1YLZA

X-ray crystallographic structure of ctx-m-14 beta-lactamase complexed with ceftazidime-like boronic acid
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
263
structure length
263
Chain Sequence
QTSAVQQKLAALEKSSGGRLGVALIDTADNTQVLYRGDERFPMCSTSKVMAAAAVLKQSETQKQLLNQPVEIKPADLVNYNPIAEKHVNGTMTLAELSAAALQYSDNTAMNKLIAQLGGPGGVTAFARAIGDETFRLDRTEPTLNTAIPGDPRDTTTPRAMAQTLRQLTLGHALGETQRAQLVTWLKGNTTGAASIRAGLPTSWTVGDKTGSGDYGTTNDIAVIWPQGRAPLVLVTYFTQPQQNAESRRDVLASAARIIAEGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords BETA-LACTAMASE CTX-M-14
publication title Structure, Function, and Inhibition along the Reaction Coordinate of CTX-M beta-Lactamases.
pubmed doi rcsb
source organism Escherichia coli
total genus 98
structure length 263
sequence length 263
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2005-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1ylzA00
4GNUA 4KQQA 1N9BA 1K6SA 2WGWA 2XH9A 2H10A 2ZJ9A 5E2EA 4LCLA 1OMEA 3SS3A 4A5RA 1VM1A 5DF9A 5EOEA 3N8RA 4QU3A 1BSGA 4GDNA 1H8ZA 2UWXA 3SH9A 2WGIA 3HLCA 5GLCA 3ITAA 5F82A 3S4XA 1XA7A 3G31A 2ZC3B 4WELA 1Q2PA 3MBZA 3PBNA 2WAFA 4KZ6A 5FDHA 5D3OA 3G30A 3OPRA 2OSUA 4KQOA 1LI9A 4UHUA 3NCKA 2JC7A 1NRFA 4ID4A 3BRMA 1M40A 2P9VB 4GB7A 4HESA 3UO9A 3WS4A 5EVLA 3WRTA 3WS5A 4E3OA 4ZAMA 5DF8A 5FQQA 3ZNTA 3BLSA 3VP2A 2WZZA 1IYPA 3GSGA 2J7VA 5CXWA 5GHXA 4EUZA 4ZJ1A 2Y2OA 1MY8A 1MBLA 2HPBA 2Y2JA 3QNBA 4P87A 5DTSA 5J8XA 2QPNA 3A3DA 3DWKA 4WMCD 4O7DA 1E3UA 1EI5A 3Q81A 4U0TA 3IXGA 3ZVTA 1GHPA 1MWUA 1IYQA 1NXYA 3BFEA 1XGJA 5HAPA 3NIAA 3PTEA 1ALQA 3IF5A 2WKHA 1YLZA 4S2PA 1ONGA 2HP6A 4QJGA 5CRFA 4GN2A 1L0EA 1L0DA 2XDMA 3JYIA 1WYCA 3UE1A 3IH9A 2Y59A 1BTLA 1MWRA 1PIOA 1ONHA 3W4PA 1TDGA 2ZC7A 4RA7A 3ZDJA 3BFFA 1JTGA 4OQIA 3GR2A 3UY6A 3WS0A 3C4PA 4Q8IA 1YQSA 4DF6A 4DXBA 4DE0A 3VMAA 3G35A 2EX6A 1LL9A 2G2WA 4GZBA 1KVLA 4N9KA 4QY5A 3LCEA 1MXOA 1CI8A 5AQ7A 3VSLA 2X71A 3CJMA 2X02A 4KZ4A 3IF6A 3HLDA 3IT9A 5M18A 5E2HA 2A3UA 3HLGA 3ISGA 1CEFA 4KG2A 3WS2A 5A93A 2WYXA 3BECA 4WZ4A 3V3SA 4IVIA 4R1GA 1KGEA 4K0WA 2EX8A 3NC8A 3C4OA 4K91A 5GHZA 2CC1A 1SKFA 1W79A 1YLPA 1SCWA 3G2ZA 4P0MA 5CTNA 4R23A 4BD0A 4E3KA 3DW0A 3WWXA 1IKGA 3C7VA 4HBTA 1BLCA 5GLDA 4FH4A 2Y2GA 4IBXA 4XUXA 5A92A 1CEGA 2JE5A 1BLHA 4RVAA 4X68A 5E2FA 1XKZA 5FQIA 4DDSA 4N1XA 4GD6A 3M6HA 3S22A 3ZNYA 1Z6FA 1ES2A 3UE0A 3CG5A 3HLBA 4BLMA 3P09A 4MNRA 5E2GA 1JWPA 1HTZA 1DJBA 3IWOA 5HFOA 3N8LA 4S2NC 3S1YA 3A3JA 3CZDA 3N8SA 5FATA 3VFHA 3HUNA 4JXSA 3FWLA 2Y2PA 4X56A 2XGNA 4C75A 4WEJA 2EX2A 2WGWB 4Z9QA 2C6WB 1FOFA 3RJUA 4ZTKA 4BJPA 1L0FA 1YM1A 2PU2A 2EX9A 1TEMA 2WKEA 5HX9A 5KSCA 4KZ5A 4P6BA 2B5RA 5CERA 4E3NA 4RYEA 1TVFA 4OH0A 1C3BA 4XXRA 4UA7A 2OV5A 1K56A 1RP5A 1W8QA 2VGKA 3BEBA 2OLVA 3HREA 3IXBA 3PBRA 3EQUA 3IH8A 3OPPA 1LL5A 4WZ5A 3Q7VB 2Z2LB 3Q7ZA 1XX2A 4QHCA 3N4IA 2WGVA 3MXSA 4WYYA 3UPOA 3UPNA 2HP9A 1FR1A 1DY6A 3TOIA 3OPHA 2XF3A 3M2JA 5DF7A 1PI4A 2Y55A 5EVIA 5CGXA 4N92A 3UN7A 5G18A 2DNSA 1DJAA 4PPRA 4LV3A 4KZ3A 1W5DA 4R4RA 4MBHA 1YLYA 3G34A 4OQHA 5FI6A 5TGFA 1E25A 3NI9A 3GVBA 3OPLA 5CGSA 3ZG7B 3D4FA 1CI9A 2HDSA 3HUMA 5AQAA 2H0TA 1QMEA 2P74A 3G4PA 3V50A 4HBUA 4X6TA 4JF4A 1FR6A 4H8RA 2BLSA 1ERMA 1CK3A 1WYBA 3OC2A 4PM9A 3LEZA 4OPRA 4BL2A 4DXCA 2RCXA 3W4OA 2FFYA 2JCHA 2ZC4B 4OOLA 1K4FA 1YLTA 1K54A 4B88A 2GDNA 3W4QA 3FKVA 1WE4A 2WKIA 2IWCA 5FQKA 4DE3A 4OPZA 5KSHA 3GV9A 2EXBA 2XLNA 5FA7A 3IQAA 5HAQA 1K57C 1YLWA 1L2SA 2XD1A 4HEFA 3VP0A 1FCNA 1PYYA 2Y91A 4LV0A 4GD8A 4KZ7A 4R3JA 4YFMA 5EPHA 1NJ4A 2XFTA 3VSKA 4D2OA 1W8YA 1JWVA 3HUOA 4Y0TA 3IF6B 1I2WA 4EBPA 1K25A 5EUAA 4IBRA 1PZOA 3IHBA 5CHUA 4R0QA 4R3BA 5GL9A 1PWGA 1G68A 3HLWA 1BLPA 1U60A 1SHVA 4N1HA 4GOGA 1KDSA 1I5QA 3IXDA 2XD5A 2Y2IA 2ZQ7A 3B3XA 5HAIA 3BLMA 3TG9A 1BLSA 2PU4A 3A3IA 3BYDA 3O88A 4L0LA 5KMWA 2WADA 3SS4A 1YLJA 3PAEA 1ESIA 4GKUA 3OCLA 2WZXA 2ZQ9A 3G2YA 1L0GA 2EFUA 4JXGA 5CHMA 2WK0A 2OLUA 3UNWA 1GA9A 3Q07A 5EE8A 3PBQA 2XQZA 4LENA 3CMZA 1W7FA 5FI7A 5HW3A 1ESUA 4JF6A 3ZG8B 4PM5A 1GHIA 2IWDA 1M6KA 1NZOA 4S2MA 4GDBA 3VOZA 4C6YA 4E6WA 4PM6A 3MZFA 5FAOA 4F94A 3FYZA 4OLGA 2DCFA 4DDYA 3EQVA 5CEBA 3BFCA 1BUEA 1FCMA 5HARA 5JYPA 4OLDA 4UAAA 3SS5A 2VGJA 3IF6C 4WBGA 4KZBA 2ZMAA 4DE2A 1JTDA 1PW8A 2R9XA 5FAQA 4OP8A 4CJNA 2XFSA 4IVKA 4PM7A 3IHAA 3ZCZA 5L2FA 1SDEA 1ZKJA 4UA6A 2Y2MA 1XGIA 3ZGAB 1KGFA 3AGFA 1MWSA 1KE3A 1S0WA 1ES3A 3PBOA 2I72A 5E43A 3SH8A 1QMFA 4KG5A 4K0XA 3ZVWA 5AQ9A 3HVFA 4JLFA 1E3UD 4E3JA 4S2NA 1JVJA 3FKWA 1TDLA 1S6RA 1EWZA 4FCFA 1E4DA 5GLAA 1FSYA 3TSGA 1MWTA 4U3TA 4WEKA 4E6XA 4OPQA 4U0XA 3Q1FA 2J8YA 2Y2QA 4WMCA 1RGYA 4YINA 5CGWA 3RXXA 4KZ9A 4IEDA 3E2KA 2EFXA 4JXWA 4S2OA 4OOYA 5FAPA 2X01A 1ES5A 2ZQCA 3BFDA 4ZJ3A 1ZC2A 1O7EA 2XK1A 3MZDA 4OQGA 5IHVA 1K55C 4E3MA 4ZDXA 2Y2NA 3VFFA 4MEZA 3ZFZA 4BENA 3A3EA 4M3KA 3VOYA 5A90A 4LV1A 1HZOA 4OONA 2IWBA 1GHMA 3P98A 4EBNA 1XA1A 4JXVA 1ZG4A 3RXWA 2ZQDA 4Y0UA 1KGGA 1RCJA 4RX2A 5KZHA 3SH7A 4OOMA 4OP5A 3WS1A 1PWDA 3VP3A 1PWCA 3UDIA 3LY4A 3M6BA 1ZG6A 1G6AA 3WRZA 3MZEA 3GRJA 1ES4A 3QNCA 5TFQA 1DJCA 3FZCA 5FASA 1GCEA 1N4OA 4EWFA 4S2LA 4MBFA 1HD8A 2H0YA 3C7UA 2V2FF 3N7WA 4DRTA 4OKPA 3NBLA 1LI0A 4OPYA 3UPPA 4MBKA 5TR7A 4UA9A 3ZG0A 1KE0A 4NETA 1XXMA 3ZG5A 4NK3A 4ZBEA 5FQMA 5DVAA 4X69A 3Q7VA 4E3IA 3ZHHA 4KZ8A 4KG6A 5F1GA 1K57A 2H5SA 3V39A 2J9OA 3HLFA 4LCMA 1BT5A 1YT4A 1NZUA 1K54C 3BFGA 4FD8A 3MFDA 2JBFA 5FQJA 5FSRA 4X55A 4BD1A 5CTMA 3UDFA 3V5MA 5M1AA 3SOIA 2Q9MA 2Y2KA 2XEPA 3I7JA 4S2JA 1NYMA 4EBLA 4KQRA 1GA0A 1VQQA 3DWZA 4QD4A 1AXBA 1K56D 2HDRA 2WUQA 1XP4A 3W8KA 5JYOA 1ERQA 2ZM0A 3MKEA 4JF5A 3AGEA 3BM6A 1IKIA 4Y0OA 3MKFA 4R4SA 2Y4AA 3Q82A 2G2UA 3IXHA 2FFFB 4RX3A 4BL3A 5GLBA 2Q9NA 2P9VA 1KVMA 4QB8A 3A3FA 3O87A 2EXAA 3HL9A 5EVID 5GHYA 3E2LA 4OQ0A 3PAGA 4BQMA 3LO7A 3PBTA 1K4EA 4WM9A 5I94A 2WAEA 4FSFA 4LV2A 4N9LA 4DKIA 3O3VA 2C5WB 1XPBA 2DRWA 5F1FA 2ZM2A 3V3RA 2R9WA 3HLEA 5EECA 5CECA 3UE3A 1KDWA 1K6RA 5M19A 1KE4A 4MLLA 2Y2HA 5HL1A 2HDQA 4PMAA 2QMIA 4JBFA 3VP1A 1FCOA 2A49A 4XUZA 5FQ9A 2ZC6B 1PZPA 4KENB 4EV4A 3M2KA 1NYYA 4JPMA 5CHJA 2ZQAA 2QZ6A 3OZHA 3IWIA 5FI2A 5AQBA 4C3QA 3AGDA 1BULA 3QHYA 3GTCA 5A91A 2ZC5B 1SDNA 1PW1A 1YMSA 1K38A 5EVIB 2HP5A 3NY4A 3GQZA 3ZG9B 5CEDA 2ZM8A 1LLBA 4P85A 3OCNA 1PI5A 4ZJ2A 2V20A 2ZQ8A 1Y54A 1YMXA 2E8IA 1IYSA 1H8YA 3NDGA 3IWQA 3GMWA 1J9MA 3C5AA 1IELA 3N6IA 2V1ZA 2ZD8A 1FSWA 3HBRA 4EQIA 1NY0A 1I2SA 2HDUA 3DTMA 2XR0A 4CPKA 2BG1A 4PM8A 3ITBA 1IYOA 4JKTA 1H5XA 4DE1A 4X53A 4S2IA 1LHYA 4B4ZA 5DTTA 3NDEA 3FV7A 4E3LA 2Z2MB 5F83A 5EOOA 4B4XA 1O07A 1K55A 2Y2LA 4FH2A 1JWZA 3MXRA 1EROA 4OVDA 4S2KA 5DTKA 1RGZA 4KZAA 1HVBA 1Q2QA 2RL3A 4QY6A 5U47A 2PBYA 2J9PA 4WZ5C 3UDXA 3PBSA 4Y7PA 5BOHA 3VP4A 1MKIA 1IEMA 1FQGA 3G32A 2ZLYA 1MPLA 1BZAA 3LY3A 5EVIC 3O86A
chains in the Genus database with same CATH superfamily
4KQQA 1OMEA 1VM1A 3LI9A 2JHEA 3T50A 1F98A 5EOEA 1H8ZA 2WGIA 5GLCA 3TE8A 1T1BA 2L0WA 1Q2PA 3MBZA 3PBNA 2A2LA 3OPRA 2OSUA 1LI9A 1S1ZA 4ARZA 3NCKA 3JVUA 2JC7A 3WS4A 5EVLA 3P7NA 4ZAMA 5FQQA 2J3WA 3GSGA 4EUZA 4O0PA 4ZJ1A 2Y2OA 3KSIA 3QNBA 3CAXA 3DWKA 3A3DA 4O7DA 4U0TA 2ZOIA 1MWUA 1XGJA 4RQ9A 1ALQA 2NUPC 4Q0JA 4S2PA 1AWIA 2W1TA 1WYCA 2HF6A 2Y59A 1BTLA 1TDGA 3R7WA 4X1LA 3LFVA 3MR0A 4DE0A 3VMAA 2EX6A 1LL9A 4FUWA 2J80A 1MXOA 2X71A 2X02A 3KYEA 5E2HA 2A3UA 1CEFA 5AVFA 3WS2A 3BECA 4WZ4A 3FG8A 4R1GA 3OLOA 4EEPA 2VLGA 2EX8A 3G2ZA 4P0MA 4M4XA 3WWXA 3C7VA 5J3WA 4Y13A 4XUXA 2JE5A 4X68A 3LR5A 3S7NA 3S22A 3VOLA 1ES2A 3HLBA 5C5KA 3LGOA 2KOIA 5HFOA 3N8LA 2OWJA 3KSGA 3HUNA 5A8BA 4HJ3A 3S7QA 3OBFA 3RJUA 4BJPA 2B02A 3D9YA 2EX9A 5KSCA 3UMDA 2O9AA 4P6BA 2B5RA 4RYEA 1TVFA 4IJGA 4UA7A 2OV5A 2NUTC 1K56A 4EESA 3EQUA 3IH8A 2Y79A 3B33A 4QHCA 3MXSA 4WYYA 1OTIA 3UPNA 2PD7A 1FR1A 5L09A 1PI4A 2Y55A 4N92A 5HPIA 4PPRA 4X25A 1SKOB 1YLYA 3G34A 1CI9A 3G4PA 2BLSA 1WYBA 2RCXA 3W4OA 5DJTA 4G3VA 1F2KA 4B88A 1WE4A 2IWCA 2EWVA 2PR6A 5FA7A 2XD1A 1PYYA 4R3JA 3VSKA 1OT6A 2XFTA 1W8YA 1I2WA 1K25A 2Z6DA 5CHUA 3RH8B 4R0QA 4HHDA 1UWPX 1U60A 5EFWA 1KDSA 3G6OA 2Y2IA 5HAIA 3EEAA 3SS4A 1ESIA 1TS8A 3LIAA 2VV6A 2WZXA 1GA9A 3Q07A 3CMZA 4GLQA 5HW3A 1A0KA 1ESUA 4WLAA 3DAVA 2IWDA 1NZOA 2HZ5A 4C6YA 3MZFA 5FAOA 3FYZA 2DCFA 3MSHA 3BFCA 5HARA 4OLDA 3SS5A 4WBGA 1Z09A 2D01A 4XT2B 2JN7A 3PHYA 4CJNA 3QP8A 3DTEA 1ZKJA 4UA6A 2ZL1B 5IT5A 2LB5A 3H9WA 1KGFA 3AGFA 1MWSA 4L9GA 4ETZA 2BASA 2ZBBA 3ZVWA 2OAQ1 2VX8A 1E3UD 4S2NA 1S6RA 4Q0IA 3DBAA 1MC0A 1BYWA 4U0XA 3SZTA 3Q1FA 5F6AA 4WMCA 3LR4A 4YINA 3RXXA 3H7WB 1LT0A 3E2KA 4LGWA 3EGXC 1TF1A 4OOYA 2JKFA 3CUEC 1ES5A 1ZC2A 4E3MA 4JXVA 1ZG4A 2Z6CA 2W3FA 1N9NA 3SH7A 4OP5A 2KX6A 4P6ZM 3VP3A 1ZG6A 3CPTA 2V0UA 1ES4A 1DJCA 3FZCA 4YOFA 4OKPA 1LI0A 4OPYA 3VE4A 1KE0A 3ZG0A 2VEAA 1XXMA 5FQMA 5F1GA 1YPRA 4DJ2A 1Y4OA 2P04A 4EERA 4GJ4A 1NZUA 4FD8A 4LRZE 3UDFA 3V5MA 2JKGA 2Q9MA 2Y2KA 4S2JA 1NYMA 1L3LA 1AXBA 5JYOA 1T18A 1XP4A 1ERQA 5FEFA 1OTAA 1TS0A 4LRYC 3KSFA 4QB8A 3HL9A 3PAGA 3UB9A 3UB7A 2W1RA 2G7UA 3MQQA 1H8MA 3S7OA 2C5WB 1LL8A 1XPBA 2DRWA 3V3RA 5HDCA 3UE3A 1KDWA 2VK3A 1FILA 4I3AA 5HL1A 4G3KA 2QMIA 5L8MA 4JBFA 3VP1A 4XUZA 2ZC6B 3UMEA 4E04A 3MQOA 2ZQAA 5FI2A 3EWKA 1BULA 3GTCA 1GSVA 1YMSA 2QJ5A 3CWFA 5CEDA 2ZM8A 2E8IA 1H8YA 4B9OA 3GMWA 3L7HA 2ZD8A 3HBRA 4EQIA 1NY0A 2HDUA 4B4ZA 3NDEA 3FV7A 2Z2MB 5F83A 1O07A 3F1NA 4QY6A 4PKYA 1Q2QA 3NULA 5U47A 1G6OA 2PBYA 3BY8A 3PBSA 4Y7PA 3VP4A 2VJWA 3LY3A 3F1PA 2V1AA 3T4KA 4GNUA 4NXEA 1K6SA 4A5RA 2PT7A 1DP8A 3SH9A 2V8FA 3G31A 2E8JA 5DJUA 4WELA 5FDHA 5D3OA 2PHYA 1NRFA 3T4LA 3BRMA 2PRFA 3ZNTA 4FTXA 3BLSA 3VP2A 1IYPA 2J7VA 5HWTA 1MY8A 5J8XA 2HPBA 5DTSA 3IBJA 2QPNA 2UV0E 4PHTA 3IXGA 4YWZA 3NIAA 2KLIA 2K31A 1ONGA 4Y5FA 4QJGA 2XDMA 3JYIA 2QJ7A 4Q0HA 3KO6A 4KUKA 3W4PA 1ONHA 1P97A 2ZC7A 1VETB 4OQIA 3UY6A 5G4YA 1YQSA 4DF6A 3MF0A 3T4TA 2QWSA 3QP4A 4GZBA 1KVLA 4QY5A 3VSLA 3CJMA 4NXGA 4R3AA 3T4SA 4KG2A 5F69A 3V3SA 1KGEA 5GHZA 1W79A 4R23A 4E3KA 4CQHA 3DW0A 4FH4A 4IBXA 1XKZA 5FQIA 4DDSA 2INWA 3UE0A 3P09A 4MNRA 2OAP1 1JWPA 1GSXA 1HTZA 4EXOA 3E0YA 3S1YA 4S2NC 3N8SA 3TW8A 5FATA 4PKYG 4JXSA 3FWLA 3IS2B 4C75A 1OPXA 2WGWB 3CUEA 2V0WA 1YM1A 2WKEA 1TEMA 5HX9A 4KZ5A 4OH0A 4XXRA 1W8QA 2VGKA 3RTYA 3HREA 3PBRA 4WZ5A 2Z2LB 3U4LP 2PYRA 1FIKA 1DY6A 3TOIA 1D06A 5DF7A 3UN7A 5CGXA 5G18A 3FPVA 1DJAA 1XJ3A 5DKKA 4LV3A 4I39A 4OQHA 5TGFA 3EOIA 1VEUB 1T1AA 2HDSA 5AQAA 4HBUA 4X6TA 4JF4A 5HPFA 4DXCA 2JCHA 1K4FA 2GDNA 3W4QA 3FKVA 2JKTM 1TD5A 5F5YA 4OPZA 3F1OA 5KSHA 2XLNA 3U2AA 4HEFA 1FCNA 4HJ6A 3C30A 4F3LB 4GD8A 4YFMA 5EPHA 1CJFA 3IF6B 5EUAA 4GS9B 1PWGA 5GL9A 1G68A 3GECA 4N1HA 4GOGA 3TG9A 5KMWA 2ZQ9A 1HLUP 1DP6A 2XQZA 4LENA 5FI7A 4JGQA 3VOZA 5CEBA 2O9CA 5J4EA 5JYPA 2PR5A 2IA2A 1JTDA 5TBMB 2R9XA 3W2ZA 3QP1A 4IVKA 4PM7A 5L2FA 3ZCZA 1SDEA 5DKLA 1VETA 1KE3A 2EWWA 1ES3A 3PBOA 5E43A 4JLFA 4IUHA 5AJGA 3FKWA 5MC7A 1S66L 1EWZA 1ZHHB 2B18A 3TSGA 4E6XA 4H6JB 1TS6A 2M1CA 4CLCA 3BQ8A 5IHVA 3T1RA 3VFFA 3NECA 3ZFZA 4BENA 5A90A 4LV1A 4OONA 2L1MA 3RXWA 2A24A 1KGGA 3T1QB 3KX0X 3WS1A 4MN5A 1STZA 3M6BA 2CMNA 3WRZA 3MZEA 1CF0A 3PXPA 3QNCA 5TFQA 1J3WA 4AFIA 4YNRA 5FASA 1GCEA 4EWFA 2H0YA 3C7UA 2V2FF 2ZMVA 3UPPA 4MBKA 5IS1A 5HL6A 3ZG5A 4HJ4A 4HH3A 3ZHHA 4GW9A 1K57A 2FH5A 3V39A 3BWLA 3HLFA 1BT5A 1K54C 2JBFA 5FSRA 4BD1A 5CTMA 5HDSA 4HP4A 1V9ZA 3QP5A 4HQAA 3TJZC 1VEUA 4KQRA 4HI4A 1K56D 2WUQA 2ZM0A 3AGEA 1IKIA 3MKFA 2FFFB 5FDSA 5GLBA 2Q9NA 1KVMA 3E4QA 4HIAA 4NKPA 5LBRA 2YKFA 4KUOA 4N9LA 4DKIA 2ZM2A 3HLEA 5CECA 5CX7A 2HV1A 5M19A 1K6RA 4GS9A 1NLZA 4PMAA 1XJ6A 5FQ9A 3M2KA 2Q0OA 4JPMA 1ACFA 5CHJA 2QZ6A 5AQBA 3AGDA 4WL9A 3BW6A 2ZC5B 5HWWA 5EVIB 2HP5A 1SZVA 3GQZA 1LLBA 3T12B 2FZ0A 2ZQ8A 5J7EA 1IYSA 3NDGA 2XRNA 3LICA 2V1ZA 2GX5A 3DTMA 4CPKA 3ITBA 2Y8HA 4JKTA 1H5XA 4X53A 1S1YA 4S2IA 1LHYA 2PD8A 5TBMA 1NWZA 3C8CA 2Y2LA 4Y3IA 4BBUA 1JWZA 4MCWA 2JKRM 4KZAA 2RL3A 3NOUC 4WZ5C 2MJ6A 3JPUA 1MKIA 3E98A 5IU1A 1FQGA 3KYZA 1N9BA 2H10A 2ZJ9A 3ZQ5A 3ITAA 4LFUA 5F82A 3S4XA 2YKHA 2WAFA 3G30A 1LSVA 1M40A 2P9VB 4NG2A 2PAVP 3UO9A 4BBTA 3WRTA 1H0MA 4E3OA 2ZMFA 4II7A 5DF8A 1SKOA 2V8CA 5GHXA 3KSHA 1MBLA 4P87A 4WMCD 3T4JA 1GHPA 1IYQA 1NXYA 3BFEA 3PTEA 3D3OA 2WKHA 2HP6A 4GN2A 3UE1A 3ZDJA 3NOTC 3C4PA 4Y17A 4N9KA 3TRCA 5HZHA 3HLDA 5M18A 2QHKA 3ISGA 2WYXA 1S4SA 1P9RA 4JGRA 1SKFA 1YLPA 1SCWA 4GCZA 3NOPC 1PFLA 3LIFA 2Y2GA 3T4OA 3T1XA 4RVAA 5DFXA 4N1XA 4GD6A 3BQAA 3ZNYA 4BBVA 4MMNA 1LSXA 1ZTUA 4BLMA 3BJNA 3LI8A 3IWOA 3A3JA 3CZDA 3UE6A 2Y2PA 2XGNA 4EUVA 1FOFA 4ZTKA 4XT2A 4L9FA 4UQIM 1C3BA 1F5MA 2ZL1A 1P9WA 3UB8A 4CLCC 1RP5A 3OPPA 3Q7VB 2OOLA 4ARZB 2WGVA 3UPOA 2HP9A 3OPHA 2XF3A 3CHWP 2O0YA 5EVIA 1JNUA 2DNSA 4KZ3A 4JGPA 5FI6A 1E25A 3OPLA 3H7WA 3D4FA 3ZG7B 3EEHA 3HUMA 1FR6A 4G3WA 5EV0A 4DJ3A 3E4OA 3OC2A 3LEZA 2FFYA 2ZC4B 4OOLA 2W1TB 1OTEA 1LSWA 1YLTA 1K54A 4NXBA 2WKIA 3QP6A 4DE3A 3VV4A 2BTFP 3R7WB 4WUJA 3IX4A 3A0VA 1K57C 1YLWA 1L2SA 2W27A 3VP0A 4LV0A 1NJ4A 3UB6A 2W0NA 1D1JA 3HUOA 4Y0TA 4IBRA 1PZOA 3IHBA 3BY9A 4R3BA 3HLWA 4EEUA 1SHVA 2XD5A 2ZQ7A 4L0LA 1BLSA 2PU4A 3BYDA 3O88A 2WADA 1YLJA 3PAEA 4GKUA 3OCLA 3MXQA 1L0GA 4JXGA 5CHMA 2OLUA 3UNWA 3PBQA 1W7FA 4JF6A 3ZG8B 4PM5A 1GHIA 4O8GA 3K3DA 4S2MA 4GDBA 4LRXC 4DN0A 4PM6A 4F94A 3PYPA 4ME4A 2QYBA 3EQVA 1BUEA 1FCMA 4UAAA 3IF6C 3EGDC 1PW8A 5FAQA 4OP8A 2XFSA 3HJKA 3HCYA 2R78A 2Y2MA 1VHMA 1XGIA 3VE3A 4GHIB 3SH8A 4K0XA 1XJ4A 1TDLA 2B95A 1E4DA 2DMWA 1FSYA 3MS6A 4U3TA 4WEKA 2J8YA 2Y2QA 1RGYA 4KZ9A 1N9OA 4IEDA 3E4PA 2EFXA 4JXWA 4S2OA 2ZQCA 3BFDA 4ZJ3A 4OQGA 1O7EA 3MZDA 5HD3A 4MEZA 1W63M 4HP9A 4M3KA 4HY8A 1HZOA 1OJGA 2IWBA 2K2NA 3P98A 1XA1A 1PNEA 2AVXA 2ZQDA 4Y0UA 4RX2A 4ESPA 3LYXA 5KZHA 4OOMA 1PWDA 3ZYTA 3UDIA 2VZWA 1G6AA 1N4OA 4MBFA 1HD8A 4CLCE 3LIBA 3LIDA 4UA9A 1IOUA 1DRMA 4WF0A 2XA7M 5FEGA 5DVAA 4X69A 3Q7VA 4KG6A 3K2NA 2H5SA 1MKMA 5FL3A 4LCMA 1YT4A 1XFQA 4X55A 3SOIA 1DP9A 3I7JA 2VV7A 4EBLA 4ETXA 2HJEA 3DTIA 1GA0A 1VQQA 3DWZA 4QD4A 2HDRA 3W8KA 4JF5A 5HDDA 3Q82A 3IX8A 3IXHA 4RX3A 4BL3A 2VGLM 4BWIA 1OT9A 5HD5A 1NRJA 1UWNX 4OQ0A 5EM0A 1K0KA 4ZRRA 4BQMA 2GJ3A 2WAEA 4FSFA 4LV2A 3O3VA 3GDIA 4I3JA 5F1FA 2R9WA 5EECA 5DFYA 1KE4A 4MLLA 2Y2HA 5G4ZA 2HDQA 1FCOA 4P6ZS 4KQDA 3K3CA 4KENB 4I38A 3OZHA 3IWIA 3QHYA 1UGUA 1PW1A 1K38A 3NY4A 4P85A 1PI5A 4ZJ2A 1Y54A 1GSWA 3IWQA 3PR6A 1J9MA 3C5AA 3N6IA 4I3IA 1I2SA 3MJQA 3CPTB 4PM8A 1CQAA 5L10A 3D72A 4DE1A 2JKTI 1WA9A 2D02A 4E3LA 5EOOA 3LR0A 1K55A 1V9YA 1ODVA 1EROA 4S2KA 5DTKA 3H82B 2J9PA 3B42A 3UDXA 2J3TC 3V67A 3KYQA 4GHIA 5EVIC 3O86A 3IS2A 2WGWA 2XH9A 5E2EA 3MFXA 4LCLA 3IX3A 3SS3A 5DF9A 3N8RA 4QU3A 1BSGA 3CLOA 3FPWA 4GDNA 2UWXA 3HLCA 1YSQA 1XA7A 1OTBA 2ZC3B 4KZ6A 4KQOA 4UHUA 4ID4A 4GB7A 4HESA 1Y28A 1YKDA 3O5YA 3WS5A 1VB6A 2WZZA 2XSSA 2V1BA 5CXWA 2Y2JA 1E3UA 1EI5A 3Q81A 4NEED 3ZVTA 1NLYA 3C38A 4Y15A 5HAPA 4CLCD 3IF5A 4R6LA 1YLZA 4HNBA 1OTDA 5CRFA 1L0EA 1L0DA 3IH9A 1N9LA 1MWRA 1PIOA 4RA7A 3BFFA 3ICYA 1JTGA 3GR2A 3WS0A 4Q8IA 4DXBA 3G35A 3LEQA 2G2WA 4F3LA 3LCEA 4Z1WA 1CI8A 5AQ7A 4PAUA 4KZ4A 3IF6A 3IT9A 4MN7A 5A93A 3HLGA 4UQIS 4HOIA 4IVIA 2M7UA 2WKQA 4K0WA 3JVVA 2VA0A 3NC8A 3C4OA 4K91A 2CC1A 5CTNA 4BD0A 4FOFA 1IKGA 2GZAA 1T1CA 1BLCA 4HBTA 4I5SA 5GLDA 3T4QA 4EW7A 5A92A 3HJIA 1CEGA 1BLHA 5E2FA 3F1NB 3M6HA 1Z6FA 3QP2A 3CG5A 4QWOA 5E2GA 3NHQA 1DJBA 3VFHA 3UB5P 3F1PB 4X56A 4WEJA 2EX2A 2W3GA 4Z9QA 2C6WB 5I5LA 1L0FA 2PU2A 5CERA 4E3NA 3BEBA 2OLVA 2VV8A 3IXBA 4BMWA 3ULFA 1LL5A 3Q7ZA 1XX2A 3N4IA 1P0ZA 4LPZA 2O99A 3M2JA 2VKSA 1W5DA 4R4RA 4MDZA 4MBHA 4H6JA 3T1SA 3NI9A 3GVBA 5CGSA 2GNXA 3P01A 3RFBA 2H0TA 1QMEA 2P74A 3V50A 2PBDP 4H8RA 1ERMA 1CK3A 4PM9A 4OPRA 3S7PA 4BL2A 1OJ5A 2WKRA 2H28A 5FQKA 3H82A 3GV9A 2EXBA 3IQAA 5HAQA 2Y91A 5KIZA 4KZ7A 3CITA 4D2OA 1JWVA 4QPRA 2PDRA 4EBPA 4EU0A 2QKPA 3OOVA 3DTKA 1BLPA 3LUQA 1I5QA 3IXDA 3B3XA 5HSQA 3BLMA 4MN6A 3A3IA 4K08A 3A0SA 2HGVA 3G2YA 1KOUA 2EFUA 2WK0A 2W3EA 5EE8A 2EA9A 5EVEA 1M6KA 4E6WA 4OLGA 4DDYA 2VGJA 4KZBA 4R70A 4R38A 2ZMAA 2JKRI 4DE2A 4IUKA 3IHAA 4NXFA 3ZGAB 3A0RA 2W3HA 1XJ2A 1S0WA 2I72A 1QMFA 4KG5A 5AQ9A 3HVFA 4E3JA 1JVJA 2K7SA 4FCFA 1PRQA 5GLAA 1MWTA 4OPQA 4UEYA 2ZOHA 5CGWA 2XA7S 4L9EA 2X01A 5FAPA 1XFNA 2XK1A 3B47A 1K55C 4ZDXA 2Y2NA 3FC7A 2WKPA 3A3EA 3VOYA 1GHMA 4EBNA 2W3DA 4WN5A 1RCJA 3F1OB 2V9AA 3C2WA 1PWCA 1S4RA 3LY4A 2P08A 2L4RA 3GRJA 2ACGA 4S2LA 4DMZA 2I9VA 3N7WA 4DRTA 2VGLS 3NBLA 3SW1A 5TR7A 5K5BA 4Y2FA 4NETA 5L07A 4NK3A 4ZBEA 4LLOB 4E3IA 4KZ8A 4EETB 2J9OA 3BFGA 3MFDA 5FQJA 1IFQA 3LR3A 5M1AA 2XEPA 3L9KA 2HJ9C 4EQ1A 4JGOA 3MKEA 1F9IA 1TS7A 2LB9A 2O9BA 3BM6A 4Y0OA 4R4SA 1YSPA 2Y4AA 2J3TD 2G2UA 3IBRA 2P7JA 2P9VA 2PYPA 3A3FA 3O87A 2EXAA 5EVID 5GHYA 1S67L 3E2LA 3LO7A 3PBTA 1W63Q 1K4EA 4WM9A 5I94A 4D60A 5F68A 5HWVA 1X0OA 1D7EA 2OWHA 2M7VA 1T19A 2A49A 1G28A 3LIEA 3MMHA 4X1MA 3MQ0A 2XROA 3R4KA 1PZPA 4CLCB 4EV4A 1NYYA 3CI6A 4C3QA 1EW0A 5A91A 1SDNA 3ZG9B 2A24B 3OCNA 2V20A 1YMXA 4O01A 4IHQA 1IELA 1FSWA 1G5UA 2XR0A 2BG1A 1IYOA 1YAXA 4B93A 5DTTA 4B4XA 5EM1A 4FH2A 3NJAA 3MXRA 4OVDA 1RGZA 1HVBA 5AVEA 1H3QA 4HH2A 5BOHA 1IEMA 1MZUA 3G32A 2KDKA 2ZLYA 1MPLA 1BZAA 5TJJA
chains in the Genus database with same CATH topology
4GNUA 4KQQA 1N9BA 1K6SA 2WGWA 2XH9A 2H10A 2ZJ9A 5E2EA 4LCLA 1OMEA 3SS3A 4A5RA 1VM1A 5DF9A 5EOEA 3N8RA 4QU3A 1BSGA 4GDNA 1H8ZA 2UWXA 3SH9A 2WGIA 3HLCA 5GLCA 3ITAA 5F82A 3S4XA 1XA7A 3G31A 2ZC3B 4WELA 1Q2PA 3MBZA 3PBNA 2WAFA 4KZ6A 5FDHA 5D3OA 3G30A 3OPRA 2OSUA 4KQOA 1LI9A 4UHUA 3NCKA 2JC7A 1NRFA 4ID4A 3BRMA 1M40A 2P9VB 4GB7A 4HESA 3UO9A 3WS4A 5EVLA 3WRTA 3WS5A 4E3OA 4ZAMA 5DF8A 5FQQA 3ZNTA 3BLSA 3VP2A 2WZZA 1IYPA 3GSGA 2J7VA 5CXWA 5GHXA 4EUZA 4ZJ1A 2Y2OA 1MY8A 1MBLA 2HPBA 2Y2JA 3QNBA 4P87A 5DTSA 5J8XA 2QPNA 3A3DA 3DWKA 4WMCD 4O7DA 1E3UA 1EI5A 3Q81A 4U0TA 3IXGA 3ZVTA 1GHPA 1MWUA 1IYQA 1NXYA 3BFEA 1XGJA 5HAPA 3NIAA 3PTEA 1ALQA 3IF5A 2WKHA 1YLZA 4S2PA 1ONGA 2HP6A 4QJGA 5CRFA 4GN2A 1L0EA 1L0DA 2XDMA 3JYIA 1WYCA 3UE1A 3IH9A 2Y59A 1BTLA 1MWRA 1PIOA 1ONHA 3W4PA 1TDGA 2ZC7A 4RA7A 3ZDJA 3BFFA 1JTGA 4OQIA 3GR2A 3UY6A 3WS0A 3C4PA 4Q8IA 1YQSA 4DF6A 4DXBA 4DE0A 3VMAA 3G35A 2EX6A 1LL9A 2G2WA 4GZBA 1KVLA 4N9KA 4QY5A 3LCEA 1MXOA 1CI8A 5AQ7A 3VSLA 2X71A 3CJMA 2X02A 4KZ4A 3IF6A 3HLDA 3IT9A 5M18A 5E2HA 2A3UA 3HLGA 3ISGA 1CEFA 4KG2A 3WS2A 5A93A 2WYXA 3BECA 4WZ4A 3V3SA 4IVIA 4R1GA 1KGEA 4K0WA 2EX8A 3NC8A 3C4OA 4K91A 5GHZA 2CC1A 1SKFA 1W79A 1YLPA 1SCWA 3G2ZA 4P0MA 5CTNA 4R23A 4BD0A 4E3KA 3DW0A 3WWXA 1IKGA 3C7VA 4HBTA 1BLCA 5GLDA 4FH4A 2Y2GA 4IBXA 4XUXA 5A92A 1CEGA 2JE5A 1BLHA 4RVAA 4X68A 5E2FA 1XKZA 5FQIA 4DDSA 4N1XA 4GD6A 3M6HA 3S22A 3ZNYA 1Z6FA 1ES2A 3UE0A 3CG5A 3HLBA 4BLMA 3P09A 4MNRA 5E2GA 1JWPA 1HTZA 1DJBA 3IWOA 5HFOA 3N8LA 4S2NC 3S1YA 3A3JA 3CZDA 3N8SA 5FATA 3VFHA 3HUNA 4JXSA 3FWLA 2Y2PA 4X56A 2XGNA 4C75A 4WEJA 2EX2A 2WGWB 4Z9QA 2C6WB 1FOFA 3RJUA 4ZTKA 4BJPA 1L0FA 1YM1A 2PU2A 2EX9A 1TEMA 2WKEA 5HX9A 5KSCA 4KZ5A 4P6BA 2B5RA 5CERA 4E3NA 4RYEA 1TVFA 4OH0A 1C3BA 4XXRA 4UA7A 2OV5A 1K56A 1RP5A 1W8QA 2VGKA 3BEBA 2OLVA 3HREA 3IXBA 3PBRA 3EQUA 3IH8A 3OPPA 1LL5A 4WZ5A 3Q7VB 2Z2LB 3Q7ZA 1XX2A 4QHCA 3N4IA 2WGVA 3MXSA 4WYYA 3UPOA 3UPNA 2HP9A 1FR1A 1DY6A 3TOIA 3OPHA 2XF3A 3M2JA 5DF7A 1PI4A 2Y55A 5EVIA 5CGXA 4N92A 3UN7A 5G18A 2DNSA 1DJAA 4PPRA 4LV3A 4KZ3A 1W5DA 4R4RA 4MBHA 1YLYA 3G34A 4OQHA 5FI6A 5TGFA 1E25A 3NI9A 3GVBA 3OPLA 5CGSA 3ZG7B 3D4FA 1CI9A 2HDSA 3HUMA 5AQAA 2H0TA 1QMEA 2P74A 3G4PA 3V50A 4HBUA 4X6TA 4JF4A 1FR6A 4H8RA 2BLSA 1ERMA 1CK3A 1WYBA 3OC2A 4PM9A 3LEZA 4OPRA 4BL2A 4DXCA 2RCXA 3W4OA 2FFYA 2JCHA 2ZC4B 4OOLA 1K4FA 1YLTA 1K54A 4B88A 2GDNA 3W4QA 3FKVA 1WE4A 2WKIA 2IWCA 5FQKA 4DE3A 4OPZA 5KSHA 3GV9A 2EXBA 2XLNA 5FA7A 3IQAA 5HAQA 1K57C 1YLWA 1L2SA 2XD1A 4HEFA 3VP0A 1FCNA 1PYYA 2Y91A 4LV0A 4GD8A 4KZ7A 4R3JA 4YFMA 5EPHA 1NJ4A 2XFTA 3VSKA 4D2OA 1W8YA 1JWVA 3HUOA 4Y0TA 3IF6B 1I2WA 4EBPA 1K25A 5EUAA 4IBRA 1PZOA 3IHBA 5CHUA 4R0QA 4R3BA 5GL9A 1PWGA 1G68A 3HLWA 1BLPA 1U60A 1SHVA 4N1HA 4GOGA 1KDSA 1I5QA 3IXDA 2XD5A 2Y2IA 2ZQ7A 3B3XA 5HAIA 3BLMA 3TG9A 1BLSA 2PU4A 3A3IA 3BYDA 3O88A 4L0LA 5KMWA 2WADA 3SS4A 1YLJA 3PAEA 1ESIA 4GKUA 3OCLA 2WZXA 2ZQ9A 3G2YA 1L0GA 2EFUA 4JXGA 5CHMA 2WK0A 2OLUA 3UNWA 1GA9A 3Q07A 5EE8A 3PBQA 2XQZA 4LENA 3CMZA 1W7FA 5FI7A 5HW3A 1ESUA 4JF6A 3ZG8B 4PM5A 1GHIA 2IWDA 1M6KA 1NZOA 4S2MA 4GDBA 3VOZA 4C6YA 4E6WA 4PM6A 3MZFA 5FAOA 4F94A 3FYZA 4OLGA 2DCFA 4DDYA 3EQVA 5CEBA 3BFCA 1BUEA 1FCMA 5HARA 5JYPA 4OLDA 4UAAA 3SS5A 2VGJA 3IF6C 4WBGA 4KZBA 2ZMAA 4DE2A 1JTDA 1PW8A 2R9XA 5FAQA 4OP8A 4CJNA 2XFSA 4IVKA 4PM7A 3IHAA 3ZCZA 5L2FA 1SDEA 1ZKJA 4UA6A 2Y2MA 1XGIA 3ZGAB 1KGFA 3AGFA 1MWSA 1KE3A 1S0WA 1ES3A 3PBOA 2I72A 5E43A 3SH8A 1QMFA 4KG5A 4K0XA 3ZVWA 5AQ9A 3HVFA 4JLFA 1E3UD 4E3JA 4S2NA 1JVJA 3FKWA 1TDLA 1S6RA 1EWZA 4FCFA 1E4DA 5GLAA 1FSYA 3TSGA 1MWTA 4U3TA 4WEKA 4E6XA 4OPQA 4U0XA 3Q1FA 2J8YA 2Y2QA 4WMCA 1RGYA 4YINA 5CGWA 3RXXA 4KZ9A 4IEDA 3E2KA 2EFXA 4JXWA 4S2OA 4OOYA 5FAPA 2X01A 1ES5A 2ZQCA 3BFDA 4ZJ3A 1ZC2A 1O7EA 2XK1A 3MZDA 4OQGA 5IHVA 1K55C 4E3MA 4ZDXA 2Y2NA 3VFFA 4MEZA 3ZFZA 4BENA 3A3EA 4M3KA 3VOYA 5A90A 4LV1A 1HZOA 4OONA 2IWBA 1GHMA 3P98A 4EBNA 1XA1A 4JXVA 1ZG4A 3RXWA 2ZQDA 4Y0UA 1KGGA 1RCJA 4RX2A 5KZHA 3SH7A 4OOMA 4OP5A 3WS1A 1PWDA 3VP3A 1PWCA 3UDIA 3LY4A 3M6BA 1ZG6A 1G6AA 3WRZA 3MZEA 3GRJA 1ES4A 3QNCA 5TFQA 1DJCA 3FZCA 5FASA 1GCEA 1N4OA 4EWFA 4S2LA 4MBFA 1HD8A 2H0YA 3C7UA 2V2FF 3N7WA 4DRTA 4OKPA 3NBLA 1LI0A 4OPYA 3UPPA 4MBKA 5TR7A 4UA9A 3ZG0A 1KE0A 4NETA 1XXMA 3ZG5A 4NK3A 4ZBEA 5FQMA 5DVAA 4X69A 3Q7VA 4E3IA 3ZHHA 4KZ8A 4KG6A 5F1GA 1K57A 2H5SA 3V39A 2J9OA 3HLFA 4LCMA 1BT5A 1YT4A 1NZUA 1K54C 3BFGA 4FD8A 3MFDA 2JBFA 5FQJA 5FSRA 4X55A 4BD1A 5CTMA 3UDFA 3V5MA 5M1AA 3SOIA 2Q9MA 2Y2KA 2XEPA 3I7JA 4S2JA 1NYMA 4EBLA 4KQRA 1GA0A 1VQQA 3DWZA 4QD4A 1AXBA 1K56D 2HDRA 2WUQA 1XP4A 3W8KA 5JYOA 1ERQA 2ZM0A 3MKEA 4JF5A 3AGEA 3BM6A 1IKIA 4Y0OA 3MKFA 4R4SA 2Y4AA 3Q82A 2G2UA 3IXHA 2FFFB 4RX3A 4BL3A 5GLBA 2Q9NA 2P9VA 1KVMA 4QB8A 3A3FA 3O87A 2EXAA 3HL9A 5EVID 5GHYA 3E2LA 4OQ0A 3PAGA 4BQMA 3LO7A 3PBTA 1K4EA 4WM9A 5I94A 2WAEA 4FSFA 4LV2A 4N9LA 4DKIA 3O3VA 2C5WB 1XPBA 2DRWA 5F1FA 2ZM2A 3V3RA 2R9WA 3HLEA 5EECA 5CECA 3UE3A 1KDWA 1K6RA 5M19A 1KE4A 4MLLA 2Y2HA 5HL1A 2HDQA 4PMAA 2QMIA 4JBFA 3VP1A 1FCOA 2A49A 4XUZA 5FQ9A 2ZC6B 1PZPA 4KENB 4EV4A 3M2KA 1NYYA 4JPMA 5CHJA 2ZQAA 2QZ6A 3OZHA 3IWIA 5FI2A 5AQBA 4C3QA 3AGDA 1BULA 3QHYA 3GTCA 5A91A 2ZC5B 1SDNA 1PW1A 1YMSA 1K38A 5EVIB 2HP5A 3NY4A 3GQZA 3ZG9B 5CEDA 2ZM8A 1LLBA 4P85A 3OCNA 1PI5A 4ZJ2A 2V20A 2ZQ8A 1Y54A 1YMXA 2E8IA 1IYSA 1H8YA 3NDGA 3IWQA 3GMWA 1J9MA 3C5AA 1IELA 3N6IA 2V1ZA 2ZD8A 1FSWA 3HBRA 4EQIA 1NY0A 1I2SA 2HDUA 3DTMA 2XR0A 4CPKA 2BG1A 4PM8A 3ITBA 1IYOA 4JKTA 1H5XA 4DE1A 4X53A 4S2IA 1LHYA 4B4ZA 5DTTA 3NDEA 3FV7A 4E3LA 2Z2MB 5F83A 5EOOA 4B4XA 1O07A 1K55A 2Y2LA 4FH2A 1JWZA 3MXRA 1EROA 4OVDA 4S2KA 5DTKA 1RGZA 4KZAA 1HVBA 1Q2QA 2RL3A 4QY6A 5U47A 2PBYA 2J9PA 4WZ5C 3UDXA 3PBSA 4Y7PA 5BOHA 3VP4A 1MKIA 1IEMA 1FQGA 3G32A 2ZLYA 1MPLA 1BZAA 3LY3A 5EVIC 3O86A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GNU A;  4KQQ A;  1N9B A;  1K6S A;  2WGW A;  2XH9 A;  2H10 A;  2ZJ9 A;  5E2E A;  4LCL A;  1OME A;  3SS3 A;  4A5R A;  1VM1 A;  5DF9 A;  5EOE A;  3N8R A;  4QU3 A;  1BSG A;  4GDN A;  1H8Z A;  2UWX A;  3SH9 A;  2WGI A;  3HLC A;  5GLC A;  3ITA A;  5F82 A;  3S4X A;  1XA7 A;  3G31 A;  2ZC3 B;  4WEL A;  1Q2P A;  3MBZ A;  3PBN A;  2WAF A;  4KZ6 A;  5FDH A;  5D3O A;  3G30 A;  3OPR A;  2OSU A;  4KQO A;  1LI9 A;  4UHU A;  3NCK A;  2JC7 A;  1NRF A;  4ID4 A;  3BRM A;  1M40 A;  2P9V B;  4GB7 A;  4HES A;  3UO9 A;  3WS4 A;  5EVL A;  3WRT A;  3WS5 A;  4E3O A;  4ZAM A;  5DF8 A;  5FQQ A;  3ZNT A;  3BLS A;  3VP2 A;  2WZZ A;  1IYP A;  3GSG A;  2J7V A;  5CXW A;  5GHX A;  4EUZ A;  4ZJ1 A;  2Y2O A;  1MY8 A;  1MBL A;  2HPB A;  2Y2J A;  3QNB A;  4P87 A;  5DTS A;  5J8X A;  2QPN A;  3A3D A;  3DWK A;  4WMC D;  4O7D A;  1E3U A;  1EI5 A;  3Q81 A;  4U0T A;  3IXG A;  3ZVT A;  1GHP A;  1MWU A;  1IYQ A;  1NXY A;  3BFE A;  1XGJ A;  5HAP A;  3NIA A;  3PTE A;  1ALQ A;  3IF5 A;  2WKH A;  1YLZ A;  4S2P A;  1ONG A;  2HP6 A;  4QJG A;  5CRF A;  4GN2 A;  1L0E A;  1L0D A;  2XDM A;  3JYI A;  1WYC A;  3UE1 A;  3IH9 A;  2Y59 A;  1BTL A;  1MWR A;  1PIO A;  1ONH A;  3W4P A;  1TDG A;  2ZC7 A;  4RA7 A;  3ZDJ A;  3BFF A;  1JTG A;  4OQI A;  3GR2 A;  3UY6 A;  3WS0 A;  3C4P A;  4Q8I A;  1YQS A;  4DF6 A;  4DXB A;  4DE0 A;  3VMA A;  3G35 A;  2EX6 A;  1LL9 A;  2G2W A;  4GZB A;  1KVL A;  4N9K A;  4QY5 A;  3LCE A;  1MXO A;  1CI8 A;  5AQ7 A;  3VSL A;  2X71 A;  3CJM A;  2X02 A;  4KZ4 A;  3IF6 A;  3HLD A;  3IT9 A;  5M18 A;  5E2H A;  2A3U A;  3HLG A;  3ISG A;  1CEF A;  4KG2 A;  3WS2 A;  5A93 A;  2WYX A;  3BEC A;  4WZ4 A;  3V3S A;  4IVI A;  4R1G A;  1KGE A;  4K0W A;  2EX8 A;  3NC8 A;  3C4O A;  4K91 A;  5GHZ A;  2CC1 A;  1SKF A;  1W79 A;  1YLP A;  1SCW A;  3G2Z A;  4P0M A;  5CTN A;  4R23 A;  4BD0 A;  4E3K A;  3DW0 A;  3WWX A;  1IKG A;  3C7V A;  4HBT A;  1BLC A;  5GLD A;  4FH4 A;  2Y2G A;  4IBX A;  4XUX A;  5A92 A;  1CEG A;  2JE5 A;  1BLH A;  4RVA A;  4X68 A;  5E2F A;  1XKZ A;  5FQI A;  4DDS A;  4N1X A;  4GD6 A;  3M6H A;  3S22 A;  3ZNY A;  1Z6F A;  1ES2 A;  3UE0 A;  3CG5 A;  3HLB A;  4BLM A;  3P09 A;  4MNR A;  5E2G A;  1JWP A;  1HTZ A;  1DJB A;  3IWO A;  5HFO A;  3N8L A;  4S2N C;  3S1Y A;  3A3J A;  3CZD A;  3N8S A;  5FAT A;  3VFH A;  3HUN A;  4JXS A;  3FWL A;  2Y2P A;  4X56 A;  2XGN A;  4C75 A;  4WEJ A;  2EX2 A;  2WGW B;  4Z9Q A;  2C6W B;  1FOF A;  3RJU A;  4ZTK A;  4BJP A;  1L0F A;  1YM1 A;  2PU2 A;  2EX9 A;  1TEM A;  2WKE A;  5HX9 A;  5KSC A;  4KZ5 A;  4P6B A;  2B5R A;  5CER A;  4E3N A;  4RYE A;  1TVF A;  4OH0 A;  1C3B A;  4XXR A;  4UA7 A;  2OV5 A;  1K56 A;  1RP5 A;  1W8Q A;  2VGK A;  3BEB A;  2OLV A;  3HRE A;  3IXB A;  3PBR A;  3EQU A;  3IH8 A;  3OPP A;  1LL5 A;  4WZ5 A;  3Q7V B;  2Z2L B;  3Q7Z A;  1XX2 A;  4QHC A;  3N4I A;  2WGV A;  3MXS A;  4WYY A;  3UPO A;  3UPN A;  2HP9 A;  1FR1 A;  1DY6 A;  3TOI A;  3OPH A;  2XF3 A;  3M2J A;  5DF7 A;  1PI4 A;  2Y55 A;  5EVI A;  5CGX A;  4N92 A;  3UN7 A;  5G18 A;  2DNS A;  1DJA A;  4PPR A;  4LV3 A;  4KZ3 A;  1W5D A;  4R4R A;  4MBH A;  1YLY A;  3G34 A;  4OQH A;  5FI6 A;  5TGF A;  1E25 A;  3NI9 A;  3GVB A;  3OPL A;  5CGS A;  3ZG7 B;  3D4F A;  1CI9 A;  2HDS A;  3HUM A;  5AQA A;  2H0T A;  1QME A;  2P74 A;  3G4P A;  3V50 A;  4HBU A;  4X6T A;  4JF4 A;  1FR6 A;  4H8R A;  2BLS A;  1ERM A;  1CK3 A;  1WYB A;  3OC2 A;  4PM9 A;  3LEZ A;  4OPR A;  4BL2 A;  4DXC A;  2RCX A;  3W4O A;  2FFY A;  2JCH A;  2ZC4 B;  4OOL A;  1K4F A;  1YLT A;  1K54 A;  4B88 A;  2GDN A;  3W4Q A;  3FKV A;  1WE4 A;  2WKI A;  2IWC A;  5FQK A;  4DE3 A;  4OPZ A;  5KSH A;  3GV9 A;  2EXB A;  2XLN A;  5FA7 A;  3IQA A;  5HAQ A;  1K57 C;  1YLW A;  1L2S A;  2XD1 A;  4HEF A;  3VP0 A;  1FCN A;  1PYY A;  2Y91 A;  4LV0 A;  4GD8 A;  4KZ7 A;  4R3J A;  4YFM A;  5EPH A;  1NJ4 A;  2XFT A;  3VSK A;  4D2O A;  1W8Y A;  1JWV A;  3HUO A;  4Y0T A;  3IF6 B;  1I2W A;  4EBP A;  1K25 A;  5EUA A;  4IBR A;  1PZO A;  3IHB A;  5CHU A;  4R0Q A;  4R3B A;  5GL9 A;  1PWG A;  1G68 A;  3HLW A;  1BLP A;  1U60 A;  1SHV A;  4N1H A;  4GOG A;  1KDS A;  1I5Q A;  3IXD A;  2XD5 A;  2Y2I A;  2ZQ7 A;  3B3X A;  5HAI A;  3BLM A;  3TG9 A;  1BLS A;  2PU4 A;  3A3I A;  3BYD A;  3O88 A;  4L0L A;  5KMW A;  2WAD A;  3SS4 A;  1YLJ A;  3PAE A;  1ESI A;  4GKU A;  3OCL A;  2WZX A;  2ZQ9 A;  3G2Y A;  1L0G A;  2EFU A;  4JXG A;  5CHM A;  2WK0 A;  2OLU A;  3UNW A;  1GA9 A;  3Q07 A;  5EE8 A;  3PBQ A;  2XQZ A;  4LEN A;  3CMZ A;  1W7F A;  5FI7 A;  5HW3 A;  1ESU A;  4JF6 A;  3ZG8 B;  4PM5 A;  1GHI A;  2IWD A;  1M6K A;  1NZO A;  4S2M A;  4GDB A;  3VOZ A;  4C6Y A;  4E6W A;  4PM6 A;  3MZF A;  5FAO A;  4F94 A;  3FYZ A;  4OLG A;  2DCF A;  4DDY A;  3EQV A;  5CEB A;  3BFC A;  1BUE A;  1FCM A;  5HAR A;  5JYP A;  4OLD A;  4UAA A;  3SS5 A;  2VGJ A;  3IF6 C;  4WBG A;  4KZB A;  2ZMA A;  4DE2 A;  1JTD A;  1PW8 A;  2R9X A;  5FAQ A;  4OP8 A;  4CJN A;  2XFS A;  4IVK A;  4PM7 A;  3IHA A;  3ZCZ A;  5L2F A;  1SDE A;  1ZKJ A;  4UA6 A;  2Y2M A;  1XGI A;  3ZGA B;  1KGF A;  3AGF A;  1MWS A;  1KE3 A;  1S0W A;  1ES3 A;  3PBO A;  2I72 A;  5E43 A;  3SH8 A;  1QMF A;  4KG5 A;  4K0X A;  3ZVW A;  5AQ9 A;  3HVF A;  4JLF A;  1E3U D;  4E3J A;  4S2N A;  1JVJ A;  3FKW A;  1TDL A;  1S6R A;  1EWZ A;  4FCF A;  1E4D A;  5GLA A;  1FSY A;  3TSG A;  1MWT A;  4U3T A;  4WEK A;  4E6X A;  4OPQ A;  4U0X A;  3Q1F A;  2J8Y A;  2Y2Q A;  4WMC A;  1RGY A;  4YIN A;  5CGW A;  3RXX A;  4KZ9 A;  4IED A;  3E2K A;  2EFX A;  4JXW A;  4S2O A;  4OOY A;  5FAP A;  2X01 A;  1ES5 A;  2ZQC A;  3BFD A;  4ZJ3 A;  1ZC2 A;  1O7E A;  2XK1 A;  3MZD A;  4OQG A;  5IHV A;  1K55 C;  4E3M A;  4ZDX A;  2Y2N A;  3VFF A;  4MEZ A;  3ZFZ A;  4BEN A;  3A3E A;  4M3K A;  3VOY A;  5A90 A;  4LV1 A;  1HZO A;  4OON A;  2IWB A;  1GHM A;  3P98 A;  4EBN A;  1XA1 A;  4JXV A;  1ZG4 A;  3RXW A;  2ZQD A;  4Y0U A;  1KGG A;  1RCJ A;  4RX2 A;  5KZH A;  3SH7 A;  4OOM A;  4OP5 A;  3WS1 A;  1PWD A;  3VP3 A;  1PWC A;  3UDI A;  3LY4 A;  3M6B A;  1ZG6 A;  1G6A A;  3WRZ A;  3MZE A;  3GRJ A;  1ES4 A;  3QNC A;  5TFQ A;  1DJC A;  3FZC A;  5FAS A;  1GCE A;  1N4O A;  4EWF A;  4S2L A;  4MBF A;  1HD8 A;  2H0Y A;  3C7U A;  2V2F F;  3N7W A;  4DRT A;  4OKP A;  3NBL A;  1LI0 A;  4OPY A;  3UPP A;  4MBK A;  5TR7 A;  4UA9 A;  3ZG0 A;  1KE0 A;  4NET A;  1XXM A;  3ZG5 A;  4NK3 A;  4ZBE A;  5FQM A;  5DVA A;  4X69 A;  3Q7V A;  4E3I A;  3ZHH A;  4KZ8 A;  4KG6 A;  5F1G A;  1K57 A;  2H5S A;  3V39 A;  2J9O A;  3HLF A;  4LCM A;  1BT5 A;  1YT4 A;  1NZU A;  1K54 C;  3BFG A;  4FD8 A;  3MFD A;  2JBF A;  5FQJ A;  5FSR A;  4X55 A;  4BD1 A;  5CTM A;  3UDF A;  3V5M A;  5M1A A;  3SOI A;  2Q9M A;  2Y2K A;  2XEP A;  3I7J A;  4S2J A;  1NYM A;  4EBL A;  4KQR A;  1GA0 A;  1VQQ A;  3DWZ A;  4QD4 A;  1AXB A;  1K56 D;  2HDR A;  2WUQ A;  1XP4 A;  3W8K A;  5JYO A;  1ERQ A;  2ZM0 A;  3MKE A;  4JF5 A;  3AGE A;  3BM6 A;  1IKI A;  4Y0O A;  3MKF A;  4R4S A;  2Y4A A;  3Q82 A;  2G2U A;  3IXH A;  2FFF B;  4RX3 A;  4BL3 A;  5GLB A;  2Q9N A;  2P9V A;  1KVM A;  4QB8 A;  3A3F A;  3O87 A;  2EXA A;  3HL9 A;  5EVI D;  5GHY A;  3E2L A;  4OQ0 A;  3PAG A;  4BQM A;  3LO7 A;  3PBT A;  1K4E A;  4WM9 A;  5I94 A;  2WAE A;  4FSF A;  4LV2 A;  4N9L A;  4DKI A;  3O3V A;  2C5W B;  1XPB A;  2DRW A;  5F1F A;  2ZM2 A;  3V3R A;  2R9W A;  3HLE A;  5EEC A;  5CEC A;  3UE3 A;  1KDW A;  1K6R A;  5M19 A;  1KE4 A;  4MLL A;  2Y2H A;  5HL1 A;  2HDQ A;  4PMA A;  2QMI A;  4JBF A;  3VP1 A;  1FCO A;  2A49 A;  4XUZ A;  5FQ9 A;  2ZC6 B;  1PZP A;  4KEN B;  4EV4 A;  3M2K A;  1NYY A;  4JPM A;  5CHJ A;  2ZQA A;  2QZ6 A;  3OZH A;  3IWI A;  5FI2 A;  5AQB A;  4C3Q A;  3AGD A;  1BUL A;  3QHY A;  3GTC A;  5A91 A;  2ZC5 B;  1SDN A;  1PW1 A;  1YMS A;  1K38 A;  5EVI B;  2HP5 A;  3NY4 A;  3GQZ A;  3ZG9 B;  5CED A;  2ZM8 A;  1LLB A;  4P85 A;  3OCN A;  1PI5 A;  4ZJ2 A;  2V20 A;  2ZQ8 A;  1Y54 A;  1YMX A;  2E8I A;  1IYS A;  1H8Y A;  3NDG A;  3IWQ A;  3GMW A;  1J9M A;  3C5A A;  1IEL A;  3N6I A;  2V1Z A;  2ZD8 A;  1FSW A;  3HBR A;  4EQI A;  1NY0 A;  1I2S A;  2HDU A;  3DTM A;  2XR0 A;  4CPK A;  2BG1 A;  4PM8 A;  3ITB A;  1IYO A;  4JKT A;  1H5X A;  4DE1 A;  4X53 A;  4S2I A;  1LHY A;  4B4Z A;  5DTT A;  3NDE A;  3FV7 A;  4E3L A;  2Z2M B;  5F83 A;  5EOO A;  4B4X A;  1O07 A;  1K55 A;  2Y2L A;  4FH2 A;  1JWZ A;  3MXR A;  1ERO A;  4OVD A;  4S2K A;  5DTK A;  1RGZ A;  4KZA A;  1HVB A;  1Q2Q A;  2RL3 A;  4QY6 A;  5U47 A;  2PBY A;  2J9P A;  4WZ5 C;  3UDX A;  3PBS A;  4Y7P A;  5BOH A;  3VP4 A;  1MKI A;  1IEM A;  1FQG A;  3G32 A;  2ZLY A;  1MPL A;  1BZA A;  3LY3 A;  5EVI C;  3O86 A; 
#chains in the Genus database with same CATH topology
 4KQQ A;  1OME A;  1VM1 A;  3LI9 A;  2JHE A;  3T50 A;  1F98 A;  5EOE A;  1H8Z A;  2WGI A;  5GLC A;  3TE8 A;  1T1B A;  2L0W A;  1Q2P A;  3MBZ A;  3PBN A;  2A2L A;  3OPR A;  2OSU A;  1LI9 A;  1S1Z A;  4ARZ A;  3NCK A;  3JVU A;  2JC7 A;  3WS4 A;  5EVL A;  3P7N A;  4ZAM A;  5FQQ A;  2J3W A;  3GSG A;  4EUZ A;  4O0P A;  4ZJ1 A;  2Y2O A;  3KSI A;  3QNB A;  3CAX A;  3DWK A;  3A3D A;  4O7D A;  4U0T A;  2ZOI A;  1MWU A;  1XGJ A;  4RQ9 A;  1ALQ A;  2NUP C;  4Q0J A;  4S2P A;  1AWI A;  2W1T A;  1WYC A;  2HF6 A;  2Y59 A;  1BTL A;  1TDG A;  3R7W A;  4X1L A;  3LFV A;  3MR0 A;  4DE0 A;  3VMA A;  2EX6 A;  1LL9 A;  4FUW A;  2J80 A;  1MXO A;  2X71 A;  2X02 A;  3KYE A;  5E2H A;  2A3U A;  1CEF A;  5AVF A;  3WS2 A;  3BEC A;  4WZ4 A;  3FG8 A;  4R1G A;  3OLO A;  4EEP A;  2VLG A;  2EX8 A;  3G2Z A;  4P0M A;  4M4X A;  3WWX A;  3C7V A;  5J3W A;  4Y13 A;  4XUX A;  2JE5 A;  4X68 A;  3LR5 A;  3S7N A;  3S22 A;  3VOL A;  1ES2 A;  3HLB A;  5C5K A;  3LGO A;  2KOI A;  5HFO A;  3N8L A;  2OWJ A;  3KSG A;  3HUN A;  5A8B A;  4HJ3 A;  3S7Q A;  3OBF A;  3RJU A;  4BJP A;  2B02 A;  3D9Y A;  2EX9 A;  5KSC A;  3UMD A;  2O9A A;  4P6B A;  2B5R A;  4RYE A;  1TVF A;  4IJG A;  4UA7 A;  2OV5 A;  2NUT C;  1K56 A;  4EES A;  3EQU A;  3IH8 A;  2Y79 A;  3B33 A;  4QHC A;  3MXS A;  4WYY A;  1OTI A;  3UPN A;  2PD7 A;  1FR1 A;  5L09 A;  1PI4 A;  2Y55 A;  4N92 A;  5HPI A;  4PPR A;  4X25 A;  1SKO B;  1YLY A;  3G34 A;  1CI9 A;  3G4P A;  2BLS A;  1WYB A;  2RCX A;  3W4O A;  5DJT A;  4G3V A;  1F2K A;  4B88 A;  1WE4 A;  2IWC A;  2EWV A;  2PR6 A;  5FA7 A;  2XD1 A;  1PYY A;  4R3J A;  3VSK A;  1OT6 A;  2XFT A;  1W8Y A;  1I2W A;  1K25 A;  2Z6D A;  5CHU A;  3RH8 B;  4R0Q A;  4HHD A;  1UWP X;  1U60 A;  5EFW A;  1KDS A;  3G6O A;  2Y2I A;  5HAI A;  3EEA A;  3SS4 A;  1ESI A;  1TS8 A;  3LIA A;  2VV6 A;  2WZX A;  1GA9 A;  3Q07 A;  3CMZ A;  4GLQ A;  5HW3 A;  1A0K A;  1ESU A;  4WLA A;  3DAV A;  2IWD A;  1NZO A;  2HZ5 A;  4C6Y A;  3MZF A;  5FAO A;  3FYZ A;  2DCF A;  3MSH A;  3BFC A;  5HAR A;  4OLD A;  3SS5 A;  4WBG A;  1Z09 A;  2D01 A;  4XT2 B;  2JN7 A;  3PHY A;  4CJN A;  3QP8 A;  3DTE A;  1ZKJ A;  4UA6 A;  2ZL1 B;  5IT5 A;  2LB5 A;  3H9W A;  1KGF A;  3AGF A;  1MWS A;  4L9G A;  4ETZ A;  2BAS A;  2ZBB A;  3ZVW A;  2OAQ 1;  2VX8 A;  1E3U D;  4S2N A;  1S6R A;  4Q0I A;  3DBA A;  1MC0 A;  1BYW A;  4U0X A;  3SZT A;  3Q1F A;  5F6A A;  4WMC A;  3LR4 A;  4YIN A;  3RXX A;  3H7W B;  1LT0 A;  3E2K A;  4LGW A;  3EGX C;  1TF1 A;  4OOY A;  2JKF A;  3CUE C;  1ES5 A;  1ZC2 A;  4E3M A;  4JXV A;  1ZG4 A;  2Z6C A;  2W3F A;  1N9N A;  3SH7 A;  4OP5 A;  2KX6 A;  4P6Z M;  3VP3 A;  1ZG6 A;  3CPT A;  2V0U A;  1ES4 A;  1DJC A;  3FZC A;  4YOF A;  4OKP A;  1LI0 A;  4OPY A;  3VE4 A;  1KE0 A;  3ZG0 A;  2VEA A;  1XXM A;  5FQM A;  5F1G A;  1YPR A;  4DJ2 A;  1Y4O A;  2P04 A;  4EER A;  4GJ4 A;  1NZU A;  4FD8 A;  4LRZ E;  3UDF A;  3V5M A;  2JKG A;  2Q9M A;  2Y2K A;  4S2J A;  1NYM A;  1L3L A;  1AXB A;  5JYO A;  1T18 A;  1XP4 A;  1ERQ A;  5FEF A;  1OTA A;  1TS0 A;  4LRY C;  3KSF A;  4QB8 A;  3HL9 A;  3PAG A;  3UB9 A;  3UB7 A;  2W1R A;  2G7U A;  3MQQ A;  1H8M A;  3S7O A;  2C5W B;  1LL8 A;  1XPB A;  2DRW A;  3V3R A;  5HDC A;  3UE3 A;  1KDW A;  2VK3 A;  1FIL A;  4I3A A;  5HL1 A;  4G3K A;  2QMI A;  5L8M A;  4JBF A;  3VP1 A;  4XUZ A;  2ZC6 B;  3UME A;  4E04 A;  3MQO A;  2ZQA A;  5FI2 A;  3EWK A;  1BUL A;  3GTC A;  1GSV A;  1YMS A;  2QJ5 A;  3CWF A;  5CED A;  2ZM8 A;  2E8I A;  1H8Y A;  4B9O A;  3GMW A;  3L7H A;  2ZD8 A;  3HBR A;  4EQI A;  1NY0 A;  2HDU A;  4B4Z A;  3NDE A;  3FV7 A;  2Z2M B;  5F83 A;  1O07 A;  3F1N A;  4QY6 A;  4PKY A;  1Q2Q A;  3NUL A;  5U47 A;  1G6O A;  2PBY A;  3BY8 A;  3PBS A;  4Y7P A;  3VP4 A;  2VJW A;  3LY3 A;  3F1P A;  2V1A A;  3T4K A;  4GNU A;  4NXE A;  1K6S A;  4A5R A;  2PT7 A;  1DP8 A;  3SH9 A;  2V8F A;  3G31 A;  2E8J A;  5DJU A;  4WEL A;  5FDH A;  5D3O A;  2PHY A;  1NRF A;  3T4L A;  3BRM A;  2PRF A;  3ZNT A;  4FTX A;  3BLS A;  3VP2 A;  1IYP A;  2J7V A;  5HWT A;  1MY8 A;  5J8X A;  2HPB A;  5DTS A;  3IBJ A;  2QPN A;  2UV0 E;  4PHT A;  3IXG A;  4YWZ A;  3NIA A;  2KLI A;  2K31 A;  1ONG A;  4Y5F A;  4QJG A;  2XDM A;  3JYI A;  2QJ7 A;  4Q0H A;  3KO6 A;  4KUK A;  3W4P A;  1ONH A;  1P97 A;  2ZC7 A;  1VET B;  4OQI A;  3UY6 A;  5G4Y A;  1YQS A;  4DF6 A;  3MF0 A;  3T4T A;  2QWS A;  3QP4 A;  4GZB A;  1KVL A;  4QY5 A;  3VSL A;  3CJM A;  4NXG A;  4R3A A;  3T4S A;  4KG2 A;  5F69 A;  3V3S A;  1KGE A;  5GHZ A;  1W79 A;  4R23 A;  4E3K A;  4CQH A;  3DW0 A;  4FH4 A;  4IBX A;  1XKZ A;  5FQI A;  4DDS A;  2INW A;  3UE0 A;  3P09 A;  4MNR A;  2OAP 1;  1JWP A;  1GSX A;  1HTZ A;  4EXO A;  3E0Y A;  3S1Y A;  4S2N C;  3N8S A;  3TW8 A;  5FAT A;  4PKY G;  4JXS A;  3FWL A;  3IS2 B;  4C75 A;  1OPX A;  2WGW B;  3CUE A;  2V0W A;  1YM1 A;  2WKE A;  1TEM A;  5HX9 A;  4KZ5 A;  4OH0 A;  4XXR A;  1W8Q A;  2VGK A;  3RTY A;  3HRE A;  3PBR A;  4WZ5 A;  2Z2L B;  3U4L P;  2PYR A;  1FIK A;  1DY6 A;  3TOI A;  1D06 A;  5DF7 A;  3UN7 A;  5CGX A;  5G18 A;  3FPV A;  1DJA A;  1XJ3 A;  5DKK A;  4LV3 A;  4I39 A;  4OQH A;  5TGF A;  3EOI A;  1VEU B;  1T1A A;  2HDS A;  5AQA A;  4HBU A;  4X6T A;  4JF4 A;  5HPF A;  4DXC A;  2JCH A;  1K4F A;  2GDN A;  3W4Q A;  3FKV A;  2JKT M;  1TD5 A;  5F5Y A;  4OPZ A;  3F1O A;  5KSH A;  2XLN A;  3U2A A;  4HEF A;  1FCN A;  4HJ6 A;  3C30 A;  4F3L B;  4GD8 A;  4YFM A;  5EPH A;  1CJF A;  3IF6 B;  5EUA A;  4GS9 B;  1PWG A;  5GL9 A;  1G68 A;  3GEC A;  4N1H A;  4GOG A;  3TG9 A;  5KMW A;  2ZQ9 A;  1HLU P;  1DP6 A;  2XQZ A;  4LEN A;  5FI7 A;  4JGQ A;  3VOZ A;  5CEB A;  2O9C A;  5J4E A;  5JYP A;  2PR5 A;  2IA2 A;  1JTD A;  5TBM B;  2R9X A;  3W2Z A;  3QP1 A;  4IVK A;  4PM7 A;  5L2F A;  3ZCZ A;  1SDE A;  5DKL A;  1VET A;  1KE3 A;  2EWW A;  1ES3 A;  3PBO A;  5E43 A;  4JLF A;  4IUH A;  5AJG A;  3FKW A;  5MC7 A;  1S66 L;  1EWZ A;  1ZHH B;  2B18 A;  3TSG A;  4E6X A;  4H6J B;  1TS6 A;  2M1C A;  4CLC A;  3BQ8 A;  5IHV A;  3T1R A;  3VFF A;  3NEC A;  3ZFZ A;  4BEN A;  5A90 A;  4LV1 A;  4OON A;  2L1M A;  3RXW A;  2A24 A;  1KGG A;  3T1Q B;  3KX0 X;  3WS1 A;  4MN5 A;  1STZ A;  3M6B A;  2CMN A;  3WRZ A;  3MZE A;  1CF0 A;  3PXP A;  3QNC A;  5TFQ A;  1J3W A;  4AFI A;  4YNR A;  5FAS A;  1GCE A;  4EWF A;  2H0Y A;  3C7U A;  2V2F F;  2ZMV A;  3UPP A;  4MBK A;  5IS1 A;  5HL6 A;  3ZG5 A;  4HJ4 A;  4HH3 A;  3ZHH A;  4GW9 A;  1K57 A;  2FH5 A;  3V39 A;  3BWL A;  3HLF A;  1BT5 A;  1K54 C;  2JBF A;  5FSR A;  4BD1 A;  5CTM A;  5HDS A;  4HP4 A;  1V9Z A;  3QP5 A;  4HQA A;  3TJZ C;  1VEU A;  4KQR A;  4HI4 A;  1K56 D;  2WUQ A;  2ZM0 A;  3AGE A;  1IKI A;  3MKF A;  2FFF B;  5FDS A;  5GLB A;  2Q9N A;  1KVM A;  3E4Q A;  4HIA A;  4NKP A;  5LBR A;  2YKF A;  4KUO A;  4N9L A;  4DKI A;  2ZM2 A;  3HLE A;  5CEC A;  5CX7 A;  2HV1 A;  5M19 A;  1K6R A;  4GS9 A;  1NLZ A;  4PMA A;  1XJ6 A;  5FQ9 A;  3M2K A;  2Q0O A;  4JPM A;  1ACF A;  5CHJ A;  2QZ6 A;  5AQB A;  3AGD A;  4WL9 A;  3BW6 A;  2ZC5 B;  5HWW A;  5EVI B;  2HP5 A;  1SZV A;  3GQZ A;  1LLB A;  3T12 B;  2FZ0 A;  2ZQ8 A;  5J7E A;  1IYS A;  3NDG A;  2XRN A;  3LIC A;  2V1Z A;  2GX5 A;  3DTM A;  4CPK A;  3ITB A;  2Y8H A;  4JKT A;  1H5X A;  4X53 A;  1S1Y A;  4S2I A;  1LHY A;  2PD8 A;  5TBM A;  1NWZ A;  3C8C A;  2Y2L A;  4Y3I A;  4BBU A;  1JWZ A;  4MCW A;  2JKR M;  4KZA A;  2RL3 A;  3NOU C;  4WZ5 C;  2MJ6 A;  3JPU A;  1MKI A;  3E98 A;  5IU1 A;  1FQG A;  3KYZ A;  1N9B A;  2H10 A;  2ZJ9 A;  3ZQ5 A;  3ITA A;  4LFU A;  5F82 A;  3S4X A;  2YKH A;  2WAF A;  3G30 A;  1LSV A;  1M40 A;  2P9V B;  4NG2 A;  2PAV P;  3UO9 A;  4BBT A;  3WRT A;  1H0M A;  4E3O A;  2ZMF A;  4II7 A;  5DF8 A;  1SKO A;  2V8C A;  5GHX A;  3KSH A;  1MBL A;  4P87 A;  4WMC D;  3T4J A;  1GHP A;  1IYQ A;  1NXY A;  3BFE A;  3PTE A;  3D3O A;  2WKH A;  2HP6 A;  4GN2 A;  3UE1 A;  3ZDJ A;  3NOT C;  3C4P A;  4Y17 A;  4N9K A;  3TRC A;  5HZH A;  3HLD A;  5M18 A;  2QHK A;  3ISG A;  2WYX A;  1S4S A;  1P9R A;  4JGR A;  1SKF A;  1YLP A;  1SCW A;  4GCZ A;  3NOP C;  1PFL A;  3LIF A;  2Y2G A;  3T4O A;  3T1X A;  4RVA A;  5DFX A;  4N1X A;  4GD6 A;  3BQA A;  3ZNY A;  4BBV A;  4MMN A;  1LSX A;  1ZTU A;  4BLM A;  3BJN A;  3LI8 A;  3IWO A;  3A3J A;  3CZD A;  3UE6 A;  2Y2P A;  2XGN A;  4EUV A;  1FOF A;  4ZTK A;  4XT2 A;  4L9F A;  4UQI M;  1C3B A;  1F5M A;  2ZL1 A;  1P9W A;  3UB8 A;  4CLC C;  1RP5 A;  3OPP A;  3Q7V B;  2OOL A;  4ARZ B;  2WGV A;  3UPO A;  2HP9 A;  3OPH A;  2XF3 A;  3CHW P;  2O0Y A;  5EVI A;  1JNU A;  2DNS A;  4KZ3 A;  4JGP A;  5FI6 A;  1E25 A;  3OPL A;  3H7W A;  3D4F A;  3ZG7 B;  3EEH A;  3HUM A;  1FR6 A;  4G3W A;  5EV0 A;  4DJ3 A;  3E4O A;  3OC2 A;  3LEZ A;  2FFY A;  2ZC4 B;  4OOL A;  2W1T B;  1OTE A;  1LSW A;  1YLT A;  1K54 A;  4NXB A;  2WKI A;  3QP6 A;  4DE3 A;  3VV4 A;  2BTF P;  3R7W B;  4WUJ A;  3IX4 A;  3A0V A;  1K57 C;  1YLW A;  1L2S A;  2W27 A;  3VP0 A;  4LV0 A;  1NJ4 A;  3UB6 A;  2W0N A;  1D1J A;  3HUO A;  4Y0T A;  4IBR A;  1PZO A;  3IHB A;  3BY9 A;  4R3B A;  3HLW A;  4EEU A;  1SHV A;  2XD5 A;  2ZQ7 A;  4L0L A;  1BLS A;  2PU4 A;  3BYD A;  3O88 A;  2WAD A;  1YLJ A;  3PAE A;  4GKU A;  3OCL A;  3MXQ A;  1L0G A;  4JXG A;  5CHM A;  2OLU A;  3UNW A;  3PBQ A;  1W7F A;  4JF6 A;  3ZG8 B;  4PM5 A;  1GHI A;  4O8G A;  3K3D A;  4S2M A;  4GDB A;  4LRX C;  4DN0 A;  4PM6 A;  4F94 A;  3PYP A;  4ME4 A;  2QYB A;  3EQV A;  1BUE A;  1FCM A;  4UAA A;  3IF6 C;  3EGD C;  1PW8 A;  5FAQ A;  4OP8 A;  2XFS A;  3HJK A;  3HCY A;  2R78 A;  2Y2M A;  1VHM A;  1XGI A;  3VE3 A;  4GHI B;  3SH8 A;  4K0X A;  1XJ4 A;  1TDL A;  2B95 A;  1E4D A;  2DMW A;  1FSY A;  3MS6 A;  4U3T A;  4WEK A;  2J8Y A;  2Y2Q A;  1RGY A;  4KZ9 A;  1N9O A;  4IED A;  3E4P A;  2EFX A;  4JXW A;  4S2O A;  2ZQC A;  3BFD A;  4ZJ3 A;  4OQG A;  1O7E A;  3MZD A;  5HD3 A;  4MEZ A;  1W63 M;  4HP9 A;  4M3K A;  4HY8 A;  1HZO A;  1OJG A;  2IWB A;  2K2N A;  3P98 A;  1XA1 A;  1PNE A;  2AVX A;  2ZQD A;  4Y0U A;  4RX2 A;  4ESP A;  3LYX A;  5KZH A;  4OOM A;  1PWD A;  3ZYT A;  3UDI A;  2VZW A;  1G6A A;  1N4O A;  4MBF A;  1HD8 A;  4CLC E;  3LIB A;  3LID A;  4UA9 A;  1IOU A;  1DRM A;  4WF0 A;  2XA7 M;  5FEG A;  5DVA A;  4X69 A;  3Q7V A;  4KG6 A;  3K2N A;  2H5S A;  1MKM A;  5FL3 A;  4LCM A;  1YT4 A;  1XFQ A;  4X55 A;  3SOI A;  1DP9 A;  3I7J A;  2VV7 A;  4EBL A;  4ETX A;  2HJE A;  3DTI A;  1GA0 A;  1VQQ A;  3DWZ A;  4QD4 A;  2HDR A;  3W8K A;  4JF5 A;  5HDD A;  3Q82 A;  3IX8 A;  3IXH A;  4RX3 A;  4BL3 A;  2VGL M;  4BWI A;  1OT9 A;  5HD5 A;  1NRJ A;  1UWN X;  4OQ0 A;  5EM0 A;  1K0K A;  4ZRR A;  4BQM A;  2GJ3 A;  2WAE A;  4FSF A;  4LV2 A;  3O3V A;  3GDI A;  4I3J A;  5F1F A;  2R9W A;  5EEC A;  5DFY A;  1KE4 A;  4MLL A;  2Y2H A;  5G4Z A;  2HDQ A;  1FCO A;  4P6Z S;  4KQD A;  3K3C A;  4KEN B;  4I38 A;  3OZH A;  3IWI A;  3QHY A;  1UGU A;  1PW1 A;  1K38 A;  3NY4 A;  4P85 A;  1PI5 A;  4ZJ2 A;  1Y54 A;  1GSW A;  3IWQ A;  3PR6 A;  1J9M A;  3C5A A;  3N6I A;  4I3I A;  1I2S A;  3MJQ A;  3CPT B;  4PM8 A;  1CQA A;  5L10 A;  3D72 A;  4DE1 A;  2JKT I;  1WA9 A;  2D02 A;  4E3L A;  5EOO A;  3LR0 A;  1K55 A;  1V9Y A;  1ODV A;  1ERO A;  4S2K A;  5DTK A;  3H82 B;  2J9P A;  3B42 A;  3UDX A;  2J3T C;  3V67 A;  3KYQ A;  4GHI A;  5EVI C;  3O86 A;  3IS2 A;  2WGW A;  2XH9 A;  5E2E A;  3MFX A;  4LCL A;  3IX3 A;  3SS3 A;  5DF9 A;  3N8R A;  4QU3 A;  1BSG A;  3CLO A;  3FPW A;  4GDN A;  2UWX A;  3HLC A;  1YSQ A;  1XA7 A;  1OTB A;  2ZC3 B;  4KZ6 A;  4KQO A;  4UHU A;  4ID4 A;  4GB7 A;  4HES A;  1Y28 A;  1YKD A;  3O5Y A;  3WS5 A;  1VB6 A;  2WZZ A;  2XSS A;  2V1B A;  5CXW A;  2Y2J A;  1E3U A;  1EI5 A;  3Q81 A;  4NEE D;  3ZVT A;  1NLY A;  3C38 A;  4Y15 A;  5HAP A;  4CLC D;  3IF5 A;  4R6L A;  1YLZ A;  4HNB A;  1OTD A;  5CRF A;  1L0E A;  1L0D A;  3IH9 A;  1N9L A;  1MWR A;  1PIO A;  4RA7 A;  3BFF A;  3ICY A;  1JTG A;  3GR2 A;  3WS0 A;  4Q8I A;  4DXB A;  3G35 A;  3LEQ A;  2G2W A;  4F3L A;  3LCE A;  4Z1W A;  1CI8 A;  5AQ7 A;  4PAU A;  4KZ4 A;  3IF6 A;  3IT9 A;  4MN7 A;  5A93 A;  3HLG A;  4UQI S;  4HOI A;  4IVI A;  2M7U A;  2WKQ A;  4K0W A;  3JVV A;  2VA0 A;  3NC8 A;  3C4O A;  4K91 A;  2CC1 A;  5CTN A;  4BD0 A;  4FOF A;  1IKG A;  2GZA A;  1T1C A;  1BLC A;  4HBT A;  4I5S A;  5GLD A;  3T4Q A;  4EW7 A;  5A92 A;  3HJI A;  1CEG A;  1BLH A;  5E2F A;  3F1N B;  3M6H A;  1Z6F A;  3QP2 A;  3CG5 A;  4QWO A;  5E2G A;  3NHQ A;  1DJB A;  3VFH A;  3UB5 P;  3F1P B;  4X56 A;  4WEJ A;  2EX2 A;  2W3G A;  4Z9Q A;  2C6W B;  5I5L A;  1L0F A;  2PU2 A;  5CER A;  4E3N A;  3BEB A;  2OLV A;  2VV8 A;  3IXB A;  4BMW A;  3ULF A;  1LL5 A;  3Q7Z A;  1XX2 A;  3N4I A;  1P0Z A;  4LPZ A;  2O99 A;  3M2J A;  2VKS A;  1W5D A;  4R4R A;  4MDZ A;  4MBH A;  4H6J A;  3T1S A;  3NI9 A;  3GVB A;  5CGS A;  2GNX A;  3P01 A;  3RFB A;  2H0T A;  1QME A;  2P74 A;  3V50 A;  2PBD P;  4H8R A;  1ERM A;  1CK3 A;  4PM9 A;  4OPR A;  3S7P A;  4BL2 A;  1OJ5 A;  2WKR A;  2H28 A;  5FQK A;  3H82 A;  3GV9 A;  2EXB A;  3IQA A;  5HAQ A;  2Y91 A;  5KIZ A;  4KZ7 A;  3CIT A;  4D2O A;  1JWV A;  4QPR A;  2PDR A;  4EBP A;  4EU0 A;  2QKP A;  3OOV A;  3DTK A;  1BLP A;  3LUQ A;  1I5Q A;  3IXD A;  3B3X A;  5HSQ A;  3BLM A;  4MN6 A;  3A3I A;  4K08 A;  3A0S A;  2HGV A;  3G2Y A;  1KOU A;  2EFU A;  2WK0 A;  2W3E A;  5EE8 A;  2EA9 A;  5EVE A;  1M6K A;  4E6W A;  4OLG A;  4DDY A;  2VGJ A;  4KZB A;  4R70 A;  4R38 A;  2ZMA A;  2JKR I;  4DE2 A;  4IUK A;  3IHA A;  4NXF A;  3ZGA B;  3A0R A;  2W3H A;  1XJ2 A;  1S0W A;  2I72 A;  1QMF A;  4KG5 A;  5AQ9 A;  3HVF A;  4E3J A;  1JVJ A;  2K7S A;  4FCF A;  1PRQ A;  5GLA A;  1MWT A;  4OPQ A;  4UEY A;  2ZOH A;  5CGW A;  2XA7 S;  4L9E A;  2X01 A;  5FAP A;  1XFN A;  2XK1 A;  3B47 A;  1K55 C;  4ZDX A;  2Y2N A;  3FC7 A;  2WKP A;  3A3E A;  3VOY A;  1GHM A;  4EBN A;  2W3D A;  4WN5 A;  1RCJ A;  3F1O B;  2V9A A;  3C2W A;  1PWC A;  1S4R A;  3LY4 A;  2P08 A;  2L4R A;  3GRJ A;  2ACG A;  4S2L A;  4DMZ A;  2I9V A;  3N7W A;  4DRT A;  2VGL S;  3NBL A;  3SW1 A;  5TR7 A;  5K5B A;  4Y2F A;  4NET A;  5L07 A;  4NK3 A;  4ZBE A;  4LLO B;  4E3I A;  4KZ8 A;  4EET B;  2J9O A;  3BFG A;  3MFD A;  5FQJ A;  1IFQ A;  3LR3 A;  5M1A A;  2XEP A;  3L9K A;  2HJ9 C;  4EQ1 A;  4JGO A;  3MKE A;  1F9I A;  1TS7 A;  2LB9 A;  2O9B A;  3BM6 A;  4Y0O A;  4R4S A;  1YSP A;  2Y4A A;  2J3T D;  2G2U A;  3IBR A;  2P7J A;  2P9V A;  2PYP A;  3A3F A;  3O87 A;  2EXA A;  5EVI D;  5GHY A;  1S67 L;  3E2L A;  3LO7 A;  3PBT A;  1W63 Q;  1K4E A;  4WM9 A;  5I94 A;  4D60 A;  5F68 A;  5HWV A;  1X0O A;  1D7E A;  2OWH A;  2M7V A;  1T19 A;  2A49 A;  1G28 A;  3LIE A;  3MMH A;  4X1M A;  3MQ0 A;  2XRO A;  3R4K A;  1PZP A;  4CLC B;  4EV4 A;  1NYY A;  3CI6 A;  4C3Q A;  1EW0 A;  5A91 A;  1SDN A;  3ZG9 B;  2A24 B;  3OCN A;  2V20 A;  1YMX A;  4O01 A;  4IHQ A;  1IEL A;  1FSW A;  1G5U A;  2XR0 A;  2BG1 A;  1IYO A;  1YAX A;  4B93 A;  5DTT A;  4B4X A;  5EM1 A;  4FH2 A;  3NJA A;  3MXR A;  4OVD A;  1RGZ A;  1HVB A;  5AVE A;  1H3Q A;  4HH2 A;  5BOH A;  1IEM A;  1MZU A;  3G32 A;  2KDK A;  2ZLY A;  1MPL A;  1BZA A;  5TJJ A; 
#chains in the Genus database with same CATH homology
 4GNU A;  4KQQ A;  1N9B A;  1K6S A;  2WGW A;  2XH9 A;  2H10 A;  2ZJ9 A;  5E2E A;  4LCL A;  1OME A;  3SS3 A;  4A5R A;  1VM1 A;  5DF9 A;  5EOE A;  3N8R A;  4QU3 A;  1BSG A;  4GDN A;  1H8Z A;  2UWX A;  3SH9 A;  2WGI A;  3HLC A;  5GLC A;  3ITA A;  5F82 A;  3S4X A;  1XA7 A;  3G31 A;  2ZC3 B;  4WEL A;  1Q2P A;  3MBZ A;  3PBN A;  2WAF A;  4KZ6 A;  5FDH A;  5D3O A;  3G30 A;  3OPR A;  2OSU A;  4KQO A;  1LI9 A;  4UHU A;  3NCK A;  2JC7 A;  1NRF A;  4ID4 A;  3BRM A;  1M40 A;  2P9V B;  4GB7 A;  4HES A;  3UO9 A;  3WS4 A;  5EVL A;  3WRT A;  3WS5 A;  4E3O A;  4ZAM A;  5DF8 A;  5FQQ A;  3ZNT A;  3BLS A;  3VP2 A;  2WZZ A;  1IYP A;  3GSG A;  2J7V A;  5CXW A;  5GHX A;  4EUZ A;  4ZJ1 A;  2Y2O A;  1MY8 A;  1MBL A;  2HPB A;  2Y2J A;  3QNB A;  4P87 A;  5DTS A;  5J8X A;  2QPN A;  3A3D A;  3DWK A;  4WMC D;  4O7D A;  1E3U A;  1EI5 A;  3Q81 A;  4U0T A;  3IXG A;  3ZVT A;  1GHP A;  1MWU A;  1IYQ A;  1NXY A;  3BFE A;  1XGJ A;  5HAP A;  3NIA A;  3PTE A;  1ALQ A;  3IF5 A;  2WKH A;  1YLZ A;  4S2P A;  1ONG A;  2HP6 A;  4QJG A;  5CRF A;  4GN2 A;  1L0E A;  1L0D A;  2XDM A;  3JYI A;  1WYC A;  3UE1 A;  3IH9 A;  2Y59 A;  1BTL A;  1MWR A;  1PIO A;  1ONH A;  3W4P A;  1TDG A;  2ZC7 A;  4RA7 A;  3ZDJ A;  3BFF A;  1JTG A;  4OQI A;  3GR2 A;  3UY6 A;  3WS0 A;  3C4P A;  4Q8I A;  1YQS A;  4DF6 A;  4DXB A;  4DE0 A;  3VMA A;  3G35 A;  2EX6 A;  1LL9 A;  2G2W A;  4GZB A;  1KVL A;  4N9K A;  4QY5 A;  3LCE A;  1MXO A;  1CI8 A;  5AQ7 A;  3VSL A;  2X71 A;  3CJM A;  2X02 A;  4KZ4 A;  3IF6 A;  3HLD A;  3IT9 A;  5M18 A;  5E2H A;  2A3U A;  3HLG A;  3ISG A;  1CEF A;  4KG2 A;  3WS2 A;  5A93 A;  2WYX A;  3BEC A;  4WZ4 A;  3V3S A;  4IVI A;  4R1G A;  1KGE A;  4K0W A;  2EX8 A;  3NC8 A;  3C4O A;  4K91 A;  5GHZ A;  2CC1 A;  1SKF A;  1W79 A;  1YLP A;  1SCW A;  3G2Z A;  4P0M A;  5CTN A;  4R23 A;  4BD0 A;  4E3K A;  3DW0 A;  3WWX A;  1IKG A;  3C7V A;  4HBT A;  1BLC A;  5GLD A;  4FH4 A;  2Y2G A;  4IBX A;  4XUX A;  5A92 A;  1CEG A;  2JE5 A;  1BLH A;  4RVA A;  4X68 A;  5E2F A;  1XKZ A;  5FQI A;  4DDS A;  4N1X A;  4GD6 A;  3M6H A;  3S22 A;  3ZNY A;  1Z6F A;  1ES2 A;  3UE0 A;  3CG5 A;  3HLB A;  4BLM A;  3P09 A;  4MNR A;  5E2G A;  1JWP A;  1HTZ A;  1DJB A;  3IWO A;  5HFO A;  3N8L A;  4S2N C;  3S1Y A;  3A3J A;  3CZD A;  3N8S A;  5FAT A;  3VFH A;  3HUN A;  4JXS A;  3FWL A;  2Y2P A;  4X56 A;  2XGN A;  4C75 A;  4WEJ A;  2EX2 A;  2WGW B;  4Z9Q A;  2C6W B;  1FOF A;  3RJU A;  4ZTK A;  4BJP A;  1L0F A;  1YM1 A;  2PU2 A;  2EX9 A;  1TEM A;  2WKE A;  5HX9 A;  5KSC A;  4KZ5 A;  4P6B A;  2B5R A;  5CER A;  4E3N A;  4RYE A;  1TVF A;  4OH0 A;  1C3B A;  4XXR A;  4UA7 A;  2OV5 A;  1K56 A;  1RP5 A;  1W8Q A;  2VGK A;  3BEB A;  2OLV A;  3HRE A;  3IXB A;  3PBR A;  3EQU A;  3IH8 A;  3OPP A;  1LL5 A;  4WZ5 A;  3Q7V B;  2Z2L B;  3Q7Z A;  1XX2 A;  4QHC A;  3N4I A;  2WGV A;  3MXS A;  4WYY A;  3UPO A;  3UPN A;  2HP9 A;  1FR1 A;  1DY6 A;  3TOI A;  3OPH A;  2XF3 A;  3M2J A;  5DF7 A;  1PI4 A;  2Y55 A;  5EVI A;  5CGX A;  4N92 A;  3UN7 A;  5G18 A;  2DNS A;  1DJA A;  4PPR A;  4LV3 A;  4KZ3 A;  1W5D A;  4R4R A;  4MBH A;  1YLY A;  3G34 A;  4OQH A;  5FI6 A;  5TGF A;  1E25 A;  3NI9 A;  3GVB A;  3OPL A;  5CGS A;  3ZG7 B;  3D4F A;  1CI9 A;  2HDS A;  3HUM A;  5AQA A;  2H0T A;  1QME A;  2P74 A;  3G4P A;  3V50 A;  4HBU A;  4X6T A;  4JF4 A;  1FR6 A;  4H8R A;  2BLS A;  1ERM A;  1CK3 A;  1WYB A;  3OC2 A;  4PM9 A;  3LEZ A;  4OPR A;  4BL2 A;  4DXC A;  2RCX A;  3W4O A;  2FFY A;  2JCH A;  2ZC4 B;  4OOL A;  1K4F A;  1YLT A;  1K54 A;  4B88 A;  2GDN A;  3W4Q A;  3FKV A;  1WE4 A;  2WKI A;  2IWC A;  5FQK A;  4DE3 A;  4OPZ A;  5KSH A;  3GV9 A;  2EXB A;  2XLN A;  5FA7 A;  3IQA A;  5HAQ A;  1K57 C;  1YLW A;  1L2S A;  2XD1 A;  4HEF A;  3VP0 A;  1FCN A;  1PYY A;  2Y91 A;  4LV0 A;  4GD8 A;  4KZ7 A;  4R3J A;  4YFM A;  5EPH A;  1NJ4 A;  2XFT A;  3VSK A;  4D2O A;  1W8Y A;  1JWV A;  3HUO A;  4Y0T A;  3IF6 B;  1I2W A;  4EBP A;  1K25 A;  5EUA A;  4IBR A;  1PZO A;  3IHB A;  5CHU A;  4R0Q A;  4R3B A;  5GL9 A;  1PWG A;  1G68 A;  3HLW A;  1BLP A;  1U60 A;  1SHV A;  4N1H A;  4GOG A;  1KDS A;  1I5Q A;  3IXD A;  2XD5 A;  2Y2I A;  2ZQ7 A;  3B3X A;  5HAI A;  3BLM A;  3TG9 A;  1BLS A;  2PU4 A;  3A3I A;  3BYD A;  3O88 A;  4L0L A;  5KMW A;  2WAD A;  3SS4 A;  1YLJ A;  3PAE A;  1ESI A;  4GKU A;  3OCL A;  2WZX A;  2ZQ9 A;  3G2Y A;  1L0G A;  2EFU A;  4JXG A;  5CHM A;  2WK0 A;  2OLU A;  3UNW A;  1GA9 A;  3Q07 A;  5EE8 A;  3PBQ A;  2XQZ A;  4LEN A;  3CMZ A;  1W7F A;  5FI7 A;  5HW3 A;  1ESU A;  4JF6 A;  3ZG8 B;  4PM5 A;  1GHI A;  2IWD A;  1M6K A;  1NZO A;  4S2M A;  4GDB A;  3VOZ A;  4C6Y A;  4E6W A;  4PM6 A;  3MZF A;  5FAO A;  4F94 A;  3FYZ A;  4OLG A;  2DCF A;  4DDY A;  3EQV A;  5CEB A;  3BFC A;  1BUE A;  1FCM A;  5HAR A;  5JYP A;  4OLD A;  4UAA A;  3SS5 A;  2VGJ A;  3IF6 C;  4WBG A;  4KZB A;  2ZMA A;  4DE2 A;  1JTD A;  1PW8 A;  2R9X A;  5FAQ A;  4OP8 A;  4CJN A;  2XFS A;  4IVK A;  4PM7 A;  3IHA A;  3ZCZ A;  5L2F A;  1SDE A;  1ZKJ A;  4UA6 A;  2Y2M A;  1XGI A;  3ZGA B;  1KGF A;  3AGF A;  1MWS A;  1KE3 A;  1S0W A;  1ES3 A;  3PBO A;  2I72 A;  5E43 A;  3SH8 A;  1QMF A;  4KG5 A;  4K0X A;  3ZVW A;  5AQ9 A;  3HVF A;  4JLF A;  1E3U D;  4E3J A;  4S2N A;  1JVJ A;  3FKW A;  1TDL A;  1S6R A;  1EWZ A;  4FCF A;  1E4D A;  5GLA A;  1FSY A;  3TSG A;  1MWT A;  4U3T A;  4WEK A;  4E6X A;  4OPQ A;  4U0X A;  3Q1F A;  2J8Y A;  2Y2Q A;  4WMC A;  1RGY A;  4YIN A;  5CGW A;  3RXX A;  4KZ9 A;  4IED A;  3E2K A;  2EFX A;  4JXW A;  4S2O A;  4OOY A;  5FAP A;  2X01 A;  1ES5 A;  2ZQC A;  3BFD A;  4ZJ3 A;  1ZC2 A;  1O7E A;  2XK1 A;  3MZD A;  4OQG A;  5IHV A;  1K55 C;  4E3M A;  4ZDX A;  2Y2N A;  3VFF A;  4MEZ A;  3ZFZ A;  4BEN A;  3A3E A;  4M3K A;  3VOY A;  5A90 A;  4LV1 A;  1HZO A;  4OON A;  2IWB A;  1GHM A;  3P98 A;  4EBN A;  1XA1 A;  4JXV A;  1ZG4 A;  3RXW A;  2ZQD A;  4Y0U A;  1KGG A;  1RCJ A;  4RX2 A;  5KZH A;  3SH7 A;  4OOM A;  4OP5 A;  3WS1 A;  1PWD A;  3VP3 A;  1PWC A;  3UDI A;  3LY4 A;  3M6B A;  1ZG6 A;  1G6A A;  3WRZ A;  3MZE A;  3GRJ A;  1ES4 A;  3QNC A;  5TFQ A;  1DJC A;  3FZC A;  5FAS A;  1GCE A;  1N4O A;  4EWF A;  4S2L A;  4MBF A;  1HD8 A;  2H0Y A;  3C7U A;  2V2F F;  3N7W A;  4DRT A;  4OKP A;  3NBL A;  1LI0 A;  4OPY A;  3UPP A;  4MBK A;  5TR7 A;  4UA9 A;  3ZG0 A;  1KE0 A;  4NET A;  1XXM A;  3ZG5 A;  4NK3 A;  4ZBE A;  5FQM A;  5DVA A;  4X69 A;  3Q7V A;  4E3I A;  3ZHH A;  4KZ8 A;  4KG6 A;  5F1G A;  1K57 A;  2H5S A;  3V39 A;  2J9O A;  3HLF A;  4LCM A;  1BT5 A;  1YT4 A;  1NZU A;  1K54 C;  3BFG A;  4FD8 A;  3MFD A;  2JBF A;  5FQJ A;  5FSR A;  4X55 A;  4BD1 A;  5CTM A;  3UDF A;  3V5M A;  5M1A A;  3SOI A;  2Q9M A;  2Y2K A;  2XEP A;  3I7J A;  4S2J A;  1NYM A;  4EBL A;  4KQR A;  1GA0 A;  1VQQ A;  3DWZ A;  4QD4 A;  1AXB A;  1K56 D;  2HDR A;  2WUQ A;  1XP4 A;  3W8K A;  5JYO A;  1ERQ A;  2ZM0 A;  3MKE A;  4JF5 A;  3AGE A;  3BM6 A;  1IKI A;  4Y0O A;  3MKF A;  4R4S A;  2Y4A A;  3Q82 A;  2G2U A;  3IXH A;  2FFF B;  4RX3 A;  4BL3 A;  5GLB A;  2Q9N A;  2P9V A;  1KVM A;  4QB8 A;  3A3F A;  3O87 A;  2EXA A;  3HL9 A;  5EVI D;  5GHY A;  3E2L A;  4OQ0 A;  3PAG A;  4BQM A;  3LO7 A;  3PBT A;  1K4E A;  4WM9 A;  5I94 A;  2WAE A;  4FSF A;  4LV2 A;  4N9L A;  4DKI A;  3O3V A;  2C5W B;  1XPB A;  2DRW A;  5F1F A;  2ZM2 A;  3V3R A;  2R9W A;  3HLE A;  5EEC A;  5CEC A;  3UE3 A;  1KDW A;  1K6R A;  5M19 A;  1KE4 A;  4MLL A;  2Y2H A;  5HL1 A;  2HDQ A;  4PMA A;  2QMI A;  4JBF A;  3VP1 A;  1FCO A;  2A49 A;  4XUZ A;  5FQ9 A;  2ZC6 B;  1PZP A;  4KEN B;  4EV4 A;  3M2K A;  1NYY A;  4JPM A;  5CHJ A;  2ZQA A;  2QZ6 A;  3OZH A;  3IWI A;  5FI2 A;  5AQB A;  4C3Q A;  3AGD A;  1BUL A;  3QHY A;  3GTC A;  5A91 A;  2ZC5 B;  1SDN A;  1PW1 A;  1YMS A;  1K38 A;  5EVI B;  2HP5 A;  3NY4 A;  3GQZ A;  3ZG9 B;  5CED A;  2ZM8 A;  1LLB A;  4P85 A;  3OCN A;  1PI5 A;  4ZJ2 A;  2V20 A;  2ZQ8 A;  1Y54 A;  1YMX A;  2E8I A;  1IYS A;  1H8Y A;  3NDG A;  3IWQ A;  3GMW A;  1J9M A;  3C5A A;  1IEL A;  3N6I A;  2V1Z A;  2ZD8 A;  1FSW A;  3HBR A;  4EQI A;  1NY0 A;  1I2S A;  2HDU A;  3DTM A;  2XR0 A;  4CPK A;  2BG1 A;  4PM8 A;  3ITB A;  1IYO A;  4JKT A;  1H5X A;  4DE1 A;  4X53 A;  4S2I A;  1LHY A;  4B4Z A;  5DTT A;  3NDE A;  3FV7 A;  4E3L A;  2Z2M B;  5F83 A;  5EOO A;  4B4X A;  1O07 A;  1K55 A;  2Y2L A;  4FH2 A;  1JWZ A;  3MXR A;  1ERO A;  4OVD A;  4S2K A;  5DTK A;  1RGZ A;  4KZA A;  1HVB A;  1Q2Q A;  2RL3 A;  4QY6 A;  5U47 A;  2PBY A;  2J9P A;  4WZ5 C;  3UDX A;  3PBS A;  4Y7P A;  5BOH A;  3VP4 A;  1MKI A;  1IEM A;  1FQG A;  3G32 A;  2ZLY A;  1MPL A;  1BZA A;  3LY3 A;  5EVI C;  3O86 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...