4HH3A

Structure of the appa-ppsr2 core complex from rb. sphaeroides
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
251
structure length
251
Chain Sequence
LPSLAPDLVRDLIATAADISLLVSQEGVVREVMANPHHPSFGQLSEWEGRPLEEVLTAESVAKFRLRSEGLEPGRGSVAVELNHIDPRSFEFPIRYILHRLPADRSILMLGRDLRPIAEVQQQLVAAQLAMERDYETQREMETRYRVVLDVSRDPMVLVSMSTGRIVDLNSAAGLLLGGVRQDLLGAAIAQEFEGRRRGEFMETMTNLAATESAAPVEVLARRSQKRLLVVPRVFRAAGERLLLCQIDPAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator, PpsR
publication title A ternary AppA-PpsR-DNA complex mediates light regulation of photosynthesis-related gene expression.
pubmed doi rcsb
source organism Rhodobacter sphaeroides
molecule tags Flavoprotein/transcription
total genus 82
structure length 251
sequence length 251
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13188 PAS_8 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4hh3A02
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4hh3A01
3BY9A 3KX0X 2PR5A 3FC7A 3H9WA 3E4PA 1TS0A 5DKLA 2M1CA 2JHEA 3NOPC 5F69A 4I3IA 1KOUA 3RH8B 1DP8A 3UB7A 4NXFA 5DJTA 1XFQA 1UWPX 4I39A 4GW9A 3E4OA 4I38A 1T1CA 3MQOA 2V1BA 2PHYA 2QWSA 4H6JB 5G4YA 4HOIA 4I3JA 3T50A 2QKPA 1P97A 3K3DA 2K7SA 4MN5A 1EW0A 2L4RA 1Y28A 1OJGA 3NOUC 2VV7A 1GSXA 4JGRA 1LSVA 1OTIA 3RTYA 4WF0A 2H28A 4I5SA 3C2WA 4KUOA 5F6AA 3H82B 1D7EA 4HH3A 3PYPA 1OTAA 1X0OA 3ULFA 5A8BA 2D02A 2ZOHA 3UB6A 5G4ZA 3IS2A 1TS8A 2OOLA 1LSXA 4HJ4A 5I5LA 1XJ4A 3C8CA 3LUQA 2GJ3A 1DP9A 3VE3A 2QJ5A 3SW1A 4GS9B 4L9EA 1F9IA 3H7WA 4WN5A 2OWHA 4EXOA 3A0RA 1T1BA 3F1NB 1OTDA 3UB9A 4HP4A 5HDSA 4E04A 2I9VA 2W0NA 1TS7A 4LRXC 4JGQA 3LIBA 1DRMA 4EETB 1DP6A 5TBMA 2B02A 4HNBA 4BBUA 2INWA 3VE4A 4KQDA 4B9OA 5J4EA 3G6OA 4LRYC 3LI8A 3LIEA 5HZHA 4DJ3A 1S1YA 3BWLA 3BY8A 4EQ1A 2V0WA 1NWZA 1N9OA 1BYWA 1N9NA 3P7NA 1T1AA 2PR6A 3A0SA 1XJ2A 1P0ZA 5HDCA 2QJ7A 4GHIA 4WLAA 1V9YA 4MN6A 1D06A 1S66L 2EA9A 5HWVA 4XT2A 3OLOA 4YWZA 1OT9A 1TS6A 1OJ5A 3IBRA 1OTEA 1VB6A 1S4RA 1N9LA 2ZOIA 4L9FA 4WUJA 2OWJA 3F1PA 1F98A 2D01A 1ODVA 2VV8A 3MXQA 4HHDA 2V1AA 3B33A 2WKRA 5DKKA 2HV1A 4LPZA 4LRZE 2Z6CA 3LIDA 2QHKA 3E4QA 4NXBA 1GSVA 1GSWA 4GCZA 3F1OA 4R70A 4R3AA 3LIAA 2J80A 2CMNA 4R6LA 3PHYA 2V0UA 4F3LA 2PD8A 1S1ZA 3IS2B 2PYRA 4JGPA 5KIZA 2YKFA 4L9GA 5J7EA 4HJ6A 5DJUA 2A24A 3NOTC 4EESA 3F1NA 2YKHA 1LT0A 1T18A 5HDDA 3MR0A 3NJAA 2R78A 4HI4A 3EWKA 1LSWA 4BBVA 5EFWA 2V9AA 4HIAA 3GECA 3H7WB 4EW7A 4M4XA 4HQAA 5J3WA 3UB8A 3D72A 2VLGA 1V9ZA 1WA9A 3GDIA 4EERA 1G28A 3CAXA 1S4SA 1JNUA 4RQ9A 4H6JA 3ICYA 5TBMB 2PYPA 1LL8A 5HSQA 3MQQA 3MFXA 2W27A 3CLOA 5IS1A 4NXEA 4NXGA 2ZBBA 1OTBA 5AVFA 2L1MA 3LI9A 2WKPA 1XJ3A 3K3CA 1XFNA 4I3AA 1S67L 3H82A 3HJKA 2VV6A 2Z6DA 5F68A 2BASA 2PDRA 3EEHA 4HY8A 4GHIB 3LICA 2PD7A 2VEAA 3LYXA 2WKQA 5HWWA 3MJQA 4HH2A 1XJ6A 4XT2B 3CWFA 1OT6A 1UGUA 1MZUA 3ZQ5A 4HP9A 5HWTA 5HD5A 3UMEA 3F1PB 4DJ2A 2KDKA 4KUKA 5F5YA 2P7JA 4LLOB 4EEPA 5HD3A 3HJIA 4GS9A 2JN7A 3LIFA 1UWNX 2KX6A 4EEUA 4R38A 3UE6A 4WL9A 3NHQA 3F1OB 3A0VA 5IU1A 5AVEA 2L0WA 4F3LB 1T19A 4BBTA 4PKYG 4PKYA 3UMDA 4JGOA 4HJ3A 4K08A 2A24B 3VOLA 3FG8A
chains in the Genus database with same CATH superfamily
1BSGA 3O3VA 2P9VB 2QMIA 3NI9A 2XD1A 1YMXA 2M1CA 3MZEA 5F69A 3ITAA 3TE8A 3LR4A 2OLUA 1DP8A 1XFQA 4NG2A 4B4XA 3JYIA 2EX6A 3E4OA 4KZ9A 1ZKJA 5EOEA 1ALQA 3UDXA 4O01A 3HLWA 3T4KA 5I94A 3L9KA 1XP4A 5FL3A 1CEGA 1H8MA 3IXDA 4HOIA 3CUEA 1P97A 2ZL1A 4Y5FA 2L4RA 5E2EA 1W63M 3EQVA 3VSLA 4CLCA 1GHIA 1G6AA 4P85A 4JGRA 1LSVA 4FTXA 3WS0A 1IYSA 3MKEA 1OTIA 3TG9A 2EWWA 2H28A 1RGYA 3H82B 5A90A 5TGFA 5HPFA 3VP2A 1OTAA 5EOOA 2Z2LB 3UE3A 1X0OA 4N92A 4XXRA 3PTEA 4PM7A 3ULFA 3MMHA 1ZHHB 2ZOHA 4EV4A 3MXRA 4U0XA 1SKOA 3A3EA 3OCNA 3UB6A 1HVBA 5G4ZA 3D9YA 2WKIA 1TS8A 4EUVA 5EVLA 1M40A 2OOLA 4XUXA 4Y13A 5DF9A 1TEMA 4O7DA 4O8GA 1XJ4A 4DN0A 2O99A 3Q7ZA 3N7WA 1K6RA 5CHJA 3LO7A 3CHWP 1ES3A 3VE3A 4R3JA 3HVFA 3H7WA 1CQAA 1ONHA 2WAFA 3DTMA 1K57C 3UY6A 1KE3A 3AGFA 4JXWA 3GSGA 2PBDP 2XQZA 5HX9A 5HDSA 2XRNA 1E3UA 3QP1A 4JGQA 3MBZA 1BTLA 4OONA 3NDGA 2H10A 1L0FA 2B5RA 1XXMA 3LEZA 5AQBA 5FA7A 4PM8A 2HJ9C 4B9OA 2V1ZA 2V20A 4MCWA 3LIEA 3A3DA 4D2OA 3VMAA 1WYCA 3DWZA 1S1YA 3GRJA 3Q07A 1G6OA 5FQIA 5KZHA 1BYWA 2A49A 1N9NA 3I7JA 2PR6A 3FPWA 5GLBA 1P0ZA 5A93A 2XROA 1BT5A 4S2LA 4EWFA 2IWDA 2FFYA 4MN6A 1S66L 3T1XA 2VK3A 1KVMA 3P01A 5K5BA 1EI5A 2Z2MB 1OJ5A 1OTEA 1VB6A 3IQAA 2WZXA 1PNEA 3TSGA 1N9LA 4L9FA 4X55A 3IWQA 5FQMA 3MXQA 5TFQA 1NXYA 5DKKA 2Y2LA 2H0TA 3M6HA 1KDWA 1ERQA 5E43A 4LRZE 2Z6CA 4MBFA 3EGDC 2ZQ7A 2O9CA 1H5XA 4NXBA 4RVAA 4GCZA 1RGZA 2XF3A 3FYZA 4LV3A 2CMNA 2UWXA 2J9OA 1K55C 3C5AA 4KG6A 3G31A 4DE3A 4F94A 3IS2B 4JGPA 4UAAA 5KIZA 4FSFA 1W7FA 4L9GA 2W1TB 4C6YA 4EESA 4X1MA 2EX2A 4CQHA 1LT0A 4LV2A 4QJGA 1YSQA 3MQ0A 2Y59A 1ZTUA 4ID4A 2FZ0A 3EWKA 3OCLA 1YLZA 4BBVA 4HIAA 1Z09A 4GDBA 2WGWA 3GECA 4ESPA 5FASA 5J3WA 3PBSA 5HL1A 1W63Q 3UB8A 3C4OA 4HESA 4E3OA 2VLGA 1V9ZA 1WA9A 4BQMA 2J3TD 4UA9A 4UA7A 3IF6C 2JKTI 3W2ZA 2HDRA 4DE0A 3PR6A 1SDEA 4E3LA 2PYPA 3Q7VB 3DWKA 3MQQA 5CGXA 5IS1A 2HP5A 1K6SA 5FQQA 2AVXA 3ZG5A 4NEED 3ZHHA 3BFGA 2VJWA 4I3AA 1PW1A 3TJZC 3UDIA 4K0XA 3HJKA 3UNWA 1L0DA 2Y79A 2PDRA 3EEHA 4OVDA 1U60A 4CLCE 3FPVA 1JWVA 3UPOA 5L8MA 4KG2A 1MKIA 1DJBA 2NUTC 3BM6A 1ZC2A 3MJQA 1KGFA 4N1HA 3T4OA 4Z1WA 4JXSA 4HP9A 3BFFA 1N9BA 4ARZA 4GD8A 3AGEA 1K56D 4KUKA 5CEDA 5F5YA 2P7JA 3IXHA 1LL5A 5HD3A 2EWVA 2JN7A 2Y2IA 3OPLA 4C75A 3BYDA 3IWIA 5AQAA 4EEUA 3V50A 5CTMA 3CITA 3C7UA 3E2KA 4X56A 4QHCA 3A0VA 5EUAA 5IU1A 2EFUA 2M7UA 1NRJA 5FI7A 3IBJA 1FOFA 4PKYA 5DTSA 4IHQA 3G34A 4ZJ3A 2W3GA 4K08A 4Y0UA 2Y2NA 2A24B 1YMSA 1P9RA 3ISGA 5G18A 3FC7A 4ZJ2A 3E4PA 2VGKA 4GKUA 4Q0JA 1G68A 5FAQA 4QY6A 5DKLA 3BLSA 2JC7A 1K56A 2JHEA 4G3WA 4I3IA 1K54A 3NIAA 1KOUA 3VP3A 4N1XA 5EM1A 1VETB 3RH8B 1ERMA 3FKVA 4I39A 2VGLM 4GW9A 3HLCA 4NKPA 1T1CA 3GQZA 3DBAA 2QWSA 1YAXA 1XGJA 1PI5A 4H6JB 5FATA 4Q8IA 3SH8A 2J3TC 3S7PA 4I3JA 4OPRA 3R7WB 2HP9A 2HF6A 3ZG8B 1Y28A 3MXSA 3P98A 1OJGA 2VGLS 2VV7A 4OOYA 4ZRRA 3PBRA 2J3WA 4WF0A 5L2FA 1L3LA 3C2WA 3OZHA 3PYPA 4B88A 2WZZA 2JBFA 2D02A 4DXCA 4S2IA 3W4QA 1YLYA 3GMWA 3FWLA 4IVIA 4UQIM 2B95A 1KVLA 4HBTA 4WZ5C 4WZ4A 5I5LA 2ZD8A 4ZDXA 1K38A 2BLSA 4LV1A 4ZTKA 3C8CA 3LUQA 2Q0OA 1BZAA 3DTKA 5FQKA 5EE8A 4GS9B 4L9EA 2JCHA 5DTTA 4UQIS 4WN5A 2OWHA 4EXOA 2K2NA 3PBNA 5EECA 4CLCD 1OTDA 2ACGA 1I2WA 5EV0A 3G2ZA 4E04A 3WRZA 2W0NA 5MC7A 4Q0HA 3LIBA 1DRMA 4MBHA 2B02A 4PPRA 2W3FA 4ZAMA 4OLGA 4E6XA 4KQDA 3QP5A 3ZGAB 1FILA 3LI8A 3IX3A 1W8QA 2Y2KA 5FI6A 4DJ3A 4FOFA 3W4OA 3HLGA 4EQ1A 4JKTA 2V0WA 4LGWA 5CGSA 5C5KA 1T1AA 5FEGA 3BFDA 1FCNA 3G35A 1XGIA 3WS1A 1ZG6A 5HDCA 2QJ7A 3W8KA 5A92A 2ZMAA 4GHIA 3CJMA 1FSWA 4WLAA 2PRFA 3CPTA 3KO6A 1D06A 2WKHA 5HWVA 4XT2A 1IFQA 3OLOA 4YWZA 5HW3A 1TS6A 2VGJA 2XFSA 3IWOA 4QB8A 2GX5A 2ZL1B 5F1GA 2ZOIA 1JWZA 3F1PA 4CLCB 1F98A 1GCEA 1E3UD 4ZBEA 2WUQA 4X69A 2VV8A 4HHDA 4Y7PA 1M6KA 4LCLA 3B33A 3ZFZA 3K2NA 4JLFA 4LPZA 3IH8A 4KZ7A 4GNUA 2DNSA 3ZNTA 3E4QA 1SCWA 1MWUA 1LHYA 4OPQA 3LIAA 1EROA 4PM9A 4JXVA 1SKOB 3SH7A 2IWBA 2V0UA 4E3MA 2PD8A 1S1ZA 2HJEA 2X71A 4DE2A 4QD4A 2W3DA 5M18A 4IBRA 1KGEA 4HJ6A 5DJUA 3FV7A 3B42A 3NOTC 4JF4A 1Q2PA 3LY4A 3N6IA 5L07A 2WADA 2YKHA 1CF0A 3TRCA 5EVIA 5HAPA 4KQOA 4EBPA 3OBFA 3Q82A 4R4SA 1STZA 4GLQA 4S2OA 1J9MA 3O86A 1LSWA 3RXXA 3H7WB 4EW7A 1TD5A 1YLWA 3OPRA 1K0KA 4E3KA 3CUEC 3D72A 4H8RA 5M19A 1YQSA 3GDIA 3DTEA 4Q0IA 4CLCC 4EERA 1G28A 1JNUA 1FIKA 4BD0A 5EM0A 4RA7A 3S7OA 1LL8A 3UN7A 5HSQA 4K91A 3T4JA 5IT5A 4CJNA 1BLHA 2VKSA 4NXGA 1RCJA 3VOZA 2L1MA 5EVEA 5J8XA 1PW8A 2WKEA 1XJ3A 3K3CA 4PMAA 4OQGA 2XA7M 4KENB 1PRQA 1LLBA 4Y2FA 1YPRA 3TW8A 2VV6A 5F68A 1Y54A 5CRFA 1ESIA 4FH4A 5KMWA 1WYBA 2QYBA 2E8JA 1RP5A 3IF6B 3UPNA 2PD7A 3V39A 4UEYA 2W3EA 1OT6A 3G2YA 1PWGA 4FD8A 2XA7S 3N8SA 3T1QB 4JXGA 3IHBA 5HWTA 2BG1A 2J7VA 3UMEA 2ZQDA 3CZDA 4LLOB 3VSKA 4R1GA 4LFUA 1LL9A 3KSFA 1XA7A 4GD6A 4QPRA 3UE6A 3VP1A 4WL9A 4X1LA 1QMFA 1LI9A 3Q81A 4KZ8A 2P08A 2DRWA 5DVAA 3T12B 3GVBA 1Y4OA 3CG5A 4ME4A 4N9KA 4HBUA 2Y2JA 3PAGA 4JGOA 4HJ3A 4LCMA 3OPPA 3QP4A 3VOLA 3BECA 5JYOA 3BY9A 2G7UA 1PWDA 3KX0X 3SZTA 2G2WA 3NULA 2JKFA 1PZOA 3SOIA 3NC8A 1MWRA 1TS0A 2E8IA 1FR6A 3MFDA 4MMNA 3NOPC 4KQRA 1XPBA 3KYZA 1ONGA 4R23A 4MDZA 4MEZA 3D4FA 3Q7VA 4S2NA 1XX2A 2Q9NA 3V67A 2BTFP 4DE1A 4NXFA 2WGWB 5DJTA 2XGNA 4OPYA 5E2HA 5HARA 3U2AA 4Y0OA 4IEDA 5GHYA 4OQIA 3MQOA 4YINA 2V1BA 3IX4A 2PHYA 1CJFA 2ZC7A 5FI2A 1MC0A 4KZ5A 5G4YA 1NYYA 2QKPA 2K7SA 4N9LA 3QNCA 3VP0A 1YM1A 3G30A 4Y15A 3NECA 1HD8A 1GSXA 5DF7A 2A3UA 4MBKA 1F5MA 5A91A 1ZG4A 4MLLA 2O9AA 3MSHA 1ES2A 3MKFA 3PBOA 4KUOA 2KOIA 4MNRA 5CGWA 1FCMA 2O0YA 3ZYTA 3UB5P 3UO9A 1PWCA 1O07A 1L2SA 2Y2PA 5L10A 1FQGA 5E2GA 1VEUA 1K4FA 2O9BA 1AXBA 4Y3IA 4WELA 5D3OA 3IF5A 3KYQA 3L7HA 4ARZB 1NLYA 3SH9A 1DP9A 2WGVA 1NLZA 3EGXC 3KSIA 3UDFA 3SW1A 1H3QA 1JWPA 4OQ0A 3BQ8A 2HDUA 1PZPA 3F1NB 3UB9A 4HP4A 4S2MA 2I9VA 1TS7A 5HAQA 4EETB 5TBMA 1IYPA 2HGVA 3KYEA 4HNBA 4A5RA 3T1RA 4IVKA 4R3BA 3JPUA 3ZG9B 3SS5A 5J4EA 3G6OA 1YSPA 5HZHA 2XDMA 3BWLA 3BY8A 3MZFA 3EEAA 5DTKA 2JE5A 3S1YA 1N9OA 1P9WA 3N8LA 2XD5A 3KSGA 3FKWA 5GHXA 2OV5A 1J3WA 2HPBA 4UHUA 3A0SA 4X25A 5FAPA 1GA0A 1ES4A 5FQ9A 3ZVWA 2GDNA 4QU3A 4FH2A 3DTIA 1DJAA 3T1SA 2X02A 1NRFA 1VHMA 1V9YA 4K0WA 1XA1A 2EA9A 3VFFA 3HREA 1W79A 2X01A 4GJ4A 3W4PA 2ZM2A 1S4RA 2XSSA 5FQJA 3OC2A 4WUJA 3DAVA 2OWJA 4BENA 2D01A 1VQQA 3V3RA 4B4ZA 5FDSA 4LV0A 4Y17A 1IEMA 2HV1A 3B3XA 3ZG7B 2JKGA 2ZMVA 2OLVA 3LIDA 1I2SA 5HL6A 3M2JA 1GSVA 1GSWA 1TF1A 3F1OA 4C3QA 4R3AA 3C7VA 3HLFA 2HZ5A 4PAUA 3MS6A 3QP2A 2G2UA 4R6LA 3PHYA 4F3LA 2PYRA 2MJ6A 1N4OA 3IT9A 3A3FA 5E2FA 1BLSA 1K54C 1MBLA 3UE1A 5J7EA 1JVJA 3LCEA 2R9WA 4PM5A 3BQAA 1JTGA 5AQ9A 3LR0A 2VA0A 3BRMA 4KZBA 2P9VA 1T18A 2DMWA 5HDDA 2R78A 3GV9A 2EX9A 4HI4A 3PAEA 4KZAA 2V9AA 3EQUA 3O87A 4M4XA 4WMCA 1CI8A 3E98A 3U4LP 3RXWA 4X68A 5GHZA 4KG5A 1VM1A 3UPPA 1G5UA 3SS4A 2V8CA 4PM6A 3E2LA 1S4SA 4RQ9A 1FSYA 2UV0E 3ICYA 1PIOA 2XK1A 1K57A 4OOLA 4DF6A 5FAOA 3WS2A 1E25A 2W27A 3MFXA 1GHPA 4OP5A 1SKFA 1FCOA 4D60A 1OTBA 1IYOA 3LI9A 2VZWA 1HZOA 1Z6FA 4KZ4A 4Z9QA 1YLTA 3C38A 2PT7A 4BLMA 3H82A 2XR0A 3M2KA 3PXPA 5EVID 3QP8A 4WBGA 3VV4A 2BASA 5BOHA 1MPLA 2Y55A 1YLJA 3D3OA 2H0YA 4GHIB 2W1RA 3ZNYA 4P87A 3LICA 4NETA 3BW6A 3CPTB 1KE4A 1NYMA 1GHMA 2VEAA 2WKQA 1WE4A 4HH2A 5TR7A 5JYPA 3VOYA 4JF6A 3LFVA 4XT2B 1UGUA 3BEBA 1MZUA 3EOIA 4GOGA 3ZQ5A 2XLNA 3PBQA 4PHTA 2XH9A 3T4QA 4OKPA 3F1PB 4DJ2A 5AQ7A 1TDGA 2M7VA 4EEPA 2P04A 1BUEA 3HJIA 1UWNX 2KX6A 2B18A 5CX7A 4DRTA 4R38A 3UE0A 3NHQA 3WS4A 1EWZA 3Q1FA 4FUWA 5GLDA 1SHVA 3MF0A 3N4IA 2OAQ1 1T19A 5U47A 1QMEA 1F2KA 3UMDA 1DJCA 4S2KA 2PAVP 2W3HA 1TVFA 3N8RA 3ZG0A 3FG8A 3G32A 3T4TA 3ZVTA 1K55A 2PR5A 5EVIB 3H9WA 3TOIA 5CEBA 4CPKA 5GL9A 2ZQ9A 3NY4A 3V5MA 5DFXA 4EBLA 5CHMA 1BLPA 5AJGA 3A3IA 3A3JA 3GR2A 1ESUA 1CK3A 5HFOA 3UB7A 3WS5A 2QPNA 1KE0A 1UWPX 4GB7A 4P0MA 4IBXA 5CERA 5IHVA 1SZVA 2DCFA 4I38A 1K25A 4WEJA 1O7EA 5F83A 3LR5A 5FEFA 1FR1A 2XEPA 2XFTA 4P6BA 4DXBA 2FFFB 3T50A 3ITBA 4LENA 3K3DA 4RX3A 4MN5A 1EW0A 4B93A 1IELA 3IHAA 3NOUC 1H0MA 4X6TA 3IF6A 3IXBA 2P74A 2EXBA 2ZMFA 2C5WB 2JKRM 5TJJA 2K31A 2Y91A 4BD1A 4BL3A 3RTYA 4I5SA 4JPMA 2LB9A 5F6AA 1D7EA 4OH0A 4HH3A 3BJNA 3LEQA 5A8BA 2ZLYA 3ZDJA 3WRTA 2Y8HA 2EXAA 5EVIC 1SDNA 1NZUA 3HLDA 1H8YA 2QZ6A 3HUMA 3IS2A 4QY5A 4OLDA 4AFIA 5DFYA 3O5YA 2WGIA 3HCYA 3B47A 1LSXA 4JBFA 2PU2A 2W1TA 4HJ4A 3AGDA 4R0QA 1W5DA 4DKIA 3VFHA 2EX8A 1KDSA 2Y2HA 1TDLA 2GJ3A 4DDYA 1ACFA 4M3KA 5CHUA 2GZAA 2QJ5A 2RL3A 1NY0A 4S2PA 1F9IA 1YLPA 2ZM8A 4OQHA 3A0RA 4DMZA 4WM9A 1T1BA 1IKIA 2OSUA 1S0WA 2Y2QA 4RX2A 4ETZA 4EBNA 3C4PA 4E3JA 4E6WA 4XUZA 2ZQCA 3VP4A 2FH5A 4LRXC 5CTNA 1DP6A 1PFLA 2PBYA 4BBUA 2PU4A 4U3TA 3IX8A 2INWA 4P6ZM 3VE4A 3OPHA 1LI0A 4LRYC 2J8YA 1E4DA 2ZJ9A 2ZQ8A 5CECA 3G4PA 2VX8A 2R9XA 3FZCA 1NWZA 4WYYA 1S6RA 1Q2QA 3P7NA 2V2FF 3T4LA 1BULA 3KSHA 1XJ2A 3LGOA 5HAIA 5EPHA 3QHYA 5KSHA 3O88A 3JVUA 4P6ZS 4KZ3A 3S7NA 3CMZA 1PYYA 2KLIA 4U0TA 4OOMA 2RCXA 1OT9A 3IBRA 1I5QA 1YT4A 3IH9A 4ZJ1A 4QWOA 5GLCA 2A2LA 2Y2OA 1ODVA 2ZM0A 2V1AA 3T4SA 3JVVA 4OPZA 2WKRA 1MXOA 2V8FA 2HDSA 3V3SA 2LB5A 4GDNA 2ZC3B 3HUOA 2Y4AA 5HPIA 3PBTA 2WAEA 4L0LA 2QHKA 1MY8A 3QP6A 4R70A 3BFEA 1H8ZA 3MZDA 4R4RA 2J80A 3WWXA 1D1JA 5FDHA 3HLBA 2GNXA 2YKFA 3C30A 1GA9A 1VEUB 1IYQA 1NZOA 3BFCA 2CC1A 4DDSA 2NUPC 2A24A 3LR3A 4FCFA 4S2NC 3SS3A 4E3IA 3F1NA 3OOVA 5L09A 2ZC5B 1MWTA 4BJPA 3MR0A 4YFMA 4BWIA 1IOUA 3P09A 4II7A 3NJAA 5CXWA 1L0GA 1W8YA 4EUZA 3NBLA 1AWIA 1YKDA 4WZ5A 1VETA 5EFWA 1CI9A 4MN7A 5KSCA 4HQAA 4X53A 4ETXA 4BMWA 1L0EA 3S7QA 1MKMA 1C3BA 3QNBA 4WEKA 3CAXA 5FSRA 2IA2A 4H6JA 4IUKA 3CI6A 4HEFA 5TBMB 4KQQA 4EQIA 3R7WA 5DF8A 3E0YA 1K4EA 3CLOA 4NXEA 1NJ4A 2ZBBA 5AVFA 3M6BA 2WKPA 3LY3A 1HTZA 4OP8A 2ZQAA 1XFNA 2H5SA 3ZCZA 2ZC6B 1S67L 4E3NA 2OAP1 4NK3A 3RFBA 1PI4A 2HDQA 4EU0A 3GTCA 1JTDA 5LBRA 4YOFA 2Z6DA 2HP6A 2I72A 1HLUP 3S4XA 4S2JA 4HY8A 3IXGA 1OMEA 3LYXA 5GLAA 5HWWA 1XJ6A 1A0KA 3CWFA 3BLMA 5F1FA 1KGGA 4WMCD 5M1AA 2WYXA 2Q9MA 3R4KA 4IUHA 2ZC4B 1XKZA 5HD5A 2KDKA 2J9PA 3HLEA 4O0PA 1CEFA 3NCKA 1IKGA 1ES5A 4BL2A 2Y2MA 1MWSA 1BLCA 2JKRI 2Y2GA 4GS9A 2WK0A 4RYEA 3LIFA 5F82A 3HBRA 4G3KA 4JF5A 4UA6A 3F1OB 4GN2A 4Y0TA 3RJUA 4YNRA 5AVEA 2JKTM 2C6WB 2EFXA 2L0WA 4IJGA 4F3LB 3HL9A 1DY6A 4BBTA 4PKYG 4G3VA 4KZ6A 3NDEA 1OPXA 3HUNA 3DW0A 3S22A 4GZBA 2IWCA
chains in the Genus database with same CATH topology
3BY9A 2G7UA 3T4TA 3KX0X 2PR5A 3FC7A 3H9WA 3E4PA 4Q0JA 5DFXA 1TS0A 5DKLA 4MMNA 2M1CA 2JHEA 5AJGA 3NOPC 4G3WA 5F69A 4I3IA 1KOUA 3TE8A 3LR4A 3KYZA 4MDZA 3V67A 3RH8B 1DP8A 3UB7A 4NXFA 5DJTA 1XFQA 1UWPX 4I39A 2VGLM 4GW9A 3E4OA 4NKPA 3U2AA 4I38A 1T1CA 4WEJA 3DBAA 3MQOA 4O01A 3LR5A 2V1BA 3T4KA 2PHYA 2QWSA 1YAXA 4H6JB 1MC0A 2J3TC 5FL3A 3S7PA 1H8MA 5G4YA 4HOIA 4I3JA 3CUEA 3T50A 2QKPA 1P97A 3K3DA 3R7WB 2K7SA 4MN5A 1EW0A 4B93A 4Y5FA 2HF6A 2L4RA 1W63M 1Y28A 3EQVA 4CLCA 1OJGA 3NOUC 2VGLS 2VV7A 1GSXA 4ZRRA 2ZMFA 4JGRA 1LSVA 2JKRM 5TJJA 2K31A 1F5MA 1OTIA 3PBRA 3RTYA 2J3WA 4WF0A 2EWWA 2H28A 4I5SA 2O9AA 2LB9A 3C2WA 3PBOA 4KUOA 5F6AA 3H82B 1D7EA 2KOIA 4HH3A 3BJNA 5HPFA 3PYPA 1OTAA 2O0YA 3ZYTA 3UE3A 1X0OA 3ULFA 5A8BA 3MMHA 1ZHHB 2D02A 2ZOHA 2Y8HA 3OCNA 3UB6A 5G4ZA 3IS2A 1TS8A 4EUVA 4AFIA 4UQIM 5DFYA 3O5YA 2OOLA 2O9BA 3HCYA 3B47A 1LSXA 4Y3IA 4WELA 2W1TA 5DF9A 4HJ4A 5I5LA 4O8GA 1XJ4A 3KYQA 2O99A 4DN0A 4ARZB 1NLYA 3C8CA 3LUQA 2GJ3A 1DP9A 1NLZA 3EGXC 3KSIA 2GZAA 3VE3A 2QJ5A 3SW1A 1H3QA 4GS9B 3BQ8A 4L9EA 1F9IA 3H7WA 4UQIS 4WN5A 2OWHA 4EXOA 2K2NA 3A0RA 3PBNA 4CLCD 4DMZA 1T1BA 3F1NB 1OTDA 3UB9A 4HP4A 4ETZA 5HDSA 4E04A 2XRNA 2I9VA 2W0NA 5MC7A 4Q0HA 2FH5A 1TS7A 4LRXC 4JGQA 3LIBA 1DRMA 4EETB 1DP6A 5TBMA 2B02A 2HGVA 4HNBA 4BBUA 2W3FA 2INWA 4P6ZM 3VE4A 4KQDA 2HJ9C 4B9OA 4MCWA 5J4EA 3G6OA 1YSPA 4LRYC 3LI8A 3LIEA 5HZHA 4DJ3A 4FOFA 1S1YA 3BWLA 3BY8A 4EQ1A 3EEAA 1G6OA 2VX8A 2V0WA 1NWZA 1N9OA 1BYWA 1P9WA 1N9NA 3P7NA 5C5KA 1T1AA 3KSGA 3T4LA 2PR6A 3KSHA 3FPWA 3A0SA 1XJ2A 1P0ZA 5KSHA 3JVUA 5HDCA 4P6ZS 2XROA 2QJ7A 4GHIA 3S7NA 1VHMA 4WLAA 2KLIA 3KO6A 1V9YA 4MN6A 1D06A 1S66L 4OOMA 2EA9A 5HWVA 4XT2A 1IFQA 3OLOA 4YWZA 1OT9A 1TS6A 4GJ4A 3P01A 5K5BA 1OJ5A 3IBRA 1OTEA 1VB6A 2GX5A 1S4RA 2XSSA 3OC2A 1N9LA 2ZOIA 4L9FA 4WUJA 2OWJA 3F1PA 4CLCB 1F98A 2D01A 2A2LA 1ODVA 2VV8A 3MXQA 4HHDA 2V1AA 3T4SA 3JVVA 3B33A 2WKRA 5DKKA 3K2NA 2HV1A 2LB5A 4LPZA 5HPIA 4LRZE 2Z6CA 2ZMVA 3LIDA 3PBTA 4L0LA 3EGDC 2QHKA 2O9CA 5HL6A 3E4QA 4NXBA 1GSVA 1GSWA 4GCZA 1TF1A 3F1OA 4R70A 4R3AA 3LIAA 4PAUA 2J80A 2CMNA 4R6LA 3PHYA 2V0UA 4F3LA 2PD8A 1S1ZA 3IS2B 2HJEA 2PYRA 2MJ6A 4JGPA 5KIZA 2GNXA 2YKFA 2W3DA 3C30A 4FSFA 4L9GA 5J7EA 2W1TB 4HJ6A 5DJUA 2NUPC 3B42A 2A24A 3LR3A 3NOTC 3BQAA 4EESA 3LR0A 3F1NA 2VA0A 3OOVA 2YKHA 3TRCA 4CQHA 1LT0A 1T18A 4KQOA 1YSQA 2DMWA 4BJPA 3MQ0A 5HDDA 1ZTUA 3OBFA 3MR0A 4BWIA 1IOUA 2FZ0A 4II7A 3NJAA 2R78A 4HI4A 3EWKA 3OCLA 1STZA 4GLQA 1YKDA 1LSWA 4BBVA 5EFWA 2V9AA 4HIAA 3EQUA 3GECA 3H7WB 4EW7A 4MN7A 1TD5A 4M4XA 4HQAA 5J3WA 3PBSA 3CUEC 1W63Q 3UB8A 4ETXA 3D72A 3E98A 4BMWA 2VLGA 1V9ZA 1WA9A 3S7QA 1MKMA 3GDIA 4Q0IA 4CLCC 2J3TD 4EERA 4WEKA 1G28A 3CAXA 1S4SA 1JNUA 2JKTI 4RQ9A 3W2ZA 2IA2A 4H6JA 4IUKA 3CI6A 3PR6A 3ICYA 5TBMB 3S7OA 2PYPA 1LL8A 5HSQA 3MQQA 4OOLA 3R7WA 3MFXA 3E0YA 2W27A 3T4JA 5IT5A 3CLOA 2VKSA 5IS1A 4NXEA 4NXGA 2ZBBA 1OTBA 5AVFA 2L1MA 3LI9A 2VZWA 2WKPA 1XJ3A 3K3CA 4NEED 1XFNA 2XA7M 2VJWA 4I3AA 1S67L 3C38A 2OAP1 2PT7A 3RFBA 3TJZC 4EU0A 3H82A 3HJKA 4Y2FA 3TW8A 3PXPA 5LBRA 4YOFA 2VV6A 2Z6DA 5F68A 3VV4A 2BASA 2Y79A 2PDRA 3EEHA 4HY8A 2QYBA 4CLCE 3FPVA 5L8MA 3D3OA 4GHIB 2W1RA 3LICA 3BW6A 2NUTC 2PD7A 2VEAA 3LYXA 4UEYA 2W3EA 2WKQA 5HWWA 3MJQA 4HH2A 1XJ6A 3LFVA 4XT2B 3CWFA 1OT6A 1UGUA 1MZUA 3EOIA 3T4OA 2XA7S 4Z1WA 3ZQ5A 4HP9A 5HWTA 4PHTA 3PBQA 3R4KA 4IUHA 5HD5A 3UMEA 4ARZA 3T4QA 3F1PB 4DJ2A 2KDKA 4KUKA 5F5YA 2P7JA 4O0PA 4LLOB 2M7VA 4EEPA 5HD3A 2P04A 2JKRI 3HJIA 4GS9A 2EWVA 2JN7A 3LIFA 1UWNX 2KX6A 3KSFA 2B18A 5CX7A 4QPRA 4EEUA 4R38A 3UE6A 4WL9A 3CITA 3NHQA 4G3KA 3F1OB 3A0VA 5IU1A 4YNRA 5AVEA 2P08A 2JKTM 3MF0A 2OAQ1 2L0WA 2M7UA 4IJGA 4F3LB 1NRJA 1T19A 4ME4A 3IBJA 4BBTA 4PKYG 4PKYA 4G3VA 4IHQA 3UMDA 4JGOA 1OPXA 2W3GA 4HJ3A 4K08A 2W3HA 2A24B 1P9RA 3VOLA 3FG8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BY9 A;  3KX0 X;  2PR5 A;  3FC7 A;  3H9W A;  3E4P A;  1TS0 A;  5DKL A;  2M1C A;  2JHE A;  3NOP C;  5F69 A;  4I3I A;  1KOU A;  3RH8 B;  1DP8 A;  3UB7 A;  4NXF A;  5DJT A;  1XFQ A;  1UWP X;  4I39 A;  4GW9 A;  3E4O A;  4I38 A;  1T1C A;  3MQO A;  2V1B A;  2PHY A;  2QWS A;  4H6J B;  5G4Y A;  4HOI A;  4I3J A;  3T50 A;  2QKP A;  1P97 A;  3K3D A;  2K7S A;  4MN5 A;  1EW0 A;  2L4R A;  1Y28 A;  1OJG A;  3NOU C;  2VV7 A;  1GSX A;  4JGR A;  1LSV A;  1OTI A;  3RTY A;  4WF0 A;  2H28 A;  4I5S A;  3C2W A;  4KUO A;  5F6A A;  3H82 B;  1D7E A;  4HH3 A;  3PYP A;  1OTA A;  1X0O A;  3ULF A;  5A8B A;  2D02 A;  2ZOH A;  3UB6 A;  5G4Z A;  3IS2 A;  1TS8 A;  2OOL A;  1LSX A;  4HJ4 A;  5I5L A;  1XJ4 A;  3C8C A;  3LUQ A;  2GJ3 A;  1DP9 A;  3VE3 A;  2QJ5 A;  3SW1 A;  4GS9 B;  4L9E A;  1F9I A;  3H7W A;  4WN5 A;  2OWH A;  4EXO A;  3A0R A;  1T1B A;  3F1N B;  1OTD A;  3UB9 A;  4HP4 A;  5HDS A;  4E04 A;  2I9V A;  2W0N A;  1TS7 A;  4LRX C;  4JGQ A;  3LIB A;  1DRM A;  4EET B;  1DP6 A;  5TBM A;  2B02 A;  4HNB A;  4BBU A;  2INW A;  3VE4 A;  4KQD A;  4B9O A;  5J4E A;  3G6O A;  4LRY C;  3LI8 A;  3LIE A;  5HZH A;  4DJ3 A;  1S1Y A;  3BWL A;  3BY8 A;  4EQ1 A;  2V0W A;  1NWZ A;  1N9O A;  1BYW A;  1N9N A;  3P7N A;  1T1A A;  2PR6 A;  3A0S A;  1XJ2 A;  1P0Z A;  5HDC A;  2QJ7 A;  4GHI A;  4WLA A;  1V9Y A;  4MN6 A;  1D06 A;  1S66 L;  2EA9 A;  5HWV A;  4XT2 A;  3OLO A;  4YWZ A;  1OT9 A;  1TS6 A;  1OJ5 A;  3IBR A;  1OTE A;  1VB6 A;  1S4R A;  1N9L A;  2ZOI A;  4L9F A;  4WUJ A;  2OWJ A;  3F1P A;  1F98 A;  2D01 A;  1ODV A;  2VV8 A;  3MXQ A;  4HHD A;  2V1A A;  3B33 A;  2WKR A;  5DKK A;  2HV1 A;  4LPZ A;  4LRZ E;  2Z6C A;  3LID A;  2QHK A;  3E4Q A;  4NXB A;  1GSV A;  1GSW A;  4GCZ A;  3F1O A;  4R70 A;  4R3A A;  3LIA A;  2J80 A;  2CMN A;  4R6L A;  3PHY A;  2V0U A;  4F3L A;  2PD8 A;  1S1Z A;  3IS2 B;  2PYR A;  4JGP A;  5KIZ A;  2YKF A;  4L9G A;  5J7E A;  4HJ6 A;  5DJU A;  2A24 A;  3NOT C;  4EES A;  3F1N A;  2YKH A;  1LT0 A;  1T18 A;  5HDD A;  3MR0 A;  3NJA A;  2R78 A;  4HI4 A;  3EWK A;  1LSW A;  4BBV A;  5EFW A;  2V9A A;  4HIA A;  3GEC A;  3H7W B;  4EW7 A;  4M4X A;  4HQA A;  5J3W A;  3UB8 A;  3D72 A;  2VLG A;  1V9Z A;  1WA9 A;  3GDI A;  4EER A;  1G28 A;  3CAX A;  1S4S A;  1JNU A;  4RQ9 A;  4H6J A;  3ICY A;  5TBM B;  2PYP A;  1LL8 A;  5HSQ A;  3MQQ A;  3MFX A;  2W27 A;  3CLO A;  5IS1 A;  4NXE A;  4NXG A;  2ZBB A;  1OTB A;  5AVF A;  2L1M A;  3LI9 A;  2WKP A;  1XJ3 A;  3K3C A;  1XFN A;  4I3A A;  1S67 L;  3H82 A;  3HJK A;  2VV6 A;  2Z6D A;  5F68 A;  2BAS A;  2PDR A;  3EEH A;  4HY8 A;  4GHI B;  3LIC A;  2PD7 A;  2VEA A;  3LYX A;  2WKQ A;  5HWW A;  3MJQ A;  4HH2 A;  1XJ6 A;  4XT2 B;  3CWF A;  1OT6 A;  1UGU A;  1MZU A;  3ZQ5 A;  4HP9 A;  5HWT A;  5HD5 A;  3UME A;  3F1P B;  4DJ2 A;  2KDK A;  4KUK A;  5F5Y A;  2P7J A;  4LLO B;  4EEP A;  5HD3 A;  3HJI A;  4GS9 A;  2JN7 A;  3LIF A;  1UWN X;  2KX6 A;  4EEU A;  4R38 A;  3UE6 A;  4WL9 A;  3NHQ A;  3F1O B;  3A0V A;  5IU1 A;  5AVE A;  2L0W A;  4F3L B;  1T19 A;  4BBT A;  4PKY G;  4PKY A;  3UMD A;  4JGO A;  4HJ3 A;  4K08 A;  2A24 B;  3VOL A;  3FG8 A; 
#chains in the Genus database with same CATH topology
 1BSG A;  3O3V A;  2P9V B;  2QMI A;  3NI9 A;  2XD1 A;  1YMX A;  2M1C A;  3MZE A;  5F69 A;  3ITA A;  3TE8 A;  3LR4 A;  2OLU A;  1DP8 A;  1XFQ A;  4NG2 A;  4B4X A;  3JYI A;  2EX6 A;  3E4O A;  4KZ9 A;  1ZKJ A;  5EOE A;  1ALQ A;  3UDX A;  4O01 A;  3HLW A;  3T4K A;  5I94 A;  3L9K A;  1XP4 A;  5FL3 A;  1CEG A;  1H8M A;  3IXD A;  4HOI A;  3CUE A;  1P97 A;  2ZL1 A;  4Y5F A;  2L4R A;  5E2E A;  1W63 M;  3EQV A;  3VSL A;  4CLC A;  1GHI A;  1G6A A;  4P85 A;  4JGR A;  1LSV A;  4FTX A;  3WS0 A;  1IYS A;  3MKE A;  1OTI A;  3TG9 A;  2EWW A;  2H28 A;  1RGY A;  3H82 B;  5A90 A;  5TGF A;  5HPF A;  3VP2 A;  1OTA A;  5EOO A;  2Z2L B;  3UE3 A;  1X0O A;  4N92 A;  4XXR A;  3PTE A;  4PM7 A;  3ULF A;  3MMH A;  1ZHH B;  2ZOH A;  4EV4 A;  3MXR A;  4U0X A;  1SKO A;  3A3E A;  3OCN A;  3UB6 A;  1HVB A;  5G4Z A;  3D9Y A;  2WKI A;  1TS8 A;  4EUV A;  5EVL A;  1M40 A;  2OOL A;  4XUX A;  4Y13 A;  5DF9 A;  1TEM A;  4O7D A;  4O8G A;  1XJ4 A;  4DN0 A;  2O99 A;  3Q7Z A;  3N7W A;  1K6R A;  5CHJ A;  3LO7 A;  3CHW P;  1ES3 A;  3VE3 A;  4R3J A;  3HVF A;  3H7W A;  1CQA A;  1ONH A;  2WAF A;  3DTM A;  1K57 C;  3UY6 A;  1KE3 A;  3AGF A;  4JXW A;  3GSG A;  2PBD P;  2XQZ A;  5HX9 A;  5HDS A;  2XRN A;  1E3U A;  3QP1 A;  4JGQ A;  3MBZ A;  1BTL A;  4OON A;  3NDG A;  2H10 A;  1L0F A;  2B5R A;  1XXM A;  3LEZ A;  5AQB A;  5FA7 A;  4PM8 A;  2HJ9 C;  4B9O A;  2V1Z A;  2V20 A;  4MCW A;  3LIE A;  3A3D A;  4D2O A;  3VMA A;  1WYC A;  3DWZ A;  1S1Y A;  3GRJ A;  3Q07 A;  1G6O A;  5FQI A;  5KZH A;  1BYW A;  2A49 A;  1N9N A;  3I7J A;  2PR6 A;  3FPW A;  5GLB A;  1P0Z A;  5A93 A;  2XRO A;  1BT5 A;  4S2L A;  4EWF A;  2IWD A;  2FFY A;  4MN6 A;  1S66 L;  3T1X A;  2VK3 A;  1KVM A;  3P01 A;  5K5B A;  1EI5 A;  2Z2M B;  1OJ5 A;  1OTE A;  1VB6 A;  3IQA A;  2WZX A;  1PNE A;  3TSG A;  1N9L A;  4L9F A;  4X55 A;  3IWQ A;  5FQM A;  3MXQ A;  5TFQ A;  1NXY A;  5DKK A;  2Y2L A;  2H0T A;  3M6H A;  1KDW A;  1ERQ A;  5E43 A;  4LRZ E;  2Z6C A;  4MBF A;  3EGD C;  2ZQ7 A;  2O9C A;  1H5X A;  4NXB A;  4RVA A;  4GCZ A;  1RGZ A;  2XF3 A;  3FYZ A;  4LV3 A;  2CMN A;  2UWX A;  2J9O A;  1K55 C;  3C5A A;  4KG6 A;  3G31 A;  4DE3 A;  4F94 A;  3IS2 B;  4JGP A;  4UAA A;  5KIZ A;  4FSF A;  1W7F A;  4L9G A;  2W1T B;  4C6Y A;  4EES A;  4X1M A;  2EX2 A;  4CQH A;  1LT0 A;  4LV2 A;  4QJG A;  1YSQ A;  3MQ0 A;  2Y59 A;  1ZTU A;  4ID4 A;  2FZ0 A;  3EWK A;  3OCL A;  1YLZ A;  4BBV A;  4HIA A;  1Z09 A;  4GDB A;  2WGW A;  3GEC A;  4ESP A;  5FAS A;  5J3W A;  3PBS A;  5HL1 A;  1W63 Q;  3UB8 A;  3C4O A;  4HES A;  4E3O A;  2VLG A;  1V9Z A;  1WA9 A;  4BQM A;  2J3T D;  4UA9 A;  4UA7 A;  3IF6 C;  2JKT I;  3W2Z A;  2HDR A;  4DE0 A;  3PR6 A;  1SDE A;  4E3L A;  2PYP A;  3Q7V B;  3DWK A;  3MQQ A;  5CGX A;  5IS1 A;  2HP5 A;  1K6S A;  5FQQ A;  2AVX A;  3ZG5 A;  4NEE D;  3ZHH A;  3BFG A;  2VJW A;  4I3A A;  1PW1 A;  3TJZ C;  3UDI A;  4K0X A;  3HJK A;  3UNW A;  1L0D A;  2Y79 A;  2PDR A;  3EEH A;  4OVD A;  1U60 A;  4CLC E;  3FPV A;  1JWV A;  3UPO A;  5L8M A;  4KG2 A;  1MKI A;  1DJB A;  2NUT C;  3BM6 A;  1ZC2 A;  3MJQ A;  1KGF A;  4N1H A;  3T4O A;  4Z1W A;  4JXS A;  4HP9 A;  3BFF A;  1N9B A;  4ARZ A;  4GD8 A;  3AGE A;  1K56 D;  4KUK A;  5CED A;  5F5Y A;  2P7J A;  3IXH A;  1LL5 A;  5HD3 A;  2EWV A;  2JN7 A;  2Y2I A;  3OPL A;  4C75 A;  3BYD A;  3IWI A;  5AQA A;  4EEU A;  3V50 A;  5CTM A;  3CIT A;  3C7U A;  3E2K A;  4X56 A;  4QHC A;  3A0V A;  5EUA A;  5IU1 A;  2EFU A;  2M7U A;  1NRJ A;  5FI7 A;  3IBJ A;  1FOF A;  4PKY A;  5DTS A;  4IHQ A;  3G34 A;  4ZJ3 A;  2W3G A;  4K08 A;  4Y0U A;  2Y2N A;  2A24 B;  1YMS A;  1P9R A;  3ISG A;  5G18 A;  3FC7 A;  4ZJ2 A;  3E4P A;  2VGK A;  4GKU A;  4Q0J A;  1G68 A;  5FAQ A;  4QY6 A;  5DKL A;  3BLS A;  2JC7 A;  1K56 A;  2JHE A;  4G3W A;  4I3I A;  1K54 A;  3NIA A;  1KOU A;  3VP3 A;  4N1X A;  5EM1 A;  1VET B;  3RH8 B;  1ERM A;  3FKV A;  4I39 A;  2VGL M;  4GW9 A;  3HLC A;  4NKP A;  1T1C A;  3GQZ A;  3DBA A;  2QWS A;  1YAX A;  1XGJ A;  1PI5 A;  4H6J B;  5FAT A;  4Q8I A;  3SH8 A;  2J3T C;  3S7P A;  4I3J A;  4OPR A;  3R7W B;  2HP9 A;  2HF6 A;  3ZG8 B;  1Y28 A;  3MXS A;  3P98 A;  1OJG A;  2VGL S;  2VV7 A;  4OOY A;  4ZRR A;  3PBR A;  2J3W A;  4WF0 A;  5L2F A;  1L3L A;  3C2W A;  3OZH A;  3PYP A;  4B88 A;  2WZZ A;  2JBF A;  2D02 A;  4DXC A;  4S2I A;  3W4Q A;  1YLY A;  3GMW A;  3FWL A;  4IVI A;  4UQI M;  2B95 A;  1KVL A;  4HBT A;  4WZ5 C;  4WZ4 A;  5I5L A;  2ZD8 A;  4ZDX A;  1K38 A;  2BLS A;  4LV1 A;  4ZTK A;  3C8C A;  3LUQ A;  2Q0O A;  1BZA A;  3DTK A;  5FQK A;  5EE8 A;  4GS9 B;  4L9E A;  2JCH A;  5DTT A;  4UQI S;  4WN5 A;  2OWH A;  4EXO A;  2K2N A;  3PBN A;  5EEC A;  4CLC D;  1OTD A;  2ACG A;  1I2W A;  5EV0 A;  3G2Z A;  4E04 A;  3WRZ A;  2W0N A;  5MC7 A;  4Q0H A;  3LIB A;  1DRM A;  4MBH A;  2B02 A;  4PPR A;  2W3F A;  4ZAM A;  4OLG A;  4E6X A;  4KQD A;  3QP5 A;  3ZGA B;  1FIL A;  3LI8 A;  3IX3 A;  1W8Q A;  2Y2K A;  5FI6 A;  4DJ3 A;  4FOF A;  3W4O A;  3HLG A;  4EQ1 A;  4JKT A;  2V0W A;  4LGW A;  5CGS A;  5C5K A;  1T1A A;  5FEG A;  3BFD A;  1FCN A;  3G35 A;  1XGI A;  3WS1 A;  1ZG6 A;  5HDC A;  2QJ7 A;  3W8K A;  5A92 A;  2ZMA A;  4GHI A;  3CJM A;  1FSW A;  4WLA A;  2PRF A;  3CPT A;  3KO6 A;  1D06 A;  2WKH A;  5HWV A;  4XT2 A;  1IFQ A;  3OLO A;  4YWZ A;  5HW3 A;  1TS6 A;  2VGJ A;  2XFS A;  3IWO A;  4QB8 A;  2GX5 A;  2ZL1 B;  5F1G A;  2ZOI A;  1JWZ A;  3F1P A;  4CLC B;  1F98 A;  1GCE A;  1E3U D;  4ZBE A;  2WUQ A;  4X69 A;  2VV8 A;  4HHD A;  4Y7P A;  1M6K A;  4LCL A;  3B33 A;  3ZFZ A;  3K2N A;  4JLF A;  4LPZ A;  3IH8 A;  4KZ7 A;  4GNU A;  2DNS A;  3ZNT A;  3E4Q A;  1SCW A;  1MWU A;  1LHY A;  4OPQ A;  3LIA A;  1ERO A;  4PM9 A;  4JXV A;  1SKO B;  3SH7 A;  2IWB A;  2V0U A;  4E3M A;  2PD8 A;  1S1Z A;  2HJE A;  2X71 A;  4DE2 A;  4QD4 A;  2W3D A;  5M18 A;  4IBR A;  1KGE A;  4HJ6 A;  5DJU A;  3FV7 A;  3B42 A;  3NOT C;  4JF4 A;  1Q2P A;  3LY4 A;  3N6I A;  5L07 A;  2WAD A;  2YKH A;  1CF0 A;  3TRC A;  5EVI A;  5HAP A;  4KQO A;  4EBP A;  3OBF A;  3Q82 A;  4R4S A;  1STZ A;  4GLQ A;  4S2O A;  1J9M A;  3O86 A;  1LSW A;  3RXX A;  3H7W B;  4EW7 A;  1TD5 A;  1YLW A;  3OPR A;  1K0K A;  4E3K A;  3CUE C;  3D72 A;  4H8R A;  5M19 A;  1YQS A;  3GDI A;  3DTE A;  4Q0I A;  4CLC C;  4EER A;  1G28 A;  1JNU A;  1FIK A;  4BD0 A;  5EM0 A;  4RA7 A;  3S7O A;  1LL8 A;  3UN7 A;  5HSQ A;  4K91 A;  3T4J A;  5IT5 A;  4CJN A;  1BLH A;  2VKS A;  4NXG A;  1RCJ A;  3VOZ A;  2L1M A;  5EVE A;  5J8X A;  1PW8 A;  2WKE A;  1XJ3 A;  3K3C A;  4PMA A;  4OQG A;  2XA7 M;  4KEN B;  1PRQ A;  1LLB A;  4Y2F A;  1YPR A;  3TW8 A;  2VV6 A;  5F68 A;  1Y54 A;  5CRF A;  1ESI A;  4FH4 A;  5KMW A;  1WYB A;  2QYB A;  2E8J A;  1RP5 A;  3IF6 B;  3UPN A;  2PD7 A;  3V39 A;  4UEY A;  2W3E A;  1OT6 A;  3G2Y A;  1PWG A;  4FD8 A;  2XA7 S;  3N8S A;  3T1Q B;  4JXG A;  3IHB A;  5HWT A;  2BG1 A;  2J7V A;  3UME A;  2ZQD A;  3CZD A;  4LLO B;  3VSK A;  4R1G A;  4LFU A;  1LL9 A;  3KSF A;  1XA7 A;  4GD6 A;  4QPR A;  3UE6 A;  3VP1 A;  4WL9 A;  4X1L A;  1QMF A;  1LI9 A;  3Q81 A;  4KZ8 A;  2P08 A;  2DRW A;  5DVA A;  3T12 B;  3GVB A;  1Y4O A;  3CG5 A;  4ME4 A;  4N9K A;  4HBU A;  2Y2J A;  3PAG A;  4JGO A;  4HJ3 A;  4LCM A;  3OPP A;  3QP4 A;  3VOL A;  3BEC A;  5JYO A;  3BY9 A;  2G7U A;  1PWD A;  3KX0 X;  3SZT A;  2G2W A;  3NUL A;  2JKF A;  1PZO A;  3SOI A;  3NC8 A;  1MWR A;  1TS0 A;  2E8I A;  1FR6 A;  3MFD A;  4MMN A;  3NOP C;  4KQR A;  1XPB A;  3KYZ A;  1ONG A;  4R23 A;  4MDZ A;  4MEZ A;  3D4F A;  3Q7V A;  4S2N A;  1XX2 A;  2Q9N A;  3V67 A;  2BTF P;  4DE1 A;  4NXF A;  2WGW B;  5DJT A;  2XGN A;  4OPY A;  5E2H A;  5HAR A;  3U2A A;  4Y0O A;  4IED A;  5GHY A;  4OQI A;  3MQO A;  4YIN A;  2V1B A;  3IX4 A;  2PHY A;  1CJF A;  2ZC7 A;  5FI2 A;  1MC0 A;  4KZ5 A;  5G4Y A;  1NYY A;  2QKP A;  2K7S A;  4N9L A;  3QNC A;  3VP0 A;  1YM1 A;  3G30 A;  4Y15 A;  3NEC A;  1HD8 A;  1GSX A;  5DF7 A;  2A3U A;  4MBK A;  1F5M A;  5A91 A;  1ZG4 A;  4MLL A;  2O9A A;  3MSH A;  1ES2 A;  3MKF A;  3PBO A;  4KUO A;  2KOI A;  4MNR A;  5CGW A;  1FCM A;  2O0Y A;  3ZYT A;  3UB5 P;  3UO9 A;  1PWC A;  1O07 A;  1L2S A;  2Y2P A;  5L10 A;  1FQG A;  5E2G A;  1VEU A;  1K4F A;  2O9B A;  1AXB A;  4Y3I A;  4WEL A;  5D3O A;  3IF5 A;  3KYQ A;  3L7H A;  4ARZ B;  1NLY A;  3SH9 A;  1DP9 A;  2WGV A;  1NLZ A;  3EGX C;  3KSI A;  3UDF A;  3SW1 A;  1H3Q A;  1JWP A;  4OQ0 A;  3BQ8 A;  2HDU A;  1PZP A;  3F1N B;  3UB9 A;  4HP4 A;  4S2M A;  2I9V A;  1TS7 A;  5HAQ A;  4EET B;  5TBM A;  1IYP A;  2HGV A;  3KYE A;  4HNB A;  4A5R A;  3T1R A;  4IVK A;  4R3B A;  3JPU A;  3ZG9 B;  3SS5 A;  5J4E A;  3G6O A;  1YSP A;  5HZH A;  2XDM A;  3BWL A;  3BY8 A;  3MZF A;  3EEA A;  5DTK A;  2JE5 A;  3S1Y A;  1N9O A;  1P9W A;  3N8L A;  2XD5 A;  3KSG A;  3FKW A;  5GHX A;  2OV5 A;  1J3W A;  2HPB A;  4UHU A;  3A0S A;  4X25 A;  5FAP A;  1GA0 A;  1ES4 A;  5FQ9 A;  3ZVW A;  2GDN A;  4QU3 A;  4FH2 A;  3DTI A;  1DJA A;  3T1S A;  2X02 A;  1NRF A;  1VHM A;  1V9Y A;  4K0W A;  1XA1 A;  2EA9 A;  3VFF A;  3HRE A;  1W79 A;  2X01 A;  4GJ4 A;  3W4P A;  2ZM2 A;  1S4R A;  2XSS A;  5FQJ A;  3OC2 A;  4WUJ A;  3DAV A;  2OWJ A;  4BEN A;  2D01 A;  1VQQ A;  3V3R A;  4B4Z A;  5FDS A;  4LV0 A;  4Y17 A;  1IEM A;  2HV1 A;  3B3X A;  3ZG7 B;  2JKG A;  2ZMV A;  2OLV A;  3LID A;  1I2S A;  5HL6 A;  3M2J A;  1GSV A;  1GSW A;  1TF1 A;  3F1O A;  4C3Q A;  4R3A A;  3C7V A;  3HLF A;  2HZ5 A;  4PAU A;  3MS6 A;  3QP2 A;  2G2U A;  4R6L A;  3PHY A;  4F3L A;  2PYR A;  2MJ6 A;  1N4O A;  3IT9 A;  3A3F A;  5E2F A;  1BLS A;  1K54 C;  1MBL A;  3UE1 A;  5J7E A;  1JVJ A;  3LCE A;  2R9W A;  4PM5 A;  3BQA A;  1JTG A;  5AQ9 A;  3LR0 A;  2VA0 A;  3BRM A;  4KZB A;  2P9V A;  1T18 A;  2DMW A;  5HDD A;  2R78 A;  3GV9 A;  2EX9 A;  4HI4 A;  3PAE A;  4KZA A;  2V9A A;  3EQU A;  3O87 A;  4M4X A;  4WMC A;  1CI8 A;  3E98 A;  3U4L P;  3RXW A;  4X68 A;  5GHZ A;  4KG5 A;  1VM1 A;  3UPP A;  1G5U A;  3SS4 A;  2V8C A;  4PM6 A;  3E2L A;  1S4S A;  4RQ9 A;  1FSY A;  2UV0 E;  3ICY A;  1PIO A;  2XK1 A;  1K57 A;  4OOL A;  4DF6 A;  5FAO A;  3WS2 A;  1E25 A;  2W27 A;  3MFX A;  1GHP A;  4OP5 A;  1SKF A;  1FCO A;  4D60 A;  1OTB A;  1IYO A;  3LI9 A;  2VZW A;  1HZO A;  1Z6F A;  4KZ4 A;  4Z9Q A;  1YLT A;  3C38 A;  2PT7 A;  4BLM A;  3H82 A;  2XR0 A;  3M2K A;  3PXP A;  5EVI D;  3QP8 A;  4WBG A;  3VV4 A;  2BAS A;  5BOH A;  1MPL A;  2Y55 A;  1YLJ A;  3D3O A;  2H0Y A;  4GHI B;  2W1R A;  3ZNY A;  4P87 A;  3LIC A;  4NET A;  3BW6 A;  3CPT B;  1KE4 A;  1NYM A;  1GHM A;  2VEA A;  2WKQ A;  1WE4 A;  4HH2 A;  5TR7 A;  5JYP A;  3VOY A;  4JF6 A;  3LFV A;  4XT2 B;  1UGU A;  3BEB A;  1MZU A;  3EOI A;  4GOG A;  3ZQ5 A;  2XLN A;  3PBQ A;  4PHT A;  2XH9 A;  3T4Q A;  4OKP A;  3F1P B;  4DJ2 A;  5AQ7 A;  1TDG A;  2M7V A;  4EEP A;  2P04 A;  1BUE A;  3HJI A;  1UWN X;  2KX6 A;  2B18 A;  5CX7 A;  4DRT A;  4R38 A;  3UE0 A;  3NHQ A;  3WS4 A;  1EWZ A;  3Q1F A;  4FUW A;  5GLD A;  1SHV A;  3MF0 A;  3N4I A;  2OAQ 1;  1T19 A;  5U47 A;  1QME A;  1F2K A;  3UMD A;  1DJC A;  4S2K A;  2PAV P;  2W3H A;  1TVF A;  3N8R A;  3ZG0 A;  3FG8 A;  3G32 A;  3T4T A;  3ZVT A;  1K55 A;  2PR5 A;  5EVI B;  3H9W A;  3TOI A;  5CEB A;  4CPK A;  5GL9 A;  2ZQ9 A;  3NY4 A;  3V5M A;  5DFX A;  4EBL A;  5CHM A;  1BLP A;  5AJG A;  3A3I A;  3A3J A;  3GR2 A;  1ESU A;  1CK3 A;  5HFO A;  3UB7 A;  3WS5 A;  2QPN A;  1KE0 A;  1UWP X;  4GB7 A;  4P0M A;  4IBX A;  5CER A;  5IHV A;  1SZV A;  2DCF A;  4I38 A;  1K25 A;  4WEJ A;  1O7E A;  5F83 A;  3LR5 A;  5FEF A;  1FR1 A;  2XEP A;  2XFT A;  4P6B A;  4DXB A;  2FFF B;  3T50 A;  3ITB A;  4LEN A;  3K3D A;  4RX3 A;  4MN5 A;  1EW0 A;  4B93 A;  1IEL A;  3IHA A;  3NOU C;  1H0M A;  4X6T A;  3IF6 A;  3IXB A;  2P74 A;  2EXB A;  2ZMF A;  2C5W B;  2JKR M;  5TJJ A;  2K31 A;  2Y91 A;  4BD1 A;  4BL3 A;  3RTY A;  4I5S A;  4JPM A;  2LB9 A;  5F6A A;  1D7E A;  4OH0 A;  4HH3 A;  3BJN A;  3LEQ A;  5A8B A;  2ZLY A;  3ZDJ A;  3WRT A;  2Y8H A;  2EXA A;  5EVI C;  1SDN A;  1NZU A;  3HLD A;  1H8Y A;  2QZ6 A;  3HUM A;  3IS2 A;  4QY5 A;  4OLD A;  4AFI A;  5DFY A;  3O5Y A;  2WGI A;  3HCY A;  3B47 A;  1LSX A;  4JBF A;  2PU2 A;  2W1T A;  4HJ4 A;  3AGD A;  4R0Q A;  1W5D A;  4DKI A;  3VFH A;  2EX8 A;  1KDS A;  2Y2H A;  1TDL A;  2GJ3 A;  4DDY A;  1ACF A;  4M3K A;  5CHU A;  2GZA A;  2QJ5 A;  2RL3 A;  1NY0 A;  4S2P A;  1F9I A;  1YLP A;  2ZM8 A;  4OQH A;  3A0R A;  4DMZ A;  4WM9 A;  1T1B A;  1IKI A;  2OSU A;  1S0W A;  2Y2Q A;  4RX2 A;  4ETZ A;  4EBN A;  3C4P A;  4E3J A;  4E6W A;  4XUZ A;  2ZQC A;  3VP4 A;  2FH5 A;  4LRX C;  5CTN A;  1DP6 A;  1PFL A;  2PBY A;  4BBU A;  2PU4 A;  4U3T A;  3IX8 A;  2INW A;  4P6Z M;  3VE4 A;  3OPH A;  1LI0 A;  4LRY C;  2J8Y A;  1E4D A;  2ZJ9 A;  2ZQ8 A;  5CEC A;  3G4P A;  2VX8 A;  2R9X A;  3FZC A;  1NWZ A;  4WYY A;  1S6R A;  1Q2Q A;  3P7N A;  2V2F F;  3T4L A;  1BUL A;  3KSH A;  1XJ2 A;  3LGO A;  5HAI A;  5EPH A;  3QHY A;  5KSH A;  3O88 A;  3JVU A;  4P6Z S;  4KZ3 A;  3S7N A;  3CMZ A;  1PYY A;  2KLI A;  4U0T A;  4OOM A;  2RCX A;  1OT9 A;  3IBR A;  1I5Q A;  1YT4 A;  3IH9 A;  4ZJ1 A;  4QWO A;  5GLC A;  2A2L A;  2Y2O A;  1ODV A;  2ZM0 A;  2V1A A;  3T4S A;  3JVV A;  4OPZ A;  2WKR A;  1MXO A;  2V8F A;  2HDS A;  3V3S A;  2LB5 A;  4GDN A;  2ZC3 B;  3HUO A;  2Y4A A;  5HPI A;  3PBT A;  2WAE A;  4L0L A;  2QHK A;  1MY8 A;  3QP6 A;  4R70 A;  3BFE A;  1H8Z A;  3MZD A;  4R4R A;  2J80 A;  3WWX A;  1D1J A;  5FDH A;  3HLB A;  2GNX A;  2YKF A;  3C30 A;  1GA9 A;  1VEU B;  1IYQ A;  1NZO A;  3BFC A;  2CC1 A;  4DDS A;  2NUP C;  2A24 A;  3LR3 A;  4FCF A;  4S2N C;  3SS3 A;  4E3I A;  3F1N A;  3OOV A;  5L09 A;  2ZC5 B;  1MWT A;  4BJP A;  3MR0 A;  4YFM A;  4BWI A;  1IOU A;  3P09 A;  4II7 A;  3NJA A;  5CXW A;  1L0G A;  1W8Y A;  4EUZ A;  3NBL A;  1AWI A;  1YKD A;  4WZ5 A;  1VET A;  5EFW A;  1CI9 A;  4MN7 A;  5KSC A;  4HQA A;  4X53 A;  4ETX A;  4BMW A;  1L0E A;  3S7Q A;  1MKM A;  1C3B A;  3QNB A;  4WEK A;  3CAX A;  5FSR A;  2IA2 A;  4H6J A;  4IUK A;  3CI6 A;  4HEF A;  5TBM B;  4KQQ A;  4EQI A;  3R7W A;  5DF8 A;  3E0Y A;  1K4E A;  3CLO A;  4NXE A;  1NJ4 A;  2ZBB A;  5AVF A;  3M6B A;  2WKP A;  3LY3 A;  1HTZ A;  4OP8 A;  2ZQA A;  1XFN A;  2H5S A;  3ZCZ A;  2ZC6 B;  1S67 L;  4E3N A;  2OAP 1;  4NK3 A;  3RFB A;  1PI4 A;  2HDQ A;  4EU0 A;  3GTC A;  1JTD A;  5LBR A;  4YOF A;  2Z6D A;  2HP6 A;  2I72 A;  1HLU P;  3S4X A;  4S2J A;  4HY8 A;  3IXG A;  1OME A;  3LYX A;  5GLA A;  5HWW A;  1XJ6 A;  1A0K A;  3CWF A;  3BLM A;  5F1F A;  1KGG A;  4WMC D;  5M1A A;  2WYX A;  2Q9M A;  3R4K A;  4IUH A;  2ZC4 B;  1XKZ A;  5HD5 A;  2KDK A;  2J9P A;  3HLE A;  4O0P A;  1CEF A;  3NCK A;  1IKG A;  1ES5 A;  4BL2 A;  2Y2M A;  1MWS A;  1BLC A;  2JKR I;  2Y2G A;  4GS9 A;  2WK0 A;  4RYE A;  3LIF A;  5F82 A;  3HBR A;  4G3K A;  4JF5 A;  4UA6 A;  3F1O B;  4GN2 A;  4Y0T A;  3RJU A;  4YNR A;  5AVE A;  2JKT M;  2C6W B;  2EFX A;  2L0W A;  4IJG A;  4F3L B;  3HL9 A;  1DY6 A;  4BBT A;  4PKY G;  4G3V A;  4KZ6 A;  3NDE A;  1OPX A;  3HUN A;  3DW0 A;  3S22 A;  4GZB A;  2IWC A; 
#chains in the Genus database with same CATH homology
 3BY9 A;  2G7U A;  3T4T A;  3KX0 X;  2PR5 A;  3FC7 A;  3H9W A;  3E4P A;  4Q0J A;  5DFX A;  1TS0 A;  5DKL A;  4MMN A;  2M1C A;  2JHE A;  5AJG A;  3NOP C;  4G3W A;  5F69 A;  4I3I A;  1KOU A;  3TE8 A;  3LR4 A;  3KYZ A;  4MDZ A;  3V67 A;  3RH8 B;  1DP8 A;  3UB7 A;  4NXF A;  5DJT A;  1XFQ A;  1UWP X;  4I39 A;  2VGL M;  4GW9 A;  3E4O A;  4NKP A;  3U2A A;  4I38 A;  1T1C A;  4WEJ A;  3DBA A;  3MQO A;  4O01 A;  3LR5 A;  2V1B A;  3T4K A;  2PHY A;  2QWS A;  1YAX A;  4H6J B;  1MC0 A;  2J3T C;  5FL3 A;  3S7P A;  1H8M A;  5G4Y A;  4HOI A;  4I3J A;  3CUE A;  3T50 A;  2QKP A;  1P97 A;  3K3D A;  3R7W B;  2K7S A;  4MN5 A;  1EW0 A;  4B93 A;  4Y5F A;  2HF6 A;  2L4R A;  1W63 M;  1Y28 A;  3EQV A;  4CLC A;  1OJG A;  3NOU C;  2VGL S;  2VV7 A;  1GSX A;  4ZRR A;  2ZMF A;  4JGR A;  1LSV A;  2JKR M;  5TJJ A;  2K31 A;  1F5M A;  1OTI A;  3PBR A;  3RTY A;  2J3W A;  4WF0 A;  2EWW A;  2H28 A;  4I5S A;  2O9A A;  2LB9 A;  3C2W A;  3PBO A;  4KUO A;  5F6A A;  3H82 B;  1D7E A;  2KOI A;  4HH3 A;  3BJN A;  5HPF A;  3PYP A;  1OTA A;  2O0Y A;  3ZYT A;  3UE3 A;  1X0O A;  3ULF A;  5A8B A;  3MMH A;  1ZHH B;  2D02 A;  2ZOH A;  2Y8H A;  3OCN A;  3UB6 A;  5G4Z A;  3IS2 A;  1TS8 A;  4EUV A;  4AFI A;  4UQI M;  5DFY A;  3O5Y A;  2OOL A;  2O9B A;  3HCY A;  3B47 A;  1LSX A;  4Y3I A;  4WEL A;  2W1T A;  5DF9 A;  4HJ4 A;  5I5L A;  4O8G A;  1XJ4 A;  3KYQ A;  2O99 A;  4DN0 A;  4ARZ B;  1NLY A;  3C8C A;  3LUQ A;  2GJ3 A;  1DP9 A;  1NLZ A;  3EGX C;  3KSI A;  2GZA A;  3VE3 A;  2QJ5 A;  3SW1 A;  1H3Q A;  4GS9 B;  3BQ8 A;  4L9E A;  1F9I A;  3H7W A;  4UQI S;  4WN5 A;  2OWH A;  4EXO A;  2K2N A;  3A0R A;  3PBN A;  4CLC D;  4DMZ A;  1T1B A;  3F1N B;  1OTD A;  3UB9 A;  4HP4 A;  4ETZ A;  5HDS A;  4E04 A;  2XRN A;  2I9V A;  2W0N A;  5MC7 A;  4Q0H A;  2FH5 A;  1TS7 A;  4LRX C;  4JGQ A;  3LIB A;  1DRM A;  4EET B;  1DP6 A;  5TBM A;  2B02 A;  2HGV A;  4HNB A;  4BBU A;  2W3F A;  2INW A;  4P6Z M;  3VE4 A;  4KQD A;  2HJ9 C;  4B9O A;  4MCW A;  5J4E A;  3G6O A;  1YSP A;  4LRY C;  3LI8 A;  3LIE A;  5HZH A;  4DJ3 A;  4FOF A;  1S1Y A;  3BWL A;  3BY8 A;  4EQ1 A;  3EEA A;  1G6O A;  2VX8 A;  2V0W A;  1NWZ A;  1N9O A;  1BYW A;  1P9W A;  1N9N A;  3P7N A;  5C5K A;  1T1A A;  3KSG A;  3T4L A;  2PR6 A;  3KSH A;  3FPW A;  3A0S A;  1XJ2 A;  1P0Z A;  5KSH A;  3JVU A;  5HDC A;  4P6Z S;  2XRO A;  2QJ7 A;  4GHI A;  3S7N A;  1VHM A;  4WLA A;  2KLI A;  3KO6 A;  1V9Y A;  4MN6 A;  1D06 A;  1S66 L;  4OOM A;  2EA9 A;  5HWV A;  4XT2 A;  1IFQ A;  3OLO A;  4YWZ A;  1OT9 A;  1TS6 A;  4GJ4 A;  3P01 A;  5K5B A;  1OJ5 A;  3IBR A;  1OTE A;  1VB6 A;  2GX5 A;  1S4R A;  2XSS A;  3OC2 A;  1N9L A;  2ZOI A;  4L9F A;  4WUJ A;  2OWJ A;  3F1P A;  4CLC B;  1F98 A;  2D01 A;  2A2L A;  1ODV A;  2VV8 A;  3MXQ A;  4HHD A;  2V1A A;  3T4S A;  3JVV A;  3B33 A;  2WKR A;  5DKK A;  3K2N A;  2HV1 A;  2LB5 A;  4LPZ A;  5HPI A;  4LRZ E;  2Z6C A;  2ZMV A;  3LID A;  3PBT A;  4L0L A;  3EGD C;  2QHK A;  2O9C A;  5HL6 A;  3E4Q A;  4NXB A;  1GSV A;  1GSW A;  4GCZ A;  1TF1 A;  3F1O A;  4R70 A;  4R3A A;  3LIA A;  4PAU A;  2J80 A;  2CMN A;  4R6L A;  3PHY A;  2V0U A;  4F3L A;  2PD8 A;  1S1Z A;  3IS2 B;  2HJE A;  2PYR A;  2MJ6 A;  4JGP A;  5KIZ A;  2GNX A;  2YKF A;  2W3D A;  3C30 A;  4FSF A;  4L9G A;  5J7E A;  2W1T B;  4HJ6 A;  5DJU A;  2NUP C;  3B42 A;  2A24 A;  3LR3 A;  3NOT C;  3BQA A;  4EES A;  3LR0 A;  3F1N A;  2VA0 A;  3OOV A;  2YKH A;  3TRC A;  4CQH A;  1LT0 A;  1T18 A;  4KQO A;  1YSQ A;  2DMW A;  4BJP A;  3MQ0 A;  5HDD A;  1ZTU A;  3OBF A;  3MR0 A;  4BWI A;  1IOU A;  2FZ0 A;  4II7 A;  3NJA A;  2R78 A;  4HI4 A;  3EWK A;  3OCL A;  1STZ A;  4GLQ A;  1YKD A;  1LSW A;  4BBV A;  5EFW A;  2V9A A;  4HIA A;  3EQU A;  3GEC A;  3H7W B;  4EW7 A;  4MN7 A;  1TD5 A;  4M4X A;  4HQA A;  5J3W A;  3PBS A;  3CUE C;  1W63 Q;  3UB8 A;  4ETX A;  3D72 A;  3E98 A;  4BMW A;  2VLG A;  1V9Z A;  1WA9 A;  3S7Q A;  1MKM A;  3GDI A;  4Q0I A;  4CLC C;  2J3T D;  4EER A;  4WEK A;  1G28 A;  3CAX A;  1S4S A;  1JNU A;  2JKT I;  4RQ9 A;  3W2Z A;  2IA2 A;  4H6J A;  4IUK A;  3CI6 A;  3PR6 A;  3ICY A;  5TBM B;  3S7O A;  2PYP A;  1LL8 A;  5HSQ A;  3MQQ A;  4OOL A;  3R7W A;  3MFX A;  3E0Y A;  2W27 A;  3T4J A;  5IT5 A;  3CLO A;  2VKS A;  5IS1 A;  4NXE A;  4NXG A;  2ZBB A;  1OTB A;  5AVF A;  2L1M A;  3LI9 A;  2VZW A;  2WKP A;  1XJ3 A;  3K3C A;  4NEE D;  1XFN A;  2XA7 M;  2VJW A;  4I3A A;  1S67 L;  3C38 A;  2OAP 1;  2PT7 A;  3RFB A;  3TJZ C;  4EU0 A;  3H82 A;  3HJK A;  4Y2F A;  3TW8 A;  3PXP A;  5LBR A;  4YOF A;  2VV6 A;  2Z6D A;  5F68 A;  3VV4 A;  2BAS A;  2Y79 A;  2PDR A;  3EEH A;  4HY8 A;  2QYB A;  4CLC E;  3FPV A;  5L8M A;  3D3O A;  4GHI B;  2W1R A;  3LIC A;  3BW6 A;  2NUT C;  2PD7 A;  2VEA A;  3LYX A;  4UEY A;  2W3E A;  2WKQ A;  5HWW A;  3MJQ A;  4HH2 A;  1XJ6 A;  3LFV A;  4XT2 B;  3CWF A;  1OT6 A;  1UGU A;  1MZU A;  3EOI A;  3T4O A;  2XA7 S;  4Z1W A;  3ZQ5 A;  4HP9 A;  5HWT A;  4PHT A;  3PBQ A;  3R4K A;  4IUH A;  5HD5 A;  3UME A;  4ARZ A;  3T4Q A;  3F1P B;  4DJ2 A;  2KDK A;  4KUK A;  5F5Y A;  2P7J A;  4O0P A;  4LLO B;  2M7V A;  4EEP A;  5HD3 A;  2P04 A;  2JKR I;  3HJI A;  4GS9 A;  2EWV A;  2JN7 A;  3LIF A;  1UWN X;  2KX6 A;  3KSF A;  2B18 A;  5CX7 A;  4QPR A;  4EEU A;  4R38 A;  3UE6 A;  4WL9 A;  3CIT A;  3NHQ A;  4G3K A;  3F1O B;  3A0V A;  5IU1 A;  4YNR A;  5AVE A;  2P08 A;  2JKT M;  3MF0 A;  2OAQ 1;  2L0W A;  2M7U A;  4IJG A;  4F3L B;  1NRJ A;  1T19 A;  4ME4 A;  3IBJ A;  4BBT A;  4PKY G;  4PKY A;  4G3V A;  4IHQ A;  3UMD A;  4JGO A;  1OPX A;  2W3G A;  4HJ3 A;  4K08 A;  2W3H A;  2A24 B;  1P9R A;  3VOL A;  3FG8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...