1XXMA

The modular architecture of protein-protein binding site
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
263
structure length
263
Chain Sequence
HPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDLVAASPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Beta-lactamase TEM
publication title The modular architecture of protein-protein binding interfaces
pubmed doi rcsb
source organism Escherichia coli
total genus 90
structure length 263
sequence length 263
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2004-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1xxmA00
1K54C 1BULA 3P98A 1RGYA 4OQGA 4WZ4A 3IXDA 1XA7A 1H8YA 3HBRA 4E3JA 4GN2A 1QMFA 4GOGA 5FA7A 4JXWA 1PW8A 4MBKA 2EX8A 4FH2A 4OOMA 1GHMA 2BG1A 3M6BA 4Y0OA 2ZQ8A 2ZC5B 4RA7A 4E3IA 1PYYA 1NYYA 3ITBA 4KZ4A 2V2FF 1DJCA 1E3UA 1HD8A 1FR1A 2EFUA 2ZQDA 3Q82A 1SCWA 1JWVA 4JXGA 5KSHA 4GKUA 3OPPA 3E2KA 2EFXA 5FQ9A 2ZC4B 3LY3A 4OP5A 2XDMA 5CHMA 4EV4A 1YLYA 5G18A 1FR6A 4JLFA 2C5WB 2OLUA 2WKEA 2WYXA 2Y59A 3GR2A 4P6BA 5E2EA 5AQAA 3IWQA 5CEDA 4IBXA 1O07A 3IWIA 2HP6A 4S2OA 2ZC3B 3MZEA 2X71A 2WGVA 3UN7A 4U3TA 2EXAA 5GHYA 1ZC2A 2XD5A 3HLFA 4MNRA 5TR7A 3LEZA 2Y2KA 2HDSA 1VQQA 1PZPA 4IVIA 1YLPA 4QU3A 4WZ5C 2G2WA 1BUEA 4IBRA 5A91A 2JE5A 3S4XA 3AGFA 2R9WA 1W79A 1IYQA 1BT5A 3WS0A 3WRTA 4D2OA 3C7UA 1TEMA 3LCEA 1IYSA 1PWCA 2XLNA 4E3OA 5FDHA 1XP4A 3N6IA 2Y55A 3BECA 2J8YA 1LLBA 4WBGA 2VGKA 3IH8A 4MBHA 4P87A 1O7EA 1DY6A 2XFSA 4JF4A 4QY6A 4UA9A 3Q07A 5FQMA 1KGFA 5GLAA 5M1AA 1Q2QA 1G6AA 4ID4A 5HX9A 3G34A 4NK3A 4QHCA 4S2JA 4EWFA 2WADA 4Y0TA 3DWZA 1YLTA 1SDNA 5DVAA 3NIAA 3UPNA 1L2SA 4Z9QA 3N4IA 4Q8IA 3FZCA 4FH4A 5CTMA 3WWXA 4R0QA 3OCNA 5DF7A 5CECA 4JXVA 4XXRA 4IEDA 5M19A 5BOHA 2OV5A 2J7VA 3HLBA 1ZG4A 3M2KA 1IEMA 2X02A 3PBOA 3WS5A 4QB8A 1MKIA 3O3VA 4LV3A 1NZUA 4OVDA 2XR0A 5GHZA 4XUXA 3MXSA 3S22A 3OPLA 4KZ5A 3AGEA 4WM9A 1XXMA 3W4QA 3G35A 1LI0A 5EECA 2PBYA 5GLCA 4OH0A 1IELA 2UWXA 1ES5A 3CZDA 4JF6A 5I94A 1PI5A 5CGSA 4EQIA 1MWRA 4S2KA 3IH9A 1TDGA 3NCKA 1PWDA 5CHJA 3ITAA 4HESA 3JYIA 1CI8A 4K0WA 1WYCA 5JYOA 4K0XA 4WZ5A 3IF6A 3IXGA 4LV1A 5E43A 3HVFA 4B4XA 4BQMA 3W4OA 2VGJA 5M18A 1HVBA 4JF5A 4LCLA 4L0LA 4N1XA 2P9VA 4R23A 5GLBA 1KE0A 4RX3A 3TG9A 3SH8A 1XKZA 4KZ6A 5DTSA 3SS3A 4DXBA 4K91A 4HEFA 5CERA 5CGWA 4LENA 1CEFA 3ZG8B 4PM5A 1MWTA 2Y2HA 3WS1A 3V3SA 5CXWA 4S2NA 2IWCA 1AXBA 5FAOA 3HLDA 2J9OA 1PWGA 3V50A 4OQIA 2HDQA 3Q81A 3IT9A 3MZFA 3N7WA 1K4EA 5F1GA 4GB7A 5FQQA 3UDFA 5HL1A 5HAQA 1NXYA 4XUZA 1G68A 3GQZA 4ZJ2A 1ERMA 2ZM8A 2XK1A 1KGGA 5E2FA 4E6WA 3GRJA 5FQIA 3N8RA 4MBFA 4X6TA 2ZC6B 1H5XA 3CG5A 1FSWA 1HZOA 2DCFA 3ZG9B 3C4OA 3LO7A 1E3UD 1K57C 3N8LA 1FCMA 1NYMA 3GV9A 3MKFA 1K55C 3PTEA 4A5RA 3ZVWA 4RVAA 1PIOA 1IYOA 3IF6C 4EUZA 1PW1A 4OPYA 2Q9MA 3C7VA 4DE1A 1Z6FA 1NJ4A 4Y0UA 3IHAA 4DF6A 5F82A 5EVIA 4PM7A 3VFFA 1S0WA 2XFTA 4OOYA 1ES3A 5HAPA 5KZHA 1L0FA 5A92A 2V20A 4CJNA 2ZC7A 1K4FA 2XGNA 4N92A 3SS5A 4UA7A 3HLWA 3UDXA 3BFEA 1FCNA 1ONHA 2WGIA 4JBFA 4OP8A 3B3XA 3UE0A 1GA9A 1Q2PA 2J9PA 1VM1A 5FATA 3UE1A 1W8YA 3HL9A 4DXCA 1K25A 2ZQAA 2Y2NA 4ZAMA 2Q9NA 4S2NC 3VOYA 1LL9A 1OMEA 1ZG6A 3FKWA 4GDBA 4H8RA 5TGFA 4U0XA 1BSGA 1BTLA 1MPLA 5CGXA 2ZJ9A 1YM1A 5EVLA 1MWUA 5EE8A 3ZFZA 2RCXA 4BL3A 4GNUA 4DDSA 1IKGA 1FOFA 1JTDA 3VSKA 3G2ZA 3GTCA 4WYYA 4BENA 3TOIA 1FQGA 3NDGA 3CJMA 4S2IA 1FSYA 3OZHA 3IF6B 4KZAA 4KZ8A 1YT4A 2EX2A 1YMXA 4YINA 4IVKA 2XD1A 4LV0A 4C75A 3O87A 5TFQA 2WKHA 3BRMA 4F94A 4S2PA 4OOLA 2P9VB 4FCFA 4JKTA 5CEBA 3PBSA 3QNBA 4RYEA 5AQ7A 2QMIA 2Z2LB 3ZVTA 5AQBA 3PBTA 4DKIA 2JC7A 4P85A 1YLWA 3G31A 1K56A 2Y4AA 5F83A 1XPBA 5EOOA 1YLZA 4ZDXA 5FAPA 1W8QA 3M6HA 4KG5A 1K6SA 2Y2MA 5GLDA 5EVIC 3V39A 4N1HA 1CI9A 1L0EA 4KQQA 3SH7A 1K57A 1DJAA 4WMCA 5EPHA 3UNWA 3FWLA 3RXWA 2XH9A 3BLMA 4GZBA 1K55A 1MY8A 3ZCZA 3OCLA 1U60A 3N8SA 5CHUA 2HDUA 3CMZA 3HREA 3NDEA 1XA1A 2IWDA 4B88A 1ES2A 1KVLA 3Q7ZA 4HBTA 1RP5A 5CTNA 3VP2A 3ZNYA 4HBUA 3A3FA 4S2LA 1YLJA 1KDWA 2HP5A 1NY0A 2WZXA 1CK3A 3Q1FA 1PI4A 3ZG0A 2OLVA 2XQZA 3BM6A 4BL2A 3V5MA 4RX2A 2ZM2A 3A3IA 3PAEA 4BJPA 4JPMA 2WZZA 1NRFA 4DE3A 2Z2MB 1E4DA 1C3BA 3HLGA 5E2GA 1N4OA 3DWKA 5FQKA 3PAGA 3ZHHA 1WYBA 2G2UA 3UPOA 4X53A 1PZOA 4PM9A 4KG2A 1XGIA 2Y2OA 3EQUA 3IF5A 4EBLA 3QHYA 1RGZA 4LCMA 4BLMA 1KVMA 2JCHA 3M2JA 4X69A 1S6RA 1JTGA 5EVIB 2P74A 2H0YA 2Y2IA 3GSGA 3G2YA 3UY6A 5KMWA 3VMAA 1Y54A 2Y2JA 2I72A 5EOEA 5DF8A 3NBLA 4R4SA 1K6RA 5HARA 4X55A 4E3LA 2H10A 3G32A 4M3KA 1I2SA 4GD6A 4ZBEA 4QY5A 3NC8A 1SKFA 4DE2A 2C6WB 3D4FA 1ALQA 4WEKA 3VP3A 3A3EA 3WRZA 4OLGA 3VP0A 2A49A 1J9MA 2Y91A 3RJUA 5FI2A 3IQAA 3MFDA 4MEZA 3PBRA 3FV7A 4OLDA 1M6KA 1BLCA 2EXBA 2WGWB 4ZTKA 1KE3A 2QPNA 2Y2PA 4WEJA 3BEBA 3C4PA 4R3BA 3AGDA 2QZ6A 4KZ9A 3VSLA 1EROA 2ZQ9A 2HDRA 3MXRA 4PM6A 1N9BA 3P09A 1QMEA 4C3QA 2IWBA 1I5QA 1E25A 4KQRA 4UHUA 4KQOA 5A90A 2Y2GA 2Y2QA 3SS4A 5E2HA 2ZQ7A 4N9KA 1L0DA 3A3JA 3ZGAB 3G4PA 1ES4A 4JXSA 5FI6A 2X01A 2HPBA 5FSRA 4OONA 5HFOA 5IHVA 2H5SA 2BLSA 5EVID 3UDIA 3WS4A 4ZJ3A 1WE4A 5GHXA 3NY4A 3VP4A 2WK0A 2ZMAA 4E3KA 2JBFA 1MXOA 3ISGA 5DTTA 4N9LA 3NI9A 5A93A 3VFHA 1EI5A 1MWSA 3EQVA 3W4PA 3PBQA 3V3RA 5U47A 4KZ3A 2WGWA 1FCOA 3MZDA 1M40A 3DW0A 5KSCA 4KG6A 3OPRA 4DRTA 1XGJA 5HW3A 4GDNA 3PBNA 4QD4A 1ONGA 2ZLYA 1I2WA 4S2MA 1BLPA 4GD8A 1ESUA 1IYPA 1YMSA 1RCJA 2CC1A 1LHYA 2ZD8A 3BFFA 4OQ0A 1KDSA 4YFMA 1ZKJA 2EX6A 3O86A 3FKVA 3UPPA 4BD0A 2FFYA 4B4ZA 3O88A 1GHIA 3Q7VB 1EWZA 3HLCA 3MKEA 1KGEA 1LL5A 4FD8A 4MLLA 3SOIA 4PMAA 1W7FA 2ZM0A 4X68A 1SHVA 3DTMA 4OQHA 2R9XA 2WAFA 5L2FA 1K54A 1ESIA 3A3DA 4KENB 2WAEA 4U0TA 1YQSA 5DTKA 1JVJA 3FYZA 3UO9A 3IXBA 5JYPA 2Y2LA 5HAIA 2DRWA 4DDYA 5FI7A 5FAQA 4P0MA 5D3OA 3BFCA 4OKPA 4R3JA 1TDLA 4R1GA 5DF9A 3G30A 3IHBA 4FSFA 1DJBA 2DNSA 2EX9A 3VOZA 3TSGA 1BLHA 3GMWA 1K56D 4X56A 4E3MA 4EBPA 4OPZA 1HTZA 4CPKA 4DE0A 2XF3A 3IWOA 4KZBA 3BLSA 1JWZA 4OPQA 2WUQA 2OSUA 3BFGA 2A3UA 3I7JA 4KZ7A 4E6XA 1L0GA 3MBZA 2H0TA 3OC2A 2PU2A 1BZAA 1W5DA 4WMCD 4BD1A 1GCEA 3Q7VA 1KE4A 3RXXA 3ZNTA 2V1ZA 3HLEA 1GHPA 4QJGA 3S1YA 4NETA 3W8KA 4UA6A 4EBNA 3WS2A 3HUOA 1GA0A 1LI9A 4OPRA 3ZG5A 4UAAA 2E8IA 3E2LA 1JWPA 4PPRA 5FASA 3GVBA 5J8XA 2XEPA 2GDNA 2HP9A 4ZJ1A 2PU4A 4C6YA 1H8ZA 4LV2A 3SH9A 3HUMA 4R4RA 1XX2A 3ZDJA 3BYDA 3IXHA 1NZOA 1SDEA 4WELA 2RL3A 1TVFA 1MBLA 4O7DA 3LY4A 5FQJA 3OPHA 4Y7PA 2B5RA 2ZQCA 5F1FA 5EUAA 4E3NA 3BFDA 3HUNA 1CEGA 1K38A 1BLSA 5CRFA 1IKIA 3QNCA 3VP1A 3ZG7B 3C5AA 2FFFB 2WKIA 3UE3A 5GL9A 5AQ9A 1ERQA 4PM8A
chains in the Genus database with same CATH superfamily
3IXDA 4LFUA 4BBTA 3HBRA 4XT2A 5FA7A 3CAXA 4OOMA 3UE6A 3M6BA 3ITBA 1HD8A 1FR1A 2FZ0A 5FQ9A 3K2NA 5CHMA 2C5WB 2WKEA 5E2EA 2VV6A 1F98A 4QPRA 4S2OA 2HP6A 4UQIM 4R6LA 2EXAA 2XSSA 1HLUP 5TR7A 4MNRA 3LEZA 3T1RA 1YLPA 4QU3A 2W3GA 2R9WA 4II7A 1PWCA 5HSQA 1N9LA 1NWZA 2VGKA 5HWWA 4G3KA 1O7EA 1DY6A 4WUJA 4UA9A 5HZHA 3F1NA 1XJ2A 5FQMA 3H82B 5HX9A 3G34A 4S2JA 3D9YA 4CLCA 1IFQA 3B33A 4F3LB 1H0MA 3FZCA 3NOPC 5FEGA 3WWXA 2AVXA 4O01A 3PBOA 4K08A 5HPFA 1MKIA 3O3VA 1JNUA 2P08A 4HI4A 4XUXA 4L9EA 1YSPA 1EW0A 3C30A 3CHWP 4WM9A 4O8GA 4F3LA 3T4LA 1IELA 2UWXA 4JF6A 1PI5A 1VEUB 2Y8HA 3IH9A 3NCKA 1YKDA 1PWDA 3ITAA 5IT5A 2IA2A 4I3JA 4K0WA 4LV1A 2JKTI 3HVFA 4B4XA 5EV0A 3W4OA 2VGJA 3GDIA 4JF5A 4L0LA 3TG9A 5MC7A 1XKZA 5DTSA 4DXBA 4K91A 4PM5A 3ZG8B 5I5LA 1ZTUA 5HDCA 1T1AA 1VEUA 2PRFA 1VETB 3EOIA 3HJKA 3MZFA 3A0VA 4EXOA 1ERMA 3CUEA 2ZM8A 2XK1A 3GRJA 3F1PB 3N8RA 1SKOB 2DCFA 3ZG9B 1E3UD 2O99A 2PYPA 1TF1A 3MKFA 1K55C 3PTEA 4EUZA 1PW1A 4GW9A 5L09A 1VETA 1KOUA 1G28A 3IHAA 4Y0UA 5EVIA 2XFTA 1L0FA 1K4FA 3BWLA 4GS9B 3SS5A 4Y2FA 1FCNA 2WGIA 4OP8A 3B3XA 3F1PA 1VM1A 1W8YA 2Y2NA 2Q9NA 3VOYA 1ZG6A 4GDBA 4M4XA 1BSGA 1MPLA 2JKRI 5J3WA 1YM1A 4BL3A 2RCXA 3LIDA 1FOFA 1JTDA 3D72A 3G2ZA 3NDGA 3T12B 2Q0OA 3IF6B 4GS9A 1YT4A 2EX2A 3BJNA 1Y4OA 3PBSA 3PBTA 4DKIA 4P85A 3G31A 4ETXA 2OOLA 3M6HA 2O9BA 4HH3A 1CI9A 3K3DA 1GSXA 1K57A 1DJAA 3UNWA 4ZRRA 4NKPA 2XH9A 3OCLA 1U60A 3CMZA 3HREA 3NDEA 1RP5A 1YLJA 2VGLM 2JHEA 3MQQA 1PI4A 3NHQA 4RX2A 4BJPA 4DE3A 2KOIA 1OTIA 4KG2A 1XGIA 2JCHA 2H0YA 3UY6A 3VMAA 2Y2JA 2I72A 3V67A 2PAVP 5HARA 2HZ5A 4Z1WA 2H10A 1H3QA 2C6WB 3A3EA 2A49A 1J9MA 3IQAA 1BLCA 4MN5A 2QZ6A 4LGWA 2HDRA 3MS6A 4LRXC 4C3QA 2IWBA 1I5QA 3TW8A 4Y13A 1DP9A 2VJWA 5E2HA 3U4LP 3A3JA 1ES4A 4JXSA 4OONA 5GHXA 2WK0A 5DTTA 5A93A 1STZA 1P97A 1M40A 5KSCA 2Z6DA 4MDZA 5L07A 3S7NA 5HW3A 2J80A 3QP1A 1W63Q 2ZLYA 1I2WA 4S2MA 1BLPA 1V9YA 5HD3A 1OT9A 1IYPA 2ZD8A 4OQ0A 1MKMA 3NECA 3O86A 3MSHA 2ZOIA 3O88A 2W0NA 1EWZA 4MLLA 1W7FA 3IS2B 3MXQA 3DTMA 4EEUA 5L2FA 1K54A 5KIZA 2ZOHA 4KENB 4GLQA 5DTKA 1JVJA 2PHYA 3VV4A 3S7QA 5HAIA 2P04A 4P0MA 4HP4A 3G30A 3IBRA 1DJBA 1D06A 2DNSA 4JGPA 4EBPA 3EGDC 1OTBA 5IS1A 4GJ4A 1JWZA 3I7JA 4KZ7A 2PU2A 1W5DA 4WMCD 2WKQA 4QJGA 3W8KA 4EBNA 3WS2A 3HUOA 4OPRA 4PHTA 2HP9A 2PU4A 4C6YA 4O0PA 3IXHA 1NZOA 1SDEA 5HDSA 4PKYG 3LFVA 3HUNA 1CEGA 1BLSA 3VP1A 1IKIA 3C5AA 3IBJA 1BULA 1RGYA 4OQGA 1H8YA 4GOGA 3QP2A 3T1XA 1PW8A 4MBKA 2EX8A 4FH2A 4UQIS 2BG1A 4Y0OA 1PYYA 1NYYA 1K0KA 4Y5FA 1DJCA 3Q82A 2D01A 2ZQDA 1JWVA 2ZBBA 4GKUA 2P7JA 2JKFA 5G18A 3UMEA 3B47A 3GR2A 3IWQA 5CEDA 1O07A 3IWIA 1XFQA 4Q0IA 3LIEA 2WGVA 3KYZA 4X1MA 3JPUA 4YWZA 2Y2KA 2WKPA 4WN5A 2G2WA 1BUEA 3LI8A 3AGFA 3NJAA 1W79A 4AFIA 2XLNA 1XP4A 1LLBA 3IH8A 4MBHA 5FEFA 1KGFA 5GLAA 4EWFA 1YLTA 3E4PA 3NIAA 1L2SA 4FH4A 4R0QA 3C2WA 3FPVA 3MR0A 5DJTA 3CUEC 3O5YA 5BOHA 2GZAA 2J7VA 2HV1A 1ZG4A 3M2KA 3VE4A 3BY9A 4Y17A 4QB8A 4E04A 1ZHHB 4I3IA 3MFXA 3H7WB 4KZ5A 2LB9A 3AGEA 1XXMA 1XJ4A 3G35A 1LI0A 4Q0JA 5GLCA 5I94A 4EEPA 4XT2B 1WA9A 4BBVA 4S2KA 5CHJA 3JYIA 4FUWA 1DP8A 4WZ5A 3SW1A 3IXGA 4BQMA 2OAQ1 2LB5A 4LCLA 4R23A 2P9VA 3MJQA 1KE0A 2D02A 4KZ6A 3SS3A 3H7WA 4HEFA 2NUPC 4LENA 2V0WA 3GECA 3VOLA 5CXWA 4S2NA 1AXBA 3HLDA 5TJJA 3V50A 2XA7M 4ARZB 5F1GA 3HJIA 3UDFA 4CLCE 1OT6A 4XUZA 3GQZA 4ZJ2A 3TJZC 4X6TA 3LR0A 1H5XA 3CG5A 3F1NB 4MN7A 3LO7A 1K57C 3N8LA 3GV9A 1S1YA 4CLCB 2VV7A 1IYOA 3IF6C 4DE1A 4ESPA 1Z6FA 2HJ9C 4ARZA 3VFFA 4OOYA 4YOFA 4LRYC 2V20A 1F9IA 4N92A 4NG2A 1Y28A 1GA9A 1Q2PA 2J9PA 3HL9A 4DXCA 1K25A 2INWA 4Y15A 4H8RA 4U0XA 1AWIA 5AVEA 5L8MA 2XROA 3VSKA 4BENA 1FQGA 1P0ZA 3OZHA 3LR5A 1S4SA 3T4OA 4IVKA 5TFQA 2WKHA 3PHYA 4F94A 3UMDA 5CEBA 5AQ7A 2Z2LB 2ACGA 2JC7A 1YLWA 2V8FA 1K56A 3LYXA 2Y4AA 5F83A 1XPBA 4Q0HA 1DRMA 1K6SA 4KQQA 3QP6A 2EA9A 2VGLS 3L7HA 3DTEA 4GZBA 2VV8A 3ZCZA 5CHUA 4B88A 4HBTA 5EVEA 5IU1A 3ZNYA 4S2LA 2WZXA 5EM1A 3ZG0A 3P01A 3PAEA 4JPMA 2V8CA 1NRFA 2Z2MB 1E4DA 3A0RA 3HLGA 1N4OA 1A0KA 3PAGA 1WYBA 3BQAA 3EQUA 3QHYA 3UB6A 1RGZA 1LSXA 1LSWA 5EVIB 2P74A 5KMWA 1TS6A 5EOEA 4E3LA 4GD6A 4HIAA 4QY5A 3EEHA 3NC8A 2E8JA 4UEYA 4WEKA 3CWFA 3VP3A 5LBRA 4OLGA 1IOUA 2Y91A 1SZVA 5FI2A 3T4KA 3MFDA 4MEZA 3FV7A 2XRNA 1KE3A 2QPNA 2Y2PA 3NOTC 4G3WA 3BEBA 3C4PA 3MXRA 1YSQA 3PXPA 1E25A 4KQRA 4UHUA 4KQOA 2Y2GA 2Y2QA 2PT7A 4IUHA 2X01A 2HPBA 2W27A 3E0YA 3CLOA 3NY4A 3VP4A 2ZMAA 4E3KA 3W4PA 3PBQA 3V3RA 5U47A 1BYWA 3PYPA 3EGXC 3LICA 4DRTA 1ODVA 4KQDA 4GD8A 1ESUA 2OWJA 2CC1A 3BFFA 1LHYA 1KDSA 2PD7A 4RQ9A 2FFYA 3EWKA 1GHIA 1KGEA 1LL5A 2HF6A 4FD8A 2VKSA 4X68A 1ESIA 5HDDA 5DFXA 3MQOA 3UO9A 3IXBA 2Y2LA 3JVVA 5FI7A 5FAQA 5D3OA 3IHBA 4HHDA 1HTZA 4CPKA 3BW6A 3MMHA 3BLSA 5J4EA 2J3TC 2A3UA 5AVFA 1BZAA 4BD1A 3DTKA 1GCEA 3ZNTA 3HLEA 4NETA 3UB7A 1GA0A 3ZG5A 4GHIA 3RTYA 4PPRA 3GVBA 5J8XA 2XEPA 3LIBA 1X0OA 4LV2A 3T4SA 2O9CA 1MBLA 4O7DA 3FG8A 3LY4A 3OPHA 2ZQCA 2M7VA 5F1FA 5EUAA 4E3NA 3BFDA 3ZG7B 2JN7A 2FFFB 2JKTM 2QWSA 5AQ9A 5HAPA 3P98A 2PD8A 4WZ4A 1XA7A 4GN2A 1QMFA 3BY8A 5EFWA 1CF0A 4JXWA 4R3AA 3U2AA 3IX4A 4RA7A 4H6JB 2EFUA 1E3UA 3RFBA 4JXGA 5KSHA 2I9VA 3E2KA 4NXEA 2ZC4B 4OP5A 4EV4A 2WYXA 2OLUA 4P6BA 3LIFA 4IBXA 2ZC3B 3MZEA 2X71A 1N9NA 2XD5A 3HLFA 1VQQA 1XJ6A 4WZ5C 3T50A 4IBRA 4LRZE 5A91A 2JE5A 3S4XA 3ICYA 2ZL1A 4H6JA 1H8MA 1BT5A 1GSVA 3LI9A 3WS0A 3C7UA 1TEMA 3LCEA 1T18A 4E3OA 3N6IA 2Y55A 2J3TD 2VX8A 4WBGA 4P87A 2W3HA 4JF4A 2XFSA 1Q2QA 4ID4A 2WADA 3DWZA 4EUVA 3MQ0A 5DVAA 4EQ1A 3UPNA 4Z9QA 3N4IA 4Q8IA 3FPWA 5CTMA 3OCNA 5DF7A 5CECA 4IEDA 5F6AA 2JKRM 2HJEA 4NXFA 3WS5A 3ZQ5A 4LV3A 1NZUA 2XR0A 5GHZA 2B18A 3E4OA 3MXSA 5G4YA 3S22A 4YNRA 5EECA 1G6OA 4OH0A 5G4ZA 1ES5A 3T4JA 4I39A 3T1QB 4HESA 1CI8A 4EETB 5JYOA 4K0XA 4L9FA 5E43A 2B95A 1GSWA 4HNBA 2XA7S 4CLCC 4BWIA 2JKGA 4HOIA 3UB9A 1CEFA 2WKRA 1MWTA 2Y2HA 3WS1A 2YKFA 1PWGA 2YKHA 4OQIA 2HDQA 3Q81A 4QWOA 4BBUA 2B02A 4G3VA 2W1TB 5HL1A 5HAQA 3KO6A 1NXYA 1G68A 3LUQA 1KGGA 5E2FA 5FQIA 4GCZA 2ZC6B 1FSWA 4CQHA 3KSGA 1FCMA 1NYMA 2NUTC 3ZVWA 4RVAA 3C7VA 4I5SA 1NJ4A 3DTIA 2W1TA 5KZHA 4UA7A 3HLWA 1YAXA 3BFEA 2VK3A 4JBFA 3UE0A 1NLYA 3LEQA 3UE1A 3LR3A 2ZQAA 3OOVA 4ZAMA 1LL9A 1OMEA 5HWTA 1BTLA 2BTFP 3KYEA 2ZJ9A 2BASA 1MWUA 5EE8A 4DDSA 4WYYA 3TOIA 4S2IA 3CJMA 4KZ8A 1YMXA 4CLCD 4LV0A 4C75A 3CI6A 3BRMA 4S2PA 5A8BA 2P9VB 4FCFA 4JKTA 3QNBA 4RYEA 3ZVTA 4P6ZM 4HH2A 5EOOA 1YLZA 4ZDXA 1P9RA 2DMWA 2A2LA 4KG5A 5GLDA 5EVIC 1XJ3A 3SH7A 4WMCA 3RXWA 3BLMA 4NXBA 1XFNA 1MY8A 3FC7A 3N8SA 1XA1A 4DN0A 5FDSA 3S7PA 3A3FA 1NY0A 3Q1FA 2OLVA 3BM6A 2R78A 2ZM2A 1MZUA 2WZZA 1C3BA 2G2UA 3JVUA 1F2KA 1PZOA 2Y2OA 4EBLA 2UV0E 5HD5A 4LCMA 1OJ5A 4BLMA 1P9WA 4X69A 4MMNA 2Y2IA 3G2YA 1Y54A 4L9GA 1FILA 3NBLA 4R4SA 1K6RA 3G32A 1VHMA 1I2SA 4ZBEA 3QP8A 4DE2A 3D4FA 1ACFA 1ALQA 1T19A 1Z09A 3VP0A 1LT0A 3CPTA 3RJUA 3KX0X 5FL3A 4D60A 4EU0A 1M6KA 4ZTKA 2PBDP 3AGDA 4R3BA 2V1BA 3F1OB 2ZMVA 5A90A 3SS4A 1J3WA 4N9KA 1L0DA 1OTAA 3ZGAB 5HFOA 2H5SA 2BLSA 3P7NA 5AJGA 5EVID 3UDIA 3WS4A 4ZJ3A 1WE4A 3BQ8A 5TBMB 2GNXA 3MZDA 3H9WA 2KLIA 5J7EA 4KG6A 1XGJA 3PBNA 2OAP1 3F1OA 4NXGA 3LIAA 1YMSA 2HGVA 3SZTA 3UPPA 4BD0A 4B4ZA 3Q7VB 3HCYA 1SHVA 4OQHA 2R9XA 2WAFA 4HP9A 3NULA 2WAEA 5TBMA 1YQSA 1UWNX 4DDYA 3BFCA 4R3JA 4FSFA 3VOZA 3TSGA 1BLHA 3GMWA 1LSVA 4X56A 5F68A 4OPZA 2XF3A 4KZBA 4PAUA 3H82A 3BFGA 4E6XA 3OC2A 3Q7VA 3RXXA 1GHPA 3S1YA 4IUKA 1LI9A 1TS7A 4UAAA 2E8IA 1JWPA 5FASA 1H8ZA 3SH9A 3HUMA 1XX2A 2VEAA 4HJ6A 3BYDA 2RL3A 2VA0A 5FQJA 2B5RA 4KUKA 5CRFA 2KX6A 2EWWA 1TD5A 3UE3A 1TS0A 1K54C 4HY8A 4E3JA 4B93A 5L10A 3UB5P 3EEAA 2PR5A 1GHMA 1FIKA 2ZQ8A 2ZC5B 4E3IA 1MC0A 4KZ4A 2V2FF 1SCWA 4LPZA 3OPPA 2EFXA 1VB6A 3LY3A 2XDMA 1YLYA 1FR6A 4JLFA 2Y59A 5AQAA 3UN7A 1T1CA 4U3TA 1LL8A 1ZC2A 5GHYA 2K7SA 2HDSA 1PZPA 4IVIA 2QHKA 3T1SA 2OWHA 4NEED 1IYQA 5K5BA 3ULFA 3WRTA 4D2OA 1IYSA 2L4RA 4I38A 5FDHA 1V9ZA 3BECA 3ZYTA 2J8YA 2PDRA 1SKOA 4JGOA 4DJ2A 3B42A 4QY6A 3S7OA 3Q07A 4EESA 5M1AA 1G6AA 4EW7A 4NK3A 4QHCA 4Y0TA 1SDNA 2PR6A 4GHIB 4X1LA 4JXVA 4XXRA 5M19A 1OTDA 2OV5A 2K2NA 1D7EA 3HLBA 4JGRA 1IEMA 2X02A 4R38A 4OVDA 1N9OA 3OPLA 3R7WB 4BMWA 3W4QA 2PBYA 3K3CA 3CZDA 5CGSA 1UWPX 4EQIA 1MWRA 4X25A 1TDGA 4MCWA 1WYCA 2A24B 3IF6A 2GJ3A 4EERA 5M18A 1HVBA 4N1XA 3KYQA 3LR4A 5GLBA 4RX3A 3LGOA 3SH8A 2EWVA 1NRJA 3R7WA 5CERA 5CGWA 2VLGA 3OLOA 5HWVA 4WLAA 3V3SA 2IWCA 5FAOA 2J9OA 2ZL1B 2KDKA 3IT9A 1PFLA 5DJUA 2A24A 3N7WA 1K4EA 4GB7A 5FQQA 1OPXA 5C5KA 1S67L 2CMNA 4ETZA 1W63M 4E6WA 4MBFA 2W3FA 1HZOA 3C4OA 2VZWA 1YPRA 1PRQA 1D1JA 3KSHA 2GX5A 4A5RA 1PIOA 2QJ5A 4OPYA 2Q9MA 1UGUA 4DF6A 5F82A 4PM7A 4DMZA 1TS8A 1S0WA 2J3WA 1ES3A 3IX8A 4I3AA 5A92A 4CJNA 2ZC7A 3TE8A 2XGNA 4DJ3A 3UDXA 5EM0A 5F5YA 3W2ZA 4FTXA 1ONHA 5FATA 1F5MA 2W1RA 2M1CA 4S2NC 3FKWA 2QKPA 5TGFA 3L9KA 5CGXA 5HPIA 4P6ZS 5EVLA 3ZFZA 4GNUA 4Y3IA 1IKGA 1L3LA 3GTCA 1FSYA 4IHQA 4KZAA 4YINA 3C38A 2XD1A 3O87A 3QP4A 4OOLA 1S4RA 2QMIA 5AQBA 2L0WA 2O0YA 2W3EA 3OBFA 5FAPA 2Z6CA 1W8QA 2M7UA 2QJ7A 2Y2MA 3QP5A 3V39A 4N1HA 1L0EA 5CX7A 5EPHA 3FWLA 1NLZA 1K55A 2HDUA 1CQAA 5F69A 2IWDA 1ES2A 3KSFA 1KVLA 3Q7ZA 5CTNA 3VP2A 4HBUA 3VE3A 1KDWA 2HP5A 5HL6A 1CK3A 2XQZA 3IS2A 4BL2A 4IJGA 3V5MA 3A3IA 5E2GA 3DWKA 5FQKA 3ZHHA 3UPOA 2QYBA 4X53A 4PM9A 3IF5A 4KUOA 2V1AA 1KVMA 3M2JA 1S6RA 1JTGA 4WF0A 3GSGA 4MN6A 1OTEA 5DF8A 3PR6A 4LLOB 4X55A 1G5UA 4M3KA 1SKFA 3DAVA 3WRZA 3NOUC 3DBAA 2G7UA 3PBRA 4OLDA 2EXBA 2WGWB 4WEJA 4KZ9A 3VSLA 1EROA 2ZQ9A 4PM6A 3MF0A 1OJGA 1N9BA 3P09A 1QMEA 2V9AA 4WL9A 2ZQ7A 4PKYA 3G4PA 5FI6A 5FSRA 3UB8A 5IHVA 2JBFA 1MXOA 2PYRA 3ISGA 4N9LA 3NI9A 3VFHA 1EI5A 1MWSA 3EQVA 4KZ3A 2WGWA 1FCOA 3DW0A 3D3OA 3OPRA 1S66L 4GDNA 4QD4A 1ONGA 4JGQA 3G6OA 4B9OA 4FOFA 1RCJA 1S1ZA 1DP6A 2FH5A 4YFMA 1ZKJA 2EX6A 3KSIA 3FKVA 2V0UA 2L1MA 3HLCA 3MKEA 3SOIA 4PMAA 2ZM0A 3CITA 4U0TA 2W3DA 3A3DA 5JYPA 3FYZA 3T4TA 3TRCA 2DRWA 4OKPA 1TDLA 5DF9A 4R1GA 4HJ4A 2EX9A 3E4QA 3E98A 1K56D 4E3MA 1CJFA 3C8CA 4DE0A 3IX3A 4R70A 3IWOA 3T4QA 3A0SA 4OPQA 2WUQA 2OSUA 2MJ6A 1L0GA 3MBZA 2H0TA 1KE4A 5DKKA 2V1ZA 2Y79A 4UA6A 2O9AA 4HJ3A 2H28A 3E2LA 5DFYA 3CPTB 2GDNA 4ZJ1A 4ME4A 5DKLA 4R4RA 2K31A 3ZDJA 4WELA 1PNEA 1TVFA 2ZMFA 1T1BA 4HQAA 4Y7PA 3RH8B 1K38A 3QNCA 2WKIA 5GL9A 1ERQA 3R4KA 4PM8A
chains in the Genus database with same CATH topology
1K54C 1BULA 3P98A 1RGYA 4OQGA 4WZ4A 3IXDA 1XA7A 1H8YA 3HBRA 4E3JA 4GN2A 1QMFA 4GOGA 5FA7A 4JXWA 1PW8A 4MBKA 2EX8A 4FH2A 4OOMA 1GHMA 2BG1A 3M6BA 4Y0OA 2ZQ8A 2ZC5B 4RA7A 4E3IA 1PYYA 1NYYA 3ITBA 4KZ4A 2V2FF 1DJCA 1E3UA 1HD8A 1FR1A 2EFUA 2ZQDA 3Q82A 1SCWA 1JWVA 4JXGA 5KSHA 4GKUA 3OPPA 3E2KA 2EFXA 5FQ9A 2ZC4B 3LY3A 4OP5A 2XDMA 5CHMA 4EV4A 1YLYA 5G18A 1FR6A 4JLFA 2C5WB 2OLUA 2WKEA 2WYXA 2Y59A 3GR2A 4P6BA 5E2EA 5AQAA 3IWQA 5CEDA 4IBXA 1O07A 3IWIA 2HP6A 4S2OA 2ZC3B 3MZEA 2X71A 2WGVA 3UN7A 4U3TA 2EXAA 5GHYA 1ZC2A 2XD5A 3HLFA 4MNRA 5TR7A 3LEZA 2Y2KA 2HDSA 1VQQA 1PZPA 4IVIA 1YLPA 4QU3A 4WZ5C 2G2WA 1BUEA 4IBRA 5A91A 2JE5A 3S4XA 3AGFA 2R9WA 1W79A 1IYQA 1BT5A 3WS0A 3WRTA 4D2OA 3C7UA 1TEMA 3LCEA 1IYSA 1PWCA 2XLNA 4E3OA 5FDHA 1XP4A 3N6IA 2Y55A 3BECA 2J8YA 1LLBA 4WBGA 2VGKA 3IH8A 4MBHA 4P87A 1O7EA 1DY6A 2XFSA 4JF4A 4QY6A 4UA9A 3Q07A 5FQMA 1KGFA 5GLAA 5M1AA 1Q2QA 1G6AA 4ID4A 5HX9A 3G34A 4NK3A 4QHCA 4S2JA 4EWFA 2WADA 4Y0TA 3DWZA 1YLTA 1SDNA 5DVAA 3NIAA 3UPNA 1L2SA 4Z9QA 3N4IA 4Q8IA 3FZCA 4FH4A 5CTMA 3WWXA 4R0QA 3OCNA 5DF7A 5CECA 4JXVA 4XXRA 4IEDA 5M19A 5BOHA 2OV5A 2J7VA 3HLBA 1ZG4A 3M2KA 1IEMA 2X02A 3PBOA 3WS5A 4QB8A 1MKIA 3O3VA 4LV3A 1NZUA 4OVDA 2XR0A 5GHZA 4XUXA 3MXSA 3S22A 3OPLA 4KZ5A 3AGEA 4WM9A 1XXMA 3W4QA 3G35A 1LI0A 5EECA 2PBYA 5GLCA 4OH0A 1IELA 2UWXA 1ES5A 3CZDA 4JF6A 5I94A 1PI5A 5CGSA 4EQIA 1MWRA 4S2KA 3IH9A 1TDGA 3NCKA 1PWDA 5CHJA 3ITAA 4HESA 3JYIA 1CI8A 4K0WA 1WYCA 5JYOA 4K0XA 4WZ5A 3IF6A 3IXGA 4LV1A 5E43A 3HVFA 4B4XA 4BQMA 3W4OA 2VGJA 5M18A 1HVBA 4JF5A 4LCLA 4L0LA 4N1XA 2P9VA 4R23A 5GLBA 1KE0A 4RX3A 3TG9A 3SH8A 1XKZA 4KZ6A 5DTSA 3SS3A 4DXBA 4K91A 4HEFA 5CERA 5CGWA 4LENA 1CEFA 3ZG8B 4PM5A 1MWTA 2Y2HA 3WS1A 3V3SA 5CXWA 4S2NA 2IWCA 1AXBA 5FAOA 3HLDA 2J9OA 1PWGA 3V50A 4OQIA 2HDQA 3Q81A 3IT9A 3MZFA 3N7WA 1K4EA 5F1GA 4GB7A 5FQQA 3UDFA 5HL1A 5HAQA 1NXYA 4XUZA 1G68A 3GQZA 4ZJ2A 1ERMA 2ZM8A 2XK1A 1KGGA 5E2FA 4E6WA 3GRJA 5FQIA 3N8RA 4MBFA 4X6TA 2ZC6B 1H5XA 3CG5A 1FSWA 1HZOA 2DCFA 3ZG9B 3C4OA 3LO7A 1E3UD 1K57C 3N8LA 1FCMA 1NYMA 3GV9A 3MKFA 1K55C 3PTEA 4A5RA 3ZVWA 4RVAA 1PIOA 1IYOA 3IF6C 4EUZA 1PW1A 4OPYA 2Q9MA 3C7VA 4DE1A 1Z6FA 1NJ4A 4Y0UA 3IHAA 4DF6A 5F82A 5EVIA 4PM7A 3VFFA 1S0WA 2XFTA 4OOYA 1ES3A 5HAPA 5KZHA 1L0FA 5A92A 2V20A 4CJNA 2ZC7A 1K4FA 2XGNA 4N92A 3SS5A 4UA7A 3HLWA 3UDXA 3BFEA 1FCNA 1ONHA 2WGIA 4JBFA 4OP8A 3B3XA 3UE0A 1GA9A 1Q2PA 2J9PA 1VM1A 5FATA 3UE1A 1W8YA 3HL9A 4DXCA 1K25A 2ZQAA 2Y2NA 4ZAMA 2Q9NA 4S2NC 3VOYA 1LL9A 1OMEA 1ZG6A 3FKWA 4GDBA 4H8RA 5TGFA 4U0XA 1BSGA 1BTLA 1MPLA 5CGXA 2ZJ9A 1YM1A 5EVLA 1MWUA 5EE8A 3ZFZA 2RCXA 4BL3A 4GNUA 4DDSA 1IKGA 1FOFA 1JTDA 3VSKA 3G2ZA 3GTCA 4WYYA 4BENA 3TOIA 1FQGA 3NDGA 3CJMA 4S2IA 1FSYA 3OZHA 3IF6B 4KZAA 4KZ8A 1YT4A 2EX2A 1YMXA 4YINA 4IVKA 2XD1A 4LV0A 4C75A 3O87A 5TFQA 2WKHA 3BRMA 4F94A 4S2PA 4OOLA 2P9VB 4FCFA 4JKTA 5CEBA 3PBSA 3QNBA 4RYEA 5AQ7A 2QMIA 2Z2LB 3ZVTA 5AQBA 3PBTA 4DKIA 2JC7A 4P85A 1YLWA 3G31A 1K56A 2Y4AA 5F83A 1XPBA 5EOOA 1YLZA 4ZDXA 5FAPA 1W8QA 3M6HA 4KG5A 1K6SA 2Y2MA 5GLDA 5EVIC 3V39A 4N1HA 1CI9A 1L0EA 4KQQA 3SH7A 1K57A 1DJAA 4WMCA 5EPHA 3UNWA 3FWLA 3RXWA 2XH9A 3BLMA 4GZBA 1K55A 1MY8A 3ZCZA 3OCLA 1U60A 3N8SA 5CHUA 2HDUA 3CMZA 3HREA 3NDEA 1XA1A 2IWDA 4B88A 1ES2A 1KVLA 3Q7ZA 4HBTA 1RP5A 5CTNA 3VP2A 3ZNYA 4HBUA 3A3FA 4S2LA 1YLJA 1KDWA 2HP5A 1NY0A 2WZXA 1CK3A 3Q1FA 1PI4A 3ZG0A 2OLVA 2XQZA 3BM6A 4BL2A 3V5MA 4RX2A 2ZM2A 3A3IA 3PAEA 4BJPA 4JPMA 2WZZA 1NRFA 4DE3A 2Z2MB 1E4DA 1C3BA 3HLGA 5E2GA 1N4OA 3DWKA 5FQKA 3PAGA 3ZHHA 1WYBA 2G2UA 3UPOA 4X53A 1PZOA 4PM9A 4KG2A 1XGIA 2Y2OA 3EQUA 3IF5A 4EBLA 3QHYA 1RGZA 4LCMA 4BLMA 1KVMA 2JCHA 3M2JA 4X69A 1S6RA 1JTGA 5EVIB 2P74A 2H0YA 2Y2IA 3GSGA 3G2YA 3UY6A 5KMWA 3VMAA 1Y54A 2Y2JA 2I72A 5EOEA 5DF8A 3NBLA 4R4SA 1K6RA 5HARA 4X55A 4E3LA 2H10A 3G32A 4M3KA 1I2SA 4GD6A 4ZBEA 4QY5A 3NC8A 1SKFA 4DE2A 2C6WB 3D4FA 1ALQA 4WEKA 3VP3A 3A3EA 3WRZA 4OLGA 3VP0A 2A49A 1J9MA 2Y91A 3RJUA 5FI2A 3IQAA 3MFDA 4MEZA 3PBRA 3FV7A 4OLDA 1M6KA 1BLCA 2EXBA 2WGWB 4ZTKA 1KE3A 2QPNA 2Y2PA 4WEJA 3BEBA 3C4PA 4R3BA 3AGDA 2QZ6A 4KZ9A 3VSLA 1EROA 2ZQ9A 2HDRA 3MXRA 4PM6A 1N9BA 3P09A 1QMEA 4C3QA 2IWBA 1I5QA 1E25A 4KQRA 4UHUA 4KQOA 5A90A 2Y2GA 2Y2QA 3SS4A 5E2HA 2ZQ7A 4N9KA 1L0DA 3A3JA 3ZGAB 3G4PA 1ES4A 4JXSA 5FI6A 2X01A 2HPBA 5FSRA 4OONA 5HFOA 5IHVA 2H5SA 2BLSA 5EVID 3UDIA 3WS4A 4ZJ3A 1WE4A 5GHXA 3NY4A 3VP4A 2WK0A 2ZMAA 4E3KA 2JBFA 1MXOA 3ISGA 5DTTA 4N9LA 3NI9A 5A93A 3VFHA 1EI5A 1MWSA 3EQVA 3W4PA 3PBQA 3V3RA 5U47A 4KZ3A 2WGWA 1FCOA 3MZDA 1M40A 3DW0A 5KSCA 4KG6A 3OPRA 4DRTA 1XGJA 5HW3A 4GDNA 3PBNA 4QD4A 1ONGA 2ZLYA 1I2WA 4S2MA 1BLPA 4GD8A 1ESUA 1IYPA 1YMSA 1RCJA 2CC1A 1LHYA 2ZD8A 3BFFA 4OQ0A 1KDSA 4YFMA 1ZKJA 2EX6A 3O86A 3FKVA 3UPPA 4BD0A 2FFYA 4B4ZA 3O88A 1GHIA 3Q7VB 1EWZA 3HLCA 3MKEA 1KGEA 1LL5A 4FD8A 4MLLA 3SOIA 4PMAA 1W7FA 2ZM0A 4X68A 1SHVA 3DTMA 4OQHA 2R9XA 2WAFA 5L2FA 1K54A 1ESIA 3A3DA 4KENB 2WAEA 4U0TA 1YQSA 5DTKA 1JVJA 3FYZA 3UO9A 3IXBA 5JYPA 2Y2LA 5HAIA 2DRWA 4DDYA 5FI7A 5FAQA 4P0MA 5D3OA 3BFCA 4OKPA 4R3JA 1TDLA 4R1GA 5DF9A 3G30A 3IHBA 4FSFA 1DJBA 2DNSA 2EX9A 3VOZA 3TSGA 1BLHA 3GMWA 1K56D 4X56A 4E3MA 4EBPA 4OPZA 1HTZA 4CPKA 4DE0A 2XF3A 3IWOA 4KZBA 3BLSA 1JWZA 4OPQA 2WUQA 2OSUA 3BFGA 2A3UA 3I7JA 4KZ7A 4E6XA 1L0GA 3MBZA 2H0TA 3OC2A 2PU2A 1BZAA 1W5DA 4WMCD 4BD1A 1GCEA 3Q7VA 1KE4A 3RXXA 3ZNTA 2V1ZA 3HLEA 1GHPA 4QJGA 3S1YA 4NETA 3W8KA 4UA6A 4EBNA 3WS2A 3HUOA 1GA0A 1LI9A 4OPRA 3ZG5A 4UAAA 2E8IA 3E2LA 1JWPA 4PPRA 5FASA 3GVBA 5J8XA 2XEPA 2GDNA 2HP9A 4ZJ1A 2PU4A 4C6YA 1H8ZA 4LV2A 3SH9A 3HUMA 4R4RA 1XX2A 3ZDJA 3BYDA 3IXHA 1NZOA 1SDEA 4WELA 2RL3A 1TVFA 1MBLA 4O7DA 3LY4A 5FQJA 3OPHA 4Y7PA 2B5RA 2ZQCA 5F1FA 5EUAA 4E3NA 3BFDA 3HUNA 1CEGA 1K38A 1BLSA 5CRFA 1IKIA 3QNCA 3VP1A 3ZG7B 3C5AA 2FFFB 2WKIA 3UE3A 5GL9A 5AQ9A 1ERQA 4PM8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K54 C;  1BUL A;  3P98 A;  1RGY A;  4OQG A;  4WZ4 A;  3IXD A;  1XA7 A;  1H8Y A;  3HBR A;  4E3J A;  4GN2 A;  1QMF A;  4GOG A;  5FA7 A;  4JXW A;  1PW8 A;  4MBK A;  2EX8 A;  4FH2 A;  4OOM A;  1GHM A;  2BG1 A;  3M6B A;  4Y0O A;  2ZQ8 A;  2ZC5 B;  4RA7 A;  4E3I A;  1PYY A;  1NYY A;  3ITB A;  4KZ4 A;  2V2F F;  1DJC A;  1E3U A;  1HD8 A;  1FR1 A;  2EFU A;  2ZQD A;  3Q82 A;  1SCW A;  1JWV A;  4JXG A;  5KSH A;  4GKU A;  3OPP A;  3E2K A;  2EFX A;  5FQ9 A;  2ZC4 B;  3LY3 A;  4OP5 A;  2XDM A;  5CHM A;  4EV4 A;  1YLY A;  5G18 A;  1FR6 A;  4JLF A;  2C5W B;  2OLU A;  2WKE A;  2WYX A;  2Y59 A;  3GR2 A;  4P6B A;  5E2E A;  5AQA A;  3IWQ A;  5CED A;  4IBX A;  1O07 A;  3IWI A;  2HP6 A;  4S2O A;  2ZC3 B;  3MZE A;  2X71 A;  2WGV A;  3UN7 A;  4U3T A;  2EXA A;  5GHY A;  1ZC2 A;  2XD5 A;  3HLF A;  4MNR A;  5TR7 A;  3LEZ A;  2Y2K A;  2HDS A;  1VQQ A;  1PZP A;  4IVI A;  1YLP A;  4QU3 A;  4WZ5 C;  2G2W A;  1BUE A;  4IBR A;  5A91 A;  2JE5 A;  3S4X A;  3AGF A;  2R9W A;  1W79 A;  1IYQ A;  1BT5 A;  3WS0 A;  3WRT A;  4D2O A;  3C7U A;  1TEM A;  3LCE A;  1IYS A;  1PWC A;  2XLN A;  4E3O A;  5FDH A;  1XP4 A;  3N6I A;  2Y55 A;  3BEC A;  2J8Y A;  1LLB A;  4WBG A;  2VGK A;  3IH8 A;  4MBH A;  4P87 A;  1O7E A;  1DY6 A;  2XFS A;  4JF4 A;  4QY6 A;  4UA9 A;  3Q07 A;  5FQM A;  1KGF A;  5GLA A;  5M1A A;  1Q2Q A;  1G6A A;  4ID4 A;  5HX9 A;  3G34 A;  4NK3 A;  4QHC A;  4S2J A;  4EWF A;  2WAD A;  4Y0T A;  3DWZ A;  1YLT A;  1SDN A;  5DVA A;  3NIA A;  3UPN A;  1L2S A;  4Z9Q A;  3N4I A;  4Q8I A;  3FZC A;  4FH4 A;  5CTM A;  3WWX A;  4R0Q A;  3OCN A;  5DF7 A;  5CEC A;  4JXV A;  4XXR A;  4IED A;  5M19 A;  5BOH A;  2OV5 A;  2J7V A;  3HLB A;  1ZG4 A;  3M2K A;  1IEM A;  2X02 A;  3PBO A;  3WS5 A;  4QB8 A;  1MKI A;  3O3V A;  4LV3 A;  1NZU A;  4OVD A;  2XR0 A;  5GHZ A;  4XUX A;  3MXS A;  3S22 A;  3OPL A;  4KZ5 A;  3AGE A;  4WM9 A;  1XXM A;  3W4Q A;  3G35 A;  1LI0 A;  5EEC A;  2PBY A;  5GLC A;  4OH0 A;  1IEL A;  2UWX A;  1ES5 A;  3CZD A;  4JF6 A;  5I94 A;  1PI5 A;  5CGS A;  4EQI A;  1MWR A;  4S2K A;  3IH9 A;  1TDG A;  3NCK A;  1PWD A;  5CHJ A;  3ITA A;  4HES A;  3JYI A;  1CI8 A;  4K0W A;  1WYC A;  5JYO A;  4K0X A;  4WZ5 A;  3IF6 A;  3IXG A;  4LV1 A;  5E43 A;  3HVF A;  4B4X A;  4BQM A;  3W4O A;  2VGJ A;  5M18 A;  1HVB A;  4JF5 A;  4LCL A;  4L0L A;  4N1X A;  2P9V A;  4R23 A;  5GLB A;  1KE0 A;  4RX3 A;  3TG9 A;  3SH8 A;  1XKZ A;  4KZ6 A;  5DTS A;  3SS3 A;  4DXB A;  4K91 A;  4HEF A;  5CER A;  5CGW A;  4LEN A;  1CEF A;  3ZG8 B;  4PM5 A;  1MWT A;  2Y2H A;  3WS1 A;  3V3S A;  5CXW A;  4S2N A;  2IWC A;  1AXB A;  5FAO A;  3HLD A;  2J9O A;  1PWG A;  3V50 A;  4OQI A;  2HDQ A;  3Q81 A;  3IT9 A;  3MZF A;  3N7W A;  1K4E A;  5F1G A;  4GB7 A;  5FQQ A;  3UDF A;  5HL1 A;  5HAQ A;  1NXY A;  4XUZ A;  1G68 A;  3GQZ A;  4ZJ2 A;  1ERM A;  2ZM8 A;  2XK1 A;  1KGG A;  5E2F A;  4E6W A;  3GRJ A;  5FQI A;  3N8R A;  4MBF A;  4X6T A;  2ZC6 B;  1H5X A;  3CG5 A;  1FSW A;  1HZO A;  2DCF A;  3ZG9 B;  3C4O A;  3LO7 A;  1E3U D;  1K57 C;  3N8L A;  1FCM A;  1NYM A;  3GV9 A;  3MKF A;  1K55 C;  3PTE A;  4A5R A;  3ZVW A;  4RVA A;  1PIO A;  1IYO A;  3IF6 C;  4EUZ A;  1PW1 A;  4OPY A;  2Q9M A;  3C7V A;  4DE1 A;  1Z6F A;  1NJ4 A;  4Y0U A;  3IHA A;  4DF6 A;  5F82 A;  5EVI A;  4PM7 A;  3VFF A;  1S0W A;  2XFT A;  4OOY A;  1ES3 A;  5HAP A;  5KZH A;  1L0F A;  5A92 A;  2V20 A;  4CJN A;  2ZC7 A;  1K4F A;  2XGN A;  4N92 A;  3SS5 A;  4UA7 A;  3HLW A;  3UDX A;  3BFE A;  1FCN A;  1ONH A;  2WGI A;  4JBF A;  4OP8 A;  3B3X A;  3UE0 A;  1GA9 A;  1Q2P A;  2J9P A;  1VM1 A;  5FAT A;  3UE1 A;  1W8Y A;  3HL9 A;  4DXC A;  1K25 A;  2ZQA A;  2Y2N A;  4ZAM A;  2Q9N A;  4S2N C;  3VOY A;  1LL9 A;  1OME A;  1ZG6 A;  3FKW A;  4GDB A;  4H8R A;  5TGF A;  4U0X A;  1BSG A;  1BTL A;  1MPL A;  5CGX A;  2ZJ9 A;  1YM1 A;  5EVL A;  1MWU A;  5EE8 A;  3ZFZ A;  2RCX A;  4BL3 A;  4GNU A;  4DDS A;  1IKG A;  1FOF A;  1JTD A;  3VSK A;  3G2Z A;  3GTC A;  4WYY A;  4BEN A;  3TOI A;  1FQG A;  3NDG A;  3CJM A;  4S2I A;  1FSY A;  3OZH A;  3IF6 B;  4KZA A;  4KZ8 A;  1YT4 A;  2EX2 A;  1YMX A;  4YIN A;  4IVK A;  2XD1 A;  4LV0 A;  4C75 A;  3O87 A;  5TFQ A;  2WKH A;  3BRM A;  4F94 A;  4S2P A;  4OOL A;  2P9V B;  4FCF A;  4JKT A;  5CEB A;  3PBS A;  3QNB A;  4RYE A;  5AQ7 A;  2QMI A;  2Z2L B;  3ZVT A;  5AQB A;  3PBT A;  4DKI A;  2JC7 A;  4P85 A;  1YLW A;  3G31 A;  1K56 A;  2Y4A A;  5F83 A;  1XPB A;  5EOO A;  1YLZ A;  4ZDX A;  5FAP A;  1W8Q A;  3M6H A;  4KG5 A;  1K6S A;  2Y2M A;  5GLD A;  5EVI C;  3V39 A;  4N1H A;  1CI9 A;  1L0E A;  4KQQ A;  3SH7 A;  1K57 A;  1DJA A;  4WMC A;  5EPH A;  3UNW A;  3FWL A;  3RXW A;  2XH9 A;  3BLM A;  4GZB A;  1K55 A;  1MY8 A;  3ZCZ A;  3OCL A;  1U60 A;  3N8S A;  5CHU A;  2HDU A;  3CMZ A;  3HRE A;  3NDE A;  1XA1 A;  2IWD A;  4B88 A;  1ES2 A;  1KVL A;  3Q7Z A;  4HBT A;  1RP5 A;  5CTN A;  3VP2 A;  3ZNY A;  4HBU A;  3A3F A;  4S2L A;  1YLJ A;  1KDW A;  2HP5 A;  1NY0 A;  2WZX A;  1CK3 A;  3Q1F A;  1PI4 A;  3ZG0 A;  2OLV A;  2XQZ A;  3BM6 A;  4BL2 A;  3V5M A;  4RX2 A;  2ZM2 A;  3A3I A;  3PAE A;  4BJP A;  4JPM A;  2WZZ A;  1NRF A;  4DE3 A;  2Z2M B;  1E4D A;  1C3B A;  3HLG A;  5E2G A;  1N4O A;  3DWK A;  5FQK A;  3PAG A;  3ZHH A;  1WYB A;  2G2U A;  3UPO A;  4X53 A;  1PZO A;  4PM9 A;  4KG2 A;  1XGI A;  2Y2O A;  3EQU A;  3IF5 A;  4EBL A;  3QHY A;  1RGZ A;  4LCM A;  4BLM A;  1KVM A;  2JCH A;  3M2J A;  4X69 A;  1S6R A;  1JTG A;  5EVI B;  2P74 A;  2H0Y A;  2Y2I A;  3GSG A;  3G2Y A;  3UY6 A;  5KMW A;  3VMA A;  1Y54 A;  2Y2J A;  2I72 A;  5EOE A;  5DF8 A;  3NBL A;  4R4S A;  1K6R A;  5HAR A;  4X55 A;  4E3L A;  2H10 A;  3G32 A;  4M3K A;  1I2S A;  4GD6 A;  4ZBE A;  4QY5 A;  3NC8 A;  1SKF A;  4DE2 A;  2C6W B;  3D4F A;  1ALQ A;  4WEK A;  3VP3 A;  3A3E A;  3WRZ A;  4OLG A;  3VP0 A;  2A49 A;  1J9M A;  2Y91 A;  3RJU A;  5FI2 A;  3IQA A;  3MFD A;  4MEZ A;  3PBR A;  3FV7 A;  4OLD A;  1M6K A;  1BLC A;  2EXB A;  2WGW B;  4ZTK A;  1KE3 A;  2QPN A;  2Y2P A;  4WEJ A;  3BEB A;  3C4P A;  4R3B A;  3AGD A;  2QZ6 A;  4KZ9 A;  3VSL A;  1ERO A;  2ZQ9 A;  2HDR A;  3MXR A;  4PM6 A;  1N9B A;  3P09 A;  1QME A;  4C3Q A;  2IWB A;  1I5Q A;  1E25 A;  4KQR A;  4UHU A;  4KQO A;  5A90 A;  2Y2G A;  2Y2Q A;  3SS4 A;  5E2H A;  2ZQ7 A;  4N9K A;  1L0D A;  3A3J A;  3ZGA B;  3G4P A;  1ES4 A;  4JXS A;  5FI6 A;  2X01 A;  2HPB A;  5FSR A;  4OON A;  5HFO A;  5IHV A;  2H5S A;  2BLS A;  5EVI D;  3UDI A;  3WS4 A;  4ZJ3 A;  1WE4 A;  5GHX A;  3NY4 A;  3VP4 A;  2WK0 A;  2ZMA A;  4E3K A;  2JBF A;  1MXO A;  3ISG A;  5DTT A;  4N9L A;  3NI9 A;  5A93 A;  3VFH A;  1EI5 A;  1MWS A;  3EQV A;  3W4P A;  3PBQ A;  3V3R A;  5U47 A;  4KZ3 A;  2WGW A;  1FCO A;  3MZD A;  1M40 A;  3DW0 A;  5KSC A;  4KG6 A;  3OPR A;  4DRT A;  1XGJ A;  5HW3 A;  4GDN A;  3PBN A;  4QD4 A;  1ONG A;  2ZLY A;  1I2W A;  4S2M A;  1BLP A;  4GD8 A;  1ESU A;  1IYP A;  1YMS A;  1RCJ A;  2CC1 A;  1LHY A;  2ZD8 A;  3BFF A;  4OQ0 A;  1KDS A;  4YFM A;  1ZKJ A;  2EX6 A;  3O86 A;  3FKV A;  3UPP A;  4BD0 A;  2FFY A;  4B4Z A;  3O88 A;  1GHI A;  3Q7V B;  1EWZ A;  3HLC A;  3MKE A;  1KGE A;  1LL5 A;  4FD8 A;  4MLL A;  3SOI A;  4PMA A;  1W7F A;  2ZM0 A;  4X68 A;  1SHV A;  3DTM A;  4OQH A;  2R9X A;  2WAF A;  5L2F A;  1K54 A;  1ESI A;  3A3D A;  4KEN B;  2WAE A;  4U0T A;  1YQS A;  5DTK A;  1JVJ A;  3FYZ A;  3UO9 A;  3IXB A;  5JYP A;  2Y2L A;  5HAI A;  2DRW A;  4DDY A;  5FI7 A;  5FAQ A;  4P0M A;  5D3O A;  3BFC A;  4OKP A;  4R3J A;  1TDL A;  4R1G A;  5DF9 A;  3G30 A;  3IHB A;  4FSF A;  1DJB A;  2DNS A;  2EX9 A;  3VOZ A;  3TSG A;  1BLH A;  3GMW A;  1K56 D;  4X56 A;  4E3M A;  4EBP A;  4OPZ A;  1HTZ A;  4CPK A;  4DE0 A;  2XF3 A;  3IWO A;  4KZB A;  3BLS A;  1JWZ A;  4OPQ A;  2WUQ A;  2OSU A;  3BFG A;  2A3U A;  3I7J A;  4KZ7 A;  4E6X A;  1L0G A;  3MBZ A;  2H0T A;  3OC2 A;  2PU2 A;  1BZA A;  1W5D A;  4WMC D;  4BD1 A;  1GCE A;  3Q7V A;  1KE4 A;  3RXX A;  3ZNT A;  2V1Z A;  3HLE A;  1GHP A;  4QJG A;  3S1Y A;  4NET A;  3W8K A;  4UA6 A;  4EBN A;  3WS2 A;  3HUO A;  1GA0 A;  1LI9 A;  4OPR A;  3ZG5 A;  4UAA A;  2E8I A;  3E2L A;  1JWP A;  4PPR A;  5FAS A;  3GVB A;  5J8X A;  2XEP A;  2GDN A;  2HP9 A;  4ZJ1 A;  2PU4 A;  4C6Y A;  1H8Z A;  4LV2 A;  3SH9 A;  3HUM A;  4R4R A;  1XX2 A;  3ZDJ A;  3BYD A;  3IXH A;  1NZO A;  1SDE A;  4WEL A;  2RL3 A;  1TVF A;  1MBL A;  4O7D A;  3LY4 A;  5FQJ A;  3OPH A;  4Y7P A;  2B5R A;  2ZQC A;  5F1F A;  5EUA A;  4E3N A;  3BFD A;  3HUN A;  1CEG A;  1K38 A;  1BLS A;  5CRF A;  1IKI A;  3QNC A;  3VP1 A;  3ZG7 B;  3C5A A;  2FFF B;  2WKI A;  3UE3 A;  5GL9 A;  5AQ9 A;  1ERQ A;  4PM8 A; 
#chains in the Genus database with same CATH topology
 3IXD A;  4LFU A;  4BBT A;  3HBR A;  4XT2 A;  5FA7 A;  3CAX A;  4OOM A;  3UE6 A;  3M6B A;  3ITB A;  1HD8 A;  1FR1 A;  2FZ0 A;  5FQ9 A;  3K2N A;  5CHM A;  2C5W B;  2WKE A;  5E2E A;  2VV6 A;  1F98 A;  4QPR A;  4S2O A;  2HP6 A;  4UQI M;  4R6L A;  2EXA A;  2XSS A;  1HLU P;  5TR7 A;  4MNR A;  3LEZ A;  3T1R A;  1YLP A;  4QU3 A;  2W3G A;  2R9W A;  4II7 A;  1PWC A;  5HSQ A;  1N9L A;  1NWZ A;  2VGK A;  5HWW A;  4G3K A;  1O7E A;  1DY6 A;  4WUJ A;  4UA9 A;  5HZH A;  3F1N A;  1XJ2 A;  5FQM A;  3H82 B;  5HX9 A;  3G34 A;  4S2J A;  3D9Y A;  4CLC A;  1IFQ A;  3B33 A;  4F3L B;  1H0M A;  3FZC A;  3NOP C;  5FEG A;  3WWX A;  2AVX A;  4O01 A;  3PBO A;  4K08 A;  5HPF A;  1MKI A;  3O3V A;  1JNU A;  2P08 A;  4HI4 A;  4XUX A;  4L9E A;  1YSP A;  1EW0 A;  3C30 A;  3CHW P;  4WM9 A;  4O8G A;  4F3L A;  3T4L A;  1IEL A;  2UWX A;  4JF6 A;  1PI5 A;  1VEU B;  2Y8H A;  3IH9 A;  3NCK A;  1YKD A;  1PWD A;  3ITA A;  5IT5 A;  2IA2 A;  4I3J A;  4K0W A;  4LV1 A;  2JKT I;  3HVF A;  4B4X A;  5EV0 A;  3W4O A;  2VGJ A;  3GDI A;  4JF5 A;  4L0L A;  3TG9 A;  5MC7 A;  1XKZ A;  5DTS A;  4DXB A;  4K91 A;  4PM5 A;  3ZG8 B;  5I5L A;  1ZTU A;  5HDC A;  1T1A A;  1VEU A;  2PRF A;  1VET B;  3EOI A;  3HJK A;  3MZF A;  3A0V A;  4EXO A;  1ERM A;  3CUE A;  2ZM8 A;  2XK1 A;  3GRJ A;  3F1P B;  3N8R A;  1SKO B;  2DCF A;  3ZG9 B;  1E3U D;  2O99 A;  2PYP A;  1TF1 A;  3MKF A;  1K55 C;  3PTE A;  4EUZ A;  1PW1 A;  4GW9 A;  5L09 A;  1VET A;  1KOU A;  1G28 A;  3IHA A;  4Y0U A;  5EVI A;  2XFT A;  1L0F A;  1K4F A;  3BWL A;  4GS9 B;  3SS5 A;  4Y2F A;  1FCN A;  2WGI A;  4OP8 A;  3B3X A;  3F1P A;  1VM1 A;  1W8Y A;  2Y2N A;  2Q9N A;  3VOY A;  1ZG6 A;  4GDB A;  4M4X A;  1BSG A;  1MPL A;  2JKR I;  5J3W A;  1YM1 A;  4BL3 A;  2RCX A;  3LID A;  1FOF A;  1JTD A;  3D72 A;  3G2Z A;  3NDG A;  3T12 B;  2Q0O A;  3IF6 B;  4GS9 A;  1YT4 A;  2EX2 A;  3BJN A;  1Y4O A;  3PBS A;  3PBT A;  4DKI A;  4P85 A;  3G31 A;  4ETX A;  2OOL A;  3M6H A;  2O9B A;  4HH3 A;  1CI9 A;  3K3D A;  1GSX A;  1K57 A;  1DJA A;  3UNW A;  4ZRR A;  4NKP A;  2XH9 A;  3OCL A;  1U60 A;  3CMZ A;  3HRE A;  3NDE A;  1RP5 A;  1YLJ A;  2VGL M;  2JHE A;  3MQQ A;  1PI4 A;  3NHQ A;  4RX2 A;  4BJP A;  4DE3 A;  2KOI A;  1OTI A;  4KG2 A;  1XGI A;  2JCH A;  2H0Y A;  3UY6 A;  3VMA A;  2Y2J A;  2I72 A;  3V67 A;  2PAV P;  5HAR A;  2HZ5 A;  4Z1W A;  2H10 A;  1H3Q A;  2C6W B;  3A3E A;  2A49 A;  1J9M A;  3IQA A;  1BLC A;  4MN5 A;  2QZ6 A;  4LGW A;  2HDR A;  3MS6 A;  4LRX C;  4C3Q A;  2IWB A;  1I5Q A;  3TW8 A;  4Y13 A;  1DP9 A;  2VJW A;  5E2H A;  3U4L P;  3A3J A;  1ES4 A;  4JXS A;  4OON A;  5GHX A;  2WK0 A;  5DTT A;  5A93 A;  1STZ A;  1P97 A;  1M40 A;  5KSC A;  2Z6D A;  4MDZ A;  5L07 A;  3S7N A;  5HW3 A;  2J80 A;  3QP1 A;  1W63 Q;  2ZLY A;  1I2W A;  4S2M A;  1BLP A;  1V9Y A;  5HD3 A;  1OT9 A;  1IYP A;  2ZD8 A;  4OQ0 A;  1MKM A;  3NEC A;  3O86 A;  3MSH A;  2ZOI A;  3O88 A;  2W0N A;  1EWZ A;  4MLL A;  1W7F A;  3IS2 B;  3MXQ A;  3DTM A;  4EEU A;  5L2F A;  1K54 A;  5KIZ A;  2ZOH A;  4KEN B;  4GLQ A;  5DTK A;  1JVJ A;  2PHY A;  3VV4 A;  3S7Q A;  5HAI A;  2P04 A;  4P0M A;  4HP4 A;  3G30 A;  3IBR A;  1DJB A;  1D06 A;  2DNS A;  4JGP A;  4EBP A;  3EGD C;  1OTB A;  5IS1 A;  4GJ4 A;  1JWZ A;  3I7J A;  4KZ7 A;  2PU2 A;  1W5D A;  4WMC D;  2WKQ A;  4QJG A;  3W8K A;  4EBN A;  3WS2 A;  3HUO A;  4OPR A;  4PHT A;  2HP9 A;  2PU4 A;  4C6Y A;  4O0P A;  3IXH A;  1NZO A;  1SDE A;  5HDS A;  4PKY G;  3LFV A;  3HUN A;  1CEG A;  1BLS A;  3VP1 A;  1IKI A;  3C5A A;  3IBJ A;  1BUL A;  1RGY A;  4OQG A;  1H8Y A;  4GOG A;  3QP2 A;  3T1X A;  1PW8 A;  4MBK A;  2EX8 A;  4FH2 A;  4UQI S;  2BG1 A;  4Y0O A;  1PYY A;  1NYY A;  1K0K A;  4Y5F A;  1DJC A;  3Q82 A;  2D01 A;  2ZQD A;  1JWV A;  2ZBB A;  4GKU A;  2P7J A;  2JKF A;  5G18 A;  3UME A;  3B47 A;  3GR2 A;  3IWQ A;  5CED A;  1O07 A;  3IWI A;  1XFQ A;  4Q0I A;  3LIE A;  2WGV A;  3KYZ A;  4X1M A;  3JPU A;  4YWZ A;  2Y2K A;  2WKP A;  4WN5 A;  2G2W A;  1BUE A;  3LI8 A;  3AGF A;  3NJA A;  1W79 A;  4AFI A;  2XLN A;  1XP4 A;  1LLB A;  3IH8 A;  4MBH A;  5FEF A;  1KGF A;  5GLA A;  4EWF A;  1YLT A;  3E4P A;  3NIA A;  1L2S A;  4FH4 A;  4R0Q A;  3C2W A;  3FPV A;  3MR0 A;  5DJT A;  3CUE C;  3O5Y A;  5BOH A;  2GZA A;  2J7V A;  2HV1 A;  1ZG4 A;  3M2K A;  3VE4 A;  3BY9 A;  4Y17 A;  4QB8 A;  4E04 A;  1ZHH B;  4I3I A;  3MFX A;  3H7W B;  4KZ5 A;  2LB9 A;  3AGE A;  1XXM A;  1XJ4 A;  3G35 A;  1LI0 A;  4Q0J A;  5GLC A;  5I94 A;  4EEP A;  4XT2 B;  1WA9 A;  4BBV A;  4S2K A;  5CHJ A;  3JYI A;  4FUW A;  1DP8 A;  4WZ5 A;  3SW1 A;  3IXG A;  4BQM A;  2OAQ 1;  2LB5 A;  4LCL A;  4R23 A;  2P9V A;  3MJQ A;  1KE0 A;  2D02 A;  4KZ6 A;  3SS3 A;  3H7W A;  4HEF A;  2NUP C;  4LEN A;  2V0W A;  3GEC A;  3VOL A;  5CXW A;  4S2N A;  1AXB A;  3HLD A;  5TJJ A;  3V50 A;  2XA7 M;  4ARZ B;  5F1G A;  3HJI A;  3UDF A;  4CLC E;  1OT6 A;  4XUZ A;  3GQZ A;  4ZJ2 A;  3TJZ C;  4X6T A;  3LR0 A;  1H5X A;  3CG5 A;  3F1N B;  4MN7 A;  3LO7 A;  1K57 C;  3N8L A;  3GV9 A;  1S1Y A;  4CLC B;  2VV7 A;  1IYO A;  3IF6 C;  4DE1 A;  4ESP A;  1Z6F A;  2HJ9 C;  4ARZ A;  3VFF A;  4OOY A;  4YOF A;  4LRY C;  2V20 A;  1F9I A;  4N92 A;  4NG2 A;  1Y28 A;  1GA9 A;  1Q2P A;  2J9P A;  3HL9 A;  4DXC A;  1K25 A;  2INW A;  4Y15 A;  4H8R A;  4U0X A;  1AWI A;  5AVE A;  5L8M A;  2XRO A;  3VSK A;  4BEN A;  1FQG A;  1P0Z A;  3OZH A;  3LR5 A;  1S4S A;  3T4O A;  4IVK A;  5TFQ A;  2WKH A;  3PHY A;  4F94 A;  3UMD A;  5CEB A;  5AQ7 A;  2Z2L B;  2ACG A;  2JC7 A;  1YLW A;  2V8F A;  1K56 A;  3LYX A;  2Y4A A;  5F83 A;  1XPB A;  4Q0H A;  1DRM A;  1K6S A;  4KQQ A;  3QP6 A;  2EA9 A;  2VGL S;  3L7H A;  3DTE A;  4GZB A;  2VV8 A;  3ZCZ A;  5CHU A;  4B88 A;  4HBT A;  5EVE A;  5IU1 A;  3ZNY A;  4S2L A;  2WZX A;  5EM1 A;  3ZG0 A;  3P01 A;  3PAE A;  4JPM A;  2V8C A;  1NRF A;  2Z2M B;  1E4D A;  3A0R A;  3HLG A;  1N4O A;  1A0K A;  3PAG A;  1WYB A;  3BQA A;  3EQU A;  3QHY A;  3UB6 A;  1RGZ A;  1LSX A;  1LSW A;  5EVI B;  2P74 A;  5KMW A;  1TS6 A;  5EOE A;  4E3L A;  4GD6 A;  4HIA A;  4QY5 A;  3EEH A;  3NC8 A;  2E8J A;  4UEY A;  4WEK A;  3CWF A;  3VP3 A;  5LBR A;  4OLG A;  1IOU A;  2Y91 A;  1SZV A;  5FI2 A;  3T4K A;  3MFD A;  4MEZ A;  3FV7 A;  2XRN A;  1KE3 A;  2QPN A;  2Y2P A;  3NOT C;  4G3W A;  3BEB A;  3C4P A;  3MXR A;  1YSQ A;  3PXP A;  1E25 A;  4KQR A;  4UHU A;  4KQO A;  2Y2G A;  2Y2Q A;  2PT7 A;  4IUH A;  2X01 A;  2HPB A;  2W27 A;  3E0Y A;  3CLO A;  3NY4 A;  3VP4 A;  2ZMA A;  4E3K A;  3W4P A;  3PBQ A;  3V3R A;  5U47 A;  1BYW A;  3PYP A;  3EGX C;  3LIC A;  4DRT A;  1ODV A;  4KQD A;  4GD8 A;  1ESU A;  2OWJ A;  2CC1 A;  3BFF A;  1LHY A;  1KDS A;  2PD7 A;  4RQ9 A;  2FFY A;  3EWK A;  1GHI A;  1KGE A;  1LL5 A;  2HF6 A;  4FD8 A;  2VKS A;  4X68 A;  1ESI A;  5HDD A;  5DFX A;  3MQO A;  3UO9 A;  3IXB A;  2Y2L A;  3JVV A;  5FI7 A;  5FAQ A;  5D3O A;  3IHB A;  4HHD A;  1HTZ A;  4CPK A;  3BW6 A;  3MMH A;  3BLS A;  5J4E A;  2J3T C;  2A3U A;  5AVF A;  1BZA A;  4BD1 A;  3DTK A;  1GCE A;  3ZNT A;  3HLE A;  4NET A;  3UB7 A;  1GA0 A;  3ZG5 A;  4GHI A;  3RTY A;  4PPR A;  3GVB A;  5J8X A;  2XEP A;  3LIB A;  1X0O A;  4LV2 A;  3T4S A;  2O9C A;  1MBL A;  4O7D A;  3FG8 A;  3LY4 A;  3OPH A;  2ZQC A;  2M7V A;  5F1F A;  5EUA A;  4E3N A;  3BFD A;  3ZG7 B;  2JN7 A;  2FFF B;  2JKT M;  2QWS A;  5AQ9 A;  5HAP A;  3P98 A;  2PD8 A;  4WZ4 A;  1XA7 A;  4GN2 A;  1QMF A;  3BY8 A;  5EFW A;  1CF0 A;  4JXW A;  4R3A A;  3U2A A;  3IX4 A;  4RA7 A;  4H6J B;  2EFU A;  1E3U A;  3RFB A;  4JXG A;  5KSH A;  2I9V A;  3E2K A;  4NXE A;  2ZC4 B;  4OP5 A;  4EV4 A;  2WYX A;  2OLU A;  4P6B A;  3LIF A;  4IBX A;  2ZC3 B;  3MZE A;  2X71 A;  1N9N A;  2XD5 A;  3HLF A;  1VQQ A;  1XJ6 A;  4WZ5 C;  3T50 A;  4IBR A;  4LRZ E;  5A91 A;  2JE5 A;  3S4X A;  3ICY A;  2ZL1 A;  4H6J A;  1H8M A;  1BT5 A;  1GSV A;  3LI9 A;  3WS0 A;  3C7U A;  1TEM A;  3LCE A;  1T18 A;  4E3O A;  3N6I A;  2Y55 A;  2J3T D;  2VX8 A;  4WBG A;  4P87 A;  2W3H A;  4JF4 A;  2XFS A;  1Q2Q A;  4ID4 A;  2WAD A;  3DWZ A;  4EUV A;  3MQ0 A;  5DVA A;  4EQ1 A;  3UPN A;  4Z9Q A;  3N4I A;  4Q8I A;  3FPW A;  5CTM A;  3OCN A;  5DF7 A;  5CEC A;  4IED A;  5F6A A;  2JKR M;  2HJE A;  4NXF A;  3WS5 A;  3ZQ5 A;  4LV3 A;  1NZU A;  2XR0 A;  5GHZ A;  2B18 A;  3E4O A;  3MXS A;  5G4Y A;  3S22 A;  4YNR A;  5EEC A;  1G6O A;  4OH0 A;  5G4Z A;  1ES5 A;  3T4J A;  4I39 A;  3T1Q B;  4HES A;  1CI8 A;  4EET B;  5JYO A;  4K0X A;  4L9F A;  5E43 A;  2B95 A;  1GSW A;  4HNB A;  2XA7 S;  4CLC C;  4BWI A;  2JKG A;  4HOI A;  3UB9 A;  1CEF A;  2WKR A;  1MWT A;  2Y2H A;  3WS1 A;  2YKF A;  1PWG A;  2YKH A;  4OQI A;  2HDQ A;  3Q81 A;  4QWO A;  4BBU A;  2B02 A;  4G3V A;  2W1T B;  5HL1 A;  5HAQ A;  3KO6 A;  1NXY A;  1G68 A;  3LUQ A;  1KGG A;  5E2F A;  5FQI A;  4GCZ A;  2ZC6 B;  1FSW A;  4CQH A;  3KSG A;  1FCM A;  1NYM A;  2NUT C;  3ZVW A;  4RVA A;  3C7V A;  4I5S A;  1NJ4 A;  3DTI A;  2W1T A;  5KZH A;  4UA7 A;  3HLW A;  1YAX A;  3BFE A;  2VK3 A;  4JBF A;  3UE0 A;  1NLY A;  3LEQ A;  3UE1 A;  3LR3 A;  2ZQA A;  3OOV A;  4ZAM A;  1LL9 A;  1OME A;  5HWT A;  1BTL A;  2BTF P;  3KYE A;  2ZJ9 A;  2BAS A;  1MWU A;  5EE8 A;  4DDS A;  4WYY A;  3TOI A;  4S2I A;  3CJM A;  4KZ8 A;  1YMX A;  4CLC D;  4LV0 A;  4C75 A;  3CI6 A;  3BRM A;  4S2P A;  5A8B A;  2P9V B;  4FCF A;  4JKT A;  3QNB A;  4RYE A;  3ZVT A;  4P6Z M;  4HH2 A;  5EOO A;  1YLZ A;  4ZDX A;  1P9R A;  2DMW A;  2A2L A;  4KG5 A;  5GLD A;  5EVI C;  1XJ3 A;  3SH7 A;  4WMC A;  3RXW A;  3BLM A;  4NXB A;  1XFN A;  1MY8 A;  3FC7 A;  3N8S A;  1XA1 A;  4DN0 A;  5FDS A;  3S7P A;  3A3F A;  1NY0 A;  3Q1F A;  2OLV A;  3BM6 A;  2R78 A;  2ZM2 A;  1MZU A;  2WZZ A;  1C3B A;  2G2U A;  3JVU A;  1F2K A;  1PZO A;  2Y2O A;  4EBL A;  2UV0 E;  5HD5 A;  4LCM A;  1OJ5 A;  4BLM A;  1P9W A;  4X69 A;  4MMN A;  2Y2I A;  3G2Y A;  1Y54 A;  4L9G A;  1FIL A;  3NBL A;  4R4S A;  1K6R A;  3G32 A;  1VHM A;  1I2S A;  4ZBE A;  3QP8 A;  4DE2 A;  3D4F A;  1ACF A;  1ALQ A;  1T19 A;  1Z09 A;  3VP0 A;  1LT0 A;  3CPT A;  3RJU A;  3KX0 X;  5FL3 A;  4D60 A;  4EU0 A;  1M6K A;  4ZTK A;  2PBD P;  3AGD A;  4R3B A;  2V1B A;  3F1O B;  2ZMV A;  5A90 A;  3SS4 A;  1J3W A;  4N9K A;  1L0D A;  1OTA A;  3ZGA B;  5HFO A;  2H5S A;  2BLS A;  3P7N A;  5AJG A;  5EVI D;  3UDI A;  3WS4 A;  4ZJ3 A;  1WE4 A;  3BQ8 A;  5TBM B;  2GNX A;  3MZD A;  3H9W A;  2KLI A;  5J7E A;  4KG6 A;  1XGJ A;  3PBN A;  2OAP 1;  3F1O A;  4NXG A;  3LIA A;  1YMS A;  2HGV A;  3SZT A;  3UPP A;  4BD0 A;  4B4Z A;  3Q7V B;  3HCY A;  1SHV A;  4OQH A;  2R9X A;  2WAF A;  4HP9 A;  3NUL A;  2WAE A;  5TBM A;  1YQS A;  1UWN X;  4DDY A;  3BFC A;  4R3J A;  4FSF A;  3VOZ A;  3TSG A;  1BLH A;  3GMW A;  1LSV A;  4X56 A;  5F68 A;  4OPZ A;  2XF3 A;  4KZB A;  4PAU A;  3H82 A;  3BFG A;  4E6X A;  3OC2 A;  3Q7V A;  3RXX A;  1GHP A;  3S1Y A;  4IUK A;  1LI9 A;  1TS7 A;  4UAA A;  2E8I A;  1JWP A;  5FAS A;  1H8Z A;  3SH9 A;  3HUM A;  1XX2 A;  2VEA A;  4HJ6 A;  3BYD A;  2RL3 A;  2VA0 A;  5FQJ A;  2B5R A;  4KUK A;  5CRF A;  2KX6 A;  2EWW A;  1TD5 A;  3UE3 A;  1TS0 A;  1K54 C;  4HY8 A;  4E3J A;  4B93 A;  5L10 A;  3UB5 P;  3EEA A;  2PR5 A;  1GHM A;  1FIK A;  2ZQ8 A;  2ZC5 B;  4E3I A;  1MC0 A;  4KZ4 A;  2V2F F;  1SCW A;  4LPZ A;  3OPP A;  2EFX A;  1VB6 A;  3LY3 A;  2XDM A;  1YLY A;  1FR6 A;  4JLF A;  2Y59 A;  5AQA A;  3UN7 A;  1T1C A;  4U3T A;  1LL8 A;  1ZC2 A;  5GHY A;  2K7S A;  2HDS A;  1PZP A;  4IVI A;  2QHK A;  3T1S A;  2OWH A;  4NEE D;  1IYQ A;  5K5B A;  3ULF A;  3WRT A;  4D2O A;  1IYS A;  2L4R A;  4I38 A;  5FDH A;  1V9Z A;  3BEC A;  3ZYT A;  2J8Y A;  2PDR A;  1SKO A;  4JGO A;  4DJ2 A;  3B42 A;  4QY6 A;  3S7O A;  3Q07 A;  4EES A;  5M1A A;  1G6A A;  4EW7 A;  4NK3 A;  4QHC A;  4Y0T A;  1SDN A;  2PR6 A;  4GHI B;  4X1L A;  4JXV A;  4XXR A;  5M19 A;  1OTD A;  2OV5 A;  2K2N A;  1D7E A;  3HLB A;  4JGR A;  1IEM A;  2X02 A;  4R38 A;  4OVD A;  1N9O A;  3OPL A;  3R7W B;  4BMW A;  3W4Q A;  2PBY A;  3K3C A;  3CZD A;  5CGS A;  1UWP X;  4EQI A;  1MWR A;  4X25 A;  1TDG A;  4MCW A;  1WYC A;  2A24 B;  3IF6 A;  2GJ3 A;  4EER A;  5M18 A;  1HVB A;  4N1X A;  3KYQ A;  3LR4 A;  5GLB A;  4RX3 A;  3LGO A;  3SH8 A;  2EWV A;  1NRJ A;  3R7W A;  5CER A;  5CGW A;  2VLG A;  3OLO A;  5HWV A;  4WLA A;  3V3S A;  2IWC A;  5FAO A;  2J9O A;  2ZL1 B;  2KDK A;  3IT9 A;  1PFL A;  5DJU A;  2A24 A;  3N7W A;  1K4E A;  4GB7 A;  5FQQ A;  1OPX A;  5C5K A;  1S67 L;  2CMN A;  4ETZ A;  1W63 M;  4E6W A;  4MBF A;  2W3F A;  1HZO A;  3C4O A;  2VZW A;  1YPR A;  1PRQ A;  1D1J A;  3KSH A;  2GX5 A;  4A5R A;  1PIO A;  2QJ5 A;  4OPY A;  2Q9M A;  1UGU A;  4DF6 A;  5F82 A;  4PM7 A;  4DMZ A;  1TS8 A;  1S0W A;  2J3W A;  1ES3 A;  3IX8 A;  4I3A A;  5A92 A;  4CJN A;  2ZC7 A;  3TE8 A;  2XGN A;  4DJ3 A;  3UDX A;  5EM0 A;  5F5Y A;  3W2Z A;  4FTX A;  1ONH A;  5FAT A;  1F5M A;  2W1R A;  2M1C A;  4S2N C;  3FKW A;  2QKP A;  5TGF A;  3L9K A;  5CGX A;  5HPI A;  4P6Z S;  5EVL A;  3ZFZ A;  4GNU A;  4Y3I A;  1IKG A;  1L3L A;  3GTC A;  1FSY A;  4IHQ A;  4KZA A;  4YIN A;  3C38 A;  2XD1 A;  3O87 A;  3QP4 A;  4OOL A;  1S4R A;  2QMI A;  5AQB A;  2L0W A;  2O0Y A;  2W3E A;  3OBF A;  5FAP A;  2Z6C A;  1W8Q A;  2M7U A;  2QJ7 A;  2Y2M A;  3QP5 A;  3V39 A;  4N1H A;  1L0E A;  5CX7 A;  5EPH A;  3FWL A;  1NLZ A;  1K55 A;  2HDU A;  1CQA A;  5F69 A;  2IWD A;  1ES2 A;  3KSF A;  1KVL A;  3Q7Z A;  5CTN A;  3VP2 A;  4HBU A;  3VE3 A;  1KDW A;  2HP5 A;  5HL6 A;  1CK3 A;  2XQZ A;  3IS2 A;  4BL2 A;  4IJG A;  3V5M A;  3A3I A;  5E2G A;  3DWK A;  5FQK A;  3ZHH A;  3UPO A;  2QYB A;  4X53 A;  4PM9 A;  3IF5 A;  4KUO A;  2V1A A;  1KVM A;  3M2J A;  1S6R A;  1JTG A;  4WF0 A;  3GSG A;  4MN6 A;  1OTE A;  5DF8 A;  3PR6 A;  4LLO B;  4X55 A;  1G5U A;  4M3K A;  1SKF A;  3DAV A;  3WRZ A;  3NOU C;  3DBA A;  2G7U A;  3PBR A;  4OLD A;  2EXB A;  2WGW B;  4WEJ A;  4KZ9 A;  3VSL A;  1ERO A;  2ZQ9 A;  4PM6 A;  3MF0 A;  1OJG A;  1N9B A;  3P09 A;  1QME A;  2V9A A;  4WL9 A;  2ZQ7 A;  4PKY A;  3G4P A;  5FI6 A;  5FSR A;  3UB8 A;  5IHV A;  2JBF A;  1MXO A;  2PYR A;  3ISG A;  4N9L A;  3NI9 A;  3VFH A;  1EI5 A;  1MWS A;  3EQV A;  4KZ3 A;  2WGW A;  1FCO A;  3DW0 A;  3D3O A;  3OPR A;  1S66 L;  4GDN A;  4QD4 A;  1ONG A;  4JGQ A;  3G6O A;  4B9O A;  4FOF A;  1RCJ A;  1S1Z A;  1DP6 A;  2FH5 A;  4YFM A;  1ZKJ A;  2EX6 A;  3KSI A;  3FKV A;  2V0U A;  2L1M A;  3HLC A;  3MKE A;  3SOI A;  4PMA A;  2ZM0 A;  3CIT A;  4U0T A;  2W3D A;  3A3D A;  5JYP A;  3FYZ A;  3T4T A;  3TRC A;  2DRW A;  4OKP A;  1TDL A;  5DF9 A;  4R1G A;  4HJ4 A;  2EX9 A;  3E4Q A;  3E98 A;  1K56 D;  4E3M A;  1CJF A;  3C8C A;  4DE0 A;  3IX3 A;  4R70 A;  3IWO A;  3T4Q A;  3A0S A;  4OPQ A;  2WUQ A;  2OSU A;  2MJ6 A;  1L0G A;  3MBZ A;  2H0T A;  1KE4 A;  5DKK A;  2V1Z A;  2Y79 A;  4UA6 A;  2O9A A;  4HJ3 A;  2H28 A;  3E2L A;  5DFY A;  3CPT B;  2GDN A;  4ZJ1 A;  4ME4 A;  5DKL A;  4R4R A;  2K31 A;  3ZDJ A;  4WEL A;  1PNE A;  1TVF A;  2ZMF A;  1T1B A;  4HQA A;  4Y7P A;  3RH8 B;  1K38 A;  3QNC A;  2WKI A;  5GL9 A;  1ERQ A;  3R4K A;  4PM8 A; 
#chains in the Genus database with same CATH homology
 1K54 C;  1BUL A;  3P98 A;  1RGY A;  4OQG A;  4WZ4 A;  3IXD A;  1XA7 A;  1H8Y A;  3HBR A;  4E3J A;  4GN2 A;  1QMF A;  4GOG A;  5FA7 A;  4JXW A;  1PW8 A;  4MBK A;  2EX8 A;  4FH2 A;  4OOM A;  1GHM A;  2BG1 A;  3M6B A;  4Y0O A;  2ZQ8 A;  2ZC5 B;  4RA7 A;  4E3I A;  1PYY A;  1NYY A;  3ITB A;  4KZ4 A;  2V2F F;  1DJC A;  1E3U A;  1HD8 A;  1FR1 A;  2EFU A;  2ZQD A;  3Q82 A;  1SCW A;  1JWV A;  4JXG A;  5KSH A;  4GKU A;  3OPP A;  3E2K A;  2EFX A;  5FQ9 A;  2ZC4 B;  3LY3 A;  4OP5 A;  2XDM A;  5CHM A;  4EV4 A;  1YLY A;  5G18 A;  1FR6 A;  4JLF A;  2C5W B;  2OLU A;  2WKE A;  2WYX A;  2Y59 A;  3GR2 A;  4P6B A;  5E2E A;  5AQA A;  3IWQ A;  5CED A;  4IBX A;  1O07 A;  3IWI A;  2HP6 A;  4S2O A;  2ZC3 B;  3MZE A;  2X71 A;  2WGV A;  3UN7 A;  4U3T A;  2EXA A;  5GHY A;  1ZC2 A;  2XD5 A;  3HLF A;  4MNR A;  5TR7 A;  3LEZ A;  2Y2K A;  2HDS A;  1VQQ A;  1PZP A;  4IVI A;  1YLP A;  4QU3 A;  4WZ5 C;  2G2W A;  1BUE A;  4IBR A;  5A91 A;  2JE5 A;  3S4X A;  3AGF A;  2R9W A;  1W79 A;  1IYQ A;  1BT5 A;  3WS0 A;  3WRT A;  4D2O A;  3C7U A;  1TEM A;  3LCE A;  1IYS A;  1PWC A;  2XLN A;  4E3O A;  5FDH A;  1XP4 A;  3N6I A;  2Y55 A;  3BEC A;  2J8Y A;  1LLB A;  4WBG A;  2VGK A;  3IH8 A;  4MBH A;  4P87 A;  1O7E A;  1DY6 A;  2XFS A;  4JF4 A;  4QY6 A;  4UA9 A;  3Q07 A;  5FQM A;  1KGF A;  5GLA A;  5M1A A;  1Q2Q A;  1G6A A;  4ID4 A;  5HX9 A;  3G34 A;  4NK3 A;  4QHC A;  4S2J A;  4EWF A;  2WAD A;  4Y0T A;  3DWZ A;  1YLT A;  1SDN A;  5DVA A;  3NIA A;  3UPN A;  1L2S A;  4Z9Q A;  3N4I A;  4Q8I A;  3FZC A;  4FH4 A;  5CTM A;  3WWX A;  4R0Q A;  3OCN A;  5DF7 A;  5CEC A;  4JXV A;  4XXR A;  4IED A;  5M19 A;  5BOH A;  2OV5 A;  2J7V A;  3HLB A;  1ZG4 A;  3M2K A;  1IEM A;  2X02 A;  3PBO A;  3WS5 A;  4QB8 A;  1MKI A;  3O3V A;  4LV3 A;  1NZU A;  4OVD A;  2XR0 A;  5GHZ A;  4XUX A;  3MXS A;  3S22 A;  3OPL A;  4KZ5 A;  3AGE A;  4WM9 A;  1XXM A;  3W4Q A;  3G35 A;  1LI0 A;  5EEC A;  2PBY A;  5GLC A;  4OH0 A;  1IEL A;  2UWX A;  1ES5 A;  3CZD A;  4JF6 A;  5I94 A;  1PI5 A;  5CGS A;  4EQI A;  1MWR A;  4S2K A;  3IH9 A;  1TDG A;  3NCK A;  1PWD A;  5CHJ A;  3ITA A;  4HES A;  3JYI A;  1CI8 A;  4K0W A;  1WYC A;  5JYO A;  4K0X A;  4WZ5 A;  3IF6 A;  3IXG A;  4LV1 A;  5E43 A;  3HVF A;  4B4X A;  4BQM A;  3W4O A;  2VGJ A;  5M18 A;  1HVB A;  4JF5 A;  4LCL A;  4L0L A;  4N1X A;  2P9V A;  4R23 A;  5GLB A;  1KE0 A;  4RX3 A;  3TG9 A;  3SH8 A;  1XKZ A;  4KZ6 A;  5DTS A;  3SS3 A;  4DXB A;  4K91 A;  4HEF A;  5CER A;  5CGW A;  4LEN A;  1CEF A;  3ZG8 B;  4PM5 A;  1MWT A;  2Y2H A;  3WS1 A;  3V3S A;  5CXW A;  4S2N A;  2IWC A;  1AXB A;  5FAO A;  3HLD A;  2J9O A;  1PWG A;  3V50 A;  4OQI A;  2HDQ A;  3Q81 A;  3IT9 A;  3MZF A;  3N7W A;  1K4E A;  5F1G A;  4GB7 A;  5FQQ A;  3UDF A;  5HL1 A;  5HAQ A;  1NXY A;  4XUZ A;  1G68 A;  3GQZ A;  4ZJ2 A;  1ERM A;  2ZM8 A;  2XK1 A;  1KGG A;  5E2F A;  4E6W A;  3GRJ A;  5FQI A;  3N8R A;  4MBF A;  4X6T A;  2ZC6 B;  1H5X A;  3CG5 A;  1FSW A;  1HZO A;  2DCF A;  3ZG9 B;  3C4O A;  3LO7 A;  1E3U D;  1K57 C;  3N8L A;  1FCM A;  1NYM A;  3GV9 A;  3MKF A;  1K55 C;  3PTE A;  4A5R A;  3ZVW A;  4RVA A;  1PIO A;  1IYO A;  3IF6 C;  4EUZ A;  1PW1 A;  4OPY A;  2Q9M A;  3C7V A;  4DE1 A;  1Z6F A;  1NJ4 A;  4Y0U A;  3IHA A;  4DF6 A;  5F82 A;  5EVI A;  4PM7 A;  3VFF A;  1S0W A;  2XFT A;  4OOY A;  1ES3 A;  5HAP A;  5KZH A;  1L0F A;  5A92 A;  2V20 A;  4CJN A;  2ZC7 A;  1K4F A;  2XGN A;  4N92 A;  3SS5 A;  4UA7 A;  3HLW A;  3UDX A;  3BFE A;  1FCN A;  1ONH A;  2WGI A;  4JBF A;  4OP8 A;  3B3X A;  3UE0 A;  1GA9 A;  1Q2P A;  2J9P A;  1VM1 A;  5FAT A;  3UE1 A;  1W8Y A;  3HL9 A;  4DXC A;  1K25 A;  2ZQA A;  2Y2N A;  4ZAM A;  2Q9N A;  4S2N C;  3VOY A;  1LL9 A;  1OME A;  1ZG6 A;  3FKW A;  4GDB A;  4H8R A;  5TGF A;  4U0X A;  1BSG A;  1BTL A;  1MPL A;  5CGX A;  2ZJ9 A;  1YM1 A;  5EVL A;  1MWU A;  5EE8 A;  3ZFZ A;  2RCX A;  4BL3 A;  4GNU A;  4DDS A;  1IKG A;  1FOF A;  1JTD A;  3VSK A;  3G2Z A;  3GTC A;  4WYY A;  4BEN A;  3TOI A;  1FQG A;  3NDG A;  3CJM A;  4S2I A;  1FSY A;  3OZH A;  3IF6 B;  4KZA A;  4KZ8 A;  1YT4 A;  2EX2 A;  1YMX A;  4YIN A;  4IVK A;  2XD1 A;  4LV0 A;  4C75 A;  3O87 A;  5TFQ A;  2WKH A;  3BRM A;  4F94 A;  4S2P A;  4OOL A;  2P9V B;  4FCF A;  4JKT A;  5CEB A;  3PBS A;  3QNB A;  4RYE A;  5AQ7 A;  2QMI A;  2Z2L B;  3ZVT A;  5AQB A;  3PBT A;  4DKI A;  2JC7 A;  4P85 A;  1YLW A;  3G31 A;  1K56 A;  2Y4A A;  5F83 A;  1XPB A;  5EOO A;  1YLZ A;  4ZDX A;  5FAP A;  1W8Q A;  3M6H A;  4KG5 A;  1K6S A;  2Y2M A;  5GLD A;  5EVI C;  3V39 A;  4N1H A;  1CI9 A;  1L0E A;  4KQQ A;  3SH7 A;  1K57 A;  1DJA A;  4WMC A;  5EPH A;  3UNW A;  3FWL A;  3RXW A;  2XH9 A;  3BLM A;  4GZB A;  1K55 A;  1MY8 A;  3ZCZ A;  3OCL A;  1U60 A;  3N8S A;  5CHU A;  2HDU A;  3CMZ A;  3HRE A;  3NDE A;  1XA1 A;  2IWD A;  4B88 A;  1ES2 A;  1KVL A;  3Q7Z A;  4HBT A;  1RP5 A;  5CTN A;  3VP2 A;  3ZNY A;  4HBU A;  3A3F A;  4S2L A;  1YLJ A;  1KDW A;  2HP5 A;  1NY0 A;  2WZX A;  1CK3 A;  3Q1F A;  1PI4 A;  3ZG0 A;  2OLV A;  2XQZ A;  3BM6 A;  4BL2 A;  3V5M A;  4RX2 A;  2ZM2 A;  3A3I A;  3PAE A;  4BJP A;  4JPM A;  2WZZ A;  1NRF A;  4DE3 A;  2Z2M B;  1E4D A;  1C3B A;  3HLG A;  5E2G A;  1N4O A;  3DWK A;  5FQK A;  3PAG A;  3ZHH A;  1WYB A;  2G2U A;  3UPO A;  4X53 A;  1PZO A;  4PM9 A;  4KG2 A;  1XGI A;  2Y2O A;  3EQU A;  3IF5 A;  4EBL A;  3QHY A;  1RGZ A;  4LCM A;  4BLM A;  1KVM A;  2JCH A;  3M2J A;  4X69 A;  1S6R A;  1JTG A;  5EVI B;  2P74 A;  2H0Y A;  2Y2I A;  3GSG A;  3G2Y A;  3UY6 A;  5KMW A;  3VMA A;  1Y54 A;  2Y2J A;  2I72 A;  5EOE A;  5DF8 A;  3NBL A;  4R4S A;  1K6R A;  5HAR A;  4X55 A;  4E3L A;  2H10 A;  3G32 A;  4M3K A;  1I2S A;  4GD6 A;  4ZBE A;  4QY5 A;  3NC8 A;  1SKF A;  4DE2 A;  2C6W B;  3D4F A;  1ALQ A;  4WEK A;  3VP3 A;  3A3E A;  3WRZ A;  4OLG A;  3VP0 A;  2A49 A;  1J9M A;  2Y91 A;  3RJU A;  5FI2 A;  3IQA A;  3MFD A;  4MEZ A;  3PBR A;  3FV7 A;  4OLD A;  1M6K A;  1BLC A;  2EXB A;  2WGW B;  4ZTK A;  1KE3 A;  2QPN A;  2Y2P A;  4WEJ A;  3BEB A;  3C4P A;  4R3B A;  3AGD A;  2QZ6 A;  4KZ9 A;  3VSL A;  1ERO A;  2ZQ9 A;  2HDR A;  3MXR A;  4PM6 A;  1N9B A;  3P09 A;  1QME A;  4C3Q A;  2IWB A;  1I5Q A;  1E25 A;  4KQR A;  4UHU A;  4KQO A;  5A90 A;  2Y2G A;  2Y2Q A;  3SS4 A;  5E2H A;  2ZQ7 A;  4N9K A;  1L0D A;  3A3J A;  3ZGA B;  3G4P A;  1ES4 A;  4JXS A;  5FI6 A;  2X01 A;  2HPB A;  5FSR A;  4OON A;  5HFO A;  5IHV A;  2H5S A;  2BLS A;  5EVI D;  3UDI A;  3WS4 A;  4ZJ3 A;  1WE4 A;  5GHX A;  3NY4 A;  3VP4 A;  2WK0 A;  2ZMA A;  4E3K A;  2JBF A;  1MXO A;  3ISG A;  5DTT A;  4N9L A;  3NI9 A;  5A93 A;  3VFH A;  1EI5 A;  1MWS A;  3EQV A;  3W4P A;  3PBQ A;  3V3R A;  5U47 A;  4KZ3 A;  2WGW A;  1FCO A;  3MZD A;  1M40 A;  3DW0 A;  5KSC A;  4KG6 A;  3OPR A;  4DRT A;  1XGJ A;  5HW3 A;  4GDN A;  3PBN A;  4QD4 A;  1ONG A;  2ZLY A;  1I2W A;  4S2M A;  1BLP A;  4GD8 A;  1ESU A;  1IYP A;  1YMS A;  1RCJ A;  2CC1 A;  1LHY A;  2ZD8 A;  3BFF A;  4OQ0 A;  1KDS A;  4YFM A;  1ZKJ A;  2EX6 A;  3O86 A;  3FKV A;  3UPP A;  4BD0 A;  2FFY A;  4B4Z A;  3O88 A;  1GHI A;  3Q7V B;  1EWZ A;  3HLC A;  3MKE A;  1KGE A;  1LL5 A;  4FD8 A;  4MLL A;  3SOI A;  4PMA A;  1W7F A;  2ZM0 A;  4X68 A;  1SHV A;  3DTM A;  4OQH A;  2R9X A;  2WAF A;  5L2F A;  1K54 A;  1ESI A;  3A3D A;  4KEN B;  2WAE A;  4U0T A;  1YQS A;  5DTK A;  1JVJ A;  3FYZ A;  3UO9 A;  3IXB A;  5JYP A;  2Y2L A;  5HAI A;  2DRW A;  4DDY A;  5FI7 A;  5FAQ A;  4P0M A;  5D3O A;  3BFC A;  4OKP A;  4R3J A;  1TDL A;  4R1G A;  5DF9 A;  3G30 A;  3IHB A;  4FSF A;  1DJB A;  2DNS A;  2EX9 A;  3VOZ A;  3TSG A;  1BLH A;  3GMW A;  1K56 D;  4X56 A;  4E3M A;  4EBP A;  4OPZ A;  1HTZ A;  4CPK A;  4DE0 A;  2XF3 A;  3IWO A;  4KZB A;  3BLS A;  1JWZ A;  4OPQ A;  2WUQ A;  2OSU A;  3BFG A;  2A3U A;  3I7J A;  4KZ7 A;  4E6X A;  1L0G A;  3MBZ A;  2H0T A;  3OC2 A;  2PU2 A;  1BZA A;  1W5D A;  4WMC D;  4BD1 A;  1GCE A;  3Q7V A;  1KE4 A;  3RXX A;  3ZNT A;  2V1Z A;  3HLE A;  1GHP A;  4QJG A;  3S1Y A;  4NET A;  3W8K A;  4UA6 A;  4EBN A;  3WS2 A;  3HUO A;  1GA0 A;  1LI9 A;  4OPR A;  3ZG5 A;  4UAA A;  2E8I A;  3E2L A;  1JWP A;  4PPR A;  5FAS A;  3GVB A;  5J8X A;  2XEP A;  2GDN A;  2HP9 A;  4ZJ1 A;  2PU4 A;  4C6Y A;  1H8Z A;  4LV2 A;  3SH9 A;  3HUM A;  4R4R A;  1XX2 A;  3ZDJ A;  3BYD A;  3IXH A;  1NZO A;  1SDE A;  4WEL A;  2RL3 A;  1TVF A;  1MBL A;  4O7D A;  3LY4 A;  5FQJ A;  3OPH A;  4Y7P A;  2B5R A;  2ZQC A;  5F1F A;  5EUA A;  4E3N A;  3BFD A;  3HUN A;  1CEG A;  1K38 A;  1BLS A;  5CRF A;  1IKI A;  3QNC A;  3VP1 A;  3ZG7 B;  3C5A A;  2FFF B;  2WKI A;  3UE3 A;  5GL9 A;  5AQ9 A;  1ERQ A;  4PM8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...