX0 X;  2Z6C A;  3CUE C;  3F1N A;  2V0W A;  1F5M A;  1XJ3 A;  3LIE A;  3R7W A;  4GLQ A;  3MR0 A;  3PBT A;  4L9G A;  2HGV A;  3E4O A;  1V9Z A;  3LIF A;  1BYW A;  2M1C A;  1N9O A;  4P6Z M;  4QPR A;  2PT7 A;  2W3G A;  1F98 A;  1YSQ A;  4KQD A;  4GHI A;  4HP4 A;  4P6Z S;  2A2L A;  1TF1 A;  4EXO A;  2VX8 A;  5HWT A;  3F1P A;  3F1O A;  4OOM A;  4HJ4 A;  3H82 A;  2W1R A;  3R4K A;  4Y3I A;  4WEK A;  4R6L A;  3VE3 A;  1T1A A;  4CLC D;  4ZRR A;  4HI4 A;  1NLY A;  1OT9 A;  2HJE A;  4L9E A;  3IS2 B;  2QJ5 A;  1W63 M;  3V67 A;  4I3J A;  2KOI A;  4EUV A;  3LIB A;  3KYQ A;  1MC0 A;  1D7E A;  3OC2 A;  4LRX C;  4ARZ A;  4BBT A;  4HIA A;  2W3D A;  4GCZ A;  2PHY A;  3VOL A;  1UGU A;  2XSS A;  4ME4 A;  1XFQ A;  3PBS A;  3CI6 A;  4WEL A;  5FL3 A;  4LPZ A;  2J3T C;  1GSX A;  1ZTU A;  1VB6 A;  2PYP A;  4BBV A;  3MQ0 A;  4R38 A;  4NXF A;  2PYR A;  2GZA A;  3C2W A;  5I5L A;  2JKR I;  4K08 A;  2NUP C;  4JGQ A;  2LB5 A;  3KSI A;  5MC7 A;  2KLI A;  3LFV A;  5AJG A;  1XFN A;  2EA9 A;  2P04 A;  4FSF A;  4I39 A;  3ZYT A;  3UB6 A;  1LSV A;  5HL6 A;  5J7E A;  1OJ5 A;  4HOI A;  4M4X A;  3PHY A;  2GX5 A;  3KSH A;  3K3D A;  5AVF A;  4G3V A;  3C8C A;  2D01 A;  2KX6 A;  2QJ7 A;  4MMN A;  4JGP A;  3KO6 A;  3E4P A;  4EER A;  4EW7 A;  3NJA A;  3MQQ A;  4HJ3 A;  3MJQ A;  3S7P A;  1ODV A;  3LR4 A;  4Q0I A;  4YNR A;  3HJI A;  3FPV A;  5G4Z A;  2VGL M;  5K5B A;  2OAQ 1;  4WF0 A;  4O01 A;  2B18 A;  2A24 B;  3UME A;  2VGL S;  1DP6 A;  3VV4 A;  4UQI M;  3D3O A;  3P7N A;  2L0W A;  2NUT C;  3RFB A;  3G6O A;  3MF0 A;  4UQI S;  3OBF A;  3A0V A;  2P08 A;  5HZH A;  1OT6 A;  2JN7 A;  3E4Q A;  4UEY A;  3EEA A;  3EEH A;  4BMW A;  3EQV A;  2M7U A;  4DN0 A;  3LR5 A;  3IS2 A;  4I3A A;  2W27 A;  4KQO A;  1P9W A;  2JKT M;  1JNU A;  3OCN A;  4EEP A;  5DKL A;  4ETX A;  3T4T A;  4G3W A;  1TD5 A;  3TRC A;  1IFQ A;  5J3W A;  3BW6 A;  4R70 A;  3OCL A;  4IUH A;  2V1A A;  3CAX A;  1S1Y A;  1X0O A;  3B47 A;  1Y28 A;  3TE8 A;  2O99 A;  3H7W B;  2WKQ A;  1XJ6 A;  2ZMV A;  1H3Q A;  1N9L A;  4CLC B;  2VEA A;  3P01 A;  5TJJ A;  2JHE A;  2PDR A;  1P97 A;  4IJG A;  4I38 A;  1GSV A;  1WA9 A;  2YKH A;  2VZW A;  3MMH A;  3VE4 A;  1T1C A;  3K3C A;  3RTY A;  1GSW A;  5DFX A;  2VJW A;  2O9B A;  2IA2 A;  4WUJ A;  5F69 A;  2FZ0 A;  2K2N A;  4WLA A;  5AVE A;  3U2A A;  5G4Y A;  3T4J A;  3D72 A;  3T4Q A;  1UWN X;  3LIC A;  3FC7 A;  4O0P A;  1T19 A;  1LSW A;  3ULF A;  3LI9 A;  4NEE D;  2PR5 A;  3T4K A;  4H6J B;  5HDD A;  4YWZ A;  4CLC E;  2INW A;  4F3L B;  5HSQ A;  5DJT A;  1V9Y A;  3OOV A;  4LRZ E;  4WEJ A;  4Z1W A;  4MDZ A;  3E0Y A;  3A0R A;  2W1T B;  5F6A A;  2QKP A;  2K31 A;  4R3A A;  2HJ9 C;  3ZQ5 A;  5LBR A;  2A24 A;  4BJP A;  1KOU A;  3A0S A;  2W3F A;  2PR6 A;  3W2Z A;  3PXP A;  1F9I A;  1S67 L;  2ZOH A;  1P9R A;  3C30 A;  3S7O A;  2OOL A;  1S66 L;  3OLO A;  3K2N A;  4EES A;  4ETZ A;  4DJ2 A;  2O9A A;  2J80 A;  3EQU A;  2YKF A;  4BBU A;  1DP8 A;  1S1Z A;  5KIZ A;  4NXE A;  2QYB A;  3O5Y A;  4PAU A;  5HD3 A;  2I9V A;  1P0Z A;  3BWL A;  1S4S A;  3LIA A;  4NKP A;  2HV1 A;  3EOI A;  1DRM A;  2VLG A;  4I3I A;  4MN5 A;  4EET B;  4I5S A;  2BAS A;  3T4L A;  4L9F A;  5IS1 A;  2CMN A;  3H7W A;  1STZ A;  2JKT I;  3ICY A;  4HY8 A;  4LLO B;  3UE3 A;  4CLC A;  4B9O A;  2HF6 A;  4Q0H A;  2GNX A;  5HPI A;  1OTE A;  1TS8 A;  1G6O A;  3C38 A;  1W63 Q;  3GDI A;  4EEU A;  4EU0 A;  3T4O A;  2PD8 A;  3UB9 A;  4MN6 A;  3CUE A;  2V0U A;  3BY9 A;  2WKR A;  4PKY G;  2K7S A;  3LR3 A;  5DKK A;  1LSX A;  5J4E A;  1NLZ A;  3CWF A;  3DBA A;  5DJU A;  4MCW A;  3T50 A;  3EWK A;  4O8G A;  3MFX A;  4JGR A;  2OWH A;  2O0Y A;  4RQ9 A;  5HDC A;  5HWW A;  1VHM A;  4H6J A;  3B33 A;  3MQO A;  4FOF A;  5HDS A;  4F3L A;  1MZU A;  1OPX A;  3KSF A;  1XJ4 A;  5EFW A;  2W1T A;  2L1M A;  2OWJ A;  4JGO A;  5HD5 A;  2QHK A;  2OAP 1;  2V9A A;  4PKY A;  3KYZ A;  4XT2 B;  4NXG A;  1MKM A;  3BQA A;  3LYX A;  3EGX C;  3UE6 A;  4MN7 A;  4HNB A;  1ZHH B;  3S7N A;  2QWS A;  3CLO A;  2V1B A;  4DMZ A;  3FPW A;  1OTA A;  1TS6 A;  3PR6 A;  3NOP C;  2H28 A;  4WN5 A;  5IU1 A;  2EWW A;  4HJ6 A;  5F5Y A;  2PD7 A;  3NOU C;  4GS9 B;  3T4S A;  3BJN A;  2VV8 A;  5TBM B;  3FG8 A;  3NOT C;  1IOU A;  1T18 A;  3B42 A;  1YAX A;  2W3H A;  4Y5F A;  3BQ8 A;  5HPF A;  3LI8 A;  4HHD A;  2L4R A;  2O9C A;  2Z6D A;  4II7 A;  3F1N B;  4KUK A;  2EWV A;  1H8M A;  3R7W B;  1N9N A;  4Y2F A;  5F68 A;  3PBQ A;  5A8B A;  1OJG A;  5L8M A;  1G28 A;  1LL8 A;  1YKD A;  5C5K A;  2D02 A;  2ZBB A;  1LT0 A;  2Y79 A;  3PBO A;  1T1B A;  4GHI B;  2VV6 A;  3TJZ C;  3E98 A;  3MXQ A;  4GJ4 A;  1YSP A;  3F1P B;  2GJ3 A;  3F1O B;  2M7V A;  3H82 B;  2VA0 A;  2G7U A;  4GW9 A;  4E04 A;  4HP9 A;  1TS7 A;  1OTB A;  3CIT A;  4HQA A;  3LID A;  3PBR A;  4L0L A;  5DF9 A;  1NRJ A;  3BY8 A;  3EGD C;  3JVV A;  3PBN A;  3GEC A;  3UB8 A;  2XRN A;  4WL9 A;  2VV7 A;  1D06 A;  4YOF A;  3UB7 A;  4IUK A;  1DP9 A;  5KSH A;  2W0N A;  2R78 A;  2MJ6 A;  4ARZ B;  4OOL A;  3NHQ A;  5HWV A;  3SW1 A;  3JVU A;  1XJ2 A;  1NWZ A;  4Q0J A;  5CX7 A;  4BWI A;  2JKR M;  3PYP A;  2Y8H A;  4IHQ A;  3TW8 A;  4HH2 A;  4XT2 A;  2J3T D;  2KDK A;  3S7Q A;  4CQH A;  2XA7 M;  2J3W A;  4AFI A;  2FH5 A;  3IBR A;  4B93 A;  4HH3 A;  3RH8 B;  4PHT A;  5IT5 A;  2XA7 S;  3H9W A;  1EW0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...