1XXMA

The modular architecture of protein-protein binding site
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
263
structure length
263
Chain Sequence
HPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDLVAASPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The modular architecture of protein-protein binding interfaces
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Beta-lactamase TEM
total genus 90
structure length 263
sequence length 263
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2004-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1xxmA00
4QY5A 1PZOA 2WGIA 3MXSA 3P98A 3UN7A 1YLJA 2Y2JA 3G2YA 3G35A 3MXRA 5E2EA 1AXBA 5EOOA 2WAEA 5CXWA 1L2SA 5CEDA 1K38A 4WZ5A 4EQIA 1K56D 1IYQA 1BLSA 1QMEA 4GKUA 4MNRA 4K0XA 3HBRA 5EECA 4MEZA 3PAGA 1HZOA 5AQAA 4IBRA 2XEPA 4HBTA 2PBYA 4QD4A 5M19A 1BTLA 3V3SA 3VP2A 5E2GA 4BL3A 4CJNA 5HX9A 1JTDA 3JYIA 2JC7A 3CG5A 1KGGA 4PM6A 3ZG0A 5FQQA 4GD6A 3S4XA 5HAQA 4LV3A 3SS5A 3UPPA 5GHZA 4S2MA 4GB7A 1IYPA 5KMWA 3UO9A 1IYSA 3UE3A 3FKWA 3SOIA 1E3UD 3NDEA 4OQIA 4BQMA 3BECA 1ZC2A 4QHCA 3LEZA 4OQ0A 1H8YA 4RA7A 3WS5A 2J8YA 2E8IA 5CERA 3Q1FA 5KSCA 4JXSA 3V3RA 2XQZA 3C4PA 3MKFA 1GA0A 1MWRA 1PZPA 1GHMA 1KGEA 3MBZA 3UDIA 3VP1A 4OPRA 2XLNA 4OLDA 1CI9A 1KDWA 3IXDA 4R4SA 2Y2QA 5HL1A 2ZQ7A 4X55A 3B3XA 2ZC6B 1PWGA 3M6BA 3VSKA 4U3TA 1L0DA 4NK3A 3ZVWA 1PW8A 1NY0A 1H5XA 1PI4A 5AQ9A 4KZ3A 2Y2MA 5DF7A 4KENB 2J7VA 3I7JA 1NZUA 3P09A 3LO7A 4KG5A 2Y2LA 3FZCA 5FASA 3FYZA 1MWSA 1DJBA 1YMXA 5TR7A 4PM9A 3ZDJA 3PBTA 4E3KA 4KQQA 4UAAA 3A3DA 1G6AA 4PM8A 1FR1A 1I2SA 4YINA 5HAIA 3IT9A 1YLWA 4S2KA 4M3KA 5CGSA 1NXYA 2Y2KA 5FA7A 4A5RA 3OPHA 4BD1A 3RXXA 3WS1A 4IEDA 4FH2A 5EPHA 3BLMA 5I94A 5D3OA 4OOYA 4EBLA 4C3QA 4UA9A 3BFDA 3W4OA 3OZHA 5FAQA 1N9BA 4P6BA 3OCNA 2HDQA 2Y2HA 4E6WA 3HL9A 4KZ8A 4P0MA 4Z9QA 2Y91A 1KDSA 2IWCA 1KE4A 4UA6A 1XGIA 4OPYA 3IH9A 1ES5A 4NETA 3IF6A 2QPNA 3MFDA 4BJPA 2HDUA 2C6WB 2ZC5B 3HLDA 3ZG5A 5HW3A 2P9VA 3IXGA 3Q81A 4GN2A 4ZAMA 4B4ZA 1MPLA 1VM1A 3G34A 4QB8A 1DJCA 2Y2NA 1KE3A 3HLBA 3ISGA 3GQZA 1GA9A 4DXCA 1LLBA 5A91A 4JF6A 3BYDA 4C6YA 3OPRA 5KSHA 1SHVA 1JTGA 4MLLA 2EXBA 2R9XA 3ZG9B 2Y2PA 4KZ7A 1FSWA 1JWZA 3WS2A 3HLCA 1K55A 2BLSA 3WRTA 4DE1A 1K57A 2ZQ8A 5DTSA 1XXMA 2I72A 1IELA 3ZVTA 3V5MA 2HP5A 5CECA 2QZ6A 4D2OA 1C3BA 4E3JA 5M1AA 2X71A 4LCLA 3PBNA 5EVIB 2PU2A 1ERMA 5G18A 2ZM8A 4DKIA 4JLFA 4KZ6A 3BEBA 1K55C 4U0TA 2ZMAA 1BT5A 3NDGA 1MXOA 2V1ZA 4WMCD 4RX3A 2C5WB 4OPZA 4OQGA 4GD8A 1N4OA 4OONA 1BUEA 4K91A 4Y7PA 4H8RA 2EX2A 4O7DA 1O7EA 1CI8A 2H10A 1L0GA 4RYEA 1MBLA 4IVKA 1LL5A 4E3IA 1YMSA 3ZG7B 1JWVA 1WYCA 4JXGA 4N1HA 4KZBA 2WZZA 4X69A 3Q7VB 4DF6A 1WYBA 3Q7ZA 4R0QA 4ZDXA 2X02A 1RCJA 4EBNA 1YT4A 5JYOA 3IH8A 1VQQA 4BL2A 3IWIA 2H0YA 3W4QA 4HBUA 2ZQDA 3DWZA 3BRMA 4GOGA 3PBSA 5CEBA 3HLGA 5GL9A 3TSGA 2EX8A 1PI5A 2G2WA 4XUXA 4JXWA 2ZQCA 4E3NA 1NJ4A 3MZDA 3O87A 4GNUA 4MBHA 2XF3A 4OOLA 4GDBA 3IQAA 3VP4A 2WUQA 3GTCA 2V20A 4JBFA 4LV0A 1E25A 4E3MA 3CJMA 3A3JA 3RJUA 2Q9MA 1ES2A 1KVMA 2EX6A 2J9PA 2J9OA 1XPBA 3N8RA 4GZBA 3G2ZA 3UY6A 4KQRA 3ITAA 4R23A 2DCFA 3HLEA 1WE4A 3TOIA 1SCWA 3G30A 4UHUA 4OVDA 5BOHA 1IYOA 4E3LA 4WMCA 3QNBA 2XGNA 2XK1A 1QMFA 2ZD8A 4KG6A 4QU3A 5F83A 3WWXA 2CC1A 4KG2A 1KGFA 2B5RA 5HARA 3UPOA 5E2FA 4DRTA 3AGEA 1U60A 1ONGA 5J8XA 3A3FA 1KVLA 1NRFA 1TVFA 5TFQA 1HD8A 5CHJA 1ERQA 1M6KA 1Q2QA 1MWTA 2WGWB 3N4IA 2WKEA 4ZJ3A 3IWQA 3HVFA 1LI9A 3HUOA 1K57C 1Y54A 1HVBA 3QNCA 5FI2A 2RL3A 3SS3A 3V50A 4OPQA 4KQOA 3Q7VA 3EQUA 1JVJA 2Y2GA 5FSRA 1SDEA 4K0WA 1M40A 2DNSA 3C4OA 4OOMA 4S2LA 3TG9A 2ZQ9A 3C5AA 5GLDA 2HDRA 4WEKA 5CGXA 3PTEA 1YLZA 3IHBA 4F94A 3PAEA 2ZM2A 4HESA 4R1GA 3A3IA 1BZAA 2QMIA 4L0LA 2BG1A 4FCFA 2ZJ9A 2XFSA 1TDGA 3LY4A 3N8LA 4Y0OA 4WYYA 1YLTA 1J9MA 3CZDA 4P85A 3UPNA 2Z2MB 1O07A 5DF8A 2FFYA 5M18A 1S6RA 1ES4A 1K4FA 3OCLA 4OLGA 3UE0A 1MY8A 3ZGAB 2DRWA 4Y0TA 1MWUA 1IKIA 1ZG4A 1XX2A 5FQMA 1W8QA 2A3UA 3IHAA 3VSLA 3NIAA 3IWOA 3S1YA 1PW1A 3IF6C 3ZCZA 5FDHA 5GLBA 2Y55A 3PBOA 3VOYA 5DVAA 1K54C 4HEFA 2ZC4B 2GDNA 4UA7A 1XGJA 4WZ4A 3C7VA 4KZ5A 4QY6A 4R3JA 5CGWA 5EVID 4JPMA 4XUZA 3NCKA 3NY4A 4PPRA 4S2IA 4EV4A 5FI6A 1H8ZA 1L0FA 3D4FA 5CHMA 2EFUA 2Q9NA 5KZHA 2PU4A 3IF6B 1CEFA 4N9KA 4PMAA 4Y0UA 5FATA 1L0EA 4IVIA 4JF4A 1YQSA 2HPBA 1Z6FA 1NYYA 2HDSA 3GMWA 4OP8A 2HP6A 1XKZA 5FQKA 5EVLA 4JKTA 4N92A 3S22A 2JCHA 3LY3A 5IHVA 4ZJ1A 5TGFA 3HUMA 1FCMA 4S2NA 5DF9A 1ZKJA 1ONHA 1K6RA 1K4EA 3M6HA 2EX9A 1PWCA 1W79A 1CEGA 4JF5A 4RVAA 1GHIA 1PIOA 4DE2A 3GSGA 1BLCA 1BSGA 1YM1A 2WGWA 4MBKA 5HAPA 4PM7A 4X6TA 2ZLYA 3LCEA 3MZEA 3HLWA 5A92A 5EVIA 2XD1A 3IXHA 5DTKA 4S2NC 3UE1A 3G4PA 1LHYA 4DE0A 1DY6A 1FSYA 3AGDA 1CK3A 4EBPA 3FKVA 4N9LA 1XA7A 3DWKA 2Y2OA 3SH9A 5HFOA 3SS4A 1HTZA 2Y2IA 3BFFA 1LI0A 3GR2A 3MKEA 2A49A 1MKIA 4JXVA 3A3EA 1OMEA 2XH9A 2VGJA 4ZJ2A 1K56A 4U0XA 2OSUA 1TDLA 4GDNA 3OC2A 3OPPA 2JBFA 3WS0A 2ZC7A 3M2JA 3HUNA 5FQ9A 1BLPA 3GV9A 1FQGA 2P9VB 1ALQA 2UWXA 1XA1A 4LCMA 2Y4AA 4ZBEA 3ZFZA 4RX2A 3MZFA 5CRFA 5U47A 1NYMA 3V39A 2HP9A 1ESIA 3UDXA 5CTMA 4E3OA 2RCXA 2IWDA 3SH8A 5DTTA 4BENA 2WYXA 1DJAA 1BLHA 3VMAA 1E4DA 4IBXA 2WK0A 3ZNYA 4FH4A 1ES3A 1LL9A 1XP4A 4S2JA 4BLMA 3N6IA 4CPKA 1PYYA 2WADA 3NC8A 3EQVA 4OQHA 4R4RA 4ZTKA 4OH0A 3BFCA 4X68A 1FOFA 3BFEA 2WKHA 5GLAA 1EROA 3IXBA 4N1XA 3QHYA 4MBFA 4LENA 1RP5A 2X01A 2P74A 4LV2A 4WZ5C 2FFFB 1I5QA 3BM6A 3O88A 2OLVA 3G31A 5EOEA 3DW0A 3OPLA 5E2HA 4X53A 1FCNA 1TEMA 3DTMA 3Q82A 4Q8IA 4E6XA 4OP5A 3W4PA 4WELA 1IEMA 3VFFA 4FD8A 2JE5A 5EVIC 2G2UA 3ZNTA 3VP0A 5A93A 3FWLA 5GHYA 2XR0A 1SKFA 4B4XA 4S2PA 1RGZA 2IWBA 3G32A 2OV5A 3NI9A 4EUZA 2EXAA 5F1FA 3E2KA 1YLPA 4EWFA 5E43A 3IF5A 2WGVA 1KE0A 4OKPA 5GLCA 3ZG8B 4YFMA 3FV7A 1ESUA 4PM5A 2XD5A 3SH7A 5GHXA 4DE3A 2WZXA 1E3UA 4WEJA 5F1GA 1S0WA 4WBGA 4B88A 4P87A 4C75A 3M2KA 3N7WA 4WM9A 1K25A 2ZQAA 3BLSA 3Q07A 3AGFA 3VOZA 1NZOA 3O3VA 1K6SA 5CTNA 4BD0A 5AQBA 5AQ7A 1IKGA 1W8YA 5FAOA 2R9WA 1GHPA 5A90A 3WS4A 3O86A 4QJGA 2Y59A 1BULA 4DXBA 3HLFA 2VGKA 2WAFA 1YLYA 2ZM0A 3CMZA 3C7UA 1ZG6A 3UDFA 5L2FA 3NBLA 1PWDA 2ZC3B 4X56A 1K54A 1Q2PA 5FI7A 3N8SA 3E2LA 4ID4A 5FAPA 1W5DA 3PBRA 1I2WA 1RGYA 2WKIA 1FR6A 4KZAA 4XXRA 2EFXA 5FQJA 3RXWA 4R3BA 5JYPA 2H5SA 3PBQA 2XDMA 5FQIA 3VFHA 4FSFA 1W7FA 1FCOA 1EWZA 1EI5A 2OLUA 3GRJA 3GVBA 4KZ4A 5CHUA 4DDYA 5EUAA 2V2FF 2XFTA 1JWPA 3UNWA 3VP3A 1G68A 4LV1A 4KZ9A 3W8KA 3HREA 5EE8A 3WRZA 1GCEA 5F82A 3ZHHA 4S2OA 1SDNA 2H0TA 3ITBA 3BFGA 4DDSA 2Z2LB
chains in the Genus database with same CATH superfamily
3MXSA 1YLJA 3G35A 2L1MA 2WAEA 1YAXA 3S7PA 3TJZC 1H0MA 2PBYA 5M19A 3E4PA 2K2NA 4BL3A 3CG5A 4PM6A 3ZG0A 5HAQA 4LV3A 2WKPA 1E3UD 3BECA 5HD5A 2DMWA 1H8YA 4LGWA 3UB7A 1GA0A 2ZOHA 3MBZA 3UDIA 3VP1A 3JVVA 4OLDA 2Y2QA 5HL1A 4X55A 4CLCE 3PYPA 4NK3A 3ZVWA 1X0OA 4NG2A 4KZ3A 1ODVA 3P09A 2Y2LA 3C2WA 2L4RA 2Z6CA 5TR7A 1IOUA 3PBTA 3P01A 4HJ4A 5HAIA 1FR1A 1I2SA 3IT9A 5CGSA 4M3KA 1D7EA 2PD7A 4Y5FA 3OPHA 5G4YA 4DJ3A 1F98A 4IEDA 4FH2A 4EBLA 2PAVP 4UA9A 4MN5A 2HDQA 4KZ8A 3DTEA 2Y91A 3DBAA 1KDSA 2Q0OA 2W3FA 3Q81A 1G28A 1KE3A 5DKLA 1GA9A 1LLBA 5A91A 3CUEA 3OPRA 4KZ7A 3WS2A 1K57A 2ZQ8A 1XXMA 3ZVTA 4KQDA 3T50A 2QZ6A 3CUEC 5M1AA 4LCLA 3PBNA 2ZL1B 3PHYA 4KZ6A 1K55C 4FUWA 4WMCD 2C5WB 4OPZA 1N9OA 4B93A 5HPFA 3F1OA 2VA0A 2K7SA 2H10A 1L0GA 2D01A 1XFQA 4RYEA 3IBRA 1YMSA 3ZG7B 4JXGA 1WYBA 1RCJA 4EBNA 4H6JA 2W1TB 3S7QA 5JYOA 2QJ5A 3IH8A 3ULFA 4BL2A 2H0YA 3DWZA 1D06A 3BRMA 2Y79A 4JXWA 4GNUA 4GDBA 1GSWA 2LB5A 1KVMA 2W0NA 3KO6A 4B9OA 2J9OA 1P97A 2PDRA 4GZBA 3G2ZA 3UY6A 2IA2A 3H7WB 4HIAA 2DCFA 5HSQA 5HWWA 1VB6A 4E3LA 3T4TA 3QNBA 4FOFA 2ZD8A 4KG6A 1KGFA 3UPOA 3H9WA 4EERA 1U60A 5J8XA 3A3FA 1TVFA 5CHJA 3KSHA 1YKDA 1M6KA 2WGWB 1MWTA 2WKEA 1D1JA 3QNCA 3SS3A 3Q7VA 2J3WA 5F6AA 3ZQ5A 4UEYA 2DNSA 2VV8A 2ZQ9A 2O9AA 3C5AA 3PTEA 5KIZA 3PAEA 5AVFA 3F1NB 1J9MA 3UPNA 1S6RA 4ARZB 4OLGA 4UQIS 3W2ZA 1NWZA 1S1ZA 1SKOB 1W8QA 3IHAA 3E98A 3IF6C 5GLBA 3PBOA 3VOYA 5DVAA 1K54C 4HEFA 4R3JA 5CGWA 4S2IA 1H8ZA 5CHMA 3NECA 3RFBA 4JF4A 2M7VA 1UGUA 1ZTUA 2HPBA 1TS7A 1NYYA 4AFIA 3R7WA 3T4LA 1NLYA 4N92A 3PR6A 5TGFA 3NHQA 1K6RA 2VV7A 4JGRA 3LIFA 3F1OB 4JF5A 1CEGA 1GHIA 1PFLA 1BLCA 1YM1A 2WGWA 4MBKA 4X6TA 2ZLYA 3KYEA 5EVIA 1XJ6A 3S7OA 1DY6A 1CK3A 3IS2A 3UMDA 1OMEA 1K56A 5TBMA 3OC2A 2JBFA 3M2JA 1BLPA 4BD1A 3HCYA 3ZFZA 4LCMA 4LRZE 5CRFA 2OWJA 3UE6A 2MJ6A 2RCXA 2IWDA 2B95A 4IBXA 2JKTM 3ZNYA 1P0ZA 1H3QA 1LL9A 4BLMA 3N6IA 1Z09A 5J4EA 1NLZA 4R4RA 3BFCA 2A24A 2WKHA 4N1XA 2A24B 3D3OA 4LENA 1Y28A 3E0YA 4LV2A 2X01A 2FFFB 1I5QA 4EEPA 5EOEA 4WL9A 3MQOA 4ETXA 1FCNA 4WELA 3LIEA 5EVIC 2G2UA 1TS8A 2QJ7A 2XR0A 4BWIA 4S2PA 1N9NA 2V1BA 3MJQA 2W3HA 3E2KA 3LI8A 1YLPA 4EWFA 4X1LA 2WKQA 1ESUA 5F1GA 4C75A 2NUTC 4WM9A 3Q07A 2BTFP 2VJWA 2J3TD 2Y59A 1BULA 2VGKA 3C7UA 1ZG6A 4RQ9A 1PWDA 4X56A 1K54A 5FI7A 1V9YA 4QWOA 2HGVA 4KUKA 2WKIA 3RXWA 5JYPA 4PAUA 3PBQA 1EI5A 5CHUA 4DDYA 4Y15A 1OTAA 3T1QB 5EE8A 3LUQA 5F82A 2JN7A 2Z2LB 1PZOA 2J80A 5CEDA 4WZ5A 1IYQA 1QMEA 1SKOA 4K0XA 3BQAA 3LR5A 1HZOA 1YSPA 4ETZA 4CJNA 5HX9A 4GD6A 3BW6A 3SS5A 3BY8A 4EXOA 4HH2A 3UO9A 3UE3A 3NDEA 5HWVA 3LEZA 4OQ0A 3WS5A 2E8IA 5CERA 3IX8A 3C4PA 1PZPA 1KDWA 3IXDA 4R4SA 3C38A 1OTEA 5EM0A 3MMHA 3B3XA 3CAXA 1PWGA 4U3TA 1NY0A 5AQ9A 2Y2MA 5DF7A 4KENB 3I7JA 3LO7A 4P6ZM 3FZCA 3FYZA 4CLCA 1YMXA 5HDDA 4PKYA 5G4ZA 3ZDJA 4E3KA 2OAQ1 4S2KA 2Y2KA 4A5RA 4EU0A 1K0KA 3KX0X 3P7NA 3EWKA 5EPHA 1VEUA 5I94A 4L9FA 5K5BA 3BFDA 5DJTA 4GHIB 3OLOA 4P0MA 4Q0HA 1MZUA 2IWCA 4UA6A 3T4QA 3CPTA 2QPNA 3MFDA 1LSWA 2HDUA 1GSXA 2JHEA 2ZC5B 5HW3A 2P9VA 3IXGA 4B4ZA 1MPLA 1DJCA 1A0KA 4DN0A 5EFWA 5KSHA 4MLLA 2EXBA 2R9XA 2Y2PA 1K55A 4ME4A 1IELA 1T18A 3V5MA 5FL3A 1W63M 2EWVA 2ZM8A 4JLFA 2VZWA 2ZMAA 1BT5A 4K91A 4H8RA 1LSXA 4O7DA 1MBLA 1LL5A 4K08A 4E3IA 1JWVA 1WYCA 4NXBA 4X1MA 4KZBA 2WZZA 3Q7VB 4DF6A 3Q7ZA 4R0QA 3IX4A 1N9LA 3NJAA 2HZ5A 2ZQDA 3H82B 4MN7A 5HL6A 3TSGA 2D02A 3KYQA 1PI5A 2G2WA 4XUXA 1NJ4A 4OOLA 4MBHA 2XF3A 5HD3A 3IQAA 3GTCA 1MKMA 3CJMA 2Q9MA 1ES2A 2EX6A 3T4OA 3A0SA 4WF0A 3ITAA 1WE4A 3TOIA 1SCWA 4OVDA 1IYOA 4EEUA 5F83A 3V67A 3HJIA 3WWXA 2B5RA 5HARA 3AGEA 2PT7A 2W27A 4XT2B 1HD8A 4JGPA 1ERQA 3FPVA 3T1RA 4NXEA 1Y54A 1HVBA 4I38A 2V1AA 4HH3A 3V50A 4KQOA 5FSRA 3OBFA 4K0WA 1M40A 3C4OA 4OOMA 3TG9A 4WEKA 3QP1A 4F94A 3CPTB 3UB9A 1BZAA 2QMIA 3UB8A 2BG1A 4FCFA 2XFSA 3N8LA 1VEUB 2Z2MB 5DF8A 1ES4A 3B47A 2DRWA 4Y0TA 3H7WA 5FQMA 4O01A 3S1YA 3T4SA 1F2KA 2ZC4B 2GDNA 4CLCD 1XGJA 4XUZA 4PPRA 5J3WA 3GECA 2Q9NA 2PU4A 4N9KA 2VK3A 4IVIA 1YQSA 3GMWA 1XKZA 4JKTA 2FH5A 4ZJ1A 3HUMA 1FCMA 5EV0A 5DF9A 1ZKJA 4F3LB 3CWFA 5MC7A 2M1CA 2GZAA 1W79A 4DE2A 3GSGA 3CLOA 4HP4A 3LCEA 3MZEA 5DTKA 4YNRA 2W3EA 1FSYA 4EBPA 2Y2OA 5HFOA 3MQQA 2A49A 1MKIA 2UV0E 1DP9A 4ZJ2A 3E4QA 3LIDA 3LR4A 4HHDA 5FQ9A 3IS2B 3HJKA 4ZBEA 2Y4AA 2KOIA 4Y13A 2L0WA 2HP9A 3UDXA 4E3OA 4DJ2A 2KLIA 2JKRM 3QHYA 1RP5A 4ESPA 3NOPC 3BM6A 3O88A 3UMEA 4X53A 1TEMA 3DTMA 4Q8IA 3LIBA 4OP5A 3MFXA 3W4PA 4FD8A 2JE5A 4I3JA 3ZNTA 4B4XA 1RGZA 1OTBA 5HWTA 5F1FA 5E43A 2W1RA 5GLCA 4WN5A 3SH7A 5GHXA 3EEAA 3M2KA 2ZQAA 3BLSA 1P9WA 3O3VA 1K6SA 4L9EA 5CTNA 5AQ7A 3WS4A 4QJGA 3HLFA 4BBUA 3UDFA 2ZC3B 4CQHA 1RGYA 4KZAA 4XXRA 2EFXA 4R3BA 2PRFA 4DDSA 2OLUA 1FCOA 1EWZA 3GRJA 2V2FF 3UNWA 3WRZA 1NRJA 3R4KA 3ZHHA 2WGIA 3P98A 3UN7A 5E2EA 5CXWA 3C8CA 3LFVA 3L9KA 4R3AA 1K56D 4MNRA 2PR6A 3HBRA 5EECA 4R38A 3K2NA 1PNEA 4JGOA 1HLUP 1JTDA 4GHIA 5FQQA 3QP5A 5GHZA 5KMWA 1OT6A 1IYSA 1JNUA 3SOIA 1Y4OA 4BQMA 1FIKA 4HJ6A 4BMWA 1ZC2A 4QHCA 4Q0JA 5EM1A 3T12B 4RA7A 3V3RA 2XQZA 4IHQA 2PBDP 1GHMA 3U4LP 3KSIA 1OTIA 4LRYC 3VSKA 4GJ4A 1NZUA 1OJ5A 4KG5A 4L9GA 2XROA 4PM9A 5IT5A 4BBTA 4KQQA 4PKYG 1G6AA 4PM8A 4YINA 1AWIA 1NXYA 1DP6A 1LT0A 1V9ZA 4LRXC 3BLMA 4HY8A 5D3OA 3C30A 3W4OA 1VHMA 3OZHA 4P6BA 3OCNA 2G7UA 5HDSA 5IU1A 4Z9QA 3BQ8A 1KE4A 1XGIA 3IH9A 1ES5A 4NETA 3IF6A 3HLDA 2C6WB 4NXGA 3ZG5A 4LFUA 3QP6A 1S1YA 1VM1A 3G34A 3TW8A 2Y2NA 3HLBA 3L7HA 3GQZA 1EW0A 3T4JA 1JTGA 3ZG9B 1FSWA 3WRTA 2INWA 4DE1A 3BY9A 2I72A 1CQAA 2HP5A 2O9CA 3EGXC 3G6OA 2ZL1A 3LR0A 2X71A 5EVIB 3RTYA 2PU2A 1ERMA 2V0UA 3VE3A 4DKIA 3B33A 1MXOA 4GD8A 1N4OA 3B42A 2JKTI 1CI8A 1G5UA 1XJ2A 4ZDXA 1F9IA 3W4QA 4HBUA 2JKFA 4GOGA 4Q0IA 5CEBA 3HLGA 2ZQCA 5EVEA 4E3NA 2V20A 4JBFA 4LV0A 5TBMB 3ZYTA 4E3MA 3RJUA 4LLOB 3N8RA 5HZHA 1OJGA 4KQRA 5FEGA 4IUKA 2PR5A 3HLEA 3MQ0A 1MC0A 2P08A 4WMCA 2XK1A 4QU3A 2CC1A 1ONGA 2PD8A 4NKPA 1NRFA 2FZ0A 1WA9A 3EOIA 2VGLS 1Q2QA 2O0YA 4EUVA 5L09A 1TD5A 4I3IA 3HVFA 1LI9A 3HUOA 1K57C 5L07A 2RL3A 3DTIA 3S7NA 1JVJA 4EQ1A 1SDEA 1P9RA 5GLDA 2HDRA 3KYZA 3IHBA 3KSFA 2ZM2A 3A3IA 3LY4A 3O5YA 1YLTA 3CZDA 1LSVA 3KSGA 4P85A 1O07A 1K4FA 1ACFA 3UE0A 4ARZA 1MWUA 1IKIA 2B18A 1T1CA 1ZG4A 1XJ3A 1PW1A 3ZCZA 5FDHA 1G6OA 3K3CA 4UA7A 2PHYA 3C7VA 4KZ5A 4QY6A 5EVID 4JPMA 4EV4A 3NCKA 3K3DA 5FI6A 3GDIA 2EA9A 2EFUA 5C5KA 5A8BA 5KZHA 3IF6B 4PMAA 1CEFA 5FATA 1L0EA 4EESA 2ZBBA 3MR0A 1Z6FA 1FILA 2HP6A 5EVLA 2VGLM 1TF1A 4S2NA 2XRNA 3M6HA 3PXPA 1PWCA 3QP4A 4RVAA 2J3TC 3CHWP 3VE4A 4YWZA 5A92A 2HV1A 3SZTA 5FEFA 4YOFA 4QPRA 4O0PA 3FKVA 2HF6A 1XA7A 3SH9A 4G3WA 3SS4A 1HTZA 2Y2IA 3BFFA 1LI0A 3GR2A 3UB5P 4JXVA 3A3EA 1STZA 1F5MA 2VGJA 4U0XA 1KOUA 4GDNA 1IFQA 5G18A 3HUNA 3GV9A 1BYWA 2H28A 4RX2A 1NYMA 4ZRRA 3FPWA 1ESIA 5CTMA 3DTKA 3SH8A 4M4XA 2BASA 3LICA 5DTTA 2WYXA 3JVUA 4FH4A 1PYYA 2WADA 3NC8A 4E04A 3EQVA 4OQHA 4KUOA 4OH0A 5GLAA 4X68A 3BFEA 1CJFA 1EROA 2XA7S 1L3LA 2P74A 4WZ5C 2QYBA 5L8MA 3G31A 3DW0A 3OPLA 5E2HA 2M7UA 4LPZA 2KDKA 4E6XA 3LYXA 5F68A 3TRCA 1CF0A 3VFFA 2V8FA 3F1PA 1T1BA 4JGQA 1TS0A 3VP0A 5A93A 3FWLA 5GHYA 2AVXA 2ZMVA 2IWBA 4H6JB 2OV5A 3NI9A 4EUZA 2EXAA 3QP8A 3ZG8B 2JKGA 4YFMA 3FV7A 4PM5A 4PHTA 4HNBA 2WZXA 1E3UA 3N7WA 2GJ3A 1K25A 2OAP1 3AGFA 3VOZA 5AQBA 1IKGA 1W8YA 5FAOA 1TS6A 5DJUA 3O86A 2YKFA 4EW7A 4GS9B 3UB6A 2ZM0A 3CMZA 3NBLA 4NEED 4MCWA 5L10A 4I39A 2JKRI 2QWSA 3E2LA 3PBRA 1FR6A 5FQJA 4II7A 2VV6A 4IUHA 2H5SA 3VMAA 2XDMA 3A0VA 5CECA 1W7FA 3GVBA 2PYPA 3CI6A 2XFTA 3VP3A 4LV1A 4D60A 2QKPA 4S2OA 1SDNA 2H0TA 3BFGA 4QY5A 4I5SA 2Y2JA 3G2YA 3MXRA 1AXBA 5EOOA 1L2SA 1K38A 3IBJA 4EQIA 1BLSA 4GKUA 4MEZA 3PAGA 5AQAA 4IBRA 2XEPA 4HBTA 4QD4A 1BTLA 2OOLA 3F1NA 3V3SA 3VP2A 5E2GA 5TJJA 3U2AA 3JYIA 2JC7A 1KGGA 3SW1A 3S4XA 3UPPA 4S2MA 3QP2A 4GB7A 1IYPA 3FKWA 2W3DA 4OQIA 4FTXA 2J8YA 3Q1FA 3R7WB 4JXSA 5KSCA 3MKFA 1MWRA 1KGEA 4OPRA 2XLNA 3CITA 1CI9A 2ZQ7A 2ZC6B 3M6BA 1L0DA 1PW8A 2HJEA 1H5XA 1PI4A 1OT9A 2J7VA 5F5YA 5FASA 1MWSA 1DJBA 1W63Q 5I5LA 4UAAA 1J3WA 4G3VA 4GCZA 3A3DA 2OWHA 1YLWA 2VKSA 5FA7A 3ICYA 3RXXA 3WS1A 4Y2FA 4OOYA 4C3QA 4X25A 3LIAA 5FAQA 1N9BA 3LGOA 2Y2HA 4E6WA 3HL9A 3BWLA 4OPYA 4BJPA 3EEHA 3NOTC 2CMNA 4ZAMA 4GN2A 3E4OA 4QB8A 3OOVA 3ISGA 4DXCA 4JF6A 3BYDA 4C6YA 1SHVA 1XFNA 1JWZA 4MMNA 4XT2A 3HLCA 2BLSA 5DTSA 5IS1A 3MS6A 4D2OA 1C3BA 4E3JA 5CX7A 2W3GA 1UWPX 3BEBA 4U0TA 3NDGA 2B02A 2V1ZA 4RX3A 4OQGA 4OONA 1BUEA 5HPIA 4Y7PA 2EX2A 1O7EA 4IVKA 1YPRA 2EWWA 2Y8HA 4N1HA 4DMZA 4X69A 1S4SA 5FDSA 2X02A 1YT4A 4HOIA 1VQQA 3T1SA 3IWIA 5AJGA 3PBSA 1ZHHB 5GL9A 2EX8A 1T19A 3MZDA 3JPUA 3O87A 3VP4A 2P7JA 2WUQA 1E25A 3A3JA 2J9PA 2V9AA 1XPBA 2ZOIA 4R23A 2PYRA 3G30A 4UHUA 5BOHA 4GLQA 1SZVA 2XGNA 1QMFA 4KG2A 1LL8A 5E2FA 4DRTA 4F3LA 3MSHA 1KVLA 4CLCB 4P6ZS 5TFQA 1PRQA 2Z6DA 4ZJ3A 3N4IA 3IWQA 3H82A 1H8MA 5FI2A 3TE8A 4OPQA 3EQUA 2Y2GA 5HDCA 1YSQA 4S2LA 3VV4A 5CGXA 2R78A 1YLZA 4HESA 4R1GA 4L0LA 4NXFA 2ZJ9A 1TDGA 4Y0OA 5DFYA 4WYYA 2ACGA 4UQIM 1GSVA 2FFYA 5M18A 1VETB 3OCLA 1MY8A 3ZGAB 2GNXA 5DFXA 1XX2A 2WKRA 2A3UA 3VSLA 3NIAA 3IWOA 4O8GA 1S67L 2Y55A 3MF0A 4G3KA 4MDZA 4WZ4A 3IX3A 3NY4A 1L0FA 2VLGA 3D4FA 2XA7M 1OPXA 5AVEA 4Y0UA 4R6LA 2HDSA 4OP8A 5FQKA 4BBVA 3S22A 2JCHA 3LY3A 5IHVA 1OTDA 4GW9A 1ONHA 1K4EA 5F69A 3NULA 2EX9A 1PIOA 2VX8A 1BSGA 3LI9A 5HAPA 4PM7A 3HLWA 2YKHA 2ZMFA 4WUJA 2V0WA 2XD1A 3IXHA 3UE1A 4S2NC 3G4PA 3EGDC 1LHYA 4DE0A 3AGDA 4IJGA 4N9LA 3DWKA 3MKEA 4Z1WA 2XH9A 3A0RA 2K31A 4WLAA 2OSUA 1TDLA 3OPPA 3WS0A 2ZC7A 2QHKA 4CLCC 1UWNX 1FQGA 2P9VB 2UWXA 1XA1A 3FG8A 3MZFA 5U47A 4MN6A 5J7EA 4HQAA 3LR3A 3V39A 3T1XA 2HJ9C 3RH8B 4HI4A 3T4KA 2KX6A 4BENA 1DJAA 1BLHA 1E4DA 2WK0A 1ES3A 1XP4A 4S2JA 4CPKA 2NUPC 4ZTKA 2P04A 1FOFA 2I9VA 1T1AA 3IXBA 4MBFA 4Y17A 2XSSA 5LBRA 4HJ3A 2E8JA 3DAVA 2OLVA 3Q82A 1IEMA 2W1TA 4EETB 1SKFA 1S66L 3G32A 3FC7A 4HP9A 3IF5A 2WGVA 1KE0A 4OKPA 4Y3IA 5DKKA 2XD5A 4DE3A 3LEQA 4WEJA 1S0WA 4WBGA 4B88A 4P87A 3NOUC 1VETA 2LB9A 2O9BA 1NZOA 1DP8A 4BD0A 2R9WA 1GHPA 5A90A 3D9YA 1XJ4A 4DXBA 2O99A 2WAFA 1YLYA 3MXQA 5L2FA 1Q2PA 3N8SA 3BJNA 2V8CA 4ID4A 5FAPA 1W5DA 1I2WA 2VEAA 4GS9A 3VFHA 5FQIA 4FSFA 4KZ4A 2GX5A 4R70A 2A2LA 3D72A 5EUAA 1JWPA 4I3AA 1G68A 1DRMA 4KZ9A 3W8KA 3HREA 1GCEA 3F1PB 3ITBA 3VOLA 1ALQA 1S4RA
chains in the Genus database with same CATH topology
4QY5A 1PZOA 2WGIA 3MXSA 3P98A 3UN7A 1YLJA 2Y2JA 3G2YA 3G35A 3MXRA 5E2EA 1AXBA 5EOOA 2WAEA 5CXWA 1L2SA 5CEDA 1K38A 4WZ5A 4EQIA 1K56D 1IYQA 1BLSA 1QMEA 4GKUA 4MNRA 4K0XA 3HBRA 5EECA 4MEZA 3PAGA 1HZOA 5AQAA 4IBRA 2XEPA 4HBTA 2PBYA 4QD4A 5M19A 1BTLA 3V3SA 3VP2A 5E2GA 4BL3A 4CJNA 5HX9A 1JTDA 3JYIA 2JC7A 3CG5A 1KGGA 4PM6A 3ZG0A 5FQQA 4GD6A 3S4XA 5HAQA 4LV3A 3SS5A 3UPPA 5GHZA 4S2MA 4GB7A 1IYPA 5KMWA 3UO9A 1IYSA 3UE3A 3FKWA 3SOIA 1E3UD 3NDEA 4OQIA 4BQMA 3BECA 1ZC2A 4QHCA 3LEZA 4OQ0A 1H8YA 4RA7A 3WS5A 2J8YA 2E8IA 5CERA 3Q1FA 5KSCA 4JXSA 3V3RA 2XQZA 3C4PA 3MKFA 1GA0A 1MWRA 1PZPA 1GHMA 1KGEA 3MBZA 3UDIA 3VP1A 4OPRA 2XLNA 4OLDA 1CI9A 1KDWA 3IXDA 4R4SA 2Y2QA 5HL1A 2ZQ7A 4X55A 3B3XA 2ZC6B 1PWGA 3M6BA 3VSKA 4U3TA 1L0DA 4NK3A 3ZVWA 1PW8A 1NY0A 1H5XA 1PI4A 5AQ9A 4KZ3A 2Y2MA 5DF7A 4KENB 2J7VA 3I7JA 1NZUA 3P09A 3LO7A 4KG5A 2Y2LA 3FZCA 5FASA 3FYZA 1MWSA 1DJBA 1YMXA 5TR7A 4PM9A 3ZDJA 3PBTA 4E3KA 4KQQA 4UAAA 3A3DA 1G6AA 4PM8A 1FR1A 1I2SA 4YINA 5HAIA 3IT9A 1YLWA 4S2KA 4M3KA 5CGSA 1NXYA 2Y2KA 5FA7A 4A5RA 3OPHA 4BD1A 3RXXA 3WS1A 4IEDA 4FH2A 5EPHA 3BLMA 5I94A 5D3OA 4OOYA 4EBLA 4C3QA 4UA9A 3BFDA 3W4OA 3OZHA 5FAQA 1N9BA 4P6BA 3OCNA 2HDQA 2Y2HA 4E6WA 3HL9A 4KZ8A 4P0MA 4Z9QA 2Y91A 1KDSA 2IWCA 1KE4A 4UA6A 1XGIA 4OPYA 3IH9A 1ES5A 4NETA 3IF6A 2QPNA 3MFDA 4BJPA 2HDUA 2C6WB 2ZC5B 3HLDA 3ZG5A 5HW3A 2P9VA 3IXGA 3Q81A 4GN2A 4ZAMA 4B4ZA 1MPLA 1VM1A 3G34A 4QB8A 1DJCA 2Y2NA 1KE3A 3HLBA 3ISGA 3GQZA 1GA9A 4DXCA 1LLBA 5A91A 4JF6A 3BYDA 4C6YA 3OPRA 5KSHA 1SHVA 1JTGA 4MLLA 2EXBA 2R9XA 3ZG9B 2Y2PA 4KZ7A 1FSWA 1JWZA 3WS2A 3HLCA 1K55A 2BLSA 3WRTA 4DE1A 1K57A 2ZQ8A 5DTSA 1XXMA 2I72A 1IELA 3ZVTA 3V5MA 2HP5A 5CECA 2QZ6A 4D2OA 1C3BA 4E3JA 5M1AA 2X71A 4LCLA 3PBNA 5EVIB 2PU2A 1ERMA 5G18A 2ZM8A 4DKIA 4JLFA 4KZ6A 3BEBA 1K55C 4U0TA 2ZMAA 1BT5A 3NDGA 1MXOA 2V1ZA 4WMCD 4RX3A 2C5WB 4OPZA 4OQGA 4GD8A 1N4OA 4OONA 1BUEA 4K91A 4Y7PA 4H8RA 2EX2A 4O7DA 1O7EA 1CI8A 2H10A 1L0GA 4RYEA 1MBLA 4IVKA 1LL5A 4E3IA 1YMSA 3ZG7B 1JWVA 1WYCA 4JXGA 4N1HA 4KZBA 2WZZA 4X69A 3Q7VB 4DF6A 1WYBA 3Q7ZA 4R0QA 4ZDXA 2X02A 1RCJA 4EBNA 1YT4A 5JYOA 3IH8A 1VQQA 4BL2A 3IWIA 2H0YA 3W4QA 4HBUA 2ZQDA 3DWZA 3BRMA 4GOGA 3PBSA 5CEBA 3HLGA 5GL9A 3TSGA 2EX8A 1PI5A 2G2WA 4XUXA 4JXWA 2ZQCA 4E3NA 1NJ4A 3MZDA 3O87A 4GNUA 4MBHA 2XF3A 4OOLA 4GDBA 3IQAA 3VP4A 2WUQA 3GTCA 2V20A 4JBFA 4LV0A 1E25A 4E3MA 3CJMA 3A3JA 3RJUA 2Q9MA 1ES2A 1KVMA 2EX6A 2J9PA 2J9OA 1XPBA 3N8RA 4GZBA 3G2ZA 3UY6A 4KQRA 3ITAA 4R23A 2DCFA 3HLEA 1WE4A 3TOIA 1SCWA 3G30A 4UHUA 4OVDA 5BOHA 1IYOA 4E3LA 4WMCA 3QNBA 2XGNA 2XK1A 1QMFA 2ZD8A 4KG6A 4QU3A 5F83A 3WWXA 2CC1A 4KG2A 1KGFA 2B5RA 5HARA 3UPOA 5E2FA 4DRTA 3AGEA 1U60A 1ONGA 5J8XA 3A3FA 1KVLA 1NRFA 1TVFA 5TFQA 1HD8A 5CHJA 1ERQA 1M6KA 1Q2QA 1MWTA 2WGWB 3N4IA 2WKEA 4ZJ3A 3IWQA 3HVFA 1LI9A 3HUOA 1K57C 1Y54A 1HVBA 3QNCA 5FI2A 2RL3A 3SS3A 3V50A 4OPQA 4KQOA 3Q7VA 3EQUA 1JVJA 2Y2GA 5FSRA 1SDEA 4K0WA 1M40A 2DNSA 3C4OA 4OOMA 4S2LA 3TG9A 2ZQ9A 3C5AA 5GLDA 2HDRA 4WEKA 5CGXA 3PTEA 1YLZA 3IHBA 4F94A 3PAEA 2ZM2A 4HESA 4R1GA 3A3IA 1BZAA 2QMIA 4L0LA 2BG1A 4FCFA 2ZJ9A 2XFSA 1TDGA 3LY4A 3N8LA 4Y0OA 4WYYA 1YLTA 1J9MA 3CZDA 4P85A 3UPNA 2Z2MB 1O07A 5DF8A 2FFYA 5M18A 1S6RA 1ES4A 1K4FA 3OCLA 4OLGA 3UE0A 1MY8A 3ZGAB 2DRWA 4Y0TA 1MWUA 1IKIA 1ZG4A 1XX2A 5FQMA 1W8QA 2A3UA 3IHAA 3VSLA 3NIAA 3IWOA 3S1YA 1PW1A 3IF6C 3ZCZA 5FDHA 5GLBA 2Y55A 3PBOA 3VOYA 5DVAA 1K54C 4HEFA 2ZC4B 2GDNA 4UA7A 1XGJA 4WZ4A 3C7VA 4KZ5A 4QY6A 4R3JA 5CGWA 5EVID 4JPMA 4XUZA 3NCKA 3NY4A 4PPRA 4S2IA 4EV4A 5FI6A 1H8ZA 1L0FA 3D4FA 5CHMA 2EFUA 2Q9NA 5KZHA 2PU4A 3IF6B 1CEFA 4N9KA 4PMAA 4Y0UA 5FATA 1L0EA 4IVIA 4JF4A 1YQSA 2HPBA 1Z6FA 1NYYA 2HDSA 3GMWA 4OP8A 2HP6A 1XKZA 5FQKA 5EVLA 4JKTA 4N92A 3S22A 2JCHA 3LY3A 5IHVA 4ZJ1A 5TGFA 3HUMA 1FCMA 4S2NA 5DF9A 1ZKJA 1ONHA 1K6RA 1K4EA 3M6HA 2EX9A 1PWCA 1W79A 1CEGA 4JF5A 4RVAA 1GHIA 1PIOA 4DE2A 3GSGA 1BLCA 1BSGA 1YM1A 2WGWA 4MBKA 5HAPA 4PM7A 4X6TA 2ZLYA 3LCEA 3MZEA 3HLWA 5A92A 5EVIA 2XD1A 3IXHA 5DTKA 4S2NC 3UE1A 3G4PA 1LHYA 4DE0A 1DY6A 1FSYA 3AGDA 1CK3A 4EBPA 3FKVA 4N9LA 1XA7A 3DWKA 2Y2OA 3SH9A 5HFOA 3SS4A 1HTZA 2Y2IA 3BFFA 1LI0A 3GR2A 3MKEA 2A49A 1MKIA 4JXVA 3A3EA 1OMEA 2XH9A 2VGJA 4ZJ2A 1K56A 4U0XA 2OSUA 1TDLA 4GDNA 3OC2A 3OPPA 2JBFA 3WS0A 2ZC7A 3M2JA 3HUNA 5FQ9A 1BLPA 3GV9A 1FQGA 2P9VB 1ALQA 2UWXA 1XA1A 4LCMA 2Y4AA 4ZBEA 3ZFZA 4RX2A 3MZFA 5CRFA 5U47A 1NYMA 3V39A 2HP9A 1ESIA 3UDXA 5CTMA 4E3OA 2RCXA 2IWDA 3SH8A 5DTTA 4BENA 2WYXA 1DJAA 1BLHA 3VMAA 1E4DA 4IBXA 2WK0A 3ZNYA 4FH4A 1ES3A 1LL9A 1XP4A 4S2JA 4BLMA 3N6IA 4CPKA 1PYYA 2WADA 3NC8A 3EQVA 4OQHA 4R4RA 4ZTKA 4OH0A 3BFCA 4X68A 1FOFA 3BFEA 2WKHA 5GLAA 1EROA 3IXBA 4N1XA 3QHYA 4MBFA 4LENA 1RP5A 2X01A 2P74A 4LV2A 4WZ5C 2FFFB 1I5QA 3BM6A 3O88A 2OLVA 3G31A 5EOEA 3DW0A 3OPLA 5E2HA 4X53A 1FCNA 1TEMA 3DTMA 3Q82A 4Q8IA 4E6XA 4OP5A 3W4PA 4WELA 1IEMA 3VFFA 4FD8A 2JE5A 5EVIC 2G2UA 3ZNTA 3VP0A 5A93A 3FWLA 5GHYA 2XR0A 1SKFA 4B4XA 4S2PA 1RGZA 2IWBA 3G32A 2OV5A 3NI9A 4EUZA 2EXAA 5F1FA 3E2KA 1YLPA 4EWFA 5E43A 3IF5A 2WGVA 1KE0A 4OKPA 5GLCA 3ZG8B 4YFMA 3FV7A 1ESUA 4PM5A 2XD5A 3SH7A 5GHXA 4DE3A 2WZXA 1E3UA 4WEJA 5F1GA 1S0WA 4WBGA 4B88A 4P87A 4C75A 3M2KA 3N7WA 4WM9A 1K25A 2ZQAA 3BLSA 3Q07A 3AGFA 3VOZA 1NZOA 3O3VA 1K6SA 5CTNA 4BD0A 5AQBA 5AQ7A 1IKGA 1W8YA 5FAOA 2R9WA 1GHPA 5A90A 3WS4A 3O86A 4QJGA 2Y59A 1BULA 4DXBA 3HLFA 2VGKA 2WAFA 1YLYA 2ZM0A 3CMZA 3C7UA 1ZG6A 3UDFA 5L2FA 3NBLA 1PWDA 2ZC3B 4X56A 1K54A 1Q2PA 5FI7A 3N8SA 3E2LA 4ID4A 5FAPA 1W5DA 3PBRA 1I2WA 1RGYA 2WKIA 1FR6A 4KZAA 4XXRA 2EFXA 5FQJA 3RXWA 4R3BA 5JYPA 2H5SA 3PBQA 2XDMA 5FQIA 3VFHA 4FSFA 1W7FA 1FCOA 1EWZA 1EI5A 2OLUA 3GRJA 3GVBA 4KZ4A 5CHUA 4DDYA 5EUAA 2V2FF 2XFTA 1JWPA 3UNWA 3VP3A 1G68A 4LV1A 4KZ9A 3W8KA 3HREA 5EE8A 3WRZA 1GCEA 5F82A 3ZHHA 4S2OA 1SDNA 2H0TA 3ITBA 3BFGA 4DDSA 2Z2LB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QY5 A;  1PZO A;  2WGI A;  3MXS A;  3P98 A;  3UN7 A;  1YLJ A;  2Y2J A;  3G2Y A;  3G35 A;  3MXR A;  5E2E A;  1AXB A;  5EOO A;  2WAE A;  5CXW A;  1L2S A;  5CED A;  1K38 A;  4WZ5 A;  4EQI A;  1K56 D;  1IYQ A;  1BLS A;  1QME A;  4GKU A;  4MNR A;  4K0X A;  3HBR A;  5EEC A;  4MEZ A;  3PAG A;  1HZO A;  5AQA A;  4IBR A;  2XEP A;  4HBT A;  2PBY A;  4QD4 A;  5M19 A;  1BTL A;  3V3S A;  3VP2 A;  5E2G A;  4BL3 A;  4CJN A;  5HX9 A;  1JTD A;  3JYI A;  2JC7 A;  3CG5 A;  1KGG A;  4PM6 A;  3ZG0 A;  5FQQ A;  4GD6 A;  3S4X A;  5HAQ A;  4LV3 A;  3SS5 A;  3UPP A;  5GHZ A;  4S2M A;  4GB7 A;  1IYP A;  5KMW A;  3UO9 A;  1IYS A;  3UE3 A;  3FKW A;  3SOI A;  1E3U D;  3NDE A;  4OQI A;  4BQM A;  3BEC A;  1ZC2 A;  4QHC A;  3LEZ A;  4OQ0 A;  1H8Y A;  4RA7 A;  3WS5 A;  2J8Y A;  2E8I A;  5CER A;  3Q1F A;  5KSC A;  4JXS A;  3V3R A;  2XQZ A;  3C4P A;  3MKF A;  1GA0 A;  1MWR A;  1PZP A;  1GHM A;  1KGE A;  3MBZ A;  3UDI A;  3VP1 A;  4OPR A;  2XLN A;  4OLD A;  1CI9 A;  1KDW A;  3IXD A;  4R4S A;  2Y2Q A;  5HL1 A;  2ZQ7 A;  4X55 A;  3B3X A;  2ZC6 B;  1PWG A;  3M6B A;  3VSK A;  4U3T A;  1L0D A;  4NK3 A;  3ZVW A;  1PW8 A;  1NY0 A;  1H5X A;  1PI4 A;  5AQ9 A;  4KZ3 A;  2Y2M A;  5DF7 A;  4KEN B;  2J7V A;  3I7J A;  1NZU A;  3P09 A;  3LO7 A;  4KG5 A;  2Y2L A;  3FZC A;  5FAS A;  3FYZ A;  1MWS A;  1DJB A;  1YMX A;  5TR7 A;  4PM9 A;  3ZDJ A;  3PBT A;  4E3K A;  4KQQ A;  4UAA A;  3A3D A;  1G6A A;  4PM8 A;  1FR1 A;  1I2S A;  4YIN A;  5HAI A;  3IT9 A;  1YLW A;  4S2K A;  4M3K A;  5CGS A;  1NXY A;  2Y2K A;  5FA7 A;  4A5R A;  3OPH A;  4BD1 A;  3RXX A;  3WS1 A;  4IED A;  4FH2 A;  5EPH A;  3BLM A;  5I94 A;  5D3O A;  4OOY A;  4EBL A;  4C3Q A;  4UA9 A;  3BFD A;  3W4O A;  3OZH A;  5FAQ A;  1N9B A;  4P6B A;  3OCN A;  2HDQ A;  2Y2H A;  4E6W A;  3HL9 A;  4KZ8 A;  4P0M A;  4Z9Q A;  2Y91 A;  1KDS A;  2IWC A;  1KE4 A;  4UA6 A;  1XGI A;  4OPY A;  3IH9 A;  1ES5 A;  4NET A;  3IF6 A;  2QPN A;  3MFD A;  4BJP A;  2HDU A;  2C6W B;  2ZC5 B;  3HLD A;  3ZG5 A;  5HW3 A;  2P9V A;  3IXG A;  3Q81 A;  4GN2 A;  4ZAM A;  4B4Z A;  1MPL A;  1VM1 A;  3G34 A;  4QB8 A;  1DJC A;  2Y2N A;  1KE3 A;  3HLB A;  3ISG A;  3GQZ A;  1GA9 A;  4DXC A;  1LLB A;  5A91 A;  4JF6 A;  3BYD A;  4C6Y A;  3OPR A;  5KSH A;  1SHV A;  1JTG A;  4MLL A;  2EXB A;  2R9X A;  3ZG9 B;  2Y2P A;  4KZ7 A;  1FSW A;  1JWZ A;  3WS2 A;  3HLC A;  1K55 A;  2BLS A;  3WRT A;  4DE1 A;  1K57 A;  2ZQ8 A;  5DTS A;  1XXM A;  2I72 A;  1IEL A;  3ZVT A;  3V5M A;  2HP5 A;  5CEC A;  2QZ6 A;  4D2O A;  1C3B A;  4E3J A;  5M1A A;  2X71 A;  4LCL A;  3PBN A;  5EVI B;  2PU2 A;  1ERM A;  5G18 A;  2ZM8 A;  4DKI A;  4JLF A;  4KZ6 A;  3BEB A;  1K55 C;  4U0T A;  2ZMA A;  1BT5 A;  3NDG A;  1MXO A;  2V1Z A;  4WMC D;  4RX3 A;  2C5W B;  4OPZ A;  4OQG A;  4GD8 A;  1N4O A;  4OON A;  1BUE A;  4K91 A;  4Y7P A;  4H8R A;  2EX2 A;  4O7D A;  1O7E A;  1CI8 A;  2H10 A;  1L0G A;  4RYE A;  1MBL A;  4IVK A;  1LL5 A;  4E3I A;  1YMS A;  3ZG7 B;  1JWV A;  1WYC A;  4JXG A;  4N1H A;  4KZB A;  2WZZ A;  4X69 A;  3Q7V B;  4DF6 A;  1WYB A;  3Q7Z A;  4R0Q A;  4ZDX A;  2X02 A;  1RCJ A;  4EBN A;  1YT4 A;  5JYO A;  3IH8 A;  1VQQ A;  4BL2 A;  3IWI A;  2H0Y A;  3W4Q A;  4HBU A;  2ZQD A;  3DWZ A;  3BRM A;  4GOG A;  3PBS A;  5CEB A;  3HLG A;  5GL9 A;  3TSG A;  2EX8 A;  1PI5 A;  2G2W A;  4XUX A;  4JXW A;  2ZQC A;  4E3N A;  1NJ4 A;  3MZD A;  3O87 A;  4GNU A;  4MBH A;  2XF3 A;  4OOL A;  4GDB A;  3IQA A;  3VP4 A;  2WUQ A;  3GTC A;  2V20 A;  4JBF A;  4LV0 A;  1E25 A;  4E3M A;  3CJM A;  3A3J A;  3RJU A;  2Q9M A;  1ES2 A;  1KVM A;  2EX6 A;  2J9P A;  2J9O A;  1XPB A;  3N8R A;  4GZB A;  3G2Z A;  3UY6 A;  4KQR A;  3ITA A;  4R23 A;  2DCF A;  3HLE A;  1WE4 A;  3TOI A;  1SCW A;  3G30 A;  4UHU A;  4OVD A;  5BOH A;  1IYO A;  4E3L A;  4WMC A;  3QNB A;  2XGN A;  2XK1 A;  1QMF A;  2ZD8 A;  4KG6 A;  4QU3 A;  5F83 A;  3WWX A;  2CC1 A;  4KG2 A;  1KGF A;  2B5R A;  5HAR A;  3UPO A;  5E2F A;  4DRT A;  3AGE A;  1U60 A;  1ONG A;  5J8X A;  3A3F A;  1KVL A;  1NRF A;  1TVF A;  5TFQ A;  1HD8 A;  5CHJ A;  1ERQ A;  1M6K A;  1Q2Q A;  1MWT A;  2WGW B;  3N4I A;  2WKE A;  4ZJ3 A;  3IWQ A;  3HVF A;  1LI9 A;  3HUO A;  1K57 C;  1Y54 A;  1HVB A;  3QNC A;  5FI2 A;  2RL3 A;  3SS3 A;  3V50 A;  4OPQ A;  4KQO A;  3Q7V A;  3EQU A;  1JVJ A;  2Y2G A;  5FSR A;  1SDE A;  4K0W A;  1M40 A;  2DNS A;  3C4O A;  4OOM A;  4S2L A;  3TG9 A;  2ZQ9 A;  3C5A A;  5GLD A;  2HDR A;  4WEK A;  5CGX A;  3PTE A;  1YLZ A;  3IHB A;  4F94 A;  3PAE A;  2ZM2 A;  4HES A;  4R1G A;  3A3I A;  1BZA A;  2QMI A;  4L0L A;  2BG1 A;  4FCF A;  2ZJ9 A;  2XFS A;  1TDG A;  3LY4 A;  3N8L A;  4Y0O A;  4WYY A;  1YLT A;  1J9M A;  3CZD A;  4P85 A;  3UPN A;  2Z2M B;  1O07 A;  5DF8 A;  2FFY A;  5M18 A;  1S6R A;  1ES4 A;  1K4F A;  3OCL A;  4OLG A;  3UE0 A;  1MY8 A;  3ZGA B;  2DRW A;  4Y0T A;  1MWU A;  1IKI A;  1ZG4 A;  1XX2 A;  5FQM A;  1W8Q A;  2A3U A;  3IHA A;  3VSL A;  3NIA A;  3IWO A;  3S1Y A;  1PW1 A;  3IF6 C;  3ZCZ A;  5FDH A;  5GLB A;  2Y55 A;  3PBO A;  3VOY A;  5DVA A;  1K54 C;  4HEF A;  2ZC4 B;  2GDN A;  4UA7 A;  1XGJ A;  4WZ4 A;  3C7V A;  4KZ5 A;  4QY6 A;  4R3J A;  5CGW A;  5EVI D;  4JPM A;  4XUZ A;  3NCK A;  3NY4 A;  4PPR A;  4S2I A;  4EV4 A;  5FI6 A;  1H8Z A;  1L0F A;  3D4F A;  5CHM A;  2EFU A;  2Q9N A;  5KZH A;  2PU4 A;  3IF6 B;  1CEF A;  4N9K A;  4PMA A;  4Y0U A;  5FAT A;  1L0E A;  4IVI A;  4JF4 A;  1YQS A;  2HPB A;  1Z6F A;  1NYY A;  2HDS A;  3GMW A;  4OP8 A;  2HP6 A;  1XKZ A;  5FQK A;  5EVL A;  4JKT A;  4N92 A;  3S22 A;  2JCH A;  3LY3 A;  5IHV A;  4ZJ1 A;  5TGF A;  3HUM A;  1FCM A;  4S2N A;  5DF9 A;  1ZKJ A;  1ONH A;  1K6R A;  1K4E A;  3M6H A;  2EX9 A;  1PWC A;  1W79 A;  1CEG A;  4JF5 A;  4RVA A;  1GHI A;  1PIO A;  4DE2 A;  3GSG A;  1BLC A;  1BSG A;  1YM1 A;  2WGW A;  4MBK A;  5HAP A;  4PM7 A;  4X6T A;  2ZLY A;  3LCE A;  3MZE A;  3HLW A;  5A92 A;  5EVI A;  2XD1 A;  3IXH A;  5DTK A;  4S2N C;  3UE1 A;  3G4P A;  1LHY A;  4DE0 A;  1DY6 A;  1FSY A;  3AGD A;  1CK3 A;  4EBP A;  3FKV A;  4N9L A;  1XA7 A;  3DWK A;  2Y2O A;  3SH9 A;  5HFO A;  3SS4 A;  1HTZ A;  2Y2I A;  3BFF A;  1LI0 A;  3GR2 A;  3MKE A;  2A49 A;  1MKI A;  4JXV A;  3A3E A;  1OME A;  2XH9 A;  2VGJ A;  4ZJ2 A;  1K56 A;  4U0X A;  2OSU A;  1TDL A;  4GDN A;  3OC2 A;  3OPP A;  2JBF A;  3WS0 A;  2ZC7 A;  3M2J A;  3HUN A;  5FQ9 A;  1BLP A;  3GV9 A;  1FQG A;  2P9V B;  1ALQ A;  2UWX A;  1XA1 A;  4LCM A;  2Y4A A;  4ZBE A;  3ZFZ A;  4RX2 A;  3MZF A;  5CRF A;  5U47 A;  1NYM A;  3V39 A;  2HP9 A;  1ESI A;  3UDX A;  5CTM A;  4E3O A;  2RCX A;  2IWD A;  3SH8 A;  5DTT A;  4BEN A;  2WYX A;  1DJA A;  1BLH A;  3VMA A;  1E4D A;  4IBX A;  2WK0 A;  3ZNY A;  4FH4 A;  1ES3 A;  1LL9 A;  1XP4 A;  4S2J A;  4BLM A;  3N6I A;  4CPK A;  1PYY A;  2WAD A;  3NC8 A;  3EQV A;  4OQH A;  4R4R A;  4ZTK A;  4OH0 A;  3BFC A;  4X68 A;  1FOF A;  3BFE A;  2WKH A;  5GLA A;  1ERO A;  3IXB A;  4N1X A;  3QHY A;  4MBF A;  4LEN A;  1RP5 A;  2X01 A;  2P74 A;  4LV2 A;  4WZ5 C;  2FFF B;  1I5Q A;  3BM6 A;  3O88 A;  2OLV A;  3G31 A;  5EOE A;  3DW0 A;  3OPL A;  5E2H A;  4X53 A;  1FCN A;  1TEM A;  3DTM A;  3Q82 A;  4Q8I A;  4E6X A;  4OP5 A;  3W4P A;  4WEL A;  1IEM A;  3VFF A;  4FD8 A;  2JE5 A;  5EVI C;  2G2U A;  3ZNT A;  3VP0 A;  5A93 A;  3FWL A;  5GHY A;  2XR0 A;  1SKF A;  4B4X A;  4S2P A;  1RGZ A;  2IWB A;  3G32 A;  2OV5 A;  3NI9 A;  4EUZ A;  2EXA A;  5F1F A;  3E2K A;  1YLP A;  4EWF A;  5E43 A;  3IF5 A;  2WGV A;  1KE0 A;  4OKP A;  5GLC A;  3ZG8 B;  4YFM A;  3FV7 A;  1ESU A;  4PM5 A;  2XD5 A;  3SH7 A;  5GHX A;  4DE3 A;  2WZX A;  1E3U A;  4WEJ A;  5F1G A;  1S0W A;  4WBG A;  4B88 A;  4P87 A;  4C75 A;  3M2K A;  3N7W A;  4WM9 A;  1K25 A;  2ZQA A;  3BLS A;  3Q07 A;  3AGF A;  3VOZ A;  1NZO A;  3O3V A;  1K6S A;  5CTN A;  4BD0 A;  5AQB A;  5AQ7 A;  1IKG A;  1W8Y A;  5FAO A;  2R9W A;  1GHP A;  5A90 A;  3WS4 A;  3O86 A;  4QJG A;  2Y59 A;  1BUL A;  4DXB A;  3HLF A;  2VGK A;  2WAF A;  1YLY A;  2ZM0 A;  3CMZ A;  3C7U A;  1ZG6 A;  3UDF A;  5L2F A;  3NBL A;  1PWD A;  2ZC3 B;  4X56 A;  1K54 A;  1Q2P A;  5FI7 A;  3N8S A;  3E2L A;  4ID4 A;  5FAP A;  1W5D A;  3PBR A;  1I2W A;  1RGY A;  2WKI A;  1FR6 A;  4KZA A;  4XXR A;  2EFX A;  5FQJ A;  3RXW A;  4R3B A;  5JYP A;  2H5S A;  3PBQ A;  2XDM A;  5FQI A;  3VFH A;  4FSF A;  1W7F A;  1FCO A;  1EWZ A;  1EI5 A;  2OLU A;  3GRJ A;  3GVB A;  4KZ4 A;  5CHU A;  4DDY A;  5EUA A;  2V2F F;  2XFT A;  1JWP A;  3UNW A;  3VP3 A;  1G68 A;  4LV1 A;  4KZ9 A;  3W8K A;  3HRE A;  5EE8 A;  3WRZ A;  1GCE A;  5F82 A;  3ZHH A;  4S2O A;  1SDN A;  2H0T A;  3ITB A;  3BFG A;  4DDS A;  2Z2L B; 
#chains in the Genus database with same CATH topology
 3MXS A;  1YLJ A;  3G35 A;  2L1M A;  2WAE A;  1YAX A;  3S7P A;  3TJZ C;  1H0M A;  2PBY A;  5M19 A;  3E4P A;  2K2N A;  4BL3 A;  3CG5 A;  4PM6 A;  3ZG0 A;  5HAQ A;  4LV3 A;  2WKP A;  1E3U D;  3BEC A;  5HD5 A;  2DMW A;  1H8Y A;  4LGW A;  3UB7 A;  1GA0 A;  2ZOH A;  3MBZ A;  3UDI A;  3VP1 A;  3JVV A;  4OLD A;  2Y2Q A;  5HL1 A;  4X55 A;  4CLC E;  3PYP A;  4NK3 A;  3ZVW A;  1X0O A;  4NG2 A;  4KZ3 A;  1ODV A;  3P09 A;  2Y2L A;  3C2W A;  2L4R A;  2Z6C A;  5TR7 A;  1IOU A;  3PBT A;  3P01 A;  4HJ4 A;  5HAI A;  1FR1 A;  1I2S A;  3IT9 A;  5CGS A;  4M3K A;  1D7E A;  2PD7 A;  4Y5F A;  3OPH A;  5G4Y A;  4DJ3 A;  1F98 A;  4IED A;  4FH2 A;  4EBL A;  2PAV P;  4UA9 A;  4MN5 A;  2HDQ A;  4KZ8 A;  3DTE A;  2Y91 A;  3DBA A;  1KDS A;  2Q0O A;  2W3F A;  3Q81 A;  1G28 A;  1KE3 A;  5DKL A;  1GA9 A;  1LLB A;  5A91 A;  3CUE A;  3OPR A;  4KZ7 A;  3WS2 A;  1K57 A;  2ZQ8 A;  1XXM A;  3ZVT A;  4KQD A;  3T50 A;  2QZ6 A;  3CUE C;  5M1A A;  4LCL A;  3PBN A;  2ZL1 B;  3PHY A;  4KZ6 A;  1K55 C;  4FUW A;  4WMC D;  2C5W B;  4OPZ A;  1N9O A;  4B93 A;  5HPF A;  3F1O A;  2VA0 A;  2K7S A;  2H10 A;  1L0G A;  2D01 A;  1XFQ A;  4RYE A;  3IBR A;  1YMS A;  3ZG7 B;  4JXG A;  1WYB A;  1RCJ A;  4EBN A;  4H6J A;  2W1T B;  3S7Q A;  5JYO A;  2QJ5 A;  3IH8 A;  3ULF A;  4BL2 A;  2H0Y A;  3DWZ A;  1D06 A;  3BRM A;  2Y79 A;  4JXW A;  4GNU A;  4GDB A;  1GSW A;  2LB5 A;  1KVM A;  2W0N A;  3KO6 A;  4B9O A;  2J9O A;  1P97 A;  2PDR A;  4GZB A;  3G2Z A;  3UY6 A;  2IA2 A;  3H7W B;  4HIA A;  2DCF A;  5HSQ A;  5HWW A;  1VB6 A;  4E3L A;  3T4T A;  3QNB A;  4FOF A;  2ZD8 A;  4KG6 A;  1KGF A;  3UPO A;  3H9W A;  4EER A;  1U60 A;  5J8X A;  3A3F A;  1TVF A;  5CHJ A;  3KSH A;  1YKD A;  1M6K A;  2WGW B;  1MWT A;  2WKE A;  1D1J A;  3QNC A;  3SS3 A;  3Q7V A;  2J3W A;  5F6A A;  3ZQ5 A;  4UEY A;  2DNS A;  2VV8 A;  2ZQ9 A;  2O9A A;  3C5A A;  3PTE A;  5KIZ A;  3PAE A;  5AVF A;  3F1N B;  1J9M A;  3UPN A;  1S6R A;  4ARZ B;  4OLG A;  4UQI S;  3W2Z A;  1NWZ A;  1S1Z A;  1SKO B;  1W8Q A;  3IHA A;  3E98 A;  3IF6 C;  5GLB A;  3PBO A;  3VOY A;  5DVA A;  1K54 C;  4HEF A;  4R3J A;  5CGW A;  4S2I A;  1H8Z A;  5CHM A;  3NEC A;  3RFB A;  4JF4 A;  2M7V A;  1UGU A;  1ZTU A;  2HPB A;  1TS7 A;  1NYY A;  4AFI A;  3R7W A;  3T4L A;  1NLY A;  4N92 A;  3PR6 A;  5TGF A;  3NHQ A;  1K6R A;  2VV7 A;  4JGR A;  3LIF A;  3F1O B;  4JF5 A;  1CEG A;  1GHI A;  1PFL A;  1BLC A;  1YM1 A;  2WGW A;  4MBK A;  4X6T A;  2ZLY A;  3KYE A;  5EVI A;  1XJ6 A;  3S7O A;  1DY6 A;  1CK3 A;  3IS2 A;  3UMD A;  1OME A;  1K56 A;  5TBM A;  3OC2 A;  2JBF A;  3M2J A;  1BLP A;  4BD1 A;  3HCY A;  3ZFZ A;  4LCM A;  4LRZ E;  5CRF A;  2OWJ A;  3UE6 A;  2MJ6 A;  2RCX A;  2IWD A;  2B95 A;  4IBX A;  2JKT M;  3ZNY A;  1P0Z A;  1H3Q A;  1LL9 A;  4BLM A;  3N6I A;  1Z09 A;  5J4E A;  1NLZ A;  4R4R A;  3BFC A;  2A24 A;  2WKH A;  4N1X A;  2A24 B;  3D3O A;  4LEN A;  1Y28 A;  3E0Y A;  4LV2 A;  2X01 A;  2FFF B;  1I5Q A;  4EEP A;  5EOE A;  4WL9 A;  3MQO A;  4ETX A;  1FCN A;  4WEL A;  3LIE A;  5EVI C;  2G2U A;  1TS8 A;  2QJ7 A;  2XR0 A;  4BWI A;  4S2P A;  1N9N A;  2V1B A;  3MJQ A;  2W3H A;  3E2K A;  3LI8 A;  1YLP A;  4EWF A;  4X1L A;  2WKQ A;  1ESU A;  5F1G A;  4C75 A;  2NUT C;  4WM9 A;  3Q07 A;  2BTF P;  2VJW A;  2J3T D;  2Y59 A;  1BUL A;  2VGK A;  3C7U A;  1ZG6 A;  4RQ9 A;  1PWD A;  4X56 A;  1K54 A;  5FI7 A;  1V9Y A;  4QWO A;  2HGV A;  4KUK A;  2WKI A;  3RXW A;  5JYP A;  4PAU A;  3PBQ A;  1EI5 A;  5CHU A;  4DDY A;  4Y15 A;  1OTA A;  3T1Q B;  5EE8 A;  3LUQ A;  5F82 A;  2JN7 A;  2Z2L B;  1PZO A;  2J80 A;  5CED A;  4WZ5 A;  1IYQ A;  1QME A;  1SKO A;  4K0X A;  3BQA A;  3LR5 A;  1HZO A;  1YSP A;  4ETZ A;  4CJN A;  5HX9 A;  4GD6 A;  3BW6 A;  3SS5 A;  3BY8 A;  4EXO A;  4HH2 A;  3UO9 A;  3UE3 A;  3NDE A;  5HWV A;  3LEZ A;  4OQ0 A;  3WS5 A;  2E8I A;  5CER A;  3IX8 A;  3C4P A;  1PZP A;  1KDW A;  3IXD A;  4R4S A;  3C38 A;  1OTE A;  5EM0 A;  3MMH A;  3B3X A;  3CAX A;  1PWG A;  4U3T A;  1NY0 A;  5AQ9 A;  2Y2M A;  5DF7 A;  4KEN B;  3I7J A;  3LO7 A;  4P6Z M;  3FZC A;  3FYZ A;  4CLC A;  1YMX A;  5HDD A;  4PKY A;  5G4Z A;  3ZDJ A;  4E3K A;  2OAQ 1;  4S2K A;  2Y2K A;  4A5R A;  4EU0 A;  1K0K A;  3KX0 X;  3P7N A;  3EWK A;  5EPH A;  1VEU A;  5I94 A;  4L9F A;  5K5B A;  3BFD A;  5DJT A;  4GHI B;  3OLO A;  4P0M A;  4Q0H A;  1MZU A;  2IWC A;  4UA6 A;  3T4Q A;  3CPT A;  2QPN A;  3MFD A;  1LSW A;  2HDU A;  1GSX A;  2JHE A;  2ZC5 B;  5HW3 A;  2P9V A;  3IXG A;  4B4Z A;  1MPL A;  1DJC A;  1A0K A;  4DN0 A;  5EFW A;  5KSH A;  4MLL A;  2EXB A;  2R9X A;  2Y2P A;  1K55 A;  4ME4 A;  1IEL A;  1T18 A;  3V5M A;  5FL3 A;  1W63 M;  2EWV A;  2ZM8 A;  4JLF A;  2VZW A;  2ZMA A;  1BT5 A;  4K91 A;  4H8R A;  1LSX A;  4O7D A;  1MBL A;  1LL5 A;  4K08 A;  4E3I A;  1JWV A;  1WYC A;  4NXB A;  4X1M A;  4KZB A;  2WZZ A;  3Q7V B;  4DF6 A;  3Q7Z A;  4R0Q A;  3IX4 A;  1N9L A;  3NJA A;  2HZ5 A;  2ZQD A;  3H82 B;  4MN7 A;  5HL6 A;  3TSG A;  2D02 A;  3KYQ A;  1PI5 A;  2G2W A;  4XUX A;  1NJ4 A;  4OOL A;  4MBH A;  2XF3 A;  5HD3 A;  3IQA A;  3GTC A;  1MKM A;  3CJM A;  2Q9M A;  1ES2 A;  2EX6 A;  3T4O A;  3A0S A;  4WF0 A;  3ITA A;  1WE4 A;  3TOI A;  1SCW A;  4OVD A;  1IYO A;  4EEU A;  5F83 A;  3V67 A;  3HJI A;  3WWX A;  2B5R A;  5HAR A;  3AGE A;  2PT7 A;  2W27 A;  4XT2 B;  1HD8 A;  4JGP A;  1ERQ A;  3FPV A;  3T1R A;  4NXE A;  1Y54 A;  1HVB A;  4I38 A;  2V1A A;  4HH3 A;  3V50 A;  4KQO A;  5FSR A;  3OBF A;  4K0W A;  1M40 A;  3C4O A;  4OOM A;  3TG9 A;  4WEK A;  3QP1 A;  4F94 A;  3CPT B;  3UB9 A;  1BZA A;  2QMI A;  3UB8 A;  2BG1 A;  4FCF A;  2XFS A;  3N8L A;  1VEU B;  2Z2M B;  5DF8 A;  1ES4 A;  3B47 A;  2DRW A;  4Y0T A;  3H7W A;  5FQM A;  4O01 A;  3S1Y A;  3T4S A;  1F2K A;  2ZC4 B;  2GDN A;  4CLC D;  1XGJ A;  4XUZ A;  4PPR A;  5J3W A;  3GEC A;  2Q9N A;  2PU4 A;  4N9K A;  2VK3 A;  4IVI A;  1YQS A;  3GMW A;  1XKZ A;  4JKT A;  2FH5 A;  4ZJ1 A;  3HUM A;  1FCM A;  5EV0 A;  5DF9 A;  1ZKJ A;  4F3L B;  3CWF A;  5MC7 A;  2M1C A;  2GZA A;  1W79 A;  4DE2 A;  3GSG A;  3CLO A;  4HP4 A;  3LCE A;  3MZE A;  5DTK A;  4YNR A;  2W3E A;  1FSY A;  4EBP A;  2Y2O A;  5HFO A;  3MQQ A;  2A49 A;  1MKI A;  2UV0 E;  1DP9 A;  4ZJ2 A;  3E4Q A;  3LID A;  3LR4 A;  4HHD A;  5FQ9 A;  3IS2 B;  3HJK A;  4ZBE A;  2Y4A A;  2KOI A;  4Y13 A;  2L0W A;  2HP9 A;  3UDX A;  4E3O A;  4DJ2 A;  2KLI A;  2JKR M;  3QHY A;  1RP5 A;  4ESP A;  3NOP C;  3BM6 A;  3O88 A;  3UME A;  4X53 A;  1TEM A;  3DTM A;  4Q8I A;  3LIB A;  4OP5 A;  3MFX A;  3W4P A;  4FD8 A;  2JE5 A;  4I3J A;  3ZNT A;  4B4X A;  1RGZ A;  1OTB A;  5HWT A;  5F1F A;  5E43 A;  2W1R A;  5GLC A;  4WN5 A;  3SH7 A;  5GHX A;  3EEA A;  3M2K A;  2ZQA A;  3BLS A;  1P9W A;  3O3V A;  1K6S A;  4L9E A;  5CTN A;  5AQ7 A;  3WS4 A;  4QJG A;  3HLF A;  4BBU A;  3UDF A;  2ZC3 B;  4CQH A;  1RGY A;  4KZA A;  4XXR A;  2EFX A;  4R3B A;  2PRF A;  4DDS A;  2OLU A;  1FCO A;  1EWZ A;  3GRJ A;  2V2F F;  3UNW A;  3WRZ A;  1NRJ A;  3R4K A;  3ZHH A;  2WGI A;  3P98 A;  3UN7 A;  5E2E A;  5CXW A;  3C8C A;  3LFV A;  3L9K A;  4R3A A;  1K56 D;  4MNR A;  2PR6 A;  3HBR A;  5EEC A;  4R38 A;  3K2N A;  1PNE A;  4JGO A;  1HLU P;  1JTD A;  4GHI A;  5FQQ A;  3QP5 A;  5GHZ A;  5KMW A;  1OT6 A;  1IYS A;  1JNU A;  3SOI A;  1Y4O A;  4BQM A;  1FIK A;  4HJ6 A;  4BMW A;  1ZC2 A;  4QHC A;  4Q0J A;  5EM1 A;  3T12 B;  4RA7 A;  3V3R A;  2XQZ A;  4IHQ A;  2PBD P;  1GHM A;  3U4L P;  3KSI A;  1OTI A;  4LRY C;  3VSK A;  4GJ4 A;  1NZU A;  1OJ5 A;  4KG5 A;  4L9G A;  2XRO A;  4PM9 A;  5IT5 A;  4BBT A;  4KQQ A;  4PKY G;  1G6A A;  4PM8 A;  4YIN A;  1AWI A;  1NXY A;  1DP6 A;  1LT0 A;  1V9Z A;  4LRX C;  3BLM A;  4HY8 A;  5D3O A;  3C30 A;  3W4O A;  1VHM A;  3OZH A;  4P6B A;  3OCN A;  2G7U A;  5HDS A;  5IU1 A;  4Z9Q A;  3BQ8 A;  1KE4 A;  1XGI A;  3IH9 A;  1ES5 A;  4NET A;  3IF6 A;  3HLD A;  2C6W B;  4NXG A;  3ZG5 A;  4LFU A;  3QP6 A;  1S1Y A;  1VM1 A;  3G34 A;  3TW8 A;  2Y2N A;  3HLB A;  3L7H A;  3GQZ A;  1EW0 A;  3T4J A;  1JTG A;  3ZG9 B;  1FSW A;  3WRT A;  2INW A;  4DE1 A;  3BY9 A;  2I72 A;  1CQA A;  2HP5 A;  2O9C A;  3EGX C;  3G6O A;  2ZL1 A;  3LR0 A;  2X71 A;  5EVI B;  3RTY A;  2PU2 A;  1ERM A;  2V0U A;  3VE3 A;  4DKI A;  3B33 A;  1MXO A;  4GD8 A;  1N4O A;  3B42 A;  2JKT I;  1CI8 A;  1G5U A;  1XJ2 A;  4ZDX A;  1F9I A;  3W4Q A;  4HBU A;  2JKF A;  4GOG A;  4Q0I A;  5CEB A;  3HLG A;  2ZQC A;  5EVE A;  4E3N A;  2V20 A;  4JBF A;  4LV0 A;  5TBM B;  3ZYT A;  4E3M A;  3RJU A;  4LLO B;  3N8R A;  5HZH A;  1OJG A;  4KQR A;  5FEG A;  4IUK A;  2PR5 A;  3HLE A;  3MQ0 A;  1MC0 A;  2P08 A;  4WMC A;  2XK1 A;  4QU3 A;  2CC1 A;  1ONG A;  2PD8 A;  4NKP A;  1NRF A;  2FZ0 A;  1WA9 A;  3EOI A;  2VGL S;  1Q2Q A;  2O0Y A;  4EUV A;  5L09 A;  1TD5 A;  4I3I A;  3HVF A;  1LI9 A;  3HUO A;  1K57 C;  5L07 A;  2RL3 A;  3DTI A;  3S7N A;  1JVJ A;  4EQ1 A;  1SDE A;  1P9R A;  5GLD A;  2HDR A;  3KYZ A;  3IHB A;  3KSF A;  2ZM2 A;  3A3I A;  3LY4 A;  3O5Y A;  1YLT A;  3CZD A;  1LSV A;  3KSG A;  4P85 A;  1O07 A;  1K4F A;  1ACF A;  3UE0 A;  4ARZ A;  1MWU A;  1IKI A;  2B18 A;  1T1C A;  1ZG4 A;  1XJ3 A;  1PW1 A;  3ZCZ A;  5FDH A;  1G6O A;  3K3C A;  4UA7 A;  2PHY A;  3C7V A;  4KZ5 A;  4QY6 A;  5EVI D;  4JPM A;  4EV4 A;  3NCK A;  3K3D A;  5FI6 A;  3GDI A;  2EA9 A;  2EFU A;  5C5K A;  5A8B A;  5KZH A;  3IF6 B;  4PMA A;  1CEF A;  5FAT A;  1L0E A;  4EES A;  2ZBB A;  3MR0 A;  1Z6F A;  1FIL A;  2HP6 A;  5EVL A;  2VGL M;  1TF1 A;  4S2N A;  2XRN A;  3M6H A;  3PXP A;  1PWC A;  3QP4 A;  4RVA A;  2J3T C;  3CHW P;  3VE4 A;  4YWZ A;  5A92 A;  2HV1 A;  3SZT A;  5FEF A;  4YOF A;  4QPR A;  4O0P A;  3FKV A;  2HF6 A;  1XA7 A;  3SH9 A;  4G3W A;  3SS4 A;  1HTZ A;  2Y2I A;  3BFF A;  1LI0 A;  3GR2 A;  3UB5 P;  4JXV A;  3A3E A;  1STZ A;  1F5M A;  2VGJ A;  4U0X A;  1KOU A;  4GDN A;  1IFQ A;  5G18 A;  3HUN A;  3GV9 A;  1BYW A;  2H28 A;  4RX2 A;  1NYM A;  4ZRR A;  3FPW A;  1ESI A;  5CTM A;  3DTK A;  3SH8 A;  4M4X A;  2BAS A;  3LIC A;  5DTT A;  2WYX A;  3JVU A;  4FH4 A;  1PYY A;  2WAD A;  3NC8 A;  4E04 A;  3EQV A;  4OQH A;  4KUO A;  4OH0 A;  5GLA A;  4X68 A;  3BFE A;  1CJF A;  1ERO A;  2XA7 S;  1L3L A;  2P74 A;  4WZ5 C;  2QYB A;  5L8M A;  3G31 A;  3DW0 A;  3OPL A;  5E2H A;  2M7U A;  4LPZ A;  2KDK A;  4E6X A;  3LYX A;  5F68 A;  3TRC A;  1CF0 A;  3VFF A;  2V8F A;  3F1P A;  1T1B A;  4JGQ A;  1TS0 A;  3VP0 A;  5A93 A;  3FWL A;  5GHY A;  2AVX A;  2ZMV A;  2IWB A;  4H6J B;  2OV5 A;  3NI9 A;  4EUZ A;  2EXA A;  3QP8 A;  3ZG8 B;  2JKG A;  4YFM A;  3FV7 A;  4PM5 A;  4PHT A;  4HNB A;  2WZX A;  1E3U A;  3N7W A;  2GJ3 A;  1K25 A;  2OAP 1;  3AGF A;  3VOZ A;  5AQB A;  1IKG A;  1W8Y A;  5FAO A;  1TS6 A;  5DJU A;  3O86 A;  2YKF A;  4EW7 A;  4GS9 B;  3UB6 A;  2ZM0 A;  3CMZ A;  3NBL A;  4NEE D;  4MCW A;  5L10 A;  4I39 A;  2JKR I;  2QWS A;  3E2L A;  3PBR A;  1FR6 A;  5FQJ A;  4II7 A;  2VV6 A;  4IUH A;  2H5S A;  3VMA A;  2XDM A;  3A0V A;  5CEC A;  1W7F A;  3GVB A;  2PYP A;  3CI6 A;  2XFT A;  3VP3 A;  4LV1 A;  4D60 A;  2QKP A;  4S2O A;  1SDN A;  2H0T A;  3BFG A;  4QY5 A;  4I5S A;  2Y2J A;  3G2Y A;  3MXR A;  1AXB A;  5EOO A;  1L2S A;  1K38 A;  3IBJ A;  4EQI A;  1BLS A;  4GKU A;  4MEZ A;  3PAG A;  5AQA A;  4IBR A;  2XEP A;  4HBT A;  4QD4 A;  1BTL A;  2OOL A;  3F1N A;  3V3S A;  3VP2 A;  5E2G A;  5TJJ A;  3U2A A;  3JYI A;  2JC7 A;  1KGG A;  3SW1 A;  3S4X A;  3UPP A;  4S2M A;  3QP2 A;  4GB7 A;  1IYP A;  3FKW A;  2W3D A;  4OQI A;  4FTX A;  2J8Y A;  3Q1F A;  3R7W B;  4JXS A;  5KSC A;  3MKF A;  1MWR A;  1KGE A;  4OPR A;  2XLN A;  3CIT A;  1CI9 A;  2ZQ7 A;  2ZC6 B;  3M6B A;  1L0D A;  1PW8 A;  2HJE A;  1H5X A;  1PI4 A;  1OT9 A;  2J7V A;  5F5Y A;  5FAS A;  1MWS A;  1DJB A;  1W63 Q;  5I5L A;  4UAA A;  1J3W A;  4G3V A;  4GCZ A;  3A3D A;  2OWH A;  1YLW A;  2VKS A;  5FA7 A;  3ICY A;  3RXX A;  3WS1 A;  4Y2F A;  4OOY A;  4C3Q A;  4X25 A;  3LIA A;  5FAQ A;  1N9B A;  3LGO A;  2Y2H A;  4E6W A;  3HL9 A;  3BWL A;  4OPY A;  4BJP A;  3EEH A;  3NOT C;  2CMN A;  4ZAM A;  4GN2 A;  3E4O A;  4QB8 A;  3OOV A;  3ISG A;  4DXC A;  4JF6 A;  3BYD A;  4C6Y A;  1SHV A;  1XFN A;  1JWZ A;  4MMN A;  4XT2 A;  3HLC A;  2BLS A;  5DTS A;  5IS1 A;  3MS6 A;  4D2O A;  1C3B A;  4E3J A;  5CX7 A;  2W3G A;  1UWP X;  3BEB A;  4U0T A;  3NDG A;  2B02 A;  2V1Z A;  4RX3 A;  4OQG A;  4OON A;  1BUE A;  5HPI A;  4Y7P A;  2EX2 A;  1O7E A;  4IVK A;  1YPR A;  2EWW A;  2Y8H A;  4N1H A;  4DMZ A;  4X69 A;  1S4S A;  5FDS A;  2X02 A;  1YT4 A;  4HOI A;  1VQQ A;  3T1S A;  3IWI A;  5AJG A;  3PBS A;  1ZHH B;  5GL9 A;  2EX8 A;  1T19 A;  3MZD A;  3JPU A;  3O87 A;  3VP4 A;  2P7J A;  2WUQ A;  1E25 A;  3A3J A;  2J9P A;  2V9A A;  1XPB A;  2ZOI A;  4R23 A;  2PYR A;  3G30 A;  4UHU A;  5BOH A;  4GLQ A;  1SZV A;  2XGN A;  1QMF A;  4KG2 A;  1LL8 A;  5E2F A;  4DRT A;  4F3L A;  3MSH A;  1KVL A;  4CLC B;  4P6Z S;  5TFQ A;  1PRQ A;  2Z6D A;  4ZJ3 A;  3N4I A;  3IWQ A;  3H82 A;  1H8M A;  5FI2 A;  3TE8 A;  4OPQ A;  3EQU A;  2Y2G A;  5HDC A;  1YSQ A;  4S2L A;  3VV4 A;  5CGX A;  2R78 A;  1YLZ A;  4HES A;  4R1G A;  4L0L A;  4NXF A;  2ZJ9 A;  1TDG A;  4Y0O A;  5DFY A;  4WYY A;  2ACG A;  4UQI M;  1GSV A;  2FFY A;  5M18 A;  1VET B;  3OCL A;  1MY8 A;  3ZGA B;  2GNX A;  5DFX A;  1XX2 A;  2WKR A;  2A3U A;  3VSL A;  3NIA A;  3IWO A;  4O8G A;  1S67 L;  2Y55 A;  3MF0 A;  4G3K A;  4MDZ A;  4WZ4 A;  3IX3 A;  3NY4 A;  1L0F A;  2VLG A;  3D4F A;  2XA7 M;  1OPX A;  5AVE A;  4Y0U A;  4R6L A;  2HDS A;  4OP8 A;  5FQK A;  4BBV A;  3S22 A;  2JCH A;  3LY3 A;  5IHV A;  1OTD A;  4GW9 A;  1ONH A;  1K4E A;  5F69 A;  3NUL A;  2EX9 A;  1PIO A;  2VX8 A;  1BSG A;  3LI9 A;  5HAP A;  4PM7 A;  3HLW A;  2YKH A;  2ZMF A;  4WUJ A;  2V0W A;  2XD1 A;  3IXH A;  3UE1 A;  4S2N C;  3G4P A;  3EGD C;  1LHY A;  4DE0 A;  3AGD A;  4IJG A;  4N9L A;  3DWK A;  3MKE A;  4Z1W A;  2XH9 A;  3A0R A;  2K31 A;  4WLA A;  2OSU A;  1TDL A;  3OPP A;  3WS0 A;  2ZC7 A;  2QHK A;  4CLC C;  1UWN X;  1FQG A;  2P9V B;  2UWX A;  1XA1 A;  3FG8 A;  3MZF A;  5U47 A;  4MN6 A;  5J7E A;  4HQA A;  3LR3 A;  3V39 A;  3T1X A;  2HJ9 C;  3RH8 B;  4HI4 A;  3T4K A;  2KX6 A;  4BEN A;  1DJA A;  1BLH A;  1E4D A;  2WK0 A;  1ES3 A;  1XP4 A;  4S2J A;  4CPK A;  2NUP C;  4ZTK A;  2P04 A;  1FOF A;  2I9V A;  1T1A A;  3IXB A;  4MBF A;  4Y17 A;  2XSS A;  5LBR A;  4HJ3 A;  2E8J A;  3DAV A;  2OLV A;  3Q82 A;  1IEM A;  2W1T A;  4EET B;  1SKF A;  1S66 L;  3G32 A;  3FC7 A;  4HP9 A;  3IF5 A;  2WGV A;  1KE0 A;  4OKP A;  4Y3I A;  5DKK A;  2XD5 A;  4DE3 A;  3LEQ A;  4WEJ A;  1S0W A;  4WBG A;  4B88 A;  4P87 A;  3NOU C;  1VET A;  2LB9 A;  2O9B A;  1NZO A;  1DP8 A;  4BD0 A;  2R9W A;  1GHP A;  5A90 A;  3D9Y A;  1XJ4 A;  4DXB A;  2O99 A;  2WAF A;  1YLY A;  3MXQ A;  5L2F A;  1Q2P A;  3N8S A;  3BJN A;  2V8C A;  4ID4 A;  5FAP A;  1W5D A;  1I2W A;  2VEA A;  4GS9 A;  3VFH A;  5FQI A;  4FSF A;  4KZ4 A;  2GX5 A;  4R70 A;  2A2L A;  3D72 A;  5EUA A;  1JWP A;  4I3A A;  1G68 A;  1DRM A;  4KZ9 A;  3W8K A;  3HRE A;  1GCE A;  3F1P B;  3ITB A;  3VOL A;  1ALQ A;  1S4R A; 
#chains in the Genus database with same CATH homology
 4QY5 A;  1PZO A;  2WGI A;  3MXS A;  3P98 A;  3UN7 A;  1YLJ A;  2Y2J A;  3G2Y A;  3G35 A;  3MXR A;  5E2E A;  1AXB A;  5EOO A;  2WAE A;  5CXW A;  1L2S A;  5CED A;  1K38 A;  4WZ5 A;  4EQI A;  1K56 D;  1IYQ A;  1BLS A;  1QME A;  4GKU A;  4MNR A;  4K0X A;  3HBR A;  5EEC A;  4MEZ A;  3PAG A;  1HZO A;  5AQA A;  4IBR A;  2XEP A;  4HBT A;  2PBY A;  4QD4 A;  5M19 A;  1BTL A;  3V3S A;  3VP2 A;  5E2G A;  4BL3 A;  4CJN A;  5HX9 A;  1JTD A;  3JYI A;  2JC7 A;  3CG5 A;  1KGG A;  4PM6 A;  3ZG0 A;  5FQQ A;  4GD6 A;  3S4X A;  5HAQ A;  4LV3 A;  3SS5 A;  3UPP A;  5GHZ A;  4S2M A;  4GB7 A;  1IYP A;  5KMW A;  3UO9 A;  1IYS A;  3UE3 A;  3FKW A;  3SOI A;  1E3U D;  3NDE A;  4OQI A;  4BQM A;  3BEC A;  1ZC2 A;  4QHC A;  3LEZ A;  4OQ0 A;  1H8Y A;  4RA7 A;  3WS5 A;  2J8Y A;  2E8I A;  5CER A;  3Q1F A;  5KSC A;  4JXS A;  3V3R A;  2XQZ A;  3C4P A;  3MKF A;  1GA0 A;  1MWR A;  1PZP A;  1GHM A;  1KGE A;  3MBZ A;  3UDI A;  3VP1 A;  4OPR A;  2XLN A;  4OLD A;  1CI9 A;  1KDW A;  3IXD A;  4R4S A;  2Y2Q A;  5HL1 A;  2ZQ7 A;  4X55 A;  3B3X A;  2ZC6 B;  1PWG A;  3M6B A;  3VSK A;  4U3T A;  1L0D A;  4NK3 A;  3ZVW A;  1PW8 A;  1NY0 A;  1H5X A;  1PI4 A;  5AQ9 A;  4KZ3 A;  2Y2M A;  5DF7 A;  4KEN B;  2J7V A;  3I7J A;  1NZU A;  3P09 A;  3LO7 A;  4KG5 A;  2Y2L A;  3FZC A;  5FAS A;  3FYZ A;  1MWS A;  1DJB A;  1YMX A;  5TR7 A;  4PM9 A;  3ZDJ A;  3PBT A;  4E3K A;  4KQQ A;  4UAA A;  3A3D A;  1G6A A;  4PM8 A;  1FR1 A;  1I2S A;  4YIN A;  5HAI A;  3IT9 A;  1YLW A;  4S2K A;  4M3K A;  5CGS A;  1NXY A;  2Y2K A;  5FA7 A;  4A5R A;  3OPH A;  4BD1 A;  3RXX A;  3WS1 A;  4IED A;  4FH2 A;  5EPH A;  3BLM A;  5I94 A;  5D3O A;  4OOY A;  4EBL A;  4C3Q A;  4UA9 A;  3BFD A;  3W4O A;  3OZH A;  5FAQ A;  1N9B A;  4P6B A;  3OCN A;  2HDQ A;  2Y2H A;  4E6W A;  3HL9 A;  4KZ8 A;  4P0M A;  4Z9Q A;  2Y91 A;  1KDS A;  2IWC A;  1KE4 A;  4UA6 A;  1XGI A;  4OPY A;  3IH9 A;  1ES5 A;  4NET A;  3IF6 A;  2QPN A;  3MFD A;  4BJP A;  2HDU A;  2C6W B;  2ZC5 B;  3HLD A;  3ZG5 A;  5HW3 A;  2P9V A;  3IXG A;  3Q81 A;  4GN2 A;  4ZAM A;  4B4Z A;  1MPL A;  1VM1 A;  3G34 A;  4QB8 A;  1DJC A;  2Y2N A;  1KE3 A;  3HLB A;  3ISG A;  3GQZ A;  1GA9 A;  4DXC A;  1LLB A;  5A91 A;  4JF6 A;  3BYD A;  4C6Y A;  3OPR A;  5KSH A;  1SHV A;  1JTG A;  4MLL A;  2EXB A;  2R9X A;  3ZG9 B;  2Y2P A;  4KZ7 A;  1FSW A;  1JWZ A;  3WS2 A;  3HLC A;  1K55 A;  2BLS A;  3WRT A;  4DE1 A;  1K57 A;  2ZQ8 A;  5DTS A;  1XXM A;  2I72 A;  1IEL A;  3ZVT A;  3V5M A;  2HP5 A;  5CEC A;  2QZ6 A;  4D2O A;  1C3B A;  4E3J A;  5M1A A;  2X71 A;  4LCL A;  3PBN A;  5EVI B;  2PU2 A;  1ERM A;  5G18 A;  2ZM8 A;  4DKI A;  4JLF A;  4KZ6 A;  3BEB A;  1K55 C;  4U0T A;  2ZMA A;  1BT5 A;  3NDG A;  1MXO A;  2V1Z A;  4WMC D;  4RX3 A;  2C5W B;  4OPZ A;  4OQG A;  4GD8 A;  1N4O A;  4OON A;  1BUE A;  4K91 A;  4Y7P A;  4H8R A;  2EX2 A;  4O7D A;  1O7E A;  1CI8 A;  2H10 A;  1L0G A;  4RYE A;  1MBL A;  4IVK A;  1LL5 A;  4E3I A;  1YMS A;  3ZG7 B;  1JWV A;  1WYC A;  4JXG A;  4N1H A;  4KZB A;  2WZZ A;  4X69 A;  3Q7V B;  4DF6 A;  1WYB A;  3Q7Z A;  4R0Q A;  4ZDX A;  2X02 A;  1RCJ A;  4EBN A;  1YT4 A;  5JYO A;  3IH8 A;  1VQQ A;  4BL2 A;  3IWI A;  2H0Y A;  3W4Q A;  4HBU A;  2ZQD A;  3DWZ A;  3BRM A;  4GOG A;  3PBS A;  5CEB A;  3HLG A;  5GL9 A;  3TSG A;  2EX8 A;  1PI5 A;  2G2W A;  4XUX A;  4JXW A;  2ZQC A;  4E3N A;  1NJ4 A;  3MZD A;  3O87 A;  4GNU A;  4MBH A;  2XF3 A;  4OOL A;  4GDB A;  3IQA A;  3VP4 A;  2WUQ A;  3GTC A;  2V20 A;  4JBF A;  4LV0 A;  1E25 A;  4E3M A;  3CJM A;  3A3J A;  3RJU A;  2Q9M A;  1ES2 A;  1KVM A;  2EX6 A;  2J9P A;  2J9O A;  1XPB A;  3N8R A;  4GZB A;  3G2Z A;  3UY6 A;  4KQR A;  3ITA A;  4R23 A;  2DCF A;  3HLE A;  1WE4 A;  3TOI A;  1SCW A;  3G30 A;  4UHU A;  4OVD A;  5BOH A;  1IYO A;  4E3L A;  4WMC A;  3QNB A;  2XGN A;  2XK1 A;  1QMF A;  2ZD8 A;  4KG6 A;  4QU3 A;  5F83 A;  3WWX A;  2CC1 A;  4KG2 A;  1KGF A;  2B5R A;  5HAR A;  3UPO A;  5E2F A;  4DRT A;  3AGE A;  1U60 A;  1ONG A;  5J8X A;  3A3F A;  1KVL A;  1NRF A;  1TVF A;  5TFQ A;  1HD8 A;  5CHJ A;  1ERQ A;  1M6K A;  1Q2Q A;  1MWT A;  2WGW B;  3N4I A;  2WKE A;  4ZJ3 A;  3IWQ A;  3HVF A;  1LI9 A;  3HUO A;  1K57 C;  1Y54 A;  1HVB A;  3QNC A;  5FI2 A;  2RL3 A;  3SS3 A;  3V50 A;  4OPQ A;  4KQO A;  3Q7V A;  3EQU A;  1JVJ A;  2Y2G A;  5FSR A;  1SDE A;  4K0W A;  1M40 A;  2DNS A;  3C4O A;  4OOM A;  4S2L A;  3TG9 A;  2ZQ9 A;  3C5A A;  5GLD A;  2HDR A;  4WEK A;  5CGX A;  3PTE A;  1YLZ A;  3IHB A;  4F94 A;  3PAE A;  2ZM2 A;  4HES A;  4R1G A;  3A3I A;  1BZA A;  2QMI A;  4L0L A;  2BG1 A;  4FCF A;  2ZJ9 A;  2XFS A;  1TDG A;  3LY4 A;  3N8L A;  4Y0O A;  4WYY A;  1YLT A;  1J9M A;  3CZD A;  4P85 A;  3UPN A;  2Z2M B;  1O07 A;  5DF8 A;  2FFY A;  5M18 A;  1S6R A;  1ES4 A;  1K4F A;  3OCL A;  4OLG A;  3UE0 A;  1MY8 A;  3ZGA B;  2DRW A;  4Y0T A;  1MWU A;  1IKI A;  1ZG4 A;  1XX2 A;  5FQM A;  1W8Q A;  2A3U A;  3IHA A;  3VSL A;  3NIA A;  3IWO A;  3S1Y A;  1PW1 A;  3IF6 C;  3ZCZ A;  5FDH A;  5GLB A;  2Y55 A;  3PBO A;  3VOY A;  5DVA A;  1K54 C;  4HEF A;  2ZC4 B;  2GDN A;  4UA7 A;  1XGJ A;  4WZ4 A;  3C7V A;  4KZ5 A;  4QY6 A;  4R3J A;  5CGW A;  5EVI D;  4JPM A;  4XUZ A;  3NCK A;  3NY4 A;  4PPR A;  4S2I A;  4EV4 A;  5FI6 A;  1H8Z A;  1L0F A;  3D4F A;  5CHM A;  2EFU A;  2Q9N A;  5KZH A;  2PU4 A;  3IF6 B;  1CEF A;  4N9K A;  4PMA A;  4Y0U A;  5FAT A;  1L0E A;  4IVI A;  4JF4 A;  1YQS A;  2HPB A;  1Z6F A;  1NYY A;  2HDS A;  3GMW A;  4OP8 A;  2HP6 A;  1XKZ A;  5FQK A;  5EVL A;  4JKT A;  4N92 A;  3S22 A;  2JCH A;  3LY3 A;  5IHV A;  4ZJ1 A;  5TGF A;  3HUM A;  1FCM A;  4S2N A;  5DF9 A;  1ZKJ A;  1ONH A;  1K6R A;  1K4E A;  3M6H A;  2EX9 A;  1PWC A;  1W79 A;  1CEG A;  4JF5 A;  4RVA A;  1GHI A;  1PIO A;  4DE2 A;  3GSG A;  1BLC A;  1BSG A;  1YM1 A;  2WGW A;  4MBK A;  5HAP A;  4PM7 A;  4X6T A;  2ZLY A;  3LCE A;  3MZE A;  3HLW A;  5A92 A;  5EVI A;  2XD1 A;  3IXH A;  5DTK A;  4S2N C;  3UE1 A;  3G4P A;  1LHY A;  4DE0 A;  1DY6 A;  1FSY A;  3AGD A;  1CK3 A;  4EBP A;  3FKV A;  4N9L A;  1XA7 A;  3DWK A;  2Y2O A;  3SH9 A;  5HFO A;  3SS4 A;  1HTZ A;  2Y2I A;  3BFF A;  1LI0 A;  3GR2 A;  3MKE A;  2A49 A;  1MKI A;  4JXV A;  3A3E A;  1OME A;  2XH9 A;  2VGJ A;  4ZJ2 A;  1K56 A;  4U0X A;  2OSU A;  1TDL A;  4GDN A;  3OC2 A;  3OPP A;  2JBF A;  3WS0 A;  2ZC7 A;  3M2J A;  3HUN A;  5FQ9 A;  1BLP A;  3GV9 A;  1FQG A;  2P9V B;  1ALQ A;  2UWX A;  1XA1 A;  4LCM A;  2Y4A A;  4ZBE A;  3ZFZ A;  4RX2 A;  3MZF A;  5CRF A;  5U47 A;  1NYM A;  3V39 A;  2HP9 A;  1ESI A;  3UDX A;  5CTM A;  4E3O A;  2RCX A;  2IWD A;  3SH8 A;  5DTT A;  4BEN A;  2WYX A;  1DJA A;  1BLH A;  3VMA A;  1E4D A;  4IBX A;  2WK0 A;  3ZNY A;  4FH4 A;  1ES3 A;  1LL9 A;  1XP4 A;  4S2J A;  4BLM A;  3N6I A;  4CPK A;  1PYY A;  2WAD A;  3NC8 A;  3EQV A;  4OQH A;  4R4R A;  4ZTK A;  4OH0 A;  3BFC A;  4X68 A;  1FOF A;  3BFE A;  2WKH A;  5GLA A;  1ERO A;  3IXB A;  4N1X A;  3QHY A;  4MBF A;  4LEN A;  1RP5 A;  2X01 A;  2P74 A;  4LV2 A;  4WZ5 C;  2FFF B;  1I5Q A;  3BM6 A;  3O88 A;  2OLV A;  3G31 A;  5EOE A;  3DW0 A;  3OPL A;  5E2H A;  4X53 A;  1FCN A;  1TEM A;  3DTM A;  3Q82 A;  4Q8I A;  4E6X A;  4OP5 A;  3W4P A;  4WEL A;  1IEM A;  3VFF A;  4FD8 A;  2JE5 A;  5EVI C;  2G2U A;  3ZNT A;  3VP0 A;  5A93 A;  3FWL A;  5GHY A;  2XR0 A;  1SKF A;  4B4X A;  4S2P A;  1RGZ A;  2IWB A;  3G32 A;  2OV5 A;  3NI9 A;  4EUZ A;  2EXA A;  5F1F A;  3E2K A;  1YLP A;  4EWF A;  5E43 A;  3IF5 A;  2WGV A;  1KE0 A;  4OKP A;  5GLC A;  3ZG8 B;  4YFM A;  3FV7 A;  1ESU A;  4PM5 A;  2XD5 A;  3SH7 A;  5GHX A;  4DE3 A;  2WZX A;  1E3U A;  4WEJ A;  5F1G A;  1S0W A;  4WBG A;  4B88 A;  4P87 A;  4C75 A;  3M2K A;  3N7W A;  4WM9 A;  1K25 A;  2ZQA A;  3BLS A;  3Q07 A;  3AGF A;  3VOZ A;  1NZO A;  3O3V A;  1K6S A;  5CTN A;  4BD0 A;  5AQB A;  5AQ7 A;  1IKG A;  1W8Y A;  5FAO A;  2R9W A;  1GHP A;  5A90 A;  3WS4 A;  3O86 A;  4QJG A;  2Y59 A;  1BUL A;  4DXB A;  3HLF A;  2VGK A;  2WAF A;  1YLY A;  2ZM0 A;  3CMZ A;  3C7U A;  1ZG6 A;  3UDF A;  5L2F A;  3NBL A;  1PWD A;  2ZC3 B;  4X56 A;  1K54 A;  1Q2P A;  5FI7 A;  3N8S A;  3E2L A;  4ID4 A;  5FAP A;  1W5D A;  3PBR A;  1I2W A;  1RGY A;  2WKI A;  1FR6 A;  4KZA A;  4XXR A;  2EFX A;  5FQJ A;  3RXW A;  4R3B A;  5JYP A;  2H5S A;  3PBQ A;  2XDM A;  5FQI A;  3VFH A;  4FSF A;  1W7F A;  1FCO A;  1EWZ A;  1EI5 A;  2OLU A;  3GRJ A;  3GVB A;  4KZ4 A;  5CHU A;  4DDY A;  5EUA A;  2V2F F;  2XFT A;  1JWP A;  3UNW A;  3VP3 A;  1G68 A;  4LV1 A;  4KZ9 A;  3W8K A;  3HRE A;  5EE8 A;  3WRZ A;  1GCE A;  5F82 A;  3ZHH A;  4S2O A;  1SDN A;  2H0T A;  3ITB A;  3BFG A;  4DDS A;  2Z2L B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...