4HH3A

Structure of the appa-ppsr2 core complex from rb. sphaeroides
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
251
structure length
251
Chain Sequence
b'LPSLAPDLVRDLIATAADISLLVSQEGVVREVMANPHHPSFGQLSEWEGRPLEEVLTAESVAKFRLRSEGLEPGRGSVAVELNHIDPRSFEFPIRYILHRLPADRSILMLGRDLRPIAEVQQQLVAAQLAMERDYETQREMETRYRVVLDVSRDPMVLVSMSTGRIVDLNSAAGLLLGGVRQDLLGAAIAQEFEGRRRGEFMETMTNLAATESAAPVEVLARRSQKRLLVVPRVFRAAGERLLLCQIDPAD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator, PpsR
publication title A ternary AppA-PpsR-DNA complex mediates light regulation of photosynthesis-related gene expression.
pubmed doi rcsb
source organism Rhodobacter sphaeroides
molecule tags Flavoprotein/transcription
total genus 82
structure length 251
sequence length 251
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13188 PAS_8 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4hh3A02
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4hh3A01
4HJ4A 2QJ7A 2Z6DA 3VOLA 1S4RA 2JN7A 3HJKA 3MJQA 2INWA 2P7JA 2R78A 4LRXC 4L9GA 4MN6A 4KUKA 1MZUA 2CMNA 1OJGA 4HJ3A 4WN5A 2OWHA 4EW7A 1S1ZA 5HDCA 2PR5A 1OT6A 1OTEA 4KUOA 2L0WA 3F1PA 4L9FA 4HY8A 2BASA 2OOLA 4F3LA 1X0OA 1P0ZA 3HJIA 2D01A 4HQAA 4B9OA 1V9ZA 4EXOA 1G28A 1N9NA 1LSXA 3LIFA 4HJ6A 2V1AA 2GJ3A 1XJ6A 1TS6A 3F1NA 3MR0A 5HD5A 1KOUA 4PKYA 3BY8A 1XJ2A 4WLAA 4JGRA 4HH2A 3LICA 4MN5A 4HH3A 4PKYG 4GS9A 4WUJA 5A8BA 1EW0A 1OTIA 3LI8A 5DJTA 4BBUA 3PHYA 5F69A 3FC7A 5G4YA 3A0SA 1F9IA 4XT2B 3H82A 2D02A 3BWLA 1S67L 5HWTA 2I9VA 2ZOIA 3E4OA 3VE3A 5IU1A 3LIDA 3UB7A 4WL9A 2ZOHA 5J4EA 4LRZE 3LUQA 2A24A 2EA9A 4L9EA 2QHKA 5DJUA 2J80A 2ZBBA 4GHIA 2K7SA 3NOTC 3CWFA 4JGOA 4R38A 5I5LA 5DKLA 5HSQA 1LSWA 1S4SA 1GSWA 3F1OA 3CAXA 4WF0A 5HDDA 2OWJA 3UMDA 2L1MA 4HP9A 2YKFA 5HD3A 3D72A 3IBRA 5KIZA 5IS1A 1T1AA 2W27A 3ICYA 2PDRA 1S66L 3KX0X 4I3JA 3ULFA 5HDSA 3VE4A 3F1PB 3NJAA 4F3LB 3GDIA 2VV8A 4JGQA 4EQ1A 4NXFA 5TBMB 2Z6CA 1WA9A 5F6AA 3F1NB 1OTBA 2PYRA 4NXEA 1V9YA 1DP6A 2PD8A 3C2WA 4H6JB 3RH8B 3T50A 3BY9A 4GS9B 1XFQA 1F98A 4K08A 2QKPA 3MQOA 3LIBA 1JNUA 1UWPX 3UMEA 2WKRA 4I5SA 5EFWA 1S1YA 4I38A 4EERA 3MFXA 2PR6A 3RTYA 4DJ2A 2A24B 3E4PA 2VEAA 4GHIB 3H7WB 4M4XA 3NOPC 1GSVA 2KDKA 2WKPA 4JGPA 3FG8A 3CLOA 3LI9A 4DJ3A 1GSXA 3B33A 1D7EA 3NOUC 3LIEA 3F1OB 1UWNX 1XJ4A 1ODVA 1UGUA 1N9OA 2W0NA 3C8CA 3LIAA 1XJ3A 4NXGA 3UE6A 2V1BA 3A0RA 2H28A 1BYWA 4EETB 2QJ5A 3IS2A 1DRMA 4XT2A 4RQ9A 3LYXA 5HWWA 1OJ5A 2V0WA 1T18A 3H9WA 4EESA 4BBVA 2QWSA 4LPZA 3PYPA 1OT9A 3MQQA 1DP8A 1NWZA 2VLGA 3P7NA 2KX6A 3A0VA 3UB6A 4R3AA 3SW1A 2YKHA 4HIAA 2V9AA 3MXQA 4E04A 1LT0A 4GW9A 4EEUA 4LLOB 2B02A 4HHDA 1Y28A 1T1CA 2VV6A 4HP4A 1LL8A 4I39A 3H82B 1OTDA 2JHEA 4HOIA 5J7EA 5F5YA 4KQDA 2HV1A 2M1CA 3GECA 4YWZA 5HWVA 2PD7A 4BBTA 5TBMA 1VB6A 2PYPA 5DKKA 3UB9A 2PHYA 3EEHA 1LSVA 1N9LA 1T19A 3EWKA 3K3CA 4H6JA 1OTAA 1TS8A 4HI4A 1XFNA 2V0UA 2WKQA 3IS2B 2L4RA 5HZHA 5J3WA 1P97A 3G6OA 2VV7A 4I3AA 4NXBA 1T1BA 1TS7A 3K3DA 1TS0A 4HNBA 4LRYC 4R6LA 3NHQA 1DP9A 4GCZA 3ZQ5A 4R70A 5AVFA 5F68A 5G4ZA 5AVEA 4I3IA 3H7WA 3OLOA 3UB8A 1D06A 3E4QA 4EEPA
chains in the Genus database with same CATH superfamily
5K5BA 3GMWA 2ZC5B 1MWRA 3UN7A 2Y2GA 3MKEA 3MZEA 1G5UA 3EGXC 5GLDA 5DF7A 1YLYA 2O0YA 4DXBA 1BULA 2Q9NA 3C7VA 1K6SA 4OKPA 1ZC2A 3HJKA 1RGZA 3MJQA 1W63Q 3SS5A 3MZDA 3T1SA 2INWA 4PM8A 4OPZA 3V50A 1IKGA 1YMSA 3C4PA 4MN6A 3ZVWA 1GHPA 4ID4A 1MZUA 2PT7A 3LFVA 3K2NA 4EV4A 1MKIA 2GDNA 5FQ9A 1VQQA 3UPNA 1S1ZA 3NBLA 1XXMA 3IBJA 1EWZA 2OSUA 4KUOA 2L0WA 1KDSA 4E3JA 3G34A 4GD8A 1PFLA 3MS6A 3HJIA 4QJGA 4DE2A 3OZHA 3R7WA 4HQAA 5EVID 4EXOA 2XFSA 2GJ3A 4X56A 2Y2HA 4BL2A 3E2KA 3S7PA 3MR0A 4PKYA 3BY8A 1AXBA 2Z2MB 3LICA 1KDWA 4MN5A 4PMAA 3WRTA 4PKYG 1QMFA 4MLLA 1EW0A 2W3DA 5A8BA 5DJTA 3FC7A 3OCNA 1XPBA 4S2NC 3PBRA 1S67L 5HWTA 4UA6A 2M7UA 1S6RA 4JXSA 1XGIA 5EVIB 1NJ4A 4LFUA 4JF6A 3A3JA 2GNXA 2ZOHA 4N9KA 4IJGA 5J4EA 4DDYA 4E3OA 4JXVA 2ZM0A 1A0KA 2QHKA 5DJUA 2J80A 2WGWB 1WYBA 1K54C 2IWBA 3PTEA 3PBSA 2P04A 1MWSA 3CWFA 3P98A 4KENB 1XA7A 5I5LA 5D3OA 4B88A 1S4SA 1GSWA 1JTDA 4UHUA 2OWJA 2L1MA 4HP9A 2Y2KA 2YKFA 5TGFA 3V39A 5IS1A 1ZTUA 1P9WA 2W27A 2I72A 2ZC3B 4DMZA 1F5MA 3PAGA 2WAFA 1G6OA 3W8KA 3MF0A 5EVIC 2ZM2A 3VE4A 4F3LB 2P08A 3ZG9B 4YOFA 4JGQA 1RP5A 1JWZA 1OPXA 2PBYA 4N9LA 2R9XA 4NXEA 2PAVP 2W1TB 1W5DA 4R3JA 1DP6A 5HAQA 1XFQA 4K08A 3QP8A 2IA2A 1FCMA 1ZG6A 1KE0A 3IHBA 2ZL1B 5HW3A 1UWPX 2Y2MA 3BW6A 4GDBA 3FPVA 3UMEA 2IWCA 2P9VB 1J9MA 2X71A 4PM7A 1S1YA 4FCFA 3GVBA 5BOHA 1IYOA 4DJ2A 4IEDA 2HDSA 4X1MA 4R23A 1ALQA 1MPLA 3S4XA 2WKPA 5HPFA 3KSIA 3LI9A 3B33A 2XA7S 2IWDA 1PNEA 2J3WA 1HZOA 3NOUC 3PBOA 4EBLA 1YQSA 2Y8HA 3LIEA 4O8GA 3VSKA 1XJ4A 3VOZA 4MEZA 4OQIA 4EUZA 1YLTA 3EQUA 5FDHA 3LIAA 3LR0A 4NXGA 2V1BA 3L7HA 1NXYA 3HUMA 3LO7A 2ZC6B 2EXAA 2HP9A 3KO6A 1KE3A 4EETB 3IS2A 1DRMA 4KZ5A 5CHUA 5FI2A 4DE1A 3IF5A 1VM1A 5EVEA 4R1GA 1ES2A 2K2NA 1L0GA 3TOIA 4OOYA 1PRQA 5DTTA 4Y0OA 4M3KA 1YPRA 5L2FA 1FSYA 3UPOA 4EBPA 2Q0OA 1I2SA 2HGVA 2QWSA 1OT9A 1LL9A 2QMIA 1CI9A 1J3WA 3ZNTA 2WKHA 3W4QA 2LB5A 3OPRA 5CGSA 4C75A 3VFHA 2B02A 4RYEA 4HHDA 1Y28A 3N4IA 5L8MA 2VV6A 1HVBA 2ZQDA 1YT4A 1Z6FA 4ME4A 2ZQAA 2JHEA 2Y59A 1K25A 3WWXA 5J7EA 4KQDA 5J8XA 3HVFA 2EWVA 1LI0A 2B95A 5GLAA 1DJBA 1K55C 3AGFA 5EV0A 3V3SA 4EBNA 1VB6A 2PYPA 4ZAMA 5DKKA 3UB9A 2Y4AA 3EEHA 2WADA 4KG2A 4L0LA 3SH8A 1T19A 4CLCD 3SZTA 2W1TA 3T1XA 3AGDA 3JPUA 4NETA 4HI4A 4OLDA 2L4RA 5KMWA 4G3WA 5KSHA 4GKUA 2ZL1A 1ZG4A 3U4LP 4NXBA 1FILA 1TF1A 3ZG0A 2P9VA 1TS7A 3K3DA 3NY4A 2WKEA 4HEFA 1YM1A 2OAQ1 1L0DA 3IH8A 4E3KA 4CLCB 4R6LA 3NHQA 3EGDC 4X68A 4GCZA 4QY5A 2Y91A 5F68A 5G4ZA 4I3IA 5GHYA 1Q2PA 5FAPA 5FATA 3E4QA 4Z9QA 3SS4A 1BTLA 1JTGA 3S22A 2Z6DA 3V67A 1FCNA 2O9CA 1VEUB 1S4RA 4ETZA 2XGNA 4ZJ1A 2JN7A 4OQHA 3EOIA 1H3QA 3KSGA 4N1HA 4ZTKA 1ES4A 5FL3A 4O7DA 1NRJA 2OLUA 4RX3A 4D60A 3UDFA 3PBQA 4L9GA 4KUKA 3HLFA 2CMNA 2HZ5A 4CLCC 4KZ8A 3MMHA 2A3UA 3PR6A 2B18A 2Y2IA 5DVAA 5IT5A 4HJ3A 1XGJA 2OWHA 2UV0E 5AQBA 4EQIA 4UQIM 2HP5A 4XUXA 4UAAA 3D9YA 1SKOB 3HLCA 2W1RA 3ZNYA 4HY8A 2BASA 2OOLA 1XP4A 5EOEA 4H8RA 1P0ZA 4S2IA 3MSHA 5F83A 3T4KA 1LSXA 4KZ3A 4HJ6A 2V1AA 2XFTA 2DMWA 1TS6A 4Q0IA 4DXCA 2JKGA 2W3FA 1PZPA 4MN7A 2BLSA 3V5MA 4YNRA 4WMCD 4WUJA 4BLMA 1K57A 5F69A 1IYQA 5G4YA 1KVMA 1F9IA 2D02A 1U60A 4UEYA 4X1LA 5L09A 2ZOIA 4FH4A 4YINA 5IU1A 5A92A 3LIDA 2ZMAA 2KOIA 3GSGA 4LRZE 3WS2A 1FQGA 4FUWA 2HPBA 3IXBA 2A24A 1XX2A 1W7FA 5IHVA 4BD1A 3SH7A 4QU3A 2FFFB 4AFIA 3CUEA 3MBZA 4WEJA 3NC8A 4OH0A 3HLWA 2NUPC 4B4XA 1K38A 4R38A 5DKLA 1LSWA 3CJMA 3OPPA 3PBTA 3CAXA 4FSFA 3UMDA 3W2ZA 3D72A 3NI9A 1T1AA 3ICYA 2PDRA 3CITA 3P01A 3LCEA 1STZA 3Q1FA 4HESA 1NZUA 3VMAA 3F1PB 3NDGA 3WS1A 1CQAA 3HREA 2H0TA 5FQQA 1VETB 3QP4A 4KZAA 5C5KA 3F1NB 3NULA 3GRJA 4KZBA 1ESIA 1QMEA 1V9YA 2V1ZA 4LV3A 4PHTA 1H8YA 4C3QA 3C2WA 3UPPA 3D3OA 3N6IA 4PM5A 3VOYA 1BZAA 1L0EA 3IQAA 4GS9B 4NK3A 2WUQA 1P9RA 3ZVTA 2JKRM 4GNUA 5M18A 4ZJ3A 2QKPA 4IBRA 3U2AA 4ZRRA 3QP6A 2R9WA 1YSPA 1NZOA 1G6AA 5EM1A 3LEQA 4EWFA 2WKRA 2VGJA 3ZG5A 4PM6A 1ACFA 3UB5P 3RTYA 4KZ6A 2QZ6A 3BLMA 3Q7ZA 3HUOA 1SKOA 4GHIB 1EI5A 2KDKA 3M2KA 4WZ5A 3P09A 4JGPA 1GSXA 1D7EA 5AQ9A 3F1OB 1UWNX 5CEBA 3FKVA 5EE8A 1PWDA 2EFXA 2XF3A 3A0RA 4X53A 4R4SA 1IEMA 2H28A 1IYPA 2XRNA 1E3UD 2MJ6A 5EPHA 3FZCA 4EUVA 1K4FA 2QJ5A 1MKMA 4S2LA 3W4PA 4BWIA 2XD1A 4RQ9A 1H8ZA 3MQ0A 3HLDA 5HWWA 1OJ5A 3BJNA 3CPTB 4S2JA 1FOFA 1T18A 2EX8A 3H9WA 4ETXA 1NY0A 1Q2QA 1FR1A 4UQIS 3R4KA 3RXXA 2Y2JA 4CLCE 3JYIA 2VKSA 3DW0A 2WZXA 3VP4A 1BSGA 1DP8A 2VLGA 3BECA 2A2LA 5GLBA 4JPMA 4OPYA 5E2GA 4YFMA 3VP2A 4R3AA 4UA9A 3O88A 3MXQA 3G30A 1NYYA 3NECA 2W3EA 2Z2LB 5HPIA 1PW8A 2O9BA 3HL9A 3OC2A 1DY6A 1LL8A 3VP1A 4Y17A 2ZQ8A 1OTDA 1BLPA 5A91A 2XDMA 5F5YA 2H0YA 4GD6A 4BJPA 2Y55A 2G2UA 2JKTI 3GECA 5HWVA 1YLWA 3Q82A 1VETA 4OP8A 1ONHA 4BBTA 2PHYA 4S2NA 4X6TA 1LSVA 4BMWA 3UY6A 2VGLM 1E4DA 2W3GA 4G3KA 3ZCZA 5FASA 3KYZA 1W8YA 3IT9A 5GHXA 1TS8A 4D2OA 2Y2NA 2V0UA 2WKQA 3VSLA 4DKIA 3DTIA 4Y15A 4X55A 5J3WA 1P97A 3G6OA 4KZ4A 4B4ZA 2VV7A 1K54A 2LB9A 1PI5A 4S2OA 1T1BA 4PPRA 5U47A 4IVKA 1TS0A 2V8FA 3BFDA 4LRYC 4R70A 2DNSA 5AVFA 2BTFP 2WGVA 5CECA 1Y4OA 3C4OA 5GLCA 4LV2A 5EVIA 1D06A 1CEGA 5FQMA 4MCWA 1H0MA 3VOLA 1SZVA 1MWTA 3HLGA 4HBTA 4OQGA 1YKDA 2G2WA 1N9BA 2WGWA 2XH9A 3IF6C 3LEZA 2VA0A 2P7JA 4Q0JA 1PI4A 4K91A 3A3EA 4Y0TA 5CXWA 3IH9A 1OJGA 3D4FA 2XROA 4P6ZM 2PRFA 1K0KA 5FI7A 2FFYA 1CJFA 4WN5A 2WAEA 4EW7A 3CPTA 5CX7A 5HDCA 4BD0A 2PR5A 1NLYA 4CQHA 2JKRI 3B3XA 3UE0A 4ARZB 1OTEA 1HTZA 1JWPA 5FQIA 5DF8A 4F3LA 3T12B 3UE1A 1PIOA 2EWWA 3SH9A 2D01A 4KG6A 5CGWA 3NDEA 3S1YA 1CEFA 1XJ6A 4MBFA 2G7UA 2HJ9C 1W8QA 2ZM8A 3PBNA 5HX9A 4DDSA 1KOUA 2WZZA 1HLUP 1XJ2A 3E0YA 2DRWA 3CG5A 2QPNA 4WLAA 3TRCA 4JGRA 2GX5A 4U3TA 3QNCA 4DN0A 4HH3A 4Y3IA 1FIKA 1K6RA 1I5QA 1WYCA 1OTIA 3C5AA 3LI8A 4BBUA 3W4OA 3A0SA 4XT2B 2A49A 3OPLA 1IYSA 4JXWA 3SS3A 5JYOA 1SHVA 2I9VA 3IXDA 3VE3A 1JVJA 3HUNA 5FQKA 3UB7A 5JYPA 4WL9A 2K31A 2XLNA 2X02A 5FEFA 3AGEA 3O86A 3ISGA 2ZMVA 2CC1A 2WYXA 3LUQA 4Y13A 2FH5A 5TR7A 2ZQ7A 5EECA 4PAUA 4S2MA 2ZBBA 3GTCA 3NOTC 4JGOA 3ZGAB 2XSSA 5HDDA 4LV0A 1RGYA 5HD3A 5DF9A 3IBRA 5CTNA 1TDGA 3MZFA 1N4OA 3BQ8A 2KLIA 5HAPA 1H8MA 2J9PA 3KX0X 4KG5A 3UNWA 3S7QA 5I94A 3BFCA 1M40A 4GN2A 4WEKA 3ULFA 3LY4A 5EM0A 5HDSA 3N7WA 1YMXA 2XR0A 4GDNA 4RVAA 5M1AA 5EVLA 2EXBA 3IWQA 3EEAA 2WK0A 5MC7A 3R7WB 4NXFA 4DE3A 4QPRA 2HJEA 2Z6CA 1PYYA 3T4SA 1IFQA 1OTBA 3VP0A 3FKWA 4GLQA 1YLJA 3JVUA 4LENA 4P0MA 3BEBA 5CHJA 3DWZA 3QHYA 1BT5A 4MMNA 2GZAA 5A93A 1L0FA 1RCJA 1K55A 4DE0A 3RH8B 3VV4A 4RA7A 3G31A 1F98A 2VX8A 4MDZA 3MQOA 5E2FA 3TSGA 3T4LA 3M6BA 5TJJA 3LIBA 4OOLA 5FAQA 4XXRA 2NUTC 3CZDA 4I5SA 5EFWA 2JE5A 1IKIA 1CK3A 1TEMA 2HDUA 3C30A 3QP2A 3FYZA 4ARZA 3A3DA 4MBHA 3G32A 1ES5A 1VHMA 3H7WB 4HBUA 4B93A 4M4XA 3NOPC 5TFQA 3FG8A 1KE4A 2E8IA 2RL3A 1DJCA 4G3VA 4ZJ2A 1LHYA 3ZYTA 5CGXA 1IELA 4X25A 2ZQCA 1N9OA 3EQVA 2W0NA 2WGIA 5A90A 4Y2FA 1XJ3A 4KZ7A 3GR2A 4GB7A 1DJAA 2AVXA 4O0PA 3O3VA 3OPHA 3O5YA 3ITAA 2Y79A 1LL5A 4XT2A 3CHWP 3S7NA 3LYXA 4WELA 3L9KA 2V0WA 3N8SA 1TD5A 2Y2PA 1S0WA 4CLCA 3DAVA 5DFYA 4EESA 4K0XA 1WE4A 4K0WA 4O01A 3ZG7B 3MQQA 2O99A 1O7EA 4JBFA 3P7NA 1Y54A 4II7A 2KX6A 3ZG8B 1ESUA 2E8JA 4GZBA 3A0VA 4HIAA 2V9AA 1K4EA 4E04A 1GA0A 1LT0A 5GL9A 1VEUA 1NYMA 3GV9A 3S7OA 4P87A 4QY6A 1T1CA 3IXGA 5HL6A 2JC7A 4RX2A 4WYYA 4LCMA 5L07A 1BLHA 1SDNA 3H82B 3MXRA 4HOIA 1W63M 1FSWA 2HV1A 2M1CA 5EUAA 4KQQA 4YWZA 1GA9A 2PD7A 3I7JA 3JVVA 3WS4A 1Z09A 3B42A 5CRFA 4Y5FA 1N9LA 2ZD8A 3HCYA 1LI9A 1IOUA 4DRTA 4R0QA 3KYEA 5CHMA 1CF0A 3A3IA 1MC0A 1OTAA 2XQZA 4QD4A 1XFNA 3IS2B 3UDXA 2V20A 4LCLA 3LGOA 3ZDJA 1GHIA 4I3AA 4JF4A 3FWLA 1GCEA 3B47A 1MWUA 3BFFA 3LR5A 4HNBA 2ZC4B 2J8YA 1DP9A 3E2LA 3ZQ5A 2B5RA 2H10A 4R3BA 5HL1A 1PWCA 4S2KA 2V2FF 2ZQ9A 5AVEA 4XUZA 4X69A 3BQAA 3H7WA 4JKTA 3OLOA 5DTSA 3UB8A 3TJZC 3V3RA 4HJ4A 2HF6A 2QJ7A 4OONA 4MNRA 4U0TA 2J7VA 4A5RA 3KSFA 4EU0A 1K56D 2EX9A 3DBAA 4WMCA 2EX6A 1SKFA 3RJUA 3DTKA 1ZHHB 1M6KA 2R78A 4R4RA 1PW1A 4LGWA 4LRXC 1G68A 3T4TA 4Y0UA 3BFEA 1YLPA 2PU2A 5FA7A 5EOOA 1D1JA 4OPRA 4CPKA 1OT6A 3F1PA 4L9FA 5M19A 1X0OA 3MXSA 1ERMA 2O9AA 4B9OA 1V9ZA 1G28A 3UDIA 1N9NA 3LIFA 4E3IA 3F1NA 2ACGA 5FAOA 4IUKA 5HD5A 4QB8A 3Q7VB 2PU4A 4IHQA 5HFOA 4HH2A 5FDSA 3NIAA 3TE8A 4OVDA 3GQZA 2DCFA 4QHCA 4NG2A 4GS9A 3OBFA 5HAIA 3N8LA 3PHYA 5F1GA 2JCHA 2JKFA 3H82A 3UO9A 5CEDA 3BWLA 3NCKA 5E43A 5HARA 1C3BA 3IF6B 4ZBEA 1YSQA 3E4OA 4BQMA 3T4JA 1KGEA 4JF5A 3LR4A 4DF6A 3M6HA 2EA9A 3WS5A 4L9EA 1ONGA 4CJNA 3BM6A 5F82A 4ZDXA 3Q07A 5E2HA 4GHIA 2ZLYA 3BLSA 3DTEA 2K7SA 3RFBA 1ERQA 5KSCA 5HSQA 2WKIA 3F1OA 4WF0A 4E6XA 3ZHHA 2EFUA 4Z1WA 2M7VA 1L2SA 5KIZA 2ZMFA 2Y2QA 2VK3A 5AQ7A 4Q0HA 1OMEA 3BFGA 1S66L 1CI8A 5L10A 4I3JA 1TDLA 1EROA 5E2EA 2Q9MA 1PZOA 4BENA 2QYBA 4QWOA 4U0XA 4OLGA 3NJAA 3GDIA 2VV8A 5DFXA 1FCOA 5FSRA 3T1QB 1JWVA 4EQ1A 2BG1A 1I2WA 1XKZA 5TBMB 1KGGA 4WZ4A 3MKFA 1WA9A 5F6AA 2PYRA 4N92A 3HLEA 3DTMA 4FD8A 2HDQA 2VJWA 2PD8A 3G35A 2X01A 3Q81A 4KZ9A 4H6JB 5G18A 1SCWA 1YAXA 3BY9A 3T50A 3G2YA 5FQJA 1TVFA 2HDRA 3IWOA 4LV1A 1E3UA 3SOIA 2J9OA 4Y7PA 4GJ4A 4UA7A 1JNUA 1BLCA 2ZC7A 2JBFA 4E3MA 2C6WB 3MFDA 4MBKA 3HLBA 4I38A 4EERA 2RCXA 3M2JA 4FTXA 3MFXA 2PR6A 2EX2A 4S2PA 5GHZA 3KYQA 2A24B 3E4PA 1XA1A 4IUHA 3ZFZA 2VEAA 1NRFA 2ZJ9A 4FH2A 1GSVA 1BUEA 2UWXA 2HP6A 2OV5A 1K56A 3CLOA 4DJ3A 1SDEA 2VZWA 5AJGA 2FZ0A 3OOVA 1KGFA 1MY8A 4IVIA 1ODVA 5F1FA 4N1XA 1K57C 3A3FA 3C7UA 2H5SA 1UGUA 3C8CA 1E25A 3Q7VA 3UE6A 3E98A 4NKPA 3HBRA 2J3TD 4C6YA 3IX8A 1BYWA 4KQOA 3O87A 2V8CA 1H5XA 3T4QA 5KZHA 1ES3A 3IF6A 5DTKA 5CTMA 1MXOA 3CUEC 1GHMA 4PM9A 1MBLA 2XD5A 3G4PA 3UE3A 3T4OA 1BLSA 3G2ZA 1YLZA 4OPQA 4BBVA 3BYDA 4LPZA 3LR3A 1NLZA 3PYPA 1NWZA 4WM9A 1HD8A 2W3HA 2PBDP 3FPWA 3UB6A 4IBXA 3N8RA 1LLBA 2OLVA 3SW1A 2YKHA 3QP5A 3QNBA 3PXPA 4GW9A 4EEUA 4LLOB 2VGLS 1F2KA 4HP4A 4JXGA 4KQRA 3RXWA 3CI6A 4NEED 4I39A 2C5WB 4GOGA 4OOMA 5FI6A 3FV7A 3IX4A 3QP1A 1L3LA 5TBMA 3T1RA 2Y2LA 3CMZA 3ITBA 4BL3A 4F94A 1W79A 1ZKJA 2J3TC 3IWIA 4Q8IA 3EWKA 2JKTM 5CERA 1FR6A 1O07A 3WRZA 5LBRA 4ESPA 2XK1A 4OP5A 3K3CA 3BRMA 3LY3A 3PAEA 4H6JA 4E3NA 3IXHA 3WS0A 5HZHA 2OAP1 2P74A 3VFFA 1KVLA 3C38A 4P6BA 2XEPA 4OQ0A 2Y2OA 3OCLA 3TG9A 4WZ5C 1PWGA 5FEGA 1AWIA 3VP3A 3IHAA 5AQAA 3TW8A 4E3LA 2VGKA 4FOFA 4P85A 4WBGA 3KSHA 2XA7M 3IX3A 4P6ZS 3DWKA 4JLFA 4E6WA 4EEPA
chains in the Genus database with same CATH topology
4HJ4A 2HF6A 2QJ7A 5K5BA 2Z6DA 3V67A 3VOLA 2O9CA 3EGXC 4ETZA 1S4RA 2O0YA 2JN7A 1YKDA 3EOIA 1H3QA 3KSFA 4EU0A 3HJKA 3MJQA 1W63Q 3KSGA 3DBAA 2INWA 2VA0A 5FL3A 2P7JA 4Q0JA 1NRJA 1ZHHB 2R78A 3PBQA 4LRXC 4L9GA 4MN6A 4KUKA 3T4TA 1MZUA 2PT7A 3LFVA 2CMNA 1OJGA 4CLCC 2XROA 3MMHA 4P6ZM 3K2NA 3PR6A 2B18A 5IT5A 4HJ3A 4WN5A 2OWHA 4EW7A 1S1ZA 4UQIM 5CX7A 5HDCA 2PR5A 1NLYA 3IBJA 4CQHA 1OT6A 2JKRI 4ARZB 1OTEA 4KUOA 2W1RA 2L0WA 3F1PA 4L9FA 4HY8A 2BASA 2OOLA 4F3LA 1X0OA 1P0ZA 3HJIA 2O9AA 2EWWA 2D01A 3R7WA 4HQAA 4B9OA 1V9ZA 3T4KA 1G28A 4EXOA 1N9NA 1LSXA 3LIFA 4HJ6A 2V1AA 2DMWA 2GJ3A 1XJ6A 1TS6A 4Q0IA 3F1NA 2G7UA 2HJ9C 3PBNA 3S7PA 2W3FA 3MR0A 4IUKA 5HD5A 1KOUA 4PKYA 3BY8A 1XJ2A 3E0YA 4MN7A 4IHQA 4WLAA 3TRCA 4JGRA 4HH2A 3LICA 2GX5A 4MN5A 4HH3A 4DN0A 3TE8A 4YNRA 4PKYG 4GS9A 3OBFA 4Y3IA 4WUJA 5A8BA 1EW0A 2W3DA 1OTIA 3LI8A 5DJTA 3PHYA 5F69A 4BBUA 3FC7A 3OCNA 3A0SA 5G4YA 1F9IA 4XT2B 3H82A 2D02A 3PBRA 3BWLA 1S67L 5HWTA 4UEYA 2M7UA 2I9VA 2ZOIA 1YSQA 3E4OA 3VE3A 5IU1A 3LIDA 3T4JA 3UB7A 4WL9A 2K31A 2KOIA 2GNXA 2ZOHA 3LR4A 4IJGA 5J4EA 4LRZE 2ZMVA 3LUQA 2A24A 2EA9A 4L9EA 2FH5A 2QHKA 4PAUA 5DJUA 4AFIA 2J80A 2ZBBA 3CUEA 4WEJA 4GHIA 2NUPC 3PBSA 2P04A 2K7SA 3NOTC 3RFBA 3CWFA 4JGOA 4R38A 5DKLA 5I5LA 5HSQA 1LSWA 1S4SA 2XSSA 1GSWA 3PBTA 3F1OA 3CAXA 4WF0A 5HDDA 4FSFA 2OWJA 4Z1WA 3UMDA 2L1MA 3W2ZA 4HP9A 2YKFA 5HD3A 5DF9A 3D72A 2M7VA 3IBRA 5KIZA 5IS1A 2ZMFA 1T1AA 1ZTUA 1P9WA 2W27A 3ICYA 4Q0HA 2PDRA 3BQ8A 2KLIA 3CITA 4DMZA 3P01A 1H8MA 1S66L 1F5MA 3KX0X 1STZA 3S7QA 4I3JA 4WEKA 3ULFA 5HDSA 1G6OA 3MF0A 3VE4A 2QYBA 3F1PB 3NJAA 4F3LB 3GDIA 2P08A 2VV8A 5DFXA 4YOFA 4JGQA 3EEAA 4EQ1A 5MC7A 3R7WB 1OPXA 4NXFA 5TBMB 4QPRA 2HJEA 2Z6CA 5C5KA 3T4SA 1WA9A 5F6AA 3F1NB 1IFQA 1OTBA 2PYRA 4GLQA 4NXEA 1V9YA 3JVUA 2W1TB 2VJWA 1DP6A 4PHTA 2PD8A 3C2WA 3D3OA 4MMNA 2GZAA 4H6JB 3RH8B 1YAXA 3BY9A 3T50A 4GS9B 1XFQA 3VV4A 1F98A 1P9RA 4K08A 2VX8A 2JKRM 4MDZA 2IA2A 2QKPA 3U2AA 4ZRRA 3MQOA 3T4LA 5TJJA 3LIBA 1YSPA 4GJ4A 4OOLA 1JNUA 1UWPX 3BW6A 3FPVA 3UMEA 2NUTC 2WKRA 4I5SA 5EFWA 1S1YA 4I38A 4EERA 3MFXA 2PR6A 3RTYA 3C30A 4DJ2A 3KYQA 2A24B 3E4PA 4IUHA 2VEAA 4ARZA 4GHIB 1VHMA 3H7WB 4B93A 4M4XA 3NOPC 1GSVA 2KDKA 2WKPA 4JGPA 5HPFA 3KSIA 3FG8A 3CLOA 3LI9A 4DJ3A 1GSXA 3B33A 2XA7S 2VZWA 1D7EA 2FZ0A 2J3WA 3NOUC 3OOVA 3PBOA 5AJGA 2Y8HA 3F1OB 1UWNX 3LIEA 4G3VA 4O8GA 1XJ4A 1ODVA 3ZYTA 3EQUA 1UGUA 1N9OA 3EQVA 2W0NA 3C8CA 3LIAA 4Y2FA 3LR0A 1XJ3A 4NXGA 3UE6A 2V1BA 3E98A 4NKPA 4EEPA 3A0RA 4O0PA 2J3TD 2H28A 2XRNA 1BYWA 2MJ6A 3KO6A 4KQOA 4EUVA 3O5YA 4EETB 2QJ5A 3IS2A 1MKMA 2Y79A 1DRMA 4XT2A 3T4QA 4BWIA 4RQ9A 3S7NA 3LYXA 3MQ0A 4WELA 5HWWA 1OJ5A 2V0WA 3BJNA 3CUEC 1T18A 1TD5A 2K2NA 3H9WA 4ETXA 4UQIS 3UE3A 3R4KA 3T4OA 4CLCA 4EESA 5DFYA 4CLCE 2VKSA 4BBVA 2HGVA 2QWSA 4O01A 4LPZA 3LR3A 1NLZA 3PYPA 1OT9A 2O99A 1DP8A 1NWZA 3MQQA 2VLGA 2A2LA 3P7NA 4II7A 2W3HA 2KX6A 3FPWA 2LB5A 3A0VA 3UB6A 4R3AA 3SW1A 2YKHA 4HIAA 2V9AA 3MXQA 4E04A 1LT0A 3PXPA 2W3EA 4GW9A 4EEUA 4LLOB 2B02A 3S7OA 2VGLS 4HHDA 1Y28A 1T1CA 5HL6A 5L8MA 2VV6A 5HPIA 4HP4A 4ME4A 2O9BA 3CI6A 4NEED 3OC2A 1LL8A 4I39A 3H82B 4OOMA 1OTDA 2JHEA 4HOIA 1W63M 5J7EA 5F5YA 4KQDA 4BJPA 2HV1A 2EWVA 2M1CA 2JKTI 3GECA 4YWZA 5HWVA 2PD7A 3JVVA 4BBTA 5TBMA 1VB6A 2PYPA 5DKKA 3UB9A 2PHYA 3EEHA 3B42A 1LSVA 4L0LA 2J3TC 4Y5FA 4BMWA 1N9LA 1T19A 2JKTM 3EWKA 4CLCD 2VGLM 2W1TA 3HCYA 5LBRA 2W3GA 4G3KA 1IOUA 3K3CA 4H6JA 3KYZA 1MC0A 1OTAA 1TS8A 4HI4A 1XFNA 2V0UA 2WKQA 3IS2B 2L4RA 5HZHA 5J3WA 1P97A 4G3WA 3G6OA 5KSHA 2OAP1 2VV7A 4I3AA 2LB9A 3C38A 4NXBA 1TF1A 1T1BA 1TS7A 3OCLA 3K3DA 3B47A 3LR5A 2OAQ1 1TS0A 4HNBA 4CLCB 4LRYC 4R6LA 3NHQA 3EGDC 1DP9A 4GCZA 3TW8A 4R70A 3ZQ5A 4FOFA 5AVFA 5F68A 5G4ZA 5AVEA 3KSHA 2XA7M 4I3IA 3BQAA 3H7WA 3OLOA 3UB8A 1D06A 3E4QA 4P6ZS 3TJZC 4MCWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HJ4 A;  2QJ7 A;  2Z6D A;  3VOL A;  1S4R A;  2JN7 A;  3HJK A;  3MJQ A;  2INW A;  2P7J A;  2R78 A;  4LRX C;  4L9G A;  4MN6 A;  4KUK A;  1MZU A;  2CMN A;  1OJG A;  4HJ3 A;  4WN5 A;  2OWH A;  4EW7 A;  1S1Z A;  5HDC A;  2PR5 A;  1OT6 A;  1OTE A;  4KUO A;  2L0W A;  3F1P A;  4L9F A;  4HY8 A;  2BAS A;  2OOL A;  4F3L A;  1X0O A;  1P0Z A;  3HJI A;  2D01 A;  4HQA A;  4B9O A;  1V9Z A;  4EXO A;  1G28 A;  1N9N A;  1LSX A;  3LIF A;  4HJ6 A;  2V1A A;  2GJ3 A;  1XJ6 A;  1TS6 A;  3F1N A;  3MR0 A;  5HD5 A;  1KOU A;  4PKY A;  3BY8 A;  1XJ2 A;  4WLA A;  4JGR A;  4HH2 A;  3LIC A;  4MN5 A;  4HH3 A;  4PKY G;  4GS9 A;  4WUJ A;  5A8B A;  1EW0 A;  1OTI A;  3LI8 A;  5DJT A;  4BBU A;  3PHY A;  5F69 A;  3FC7 A;  5G4Y A;  3A0S A;  1F9I A;  4XT2 B;  3H82 A;  2D02 A;  3BWL A;  1S67 L;  5HWT A;  2I9V A;  2ZOI A;  3E4O A;  3VE3 A;  5IU1 A;  3LID A;  3UB7 A;  4WL9 A;  2ZOH A;  5J4E A;  4LRZ E;  3LUQ A;  2A24 A;  2EA9 A;  4L9E A;  2QHK A;  5DJU A;  2J80 A;  2ZBB A;  4GHI A;  2K7S A;  3NOT C;  3CWF A;  4JGO A;  4R38 A;  5I5L A;  5DKL A;  5HSQ A;  1LSW A;  1S4S A;  1GSW A;  3F1O A;  3CAX A;  4WF0 A;  5HDD A;  2OWJ A;  3UMD A;  2L1M A;  4HP9 A;  2YKF A;  5HD3 A;  3D72 A;  3IBR A;  5KIZ A;  5IS1 A;  1T1A A;  2W27 A;  3ICY A;  2PDR A;  1S66 L;  3KX0 X;  4I3J A;  3ULF A;  5HDS A;  3VE4 A;  3F1P B;  3NJA A;  4F3L B;  3GDI A;  2VV8 A;  4JGQ A;  4EQ1 A;  4NXF A;  5TBM B;  2Z6C A;  1WA9 A;  5F6A A;  3F1N B;  1OTB A;  2PYR A;  4NXE A;  1V9Y A;  1DP6 A;  2PD8 A;  3C2W A;  4H6J B;  3RH8 B;  3T50 A;  3BY9 A;  4GS9 B;  1XFQ A;  1F98 A;  4K08 A;  2QKP A;  3MQO A;  3LIB A;  1JNU A;  1UWP X;  3UME A;  2WKR A;  4I5S A;  5EFW A;  1S1Y A;  4I38 A;  4EER A;  3MFX A;  2PR6 A;  3RTY A;  4DJ2 A;  2A24 B;  3E4P A;  2VEA A;  4GHI B;  3H7W B;  4M4X A;  3NOP C;  1GSV A;  2KDK A;  2WKP A;  4JGP A;  3FG8 A;  3CLO A;  3LI9 A;  4DJ3 A;  1GSX A;  3B33 A;  1D7E A;  3NOU C;  3LIE A;  3F1O B;  1UWN X;  1XJ4 A;  1ODV A;  1UGU A;  1N9O A;  2W0N A;  3C8C A;  3LIA A;  1XJ3 A;  4NXG A;  3UE6 A;  2V1B A;  3A0R A;  2H28 A;  1BYW A;  4EET B;  2QJ5 A;  3IS2 A;  1DRM A;  4XT2 A;  4RQ9 A;  3LYX A;  5HWW A;  1OJ5 A;  2V0W A;  1T18 A;  3H9W A;  4EES A;  4BBV A;  2QWS A;  4LPZ A;  3PYP A;  1OT9 A;  3MQQ A;  1DP8 A;  1NWZ A;  2VLG A;  3P7N A;  2KX6 A;  3A0V A;  3UB6 A;  4R3A A;  3SW1 A;  2YKH A;  4HIA A;  2V9A A;  3MXQ A;  4E04 A;  1LT0 A;  4GW9 A;  4EEU A;  4LLO B;  2B02 A;  4HHD A;  1Y28 A;  1T1C A;  2VV6 A;  4HP4 A;  1LL8 A;  4I39 A;  3H82 B;  1OTD A;  2JHE A;  4HOI A;  5J7E A;  5F5Y A;  4KQD A;  2HV1 A;  2M1C A;  3GEC A;  4YWZ A;  5HWV A;  2PD7 A;  4BBT A;  5TBM A;  1VB6 A;  2PYP A;  5DKK A;  3UB9 A;  2PHY A;  3EEH A;  1LSV A;  1N9L A;  1T19 A;  3EWK A;  3K3C A;  4H6J A;  1OTA A;  1TS8 A;  4HI4 A;  1XFN A;  2V0U A;  2WKQ A;  3IS2 B;  2L4R A;  5HZH A;  5J3W A;  1P97 A;  3G6O A;  2VV7 A;  4I3A A;  4NXB A;  1T1B A;  1TS7 A;  3K3D A;  1TS0 A;  4HNB A;  4LRY C;  4R6L A;  3NHQ A;  1DP9 A;  4GCZ A;  3ZQ5 A;  4R70 A;  5AVF A;  5F68 A;  5G4Z A;  5AVE A;  4I3I A;  3H7W A;  3OLO A;  3UB8 A;  1D06 A;  3E4Q A;  4EEP A; 
#chains in the Genus database with same CATH topology
 5K5B A;  3GMW A;  2ZC5 B;  1MWR A;  3UN7 A;  2Y2G A;  3MKE A;  3MZE A;  1G5U A;  3EGX C;  5GLD A;  5DF7 A;  1YLY A;  2O0Y A;  4DXB A;  1BUL A;  2Q9N A;  3C7V A;  1K6S A;  4OKP A;  1ZC2 A;  3HJK A;  1RGZ A;  3MJQ A;  1W63 Q;  3SS5 A;  3MZD A;  3T1S A;  2INW A;  4PM8 A;  4OPZ A;  3V50 A;  1IKG A;  1YMS A;  3C4P A;  4MN6 A;  3ZVW A;  1GHP A;  4ID4 A;  1MZU A;  2PT7 A;  3LFV A;  3K2N A;  4EV4 A;  1MKI A;  2GDN A;  5FQ9 A;  1VQQ A;  3UPN A;  1S1Z A;  3NBL A;  1XXM A;  3IBJ A;  1EWZ A;  2OSU A;  4KUO A;  2L0W A;  1KDS A;  4E3J A;  3G34 A;  4GD8 A;  1PFL A;  3MS6 A;  3HJI A;  4QJG A;  4DE2 A;  3OZH A;  3R7W A;  4HQA A;  5EVI D;  4EXO A;  2XFS A;  2GJ3 A;  4X56 A;  2Y2H A;  4BL2 A;  3E2K A;  3S7P A;  3MR0 A;  4PKY A;  3BY8 A;  1AXB A;  2Z2M B;  3LIC A;  1KDW A;  4MN5 A;  4PMA A;  3WRT A;  4PKY G;  1QMF A;  4MLL A;  1EW0 A;  2W3D A;  5A8B A;  5DJT A;  3FC7 A;  3OCN A;  1XPB A;  4S2N C;  3PBR A;  1S67 L;  5HWT A;  4UA6 A;  2M7U A;  1S6R A;  4JXS A;  1XGI A;  5EVI B;  1NJ4 A;  4LFU A;  4JF6 A;  3A3J A;  2GNX A;  2ZOH A;  4N9K A;  4IJG A;  5J4E A;  4DDY A;  4E3O A;  4JXV A;  2ZM0 A;  1A0K A;  2QHK A;  5DJU A;  2J80 A;  2WGW B;  1WYB A;  1K54 C;  2IWB A;  3PTE A;  3PBS A;  2P04 A;  1MWS A;  3CWF A;  3P98 A;  4KEN B;  1XA7 A;  5I5L A;  5D3O A;  4B88 A;  1S4S A;  1GSW A;  1JTD A;  4UHU A;  2OWJ A;  2L1M A;  4HP9 A;  2Y2K A;  2YKF A;  5TGF A;  3V39 A;  5IS1 A;  1ZTU A;  1P9W A;  2W27 A;  2I72 A;  2ZC3 B;  4DMZ A;  1F5M A;  3PAG A;  2WAF A;  1G6O A;  3W8K A;  3MF0 A;  5EVI C;  2ZM2 A;  3VE4 A;  4F3L B;  2P08 A;  3ZG9 B;  4YOF A;  4JGQ A;  1RP5 A;  1JWZ A;  1OPX A;  2PBY A;  4N9L A;  2R9X A;  4NXE A;  2PAV P;  2W1T B;  1W5D A;  4R3J A;  1DP6 A;  5HAQ A;  1XFQ A;  4K08 A;  3QP8 A;  2IA2 A;  1FCM A;  1ZG6 A;  1KE0 A;  3IHB A;  2ZL1 B;  5HW3 A;  1UWP X;  2Y2M A;  3BW6 A;  4GDB A;  3FPV A;  3UME A;  2IWC A;  2P9V B;  1J9M A;  2X71 A;  4PM7 A;  1S1Y A;  4FCF A;  3GVB A;  5BOH A;  1IYO A;  4DJ2 A;  4IED A;  2HDS A;  4X1M A;  4R23 A;  1ALQ A;  1MPL A;  3S4X A;  2WKP A;  5HPF A;  3KSI A;  3LI9 A;  3B33 A;  2XA7 S;  2IWD A;  1PNE A;  2J3W A;  1HZO A;  3NOU C;  3PBO A;  4EBL A;  1YQS A;  2Y8H A;  3LIE A;  4O8G A;  3VSK A;  1XJ4 A;  3VOZ A;  4MEZ A;  4OQI A;  4EUZ A;  1YLT A;  3EQU A;  5FDH A;  3LIA A;  3LR0 A;  4NXG A;  2V1B A;  3L7H A;  1NXY A;  3HUM A;  3LO7 A;  2ZC6 B;  2EXA A;  2HP9 A;  3KO6 A;  1KE3 A;  4EET B;  3IS2 A;  1DRM A;  4KZ5 A;  5CHU A;  5FI2 A;  4DE1 A;  3IF5 A;  1VM1 A;  5EVE A;  4R1G A;  1ES2 A;  2K2N A;  1L0G A;  3TOI A;  4OOY A;  1PRQ A;  5DTT A;  4Y0O A;  4M3K A;  1YPR A;  5L2F A;  1FSY A;  3UPO A;  4EBP A;  2Q0O A;  1I2S A;  2HGV A;  2QWS A;  1OT9 A;  1LL9 A;  2QMI A;  1CI9 A;  1J3W A;  3ZNT A;  2WKH A;  3W4Q A;  2LB5 A;  3OPR A;  5CGS A;  4C75 A;  3VFH A;  2B02 A;  4RYE A;  4HHD A;  1Y28 A;  3N4I A;  5L8M A;  2VV6 A;  1HVB A;  2ZQD A;  1YT4 A;  1Z6F A;  4ME4 A;  2ZQA A;  2JHE A;  2Y59 A;  1K25 A;  3WWX A;  5J7E A;  4KQD A;  5J8X A;  3HVF A;  2EWV A;  1LI0 A;  2B95 A;  5GLA A;  1DJB A;  1K55 C;  3AGF A;  5EV0 A;  3V3S A;  4EBN A;  1VB6 A;  2PYP A;  4ZAM A;  5DKK A;  3UB9 A;  2Y4A A;  3EEH A;  2WAD A;  4KG2 A;  4L0L A;  3SH8 A;  1T19 A;  4CLC D;  3SZT A;  2W1T A;  3T1X A;  3AGD A;  3JPU A;  4NET A;  4HI4 A;  4OLD A;  2L4R A;  5KMW A;  4G3W A;  5KSH A;  4GKU A;  2ZL1 A;  1ZG4 A;  3U4L P;  4NXB A;  1FIL A;  1TF1 A;  3ZG0 A;  2P9V A;  1TS7 A;  3K3D A;  3NY4 A;  2WKE A;  4HEF A;  1YM1 A;  2OAQ 1;  1L0D A;  3IH8 A;  4E3K A;  4CLC B;  4R6L A;  3NHQ A;  3EGD C;  4X68 A;  4GCZ A;  4QY5 A;  2Y91 A;  5F68 A;  5G4Z A;  4I3I A;  5GHY A;  1Q2P A;  5FAP A;  5FAT A;  3E4Q A;  4Z9Q A;  3SS4 A;  1BTL A;  1JTG A;  3S22 A;  2Z6D A;  3V67 A;  1FCN A;  2O9C A;  1VEU B;  1S4R A;  4ETZ A;  2XGN A;  4ZJ1 A;  2JN7 A;  4OQH A;  3EOI A;  1H3Q A;  3KSG A;  4N1H A;  4ZTK A;  1ES4 A;  5FL3 A;  4O7D A;  1NRJ A;  2OLU A;  4RX3 A;  4D60 A;  3UDF A;  3PBQ A;  4L9G A;  4KUK A;  3HLF A;  2CMN A;  2HZ5 A;  4CLC C;  4KZ8 A;  3MMH A;  2A3U A;  3PR6 A;  2B18 A;  2Y2I A;  5DVA A;  5IT5 A;  4HJ3 A;  1XGJ A;  2OWH A;  2UV0 E;  5AQB A;  4EQI A;  4UQI M;  2HP5 A;  4XUX A;  4UAA A;  3D9Y A;  1SKO B;  3HLC A;  2W1R A;  3ZNY A;  4HY8 A;  2BAS A;  2OOL A;  1XP4 A;  5EOE A;  4H8R A;  1P0Z A;  4S2I A;  3MSH A;  5F83 A;  3T4K A;  1LSX A;  4KZ3 A;  4HJ6 A;  2V1A A;  2XFT A;  2DMW A;  1TS6 A;  4Q0I A;  4DXC A;  2JKG A;  2W3F A;  1PZP A;  4MN7 A;  2BLS A;  3V5M A;  4YNR A;  4WMC D;  4WUJ A;  4BLM A;  1K57 A;  5F69 A;  1IYQ A;  5G4Y A;  1KVM A;  1F9I A;  2D02 A;  1U60 A;  4UEY A;  4X1L A;  5L09 A;  2ZOI A;  4FH4 A;  4YIN A;  5IU1 A;  5A92 A;  3LID A;  2ZMA A;  2KOI A;  3GSG A;  4LRZ E;  3WS2 A;  1FQG A;  4FUW A;  2HPB A;  3IXB A;  2A24 A;  1XX2 A;  1W7F A;  5IHV A;  4BD1 A;  3SH7 A;  4QU3 A;  2FFF B;  4AFI A;  3CUE A;  3MBZ A;  4WEJ A;  3NC8 A;  4OH0 A;  3HLW A;  2NUP C;  4B4X A;  1K38 A;  4R38 A;  5DKL A;  1LSW A;  3CJM A;  3OPP A;  3PBT A;  3CAX A;  4FSF A;  3UMD A;  3W2Z A;  3D72 A;  3NI9 A;  1T1A A;  3ICY A;  2PDR A;  3CIT A;  3P01 A;  3LCE A;  1STZ A;  3Q1F A;  4HES A;  1NZU A;  3VMA A;  3F1P B;  3NDG A;  3WS1 A;  1CQA A;  3HRE A;  2H0T A;  5FQQ A;  1VET B;  3QP4 A;  4KZA A;  5C5K A;  3F1N B;  3NUL A;  3GRJ A;  4KZB A;  1ESI A;  1QME A;  1V9Y A;  2V1Z A;  4LV3 A;  4PHT A;  1H8Y A;  4C3Q A;  3C2W A;  3UPP A;  3D3O A;  3N6I A;  4PM5 A;  3VOY A;  1BZA A;  1L0E A;  3IQA A;  4GS9 B;  4NK3 A;  2WUQ A;  1P9R A;  3ZVT A;  2JKR M;  4GNU A;  5M18 A;  4ZJ3 A;  2QKP A;  4IBR A;  3U2A A;  4ZRR A;  3QP6 A;  2R9W A;  1YSP A;  1NZO A;  1G6A A;  5EM1 A;  3LEQ A;  4EWF A;  2WKR A;  2VGJ A;  3ZG5 A;  4PM6 A;  1ACF A;  3UB5 P;  3RTY A;  4KZ6 A;  2QZ6 A;  3BLM A;  3Q7Z A;  3HUO A;  1SKO A;  4GHI B;  1EI5 A;  2KDK A;  3M2K A;  4WZ5 A;  3P09 A;  4JGP A;  1GSX A;  1D7E A;  5AQ9 A;  3F1O B;  1UWN X;  5CEB A;  3FKV A;  5EE8 A;  1PWD A;  2EFX A;  2XF3 A;  3A0R A;  4X53 A;  4R4S A;  1IEM A;  2H28 A;  1IYP A;  2XRN A;  1E3U D;  2MJ6 A;  5EPH A;  3FZC A;  4EUV A;  1K4F A;  2QJ5 A;  1MKM A;  4S2L A;  3W4P A;  4BWI A;  2XD1 A;  4RQ9 A;  1H8Z A;  3MQ0 A;  3HLD A;  5HWW A;  1OJ5 A;  3BJN A;  3CPT B;  4S2J A;  1FOF A;  1T18 A;  2EX8 A;  3H9W A;  4ETX A;  1NY0 A;  1Q2Q A;  1FR1 A;  4UQI S;  3R4K A;  3RXX A;  2Y2J A;  4CLC E;  3JYI A;  2VKS A;  3DW0 A;  2WZX A;  3VP4 A;  1BSG A;  1DP8 A;  2VLG A;  3BEC A;  2A2L A;  5GLB A;  4JPM A;  4OPY A;  5E2G A;  4YFM A;  3VP2 A;  4R3A A;  4UA9 A;  3O88 A;  3MXQ A;  3G30 A;  1NYY A;  3NEC A;  2W3E A;  2Z2L B;  5HPI A;  1PW8 A;  2O9B A;  3HL9 A;  3OC2 A;  1DY6 A;  1LL8 A;  3VP1 A;  4Y17 A;  2ZQ8 A;  1OTD A;  1BLP A;  5A91 A;  2XDM A;  5F5Y A;  2H0Y A;  4GD6 A;  4BJP A;  2Y55 A;  2G2U A;  2JKT I;  3GEC A;  5HWV A;  1YLW A;  3Q82 A;  1VET A;  4OP8 A;  1ONH A;  4BBT A;  2PHY A;  4S2N A;  4X6T A;  1LSV A;  4BMW A;  3UY6 A;  2VGL M;  1E4D A;  2W3G A;  4G3K A;  3ZCZ A;  5FAS A;  3KYZ A;  1W8Y A;  3IT9 A;  5GHX A;  1TS8 A;  4D2O A;  2Y2N A;  2V0U A;  2WKQ A;  3VSL A;  4DKI A;  3DTI A;  4Y15 A;  4X55 A;  5J3W A;  1P97 A;  3G6O A;  4KZ4 A;  4B4Z A;  2VV7 A;  1K54 A;  2LB9 A;  1PI5 A;  4S2O A;  1T1B A;  4PPR A;  5U47 A;  4IVK A;  1TS0 A;  2V8F A;  3BFD A;  4LRY C;  4R70 A;  2DNS A;  5AVF A;  2BTF P;  2WGV A;  5CEC A;  1Y4O A;  3C4O A;  5GLC A;  4LV2 A;  5EVI A;  1D06 A;  1CEG A;  5FQM A;  4MCW A;  1H0M A;  3VOL A;  1SZV A;  1MWT A;  3HLG A;  4HBT A;  4OQG A;  1YKD A;  2G2W A;  1N9B A;  2WGW A;  2XH9 A;  3IF6 C;  3LEZ A;  2VA0 A;  2P7J A;  4Q0J A;  1PI4 A;  4K91 A;  3A3E A;  4Y0T A;  5CXW A;  3IH9 A;  1OJG A;  3D4F A;  2XRO A;  4P6Z M;  2PRF A;  1K0K A;  5FI7 A;  2FFY A;  1CJF A;  4WN5 A;  2WAE A;  4EW7 A;  3CPT A;  5CX7 A;  5HDC A;  4BD0 A;  2PR5 A;  1NLY A;  4CQH A;  2JKR I;  3B3X A;  3UE0 A;  4ARZ B;  1OTE A;  1HTZ A;  1JWP A;  5FQI A;  5DF8 A;  4F3L A;  3T12 B;  3UE1 A;  1PIO A;  2EWW A;  3SH9 A;  2D01 A;  4KG6 A;  5CGW A;  3NDE A;  3S1Y A;  1CEF A;  1XJ6 A;  4MBF A;  2G7U A;  2HJ9 C;  1W8Q A;  2ZM8 A;  3PBN A;  5HX9 A;  4DDS A;  1KOU A;  2WZZ A;  1HLU P;  1XJ2 A;  3E0Y A;  2DRW A;  3CG5 A;  2QPN A;  4WLA A;  3TRC A;  4JGR A;  2GX5 A;  4U3T A;  3QNC A;  4DN0 A;  4HH3 A;  4Y3I A;  1FIK A;  1K6R A;  1I5Q A;  1WYC A;  1OTI A;  3C5A A;  3LI8 A;  4BBU A;  3W4O A;  3A0S A;  4XT2 B;  2A49 A;  3OPL A;  1IYS A;  4JXW A;  3SS3 A;  5JYO A;  1SHV A;  2I9V A;  3IXD A;  3VE3 A;  1JVJ A;  3HUN A;  5FQK A;  3UB7 A;  5JYP A;  4WL9 A;  2K31 A;  2XLN A;  2X02 A;  5FEF A;  3AGE A;  3O86 A;  3ISG A;  2ZMV A;  2CC1 A;  2WYX A;  3LUQ A;  4Y13 A;  2FH5 A;  5TR7 A;  2ZQ7 A;  5EEC A;  4PAU A;  4S2M A;  2ZBB A;  3GTC A;  3NOT C;  4JGO A;  3ZGA B;  2XSS A;  5HDD A;  4LV0 A;  1RGY A;  5HD3 A;  5DF9 A;  3IBR A;  5CTN A;  1TDG A;  3MZF A;  1N4O A;  3BQ8 A;  2KLI A;  5HAP A;  1H8M A;  2J9P A;  3KX0 X;  4KG5 A;  3UNW A;  3S7Q A;  5I94 A;  3BFC A;  1M40 A;  4GN2 A;  4WEK A;  3ULF A;  3LY4 A;  5EM0 A;  5HDS A;  3N7W A;  1YMX A;  2XR0 A;  4GDN A;  4RVA A;  5M1A A;  5EVL A;  2EXB A;  3IWQ A;  3EEA A;  2WK0 A;  5MC7 A;  3R7W B;  4NXF A;  4DE3 A;  4QPR A;  2HJE A;  2Z6C A;  1PYY A;  3T4S A;  1IFQ A;  1OTB A;  3VP0 A;  3FKW A;  4GLQ A;  1YLJ A;  3JVU A;  4LEN A;  4P0M A;  3BEB A;  5CHJ A;  3DWZ A;  3QHY A;  1BT5 A;  4MMN A;  2GZA A;  5A93 A;  1L0F A;  1RCJ A;  1K55 A;  4DE0 A;  3RH8 B;  3VV4 A;  4RA7 A;  3G31 A;  1F98 A;  2VX8 A;  4MDZ A;  3MQO A;  5E2F A;  3TSG A;  3T4L A;  3M6B A;  5TJJ A;  3LIB A;  4OOL A;  5FAQ A;  4XXR A;  2NUT C;  3CZD A;  4I5S A;  5EFW A;  2JE5 A;  1IKI A;  1CK3 A;  1TEM A;  2HDU A;  3C30 A;  3QP2 A;  3FYZ A;  4ARZ A;  3A3D A;  4MBH A;  3G32 A;  1ES5 A;  1VHM A;  3H7W B;  4HBU A;  4B93 A;  4M4X A;  3NOP C;  5TFQ A;  3FG8 A;  1KE4 A;  2E8I A;  2RL3 A;  1DJC A;  4G3V A;  4ZJ2 A;  1LHY A;  3ZYT A;  5CGX A;  1IEL A;  4X25 A;  2ZQC A;  1N9O A;  3EQV A;  2W0N A;  2WGI A;  5A90 A;  4Y2F A;  1XJ3 A;  4KZ7 A;  3GR2 A;  4GB7 A;  1DJA A;  2AVX A;  4O0P A;  3O3V A;  3OPH A;  3O5Y A;  3ITA A;  2Y79 A;  1LL5 A;  4XT2 A;  3CHW P;  3S7N A;  3LYX A;  4WEL A;  3L9K A;  2V0W A;  3N8S A;  1TD5 A;  2Y2P A;  1S0W A;  4CLC A;  3DAV A;  5DFY A;  4EES A;  4K0X A;  1WE4 A;  4K0W A;  4O01 A;  3ZG7 B;  3MQQ A;  2O99 A;  1O7E A;  4JBF A;  3P7N A;  1Y54 A;  4II7 A;  2KX6 A;  3ZG8 B;  1ESU A;  2E8J A;  4GZB A;  3A0V A;  4HIA A;  2V9A A;  1K4E A;  4E04 A;  1GA0 A;  1LT0 A;  5GL9 A;  1VEU A;  1NYM A;  3GV9 A;  3S7O A;  4P87 A;  4QY6 A;  1T1C A;  3IXG A;  5HL6 A;  2JC7 A;  4RX2 A;  4WYY A;  4LCM A;  5L07 A;  1BLH A;  1SDN A;  3H82 B;  3MXR A;  4HOI A;  1W63 M;  1FSW A;  2HV1 A;  2M1C A;  5EUA A;  4KQQ A;  4YWZ A;  1GA9 A;  2PD7 A;  3I7J A;  3JVV A;  3WS4 A;  1Z09 A;  3B42 A;  5CRF A;  4Y5F A;  1N9L A;  2ZD8 A;  3HCY A;  1LI9 A;  1IOU A;  4DRT A;  4R0Q A;  3KYE A;  5CHM A;  1CF0 A;  3A3I A;  1MC0 A;  1OTA A;  2XQZ A;  4QD4 A;  1XFN A;  3IS2 B;  3UDX A;  2V20 A;  4LCL A;  3LGO A;  3ZDJ A;  1GHI A;  4I3A A;  4JF4 A;  3FWL A;  1GCE A;  3B47 A;  1MWU A;  3BFF A;  3LR5 A;  4HNB A;  2ZC4 B;  2J8Y A;  1DP9 A;  3E2L A;  3ZQ5 A;  2B5R A;  2H10 A;  4R3B A;  5HL1 A;  1PWC A;  4S2K A;  2V2F F;  2ZQ9 A;  5AVE A;  4XUZ A;  4X69 A;  3BQA A;  3H7W A;  4JKT A;  3OLO A;  5DTS A;  3UB8 A;  3TJZ C;  3V3R A;  4HJ4 A;  2HF6 A;  2QJ7 A;  4OON A;  4MNR A;  4U0T A;  2J7V A;  4A5R A;  3KSF A;  4EU0 A;  1K56 D;  2EX9 A;  3DBA A;  4WMC A;  2EX6 A;  1SKF A;  3RJU A;  3DTK A;  1ZHH B;  1M6K A;  2R78 A;  4R4R A;  1PW1 A;  4LGW A;  4LRX C;  1G68 A;  3T4T A;  4Y0U A;  3BFE A;  1YLP A;  2PU2 A;  5FA7 A;  5EOO A;  1D1J A;  4OPR A;  4CPK A;  1OT6 A;  3F1P A;  4L9F A;  5M19 A;  1X0O A;  3MXS A;  1ERM A;  2O9A A;  4B9O A;  1V9Z A;  1G28 A;  3UDI A;  1N9N A;  3LIF A;  4E3I A;  3F1N A;  2ACG A;  5FAO A;  4IUK A;  5HD5 A;  4QB8 A;  3Q7V B;  2PU4 A;  4IHQ A;  5HFO A;  4HH2 A;  5FDS A;  3NIA A;  3TE8 A;  4OVD A;  3GQZ A;  2DCF A;  4QHC A;  4NG2 A;  4GS9 A;  3OBF A;  5HAI A;  3N8L A;  3PHY A;  5F1G A;  2JCH A;  2JKF A;  3H82 A;  3UO9 A;  5CED A;  3BWL A;  3NCK A;  5E43 A;  5HAR A;  1C3B A;  3IF6 B;  4ZBE A;  1YSQ A;  3E4O A;  4BQM A;  3T4J A;  1KGE A;  4JF5 A;  3LR4 A;  4DF6 A;  3M6H A;  2EA9 A;  3WS5 A;  4L9E A;  1ONG A;  4CJN A;  3BM6 A;  5F82 A;  4ZDX A;  3Q07 A;  5E2H A;  4GHI A;  2ZLY A;  3BLS A;  3DTE A;  2K7S A;  3RFB A;  1ERQ A;  5KSC A;  5HSQ A;  2WKI A;  3F1O A;  4WF0 A;  4E6X A;  3ZHH A;  2EFU A;  4Z1W A;  2M7V A;  1L2S A;  5KIZ A;  2ZMF A;  2Y2Q A;  2VK3 A;  5AQ7 A;  4Q0H A;  1OME A;  3BFG A;  1S66 L;  1CI8 A;  5L10 A;  4I3J A;  1TDL A;  1ERO A;  5E2E A;  2Q9M A;  1PZO A;  4BEN A;  2QYB A;  4QWO A;  4U0X A;  4OLG A;  3NJA A;  3GDI A;  2VV8 A;  5DFX A;  1FCO A;  5FSR A;  3T1Q B;  1JWV A;  4EQ1 A;  2BG1 A;  1I2W A;  1XKZ A;  5TBM B;  1KGG A;  4WZ4 A;  3MKF A;  1WA9 A;  5F6A A;  2PYR A;  4N92 A;  3HLE A;  3DTM A;  4FD8 A;  2HDQ A;  2VJW A;  2PD8 A;  3G35 A;  2X01 A;  3Q81 A;  4KZ9 A;  4H6J B;  5G18 A;  1SCW A;  1YAX A;  3BY9 A;  3T50 A;  3G2Y A;  5FQJ A;  1TVF A;  2HDR A;  3IWO A;  4LV1 A;  1E3U A;  3SOI A;  2J9O A;  4Y7P A;  4GJ4 A;  4UA7 A;  1JNU A;  1BLC A;  2ZC7 A;  2JBF A;  4E3M A;  2C6W B;  3MFD A;  4MBK A;  3HLB A;  4I38 A;  4EER A;  2RCX A;  3M2J A;  4FTX A;  3MFX A;  2PR6 A;  2EX2 A;  4S2P A;  5GHZ A;  3KYQ A;  2A24 B;  3E4P A;  1XA1 A;  4IUH A;  3ZFZ A;  2VEA A;  1NRF A;  2ZJ9 A;  4FH2 A;  1GSV A;  1BUE A;  2UWX A;  2HP6 A;  2OV5 A;  1K56 A;  3CLO A;  4DJ3 A;  1SDE A;  2VZW A;  5AJG A;  2FZ0 A;  3OOV A;  1KGF A;  1MY8 A;  4IVI A;  1ODV A;  5F1F A;  4N1X A;  1K57 C;  3A3F A;  3C7U A;  2H5S A;  1UGU A;  3C8C A;  1E25 A;  3Q7V A;  3UE6 A;  3E98 A;  4NKP A;  3HBR A;  2J3T D;  4C6Y A;  3IX8 A;  1BYW A;  4KQO A;  3O87 A;  2V8C A;  1H5X A;  3T4Q A;  5KZH A;  1ES3 A;  3IF6 A;  5DTK A;  5CTM A;  1MXO A;  3CUE C;  1GHM A;  4PM9 A;  1MBL A;  2XD5 A;  3G4P A;  3UE3 A;  3T4O A;  1BLS A;  3G2Z A;  1YLZ A;  4OPQ A;  4BBV A;  3BYD A;  4LPZ A;  3LR3 A;  1NLZ A;  3PYP A;  1NWZ A;  4WM9 A;  1HD8 A;  2W3H A;  2PBD P;  3FPW A;  3UB6 A;  4IBX A;  3N8R A;  1LLB A;  2OLV A;  3SW1 A;  2YKH A;  3QP5 A;  3QNB A;  3PXP A;  4GW9 A;  4EEU A;  4LLO B;  2VGL S;  1F2K A;  4HP4 A;  4JXG A;  4KQR A;  3RXW A;  3CI6 A;  4NEE D;  4I39 A;  2C5W B;  4GOG A;  4OOM A;  5FI6 A;  3FV7 A;  3IX4 A;  3QP1 A;  1L3L A;  5TBM A;  3T1R A;  2Y2L A;  3CMZ A;  3ITB A;  4BL3 A;  4F94 A;  1W79 A;  1ZKJ A;  2J3T C;  3IWI A;  4Q8I A;  3EWK A;  2JKT M;  5CER A;  1FR6 A;  1O07 A;  3WRZ A;  5LBR A;  4ESP A;  2XK1 A;  4OP5 A;  3K3C A;  3BRM A;  3LY3 A;  3PAE A;  4H6J A;  4E3N A;  3IXH A;  3WS0 A;  5HZH A;  2OAP 1;  2P74 A;  3VFF A;  1KVL A;  3C38 A;  4P6B A;  2XEP A;  4OQ0 A;  2Y2O A;  3OCL A;  3TG9 A;  4WZ5 C;  1PWG A;  5FEG A;  1AWI A;  3VP3 A;  3IHA A;  5AQA A;  3TW8 A;  4E3L A;  2VGK A;  4FOF A;  4P85 A;  4WBG A;  3KSH A;  2XA7 M;  3IX3 A;  4P6Z S;  3DWK A;  4JLF A;  4E6W A;  4EEP A; 
#chains in the Genus database with same CATH homology
 4HJ4 A;  2HF6 A;  2QJ7 A;  5K5B A;  2Z6D A;  3V67 A;  3VOL A;  2O9C A;  3EGX C;  4ETZ A;  1S4R A;  2O0Y A;  2JN7 A;  1YKD A;  3EOI A;  1H3Q A;  3KSF A;  4EU0 A;  3HJK A;  3MJQ A;  1W63 Q;  3KSG A;  3DBA A;  2INW A;  2VA0 A;  5FL3 A;  2P7J A;  4Q0J A;  1NRJ A;  1ZHH B;  2R78 A;  3PBQ A;  4LRX C;  4L9G A;  4MN6 A;  4KUK A;  3T4T A;  1MZU A;  2PT7 A;  3LFV A;  2CMN A;  1OJG A;  4CLC C;  2XRO A;  3MMH A;  4P6Z M;  3K2N A;  3PR6 A;  2B18 A;  5IT5 A;  4HJ3 A;  4WN5 A;  2OWH A;  4EW7 A;  1S1Z A;  4UQI M;  5CX7 A;  5HDC A;  2PR5 A;  1NLY A;  3IBJ A;  4CQH A;  1OT6 A;  2JKR I;  4ARZ B;  1OTE A;  4KUO A;  2W1R A;  2L0W A;  3F1P A;  4L9F A;  4HY8 A;  2BAS A;  2OOL A;  4F3L A;  1X0O A;  1P0Z A;  3HJI A;  2O9A A;  2EWW A;  2D01 A;  3R7W A;  4HQA A;  4B9O A;  1V9Z A;  3T4K A;  1G28 A;  4EXO A;  1N9N A;  1LSX A;  3LIF A;  4HJ6 A;  2V1A A;  2DMW A;  2GJ3 A;  1XJ6 A;  1TS6 A;  4Q0I A;  3F1N A;  2G7U A;  2HJ9 C;  3PBN A;  3S7P A;  2W3F A;  3MR0 A;  4IUK A;  5HD5 A;  1KOU A;  4PKY A;  3BY8 A;  1XJ2 A;  3E0Y A;  4MN7 A;  4IHQ A;  4WLA A;  3TRC A;  4JGR A;  4HH2 A;  3LIC A;  2GX5 A;  4MN5 A;  4HH3 A;  4DN0 A;  3TE8 A;  4YNR A;  4PKY G;  4GS9 A;  3OBF A;  4Y3I A;  4WUJ A;  5A8B A;  1EW0 A;  2W3D A;  1OTI A;  3LI8 A;  5DJT A;  3PHY A;  5F69 A;  4BBU A;  3FC7 A;  3OCN A;  3A0S A;  5G4Y A;  1F9I A;  4XT2 B;  3H82 A;  2D02 A;  3PBR A;  3BWL A;  1S67 L;  5HWT A;  4UEY A;  2M7U A;  2I9V A;  2ZOI A;  1YSQ A;  3E4O A;  3VE3 A;  5IU1 A;  3LID A;  3T4J A;  3UB7 A;  4WL9 A;  2K31 A;  2KOI A;  2GNX A;  2ZOH A;  3LR4 A;  4IJG A;  5J4E A;  4LRZ E;  2ZMV A;  3LUQ A;  2A24 A;  2EA9 A;  4L9E A;  2FH5 A;  2QHK A;  4PAU A;  5DJU A;  4AFI A;  2J80 A;  2ZBB A;  3CUE A;  4WEJ A;  4GHI A;  2NUP C;  3PBS A;  2P04 A;  2K7S A;  3NOT C;  3RFB A;  3CWF A;  4JGO A;  4R38 A;  5DKL A;  5I5L A;  5HSQ A;  1LSW A;  1S4S A;  2XSS A;  1GSW A;  3PBT A;  3F1O A;  3CAX A;  4WF0 A;  5HDD A;  4FSF A;  2OWJ A;  4Z1W A;  3UMD A;  2L1M A;  3W2Z A;  4HP9 A;  2YKF A;  5HD3 A;  5DF9 A;  3D72 A;  2M7V A;  3IBR A;  5KIZ A;  5IS1 A;  2ZMF A;  1T1A A;  1ZTU A;  1P9W A;  2W27 A;  3ICY A;  4Q0H A;  2PDR A;  3BQ8 A;  2KLI A;  3CIT A;  4DMZ A;  3P01 A;  1H8M A;  1S66 L;  1F5M A;  3KX0 X;  1STZ A;  3S7Q A;  4I3J A;  4WEK A;  3ULF A;  5HDS A;  1G6O A;  3MF0 A;  3VE4 A;  2QYB A;  3F1P B;  3NJA A;  4F3L B;  3GDI A;  2P08 A;  2VV8 A;  5DFX A;  4YOF A;  4JGQ A;  3EEA A;  4EQ1 A;  5MC7 A;  3R7W B;  1OPX A;  4NXF A;  5TBM B;  4QPR A;  2HJE A;  2Z6C A;  5C5K A;  3T4S A;  1WA9 A;  5F6A A;  3F1N B;  1IFQ A;  1OTB A;  2PYR A;  4GLQ A;  4NXE A;  1V9Y A;  3JVU A;  2W1T B;  2VJW A;  1DP6 A;  4PHT A;  2PD8 A;  3C2W A;  3D3O A;  4MMN A;  2GZA A;  4H6J B;  3RH8 B;  1YAX A;  3BY9 A;  3T50 A;  4GS9 B;  1XFQ A;  3VV4 A;  1F98 A;  1P9R A;  4K08 A;  2VX8 A;  2JKR M;  4MDZ A;  2IA2 A;  2QKP A;  3U2A A;  4ZRR A;  3MQO A;  3T4L A;  5TJJ A;  3LIB A;  1YSP A;  4GJ4 A;  4OOL A;  1JNU A;  1UWP X;  3BW6 A;  3FPV A;  3UME A;  2NUT C;  2WKR A;  4I5S A;  5EFW A;  1S1Y A;  4I38 A;  4EER A;  3MFX A;  2PR6 A;  3RTY A;  3C30 A;  4DJ2 A;  3KYQ A;  2A24 B;  3E4P A;  4IUH A;  2VEA A;  4ARZ A;  4GHI B;  1VHM A;  3H7W B;  4B93 A;  4M4X A;  3NOP C;  1GSV A;  2KDK A;  2WKP A;  4JGP A;  5HPF A;  3KSI A;  3FG8 A;  3CLO A;  3LI9 A;  4DJ3 A;  1GSX A;  3B33 A;  2XA7 S;  2VZW A;  1D7E A;  2FZ0 A;  2J3W A;  3NOU C;  3OOV A;  3PBO A;  5AJG A;  2Y8H A;  3F1O B;  1UWN X;  3LIE A;  4G3V A;  4O8G A;  1XJ4 A;  1ODV A;  3ZYT A;  3EQU A;  1UGU A;  1N9O A;  3EQV A;  2W0N A;  3C8C A;  3LIA A;  4Y2F A;  3LR0 A;  1XJ3 A;  4NXG A;  3UE6 A;  2V1B A;  3E98 A;  4NKP A;  4EEP A;  3A0R A;  4O0P A;  2J3T D;  2H28 A;  2XRN A;  1BYW A;  2MJ6 A;  3KO6 A;  4KQO A;  4EUV A;  3O5Y A;  4EET B;  2QJ5 A;  3IS2 A;  1MKM A;  2Y79 A;  1DRM A;  4XT2 A;  3T4Q A;  4BWI A;  4RQ9 A;  3S7N A;  3LYX A;  3MQ0 A;  4WEL A;  5HWW A;  1OJ5 A;  2V0W A;  3BJN A;  3CUE C;  1T18 A;  1TD5 A;  2K2N A;  3H9W A;  4ETX A;  4UQI S;  3UE3 A;  3R4K A;  3T4O A;  4CLC A;  4EES A;  5DFY A;  4CLC E;  2VKS A;  4BBV A;  2HGV A;  2QWS A;  4O01 A;  4LPZ A;  3LR3 A;  1NLZ A;  3PYP A;  1OT9 A;  2O99 A;  1DP8 A;  1NWZ A;  3MQQ A;  2VLG A;  2A2L A;  3P7N A;  4II7 A;  2W3H A;  2KX6 A;  3FPW A;  2LB5 A;  3A0V A;  3UB6 A;  4R3A A;  3SW1 A;  2YKH A;  4HIA A;  2V9A A;  3MXQ A;  4E04 A;  1LT0 A;  3PXP A;  2W3E A;  4GW9 A;  4EEU A;  4LLO B;  2B02 A;  3S7O A;  2VGL S;  4HHD A;  1Y28 A;  1T1C A;  5HL6 A;  5L8M A;  2VV6 A;  5HPI A;  4HP4 A;  4ME4 A;  2O9B A;  3CI6 A;  4NEE D;  3OC2 A;  1LL8 A;  4I39 A;  3H82 B;  4OOM A;  1OTD A;  2JHE A;  4HOI A;  1W63 M;  5J7E A;  5F5Y A;  4KQD A;  4BJP A;  2HV1 A;  2EWV A;  2M1C A;  2JKT I;  3GEC A;  4YWZ A;  5HWV A;  2PD7 A;  3JVV A;  4BBT A;  5TBM A;  1VB6 A;  2PYP A;  5DKK A;  3UB9 A;  2PHY A;  3EEH A;  3B42 A;  1LSV A;  4L0L A;  2J3T C;  4Y5F A;  4BMW A;  1N9L A;  1T19 A;  2JKT M;  3EWK A;  4CLC D;  2VGL M;  2W1T A;  3HCY A;  5LBR A;  2W3G A;  4G3K A;  1IOU A;  3K3C A;  4H6J A;  3KYZ A;  1MC0 A;  1OTA A;  1TS8 A;  4HI4 A;  1XFN A;  2V0U A;  2WKQ A;  3IS2 B;  2L4R A;  5HZH A;  5J3W A;  1P97 A;  4G3W A;  3G6O A;  5KSH A;  2OAP 1;  2VV7 A;  4I3A A;  2LB9 A;  3C38 A;  4NXB A;  1TF1 A;  1T1B A;  1TS7 A;  3OCL A;  3K3D A;  3B47 A;  3LR5 A;  2OAQ 1;  1TS0 A;  4HNB A;  4CLC B;  4LRY C;  4R6L A;  3NHQ A;  3EGD C;  1DP9 A;  4GCZ A;  3TW8 A;  4R70 A;  3ZQ5 A;  4FOF A;  5AVF A;  5F68 A;  5G4Z A;  5AVE A;  3KSH A;  2XA7 M;  4I3I A;  3BQA A;  3H7W A;  3OLO A;  3UB8 A;  1D06 A;  3E4Q A;  4P6Z S;  3TJZ C;  4MCW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...