1XXMA

The modular architecture of protein-protein binding site
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
263
structure length
263
Chain Sequence
b'HPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDLVAASPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase TEM
molecule tags Hydrolase/hydrolase inhibitor
source organism Escherichia coli
publication title The modular architecture of protein-protein binding interfaces
pubmed doi rcsb
total genus 90
structure length 263
sequence length 263
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2004-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1xxmA00
1IYQA 4IEDA 1ES2A 5DF8A 1AXBA 3PBOA 4EWFA 1GHIA 4JKTA 4NETA 1PI5A 4OONA 1BLHA 2XDMA 3Q07A 2FFFB 2XLNA 3IWIA 1SDEA 4E3NA 4WYYA 3Q7ZA 1XKZA 1DY6A 2Y59A 3N8LA 3GR2A 3UY6A 2XD5A 1FCNA 2IWCA 2R9XA 2WAFA 3G2ZA 1IYOA 1JWVA 4R3JA 1K54A 4MBKA 3A3EA 4N9KA 2V2FF 2XD1A 4RX2A 4EBPA 3BLSA 2ZQ8A 5KMWA 5BOHA 5EVIA 5GLAA 4ZJ2A 3ZNYA 5CGWA 1YT4A 1XP4A 3VP4A 4BD1A 5U47A 3LO7A 1NYYA 2ZQDA 1CI8A 1TVFA 1SCWA 2EFXA 2ZC3B 4B88A 3HLBA 5KSHA 1MWRA 2G2WA 4R3BA 4WM9A 1MWTA 2ZC5B 5DF7A 5F82A 4Y0OA 5GHXA 2HP5A 3AGEA 3TSGA 1IYPA 1PWCA 1NY0A 2QMIA 3OCNA 2J9PA 3VFFA 4DE3A 3GV9A 3N4IA 4OLGA 1IKGA 4GD6A 4KQRA 3AGFA 4MBHA 3QHYA 4ZBEA 4EV4A 1IEMA 2OV5A 5FQQA 4N9LA 1K6RA 2ZMAA 2OLUA 2JC7A 4S2JA 1L0GA 2Q9MA 3GTCA 5CERA 5CGXA 3V50A 3A3FA 3WRTA 4E3OA 4S2MA 4F94A 3BFGA 5FQ9A 5E2HA 3PAGA 3IHAA 2WK0A 1NXYA 4MBFA 3W4PA 5HL1A 4KG5A 3MBZA 3BLMA 5EPHA 4FH2A 1Q2PA 2GDNA 5CXWA 3BYDA 4R0QA 4FSFA 4QY6A 1RCJA 3NDEA 3W4QA 1PYYA 1K25A 4KZ7A 1S0WA 4S2LA 1PIOA 3E2KA 5TR7A 3NY4A 1ZC2A 1HZOA 4A5RA 1YM1A 4GB7A 4GNUA 1FOFA 4CPKA 1BSGA 2Y2IA 3HREA 4X53A 4K0WA 2C5WB 4XUZA 5KSCA 2HDUA 1WE4A 4WMCA 1M40A 3Q7VA 3GSGA 1XA7A 5HAIA 1BTLA 1YLPA 4JXWA 3RJUA 1Q2QA 4KENB 4K91A 3Q81A 3WS4A 1PW1A 3LCEA 3SOIA 4OOYA 1YMSA 1NZOA 4JXVA 4OQ0A 3PBRA 3O87A 3SS3A 4S2KA 3VSLA 4E6XA 2I72A 5FQKA 1ERQA 5CEDA 1K4EA 3MZEA 4E3IA 1K38A 1LI9A 3V3SA 1K56D 2WADA 1NYMA 5FDHA 2Y4AA 3ZG0A 1DJAA 2EX2A 3IQAA 4QD4A 4BL2A 1L0FA 4KZBA 2PU2A 4KZ9A 4DXBA 1BLCA 1QMFA 3NC8A 4KZ8A 5FI7A 3TOIA 4N1HA 4IBRA 5E43A 3UPOA 2ZLYA 2BG1A 4U0XA 1NZUA 4U0TA 1CEFA 1K6SA 3FKWA 3UE3A 2ZQCA 1YMXA 3G32A 5CEBA 2EX8A 3M6BA 5HX9A 5JYOA 2EX6A 4Z9QA 4KZ3A 5AQAA 4L0LA 2Y2HA 3EQUA 5FAPA 5A90A 3FYZA 1BT5A 4U3TA 5DTSA 5EVLA 4C6YA 2ZM2A 3ISGA 5M19A 4P85A 2PU4A 2HP6A 4RVAA 1ZG6A 1FR6A 2JCHA 4WELA 5CTNA 4E3LA 3N6IA 5HAQA 1C3BA 3UDFA 2X02A 3I7JA 3PBQA 1G68A 5EOOA 5TFQA 4DF6A 5CTMA 3C7VA 3HUNA 4GD8A 1YLYA 2CC1A 2WGVA 4OLDA 3BFDA 3Q82A 5DTKA 3PBNA 5M18A 2WKIA 3HLCA 4H8RA 3B3XA 1HTZA 3ZFZA 1LL5A 2WZXA 3VMAA 1MXOA 3IWQA 4GN2A 2X01A 2JE5A 2WUQA 3V5MA 4OH0A 4RA7A 1EWZA 3DTMA 3GQZA 3GVBA 2HPBA 4WMCD 3ZVTA 1ESUA 3HL9A 3MZFA 3Q1FA 1JWPA 3O86A 4RYEA 4JF4A 3VFHA 4P6BA 4EBNA 2C6WB 4FH4A 5EE8A 2XFTA 2IWDA 3OC2A 3MZDA 2Y91A 3MXRA 3QNCA 4DE1A 2Y2LA 3A3IA 5FQJA 1ONGA 2WGIA 4R4SA 1ZG4A 2EXAA 3M2JA 5E2FA 4KZAA 2OLVA 2Y2PA 4LV0A 3N8RA 2VGJA 1ZKJA 1YLJA 4DXCA 2WAEA 4MNRA 4ZTKA 3CMZA 1I2WA 1SDNA 2EXBA 3HLGA 4MLLA 3IF6B 4P0MA 4YINA 3IT9A 5F83A 1U60A 1BLSA 4WEKA 4LV2A 2HDQA 4N92A 1CEGA 3NCKA 2WGWB 4UHUA 3BEBA 4JXSA 4XUXA 1GCEA 3SS4A 3CG5A 2ZD8A 1BUEA 2Y2KA 5F1FA 5KZHA 3PAEA 4YFMA 5G18A 3ZHHA 4OVDA 5GLDA 4PM7A 5FA7A 1W79A 4DDYA 5HW3A 2X71A 4JBFA 1L0EA 1WYCA 2HP9A 1XA1A 1KDWA 3ZVWA 4JF5A 1VM1A 3OPLA 4E3JA 1QMEA 4WZ4A 3LY4A 4QU3A 1JWZA 2WYXA 1KGEA 3UPNA 3VOZA 3OPRA 4DE0A 1PWDA 3VP2A 1ES5A 4QHCA 5AQ7A 1LLBA 4KQQA 2Q9NA 3N8SA 1PZPA 3UNWA 3SH9A 1KE4A 3O3VA 3WRZA 2R9WA 5DVAA 5GLCA 4P87A 3WS1A 3ZDJA 4E3MA 3G31A 5F1GA 4N1XA 4D2OA 4ZAMA 1TDLA 1W7FA 1GA0A 1GA9A 2G2UA 2J8YA 2ZC7A 5CHJA 5FSRA 3IF5A 4DDSA 5HARA 3HLFA 4QB8A 1SHVA 1EI5A 3BFFA 3EQVA 2WKEA 1E4DA 5M1AA 3W4OA 1KGFA 3OPHA 1ALQA 1FQGA 2A49A 5CECA 4FD8A 4IBXA 4IVKA 4OPRA 4S2IA 1KDSA 1KGGA 3IXDA 4GOGA 4MEZA 4Y0TA 4R23A 3NIAA 4EUZA 4LENA 1YLWA 4WEJA 3UPPA 3OZHA 1MY8A 4OP8A 1Z6FA 2HDSA 5D3OA 5GL9A 3C7UA 3ITBA 2Y2GA 3IXHA 2J9OA 2ZQAA 4OKPA 4Q8IA 1MWUA 1TDGA 3GRJA 3SH7A 3BFCA 2Z2LB 5GHYA 5AQBA 2B5RA 5EECA 4OOMA 4DKIA 1RGYA 1LI0A 4HBUA 3W8KA 1MWSA 1G6AA 1CI9A 2UWXA 3BFEA 3ZGAB 3DWZA 1IYSA 5EOEA 2A3UA 1JTDA 3HBRA 4C3QA 4OPYA 2H10A 1EROA 1GHPA 3E2LA 1DJCA 4KZ6A 2XFSA 5A93A 2XGNA 2Y2NA 3Q7VB 4S2PA 3SH8A 5I94A 1KVMA 3ITAA 4GDBA 3UO9A 1Y54A 3OPPA 3ZG7B 1RGZA 4OOLA 3IWOA 3ZG5A 2XH9A 4ZJ3A 4M3KA 3PTEA 4E6WA 4JXGA 2RL3A 1KE0A 2V1ZA 3GMWA 3HUMA 3IHBA 4GKUA 3VOYA 1E25A 2PBYA 1YQSA 3C5AA 1HD8A 3C4PA 4X69A 3OCLA 2EX9A 1N4OA 1WYBA 2E8IA 3IH8A 3UE1A 3ZG8B 5L2FA 4PPRA 3G30A 1K56A 3IF6C 1NJ4A 4UA6A 5TGFA 3LY3A 4K0XA 1SKFA 4R4RA 5FATA 1M6KA 2XR0A 4X56A 5EVID 4OQHA 3ZNTA 2QZ6A 4ZDXA 2J7VA 5JYPA 1H8YA 3C4OA 4Y7PA 3JYIA 5GHZA 3FZCA 4LCLA 5DTTA 5CHMA 3IF6A 3CJMA 4BD0A 1IELA 1XXMA 4HBTA 3IXBA 1K55C 3LEZA 3WS5A 1XGIA 2XK1A 3HVFA 5FAQA 3MKFA 3IXGA 5HAPA 2P9VA 4WBGA 4BL3A 3A3DA 1L2SA 1PW8A 3HUOA 5CHUA 5FAOA 1FCMA 1L0DA 1E3UA 1KVLA 3RXXA 3N7WA 1XPBA 2DNSA 4S2OA 1K57A 1KE3A 1PWGA 2OSUA 3HLDA 3VP0A 4BQMA 1K55A 4KG6A 1XGJA 2ZC4B 5CGSA 2ZQ7A 3VP1A 3O88A 5DF9A 1XX2A 1I2SA 3SS5A 3MFDA 4UA7A 4JLFA 1ERMA 3G2YA 4JF6A 4OQIA 4O7DA 4BENA 4PM6A 5GLBA 1S6RA 1IKIA 4E3KA 1JTGA 4UAAA 4PM8A 5AQ9A 3RXWA 5FASA 1ES3A 1PZOA 1BZAA 1H8ZA 1K57C 2XF3A 4KZ4A 2ZM8A 1HVBA 5A91A 3IH9A 3S22A 3VP3A 4HEFA 2H0YA 3HLEA 3PBTA 3DWKA 2QPNA 4KZ5A 2Y2MA 2V20A 1FSWA 2Z2MB 1FSYA 3MXSA 1PI4A 4FCFA 4LV3A 4C75A 2WGWA 4X68A 4GDNA 2Y2OA 2WZZA 4Y0UA 5E2GA 4CJNA 2DRWA 2ZM0A 1K54C 1H5XA 3BRMA 3NBLA 3NI9A 3M2KA 3AGDA 4X6TA 2Y55A 3V39A 1MBLA 4PM9A 3UDIA 1MPLA 4DE2A 1W8YA 4X55A 5EVIC 4B4ZA 4PMAA 3S1YA 1E3UD 3BECA 4QY5A 1GHMA 1RP5A 2DCFA 1MKIA 3UN7A 1O7EA 3NDGA 4B4XA 3S4XA 1NRFA 2FFYA 4KQOA 1BULA 1LHYA 4JPMA 4EBLA 3D4FA 3FKVA 3QNBA 3HLWA 3FV7A 3V3RA 4HESA 1BLPA 4OPQA 3A3JA 1K4FA 3CZDA 3M6HA 4WZ5A 3VSKA 2HDRA 4LCMA 4UA9A 2P74A 1ES4A 4RX3A 1DJBA 4DRTA 1N9BA 1I5QA 1ONHA 4NK3A 2H0TA 4ZJ1A 5HFOA 5A92A 2P9VB 3P09A 4LV1A 1ESIA 2RCXA 4OQGA 2EFUA 3BM6A 4PM5A 2JBFA 1J9MA 3TG9A 3WS2A 4BLMA 4XXRA 5CRFA 4S2NC 4KG2A 5EUAA 2ZJ9A 3MKEA 2Y2JA 4WZ5C 5FI2A 3UDXA 5E2EA 1VQQA 2IWBA 3UE0A 3G4PA 3PBSA 4OP5A 4QJGA 1YLTA 3ZG9B 2XEPA 4R1GA 1TEMA 5FQIA 3WS0A 3G34A 5J8XA 2VGKA 4OPZA 1FCOA 1W5DA 2XQZA 3DW0A 3G35A 4S2NA 1CK3A 2WKHA 2ZQ9A 1FR1A 4BJPA 1OMEA 3P98A 5EVIB 1W8QA 1YLZA 4EQIA 5FI6A 5IHVA 3FWLA 3WWXA 2BLSA 1O07A 2ZC6B 4IVIA 4GZBA 1LL9A 4ID4A 5FQMA 3ZCZA 2H5SA 2Y2QA 1JVJA
chains in the Genus database with same CATH superfamily
2WKQA 2OOLA 1ES2A 1AXBA 1PI5A 4NXBA 1VEUB 2XLNA 2Y59A 3U4LP 1FCNA 4F3LA 2WAFA 4R3JA 1IYOA 1JWVA 2GZAA 1K54A 2XD1A 3BLSA 3UB6A 5BOHA 2J3WA 5CGWA 1YT4A 1P9WA 1NYYA 1CI8A 4B88A 1SCWA 3F1OA 3CPTA 5KSHA 1MWRA 5DF7A 1IOUA 3L7HA 4BBTA 4OLGA 4HJ6A 3ZQ5A 4KQRA 4MBHA 3QHYA 2OV5A 4DJ3A 2JC7A 3V50A 3GTCA 2A24A 3WRTA 3A3FA 3BFGA 2VA0A 4Z1WA 3W4PA 4GJ4A 4FH2A 1XJ3A 2GDNA 3P7NA 4QY6A 3T4TA 4EEPA 1K25A 1PIOA 3KX0X 2VV7A 4HHDA 2V8CA 2VGLS 1HZOA 4A5RA 2W1TB 2XA7M 3HREA 4K0WA 4XUZA 4FTXA 1XFNA 4WMCA 2KX6A 4X1MA 4JXWA 1S1ZA 1YSQA 4NG2A 5HDCA 3CHWP 5DJUA 2PDRA 3MFXA 4JXVA 4OQ0A 3CPTB 2Y79A 1TS0A 3B47A 3O87A 2I72A 1K4EA 1NYMA 5FDHA 2Y4AA 3ZG0A 4QD4A 3IQAA 1BYWA 4KZBA 5HSQA 4KZ8A 5TJJA 3LR3A 4PKYA 2PYPA 4U0TA 1CEFA 4GCZA 1S66L 3GDIA 5JYOA 2P7JA 3CWFA 5I5LA 3EQUA 5FAPA 4U3TA 5DTSA 5EVLA 2J3TC 5M19A 4MN6A 2B18A 3N6IA 5HAQA 2M7VA 3C7VA 4OLDA 3HLCA 3B3XA 1HTZA 4CLCC 2WZXA 1MXOA 4E04A 2WUQA 4OH0A 3ZVTA 3GVBA 3IS2B 3HL9A 3MZFA 3H9WA 4RYEA 2ZMVA 4XT2A 4P6BA 2VK3A 2XFTA 3MZDA 2W1TA 2Y2LA 3M2JA 4PKYG 4DXCA 1I2WA 1S4RA 3IF6B 4YINA 4WEKA 4N92A 4XUXA 2WGWB 2ACGA 2EWWA 5GLDA 3CAXA 4MN7A 1XA1A 1KDWA 1DP8A 3LY4A 1NWZA 1CJFA 4DN0A 4DE0A 3VP2A 1LT0A 3SH9A 1KE4A 4P87A 3G31A 3KSHA 4N1XA 1GA9A 2G2UA 5CHJA 5FDSA 4BBUA 1XJ4A 3W4OA 1KGFA 3OPHA 2V0UA 2PAVP 4GOGA 4WEJA 3C38A 1MY8A 2B02A 2HDSA 4QPRA 5GL9A 3ITBA 3IXHA 3EEAA 4OKPA 2KOIA 1MWUA 2Z2LB 5AQBA 2B5RA 4DKIA 2AVXA 1LI0A 4YWZA 2H10A 1GHPA 3A0SA 4KZ6A 1KVMA 3ITAA 3EWKA 3UO9A 1Y54A 4OOLA 1OJ5A 4LRXC 3PTEA 2RL3A 1KE0A 3IHBA 3KSIA 3RH8B 2HGVA 4X69A 2EX9A 3LIDA 4G3WA 3NJAA 3G30A 3IF6C 4UA6A 4K0XA 1M6KA 3UE6A 2QZ6A 3LIEA 2IA2A 2NUPC 3IF6A 4JGQA 4BD0A 1TD5A 1IELA 5FL3A 3IXBA 1XGIA 2V0WA 3MKFA 5HAPA 2P9VA 2V1AA 3A3DA 3HUOA 5FAOA 2XROA 4S2OA 1XPBA 2DNSA 1K57A 1KE3A 4PM5A 2INWA 4NKPA 4KG6A 4LRZE 3VV4A 1XGJA 5DF9A 3CUEC 3MFDA 4UA7A 4UQIS 3B42A 2VV8A 4O7DA 5GLBA 1S6RA 1IKIA 1G5UA 1ZHHB 1JTGA 4MDZA 4KZ4A 1BZAA 1K57C 1HVBA 5EV0A 5A91A 3IH9A 2H0YA 3PBTA 3SW1A 2QPNA 3JPUA 2VKSA 1FSWA 3MXSA 3LICA 3MR0A 4Q0JA 4Y0UA 2WZZA 1H5XA 4P6ZM 4NXGA 2Y55A 4DE2A 3LI8A 2EA9A 1JNUA 2DCFA 2Y8HA 4LFUA 2PT7A 1LHYA 4JPMA 4R38A 3D4FA 1S1YA 3M6HA 4LCMA 4DRTA 1I5QA 4ZJ1A 5DKKA 5A92A 2BTFP 2EFUA 3BM6A 3TG9A 3WS2A 2K2NA 1OJGA 5EM1A 3MKEA 2PRFA 3EEHA 3UE0A 1YLTA 2XEPA 2GJ3A 3WS0A 1W5DA 1CK3A 2WKHA 1OPXA 5FI6A 3NOTC 3FWLA 3WWXA 1O07A 4GZBA 1LL9A 2H5SA 3E4PA 3MS6A 4IEDA 5DF8A 3PBOA 4JKTA 4NETA 4OONA 1BLHA 3Q07A 3F1PB 4E3NA 3GR2A 1IFQA 2LB9A 2R9XA 3KSGA 4MBKA 3DTEA 2V2FF 4RX2A 2G7UA 4EEUA 2ZQ8A 5KMWA 4R3AA 5GLAA 2W3FA 4ZJ2A 3VP4A 3DAVA 2ZQDA 1TVFA 2G2WA 2DMWA 4WM9A 1MWTA 5F82A 4Y0OA 2KLIA 3VFFA 3GV9A 3LR0A 5G4YA 1OTEA 2ZBBA 4ZBEA 3OOVA 1IEMA 5FQQA 1K6RA 2OLUA 4BWIA 4S2JA 1L0GA 2Q9MA 4EUVA 4S2MA 5FQ9A 2WK0A 1CF0A 3MBZA 3BLMA 3BYDA 1RCJA 3NDEA 3QP8A 3FPWA 5TR7A 1TF1A 3S7OA 1ZC2A 1YM1A 1BSGA 2Y2IA 3SZTA 5KSCA 4I3IA 3O5YA 1WE4A 4O0PA 3Q7VA 2ZOIA 5HAIA 1T18A 3Q81A 1P9RA 3LCEA 1YMSA 4QWOA 3IBJA 3NOPC 3SS3A 2PBDP 1ERQA 3MZEA 4DJ2A 4LGWA 2R78A 5LBRA 5L09A 1DJAA 2EX2A 4BL2A 4DXBA 3NC8A 3T4JA 3JVVA 5E43A 2XSSA 2ZLYA 4U0XA 3NULA 3FKWA 1YSPA 2ZQCA 4HNBA 5HX9A 5J3WA 5AQAA 2V1BA 4L0LA 3FYZA 2ZM2A 3ISGA 2JCHA 1VHMA 4DF6A 3UDFA 5TFQA 4LPZA 4F3LB 4GD8A 1N9LA 1YLYA 2EWVA 5DTKA 2OAP1 2WKIA 4H8RA 1NRJA 3LEQA 2W3DA 3ZFZA 3K3DA 1KOUA 3IWQA 4Y5FA 2M7UA 3GQZA 5C5KA 1JWPA 3VFHA 1T1CA 3OLOA 2XA7S 3MXRA 3QP5A 3QNCA 4DE1A 3BQAA 2WGIA 2EXAA 3MXQA 4ARZB 4I5SA 2VGJA 4ZTKA 4MLLA 3IT9A 1U60A 4GS9B 3NCKA 3BEBA 3CG5A 3ICYA 1GSXA 5KZHA 4JGRA 3PAEA 4YFMA 4OVDA 3FC7A 5FA7A 4DDYA 4BBVA 1K0KA 3OPLA 1QMEA 1KGEA 3RTYA 3LFVA 4QHCA 2A24B 4KQQA 2Q9NA 3N8SA 1PZPA 3R7WB 3O3VA 1NLZA 3T12B 1HLUP 2V8FA 4YNRA 4ZAMA 2J8YA 4DDSA 5FSRA 5HARA 3HLFA 3EQVA 2A49A 4IVKA 4OPRA 3LI9A 4JGPA 3TW8A 4R23A 4EUZA 2VLGA 4OP8A 3K2NA 2KDKA 1XJ6A 1OT9A 1SZVA 4Q8IA 3R7WA 3SH7A 3BFCA 3T4LA 4OOMA 3W8KA 1T1AA 1YAXA 5EOEA 2A3UA 3S7PA 2Z6DA 4IHQA 5A93A 4Y3IA 2Y2NA 3SH8A 5EFWA 1P97A 1RGZA 3T50A 4Y2FA 4ZJ3A 4M3KA 4JGOA 2V1ZA 3P01A 4L9EA 1LSVA 4GKUA 3T4OA 3VOYA 5L8MA 1E25A 1YQSA 5HD3A 3C5AA 3HCYA 5K5BA 4WUJA 1N4OA 3ZG8B 5L2FA 1NJ4A 1OT6A 2XR0A 1P0ZA 3ZNTA 4NXEA 1H8YA 4Y7PA 3JYIA 3FZCA 5CHMA 3CJMA 1XXMA 2OWJA 4HBTA 5IS1A 3WS5A 3HVFA 3UMDA 4HP4A 4BL3A 4NEED 5CHUA 2B95A 3LIAA 1L0DA 1KVLA 3MQQA 3HLDA 2OSUA 1DRMA 3T1SA 1VEUA 2ZC4B 4R70A 4Q0IA 3SS5A 4X25A 3RXWA 5FASA 5AQ9A 2W27A 1PZOA 3OBFA 1D06A 1Z09A 5IT5A 1SKOA 3HLEA 2UV0E 2MJ6A 4KZ5A 2V20A 4EETB 2ZM0A 3BRMA 3NBLA 4EW7A 3AGDA 4X6TA 1MBLA 4PM9A 1H0MA 3VE3A 1MPLA 3QP1A 5EVIC 1E3UD 3BECA 4QY5A 1O7EA 1NRFA 2LB5A 3QNBA 1PRQA 3FV7A 4HESA 4OPQA 3A3JA 1K4FA 4WZ5A 1S4SA 2P74A 3VE4A 2H0TA 3P09A 4OQGA 2JKTI 5EUAA 4GHIB 2ZJ9A 2W3HA 4WZ5C 5E2EA 2L4RA 3G4PA 3PBSA 4QJGA 5AJGA 4R1GA 3G34A 1FCOA 2W0NA 3FG8A 1SKOB 1OMEA 5DFYA 5EVIB 4EQIA 5IHVA 3KYZA 2BLSA 2JN7A 1JVJA 2H28A 2XDMA 5DJTA 1SDEA 3LYXA 4WYYA 1XKZA 3FPVA 2IWCA 3G2ZA 3A3EA 2M1CA 1MZUA 4EBPA 4KQDA 2O9BA 1XJ2A 3ZNYA 1XP4A 3MMHA 4HJ3A 2EFXA 4GS9A 4R3BA 1F2KA 5GHXA 4I38A 2HP5A 1F98A 2Z6CA 3TSGA 1IYPA 1PWCA 3OCNA 5IU1A 3N4IA 1EW0A 1IKGA 4GD6A 4EV4A 4EU0A 3DBAA 4N9LA 5CERA 4E3OA 4F94A 5HL1A 2WKRA 5EPHA 1Q2PA 3IS2A 2K7SA 3D3OA 3H82B 4S2LA 3E2KA 2HF6A 3NY4A 3EGDC 4CLCB 4GB7A 4X53A 2VGLM 5EM0A 2HDUA 2VX8A 1XA7A 2ZOHA 2JKFA 2Q0OA 1Q2QA 1ODVA 4K91A 3SOIA 4OOYA 3NOUC 3F1OB 4S2KA 2JKGA 1LI9A 3V3SA 1L0FA 2PU2A 3QP4A 5FI7A 2PR5A 4N1HA 4IBRA 1DP6A 3UPOA 2BG1A 1NZUA 5HZHA 1YMXA 3G32A 2EX8A 4PAUA 3M6BA 1TS7A 2EX6A 3BY9A 4KZ3A 5A90A 1BT5A 3T4KA 3QP2A 4P85A 2HP6A 4RVAA 4E3LA 3L9KA 3H7WA 1C3BA 3PBQA 3I7JA 1G68A 2CC1A 3BFDA 3Q82A 3VOLA 4MMNA 2PD8A 2A2LA 4WLAA 3CLOA 4GN2A 2X01A 2JE5A 3V5MA 3NECA 1T1BA 3UMEA 4FOFA 4RA7A 4WMCD 2HPBA 3T4QA 3Q1FA 3O86A 4EBNA 2C6WB 4CLCD 4Y17A 3JVUA 2IWDA 3OC2A 3F1PA 2GX5A 3A3IA 1ZG4A 4LV0A 2VJWA 2K31A 3N8RA 2OWHA 1ZKJA 3CMZA 1SDNA 2EXBA 4P0MA 5F83A 2HDQA 4JXSA 2ZD8A 1BUEA 5F69A 5F1FA 2PHYA 4PM7A 3ZYTA 5HW3A 2X71A 2ZL1A 1L0EA 3MQ0A 4JF5A 3LR5A 4WZ4A 4QU3A 4ARZA 2QKPA 3UPNA 3VOZA 3OPRA 1PWDA 1CQAA 1ES5A 1LLBA 3UNWA 2R9WA 5DVAA 5GLCA 2CMNA 4E3MA 4WF0A 3BY8A 4D2OA 4D60A 1W7FA 1GA0A 2ZC7A 3IF5A 4H6JA 5HDDA 1EI5A 4L9GA 5M1AA 2W3EA 3MQOA 1ALQA 1FQGA 4FD8A 4IBXA 4S2IA 1A0KA 3A0VA 1KDSA 3IXDA 4MEZA 4Y0TA 3NIAA 1YLWA 3UPPA 4G3VA 2J9OA 3B33A 1UGUA 5J4EA 3LGOA 3GRJA 5GHYA 1RGYA 4HBUA 1MWSA 5EVEA 4Y13A 2UWXA 3BFEA 3ZGAB 3DWZA 1IYSA 5HL6A 4OPYA 1EROA 2ZL1B 1DJCA 1PNEA 3HJIA 3U2AA 4S2PA 3Q7VB 3KSFA 5I94A 2D02A 5CX7A 4GDBA 5A8BA 3OPPA 1F5MA 3F1NA 3R4KA 5F68A 1WA9A 3ZG5A 1MC0A 2PYRA 4MCWA 4KUKA 1YKDA 1HD8A 3MJQA 4HI4A 3C4PA 4Q0HA 3E4OA 3IH8A 3TRCA 2P08A 4R4RA 4HIAA 4WL9A 4ZDXA 1N9NA 1AWIA 4LCLA 3F1NB 5DTTA 1VETA 4IUHA 2XK1A 4HH3A 2D01A 4WBGA 4KUOA 1L2SA 1PW8A 1FCMA 1E3UA 3N7WA 3E98A 4UQIM 1PWGA 4ZRRA 4BQMA 1DP9A 3VP0A 5HPFA 1I2SA 3T1XA 4JLFA 2O99A 3PYPA 1ERMA 4OQIA 3CITA 4PM6A 4PM8A 2XF3A 2ZM8A 3D9YA 3BWLA 3S22A 5TBMA 4HEFA 1H8MA 1Y28A 1FILA 2Y2MA 1PI4A 4LV3A 4C75A 4X68A 4GDNA 2QYBA 5E2GA 1K54C 3NI9A 3M2KA 1ZTUA 3V39A 2E8JA 2JHEA 1W8YA 4X55A 4B4ZA 4PMAA 4O01A 1GHMA 3K3CA 1MKIA 1TS8A 3NDGA 4B4XA 3BJNA 1BULA 3PHYA 3FKVA 2HV1A 3HLWA 3NHQA 3V3RA 1BLPA 5AVEA 2O9CA 3CZDA 3E4QA 3VSKA 4UA9A 4L9FA 1ES4A 5DKLA 4RX3A 1DJBA 1ONHA 4NK3A 4M4XA 2P9VB 4LV1A 2JBFA 4BLMA 4XXRA 4EERA 3HJKA 3IX8A 1D7EA 2Y2JA 4GHIA 2QHKA 3RFBA 3C2WA 1VQQA 2IWBA 3H7WB 1S67L 4OP5A 4DMZA 2FH5A 5FQIA 5J8XA 2VGKA 2XQZA 3DW0A 3G35A 2ZQ9A 4ETZA 4BJPA 3P98A 1W8QA 3UB8A 5G4ZA 5HDSA 1UWNX 4IVIA 3ZCZA 2Y2QA 3LY3A 4IJGA 4XT2B 1IYQA 4EWFA 1GHIA 2FFFB 3IWIA 2O9AA 3Q7ZA 4FUWA 1DY6A 3N8LA 4CQHA 3UY6A 2XD5A 4N9KA 3QP6A 1MKMA 4EESA 5TBMB 1L3LA 5EVIA 1G28A 1T19A 5U47A 3LO7A 2ZC3B 3HLBA 1GSWA 2ZC5B 2W3GA 2XRNA 3AGEA 5HD5A 1NY0A 2QMIA 2J9PA 4DE3A 3ULFA 3KO6A 3AGFA 1VB6A 1LSWA 2ZMAA 2QJ5A 5CGXA 1H3QA 3MF0A 5E2HA 3PAGA 4R6LA 1W63Q 3IHAA 1NXYA 3KYEA 4MBFA 2WKPA 4KG5A 4GLQA 5HWVA 5CXWA 4R0QA 1X0OA 4FSFA 3PXPA 3W4QA 1PYYA 2FZ0A 4KZ7A 1S0WA 3DTIA 3UB5P 4CLCA 4GNUA 1FOFA 4CPKA 5FEFA 4HH2A 2C5WB 5F5YA 2PD7A 4MN5A 1M40A 3GSGA 1BTLA 1YLPA 3RJUA 5HWTA 4AFIA 4RQ9A 2YKFA 4GW9A 4KENB 3WS4A 1PW1A 1NZOA 3PBRA 1W63M 3VSLA 4E6XA 5FQKA 5CEDA 4E3IA 4WN5A 1K38A 3T4SA 4LLOB 1K56D 2WADA 4KZ9A 4PHTA 1BLCA 1QMFA 1F9IA 3TOIA 2JKRI 2I9VA 3E0YA 1K6SA 3UE3A 4ESPA 1V9ZA 5CEBA 2PR6A 4ETXA 4Z9QA 2Y2HA 1OTAA 4BMWA 4C6YA 1XFQA 2PU4A 1ZG6A 1FR6A 2L0WA 4WELA 5CTNA 3S7QA 4II7A 3C8CA 2X02A 5EOOA 5CTMA 3HUNA 2WGVA 3IX3A 4HQAA 3PBNA 3BW6A 5M18A 4G3KA 1LL5A 3VMAA 3D72A 1VETB 2J3TD 4HY8A 2YKHA 1EWZA 3DTMA 1YPRA 1ESUA 5MC7A 5AVFA 4ME4A 1LSXA 2GNXA 4JF4A 4FH4A 5EE8A 1D1JA 2Y91A 3KYQA 5FQJA 4HP9A 1ONGA 3PR6A 4R4SA 5E2FA 5FEGA 4KZAA 3C30A 2OLVA 2Y2PA 3T1RA 2VZWA 1YLJA 2WAEA 3BQ8A 4MNRA 4BD1A 3HLGA 1V9YA 2JKTM 1BLSA 4LV2A 3EOIA 3SS4A 1CEGA 4UHUA 4I3AA 1GCEA 2Y2KA 3H82A 2P04A 2JKRM 5G18A 3ZHHA 4H6JB 1W79A 3IBRA 4JBFA 1WYCA 2HP9A 3ZVWA 4IUKA 1VM1A 4UEYA 4E3JA 1JWZA 2WYXA 5AQ7A 1PFLA 2V9AA 3V67A 1G6OA 3WRZA 4B93A 3EGXC 3LR4A 3WS1A 3ZDJA 5L07A 3MSHA 5F1GA 2HZ5A 3A0RA 3W2ZA 3LIBA 1TDLA 1STZA 4QB8A 1SHVA 1J3WA 2QJ7A 3BFFA 4O8GA 2WKEA 1E4DA 5CECA 4I3JA 4NXFA 1KGGA 4B9OA 4LENA 3OZHA 4EQ1A 1Z6FA 5D3OA 3C7UA 2Y2GA 1LL8A 1TS6A 2VV6A 2ZMFA 2ZQAA 1TDGA 3CUEA 4X1LA 5EECA 2J80A 4K08A 1G6AA 1CI9A 1FIKA 1JTDA 3HBRA 4C3QA 1UWPX 4HJ4A 3E2LA 2XFSA 2XGNA 2OAQ1 3ZG7B 3IWOA 3G6OA 2XH9A 4E6WA 4JXGA 3GMWA 3IX4A 3HUMA 3CI6A 5L10A 2PBYA 3OCLA 1WYBA 2E8IA 3UE1A 4PPRA 5HWWA 5J7EA 1K56A 3TJZC 3TE8A 5TGFA 1SKFA 5FATA 4X56A 5EVID 4OQHA 2J7VA 3UB9A 5JYPA 3C4OA 5GHZA 3LIFA 2HJEA 1K55C 3LEZA 5FAQA 1NLYA 3IXGA 2QWSA 5DFXA 3DTKA 4P6ZS 3RXXA 1K55A 2HJ9C 1OTBA 5CGSA 3VP1A 2ZQ7A 3O88A 1XX2A 3G2YA 4JF6A 4BENA 4E3KA 4UAAA 1ES3A 1H8ZA 5F6AA 3T1QB 2VEAA 3VP3A 3DWKA 3UB7A 1FSYA 2Z2MB 4FCFA 2WGWA 4CLCE 2Y2OA 4CJNA 2DRWA 4Y15A 4HOIA 4YOFA 3UDIA 3S1YA 2NUTC 1OTIA 1RP5A 3UN7A 1Y4OA 3S4XA 2FFYA 4KQOA 4EBLA 2BASA 3GECA 3S7NA 2HDRA 2L1MA 1N9BA 4EXOA 5HFOA 1ESIA 2RCXA 1ACFA 1J9MA 5CRFA 4S2NC 4KG2A 5FI2A 3UDXA 4LRYC 3ZG9B 1TEMA 1OTDA 1N9OA 4OPZA 4S2NA 4I39A 3LUQA 5KIZA 1GSVA 1FR1A 1YLZA 2ZC6B 4ID4A 5FQMA 2W1RA 5HPIA 2O0YA
chains in the Genus database with same CATH topology
1IYQA 4IEDA 1ES2A 5DF8A 1AXBA 3PBOA 4EWFA 1GHIA 4JKTA 4NETA 1PI5A 4OONA 1BLHA 2XDMA 3Q07A 2FFFB 2XLNA 3IWIA 1SDEA 4E3NA 4WYYA 3Q7ZA 1XKZA 1DY6A 2Y59A 3N8LA 3GR2A 3UY6A 2XD5A 1FCNA 2IWCA 2R9XA 2WAFA 3G2ZA 1IYOA 1JWVA 4R3JA 1K54A 4MBKA 3A3EA 4N9KA 2V2FF 2XD1A 4RX2A 4EBPA 3BLSA 2ZQ8A 5KMWA 5BOHA 5EVIA 5GLAA 4ZJ2A 3ZNYA 5CGWA 1YT4A 1XP4A 3VP4A 4BD1A 5U47A 3LO7A 1NYYA 2ZQDA 1CI8A 1TVFA 1SCWA 2EFXA 2ZC3B 4B88A 3HLBA 5KSHA 1MWRA 2G2WA 4R3BA 4WM9A 1MWTA 2ZC5B 5DF7A 5F82A 4Y0OA 5GHXA 2HP5A 3AGEA 3TSGA 1IYPA 1PWCA 1NY0A 2QMIA 3OCNA 2J9PA 3VFFA 4DE3A 3GV9A 3N4IA 4OLGA 1IKGA 4GD6A 4KQRA 3AGFA 4MBHA 3QHYA 4ZBEA 4EV4A 1IEMA 2OV5A 5FQQA 4N9LA 1K6RA 2ZMAA 2OLUA 2JC7A 4S2JA 1L0GA 2Q9MA 3GTCA 5CERA 5CGXA 3V50A 3A3FA 3WRTA 4E3OA 4S2MA 4F94A 3BFGA 5FQ9A 5E2HA 3PAGA 3IHAA 2WK0A 1NXYA 4MBFA 3W4PA 5HL1A 4KG5A 3MBZA 3BLMA 5EPHA 4FH2A 1Q2PA 2GDNA 5CXWA 3BYDA 4R0QA 4FSFA 4QY6A 1RCJA 3NDEA 3W4QA 1PYYA 1K25A 4KZ7A 1S0WA 4S2LA 1PIOA 3E2KA 5TR7A 3NY4A 1ZC2A 1HZOA 4A5RA 1YM1A 4GB7A 4GNUA 1FOFA 4CPKA 1BSGA 2Y2IA 3HREA 4X53A 4K0WA 2C5WB 4XUZA 5KSCA 2HDUA 1WE4A 4WMCA 1M40A 3Q7VA 3GSGA 1XA7A 5HAIA 1BTLA 1YLPA 4JXWA 3RJUA 1Q2QA 4KENB 4K91A 3Q81A 3WS4A 1PW1A 3LCEA 3SOIA 4OOYA 1YMSA 1NZOA 4JXVA 4OQ0A 3PBRA 3O87A 3SS3A 4S2KA 3VSLA 4E6XA 2I72A 5FQKA 1ERQA 5CEDA 1K4EA 3MZEA 4E3IA 1K38A 1LI9A 3V3SA 1K56D 2WADA 1NYMA 5FDHA 2Y4AA 3ZG0A 1DJAA 2EX2A 3IQAA 4QD4A 4BL2A 1L0FA 4KZBA 2PU2A 4KZ9A 4DXBA 1BLCA 1QMFA 3NC8A 4KZ8A 5FI7A 3TOIA 4N1HA 4IBRA 5E43A 3UPOA 2ZLYA 2BG1A 4U0XA 1NZUA 4U0TA 1CEFA 1K6SA 3FKWA 3UE3A 2ZQCA 1YMXA 3G32A 5CEBA 2EX8A 3M6BA 5HX9A 5JYOA 2EX6A 4Z9QA 4KZ3A 5AQAA 4L0LA 2Y2HA 3EQUA 5FAPA 5A90A 3FYZA 1BT5A 4U3TA 5DTSA 5EVLA 4C6YA 2ZM2A 3ISGA 5M19A 4P85A 2PU4A 2HP6A 4RVAA 1ZG6A 1FR6A 2JCHA 4WELA 5CTNA 4E3LA 3N6IA 5HAQA 1C3BA 3UDFA 2X02A 3I7JA 3PBQA 1G68A 5EOOA 5TFQA 4DF6A 5CTMA 3C7VA 3HUNA 4GD8A 1YLYA 2CC1A 2WGVA 4OLDA 3BFDA 3Q82A 5DTKA 3PBNA 5M18A 2WKIA 3HLCA 4H8RA 3B3XA 1HTZA 3ZFZA 1LL5A 2WZXA 3VMAA 1MXOA 3IWQA 4GN2A 2X01A 2JE5A 2WUQA 3V5MA 4OH0A 4RA7A 1EWZA 3DTMA 3GQZA 3GVBA 2HPBA 4WMCD 3ZVTA 1ESUA 3HL9A 3MZFA 3Q1FA 1JWPA 3O86A 4RYEA 4JF4A 3VFHA 4P6BA 4EBNA 2C6WB 4FH4A 5EE8A 2XFTA 2IWDA 3OC2A 3MZDA 2Y91A 3MXRA 3QNCA 4DE1A 2Y2LA 3A3IA 5FQJA 1ONGA 2WGIA 4R4SA 1ZG4A 2EXAA 3M2JA 5E2FA 4KZAA 2OLVA 2Y2PA 4LV0A 3N8RA 2VGJA 1ZKJA 1YLJA 4DXCA 2WAEA 4MNRA 4ZTKA 3CMZA 1I2WA 1SDNA 2EXBA 3HLGA 4MLLA 3IF6B 4P0MA 4YINA 3IT9A 5F83A 1U60A 1BLSA 4WEKA 4LV2A 2HDQA 4N92A 1CEGA 3NCKA 2WGWB 4UHUA 3BEBA 4JXSA 4XUXA 1GCEA 3SS4A 3CG5A 2ZD8A 1BUEA 2Y2KA 5F1FA 5KZHA 3PAEA 4YFMA 5G18A 3ZHHA 4OVDA 5GLDA 4PM7A 5FA7A 1W79A 4DDYA 5HW3A 2X71A 4JBFA 1L0EA 1WYCA 2HP9A 1XA1A 1KDWA 3ZVWA 4JF5A 1VM1A 3OPLA 4E3JA 1QMEA 4WZ4A 3LY4A 4QU3A 1JWZA 2WYXA 1KGEA 3UPNA 3VOZA 3OPRA 4DE0A 1PWDA 3VP2A 1ES5A 4QHCA 5AQ7A 1LLBA 4KQQA 2Q9NA 3N8SA 1PZPA 3UNWA 3SH9A 1KE4A 3O3VA 3WRZA 2R9WA 5DVAA 5GLCA 4P87A 3WS1A 3ZDJA 4E3MA 3G31A 5F1GA 4N1XA 4D2OA 4ZAMA 1TDLA 1W7FA 1GA0A 1GA9A 2G2UA 2J8YA 2ZC7A 5CHJA 5FSRA 3IF5A 4DDSA 5HARA 3HLFA 4QB8A 1SHVA 1EI5A 3BFFA 3EQVA 2WKEA 1E4DA 5M1AA 3W4OA 1KGFA 3OPHA 1ALQA 1FQGA 2A49A 5CECA 4FD8A 4IBXA 4IVKA 4OPRA 4S2IA 1KDSA 1KGGA 3IXDA 4GOGA 4MEZA 4Y0TA 4R23A 3NIAA 4EUZA 4LENA 1YLWA 4WEJA 3UPPA 3OZHA 1MY8A 4OP8A 1Z6FA 2HDSA 5D3OA 5GL9A 3C7UA 3ITBA 2Y2GA 3IXHA 2J9OA 2ZQAA 4OKPA 4Q8IA 1MWUA 1TDGA 3GRJA 3SH7A 3BFCA 2Z2LB 5GHYA 5AQBA 2B5RA 5EECA 4OOMA 4DKIA 1RGYA 1LI0A 4HBUA 3W8KA 1MWSA 1G6AA 1CI9A 2UWXA 3BFEA 3ZGAB 3DWZA 1IYSA 5EOEA 2A3UA 1JTDA 3HBRA 4C3QA 4OPYA 2H10A 1EROA 1GHPA 3E2LA 1DJCA 4KZ6A 2XFSA 5A93A 2XGNA 2Y2NA 3Q7VB 4S2PA 3SH8A 5I94A 1KVMA 3ITAA 4GDBA 3UO9A 1Y54A 3OPPA 3ZG7B 1RGZA 4OOLA 3IWOA 3ZG5A 2XH9A 4ZJ3A 4M3KA 3PTEA 4E6WA 4JXGA 2RL3A 1KE0A 2V1ZA 3GMWA 3HUMA 3IHBA 4GKUA 3VOYA 1E25A 2PBYA 1YQSA 3C5AA 1HD8A 3C4PA 4X69A 3OCLA 2EX9A 1N4OA 1WYBA 2E8IA 3IH8A 3UE1A 3ZG8B 5L2FA 4PPRA 3G30A 1K56A 3IF6C 1NJ4A 4UA6A 5TGFA 3LY3A 4K0XA 1SKFA 4R4RA 5FATA 1M6KA 2XR0A 4X56A 5EVID 4OQHA 3ZNTA 2QZ6A 4ZDXA 2J7VA 5JYPA 1H8YA 3C4OA 4Y7PA 3JYIA 5GHZA 3FZCA 4LCLA 5DTTA 5CHMA 3IF6A 3CJMA 4BD0A 1IELA 1XXMA 4HBTA 3IXBA 1K55C 3LEZA 3WS5A 1XGIA 2XK1A 3HVFA 5FAQA 3MKFA 3IXGA 5HAPA 2P9VA 4WBGA 4BL3A 3A3DA 1L2SA 1PW8A 3HUOA 5CHUA 5FAOA 1FCMA 1L0DA 1E3UA 1KVLA 3RXXA 3N7WA 1XPBA 2DNSA 4S2OA 1K57A 1KE3A 1PWGA 2OSUA 3HLDA 3VP0A 4BQMA 1K55A 4KG6A 1XGJA 2ZC4B 5CGSA 2ZQ7A 3VP1A 3O88A 5DF9A 1XX2A 1I2SA 3SS5A 3MFDA 4UA7A 4JLFA 1ERMA 3G2YA 4JF6A 4OQIA 4O7DA 4BENA 4PM6A 5GLBA 1S6RA 1IKIA 4E3KA 1JTGA 4UAAA 4PM8A 5AQ9A 3RXWA 5FASA 1ES3A 1PZOA 1BZAA 1H8ZA 1K57C 2XF3A 4KZ4A 2ZM8A 1HVBA 5A91A 3IH9A 3S22A 3VP3A 4HEFA 2H0YA 3HLEA 3PBTA 3DWKA 2QPNA 4KZ5A 2Y2MA 2V20A 1FSWA 2Z2MB 1FSYA 3MXSA 1PI4A 4FCFA 4LV3A 4C75A 2WGWA 4X68A 4GDNA 2Y2OA 2WZZA 4Y0UA 5E2GA 4CJNA 2DRWA 2ZM0A 1K54C 1H5XA 3BRMA 3NBLA 3NI9A 3M2KA 3AGDA 4X6TA 2Y55A 3V39A 1MBLA 4PM9A 3UDIA 1MPLA 4DE2A 1W8YA 4X55A 5EVIC 4B4ZA 4PMAA 3S1YA 1E3UD 3BECA 4QY5A 1GHMA 1RP5A 2DCFA 1MKIA 3UN7A 1O7EA 3NDGA 4B4XA 3S4XA 1NRFA 2FFYA 4KQOA 1BULA 1LHYA 4JPMA 4EBLA 3D4FA 3FKVA 3QNBA 3HLWA 3FV7A 3V3RA 4HESA 1BLPA 4OPQA 3A3JA 1K4FA 3CZDA 3M6HA 4WZ5A 3VSKA 2HDRA 4LCMA 4UA9A 2P74A 1ES4A 4RX3A 1DJBA 4DRTA 1N9BA 1I5QA 1ONHA 4NK3A 2H0TA 4ZJ1A 5HFOA 5A92A 2P9VB 3P09A 4LV1A 1ESIA 2RCXA 4OQGA 2EFUA 3BM6A 4PM5A 2JBFA 1J9MA 3TG9A 3WS2A 4BLMA 4XXRA 5CRFA 4S2NC 4KG2A 5EUAA 2ZJ9A 3MKEA 2Y2JA 4WZ5C 5FI2A 3UDXA 5E2EA 1VQQA 2IWBA 3UE0A 3G4PA 3PBSA 4OP5A 4QJGA 1YLTA 3ZG9B 2XEPA 4R1GA 1TEMA 5FQIA 3WS0A 3G34A 5J8XA 2VGKA 4OPZA 1FCOA 1W5DA 2XQZA 3DW0A 3G35A 4S2NA 1CK3A 2WKHA 2ZQ9A 1FR1A 4BJPA 1OMEA 3P98A 5EVIB 1W8QA 1YLZA 4EQIA 5FI6A 5IHVA 3FWLA 3WWXA 2BLSA 1O07A 2ZC6B 4IVIA 4GZBA 1LL9A 4ID4A 5FQMA 3ZCZA 2H5SA 2Y2QA 1JVJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IYQ A;  4IED A;  1ES2 A;  5DF8 A;  1AXB A;  3PBO A;  4EWF A;  1GHI A;  4JKT A;  4NET A;  1PI5 A;  4OON A;  1BLH A;  2XDM A;  3Q07 A;  2FFF B;  2XLN A;  3IWI A;  1SDE A;  4E3N A;  4WYY A;  3Q7Z A;  1XKZ A;  1DY6 A;  2Y59 A;  3N8L A;  3GR2 A;  3UY6 A;  2XD5 A;  1FCN A;  2IWC A;  2R9X A;  2WAF A;  3G2Z A;  1IYO A;  1JWV A;  4R3J A;  1K54 A;  4MBK A;  3A3E A;  4N9K A;  2V2F F;  2XD1 A;  4RX2 A;  4EBP A;  3BLS A;  2ZQ8 A;  5KMW A;  5BOH A;  5EVI A;  5GLA A;  4ZJ2 A;  3ZNY A;  5CGW A;  1YT4 A;  1XP4 A;  3VP4 A;  4BD1 A;  5U47 A;  3LO7 A;  1NYY A;  2ZQD A;  1CI8 A;  1TVF A;  1SCW A;  2EFX A;  2ZC3 B;  4B88 A;  3HLB A;  5KSH A;  1MWR A;  2G2W A;  4R3B A;  4WM9 A;  1MWT A;  2ZC5 B;  5DF7 A;  5F82 A;  4Y0O A;  5GHX A;  2HP5 A;  3AGE A;  3TSG A;  1IYP A;  1PWC A;  1NY0 A;  2QMI A;  3OCN A;  2J9P A;  3VFF A;  4DE3 A;  3GV9 A;  3N4I A;  4OLG A;  1IKG A;  4GD6 A;  4KQR A;  3AGF A;  4MBH A;  3QHY A;  4ZBE A;  4EV4 A;  1IEM A;  2OV5 A;  5FQQ A;  4N9L A;  1K6R A;  2ZMA A;  2OLU A;  2JC7 A;  4S2J A;  1L0G A;  2Q9M A;  3GTC A;  5CER A;  5CGX A;  3V50 A;  3A3F A;  3WRT A;  4E3O A;  4S2M A;  4F94 A;  3BFG A;  5FQ9 A;  5E2H A;  3PAG A;  3IHA A;  2WK0 A;  1NXY A;  4MBF A;  3W4P A;  5HL1 A;  4KG5 A;  3MBZ A;  3BLM A;  5EPH A;  4FH2 A;  1Q2P A;  2GDN A;  5CXW A;  3BYD A;  4R0Q A;  4FSF A;  4QY6 A;  1RCJ A;  3NDE A;  3W4Q A;  1PYY A;  1K25 A;  4KZ7 A;  1S0W A;  4S2L A;  1PIO A;  3E2K A;  5TR7 A;  3NY4 A;  1ZC2 A;  1HZO A;  4A5R A;  1YM1 A;  4GB7 A;  4GNU A;  1FOF A;  4CPK A;  1BSG A;  2Y2I A;  3HRE A;  4X53 A;  4K0W A;  2C5W B;  4XUZ A;  5KSC A;  2HDU A;  1WE4 A;  4WMC A;  1M40 A;  3Q7V A;  3GSG A;  1XA7 A;  5HAI A;  1BTL A;  1YLP A;  4JXW A;  3RJU A;  1Q2Q A;  4KEN B;  4K91 A;  3Q81 A;  3WS4 A;  1PW1 A;  3LCE A;  3SOI A;  4OOY A;  1YMS A;  1NZO A;  4JXV A;  4OQ0 A;  3PBR A;  3O87 A;  3SS3 A;  4S2K A;  3VSL A;  4E6X A;  2I72 A;  5FQK A;  1ERQ A;  5CED A;  1K4E A;  3MZE A;  4E3I A;  1K38 A;  1LI9 A;  3V3S A;  1K56 D;  2WAD A;  1NYM A;  5FDH A;  2Y4A A;  3ZG0 A;  1DJA A;  2EX2 A;  3IQA A;  4QD4 A;  4BL2 A;  1L0F A;  4KZB A;  2PU2 A;  4KZ9 A;  4DXB A;  1BLC A;  1QMF A;  3NC8 A;  4KZ8 A;  5FI7 A;  3TOI A;  4N1H A;  4IBR A;  5E43 A;  3UPO A;  2ZLY A;  2BG1 A;  4U0X A;  1NZU A;  4U0T A;  1CEF A;  1K6S A;  3FKW A;  3UE3 A;  2ZQC A;  1YMX A;  3G32 A;  5CEB A;  2EX8 A;  3M6B A;  5HX9 A;  5JYO A;  2EX6 A;  4Z9Q A;  4KZ3 A;  5AQA A;  4L0L A;  2Y2H A;  3EQU A;  5FAP A;  5A90 A;  3FYZ A;  1BT5 A;  4U3T A;  5DTS A;  5EVL A;  4C6Y A;  2ZM2 A;  3ISG A;  5M19 A;  4P85 A;  2PU4 A;  2HP6 A;  4RVA A;  1ZG6 A;  1FR6 A;  2JCH A;  4WEL A;  5CTN A;  4E3L A;  3N6I A;  5HAQ A;  1C3B A;  3UDF A;  2X02 A;  3I7J A;  3PBQ A;  1G68 A;  5EOO A;  5TFQ A;  4DF6 A;  5CTM A;  3C7V A;  3HUN A;  4GD8 A;  1YLY A;  2CC1 A;  2WGV A;  4OLD A;  3BFD A;  3Q82 A;  5DTK A;  3PBN A;  5M18 A;  2WKI A;  3HLC A;  4H8R A;  3B3X A;  1HTZ A;  3ZFZ A;  1LL5 A;  2WZX A;  3VMA A;  1MXO A;  3IWQ A;  4GN2 A;  2X01 A;  2JE5 A;  2WUQ A;  3V5M A;  4OH0 A;  4RA7 A;  1EWZ A;  3DTM A;  3GQZ A;  3GVB A;  2HPB A;  4WMC D;  3ZVT A;  1ESU A;  3HL9 A;  3MZF A;  3Q1F A;  1JWP A;  3O86 A;  4RYE A;  4JF4 A;  3VFH A;  4P6B A;  4EBN A;  2C6W B;  4FH4 A;  5EE8 A;  2XFT A;  2IWD A;  3OC2 A;  3MZD A;  2Y91 A;  3MXR A;  3QNC A;  4DE1 A;  2Y2L A;  3A3I A;  5FQJ A;  1ONG A;  2WGI A;  4R4S A;  1ZG4 A;  2EXA A;  3M2J A;  5E2F A;  4KZA A;  2OLV A;  2Y2P A;  4LV0 A;  3N8R A;  2VGJ A;  1ZKJ A;  1YLJ A;  4DXC A;  2WAE A;  4MNR A;  4ZTK A;  3CMZ A;  1I2W A;  1SDN A;  2EXB A;  3HLG A;  4MLL A;  3IF6 B;  4P0M A;  4YIN A;  3IT9 A;  5F83 A;  1U60 A;  1BLS A;  4WEK A;  4LV2 A;  2HDQ A;  4N92 A;  1CEG A;  3NCK A;  2WGW B;  4UHU A;  3BEB A;  4JXS A;  4XUX A;  1GCE A;  3SS4 A;  3CG5 A;  2ZD8 A;  1BUE A;  2Y2K A;  5F1F A;  5KZH A;  3PAE A;  4YFM A;  5G18 A;  3ZHH A;  4OVD A;  5GLD A;  4PM7 A;  5FA7 A;  1W79 A;  4DDY A;  5HW3 A;  2X71 A;  4JBF A;  1L0E A;  1WYC A;  2HP9 A;  1XA1 A;  1KDW A;  3ZVW A;  4JF5 A;  1VM1 A;  3OPL A;  4E3J A;  1QME A;  4WZ4 A;  3LY4 A;  4QU3 A;  1JWZ A;  2WYX A;  1KGE A;  3UPN A;  3VOZ A;  3OPR A;  4DE0 A;  1PWD A;  3VP2 A;  1ES5 A;  4QHC A;  5AQ7 A;  1LLB A;  4KQQ A;  2Q9N A;  3N8S A;  1PZP A;  3UNW A;  3SH9 A;  1KE4 A;  3O3V A;  3WRZ A;  2R9W A;  5DVA A;  5GLC A;  4P87 A;  3WS1 A;  3ZDJ A;  4E3M A;  3G31 A;  5F1G A;  4N1X A;  4D2O A;  4ZAM A;  1TDL A;  1W7F A;  1GA0 A;  1GA9 A;  2G2U A;  2J8Y A;  2ZC7 A;  5CHJ A;  5FSR A;  3IF5 A;  4DDS A;  5HAR A;  3HLF A;  4QB8 A;  1SHV A;  1EI5 A;  3BFF A;  3EQV A;  2WKE A;  1E4D A;  5M1A A;  3W4O A;  1KGF A;  3OPH A;  1ALQ A;  1FQG A;  2A49 A;  5CEC A;  4FD8 A;  4IBX A;  4IVK A;  4OPR A;  4S2I A;  1KDS A;  1KGG A;  3IXD A;  4GOG A;  4MEZ A;  4Y0T A;  4R23 A;  3NIA A;  4EUZ A;  4LEN A;  1YLW A;  4WEJ A;  3UPP A;  3OZH A;  1MY8 A;  4OP8 A;  1Z6F A;  2HDS A;  5D3O A;  5GL9 A;  3C7U A;  3ITB A;  2Y2G A;  3IXH A;  2J9O A;  2ZQA A;  4OKP A;  4Q8I A;  1MWU A;  1TDG A;  3GRJ A;  3SH7 A;  3BFC A;  2Z2L B;  5GHY A;  5AQB A;  2B5R A;  5EEC A;  4OOM A;  4DKI A;  1RGY A;  1LI0 A;  4HBU A;  3W8K A;  1MWS A;  1G6A A;  1CI9 A;  2UWX A;  3BFE A;  3ZGA B;  3DWZ A;  1IYS A;  5EOE A;  2A3U A;  1JTD A;  3HBR A;  4C3Q A;  4OPY A;  2H10 A;  1ERO A;  1GHP A;  3E2L A;  1DJC A;  4KZ6 A;  2XFS A;  5A93 A;  2XGN A;  2Y2N A;  3Q7V B;  4S2P A;  3SH8 A;  5I94 A;  1KVM A;  3ITA A;  4GDB A;  3UO9 A;  1Y54 A;  3OPP A;  3ZG7 B;  1RGZ A;  4OOL A;  3IWO A;  3ZG5 A;  2XH9 A;  4ZJ3 A;  4M3K A;  3PTE A;  4E6W A;  4JXG A;  2RL3 A;  1KE0 A;  2V1Z A;  3GMW A;  3HUM A;  3IHB A;  4GKU A;  3VOY A;  1E25 A;  2PBY A;  1YQS A;  3C5A A;  1HD8 A;  3C4P A;  4X69 A;  3OCL A;  2EX9 A;  1N4O A;  1WYB A;  2E8I A;  3IH8 A;  3UE1 A;  3ZG8 B;  5L2F A;  4PPR A;  3G30 A;  1K56 A;  3IF6 C;  1NJ4 A;  4UA6 A;  5TGF A;  3LY3 A;  4K0X A;  1SKF A;  4R4R A;  5FAT A;  1M6K A;  2XR0 A;  4X56 A;  5EVI D;  4OQH A;  3ZNT A;  2QZ6 A;  4ZDX A;  2J7V A;  5JYP A;  1H8Y A;  3C4O A;  4Y7P A;  3JYI A;  5GHZ A;  3FZC A;  4LCL A;  5DTT A;  5CHM A;  3IF6 A;  3CJM A;  4BD0 A;  1IEL A;  1XXM A;  4HBT A;  3IXB A;  1K55 C;  3LEZ A;  3WS5 A;  1XGI A;  2XK1 A;  3HVF A;  5FAQ A;  3MKF A;  3IXG A;  5HAP A;  2P9V A;  4WBG A;  4BL3 A;  3A3D A;  1L2S A;  1PW8 A;  3HUO A;  5CHU A;  5FAO A;  1FCM A;  1L0D A;  1E3U A;  1KVL A;  3RXX A;  3N7W A;  1XPB A;  2DNS A;  4S2O A;  1K57 A;  1KE3 A;  1PWG A;  2OSU A;  3HLD A;  3VP0 A;  4BQM A;  1K55 A;  4KG6 A;  1XGJ A;  2ZC4 B;  5CGS A;  2ZQ7 A;  3VP1 A;  3O88 A;  5DF9 A;  1XX2 A;  1I2S A;  3SS5 A;  3MFD A;  4UA7 A;  4JLF A;  1ERM A;  3G2Y A;  4JF6 A;  4OQI A;  4O7D A;  4BEN A;  4PM6 A;  5GLB A;  1S6R A;  1IKI A;  4E3K A;  1JTG A;  4UAA A;  4PM8 A;  5AQ9 A;  3RXW A;  5FAS A;  1ES3 A;  1PZO A;  1BZA A;  1H8Z A;  1K57 C;  2XF3 A;  4KZ4 A;  2ZM8 A;  1HVB A;  5A91 A;  3IH9 A;  3S22 A;  3VP3 A;  4HEF A;  2H0Y A;  3HLE A;  3PBT A;  3DWK A;  2QPN A;  4KZ5 A;  2Y2M A;  2V20 A;  1FSW A;  2Z2M B;  1FSY A;  3MXS A;  1PI4 A;  4FCF A;  4LV3 A;  4C75 A;  2WGW A;  4X68 A;  4GDN A;  2Y2O A;  2WZZ A;  4Y0U A;  5E2G A;  4CJN A;  2DRW A;  2ZM0 A;  1K54 C;  1H5X A;  3BRM A;  3NBL A;  3NI9 A;  3M2K A;  3AGD A;  4X6T A;  2Y55 A;  3V39 A;  1MBL A;  4PM9 A;  3UDI A;  1MPL A;  4DE2 A;  1W8Y A;  4X55 A;  5EVI C;  4B4Z A;  4PMA A;  3S1Y A;  1E3U D;  3BEC A;  4QY5 A;  1GHM A;  1RP5 A;  2DCF A;  1MKI A;  3UN7 A;  1O7E A;  3NDG A;  4B4X A;  3S4X A;  1NRF A;  2FFY A;  4KQO A;  1BUL A;  1LHY A;  4JPM A;  4EBL A;  3D4F A;  3FKV A;  3QNB A;  3HLW A;  3FV7 A;  3V3R A;  4HES A;  1BLP A;  4OPQ A;  3A3J A;  1K4F A;  3CZD A;  3M6H A;  4WZ5 A;  3VSK A;  2HDR A;  4LCM A;  4UA9 A;  2P74 A;  1ES4 A;  4RX3 A;  1DJB A;  4DRT A;  1N9B A;  1I5Q A;  1ONH A;  4NK3 A;  2H0T A;  4ZJ1 A;  5HFO A;  5A92 A;  2P9V B;  3P09 A;  4LV1 A;  1ESI A;  2RCX A;  4OQG A;  2EFU A;  3BM6 A;  4PM5 A;  2JBF A;  1J9M A;  3TG9 A;  3WS2 A;  4BLM A;  4XXR A;  5CRF A;  4S2N C;  4KG2 A;  5EUA A;  2ZJ9 A;  3MKE A;  2Y2J A;  4WZ5 C;  5FI2 A;  3UDX A;  5E2E A;  1VQQ A;  2IWB A;  3UE0 A;  3G4P A;  3PBS A;  4OP5 A;  4QJG A;  1YLT A;  3ZG9 B;  2XEP A;  4R1G A;  1TEM A;  5FQI A;  3WS0 A;  3G34 A;  5J8X A;  2VGK A;  4OPZ A;  1FCO A;  1W5D A;  2XQZ A;  3DW0 A;  3G35 A;  4S2N A;  1CK3 A;  2WKH A;  2ZQ9 A;  1FR1 A;  4BJP A;  1OME A;  3P98 A;  5EVI B;  1W8Q A;  1YLZ A;  4EQI A;  5FI6 A;  5IHV A;  3FWL A;  3WWX A;  2BLS A;  1O07 A;  2ZC6 B;  4IVI A;  4GZB A;  1LL9 A;  4ID4 A;  5FQM A;  3ZCZ A;  2H5S A;  2Y2Q A;  1JVJ A; 
#chains in the Genus database with same CATH topology
 2WKQ A;  2OOL A;  1ES2 A;  1AXB A;  1PI5 A;  4NXB A;  1VEU B;  2XLN A;  2Y59 A;  3U4L P;  1FCN A;  4F3L A;  2WAF A;  4R3J A;  1IYO A;  1JWV A;  2GZA A;  1K54 A;  2XD1 A;  3BLS A;  3UB6 A;  5BOH A;  2J3W A;  5CGW A;  1YT4 A;  1P9W A;  1NYY A;  1CI8 A;  4B88 A;  1SCW A;  3F1O A;  3CPT A;  5KSH A;  1MWR A;  5DF7 A;  1IOU A;  3L7H A;  4BBT A;  4OLG A;  4HJ6 A;  3ZQ5 A;  4KQR A;  4MBH A;  3QHY A;  2OV5 A;  4DJ3 A;  2JC7 A;  3V50 A;  3GTC A;  2A24 A;  3WRT A;  3A3F A;  3BFG A;  2VA0 A;  4Z1W A;  3W4P A;  4GJ4 A;  4FH2 A;  1XJ3 A;  2GDN A;  3P7N A;  4QY6 A;  3T4T A;  4EEP A;  1K25 A;  1PIO A;  3KX0 X;  2VV7 A;  4HHD A;  2V8C A;  2VGL S;  1HZO A;  4A5R A;  2W1T B;  2XA7 M;  3HRE A;  4K0W A;  4XUZ A;  4FTX A;  1XFN A;  4WMC A;  2KX6 A;  4X1M A;  4JXW A;  1S1Z A;  1YSQ A;  4NG2 A;  5HDC A;  3CHW P;  5DJU A;  2PDR A;  3MFX A;  4JXV A;  4OQ0 A;  3CPT B;  2Y79 A;  1TS0 A;  3B47 A;  3O87 A;  2I72 A;  1K4E A;  1NYM A;  5FDH A;  2Y4A A;  3ZG0 A;  4QD4 A;  3IQA A;  1BYW A;  4KZB A;  5HSQ A;  4KZ8 A;  5TJJ A;  3LR3 A;  4PKY A;  2PYP A;  4U0T A;  1CEF A;  4GCZ A;  1S66 L;  3GDI A;  5JYO A;  2P7J A;  3CWF A;  5I5L A;  3EQU A;  5FAP A;  4U3T A;  5DTS A;  5EVL A;  2J3T C;  5M19 A;  4MN6 A;  2B18 A;  3N6I A;  5HAQ A;  2M7V A;  3C7V A;  4OLD A;  3HLC A;  3B3X A;  1HTZ A;  4CLC C;  2WZX A;  1MXO A;  4E04 A;  2WUQ A;  4OH0 A;  3ZVT A;  3GVB A;  3IS2 B;  3HL9 A;  3MZF A;  3H9W A;  4RYE A;  2ZMV A;  4XT2 A;  4P6B A;  2VK3 A;  2XFT A;  3MZD A;  2W1T A;  2Y2L A;  3M2J A;  4PKY G;  4DXC A;  1I2W A;  1S4R A;  3IF6 B;  4YIN A;  4WEK A;  4N92 A;  4XUX A;  2WGW B;  2ACG A;  2EWW A;  5GLD A;  3CAX A;  4MN7 A;  1XA1 A;  1KDW A;  1DP8 A;  3LY4 A;  1NWZ A;  1CJF A;  4DN0 A;  4DE0 A;  3VP2 A;  1LT0 A;  3SH9 A;  1KE4 A;  4P87 A;  3G31 A;  3KSH A;  4N1X A;  1GA9 A;  2G2U A;  5CHJ A;  5FDS A;  4BBU A;  1XJ4 A;  3W4O A;  1KGF A;  3OPH A;  2V0U A;  2PAV P;  4GOG A;  4WEJ A;  3C38 A;  1MY8 A;  2B02 A;  2HDS A;  4QPR A;  5GL9 A;  3ITB A;  3IXH A;  3EEA A;  4OKP A;  2KOI A;  1MWU A;  2Z2L B;  5AQB A;  2B5R A;  4DKI A;  2AVX A;  1LI0 A;  4YWZ A;  2H10 A;  1GHP A;  3A0S A;  4KZ6 A;  1KVM A;  3ITA A;  3EWK A;  3UO9 A;  1Y54 A;  4OOL A;  1OJ5 A;  4LRX C;  3PTE A;  2RL3 A;  1KE0 A;  3IHB A;  3KSI A;  3RH8 B;  2HGV A;  4X69 A;  2EX9 A;  3LID A;  4G3W A;  3NJA A;  3G30 A;  3IF6 C;  4UA6 A;  4K0X A;  1M6K A;  3UE6 A;  2QZ6 A;  3LIE A;  2IA2 A;  2NUP C;  3IF6 A;  4JGQ A;  4BD0 A;  1TD5 A;  1IEL A;  5FL3 A;  3IXB A;  1XGI A;  2V0W A;  3MKF A;  5HAP A;  2P9V A;  2V1A A;  3A3D A;  3HUO A;  5FAO A;  2XRO A;  4S2O A;  1XPB A;  2DNS A;  1K57 A;  1KE3 A;  4PM5 A;  2INW A;  4NKP A;  4KG6 A;  4LRZ E;  3VV4 A;  1XGJ A;  5DF9 A;  3CUE C;  3MFD A;  4UA7 A;  4UQI S;  3B42 A;  2VV8 A;  4O7D A;  5GLB A;  1S6R A;  1IKI A;  1G5U A;  1ZHH B;  1JTG A;  4MDZ A;  4KZ4 A;  1BZA A;  1K57 C;  1HVB A;  5EV0 A;  5A91 A;  3IH9 A;  2H0Y A;  3PBT A;  3SW1 A;  2QPN A;  3JPU A;  2VKS A;  1FSW A;  3MXS A;  3LIC A;  3MR0 A;  4Q0J A;  4Y0U A;  2WZZ A;  1H5X A;  4P6Z M;  4NXG A;  2Y55 A;  4DE2 A;  3LI8 A;  2EA9 A;  1JNU A;  2DCF A;  2Y8H A;  4LFU A;  2PT7 A;  1LHY A;  4JPM A;  4R38 A;  3D4F A;  1S1Y A;  3M6H A;  4LCM A;  4DRT A;  1I5Q A;  4ZJ1 A;  5DKK A;  5A92 A;  2BTF P;  2EFU A;  3BM6 A;  3TG9 A;  3WS2 A;  2K2N A;  1OJG A;  5EM1 A;  3MKE A;  2PRF A;  3EEH A;  3UE0 A;  1YLT A;  2XEP A;  2GJ3 A;  3WS0 A;  1W5D A;  1CK3 A;  2WKH A;  1OPX A;  5FI6 A;  3NOT C;  3FWL A;  3WWX A;  1O07 A;  4GZB A;  1LL9 A;  2H5S A;  3E4P A;  3MS6 A;  4IED A;  5DF8 A;  3PBO A;  4JKT A;  4NET A;  4OON A;  1BLH A;  3Q07 A;  3F1P B;  4E3N A;  3GR2 A;  1IFQ A;  2LB9 A;  2R9X A;  3KSG A;  4MBK A;  3DTE A;  2V2F F;  4RX2 A;  2G7U A;  4EEU A;  2ZQ8 A;  5KMW A;  4R3A A;  5GLA A;  2W3F A;  4ZJ2 A;  3VP4 A;  3DAV A;  2ZQD A;  1TVF A;  2G2W A;  2DMW A;  4WM9 A;  1MWT A;  5F82 A;  4Y0O A;  2KLI A;  3VFF A;  3GV9 A;  3LR0 A;  5G4Y A;  1OTE A;  2ZBB A;  4ZBE A;  3OOV A;  1IEM A;  5FQQ A;  1K6R A;  2OLU A;  4BWI A;  4S2J A;  1L0G A;  2Q9M A;  4EUV A;  4S2M A;  5FQ9 A;  2WK0 A;  1CF0 A;  3MBZ A;  3BLM A;  3BYD A;  1RCJ A;  3NDE A;  3QP8 A;  3FPW A;  5TR7 A;  1TF1 A;  3S7O A;  1ZC2 A;  1YM1 A;  1BSG A;  2Y2I A;  3SZT A;  5KSC A;  4I3I A;  3O5Y A;  1WE4 A;  4O0P A;  3Q7V A;  2ZOI A;  5HAI A;  1T18 A;  3Q81 A;  1P9R A;  3LCE A;  1YMS A;  4QWO A;  3IBJ A;  3NOP C;  3SS3 A;  2PBD P;  1ERQ A;  3MZE A;  4DJ2 A;  4LGW A;  2R78 A;  5LBR A;  5L09 A;  1DJA A;  2EX2 A;  4BL2 A;  4DXB A;  3NC8 A;  3T4J A;  3JVV A;  5E43 A;  2XSS A;  2ZLY A;  4U0X A;  3NUL A;  3FKW A;  1YSP A;  2ZQC A;  4HNB A;  5HX9 A;  5J3W A;  5AQA A;  2V1B A;  4L0L A;  3FYZ A;  2ZM2 A;  3ISG A;  2JCH A;  1VHM A;  4DF6 A;  3UDF A;  5TFQ A;  4LPZ A;  4F3L B;  4GD8 A;  1N9L A;  1YLY A;  2EWV A;  5DTK A;  2OAP 1;  2WKI A;  4H8R A;  1NRJ A;  3LEQ A;  2W3D A;  3ZFZ A;  3K3D A;  1KOU A;  3IWQ A;  4Y5F A;  2M7U A;  3GQZ A;  5C5K A;  1JWP A;  3VFH A;  1T1C A;  3OLO A;  2XA7 S;  3MXR A;  3QP5 A;  3QNC A;  4DE1 A;  3BQA A;  2WGI A;  2EXA A;  3MXQ A;  4ARZ B;  4I5S A;  2VGJ A;  4ZTK A;  4MLL A;  3IT9 A;  1U60 A;  4GS9 B;  3NCK A;  3BEB A;  3CG5 A;  3ICY A;  1GSX A;  5KZH A;  4JGR A;  3PAE A;  4YFM A;  4OVD A;  3FC7 A;  5FA7 A;  4DDY A;  4BBV A;  1K0K A;  3OPL A;  1QME A;  1KGE A;  3RTY A;  3LFV A;  4QHC A;  2A24 B;  4KQQ A;  2Q9N A;  3N8S A;  1PZP A;  3R7W B;  3O3V A;  1NLZ A;  3T12 B;  1HLU P;  2V8F A;  4YNR A;  4ZAM A;  2J8Y A;  4DDS A;  5FSR A;  5HAR A;  3HLF A;  3EQV A;  2A49 A;  4IVK A;  4OPR A;  3LI9 A;  4JGP A;  3TW8 A;  4R23 A;  4EUZ A;  2VLG A;  4OP8 A;  3K2N A;  2KDK A;  1XJ6 A;  1OT9 A;  1SZV A;  4Q8I A;  3R7W A;  3SH7 A;  3BFC A;  3T4L A;  4OOM A;  3W8K A;  1T1A A;  1YAX A;  5EOE A;  2A3U A;  3S7P A;  2Z6D A;  4IHQ A;  5A93 A;  4Y3I A;  2Y2N A;  3SH8 A;  5EFW A;  1P97 A;  1RGZ A;  3T50 A;  4Y2F A;  4ZJ3 A;  4M3K A;  4JGO A;  2V1Z A;  3P01 A;  4L9E A;  1LSV A;  4GKU A;  3T4O A;  3VOY A;  5L8M A;  1E25 A;  1YQS A;  5HD3 A;  3C5A A;  3HCY A;  5K5B A;  4WUJ A;  1N4O A;  3ZG8 B;  5L2F A;  1NJ4 A;  1OT6 A;  2XR0 A;  1P0Z A;  3ZNT A;  4NXE A;  1H8Y A;  4Y7P A;  3JYI A;  3FZC A;  5CHM A;  3CJM A;  1XXM A;  2OWJ A;  4HBT A;  5IS1 A;  3WS5 A;  3HVF A;  3UMD A;  4HP4 A;  4BL3 A;  4NEE D;  5CHU A;  2B95 A;  3LIA A;  1L0D A;  1KVL A;  3MQQ A;  3HLD A;  2OSU A;  1DRM A;  3T1S A;  1VEU A;  2ZC4 B;  4R70 A;  4Q0I A;  3SS5 A;  4X25 A;  3RXW A;  5FAS A;  5AQ9 A;  2W27 A;  1PZO A;  3OBF A;  1D06 A;  1Z09 A;  5IT5 A;  1SKO A;  3HLE A;  2UV0 E;  2MJ6 A;  4KZ5 A;  2V20 A;  4EET B;  2ZM0 A;  3BRM A;  3NBL A;  4EW7 A;  3AGD A;  4X6T A;  1MBL A;  4PM9 A;  1H0M A;  3VE3 A;  1MPL A;  3QP1 A;  5EVI C;  1E3U D;  3BEC A;  4QY5 A;  1O7E A;  1NRF A;  2LB5 A;  3QNB A;  1PRQ A;  3FV7 A;  4HES A;  4OPQ A;  3A3J A;  1K4F A;  4WZ5 A;  1S4S A;  2P74 A;  3VE4 A;  2H0T A;  3P09 A;  4OQG A;  2JKT I;  5EUA A;  4GHI B;  2ZJ9 A;  2W3H A;  4WZ5 C;  5E2E A;  2L4R A;  3G4P A;  3PBS A;  4QJG A;  5AJG A;  4R1G A;  3G34 A;  1FCO A;  2W0N A;  3FG8 A;  1SKO B;  1OME A;  5DFY A;  5EVI B;  4EQI A;  5IHV A;  3KYZ A;  2BLS A;  2JN7 A;  1JVJ A;  2H28 A;  2XDM A;  5DJT A;  1SDE A;  3LYX A;  4WYY A;  1XKZ A;  3FPV A;  2IWC A;  3G2Z A;  3A3E A;  2M1C A;  1MZU A;  4EBP A;  4KQD A;  2O9B A;  1XJ2 A;  3ZNY A;  1XP4 A;  3MMH A;  4HJ3 A;  2EFX A;  4GS9 A;  4R3B A;  1F2K A;  5GHX A;  4I38 A;  2HP5 A;  1F98 A;  2Z6C A;  3TSG A;  1IYP A;  1PWC A;  3OCN A;  5IU1 A;  3N4I A;  1EW0 A;  1IKG A;  4GD6 A;  4EV4 A;  4EU0 A;  3DBA A;  4N9L A;  5CER A;  4E3O A;  4F94 A;  5HL1 A;  2WKR A;  5EPH A;  1Q2P A;  3IS2 A;  2K7S A;  3D3O A;  3H82 B;  4S2L A;  3E2K A;  2HF6 A;  3NY4 A;  3EGD C;  4CLC B;  4GB7 A;  4X53 A;  2VGL M;  5EM0 A;  2HDU A;  2VX8 A;  1XA7 A;  2ZOH A;  2JKF A;  2Q0O A;  1Q2Q A;  1ODV A;  4K91 A;  3SOI A;  4OOY A;  3NOU C;  3F1O B;  4S2K A;  2JKG A;  1LI9 A;  3V3S A;  1L0F A;  2PU2 A;  3QP4 A;  5FI7 A;  2PR5 A;  4N1H A;  4IBR A;  1DP6 A;  3UPO A;  2BG1 A;  1NZU A;  5HZH A;  1YMX A;  3G32 A;  2EX8 A;  4PAU A;  3M6B A;  1TS7 A;  2EX6 A;  3BY9 A;  4KZ3 A;  5A90 A;  1BT5 A;  3T4K A;  3QP2 A;  4P85 A;  2HP6 A;  4RVA A;  4E3L A;  3L9K A;  3H7W A;  1C3B A;  3PBQ A;  3I7J A;  1G68 A;  2CC1 A;  3BFD A;  3Q82 A;  3VOL A;  4MMN A;  2PD8 A;  2A2L A;  4WLA A;  3CLO A;  4GN2 A;  2X01 A;  2JE5 A;  3V5M A;  3NEC A;  1T1B A;  3UME A;  4FOF A;  4RA7 A;  4WMC D;  2HPB A;  3T4Q A;  3Q1F A;  3O86 A;  4EBN A;  2C6W B;  4CLC D;  4Y17 A;  3JVU A;  2IWD A;  3OC2 A;  3F1P A;  2GX5 A;  3A3I A;  1ZG4 A;  4LV0 A;  2VJW A;  2K31 A;  3N8R A;  2OWH A;  1ZKJ A;  3CMZ A;  1SDN A;  2EXB A;  4P0M A;  5F83 A;  2HDQ A;  4JXS A;  2ZD8 A;  1BUE A;  5F69 A;  5F1F A;  2PHY A;  4PM7 A;  3ZYT A;  5HW3 A;  2X71 A;  2ZL1 A;  1L0E A;  3MQ0 A;  4JF5 A;  3LR5 A;  4WZ4 A;  4QU3 A;  4ARZ A;  2QKP A;  3UPN A;  3VOZ A;  3OPR A;  1PWD A;  1CQA A;  1ES5 A;  1LLB A;  3UNW A;  2R9W A;  5DVA A;  5GLC A;  2CMN A;  4E3M A;  4WF0 A;  3BY8 A;  4D2O A;  4D60 A;  1W7F A;  1GA0 A;  2ZC7 A;  3IF5 A;  4H6J A;  5HDD A;  1EI5 A;  4L9G A;  5M1A A;  2W3E A;  3MQO A;  1ALQ A;  1FQG A;  4FD8 A;  4IBX A;  4S2I A;  1A0K A;  3A0V A;  1KDS A;  3IXD A;  4MEZ A;  4Y0T A;  3NIA A;  1YLW A;  3UPP A;  4G3V A;  2J9O A;  3B33 A;  1UGU A;  5J4E A;  3LGO A;  3GRJ A;  5GHY A;  1RGY A;  4HBU A;  1MWS A;  5EVE A;  4Y13 A;  2UWX A;  3BFE A;  3ZGA B;  3DWZ A;  1IYS A;  5HL6 A;  4OPY A;  1ERO A;  2ZL1 B;  1DJC A;  1PNE A;  3HJI A;  3U2A A;  4S2P A;  3Q7V B;  3KSF A;  5I94 A;  2D02 A;  5CX7 A;  4GDB A;  5A8B A;  3OPP A;  1F5M A;  3F1N A;  3R4K A;  5F68 A;  1WA9 A;  3ZG5 A;  1MC0 A;  2PYR A;  4MCW A;  4KUK A;  1YKD A;  1HD8 A;  3MJQ A;  4HI4 A;  3C4P A;  4Q0H A;  3E4O A;  3IH8 A;  3TRC A;  2P08 A;  4R4R A;  4HIA A;  4WL9 A;  4ZDX A;  1N9N A;  1AWI A;  4LCL A;  3F1N B;  5DTT A;  1VET A;  4IUH A;  2XK1 A;  4HH3 A;  2D01 A;  4WBG A;  4KUO A;  1L2S A;  1PW8 A;  1FCM A;  1E3U A;  3N7W A;  3E98 A;  4UQI M;  1PWG A;  4ZRR A;  4BQM A;  1DP9 A;  3VP0 A;  5HPF A;  1I2S A;  3T1X A;  4JLF A;  2O99 A;  3PYP A;  1ERM A;  4OQI A;  3CIT A;  4PM6 A;  4PM8 A;  2XF3 A;  2ZM8 A;  3D9Y A;  3BWL A;  3S22 A;  5TBM A;  4HEF A;  1H8M A;  1Y28 A;  1FIL A;  2Y2M A;  1PI4 A;  4LV3 A;  4C75 A;  4X68 A;  4GDN A;  2QYB A;  5E2G A;  1K54 C;  3NI9 A;  3M2K A;  1ZTU A;  3V39 A;  2E8J A;  2JHE A;  1W8Y A;  4X55 A;  4B4Z A;  4PMA A;  4O01 A;  1GHM A;  3K3C A;  1MKI A;  1TS8 A;  3NDG A;  4B4X A;  3BJN A;  1BUL A;  3PHY A;  3FKV A;  2HV1 A;  3HLW A;  3NHQ A;  3V3R A;  1BLP A;  5AVE A;  2O9C A;  3CZD A;  3E4Q A;  3VSK A;  4UA9 A;  4L9F A;  1ES4 A;  5DKL A;  4RX3 A;  1DJB A;  1ONH A;  4NK3 A;  4M4X A;  2P9V B;  4LV1 A;  2JBF A;  4BLM A;  4XXR A;  4EER A;  3HJK A;  3IX8 A;  1D7E A;  2Y2J A;  4GHI A;  2QHK A;  3RFB A;  3C2W A;  1VQQ A;  2IWB A;  3H7W B;  1S67 L;  4OP5 A;  4DMZ A;  2FH5 A;  5FQI A;  5J8X A;  2VGK A;  2XQZ A;  3DW0 A;  3G35 A;  2ZQ9 A;  4ETZ A;  4BJP A;  3P98 A;  1W8Q A;  3UB8 A;  5G4Z A;  5HDS A;  1UWN X;  4IVI A;  3ZCZ A;  2Y2Q A;  3LY3 A;  4IJG A;  4XT2 B;  1IYQ A;  4EWF A;  1GHI A;  2FFF B;  3IWI A;  2O9A A;  3Q7Z A;  4FUW A;  1DY6 A;  3N8L A;  4CQH A;  3UY6 A;  2XD5 A;  4N9K A;  3QP6 A;  1MKM A;  4EES A;  5TBM B;  1L3L A;  5EVI A;  1G28 A;  1T19 A;  5U47 A;  3LO7 A;  2ZC3 B;  3HLB A;  1GSW A;  2ZC5 B;  2W3G A;  2XRN A;  3AGE A;  5HD5 A;  1NY0 A;  2QMI A;  2J9P A;  4DE3 A;  3ULF A;  3KO6 A;  3AGF A;  1VB6 A;  1LSW A;  2ZMA A;  2QJ5 A;  5CGX A;  1H3Q A;  3MF0 A;  5E2H A;  3PAG A;  4R6L A;  1W63 Q;  3IHA A;  1NXY A;  3KYE A;  4MBF A;  2WKP A;  4KG5 A;  4GLQ A;  5HWV A;  5CXW A;  4R0Q A;  1X0O A;  4FSF A;  3PXP A;  3W4Q A;  1PYY A;  2FZ0 A;  4KZ7 A;  1S0W A;  3DTI A;  3UB5 P;  4CLC A;  4GNU A;  1FOF A;  4CPK A;  5FEF A;  4HH2 A;  2C5W B;  5F5Y A;  2PD7 A;  4MN5 A;  1M40 A;  3GSG A;  1BTL A;  1YLP A;  3RJU A;  5HWT A;  4AFI A;  4RQ9 A;  2YKF A;  4GW9 A;  4KEN B;  3WS4 A;  1PW1 A;  1NZO A;  3PBR A;  1W63 M;  3VSL A;  4E6X A;  5FQK A;  5CED A;  4E3I A;  4WN5 A;  1K38 A;  3T4S A;  4LLO B;  1K56 D;  2WAD A;  4KZ9 A;  4PHT A;  1BLC A;  1QMF A;  1F9I A;  3TOI A;  2JKR I;  2I9V A;  3E0Y A;  1K6S A;  3UE3 A;  4ESP A;  1V9Z A;  5CEB A;  2PR6 A;  4ETX A;  4Z9Q A;  2Y2H A;  1OTA A;  4BMW A;  4C6Y A;  1XFQ A;  2PU4 A;  1ZG6 A;  1FR6 A;  2L0W A;  4WEL A;  5CTN A;  3S7Q A;  4II7 A;  3C8C A;  2X02 A;  5EOO A;  5CTM A;  3HUN A;  2WGV A;  3IX3 A;  4HQA A;  3PBN A;  3BW6 A;  5M18 A;  4G3K A;  1LL5 A;  3VMA A;  3D72 A;  1VET B;  2J3T D;  4HY8 A;  2YKH A;  1EWZ A;  3DTM A;  1YPR A;  1ESU A;  5MC7 A;  5AVF A;  4ME4 A;  1LSX A;  2GNX A;  4JF4 A;  4FH4 A;  5EE8 A;  1D1J A;  2Y91 A;  3KYQ A;  5FQJ A;  4HP9 A;  1ONG A;  3PR6 A;  4R4S A;  5E2F A;  5FEG A;  4KZA A;  3C30 A;  2OLV A;  2Y2P A;  3T1R A;  2VZW A;  1YLJ A;  2WAE A;  3BQ8 A;  4MNR A;  4BD1 A;  3HLG A;  1V9Y A;  2JKT M;  1BLS A;  4LV2 A;  3EOI A;  3SS4 A;  1CEG A;  4UHU A;  4I3A A;  1GCE A;  2Y2K A;  3H82 A;  2P04 A;  2JKR M;  5G18 A;  3ZHH A;  4H6J B;  1W79 A;  3IBR A;  4JBF A;  1WYC A;  2HP9 A;  3ZVW A;  4IUK A;  1VM1 A;  4UEY A;  4E3J A;  1JWZ A;  2WYX A;  5AQ7 A;  1PFL A;  2V9A A;  3V67 A;  1G6O A;  3WRZ A;  4B93 A;  3EGX C;  3LR4 A;  3WS1 A;  3ZDJ A;  5L07 A;  3MSH A;  5F1G A;  2HZ5 A;  3A0R A;  3W2Z A;  3LIB A;  1TDL A;  1STZ A;  4QB8 A;  1SHV A;  1J3W A;  2QJ7 A;  3BFF A;  4O8G A;  2WKE A;  1E4D A;  5CEC A;  4I3J A;  4NXF A;  1KGG A;  4B9O A;  4LEN A;  3OZH A;  4EQ1 A;  1Z6F A;  5D3O A;  3C7U A;  2Y2G A;  1LL8 A;  1TS6 A;  2VV6 A;  2ZMF A;  2ZQA A;  1TDG A;  3CUE A;  4X1L A;  5EEC A;  2J80 A;  4K08 A;  1G6A A;  1CI9 A;  1FIK A;  1JTD A;  3HBR A;  4C3Q A;  1UWP X;  4HJ4 A;  3E2L A;  2XFS A;  2XGN A;  2OAQ 1;  3ZG7 B;  3IWO A;  3G6O A;  2XH9 A;  4E6W A;  4JXG A;  3GMW A;  3IX4 A;  3HUM A;  3CI6 A;  5L10 A;  2PBY A;  3OCL A;  1WYB A;  2E8I A;  3UE1 A;  4PPR A;  5HWW A;  5J7E A;  1K56 A;  3TJZ C;  3TE8 A;  5TGF A;  1SKF A;  5FAT A;  4X56 A;  5EVI D;  4OQH A;  2J7V A;  3UB9 A;  5JYP A;  3C4O A;  5GHZ A;  3LIF A;  2HJE A;  1K55 C;  3LEZ A;  5FAQ A;  1NLY A;  3IXG A;  2QWS A;  5DFX A;  3DTK A;  4P6Z S;  3RXX A;  1K55 A;  2HJ9 C;  1OTB A;  5CGS A;  3VP1 A;  2ZQ7 A;  3O88 A;  1XX2 A;  3G2Y A;  4JF6 A;  4BEN A;  4E3K A;  4UAA A;  1ES3 A;  1H8Z A;  5F6A A;  3T1Q B;  2VEA A;  3VP3 A;  3DWK A;  3UB7 A;  1FSY A;  2Z2M B;  4FCF A;  2WGW A;  4CLC E;  2Y2O A;  4CJN A;  2DRW A;  4Y15 A;  4HOI A;  4YOF A;  3UDI A;  3S1Y A;  2NUT C;  1OTI A;  1RP5 A;  3UN7 A;  1Y4O A;  3S4X A;  2FFY A;  4KQO A;  4EBL A;  2BAS A;  3GEC A;  3S7N A;  2HDR A;  2L1M A;  1N9B A;  4EXO A;  5HFO A;  1ESI A;  2RCX A;  1ACF A;  1J9M A;  5CRF A;  4S2N C;  4KG2 A;  5FI2 A;  3UDX A;  4LRY C;  3ZG9 B;  1TEM A;  1OTD A;  1N9O A;  4OPZ A;  4S2N A;  4I39 A;  3LUQ A;  5KIZ A;  1GSV A;  1FR1 A;  1YLZ A;  2ZC6 B;  4ID4 A;  5FQM A;  2W1R A;  5HPI A;  2O0Y A; 
#chains in the Genus database with same CATH homology
 1IYQ A;  4IED A;  1ES2 A;  5DF8 A;  1AXB A;  3PBO A;  4EWF A;  1GHI A;  4JKT A;  4NET A;  1PI5 A;  4OON A;  1BLH A;  2XDM A;  3Q07 A;  2FFF B;  2XLN A;  3IWI A;  1SDE A;  4E3N A;  4WYY A;  3Q7Z A;  1XKZ A;  1DY6 A;  2Y59 A;  3N8L A;  3GR2 A;  3UY6 A;  2XD5 A;  1FCN A;  2IWC A;  2R9X A;  2WAF A;  3G2Z A;  1IYO A;  1JWV A;  4R3J A;  1K54 A;  4MBK A;  3A3E A;  4N9K A;  2V2F F;  2XD1 A;  4RX2 A;  4EBP A;  3BLS A;  2ZQ8 A;  5KMW A;  5BOH A;  5EVI A;  5GLA A;  4ZJ2 A;  3ZNY A;  5CGW A;  1YT4 A;  1XP4 A;  3VP4 A;  4BD1 A;  5U47 A;  3LO7 A;  1NYY A;  2ZQD A;  1CI8 A;  1TVF A;  1SCW A;  2EFX A;  2ZC3 B;  4B88 A;  3HLB A;  5KSH A;  1MWR A;  2G2W A;  4R3B A;  4WM9 A;  1MWT A;  2ZC5 B;  5DF7 A;  5F82 A;  4Y0O A;  5GHX A;  2HP5 A;  3AGE A;  3TSG A;  1IYP A;  1PWC A;  1NY0 A;  2QMI A;  3OCN A;  2J9P A;  3VFF A;  4DE3 A;  3GV9 A;  3N4I A;  4OLG A;  1IKG A;  4GD6 A;  4KQR A;  3AGF A;  4MBH A;  3QHY A;  4ZBE A;  4EV4 A;  1IEM A;  2OV5 A;  5FQQ A;  4N9L A;  1K6R A;  2ZMA A;  2OLU A;  2JC7 A;  4S2J A;  1L0G A;  2Q9M A;  3GTC A;  5CER A;  5CGX A;  3V50 A;  3A3F A;  3WRT A;  4E3O A;  4S2M A;  4F94 A;  3BFG A;  5FQ9 A;  5E2H A;  3PAG A;  3IHA A;  2WK0 A;  1NXY A;  4MBF A;  3W4P A;  5HL1 A;  4KG5 A;  3MBZ A;  3BLM A;  5EPH A;  4FH2 A;  1Q2P A;  2GDN A;  5CXW A;  3BYD A;  4R0Q A;  4FSF A;  4QY6 A;  1RCJ A;  3NDE A;  3W4Q A;  1PYY A;  1K25 A;  4KZ7 A;  1S0W A;  4S2L A;  1PIO A;  3E2K A;  5TR7 A;  3NY4 A;  1ZC2 A;  1HZO A;  4A5R A;  1YM1 A;  4GB7 A;  4GNU A;  1FOF A;  4CPK A;  1BSG A;  2Y2I A;  3HRE A;  4X53 A;  4K0W A;  2C5W B;  4XUZ A;  5KSC A;  2HDU A;  1WE4 A;  4WMC A;  1M40 A;  3Q7V A;  3GSG A;  1XA7 A;  5HAI A;  1BTL A;  1YLP A;  4JXW A;  3RJU A;  1Q2Q A;  4KEN B;  4K91 A;  3Q81 A;  3WS4 A;  1PW1 A;  3LCE A;  3SOI A;  4OOY A;  1YMS A;  1NZO A;  4JXV A;  4OQ0 A;  3PBR A;  3O87 A;  3SS3 A;  4S2K A;  3VSL A;  4E6X A;  2I72 A;  5FQK A;  1ERQ A;  5CED A;  1K4E A;  3MZE A;  4E3I A;  1K38 A;  1LI9 A;  3V3S A;  1K56 D;  2WAD A;  1NYM A;  5FDH A;  2Y4A A;  3ZG0 A;  1DJA A;  2EX2 A;  3IQA A;  4QD4 A;  4BL2 A;  1L0F A;  4KZB A;  2PU2 A;  4KZ9 A;  4DXB A;  1BLC A;  1QMF A;  3NC8 A;  4KZ8 A;  5FI7 A;  3TOI A;  4N1H A;  4IBR A;  5E43 A;  3UPO A;  2ZLY A;  2BG1 A;  4U0X A;  1NZU A;  4U0T A;  1CEF A;  1K6S A;  3FKW A;  3UE3 A;  2ZQC A;  1YMX A;  3G32 A;  5CEB A;  2EX8 A;  3M6B A;  5HX9 A;  5JYO A;  2EX6 A;  4Z9Q A;  4KZ3 A;  5AQA A;  4L0L A;  2Y2H A;  3EQU A;  5FAP A;  5A90 A;  3FYZ A;  1BT5 A;  4U3T A;  5DTS A;  5EVL A;  4C6Y A;  2ZM2 A;  3ISG A;  5M19 A;  4P85 A;  2PU4 A;  2HP6 A;  4RVA A;  1ZG6 A;  1FR6 A;  2JCH A;  4WEL A;  5CTN A;  4E3L A;  3N6I A;  5HAQ A;  1C3B A;  3UDF A;  2X02 A;  3I7J A;  3PBQ A;  1G68 A;  5EOO A;  5TFQ A;  4DF6 A;  5CTM A;  3C7V A;  3HUN A;  4GD8 A;  1YLY A;  2CC1 A;  2WGV A;  4OLD A;  3BFD A;  3Q82 A;  5DTK A;  3PBN A;  5M18 A;  2WKI A;  3HLC A;  4H8R A;  3B3X A;  1HTZ A;  3ZFZ A;  1LL5 A;  2WZX A;  3VMA A;  1MXO A;  3IWQ A;  4GN2 A;  2X01 A;  2JE5 A;  2WUQ A;  3V5M A;  4OH0 A;  4RA7 A;  1EWZ A;  3DTM A;  3GQZ A;  3GVB A;  2HPB A;  4WMC D;  3ZVT A;  1ESU A;  3HL9 A;  3MZF A;  3Q1F A;  1JWP A;  3O86 A;  4RYE A;  4JF4 A;  3VFH A;  4P6B A;  4EBN A;  2C6W B;  4FH4 A;  5EE8 A;  2XFT A;  2IWD A;  3OC2 A;  3MZD A;  2Y91 A;  3MXR A;  3QNC A;  4DE1 A;  2Y2L A;  3A3I A;  5FQJ A;  1ONG A;  2WGI A;  4R4S A;  1ZG4 A;  2EXA A;  3M2J A;  5E2F A;  4KZA A;  2OLV A;  2Y2P A;  4LV0 A;  3N8R A;  2VGJ A;  1ZKJ A;  1YLJ A;  4DXC A;  2WAE A;  4MNR A;  4ZTK A;  3CMZ A;  1I2W A;  1SDN A;  2EXB A;  3HLG A;  4MLL A;  3IF6 B;  4P0M A;  4YIN A;  3IT9 A;  5F83 A;  1U60 A;  1BLS A;  4WEK A;  4LV2 A;  2HDQ A;  4N92 A;  1CEG A;  3NCK A;  2WGW B;  4UHU A;  3BEB A;  4JXS A;  4XUX A;  1GCE A;  3SS4 A;  3CG5 A;  2ZD8 A;  1BUE A;  2Y2K A;  5F1F A;  5KZH A;  3PAE A;  4YFM A;  5G18 A;  3ZHH A;  4OVD A;  5GLD A;  4PM7 A;  5FA7 A;  1W79 A;  4DDY A;  5HW3 A;  2X71 A;  4JBF A;  1L0E A;  1WYC A;  2HP9 A;  1XA1 A;  1KDW A;  3ZVW A;  4JF5 A;  1VM1 A;  3OPL A;  4E3J A;  1QME A;  4WZ4 A;  3LY4 A;  4QU3 A;  1JWZ A;  2WYX A;  1KGE A;  3UPN A;  3VOZ A;  3OPR A;  4DE0 A;  1PWD A;  3VP2 A;  1ES5 A;  4QHC A;  5AQ7 A;  1LLB A;  4KQQ A;  2Q9N A;  3N8S A;  1PZP A;  3UNW A;  3SH9 A;  1KE4 A;  3O3V A;  3WRZ A;  2R9W A;  5DVA A;  5GLC A;  4P87 A;  3WS1 A;  3ZDJ A;  4E3M A;  3G31 A;  5F1G A;  4N1X A;  4D2O A;  4ZAM A;  1TDL A;  1W7F A;  1GA0 A;  1GA9 A;  2G2U A;  2J8Y A;  2ZC7 A;  5CHJ A;  5FSR A;  3IF5 A;  4DDS A;  5HAR A;  3HLF A;  4QB8 A;  1SHV A;  1EI5 A;  3BFF A;  3EQV A;  2WKE A;  1E4D A;  5M1A A;  3W4O A;  1KGF A;  3OPH A;  1ALQ A;  1FQG A;  2A49 A;  5CEC A;  4FD8 A;  4IBX A;  4IVK A;  4OPR A;  4S2I A;  1KDS A;  1KGG A;  3IXD A;  4GOG A;  4MEZ A;  4Y0T A;  4R23 A;  3NIA A;  4EUZ A;  4LEN A;  1YLW A;  4WEJ A;  3UPP A;  3OZH A;  1MY8 A;  4OP8 A;  1Z6F A;  2HDS A;  5D3O A;  5GL9 A;  3C7U A;  3ITB A;  2Y2G A;  3IXH A;  2J9O A;  2ZQA A;  4OKP A;  4Q8I A;  1MWU A;  1TDG A;  3GRJ A;  3SH7 A;  3BFC A;  2Z2L B;  5GHY A;  5AQB A;  2B5R A;  5EEC A;  4OOM A;  4DKI A;  1RGY A;  1LI0 A;  4HBU A;  3W8K A;  1MWS A;  1G6A A;  1CI9 A;  2UWX A;  3BFE A;  3ZGA B;  3DWZ A;  1IYS A;  5EOE A;  2A3U A;  1JTD A;  3HBR A;  4C3Q A;  4OPY A;  2H10 A;  1ERO A;  1GHP A;  3E2L A;  1DJC A;  4KZ6 A;  2XFS A;  5A93 A;  2XGN A;  2Y2N A;  3Q7V B;  4S2P A;  3SH8 A;  5I94 A;  1KVM A;  3ITA A;  4GDB A;  3UO9 A;  1Y54 A;  3OPP A;  3ZG7 B;  1RGZ A;  4OOL A;  3IWO A;  3ZG5 A;  2XH9 A;  4ZJ3 A;  4M3K A;  3PTE A;  4E6W A;  4JXG A;  2RL3 A;  1KE0 A;  2V1Z A;  3GMW A;  3HUM A;  3IHB A;  4GKU A;  3VOY A;  1E25 A;  2PBY A;  1YQS A;  3C5A A;  1HD8 A;  3C4P A;  4X69 A;  3OCL A;  2EX9 A;  1N4O A;  1WYB A;  2E8I A;  3IH8 A;  3UE1 A;  3ZG8 B;  5L2F A;  4PPR A;  3G30 A;  1K56 A;  3IF6 C;  1NJ4 A;  4UA6 A;  5TGF A;  3LY3 A;  4K0X A;  1SKF A;  4R4R A;  5FAT A;  1M6K A;  2XR0 A;  4X56 A;  5EVI D;  4OQH A;  3ZNT A;  2QZ6 A;  4ZDX A;  2J7V A;  5JYP A;  1H8Y A;  3C4O A;  4Y7P A;  3JYI A;  5GHZ A;  3FZC A;  4LCL A;  5DTT A;  5CHM A;  3IF6 A;  3CJM A;  4BD0 A;  1IEL A;  1XXM A;  4HBT A;  3IXB A;  1K55 C;  3LEZ A;  3WS5 A;  1XGI A;  2XK1 A;  3HVF A;  5FAQ A;  3MKF A;  3IXG A;  5HAP A;  2P9V A;  4WBG A;  4BL3 A;  3A3D A;  1L2S A;  1PW8 A;  3HUO A;  5CHU A;  5FAO A;  1FCM A;  1L0D A;  1E3U A;  1KVL A;  3RXX A;  3N7W A;  1XPB A;  2DNS A;  4S2O A;  1K57 A;  1KE3 A;  1PWG A;  2OSU A;  3HLD A;  3VP0 A;  4BQM A;  1K55 A;  4KG6 A;  1XGJ A;  2ZC4 B;  5CGS A;  2ZQ7 A;  3VP1 A;  3O88 A;  5DF9 A;  1XX2 A;  1I2S A;  3SS5 A;  3MFD A;  4UA7 A;  4JLF A;  1ERM A;  3G2Y A;  4JF6 A;  4OQI A;  4O7D A;  4BEN A;  4PM6 A;  5GLB A;  1S6R A;  1IKI A;  4E3K A;  1JTG A;  4UAA A;  4PM8 A;  5AQ9 A;  3RXW A;  5FAS A;  1ES3 A;  1PZO A;  1BZA A;  1H8Z A;  1K57 C;  2XF3 A;  4KZ4 A;  2ZM8 A;  1HVB A;  5A91 A;  3IH9 A;  3S22 A;  3VP3 A;  4HEF A;  2H0Y A;  3HLE A;  3PBT A;  3DWK A;  2QPN A;  4KZ5 A;  2Y2M A;  2V20 A;  1FSW A;  2Z2M B;  1FSY A;  3MXS A;  1PI4 A;  4FCF A;  4LV3 A;  4C75 A;  2WGW A;  4X68 A;  4GDN A;  2Y2O A;  2WZZ A;  4Y0U A;  5E2G A;  4CJN A;  2DRW A;  2ZM0 A;  1K54 C;  1H5X A;  3BRM A;  3NBL A;  3NI9 A;  3M2K A;  3AGD A;  4X6T A;  2Y55 A;  3V39 A;  1MBL A;  4PM9 A;  3UDI A;  1MPL A;  4DE2 A;  1W8Y A;  4X55 A;  5EVI C;  4B4Z A;  4PMA A;  3S1Y A;  1E3U D;  3BEC A;  4QY5 A;  1GHM A;  1RP5 A;  2DCF A;  1MKI A;  3UN7 A;  1O7E A;  3NDG A;  4B4X A;  3S4X A;  1NRF A;  2FFY A;  4KQO A;  1BUL A;  1LHY A;  4JPM A;  4EBL A;  3D4F A;  3FKV A;  3QNB A;  3HLW A;  3FV7 A;  3V3R A;  4HES A;  1BLP A;  4OPQ A;  3A3J A;  1K4F A;  3CZD A;  3M6H A;  4WZ5 A;  3VSK A;  2HDR A;  4LCM A;  4UA9 A;  2P74 A;  1ES4 A;  4RX3 A;  1DJB A;  4DRT A;  1N9B A;  1I5Q A;  1ONH A;  4NK3 A;  2H0T A;  4ZJ1 A;  5HFO A;  5A92 A;  2P9V B;  3P09 A;  4LV1 A;  1ESI A;  2RCX A;  4OQG A;  2EFU A;  3BM6 A;  4PM5 A;  2JBF A;  1J9M A;  3TG9 A;  3WS2 A;  4BLM A;  4XXR A;  5CRF A;  4S2N C;  4KG2 A;  5EUA A;  2ZJ9 A;  3MKE A;  2Y2J A;  4WZ5 C;  5FI2 A;  3UDX A;  5E2E A;  1VQQ A;  2IWB A;  3UE0 A;  3G4P A;  3PBS A;  4OP5 A;  4QJG A;  1YLT A;  3ZG9 B;  2XEP A;  4R1G A;  1TEM A;  5FQI A;  3WS0 A;  3G34 A;  5J8X A;  2VGK A;  4OPZ A;  1FCO A;  1W5D A;  2XQZ A;  3DW0 A;  3G35 A;  4S2N A;  1CK3 A;  2WKH A;  2ZQ9 A;  1FR1 A;  4BJP A;  1OME A;  3P98 A;  5EVI B;  1W8Q A;  1YLZ A;  4EQI A;  5FI6 A;  5IHV A;  3FWL A;  3WWX A;  2BLS A;  1O07 A;  2ZC6 B;  4IVI A;  4GZB A;  1LL9 A;  4ID4 A;  5FQM A;  3ZCZ A;  2H5S A;  2Y2Q A;  1JVJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...