4HH3A

Structure of the appa-ppsr2 core complex from rb. sphaeroides
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
251
structure length
251
Chain Sequence
LPSLAPDLVRDLIATAADISLLVSQEGVVREVMANPHHPSFGQLSEWEGRPLEEVLTAESVAKFRLRSEGLEPGRGSVAVELNHIDPRSFEFPIRYILHRLPADRSILMLGRDLRPIAEVQQQLVAAQLAMERDYETQREMETRYRVVLDVSRDPMVLVSMSTGRIVDLNSAAGLLLGGVRQDLLGAAIAQEFEGRRRGEFMETMTNLAATESAAPVEVLARRSQKRLLVVPRVFRAAGERLLLCQIDPAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A ternary AppA-PpsR-DNA complex mediates light regulation of photosynthesis-related gene expression.
pubmed doi rcsb
source organism Rhodobacter sphaeroides
molecule tags Flavoprotein/transcription
molecule keywords Transcriptional regulator, PpsR
total genus 82
structure length 251
sequence length 251
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13188 PAS_8 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4hh3A02
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4hh3A01
1TS6A 1GSWA 1G28A 2A24A 2D01A 2PD8A 1GSVA 2Z6DA 4LPZA 4BBTA 4DJ2A 1OTDA 1OTIA 2K7SA 1S66L 2QKPA 1DRMA 1JNUA 2EA9A 3D72A 3G6OA 3H9WA 4NXGA 5J4EA 4EXOA 1UWPX 3CAXA 2OWHA 4I3JA 5HWTA 5J3WA 1XJ3A 3A0VA 3MR0A 3VE4A 3NOUC 4MN5A 4L9EA 1UWNX 1LL8A 3LIEA 1OJGA 3C2WA 3PHYA 1S1ZA 4I3AA 4BBVA 3GECA 5HDSA 1F98A 3F1NB 4JGRA 1EW0A 1X0OA 2KDKA 2V1BA 2HV1A 2PR6A 4GHIB 2PD7A 4GW9A 5F68A 4GS9B 3BWLA 3F1NA 2WKQA 3NOPC 3UMEA 2V0WA 2QJ7A 4KUOA 3ZQ5A 3LIBA 4E04A 1OTEA 4LRYC 4MN6A 1T1CA 1XJ2A 5G4YA 2CMNA 1S67L 5EFWA 4I39A 2I9VA 1NWZA 1S4RA 4PKYG 3OLOA 2PR5A 5DJTA 1ODVA 2GJ3A 5G4ZA 1P97A 1XJ6A 2ZBBA 2PYPA 1V9ZA 3UB9A 4EETB 4EEUA 1D06A 3EEHA 4R70A 5HSQA 1OJ5A 1LSXA 5I5LA 4XT2A 2WKRA 2V9AA 4H6JB 2ZOHA 4LLOB 5IU1A 5HWWA 5DJUA 2QJ5A 1TS8A 4HOIA 1N9NA 3C8CA 3LUQA 3MXQA 4PKYA 2A24B 5F6AA 3F1OB 5F69A 4L9FA 2QWSA 3A0RA 3CWFA 1T1AA 3E4PA 1XFQA 3LICA 4R3AA 4B9OA 1BYWA 3LIAA 1LSWA 2PYRA 4I5SA 2BASA 4JGPA 3VE3A 3A0SA 1OT9A 1XJ4A 1KOUA 2M1CA 3ICYA 5F5YA 3UB7A 4EERA 5HD3A 4HIAA 3KX0X 3H7WB 3IBRA 4HJ6A 3B33A 4NXEA 3BY8A 1VB6A 1T19A 4LRZE 5HD5A 5IS1A 3P7NA 3IS2B 4HH3A 4HH2A 3H7WA 3BY9A 4I38A 4LRXC 4YWZA 4H6JA 3UB8A 2WKPA 4EEPA 1D7EA 1UGUA 1OT6A 2P7JA 2INWA 3E4OA 4GCZA 5AVEA 5TBMB 4KUKA 2B02A 2J80A 3NHQA 3ULFA 2H28A 2VV7A 3RH8B 3H82A 1DP8A 1N9OA 3MQOA 4HP9A 4XT2B 1S4SA 2L0WA 4F3LB 2KX6A 1OTBA 1N9LA 2Z6CA 2VEAA 3HJIA 2PDRA 4WL9A 5J7EA 3SW1A 4GS9A 2R78A 3FG8A 3EWKA 3PYPA 3UE6A 1V9YA 3LIDA 3FC7A 3LIFA 4NXBA 4DJ3A 1TS0A 1XFNA 2YKHA 2L4RA 3UB6A 5HZHA 4GHIA 3HJKA 1LSVA 4WLAA 1DP9A 4KQDA 2OWJA 4WUJA 5HDDA 4NXFA 3NOTC 3MJQA 4R6LA 4F3LA 3CLOA 3LI9A 4WF0A 1GSXA 5HDCA 4EW7A 2V0UA 1OTAA 2PHYA 3RTYA 1MZUA 4HY8A 4HJ3A 2VV8A 5DKKA 1DP6A 4EQ1A 1S1YA 1T18A 2VV6A 2ZOIA 2W0NA 1Y28A 3K3CA 4I3IA 4L9GA 4RQ9A 3H82B 5HWVA 3GDIA 3T50A 2QHKA 3VOLA 3IS2A 2D02A 4EESA 3NJAA 4WN5A 1WA9A 4HP4A 5TBMA 5A8BA 3MFXA 4JGQA 3F1PB 4BBUA 3E4QA 1F9IA 4HI4A 4HNBA 4HQAA 5AVFA 4JGOA 3LYXA 2VLGA 2W27A 4M4XA 3MQQA 4K08A 3UMDA 5KIZA 1LT0A 3K3DA 2JHEA 2YKFA 2OOLA 3F1OA 2JN7A 1T1BA 4HHDA 4R38A 4HJ4A 2L1MA 2V1AA 5DKLA 1TS7A 3F1PA 1P0ZA 3LI8A
chains in the Genus database with same CATH superfamily
4PMAA 3NBLA 4EU0A 2DCFA 3SS3A 5KMWA 3HUOA 3U4LP 1AWIA 2ZM0A 3F1NB 3GRJA 4JGRA 1EW0A 2AVXA 3NOPC 3T1XA 1BT5A 4E6WA 3LR3A 1L2SA 3NC8A 1P97A 4X1LA 2HPBA 4S2IA 4H6JB 4HOIA 3MXQA 4OQGA 4IBXA 2QWSA 3E4PA 3HLCA 4JF4A 4R4RA 4GOGA 4O0PA 3IF6A 4E3OA 4FTXA 3H7WB 5EVLA 1E3UA 1J9MA 4LRZE 4EQIA 1WYCA 2E8IA 1GHIA 3ULFA 3RH8B 1N9OA 1ES5A 1TF1A 1S4SA 1K38A 1OTBA 2P74A 4WL9A 3ITBA 2IWCA 1GHMA 4ETZA 4N1HA 2ZC6B 2YKHA 3IXGA 3BLMA 1GA9A 4A5RA 3EOIA 3CLOA 2Y91A 4CLCA 3JVUA 1DP6A 3HUMA 4KZ8A 5FDHA 3R7WB 3VP3A 3VP0A 4HI4A 3S1YA 1FCNA 1IELA 2JE5A 4R3JA 1ONGA 4HJ4A 1BLHA 2J8YA 1XXMA 1P9RA 1HTZA 2O9CA 1PIOA 4MDZA 3MBZA 4Y0OA 4KQQA 3G6OA 3B42A 1SHVA 3IXBA 3IF5A 1IEMA 5FI7A 2Y2QA 2O99A 1M40A 3UMEA 3BFGA 1IYOA 2Y2NA 4LV2A 1J3WA 2BTFP 4I39A 1O07A 2RL3A 3N8SA 4R23A 1LSXA 1KE0A 5IU1A 4QWOA 3VP2A 2QJ5A 4UHUA 5CTMA 3F1OB 1G6OA 2XA7M 2CC1A 4OP8A 5HW3A 4R3AA 3OPHA 3VV4A 2W3EA 1K57C 1MY8A 1S6RA 3BY8A 4KG5A 2GDNA 1BLCA 2XR0A 2XEPA 4BLMA 3HLBA 2L4RA 2JC7A 5FATA 5M18A 1I2SA 3ZG5A 4NXFA 3MJQA 4BL2A 4WF0A 1OTAA 3IWQA 2VV6A 4C75A 1MWSA 2XRNA 5TJJA 2ZJ9A 1VQQA 1RCJA 3Q82A 1S0WA 3NJAA 3MFXA 1KVLA 2Z2MB 4DDSA 3Q81A 4QB8A 1LT0A 1KVMA 1T1BA 3ZG8B 1H8YA 3UN7A 3OOVA 2VGKA 1ERQA 4X1MA 2V2FF 4LGWA 5J3WA 3A0VA 5FAOA 5CGWA 3N8LA 4IUHA 4B93A 5F82A 4S2NA 5CERA 4GHIB 4CQHA 2WGWB 3UE3A 4LRYC 3IT9A 3OCLA 4ZAMA 3TRCA 5FEFA 3W4QA 2EXBA 3G31A 3ZG7B 2PR5A 2EWWA 3SS5A 2ZBBA 5EVEA 5HSQA 4XT2A 2V9AA 4GZBA 2PBDP 2FZ0A 3DTKA 5F69A 1FSWA 1NLYA 3DWKA 5CEBA 1GA0A 2EXAA 4X6TA 1W79A 3KYQA 4RYEA 1ZG4A 2Y2KA 2G2UA 1PNEA 3MQOA 5EOOA 3A3JA 2ZQAA 4KG6A 3T4KA 2PDRA 1PZPA 2R9XA 4X68A 2W1TA 1STZA 1DP9A 4D60A 4F3LA 5HDCA 5CTNA 1LLBA 3CITA 3G35A 3H82B 5GL9A 4QY5A 3CZDA 4R4SA 5I94A 4HBUA 1WA9A 4NEED 2EFXA 4DE1A 3GR2A 4XUXA 4Y0TA 3VP4A 2JHEA 5A93A 4OQIA 2A24A 5DFXA 3MZEA 4LPZA 3UPNA 1S66L 3TOIA 4EXOA 2OWHA 4JF6A 2VGJA 1LL8A 2MJ6A 1D1JA 3OBFA 4RA7A 4K91A 3T1RA 3T4OA 3NY4A 3SZTA 3HLDA 2V0WA 3CPTA 3CI6A 5HL6A 3L7HA 1MXOA 3V5MA 1XJ2A 4M3KA 3PR6A 4UA9A 1K6RA 3HLGA 4DMZA 4DN0A 2V20A 2A24B 4E3JA 3A0RA 4S2KA 1OMEA 4KZBA 1OT9A 4OOLA 4YINA 5FSRA 2VX8A 4NXEA 4BWIA 2HGVA 2OLUA 3BY9A 4X56A 5AVEA 3NHQA 1OPXA 4OONA 2Z2LB 4WZ5A 4YNRA 2J9OA 4F3LB 3UDIA 3LGOA 3TW8A 3IXHA 4JKTA 1LSVA 3M6BA 4KQDA 2V0UA 1NRJA 3IF6C 4HY8A 5DKKA 4EQ1A 1XPBA 2VA0A 3T50A 1G68A 4Z1WA 4WN5A 3A3DA 5M1AA 4MBHA 1NJ4A 5TR7A 5AVFA 5KIZA 1FR1A 3PAGA 3VMAA 4KZ5A 4HHDA 2A2LA 2WZZA 5DF9A 4S2JA 4O01A 1K55A 1K25A 2IWDA 3IHBA 1EI5A 4G3VA 4EWFA 5CHMA 4WELA 2I72A 1RGYA 4I3JA 4Y17A 5HWTA 3NOUC 3UE1A 4LCLA 3LIEA 3MS6A 5HPIA 1IYPA 1W8QA 3ZHHA 5HX9A 1KE4A 2OAP1 1IKGA 1BSGA 4MMNA 3O5YA 3ZDJA 5TFQA 3WS4A 3UB5P 3QP2A 4JF5A 3LIAA 3SH8A 3UB7A 1ZKJA 4X25A 2B95A 3KX0X 3MZFA 2W3HA 3NI9A 2K31A 4ARZA 2ZQ9A 2ZM8A 1W63Q 1N4OA 5CECA 1FILA 4DDYA 1YM1A 5EM1A 3C30A 4DE0A 4JXVA 4YOFA 3FG8A 2DNSA 3FC7A 4X55A 4WBGA 4IHQA 2HJEA 4C6YA 1IFQA 1NYYA 3JYIA 5L09A 5L2FA 4EESA 2FH5A 3V3SA 1MPLA 3NCKA 4Y5FA 3TE8A 3LYXA 4NKPA 4E3LA 4OPYA 2XQZA 4DRTA 1E3UD 1W63M 1GSVA 5K5BA 4B4XA 1OTDA 3LEZA 1JNUA 5IT5A 3VE4A 4WYYA 3KSIA 2ZQDA 4L9EA 4JLFA 4Y15A 3QP6A 4YFMA 2Q9NA 3PHYA 3C7VA 4I3AA 4BBVA 3QNBA 5CX7A 1JWZA 1L0DA 2Y2HA 3LIBA 5DF8A 1YQSA 5G4YA 2Y2LA 2CMNA 3UO9A 4KQRA 2VGLM 4BL3A 2C6WB 1W5DA 4ME4A 1XJ6A 3IHAA 5FDSA 5M19A 3BFFA 3LFVA 2WADA 1N9NA 4MNRA 3VOZA 4L9FA 2PBYA 1CK3A 1T1AA 1G5UA 3OPPA 1G6AA 5GLDA 5CHJA 1DY6A 4GB7A 3FV7A 5A91A 3AGEA 4HH2A 4YWZA 2WKPA 1DJBA 3MXRA 1PWDA 3O86A 1NY0A 1JWPA 2J80A 3DTIA 3PTEA 5CGSA 3GQZA 4Y3IA 1NXYA 2OSUA 3CPTB 4E6XA 1W7FA 4OQ0A 1L0GA 4Y0UA 4WEKA 5DTTA 3IH8A 4GHIA 4E3KA 2HP5A 3HJKA 1BUEA 2UWXA 3DWZA 4UQIS 2PHYA 3MQ0A 4PAUA 2ZMFA 3BFDA 1K56D 4HP4A 5TBMA 3NDEA 1K54A 3E4QA 3BQ8A 2H0YA 3GVBA 4Y13A 1YLWA 4QPRA 4BQMA 2D01A 2JKTI 1HLUP 4BBTA 3CHWP 5F1GA 1BLPA 3A3FA 4B9OA 2EA9A 4WZ5C 3PBSA 3EEAA 2J3TC 3PBNA 1S1ZA 4P6ZS 3S7NA 5HDSA 3KSFA 1X0OA 2KDKA 3GTCA 2PD7A 4ZRRA 3HLEA 4MCWA 1ALQA 1AXBA 2QJ7A 2EWVA 2JCHA 4EBLA 4PKYG 1ZHHB 3LCEA 4ETXA 2WUQA 4MEZA 5DJUA 3QHYA 5DTKA 2XH9A 1PW8A 1LSWA 2BASA 5CRFA 1KOUA 1TD5A 4CLCC 2PAVP 5FQJA 3CG5A 3B33A 4D2OA 1ESUA 4IUKA 3K2NA 1D7EA 5HL1A 3E4OA 3LY3A 2X71A 5EV0A 4HP9A 1SKOB 3LR5A 3MMHA 2QZ6A 2XD1A 4CLCE 3FPVA 1V9YA 1TS0A 3FWLA 4OP5A 1NZUA 1YLTA 3HREA 3G30A 4EW7A 1S1YA 2IWBA 4RQ9A 1CF0A 5L07A 2HP9A 4KZ3A 2D02A 5HFOA 2JKGA 4JGOA 2VLGA 2W3FA 1I5QA 2ZLYA 1LHYA 1Y54A 2HDUA 1SDNA 3WS1A 4ZJ3A 2HDQA 4II7A 4AFIA 5GLCA 1TEMA 1F98A 3PBTA 4Q0JA 5BOHA 3N6IA 5A92A 1FOFA 5C5KA 1ONHA 3G34A 4Y7PA 1S67L 2QPNA 3T4LA 3HCYA 3OLOA 3ZFZA 5E2FA 2J3TD 1I2WA 1D06A 1VEUB 1ERMA 2ZL1A 4RVAA 3JVVA 1MWUA 3LR0A 4LV1A 4ESPA 1KGEA 1BYWA 4GD6A 3VE3A 5CHUA 3A0SA 3AGDA 4GDNA 1SKFA 3TJZC 1GHPA 4U3TA 5HD5A 4EEPA 2EFUA 2OAQ1 3KSGA 4MBKA 4H6JA 3E2LA 1NLZA 3FKVA 5TBMB 1FSYA 4EBNA 4KZ6A 2H28A 5E2EA 4QU3A 2ZL1B 3QNCA 3MZDA 4N1XA 2ZC4B 4IVKA 1XGJA 2W3GA 1XFNA 2Q0OA 4KZAA 3T4QA 1RP5A 2Y79A 2WGVA 2WKIA 4OKPA 1HZOA 4HJ3A 3FZCA 4KENB 2ZOIA 3UDFA 3C38A 1K0KA 3ZVTA 4LV3A 4OVDA 1ZG6A 3ITAA 3QP5A 3HVFA 1YSPA 3WS0A 1YAXA 2A49A 2W27A 3UMDA 2JN7A 3BYDA 2XA7S 2Y2PA 4R38A 2L1MA 4MN7A 4NXBA 2ZQ8A 3F1PA 1G28A 1BZAA 2WYXA 4NXGA 1QMFA 1Q2QA 2DRWA 1IKIA 4WZ4A 3MR0A 3D9YA 3E98A 2V1ZA 3PBRA 2PT7A 2ZQ7A 3WS2A 3W8KA 3EGDC 3C4PA 3V67A 4GN2A 3QP8A 4U0XA 1C3BA 5DJTA 5G4ZA 1BTLA 5LBRA 3DTEA 1SKOA 3MF0A 3D3OA 1EROA 1JWVA 4JGPA 3HLFA 3ICYA 5TGFA 3QP4A 3MSHA 4EERA 1EWZA 1KDWA 4BENA 3BM6A 4GDBA 3MKEA 1U60A 4G3KA 3Q7ZA 5D3OA 2P7JA 3V39A 4MLLA 3P98A 1DP8A 3T4TA 3HUNA 1H0MA 3ZNYA 1L3LA 4R3BA 1KGFA 1VM1A 5DF7A 5DTSA 1KGGA 2KOIA 3G2YA 3BFCA 1XGIA 1PWCA 4JPMA 2JBFA 2WGWA 2XFTA 3BJNA 3UPOA 1VETA 1SCWA 4JXSA 3IS2A 5EECA 1PWGA 2GNXA 5GHYA 4IEDA 3S7OA 4HQAA 3MQQA 4ARZB 3F1OA 1Z6FA 4UA7A 5HARA 3Q7VA 3GMWA 2Z6DA 3LI8A 5FL3A 5FASA 3LR4A 2WKHA 3T4JA 1TVFA 2HV1A 4QY6A 3BWLA 4DE3A 4E3MA 4E04A 3V3RA 1PFLA 5EFWA 1O7EA 3UB9A 2GJ3A 1TDLA 1ZTUA 3EEHA 3MFDA 3T1SA 3T12B 4ID4A 4Q8IA 3M2KA 5I5LA 3I7JA 1TS8A 5F6AA 3W4OA 1BULA 5DFYA 4I5SA 1K57A 4RX3A 3DBAA 4HIAA 1YLZA 3G4PA 4P0MA 2NUTC 5FI2A 2ZMAA 4I38A 1W8YA 4P6BA 5GHZA 4GCZA 4BD0A 3HBRA 2XROA 1FCOA 1YT4A 3ZVWA 3NDGA 1L0FA 3NULA 4XXRA 2B5RA 3E0YA 3A3EA 2PRFA 3UB6A 1IYSA 4FD8A 3JPUA 3B47A 3LI9A 3R4KA 1SZVA 4Q0IA 2QYBA 4IVIA 2W1TB 4OH0A 1T18A 2VZWA 2ZC7A 3BEBA 1JTDA 4UQIM 1LI0A 2QHKA 5EOEA 3LY4A 4EUZA 1NYMA 3E2KA 1LL5A 4PM7A 1PYYA 4JBFA 1H8MA 5DKLA 5FQIA 1YPRA 5FEGA 2PU2A 2K7SA 2QKPA 4L0LA 1PRQA 1Z09A 2P04A 4S2NC 5FAQA 3W4PA 3NIAA 5DVAA 3IBJA 3GECA 3KO6A 2V1BA 3UE0A 2XK1A 3F1NA 3C5AA 3ZQ5A 4KG2A 2C5WB 3PAEA 3OZHA 2PYPA 1V9ZA 3ZG9B 4FSFA 5KSHA 4R70A 4E3NA 4KZ4A 2H10A 3IXDA 3EGXC 1IYQA 3CWFA 3FKWA 1E4DA 4GKUA 3QP1A 4QJGA 3S7PA 3N7WA 4KZ9A 4NK3A 1K6SA 2HP6A 3H7WA 4GLQA 3L9KA 3IF6B 2B02A 3BRMA 3B3XA 3CJMA 2M7VA 3UDXA 3H82A 3V50A 2P08A 2J9PA 2X02A 5CEDA 2L0WA 5MC7A 2KX6A 1N9LA 5EE8A 5AQBA 3WRTA 5L10A 1F5MA 1H3QA 1K55C 2Y59A 3LIFA 1F2KA 3IWOA 3NOTC 1YSQA 3O88A 3WRZA 3RTYA 4O7DA 1JTGA 4HBTA 1MKMA 3T1QB 2LB9A 1YMSA 4OLGA 5L8MA 5GLAA 4ZJ1A 4I3IA 4L9GA 3GDIA 4F94A 5A8BA 1MWRA 1YKDA 4FUWA 3VFFA 3ZNTA 5JYOA 2Y55A 2PU4A 1KDSA 1TS6A 4K0XA 3CMZA 2XGNA 4P87A 3KYZA 3N8RA 1K4FA 4KQOA 3D72A 1YLJA 1ES2A 5GLBA 1MBLA 4LENA 4MN5A 3S4XA 1OJGA 4GW9A 4GS9B 3CUEA 2NUPC 4KUOA 1QMEA 5U47A 4PM9A 1BLSA 5CGXA 2I9VA 1ODVA 2GX5A 3D4FA 5HWWA 2Y4AA 4N9KA 4Q0HA 3TSGA 3BQAA 4KZ7A 2LB5A 4JXGA 2XLNA 4MBFA 2Y8HA 3KSHA 4OPZA 4X69A 1NZOA 5HD3A 4CLCD 2EX6A 4HJ6A 1VB6A 4C3QA 3SH7A 1KE3A 5E2HA 2B18A 1GCEA 2Y2GA 4UAAA 5EM0A 2XD5A 1Y4OA 1P9WA 3DW0A 5J8XA 2R78A 3BFEA 4RX2A 4IBRA 4HEFA 4E3IA 3LIDA 4DJ3A 3IH9A 3FPWA 4CLCB 2FFYA 1ZC2A 2Y2MA 5HZHA 4WUJA 5HDDA 1PI4A 4UEYA 2M7UA 2VV8A 1LL9A 1A0KA 2XSSA 1Y28A 1DJCA 4PHTA 4S2PA 2P9VA 3A3IA 4U0TA 3G2ZA 1ES3A 4BBUA 4EV4A 4K08A 2OOLA 1VHMA 3ZCZA 4ZDXA 1GSWA 1PZOA 3NECA 5FAPA 5AQ7A 2P9VB 1OTIA 1DRMA 2V8CA 3PBQA 2HZ5A 4S2OA 1XJ3A 1FCMA 2HDSA 5F1FA 2XFSA 1YLYA 3BLSA 5CXWA 2XDMA 4NG2A 4BMWA 3N4IA 2PR6A 5AQ9A 2G2WA 2HF6A 2WZXA 2Y2JA 1YMXA 5E2GA 2WGIA 4N92A 1RGZA 1NWZA 4GJ4A 2OV5A 3VSLA 2RCXA 4OPRA 5KZHA 4OLDA 1XKZA 2VK3A 2WKRA 2ZC3B 4FH4A 4ZTKA 5EUAA 5F5YA 1XJ4A 5EVIA 4P6ZM 2A3UA 2GZAA 4UA6A 3IBRA 1XA7A 4N9LA 5AJGA 3P7NA 3M2JA 4CJNA 1PI5A 4KUKA 2Q9MA 2VV7A 3EQVA 4LCMA 4XT2B 5HAIA 2VEAA 5FQQA 3Q1FA 2BG1A 4XUZA 3ZGAB 3CUEC 2H0TA 2OWJA 5GHXA 4FH2A 2H5SA 1MZUA 3DTMA 4OOYA 4K0WA 2R9WA 3C4OA 5HWVA 5KSCA 2O9AA 4JGQA 1F9IA 3HLWA 4HNBA 4PPRA 4BD1A 1XX2A 3SW1A 3K3DA 2YKFA 1HVBA 1M6KA 2OLVA 4PKYA 1Q2PA 3IQAA 1JVJA 5J4EA 3Q07A 2EX9A 5F68A 2WAFA 1XA1A 3WS5A 4ZBEA 5HAPA 4O8GA 3IX3A 3W2ZA 1N9BA 3UNWA 3PBOA 2EX2A 1OJ5A 4WEJA 1E25A 2DMWA 2O9BA 3KYEA 2VGLS 2WK0A 3LUQA 1YLPA 1ES4A 2JKRI 3IWIA 1CQAA 1XFQA 2M1CA 1K4EA 2ZMVA 1CJFA 2V8FA 4B4ZA 3EQUA 4GNUA 5IS1A 3G32A 3IS2B 4EBPA 2J7VA 3ZG0A 1VETB 2INWA 3LEQA 3T4SA 4DXBA 3O3VA 1FQGA 3ZYTA 5FI6A 3RJUA 3HJIA 5J7EA 4Z9QA 4GS9A 1MC0A 4R1GA 2JKRM 4OQHA 3S22A 2IA2A 5FQMA 2UV0E 2ACGA 4LFUA 4LV0A 4R6LA 4QHCA 3RXXA 1ESIA 1L0EA 2ZM2A 4OOMA 2BLSA 3OPLA 4WM9A 2V1AA 1TS7A 1PW1A 1P0ZA 2PD8A 3ISGA 4DJ2A 2Y2OA 2W3DA 3CAXA 5E43A 4PM6A 3R7WA 4B88A 3C2WA 1H5XA 3VP1A 1CEGA 4S2MA 3TG9A 2WKQA 4JXWA 4MN6A 2WKEA 3SS4A 1S4RA 3SH9A 1NRFA 4EETB 5AQAA 2XF3A 5A90A 5G18A 2ZOHA 4LLOB 4QD4A 3GSGA 2ZC5B 3C8CA 5JYPA 5EPHA 5HAQA 1SDEA 2PYRA 1DJAA 2J3WA 1LI9A 2K2NA 3P09A 2FFFB 4HH3A 4IJGA 3UB8A 4LRXC 2E8JA 5EVIB 2KLIA 2EX8A 4DE2A 1XP4A 4GD8A 3LO7A 4OPQA 3EWKA 3BW6A 4FCFA 4G3WA 1H8ZA 3VOYA 1CI8A 3WWXA 2HJ9C 3RXWA 5F83A 1GSXA 3GV9A 1MWTA 2ZD8A 4EUVA 2W1RA 4BJPA 2G7UA 5FA7A 3FYZA 3Q7VB 4PM8A 4P85A 1TDGA 1K54C 4S2LA 3RFBA 3H9WA 1UWPX 2WAEA 1VEUA 3IX4A 3OPRA 3UY6A 1UWNX 3OC2A 4DXCA 2VKSA 2ZQCA 5FQKA 3U2AA 2O0YA 2X01A 3HL9A 1OTEA 1T1CA 1MKIA 4EEUA 2JKTM 3PXPA 3VFHA 1WYBA 3DAVA 3AGFA 2HDRA 2VJWA 3O87A 3LICA 4DKIA 3SOIA 4X53A 3IX8A 1T19A 4FOFA 2Y2IA 1UGUA 1OT6A 3MXSA 1CEFA 1K56A 4R0QA 4HESA 2Z6CA 1FIKA 3S7QA 4H8RA 3PYPA 3UE6A 2JKFA 3M6HA 3MKFA 3OCNA 4CPKA 3VSKA 4PM5A 1HD8A 4WLAA 1IOUA 5EVIC 5EVID 5HPFA 3BECA 1FR6A 2W0NA 3K3CA 3C7UA 4Y2FA 1CI9A 3P01A 3VOLA 1WE4A 3UPPA 4WMCD 5IHVA 3F1PB 1ACFA 2QMIA 4M4XA 4ZJ2A 4NETA 5FQ9A 4DF6A 4WMCA
chains in the Genus database with same CATH topology
1GSWA 1G28A 4EU0A 4G3VA 1OTIA 4NXGA 1DRMA 3PBQA 4WELA 4I3JA 5HWTA 1XJ3A 3MR0A 3E98A 3NOUC 3LIEA 3PBRA 2PT7A 3F1NB 4JGRA 4BMWA 1EW0A 5HPIA 2PR6A 3EGDC 2HF6A 3NOPC 3V67A 2OAP1 4MMNA 3O5YA 1NWZA 3LR3A 4GJ4A 5DJTA 5G4ZA 1P97A 5LBRA 2WKRA 4H6JB 4HOIA 3MF0A 3D3OA 3MXQA 2QWSA 3E4PA 3LIAA 4JGPA 4O0PA 5F5YA 3ICYA 1XJ4A 3UB7A 4P6ZM 4EERA 3KX0X 2GZAA 3H7WB 2W3HA 3IBRA 4LRZE 2K31A 5AJGA 4ARZA 3P7NA 4G3KA 1W63Q 2P7JA 4KUKA 3ULFA 3RH8B 2VV7A 3EQVA 1DP8A 1N9OA 4XT2B 3T4TA 1TF1A 3C30A 1S4SA 1OTBA 4WL9A 2VEAA 4YOFA 3FG8A 4ETZA 3FC7A 2YKHA 3CUEC 2KOIA 2OWJA 4IHQA 3EOIA 3CLOA 4CLCA 1MZUA 3JVUA 1DP6A 2HJEA 1IFQA 3BJNA 5HWVA 3IS2A 3R7WB 4EESA 2FH5A 2GNXA 2O9AA 4JGQA 1F9IA 4HI4A 4HNBA 4HQAA 4Y5FA 3S7OA 3TE8A 3LYXA 3MQQA 4NKPA 4ARZB 3SW1A 3K3DA 2YKFA 3F1OA 4HJ4A 4PKYA 2Z6DA 1W63M 1GSVA 1P9RA 2O9CA 5K5BA 4MDZA 1OTDA 3LI8A 5FL3A 3LR4A 1JNUA 3G6OA 5J4EA 5IT5A 3B42A 3VE4A 3KSIA 4L9EA 3PHYA 3T4JA 4I3AA 4BBVA 5CX7A 5F68A 2HV1A 2O99A 3BWLA 3UMEA 4E04A 3LIBA 4O8GA 3W2ZA 5G4YA 2CMNA 5EFWA 2VGLM 4I39A 4ME4A 3UB9A 2GJ3A 1XJ6A 1ZTUA 3EEHA 3PBOA 1OJ5A 1LSXA 4WEJA 5I5LA 2DMWA 2O9BA 5IU1A 3LFVA 2VGLS 2QJ5A 1TS8A 1N9NA 3LUQA 5F6AA 3F1OB 1G6OA 4L9FA 2JKRI 5DFYA 2XA7M 1T1AA 1XFQA 4R3AA 4I5SA 2M1CA 3DBAA 4HIAA 2ZMVA 3VV4A 2W3EA 3BY8A 3EQUA 2NUTC 5IS1A 3IS2B 4HH2A 4I38A 4YWZA 2WKPA 2INWA 4GCZA 3T4SA 2XROA 2J80A 3ZYTA 4Y3IA 3HJIA 5J7EA 4GS9A 1MC0A 2JKRM 4NXBA 3E0YA 4WEKA 2L4RA 3UB6A 4GHIA 2IA2A 3HJKA 4NXFA 3MJQA 4R6LA 3B47A 3LI9A 4WF0A 3R4KA 4UQIS 1OTAA 2PHYA 4Q0IA 2QYBA 2W1TB 3MQ0A 1T18A 2VV6A 2VZWA 4UQIM 2XRNA 4PAUA 5TJJA 2QHKA 2ZMFA 3NJAA 4HP4A 5TBMA 3MFXA 3E4QA 3BQ8A 4OOMA 1LT0A 1T1BA 1H8MA 2V1AA 5DKLA 4QPRA 1TS7A 1P0ZA 3OOVA 2PD8A 2D01A 2JKTI 4BBTA 4DJ2A 2K7SA 2QKPA 4B9OA 2W3DA 2EA9A 3CAXA 4L0LA 5J3WA 3A0VA 3R7WA 3PBSA 2P04A 3EEAA 4IUHA 2J3TC 4B93A 3C2WA 3PBNA 1S1ZA 3IBJA 4P6ZS 3GECA 3S7NA 5HDSA 3KSFA 1X0OA 2KDKA 2V1BA 3KO6A 4GHIB 4CQHA 2PD7A 4ZRRA 4MCWA 3F1NA 3UE3A 2WKQA 3ZQ5A 2QJ7A 4LRYC 2EWVA 4MN6A 3OCLA 3TRCA 4PKYG 1S4RA 1ZHHB 2PR5A 2EWWA 4ETXA 4EETB 2ZBBA 2PYPA 1V9ZA 4FSFA 5KSHA 4R70A 5HSQA 4XT2A 2V9AA 2ZOHA 4LLOB 5DJUA 3EGXC 3C8CA 2FZ0A 5F69A 3CWFA 1LSWA 2PYRA 1NLYA 2BASA 1KOUA 1TD5A 2J3WA 3S7PA 4CLCC 3B33A 2K2NA 3KYQA 4IUKA 4HH3A 3K2NA 3H7WA 4IJGA 4LRXC 3UB8A 4GLQA 1D7EA 2KLIA 3E4OA 2B02A 2M7VA 3MQOA 3H82A 4HP9A 2P08A 5MC7A 2L0WA 2KX6A 1N9LA 3T4KA 2PDRA 3LR5A 3MMHA 4CLCE 3EWKA 3FPVA 1V9YA 1F5MA 1H3QA 3LIFA 3BW6A 2W1TA 4G3WA 1TS0A 1STZA 2HJ9C 1DP9A 3NOTC 1YSQA 4F3LA 5HDCA 1GSXA 4EW7A 3RTYA 1MKMA 2LB9A 3CITA 1S1YA 5L8MA 4EUVA 4I3IA 4RQ9A 2W1RA 4L9GA 4BJPA 3H82B 3GDIA 2G7UA 2D02A 1WA9A 4NEED 5A8BA 1YKDA 4JGOA 2VLGA 2JHEA 2W3FA 1TS6A 2A24A 5DFXA 4LPZA 3KYZA 4KQOA 1S66L 3RFBA 3H9WA 3D72A 4EXOA 1UWPX 2OWHA 4II7A 4AFIA 4MN5A 1UWNX 1LL8A 2MJ6A 3OBFA 1OJGA 3OC2A 3T4OA 2VKSA 1F98A 3PBTA 4Q0JA 3U2AA 4GW9A 2O0YA 4GS9B 3CUEA 2NUPC 2V0WA 4KUOA 3CI6A 1OTEA 5HL6A 1T1CA 5C5KA 1XJ2A 1S67L 3PR6A 3T4LA 2I9VA 3HCYA 3OLOA 1ODVA 2GX5A 4EEUA 2J3TD 2JKTM 1D06A 3PXPA 3JVVA 4DMZA 4DN0A 3LR0A 5HWWA 4Q0HA 3BQAA 2A24B 2LB5A 3A0RA 2VJWA 2Y8HA 3KSHA 3LICA 1BYWA 3VE3A 3A0SA 1OT9A 4OOLA 5HD3A 4CLCD 4HJ6A 2VX8A 4NXEA 3TJZC 4BWIA 1VB6A 1T19A 2HGVA 5HD5A 4FOFA 4EEPA 2B18A 2OAQ1 3BY9A 3KSGA 4H6JA 1UGUA 1OT6A 1NLZA 5AVEA 5TBMB 3NHQA 1OPXA 2H28A 1P9WA 4YNRA 4F3LB 2Z6CA 2R78A 3S7QA 3PYPA 3UE6A 3LIDA 4DJ3A 2W3GA 3TW8A 1XFNA 3OCNA 3T4QA 3FPWA 4CLCB 5HZHA 1LSVA 4WLAA 4KQDA 2Y79A 4WUJA 5HDDA 1IOUA 4UEYA 2M7UA 2V0UA 1NRJA 4HY8A 4HJ3A 2VV8A 5DKKA 5HPFA 4EQ1A 2XSSA 2ZOIA 2VA0A 1Y28A 2W0NA 3C38A 3K3CA 4PHTA 4Y2FA 3T50A 3P01A 4Z1WA 3VOLA 4WN5A 3F1PB 4BBUA 1YSPA 5AVFA 1YAXA 2W27A 4M4XA 3UMDA 4K08A 5KIZA 2OOLA 2JN7A 4HHDA 1VHMA 2XA7S 2A2LA 4R38A 2L1MA 5DF9A 4O01A 4MN7A 3F1PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TS6 A;  1GSW A;  1G28 A;  2A24 A;  2D01 A;  2PD8 A;  1GSV A;  2Z6D A;  4LPZ A;  4BBT A;  4DJ2 A;  1OTD A;  1OTI A;  2K7S A;  1S66 L;  2QKP A;  1DRM A;  1JNU A;  2EA9 A;  3D72 A;  3G6O A;  3H9W A;  4NXG A;  5J4E A;  4EXO A;  1UWP X;  3CAX A;  2OWH A;  4I3J A;  5HWT A;  5J3W A;  1XJ3 A;  3A0V A;  3MR0 A;  3VE4 A;  3NOU C;  4MN5 A;  4L9E A;  1UWN X;  1LL8 A;  3LIE A;  1OJG A;  3C2W A;  3PHY A;  1S1Z A;  4I3A A;  4BBV A;  3GEC A;  5HDS A;  1F98 A;  3F1N B;  4JGR A;  1EW0 A;  1X0O A;  2KDK A;  2V1B A;  2HV1 A;  2PR6 A;  4GHI B;  2PD7 A;  4GW9 A;  5F68 A;  4GS9 B;  3BWL A;  3F1N A;  2WKQ A;  3NOP C;  3UME A;  2V0W A;  2QJ7 A;  4KUO A;  3ZQ5 A;  3LIB A;  4E04 A;  1OTE A;  4LRY C;  4MN6 A;  1T1C A;  1XJ2 A;  5G4Y A;  2CMN A;  1S67 L;  5EFW A;  4I39 A;  2I9V A;  1NWZ A;  1S4R A;  4PKY G;  3OLO A;  2PR5 A;  5DJT A;  1ODV A;  2GJ3 A;  5G4Z A;  1P97 A;  1XJ6 A;  2ZBB A;  2PYP A;  1V9Z A;  3UB9 A;  4EET B;  4EEU A;  1D06 A;  3EEH A;  4R70 A;  5HSQ A;  1OJ5 A;  1LSX A;  5I5L A;  4XT2 A;  2WKR A;  2V9A A;  4H6J B;  2ZOH A;  4LLO B;  5IU1 A;  5HWW A;  5DJU A;  2QJ5 A;  1TS8 A;  4HOI A;  1N9N A;  3C8C A;  3LUQ A;  3MXQ A;  4PKY A;  2A24 B;  5F6A A;  3F1O B;  5F69 A;  4L9F A;  2QWS A;  3A0R A;  3CWF A;  1T1A A;  3E4P A;  1XFQ A;  3LIC A;  4R3A A;  4B9O A;  1BYW A;  3LIA A;  1LSW A;  2PYR A;  4I5S A;  2BAS A;  4JGP A;  3VE3 A;  3A0S A;  1OT9 A;  1XJ4 A;  1KOU A;  2M1C A;  3ICY A;  5F5Y A;  3UB7 A;  4EER A;  5HD3 A;  4HIA A;  3KX0 X;  3H7W B;  3IBR A;  4HJ6 A;  3B33 A;  4NXE A;  3BY8 A;  1VB6 A;  1T19 A;  4LRZ E;  5HD5 A;  5IS1 A;  3P7N A;  3IS2 B;  4HH3 A;  4HH2 A;  3H7W A;  3BY9 A;  4I38 A;  4LRX C;  4YWZ A;  4H6J A;  3UB8 A;  2WKP A;  4EEP A;  1D7E A;  1UGU A;  1OT6 A;  2P7J A;  2INW A;  3E4O A;  4GCZ A;  5AVE A;  5TBM B;  4KUK A;  2B02 A;  2J80 A;  3NHQ A;  3ULF A;  2H28 A;  2VV7 A;  3RH8 B;  3H82 A;  1DP8 A;  1N9O A;  3MQO A;  4HP9 A;  4XT2 B;  1S4S A;  2L0W A;  4F3L B;  2KX6 A;  1OTB A;  1N9L A;  2Z6C A;  2VEA A;  3HJI A;  2PDR A;  4WL9 A;  5J7E A;  3SW1 A;  4GS9 A;  2R78 A;  3FG8 A;  3EWK A;  3PYP A;  3UE6 A;  1V9Y A;  3LID A;  3FC7 A;  3LIF A;  4NXB A;  4DJ3 A;  1TS0 A;  1XFN A;  2YKH A;  2L4R A;  3UB6 A;  5HZH A;  4GHI A;  3HJK A;  1LSV A;  4WLA A;  1DP9 A;  4KQD A;  2OWJ A;  4WUJ A;  5HDD A;  4NXF A;  3NOT C;  3MJQ A;  4R6L A;  4F3L A;  3CLO A;  3LI9 A;  4WF0 A;  1GSX A;  5HDC A;  4EW7 A;  2V0U A;  1OTA A;  2PHY A;  3RTY A;  1MZU A;  4HY8 A;  4HJ3 A;  2VV8 A;  5DKK A;  1DP6 A;  4EQ1 A;  1S1Y A;  1T18 A;  2VV6 A;  2ZOI A;  2W0N A;  1Y28 A;  3K3C A;  4I3I A;  4L9G A;  4RQ9 A;  3H82 B;  5HWV A;  3GDI A;  3T50 A;  2QHK A;  3VOL A;  3IS2 A;  2D02 A;  4EES A;  3NJA A;  4WN5 A;  1WA9 A;  4HP4 A;  5TBM A;  5A8B A;  3MFX A;  4JGQ A;  3F1P B;  4BBU A;  3E4Q A;  1F9I A;  4HI4 A;  4HNB A;  4HQA A;  5AVF A;  4JGO A;  3LYX A;  2VLG A;  2W27 A;  4M4X A;  3MQQ A;  4K08 A;  3UMD A;  5KIZ A;  1LT0 A;  3K3D A;  2JHE A;  2YKF A;  2OOL A;  3F1O A;  2JN7 A;  1T1B A;  4HHD A;  4R38 A;  4HJ4 A;  2L1M A;  2V1A A;  5DKL A;  1TS7 A;  3F1P A;  1P0Z A;  3LI8 A; 
#chains in the Genus database with same CATH topology
 4PMA A;  3NBL A;  4EU0 A;  2DCF A;  3SS3 A;  5KMW A;  3HUO A;  3U4L P;  1AWI A;  2ZM0 A;  3F1N B;  3GRJ A;  4JGR A;  1EW0 A;  2AVX A;  3NOP C;  3T1X A;  1BT5 A;  4E6W A;  3LR3 A;  1L2S A;  3NC8 A;  1P97 A;  4X1L A;  2HPB A;  4S2I A;  4H6J B;  4HOI A;  3MXQ A;  4OQG A;  4IBX A;  2QWS A;  3E4P A;  3HLC A;  4JF4 A;  4R4R A;  4GOG A;  4O0P A;  3IF6 A;  4E3O A;  4FTX A;  3H7W B;  5EVL A;  1E3U A;  1J9M A;  4LRZ E;  4EQI A;  1WYC A;  2E8I A;  1GHI A;  3ULF A;  3RH8 B;  1N9O A;  1ES5 A;  1TF1 A;  1S4S A;  1K38 A;  1OTB A;  2P74 A;  4WL9 A;  3ITB A;  2IWC A;  1GHM A;  4ETZ A;  4N1H A;  2ZC6 B;  2YKH A;  3IXG A;  3BLM A;  1GA9 A;  4A5R A;  3EOI A;  3CLO A;  2Y91 A;  4CLC A;  3JVU A;  1DP6 A;  3HUM A;  4KZ8 A;  5FDH A;  3R7W B;  3VP3 A;  3VP0 A;  4HI4 A;  3S1Y A;  1FCN A;  1IEL A;  2JE5 A;  4R3J A;  1ONG A;  4HJ4 A;  1BLH A;  2J8Y A;  1XXM A;  1P9R A;  1HTZ A;  2O9C A;  1PIO A;  4MDZ A;  3MBZ A;  4Y0O A;  4KQQ A;  3G6O A;  3B42 A;  1SHV A;  3IXB A;  3IF5 A;  1IEM A;  5FI7 A;  2Y2Q A;  2O99 A;  1M40 A;  3UME A;  3BFG A;  1IYO A;  2Y2N A;  4LV2 A;  1J3W A;  2BTF P;  4I39 A;  1O07 A;  2RL3 A;  3N8S A;  4R23 A;  1LSX A;  1KE0 A;  5IU1 A;  4QWO A;  3VP2 A;  2QJ5 A;  4UHU A;  5CTM A;  3F1O B;  1G6O A;  2XA7 M;  2CC1 A;  4OP8 A;  5HW3 A;  4R3A A;  3OPH A;  3VV4 A;  2W3E A;  1K57 C;  1MY8 A;  1S6R A;  3BY8 A;  4KG5 A;  2GDN A;  1BLC A;  2XR0 A;  2XEP A;  4BLM A;  3HLB A;  2L4R A;  2JC7 A;  5FAT A;  5M18 A;  1I2S A;  3ZG5 A;  4NXF A;  3MJQ A;  4BL2 A;  4WF0 A;  1OTA A;  3IWQ A;  2VV6 A;  4C75 A;  1MWS A;  2XRN A;  5TJJ A;  2ZJ9 A;  1VQQ A;  1RCJ A;  3Q82 A;  1S0W A;  3NJA A;  3MFX A;  1KVL A;  2Z2M B;  4DDS A;  3Q81 A;  4QB8 A;  1LT0 A;  1KVM A;  1T1B A;  3ZG8 B;  1H8Y A;  3UN7 A;  3OOV A;  2VGK A;  1ERQ A;  4X1M A;  2V2F F;  4LGW A;  5J3W A;  3A0V A;  5FAO A;  5CGW A;  3N8L A;  4IUH A;  4B93 A;  5F82 A;  4S2N A;  5CER A;  4GHI B;  4CQH A;  2WGW B;  3UE3 A;  4LRY C;  3IT9 A;  3OCL A;  4ZAM A;  3TRC A;  5FEF A;  3W4Q A;  2EXB A;  3G31 A;  3ZG7 B;  2PR5 A;  2EWW A;  3SS5 A;  2ZBB A;  5EVE A;  5HSQ A;  4XT2 A;  2V9A A;  4GZB A;  2PBD P;  2FZ0 A;  3DTK A;  5F69 A;  1FSW A;  1NLY A;  3DWK A;  5CEB A;  1GA0 A;  2EXA A;  4X6T A;  1W79 A;  3KYQ A;  4RYE A;  1ZG4 A;  2Y2K A;  2G2U A;  1PNE A;  3MQO A;  5EOO A;  3A3J A;  2ZQA A;  4KG6 A;  3T4K A;  2PDR A;  1PZP A;  2R9X A;  4X68 A;  2W1T A;  1STZ A;  1DP9 A;  4D60 A;  4F3L A;  5HDC A;  5CTN A;  1LLB A;  3CIT A;  3G35 A;  3H82 B;  5GL9 A;  4QY5 A;  3CZD A;  4R4S A;  5I94 A;  4HBU A;  1WA9 A;  4NEE D;  2EFX A;  4DE1 A;  3GR2 A;  4XUX A;  4Y0T A;  3VP4 A;  2JHE A;  5A93 A;  4OQI A;  2A24 A;  5DFX A;  3MZE A;  4LPZ A;  3UPN A;  1S66 L;  3TOI A;  4EXO A;  2OWH A;  4JF6 A;  2VGJ A;  1LL8 A;  2MJ6 A;  1D1J A;  3OBF A;  4RA7 A;  4K91 A;  3T1R A;  3T4O A;  3NY4 A;  3SZT A;  3HLD A;  2V0W A;  3CPT A;  3CI6 A;  5HL6 A;  3L7H A;  1MXO A;  3V5M A;  1XJ2 A;  4M3K A;  3PR6 A;  4UA9 A;  1K6R A;  3HLG A;  4DMZ A;  4DN0 A;  2V20 A;  2A24 B;  4E3J A;  3A0R A;  4S2K A;  1OME A;  4KZB A;  1OT9 A;  4OOL A;  4YIN A;  5FSR A;  2VX8 A;  4NXE A;  4BWI A;  2HGV A;  2OLU A;  3BY9 A;  4X56 A;  5AVE A;  3NHQ A;  1OPX A;  4OON A;  2Z2L B;  4WZ5 A;  4YNR A;  2J9O A;  4F3L B;  3UDI A;  3LGO A;  3TW8 A;  3IXH A;  4JKT A;  1LSV A;  3M6B A;  4KQD A;  2V0U A;  1NRJ A;  3IF6 C;  4HY8 A;  5DKK A;  4EQ1 A;  1XPB A;  2VA0 A;  3T50 A;  1G68 A;  4Z1W A;  4WN5 A;  3A3D A;  5M1A A;  4MBH A;  1NJ4 A;  5TR7 A;  5AVF A;  5KIZ A;  1FR1 A;  3PAG A;  3VMA A;  4KZ5 A;  4HHD A;  2A2L A;  2WZZ A;  5DF9 A;  4S2J A;  4O01 A;  1K55 A;  1K25 A;  2IWD A;  3IHB A;  1EI5 A;  4G3V A;  4EWF A;  5CHM A;  4WEL A;  2I72 A;  1RGY A;  4I3J A;  4Y17 A;  5HWT A;  3NOU C;  3UE1 A;  4LCL A;  3LIE A;  3MS6 A;  5HPI A;  1IYP A;  1W8Q A;  3ZHH A;  5HX9 A;  1KE4 A;  2OAP 1;  1IKG A;  1BSG A;  4MMN A;  3O5Y A;  3ZDJ A;  5TFQ A;  3WS4 A;  3UB5 P;  3QP2 A;  4JF5 A;  3LIA A;  3SH8 A;  3UB7 A;  1ZKJ A;  4X25 A;  2B95 A;  3KX0 X;  3MZF A;  2W3H A;  3NI9 A;  2K31 A;  4ARZ A;  2ZQ9 A;  2ZM8 A;  1W63 Q;  1N4O A;  5CEC A;  1FIL A;  4DDY A;  1YM1 A;  5EM1 A;  3C30 A;  4DE0 A;  4JXV A;  4YOF A;  3FG8 A;  2DNS A;  3FC7 A;  4X55 A;  4WBG A;  4IHQ A;  2HJE A;  4C6Y A;  1IFQ A;  1NYY A;  3JYI A;  5L09 A;  5L2F A;  4EES A;  2FH5 A;  3V3S A;  1MPL A;  3NCK A;  4Y5F A;  3TE8 A;  3LYX A;  4NKP A;  4E3L A;  4OPY A;  2XQZ A;  4DRT A;  1E3U D;  1W63 M;  1GSV A;  5K5B A;  4B4X A;  1OTD A;  3LEZ A;  1JNU A;  5IT5 A;  3VE4 A;  4WYY A;  3KSI A;  2ZQD A;  4L9E A;  4JLF A;  4Y15 A;  3QP6 A;  4YFM A;  2Q9N A;  3PHY A;  3C7V A;  4I3A A;  4BBV A;  3QNB A;  5CX7 A;  1JWZ A;  1L0D A;  2Y2H A;  3LIB A;  5DF8 A;  1YQS A;  5G4Y A;  2Y2L A;  2CMN A;  3UO9 A;  4KQR A;  2VGL M;  4BL3 A;  2C6W B;  1W5D A;  4ME4 A;  1XJ6 A;  3IHA A;  5FDS A;  5M19 A;  3BFF A;  3LFV A;  2WAD A;  1N9N A;  4MNR A;  3VOZ A;  4L9F A;  2PBY A;  1CK3 A;  1T1A A;  1G5U A;  3OPP A;  1G6A A;  5GLD A;  5CHJ A;  1DY6 A;  4GB7 A;  3FV7 A;  5A91 A;  3AGE A;  4HH2 A;  4YWZ A;  2WKP A;  1DJB A;  3MXR A;  1PWD A;  3O86 A;  1NY0 A;  1JWP A;  2J80 A;  3DTI A;  3PTE A;  5CGS A;  3GQZ A;  4Y3I A;  1NXY A;  2OSU A;  3CPT B;  4E6X A;  1W7F A;  4OQ0 A;  1L0G A;  4Y0U A;  4WEK A;  5DTT A;  3IH8 A;  4GHI A;  4E3K A;  2HP5 A;  3HJK A;  1BUE A;  2UWX A;  3DWZ A;  4UQI S;  2PHY A;  3MQ0 A;  4PAU A;  2ZMF A;  3BFD A;  1K56 D;  4HP4 A;  5TBM A;  3NDE A;  1K54 A;  3E4Q A;  3BQ8 A;  2H0Y A;  3GVB A;  4Y13 A;  1YLW A;  4QPR A;  4BQM A;  2D01 A;  2JKT I;  1HLU P;  4BBT A;  3CHW P;  5F1G A;  1BLP A;  3A3F A;  4B9O A;  2EA9 A;  4WZ5 C;  3PBS A;  3EEA A;  2J3T C;  3PBN A;  1S1Z A;  4P6Z S;  3S7N A;  5HDS A;  3KSF A;  1X0O A;  2KDK A;  3GTC A;  2PD7 A;  4ZRR A;  3HLE A;  4MCW A;  1ALQ A;  1AXB A;  2QJ7 A;  2EWV A;  2JCH A;  4EBL A;  4PKY G;  1ZHH B;  3LCE A;  4ETX A;  2WUQ A;  4MEZ A;  5DJU A;  3QHY A;  5DTK A;  2XH9 A;  1PW8 A;  1LSW A;  2BAS A;  5CRF A;  1KOU A;  1TD5 A;  4CLC C;  2PAV P;  5FQJ A;  3CG5 A;  3B33 A;  4D2O A;  1ESU A;  4IUK A;  3K2N A;  1D7E A;  5HL1 A;  3E4O A;  3LY3 A;  2X71 A;  5EV0 A;  4HP9 A;  1SKO B;  3LR5 A;  3MMH A;  2QZ6 A;  2XD1 A;  4CLC E;  3FPV A;  1V9Y A;  1TS0 A;  3FWL A;  4OP5 A;  1NZU A;  1YLT A;  3HRE A;  3G30 A;  4EW7 A;  1S1Y A;  2IWB A;  4RQ9 A;  1CF0 A;  5L07 A;  2HP9 A;  4KZ3 A;  2D02 A;  5HFO A;  2JKG A;  4JGO A;  2VLG A;  2W3F A;  1I5Q A;  2ZLY A;  1LHY A;  1Y54 A;  2HDU A;  1SDN A;  3WS1 A;  4ZJ3 A;  2HDQ A;  4II7 A;  4AFI A;  5GLC A;  1TEM A;  1F98 A;  3PBT A;  4Q0J A;  5BOH A;  3N6I A;  5A92 A;  1FOF A;  5C5K A;  1ONH A;  3G34 A;  4Y7P A;  1S67 L;  2QPN A;  3T4L A;  3HCY A;  3OLO A;  3ZFZ A;  5E2F A;  2J3T D;  1I2W A;  1D06 A;  1VEU B;  1ERM A;  2ZL1 A;  4RVA A;  3JVV A;  1MWU A;  3LR0 A;  4LV1 A;  4ESP A;  1KGE A;  1BYW A;  4GD6 A;  3VE3 A;  5CHU A;  3A0S A;  3AGD A;  4GDN A;  1SKF A;  3TJZ C;  1GHP A;  4U3T A;  5HD5 A;  4EEP A;  2EFU A;  2OAQ 1;  3KSG A;  4MBK A;  4H6J A;  3E2L A;  1NLZ A;  3FKV A;  5TBM B;  1FSY A;  4EBN A;  4KZ6 A;  2H28 A;  5E2E A;  4QU3 A;  2ZL1 B;  3QNC A;  3MZD A;  4N1X A;  2ZC4 B;  4IVK A;  1XGJ A;  2W3G A;  1XFN A;  2Q0O A;  4KZA A;  3T4Q A;  1RP5 A;  2Y79 A;  2WGV A;  2WKI A;  4OKP A;  1HZO A;  4HJ3 A;  3FZC A;  4KEN B;  2ZOI A;  3UDF A;  3C38 A;  1K0K A;  3ZVT A;  4LV3 A;  4OVD A;  1ZG6 A;  3ITA A;  3QP5 A;  3HVF A;  1YSP A;  3WS0 A;  1YAX A;  2A49 A;  2W27 A;  3UMD A;  2JN7 A;  3BYD A;  2XA7 S;  2Y2P A;  4R38 A;  2L1M A;  4MN7 A;  4NXB A;  2ZQ8 A;  3F1P A;  1G28 A;  1BZA A;  2WYX A;  4NXG A;  1QMF A;  1Q2Q A;  2DRW A;  1IKI A;  4WZ4 A;  3MR0 A;  3D9Y A;  3E98 A;  2V1Z A;  3PBR A;  2PT7 A;  2ZQ7 A;  3WS2 A;  3W8K A;  3EGD C;  3C4P A;  3V67 A;  4GN2 A;  3QP8 A;  4U0X A;  1C3B A;  5DJT A;  5G4Z A;  1BTL A;  5LBR A;  3DTE A;  1SKO A;  3MF0 A;  3D3O A;  1ERO A;  1JWV A;  4JGP A;  3HLF A;  3ICY A;  5TGF A;  3QP4 A;  3MSH A;  4EER A;  1EWZ A;  1KDW A;  4BEN A;  3BM6 A;  4GDB A;  3MKE A;  1U60 A;  4G3K A;  3Q7Z A;  5D3O A;  2P7J A;  3V39 A;  4MLL A;  3P98 A;  1DP8 A;  3T4T A;  3HUN A;  1H0M A;  3ZNY A;  1L3L A;  4R3B A;  1KGF A;  1VM1 A;  5DF7 A;  5DTS A;  1KGG A;  2KOI A;  3G2Y A;  3BFC A;  1XGI A;  1PWC A;  4JPM A;  2JBF A;  2WGW A;  2XFT A;  3BJN A;  3UPO A;  1VET A;  1SCW A;  4JXS A;  3IS2 A;  5EEC A;  1PWG A;  2GNX A;  5GHY A;  4IED A;  3S7O A;  4HQA A;  3MQQ A;  4ARZ B;  3F1O A;  1Z6F A;  4UA7 A;  5HAR A;  3Q7V A;  3GMW A;  2Z6D A;  3LI8 A;  5FL3 A;  5FAS A;  3LR4 A;  2WKH A;  3T4J A;  1TVF A;  2HV1 A;  4QY6 A;  3BWL A;  4DE3 A;  4E3M A;  4E04 A;  3V3R A;  1PFL A;  5EFW A;  1O7E A;  3UB9 A;  2GJ3 A;  1TDL A;  1ZTU A;  3EEH A;  3MFD A;  3T1S A;  3T12 B;  4ID4 A;  4Q8I A;  3M2K A;  5I5L A;  3I7J A;  1TS8 A;  5F6A A;  3W4O A;  1BUL A;  5DFY A;  4I5S A;  1K57 A;  4RX3 A;  3DBA A;  4HIA A;  1YLZ A;  3G4P A;  4P0M A;  2NUT C;  5FI2 A;  2ZMA A;  4I38 A;  1W8Y A;  4P6B A;  5GHZ A;  4GCZ A;  4BD0 A;  3HBR A;  2XRO A;  1FCO A;  1YT4 A;  3ZVW A;  3NDG A;  1L0F A;  3NUL A;  4XXR A;  2B5R A;  3E0Y A;  3A3E A;  2PRF A;  3UB6 A;  1IYS A;  4FD8 A;  3JPU A;  3B47 A;  3LI9 A;  3R4K A;  1SZV A;  4Q0I A;  2QYB A;  4IVI A;  2W1T B;  4OH0 A;  1T18 A;  2VZW A;  2ZC7 A;  3BEB A;  1JTD A;  4UQI M;  1LI0 A;  2QHK A;  5EOE A;  3LY4 A;  4EUZ A;  1NYM A;  3E2K A;  1LL5 A;  4PM7 A;  1PYY A;  4JBF A;  1H8M A;  5DKL A;  5FQI A;  1YPR A;  5FEG A;  2PU2 A;  2K7S A;  2QKP A;  4L0L A;  1PRQ A;  1Z09 A;  2P04 A;  4S2N C;  5FAQ A;  3W4P A;  3NIA A;  5DVA A;  3IBJ A;  3GEC A;  3KO6 A;  2V1B A;  3UE0 A;  2XK1 A;  3F1N A;  3C5A A;  3ZQ5 A;  4KG2 A;  2C5W B;  3PAE A;  3OZH A;  2PYP A;  1V9Z A;  3ZG9 B;  4FSF A;  5KSH A;  4R70 A;  4E3N A;  4KZ4 A;  2H10 A;  3IXD A;  3EGX C;  1IYQ A;  3CWF A;  3FKW A;  1E4D A;  4GKU A;  3QP1 A;  4QJG A;  3S7P A;  3N7W A;  4KZ9 A;  4NK3 A;  1K6S A;  2HP6 A;  3H7W A;  4GLQ A;  3L9K A;  3IF6 B;  2B02 A;  3BRM A;  3B3X A;  3CJM A;  2M7V A;  3UDX A;  3H82 A;  3V50 A;  2P08 A;  2J9P A;  2X02 A;  5CED A;  2L0W A;  5MC7 A;  2KX6 A;  1N9L A;  5EE8 A;  5AQB A;  3WRT A;  5L10 A;  1F5M A;  1H3Q A;  1K55 C;  2Y59 A;  3LIF A;  1F2K A;  3IWO A;  3NOT C;  1YSQ A;  3O88 A;  3WRZ A;  3RTY A;  4O7D A;  1JTG A;  4HBT A;  1MKM A;  3T1Q B;  2LB9 A;  1YMS A;  4OLG A;  5L8M A;  5GLA A;  4ZJ1 A;  4I3I A;  4L9G A;  3GDI A;  4F94 A;  5A8B A;  1MWR A;  1YKD A;  4FUW A;  3VFF A;  3ZNT A;  5JYO A;  2Y55 A;  2PU4 A;  1KDS A;  1TS6 A;  4K0X A;  3CMZ A;  2XGN A;  4P87 A;  3KYZ A;  3N8R A;  1K4F A;  4KQO A;  3D72 A;  1YLJ A;  1ES2 A;  5GLB A;  1MBL A;  4LEN A;  4MN5 A;  3S4X A;  1OJG A;  4GW9 A;  4GS9 B;  3CUE A;  2NUP C;  4KUO A;  1QME A;  5U47 A;  4PM9 A;  1BLS A;  5CGX A;  2I9V A;  1ODV A;  2GX5 A;  3D4F A;  5HWW A;  2Y4A A;  4N9K A;  4Q0H A;  3TSG A;  3BQA A;  4KZ7 A;  2LB5 A;  4JXG A;  2XLN A;  4MBF A;  2Y8H A;  3KSH A;  4OPZ A;  4X69 A;  1NZO A;  5HD3 A;  4CLC D;  2EX6 A;  4HJ6 A;  1VB6 A;  4C3Q A;  3SH7 A;  1KE3 A;  5E2H A;  2B18 A;  1GCE A;  2Y2G A;  4UAA A;  5EM0 A;  2XD5 A;  1Y4O A;  1P9W A;  3DW0 A;  5J8X A;  2R78 A;  3BFE A;  4RX2 A;  4IBR A;  4HEF A;  4E3I A;  3LID A;  4DJ3 A;  3IH9 A;  3FPW A;  4CLC B;  2FFY A;  1ZC2 A;  2Y2M A;  5HZH A;  4WUJ A;  5HDD A;  1PI4 A;  4UEY A;  2M7U A;  2VV8 A;  1LL9 A;  1A0K A;  2XSS A;  1Y28 A;  1DJC A;  4PHT A;  4S2P A;  2P9V A;  3A3I A;  4U0T A;  3G2Z A;  1ES3 A;  4BBU A;  4EV4 A;  4K08 A;  2OOL A;  1VHM A;  3ZCZ A;  4ZDX A;  1GSW A;  1PZO A;  3NEC A;  5FAP A;  5AQ7 A;  2P9V B;  1OTI A;  1DRM A;  2V8C A;  3PBQ A;  2HZ5 A;  4S2O A;  1XJ3 A;  1FCM A;  2HDS A;  5F1F A;  2XFS A;  1YLY A;  3BLS A;  5CXW A;  2XDM A;  4NG2 A;  4BMW A;  3N4I A;  2PR6 A;  5AQ9 A;  2G2W A;  2HF6 A;  2WZX A;  2Y2J A;  1YMX A;  5E2G A;  2WGI A;  4N92 A;  1RGZ A;  1NWZ A;  4GJ4 A;  2OV5 A;  3VSL A;  2RCX A;  4OPR A;  5KZH A;  4OLD A;  1XKZ A;  2VK3 A;  2WKR A;  2ZC3 B;  4FH4 A;  4ZTK A;  5EUA A;  5F5Y A;  1XJ4 A;  5EVI A;  4P6Z M;  2A3U A;  2GZA A;  4UA6 A;  3IBR A;  1XA7 A;  4N9L A;  5AJG A;  3P7N A;  3M2J A;  4CJN A;  1PI5 A;  4KUK A;  2Q9M A;  2VV7 A;  3EQV A;  4LCM A;  4XT2 B;  5HAI A;  2VEA A;  5FQQ A;  3Q1F A;  2BG1 A;  4XUZ A;  3ZGA B;  3CUE C;  2H0T A;  2OWJ A;  5GHX A;  4FH2 A;  2H5S A;  1MZU A;  3DTM A;  4OOY A;  4K0W A;  2R9W A;  3C4O A;  5HWV A;  5KSC A;  2O9A A;  4JGQ A;  1F9I A;  3HLW A;  4HNB A;  4PPR A;  4BD1 A;  1XX2 A;  3SW1 A;  3K3D A;  2YKF A;  1HVB A;  1M6K A;  2OLV A;  4PKY A;  1Q2P A;  3IQA A;  1JVJ A;  5J4E A;  3Q07 A;  2EX9 A;  5F68 A;  2WAF A;  1XA1 A;  3WS5 A;  4ZBE A;  5HAP A;  4O8G A;  3IX3 A;  3W2Z A;  1N9B A;  3UNW A;  3PBO A;  2EX2 A;  1OJ5 A;  4WEJ A;  1E25 A;  2DMW A;  2O9B A;  3KYE A;  2VGL S;  2WK0 A;  3LUQ A;  1YLP A;  1ES4 A;  2JKR I;  3IWI A;  1CQA A;  1XFQ A;  2M1C A;  1K4E A;  2ZMV A;  1CJF A;  2V8F A;  4B4Z A;  3EQU A;  4GNU A;  5IS1 A;  3G32 A;  3IS2 B;  4EBP A;  2J7V A;  3ZG0 A;  1VET B;  2INW A;  3LEQ A;  3T4S A;  4DXB A;  3O3V A;  1FQG A;  3ZYT A;  5FI6 A;  3RJU A;  3HJI A;  5J7E A;  4Z9Q A;  4GS9 A;  1MC0 A;  4R1G A;  2JKR M;  4OQH A;  3S22 A;  2IA2 A;  5FQM A;  2UV0 E;  2ACG A;  4LFU A;  4LV0 A;  4R6L A;  4QHC A;  3RXX A;  1ESI A;  1L0E A;  2ZM2 A;  4OOM A;  2BLS A;  3OPL A;  4WM9 A;  2V1A A;  1TS7 A;  1PW1 A;  1P0Z A;  2PD8 A;  3ISG A;  4DJ2 A;  2Y2O A;  2W3D A;  3CAX A;  5E43 A;  4PM6 A;  3R7W A;  4B88 A;  3C2W A;  1H5X A;  3VP1 A;  1CEG A;  4S2M A;  3TG9 A;  2WKQ A;  4JXW A;  4MN6 A;  2WKE A;  3SS4 A;  1S4R A;  3SH9 A;  1NRF A;  4EET B;  5AQA A;  2XF3 A;  5A90 A;  5G18 A;  2ZOH A;  4LLO B;  4QD4 A;  3GSG A;  2ZC5 B;  3C8C A;  5JYP A;  5EPH A;  5HAQ A;  1SDE A;  2PYR A;  1DJA A;  2J3W A;  1LI9 A;  2K2N A;  3P09 A;  2FFF B;  4HH3 A;  4IJG A;  3UB8 A;  4LRX C;  2E8J A;  5EVI B;  2KLI A;  2EX8 A;  4DE2 A;  1XP4 A;  4GD8 A;  3LO7 A;  4OPQ A;  3EWK A;  3BW6 A;  4FCF A;  4G3W A;  1H8Z A;  3VOY A;  1CI8 A;  3WWX A;  2HJ9 C;  3RXW A;  5F83 A;  1GSX A;  3GV9 A;  1MWT A;  2ZD8 A;  4EUV A;  2W1R A;  4BJP A;  2G7U A;  5FA7 A;  3FYZ A;  3Q7V B;  4PM8 A;  4P85 A;  1TDG A;  1K54 C;  4S2L A;  3RFB A;  3H9W A;  1UWP X;  2WAE A;  1VEU A;  3IX4 A;  3OPR A;  3UY6 A;  1UWN X;  3OC2 A;  4DXC A;  2VKS A;  2ZQC A;  5FQK A;  3U2A A;  2O0Y A;  2X01 A;  3HL9 A;  1OTE A;  1T1C A;  1MKI A;  4EEU A;  2JKT M;  3PXP A;  3VFH A;  1WYB A;  3DAV A;  3AGF A;  2HDR A;  2VJW A;  3O87 A;  3LIC A;  4DKI A;  3SOI A;  4X53 A;  3IX8 A;  1T19 A;  4FOF A;  2Y2I A;  1UGU A;  1OT6 A;  3MXS A;  1CEF A;  1K56 A;  4R0Q A;  4HES A;  2Z6C A;  1FIK A;  3S7Q A;  4H8R A;  3PYP A;  3UE6 A;  2JKF A;  3M6H A;  3MKF A;  3OCN A;  4CPK A;  3VSK A;  4PM5 A;  1HD8 A;  4WLA A;  1IOU A;  5EVI C;  5EVI D;  5HPF A;  3BEC A;  1FR6 A;  2W0N A;  3K3C A;  3C7U A;  4Y2F A;  1CI9 A;  3P01 A;  3VOL A;  1WE4 A;  3UPP A;  4WMC D;  5IHV A;  3F1P B;  1ACF A;  2QMI A;  4M4X A;  4ZJ2 A;  4NET A;  5FQ9 A;  4DF6 A;  4WMC A; 
#chains in the Genus database with same CATH homology
 1GSW A;  1G28 A;  4EU0 A;  4G3V A;  1OTI A;  4NXG A;  1DRM A;  3PBQ A;  4WEL A;  4I3J A;  5HWT A;  1XJ3 A;  3MR0 A;  3E98 A;  3NOU C;  3LIE A;  3PBR A;  2PT7 A;  3F1N B;  4JGR A;  4BMW A;  1EW0 A;  5HPI A;  2PR6 A;  3EGD C;  2HF6 A;  3NOP C;  3V67 A;  2OAP 1;  4MMN A;  3O5Y A;  1NWZ A;  3LR3 A;  4GJ4 A;  5DJT A;  5G4Z A;  1P97 A;  5LBR A;  2WKR A;  4H6J B;  4HOI A;  3MF0 A;  3D3O A;  3MXQ A;  2QWS A;  3E4P A;  3LIA A;  4JGP A;  4O0P A;  5F5Y A;  3ICY A;  1XJ4 A;  3UB7 A;  4P6Z M;  4EER A;  3KX0 X;  2GZA A;  3H7W B;  2W3H A;  3IBR A;  4LRZ E;  2K31 A;  5AJG A;  4ARZ A;  3P7N A;  4G3K A;  1W63 Q;  2P7J A;  4KUK A;  3ULF A;  3RH8 B;  2VV7 A;  3EQV A;  1DP8 A;  1N9O A;  4XT2 B;  3T4T A;  1TF1 A;  3C30 A;  1S4S A;  1OTB A;  4WL9 A;  2VEA A;  4YOF A;  3FG8 A;  4ETZ A;  3FC7 A;  2YKH A;  3CUE C;  2KOI A;  2OWJ A;  4IHQ A;  3EOI A;  3CLO A;  4CLC A;  1MZU A;  3JVU A;  1DP6 A;  2HJE A;  1IFQ A;  3BJN A;  5HWV A;  3IS2 A;  3R7W B;  4EES A;  2FH5 A;  2GNX A;  2O9A A;  4JGQ A;  1F9I A;  4HI4 A;  4HNB A;  4HQA A;  4Y5F A;  3S7O A;  3TE8 A;  3LYX A;  3MQQ A;  4NKP A;  4ARZ B;  3SW1 A;  3K3D A;  2YKF A;  3F1O A;  4HJ4 A;  4PKY A;  2Z6D A;  1W63 M;  1GSV A;  1P9R A;  2O9C A;  5K5B A;  4MDZ A;  1OTD A;  3LI8 A;  5FL3 A;  3LR4 A;  1JNU A;  3G6O A;  5J4E A;  5IT5 A;  3B42 A;  3VE4 A;  3KSI A;  4L9E A;  3PHY A;  3T4J A;  4I3A A;  4BBV A;  5CX7 A;  5F68 A;  2HV1 A;  2O99 A;  3BWL A;  3UME A;  4E04 A;  3LIB A;  4O8G A;  3W2Z A;  5G4Y A;  2CMN A;  5EFW A;  2VGL M;  4I39 A;  4ME4 A;  3UB9 A;  2GJ3 A;  1XJ6 A;  1ZTU A;  3EEH A;  3PBO A;  1OJ5 A;  1LSX A;  4WEJ A;  5I5L A;  2DMW A;  2O9B A;  5IU1 A;  3LFV A;  2VGL S;  2QJ5 A;  1TS8 A;  1N9N A;  3LUQ A;  5F6A A;  3F1O B;  1G6O A;  4L9F A;  2JKR I;  5DFY A;  2XA7 M;  1T1A A;  1XFQ A;  4R3A A;  4I5S A;  2M1C A;  3DBA A;  4HIA A;  2ZMV A;  3VV4 A;  2W3E A;  3BY8 A;  3EQU A;  2NUT C;  5IS1 A;  3IS2 B;  4HH2 A;  4I38 A;  4YWZ A;  2WKP A;  2INW A;  4GCZ A;  3T4S A;  2XRO A;  2J80 A;  3ZYT A;  4Y3I A;  3HJI A;  5J7E A;  4GS9 A;  1MC0 A;  2JKR M;  4NXB A;  3E0Y A;  4WEK A;  2L4R A;  3UB6 A;  4GHI A;  2IA2 A;  3HJK A;  4NXF A;  3MJQ A;  4R6L A;  3B47 A;  3LI9 A;  4WF0 A;  3R4K A;  4UQI S;  1OTA A;  2PHY A;  4Q0I A;  2QYB A;  2W1T B;  3MQ0 A;  1T18 A;  2VV6 A;  2VZW A;  4UQI M;  2XRN A;  4PAU A;  5TJJ A;  2QHK A;  2ZMF A;  3NJA A;  4HP4 A;  5TBM A;  3MFX A;  3E4Q A;  3BQ8 A;  4OOM A;  1LT0 A;  1T1B A;  1H8M A;  2V1A A;  5DKL A;  4QPR A;  1TS7 A;  1P0Z A;  3OOV A;  2PD8 A;  2D01 A;  2JKT I;  4BBT A;  4DJ2 A;  2K7S A;  2QKP A;  4B9O A;  2W3D A;  2EA9 A;  3CAX A;  4L0L A;  5J3W A;  3A0V A;  3R7W A;  3PBS A;  2P04 A;  3EEA A;  4IUH A;  2J3T C;  4B93 A;  3C2W A;  3PBN A;  1S1Z A;  3IBJ A;  4P6Z S;  3GEC A;  3S7N A;  5HDS A;  3KSF A;  1X0O A;  2KDK A;  2V1B A;  3KO6 A;  4GHI B;  4CQH A;  2PD7 A;  4ZRR A;  4MCW A;  3F1N A;  3UE3 A;  2WKQ A;  3ZQ5 A;  2QJ7 A;  4LRY C;  2EWV A;  4MN6 A;  3OCL A;  3TRC A;  4PKY G;  1S4R A;  1ZHH B;  2PR5 A;  2EWW A;  4ETX A;  4EET B;  2ZBB A;  2PYP A;  1V9Z A;  4FSF A;  5KSH A;  4R70 A;  5HSQ A;  4XT2 A;  2V9A A;  2ZOH A;  4LLO B;  5DJU A;  3EGX C;  3C8C A;  2FZ0 A;  5F69 A;  3CWF A;  1LSW A;  2PYR A;  1NLY A;  2BAS A;  1KOU A;  1TD5 A;  2J3W A;  3S7P A;  4CLC C;  3B33 A;  2K2N A;  3KYQ A;  4IUK A;  4HH3 A;  3K2N A;  3H7W A;  4IJG A;  4LRX C;  3UB8 A;  4GLQ A;  1D7E A;  2KLI A;  3E4O A;  2B02 A;  2M7V A;  3MQO A;  3H82 A;  4HP9 A;  2P08 A;  5MC7 A;  2L0W A;  2KX6 A;  1N9L A;  3T4K A;  2PDR A;  3LR5 A;  3MMH A;  4CLC E;  3EWK A;  3FPV A;  1V9Y A;  1F5M A;  1H3Q A;  3LIF A;  3BW6 A;  2W1T A;  4G3W A;  1TS0 A;  1STZ A;  2HJ9 C;  1DP9 A;  3NOT C;  1YSQ A;  4F3L A;  5HDC A;  1GSX A;  4EW7 A;  3RTY A;  1MKM A;  2LB9 A;  3CIT A;  1S1Y A;  5L8M A;  4EUV A;  4I3I A;  4RQ9 A;  2W1R A;  4L9G A;  4BJP A;  3H82 B;  3GDI A;  2G7U A;  2D02 A;  1WA9 A;  4NEE D;  5A8B A;  1YKD A;  4JGO A;  2VLG A;  2JHE A;  2W3F A;  1TS6 A;  2A24 A;  5DFX A;  4LPZ A;  3KYZ A;  4KQO A;  1S66 L;  3RFB A;  3H9W A;  3D72 A;  4EXO A;  1UWP X;  2OWH A;  4II7 A;  4AFI A;  4MN5 A;  1UWN X;  1LL8 A;  2MJ6 A;  3OBF A;  1OJG A;  3OC2 A;  3T4O A;  2VKS A;  1F98 A;  3PBT A;  4Q0J A;  3U2A A;  4GW9 A;  2O0Y A;  4GS9 B;  3CUE A;  2NUP C;  2V0W A;  4KUO A;  3CI6 A;  1OTE A;  5HL6 A;  1T1C A;  5C5K A;  1XJ2 A;  1S67 L;  3PR6 A;  3T4L A;  2I9V A;  3HCY A;  3OLO A;  1ODV A;  2GX5 A;  4EEU A;  2J3T D;  2JKT M;  1D06 A;  3PXP A;  3JVV A;  4DMZ A;  4DN0 A;  3LR0 A;  5HWW A;  4Q0H A;  3BQA A;  2A24 B;  2LB5 A;  3A0R A;  2VJW A;  2Y8H A;  3KSH A;  3LIC A;  1BYW A;  3VE3 A;  3A0S A;  1OT9 A;  4OOL A;  5HD3 A;  4CLC D;  4HJ6 A;  2VX8 A;  4NXE A;  3TJZ C;  4BWI A;  1VB6 A;  1T19 A;  2HGV A;  5HD5 A;  4FOF A;  4EEP A;  2B18 A;  2OAQ 1;  3BY9 A;  3KSG A;  4H6J A;  1UGU A;  1OT6 A;  1NLZ A;  5AVE A;  5TBM B;  3NHQ A;  1OPX A;  2H28 A;  1P9W A;  4YNR A;  4F3L B;  2Z6C A;  2R78 A;  3S7Q A;  3PYP A;  3UE6 A;  3LID A;  4DJ3 A;  2W3G A;  3TW8 A;  1XFN A;  3OCN A;  3T4Q A;  3FPW A;  4CLC B;  5HZH A;  1LSV A;  4WLA A;  4KQD A;  2Y79 A;  4WUJ A;  5HDD A;  1IOU A;  4UEY A;  2M7U A;  2V0U A;  1NRJ A;  4HY8 A;  4HJ3 A;  2VV8 A;  5DKK A;  5HPF A;  4EQ1 A;  2XSS A;  2ZOI A;  2VA0 A;  1Y28 A;  2W0N A;  3C38 A;  3K3C A;  4PHT A;  4Y2F A;  3T50 A;  3P01 A;  4Z1W A;  3VOL A;  4WN5 A;  3F1P B;  4BBU A;  1YSP A;  5AVF A;  1YAX A;  2W27 A;  4M4X A;  3UMD A;  4K08 A;  5KIZ A;  2OOL A;  2JN7 A;  4HHD A;  1VHM A;  2XA7 S;  2A2L A;  4R38 A;  2L1M A;  5DF9 A;  4O01 A;  4MN7 A;  3F1P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...