1YLZA

X-ray crystallographic structure of ctx-m-14 beta-lactamase complexed with ceftazidime-like boronic acid
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
263
structure length
263
Chain Sequence
QTSAVQQKLAALEKSSGGRLGVALIDTADNTQVLYRGDERFPMCSTSKVMAAAAVLKQSETQKQLLNQPVEIKPADLVNYNPIAEKHVNGTMTLAELSAAALQYSDNTAMNKLIAQLGGPGGVTAFARAIGDETFRLDRTEPTLNTAIPGDPRDTTTPRAMAQTLRQLTLGHALGETQRAQLVTWLKGNTTGAASIRAGLPTSWTVGDKTGSGDYGTTNDIAVIWPQGRAPLVLVTYFTQPQQNAESRRDVLASAARIIAEGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-LACTAMASE CTX-M-14
publication title Structure, Function, and Inhibition along the Reaction Coordinate of CTX-M beta-Lactamases.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 98
structure length 263
sequence length 263
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2005-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1ylzA00
3Q07A 4P6BA 3HUNA 1FSYA 3A3IA 2ZM8A 4BJPA 1JWZA 1NYMA 1Z6FA 3GQZA 4N92A 1PW8A 4PPRA 3GVBA 2Z2LB 4KQQA 4OVDA 5HARA 2R9WA 4LCLA 3V5MA 3S1YA 4S2MA 5HAPA 1W7FA 5F83A 2PBYA 5F1GA 5FATA 4K0XA 4KZAA 2DNSA 5L2FA 4UHUA 2QZ6A 4B88A 1ES2A 1MWRA 4UA6A 2WUQA 3EQVA 3IF6C 1E25A 5JYOA 1XXMA 4Y7PA 3BRMA 1OMEA 3LY3A 4JBFA 5FQQA 1U60A 2Y2IA 3ZG7B 2VGJA 4OPQA 1QMFA 3MKFA 4WZ5A 3MZEA 3NY4A 5CGWA 5DF7A 1GA9A 5EVIA 4E3KA 4U3TA 1YLTA 1YT4A 4BENA 2HDSA 3D4FA 1ES4A 4PM7A 5CGSA 1E4DA 4RX3A 1JVJA 2A49A 2Y59A 1K4EA 1IKGA 2HP6A 1WYBA 2ZC7A 4KG5A 3HUMA 5F82A 1NZUA 1K56A 2Y2HA 5FDHA 1PWDA 1DJCA 3ZG8B 5AQBA 4IVKA 5GHXA 3G30A 3ITAA 4DE1A 5KMWA 1YMSA 4FD8A 4E3JA 4E6XA 2Q9NA 4YINA 4GDNA 5DF8A 1TVFA 2V2FF 4ZDXA 1IYOA 1NRFA 1IYPA 1TEMA 4GDBA 5FSRA 2HP5A 2E8IA 2WKEA 4KENB 2EFUA 1SCWA 3E2KA 1L0EA 3DWKA 3GTCA 1M40A 1ES3A 3TSGA 2Y4AA 4R23A 1YLJA 1I5QA 4E3NA 3V3SA 5GL9A 1BLPA 3HLEA 3A3JA 2WGVA 4P0MA 5FQ9A 4C6YA 3HVFA 4OOLA 1H8ZA 4OPZA 4OQHA 2A3UA 2OV5A 2FFYA 4OQ0A 2ZM2A 5E2EA 4N1XA 4GN2A 4QY5A 3IXGA 4X6TA 2ZQ9A 1YLZA 4BL3A 3VFHA 4B4XA 4OP5A 4R0QA 5FI2A 1N9BA 1TDGA 3UPNA 1XX2A 1KVLA 4QD4A 1L0FA 4ZAMA 3NCKA 4KZ7A 4N1HA 1W8YA 3IWOA 1RP5A 4P85A 5F1FA 3BFFA 1BULA 3IXDA 2J8YA 4RA7A 5CTMA 2IWBA 4EBLA 5KZHA 3BEBA 3IQAA 1MKIA 4WBGA 3G34A 3BYDA 2EX9A 5GLBA 1XPBA 4N9KA 4OQGA 1DJAA 4IEDA 4D2OA 4WEJA 2JBFA 1EWZA 2ZQ7A 1Q2QA 2HP9A 3VP4A 4EBPA 5HAIA 2XEPA 2XGNA 3RJUA 1W5DA 3VSKA 3UN7A 5CEDA 3ZHHA 3WS0A 1IYSA 2R9XA 4DXCA 4DXBA 3IHAA 2WZXA 4BL2A 1WE4A 4PM8A 2Y91A 3IXBA 3PBNA 4WMCD 3O87A 3W8KA 3DTMA 3HLCA 2WAFA 1HD8A 1L2SA 1ONGA 1TDLA 1CEGA 1BLHA 3BFDA 4WM9A 1W8QA 5FAQA 5CECA 1FSWA 1PYYA 4KZ5A 3VP3A 1ESIA 1PIOA 3SH7A 4PM5A 2PU2A 4LV2A 4NK3A 3MZDA 2OLVA 4GZBA 1K54A 3V39A 4BD0A 1WYCA 3E2LA 5HFOA 1SDEA 3MBZA 3A3DA 2Z2MB 4KG6A 4RVAA 4Y0UA 3UDFA 4GKUA 3HREA 5DTTA 1C3BA 1L0DA 2X71A 3ZVWA 1K38A 3BFCA 3FV7A 3PAEA 5DTSA 2XFTA 5GLDA 1MPLA 2H0TA 2Y2QA 3G2YA 3BLMA 5HAQA 4ZJ1A 3MXSA 5E2HA 3Q81A 1YM1A 3WS2A 3ZCZA 4X53A 2X01A 1HVBA 2ZM0A 1JWPA 1YLPA 4S2OA 3ZNTA 2CC1A 2JE5A 3CMZA 3UE0A 5HW3A 4OH0A 4KZ9A 2V20A 4L0LA 4MBKA 3SH8A 2XLNA 2XF3A 4DF6A 4JLFA 2DRWA 1GHPA 5GHZA 3Q7ZA 4GD6A 2BLSA 2P9VB 2Y2MA 3GSGA 2ZQDA 2WKHA 4KQOA 2WGIA 3VP1A 3ZGAB 1IEMA 2J9OA 4N9LA 1PI5A 3M2JA 4MBHA 3ZG0A 5CHUA 3G31A 4PM9A 3VOZA 3I7JA 3HLGA 4WZ4A 3PBRA 5EPHA 5M18A 1Q2PA 3WRZA 3V3RA 5GHYA 5CTNA 3UE3A 5EUAA 2H5SA 4X55A 1ERQA 2G2UA 3GMWA 5I94A 1MBLA 5EVLA 3RXWA 5EE8A 4LENA 5AQAA 4DRTA 4JXVA 2H10A 4LV1A 4E3MA 3Q7VA 5TFQA 1CK3A 2WADA 4C3QA 3MKEA 5G18A 5EVIB 4DKIA 1AXBA 4U0XA 4LV0A 4PM6A 2Y2GA 1XA1A 3CZDA 5JYPA 5E2GA 3CG5A 4CPKA 5E43A 3N4IA 5CHMA 1EI5A 2I72A 1XGIA 3QHYA 4FH4A 2WGWB 1KVMA 5EECA 2UWXA 3VMAA 4CJNA 4Q8IA 4XXRA 2XDMA 3C7VA 1YQSA 2EFXA 1E3UD 1ZG4A 3G35A 3Q82A 4JKTA 4K0WA 4S2NC 4EUZA 5M19A 1QMEA 3C5AA 4JF6A 2RL3A 1KE0A 1JTDA 4DE2A 2ZC4B 2DCFA 3MFDA 1H5XA 3N7WA 1ZKJA 1K6RA 3IF6B 1G6AA 5CXWA 4OLDA 1GCEA 5A91A 2C6WB 1YMXA 4DDYA 1EROA 1YLWA 3OPLA 3A3FA 5M1AA 2EX8A 3SH9A 3LEZA 5EVID 3OPRA 1K54C 3BECA 1M6KA 3NC8A 4KZBA 5CHJA 5FA7A 4R4RA 2EXAA 4WEKA 4Z9QA 5U47A 3UDXA 4WMCA 4GD8A 2ZQAA 4UAAA 3P09A 3HLDA 3QNBA 1FR1A 4E3OA 5KSCA 2XD5A 2OSUA 3PTEA 1BZAA 5FAOA 4BQMA 1CEFA 1KE4A 5J8XA 1RGZA 2WKIA 3OC2A 1BTLA 1ZC2A 5HL1A 3W4PA 1FR6A 3NBLA 4MBFA 3UDIA 4OQIA 3UE1A 3IWQA 2ZQ8A 5DTKA 3WS4A 4E3IA 2XR0A 3FZCA 3EQUA 3ITBA 2WAEA 1L0GA 5EOEA 3GR2A 1GA0A 3MXRA 1CI9A 4JF5A 2HPBA 3FKWA 3IHBA 4DDSA 4KZ6A 3FWLA 4S2NA 5D3OA 1BLCA 1LL5A 3WS5A 1DJBA 4C75A 1K57C 4NETA 2Q9MA 3SOIA 1FCNA 5FASA 4IBXA 3NDEA 4ZBEA 4WELA 3CJMA 4JXWA 4M3KA 4MEZA 4EWFA 1GHMA 3UPOA 1XP4A 5FQJA 1K6SA 1NYYA 2JC7A 1LLBA 4KZ8A 5GLAA 1ES5A 2WZZA 4FCFA 4JXGA 3HUOA 4KG2A 5CEBA 1VM1A 2Y2PA 1BLSA 2IWDA 3VOYA 5FI6A 4IBRA 1ZG6A 5EOOA 3VP0A 5BOHA 2G2WA 4R3BA 3HL9A 2RCXA 5CRFA 2Y2LA 3HLFA 3WS1A 4BD1A 3OCLA 5FQKA 4OPRA 4S2LA 2Y2OA 1XKZA 3UO9A 5FQMA 1NY0A 4Y0TA 1PWGA 3HBRA 5TR7A 1K55C 2WYXA 1VQQA 4PMAA 3PBQA 4R1GA 1IELA 1K57A 1MY8A 3AGFA 4K91A 4RYEA 4S2KA 3G32A 1SDNA 2ZC3B 4EBNA 4P87A 3SS5A 1MWTA 1Y54A 4OPYA 4UA9A 2ZQCA 1BSGA 1PZPA 2J9PA 1DY6A 3PBTA 3VP2A 1MWUA 4ID4A 1JWVA 2XQZA 3M2KA 1NJ4A 3ZG5A 4IVIA 1ONHA 2P9VA 3SS3A 3N8SA 2OLUA 3TOIA 3C7UA 1XGJA 2QPNA 3PBOA 4S2IA 3G4PA 4DE0A 1LL9A 5FQIA 3UNWA 3QNCA 4X56A 2XD1A 1RGYA 2VGKA 1E3UA 3C4PA 4MLLA 1K25A 1NXYA 3A3EA 1PZOA 3JYIA 3N6IA 4MNRA 3S4XA 4UA7A 3DW0A 4JF4A 1N4OA 1PWCA 2GDNA 3HLWA 1H8YA 4KZ3A 1LI0A 3OPPA 1FQGA 3PBSA 3VSLA 4OOYA 1MWSA 4R3JA 3IXHA 1JTGA 4JXSA 5TGFA 2XK1A 3RXXA 1K4FA 1K55A 2PU4A 3M6HA 1KGGA 1BT5A 2Y2JA 3WRTA 4BLMA 5GLCA 1SKFA 2EX6A 4QY6A 4LCMA 4R4SA 2EXBA 1G68A 2XH9A 2FFFB 1IKIA 2V1ZA 2C5WB 1SHVA 4E6WA 3Q7VB 4QB8A 4E3LA 2HDUA 2WGWA 1CI8A 1O7EA 1HTZA 3NIAA 3LCEA 3O3VA 2ZMAA 3FYZA 5IHVA 4B4ZA 5AQ7A 1FOFA 2IWCA 3B3XA 3IF5A 4EQIA 5CERA 5DF9A 2Y2KA 5FI7A 4OONA 4ZJ3A 3UPPA 4LV3A 2QMIA 2ZLYA 3O88A 3TG9A 3W4OA 3IF6A 4XUZA 2ZD8A 5KSHA 4H8RA 4KZ4A 1PI4A 1S6RA 1J9MA 2Y2NA 3ISGA 4S2PA 3BM6A 1W79A 2B5RA 1GHIA 2WK0A 3GRJA 4XUXA 4O7DA 4GNUA 4X68A 3V50A 3NDGA 4QHCA 4QJGA 4JPMA 5FAPA 2HDRA 1K56D 1I2WA 2P74A 3BFEA 4A5RA 5AQ9A 4FSFA 2Y55A 2J7VA 3HLBA 4U0TA 1RCJA 3AGDA 2HDQA 5A90A 4OLGA 3MZFA 3ZVTA 1MXOA 1KGFA 5CGXA 3ZG9B 3SS4A 4YFMA 2EX2A 2X02A 3IT9A 1LHYA 3N8RA 4RX2A 3W4QA 2ZC6B 4FH2A 4Y0OA 4F94A 2ZJ9A 1NZOA 3DWZA 1FCMA 1O07A 3M6BA 3P98A 4GB7A 3C4OA 3BLSA 3LO7A 3VFFA 3IH8A 4GOGA 4ZTKA 3OCNA 1BUEA 4HBUA 4X69A 4HEFA 3O86A 5A92A 2BG1A 1FCOA 4EV4A 3PAGA 4QU3A 3OZHA 3OPHA 1LI9A 1XA7A 4OOMA 5E2FA 4ZJ2A 4HBTA 3S22A 3FKVA 1YLYA 3BFGA 3WWXA 1KGEA 3ZDJA 1ERMA 1I2SA 2H0YA 3NI9A 4OKPA 4KQRA 3G2ZA 4S2JA 1KE3A 5DVAA 3Q1FA 4OP8A 1PW1A 3IH9A 1IYQA 2XFSA 2ZC5B 1KDWA 1KDSA 1ALQA 3GV9A 3IWIA 4WZ5C 5HX9A 1ESUA 3N8LA 3LY4A 4HESA 5EVIC 3AGEA 4WYYA 1HZOA 3UY6A 4DE3A 1S0WA 3ZNYA 2JCHA 5A93A 3ZFZA
chains in the Genus database with same CATH superfamily
3HUNA 3PYPA 1FSYA 3CWFA 2HV1A 4PPRA 3GQZA 4N92A 4KQQA 4OVDA 4LCLA 3IX3A 2PBYA 5FATA 3VOLA 3OOVA 4KZAA 4EQ1A 5HDSA 3T12B 1SKOB 4RQ9A 1YSQA 2KOIA 4LRYC 4JBFA 1LT0A 3KYQA 2FH5A 3BWLA 3T4KA 2ZOIA 4U3TA 1YT4A 3GECA 3A0SA 2HDSA 3D4FA 1CJFA 2J3WA 2WKPA 5CGSA 2V1AA 4KG5A 1NZUA 4LRZE 1PWDA 1DJCA 4IHQA 4IVKA 4DE1A 1YMSA 4FD8A 4E6XA 2Q9NA 5DF8A 4YNRA 2E8IA 1SCWA 4GS9A 1M40A 5EFWA 2Y4AA 3TSGA 4E3NA 1D1JA 3HLEA 5IT5A 1H8ZA 4NG2A 5HPIA 1OPXA 2OV5A 2FFYA 2ZM2A 2Q0OA 4QY5A 4BL3A 5L10A 3LIDA 3VFHA 1TDGA 2JHEA 3NCKA 4N1HA 1W8YA 1RP5A 1BULA 5CTMA 2IWBA 4WBGA 3BYDA 4Y2FA 5HPFA 4OQGA 4I3IA 1W5DA 3VSKA 3UN7A 5CEDA 3MS6A 4DXBA 4EESA 3PBNA 3O87A 1HD8A 1L2SA 1ONGA 1TDLA 1FSWA 1P9RA 1PYYA 3VP3A 1ESIA 1Y28A 2OLVA 2VK3A 2WKRA 3QP1A 1TD5A 3E2LA 1S4SA 4KG6A 3HREA 3ZVWA 3BFCA 3PAEA 3P7NA 1H0MA 2L4RA 1S66L 4ZJ1A 5E2HA 3EEHA 2X01A 1HVBA 4HQAA 4S2OA 1AWIA 3ZNTA 3CPTB 3T50A 4L0LA 2XF3A 5AVEA 1SKOA 4PHTA 4GD6A 2P9VB 2ZQDA 3DTIA 4I3AA 4N9LA 3ZG0A 4PM9A 2GZAA 3NHQA 3I7JA 3HLGA 3NJAA 2P7JA 3DTEA 3KSHA 3TJZC 3GMWA 5EVLA 5EE8A 4LENA 4MN5A 4EERA 1TS6A 1CK3A 4ARZA 3MKEA 1AXBA 4U0XA 2Y2GA 3CZDA 3MFXA 4L9FA 1XGIA 2WGWB 1YAXA 3E4QA 3KSGA 3A0RA 4S2NC 1PFLA 3Q82A 4JKTA 1UGUA 4DJ2A 2ZC4B 3MFDA 1P9WA 3B47A 1ZKJA 3IF6B 3LGOA 1YMXA 2ZBBA 2EX8A 3LEZA 3CUEA 1M6KA 5FA7A 2QJ5A 2EXAA 3P09A 2VEAA 3QNBA 2OSUA 5J8XA 1BZAA 5AJGA 3OC2A 1ZC2A 1F9IA 1FR6A 4MBFA 2D01A 3KO6A 3UE1A 3WS4A 4E3IA 2PT7A 1L0GA 3KSIA 4JF5A 3FKWA 1UWPX 3FWLA 1VETB 3RTYA 4NETA 2Q9MA 3TE8A 5FASA 4ZBEA 3NULA 4JXWA 4MEZA 4NEED 1GHMA 1XP4A 1K6SA 1OJ5A 2JC7A 1OTBA 2HJEA 3RFBA 5F5YA 3VP0A 4ETZA 5BOHA 4R3BA 2K2NA 3HL9A 3T4SA 2K31A 3LR0A 3OCLA 4OPRA 5A8BA 1XKZA 1BYWA 1DRMA 1IELA 1K57A 1MY8A 3CPTA 1MWTA 4H6JB 2ZQCA 1BSGA 3TW8A 3VP2A 3LEQA 4L9EA 2DMWA 4IVIA 1P0ZA 1ONHA 2P9VA 2Z6DA 1T1AA 4S2IA 3G4PA 5FQIA 2O9CA 4X56A 2XD1A 4MLLA 3N6IA 3S4XA 4UA7A 2XSSA 4JF4A 4Y13A 1LL8A 3HLWA 4KZ3A 1LI0A 2A24B 3OPPA 4ME4A 4EEPA 1S1ZA 1JTGA 4JXSA 4HY8A 5TGFA 1K55A 1KGGA 1BT5A 2GNXA 2V0UA 2PDRA 2EXBA 2H28A 2XH9A 5C5KA 1MC0A 2WGWA 1O7EA 2GJ3A 3LCEA 3FYZA 5AQ7A 3W2ZA 1FOFA 4EQIA 1DP9A 5HWWA 5J4EA 4ZJ3A 3TG9A 3IF6A 4XUZA 2QHKA 5KSHA 2OAQ1 4BBTA 4S2PA 4X25A 2M7VA 3LIBA 3JVVA 3NDGA 2VGLS 2VV7A 2JKTM 2PYPA 2Y55A 2J7VA 2HDQA 4OLGA 4GHIB 3ZVTA 5AVFA 3NOPC 5DFXA 3IT9A 1W63M 3N8RA 4RX2A 5HD5A 3O5YA 1VETA 3P98A 3C4OA 3BLSA 3MSHA 2VJWA 3DAVA 3O86A 4QU3A 5F6AA 4OOMA 3T4JA 3H9WA 1T19A 3S22A 3T1SA 3BFGA 1ERMA 1I2SA 3NI9A 3G2ZA 4S2JA 2XRNA 5EM1A 3Q1FA 4OP8A 3GV9A 5HX9A 3UY6A 3CHWP 4P6BA 4FOFA 3A3IA 2ZM8A 3EWKA 1Z6FA 2Z2LB 5HAPA 4NXGA 2DNSA 3SZTA 3D9YA 2QZ6A 4B88A 1MWRA 4EETB 2WUQA 3BQ8A 5JYOA 3LY3A 2Y2IA 3ZG7B 2VGJA 3LR4A 4OPQA 4WZ5A 2A24A 3VV4A 5CGWA 5DF7A 5EVIA 2W3FA 3PXPA 1YLTA 5FEFA 3IBJA 4PM7A 3LR5A 4HH3A 2A49A 2Y59A 2ZC7A 2Y2HA 1K56A 2ZL1A 3QP5A 5GHXA 5KMWA 4E3JA 4YINA 1FIKA 5EVEA 3K3CA 5TBMB 1TEMA 4EU0A 2O0YA 2WKEA 1KOUA 1YLJA 1I5QA 1BLPA 2VZWA 3A3JA 5FQ9A 4C6YA 4DJ3A 1OTIA 4OQ0A 4GN2A 2JKRM 3NOUC 3IXGA 4R38A 4EW7A 4B4XA 4R0QA 5FI2A 1N9BA 3UPNA 4GHIA 1KVLA 4QD4A 4CLCB 3IWOA 4P85A 5F1FA 3IXDA 2J8YA 5KZHA 3IQAA 5EV0A 2EX9A 3R7WB 4N9KA 3S7PA 1VEUB 4D2OA 4WEJA 3LI9A 3LIEA 2ZQ7A 4EBPA 2XEPA 3RJUA 3ZHHA 1WA9A 1IYSA 4DXCA 4Q0HA 1MKMA 1TF1A 1WE4A 3MF0A 2Y91A 4WMCD 2Y8HA 2MJ6A 1OTAA 4KZ5A 4CQHA 4LV2A 4NK3A 4GZBA 2XA7M 2ZMVA 1SDEA 2Z2MB 4RVAA 4GKUA 1L0DA 5IS1A 1MPLA 1TS7A 2Y2QA 3G2YA 3A0VA 3UB8A 4X53A 2ZM0A 4NXBA 3T4LA 3PHYA 4MBKA 3SH8A 2XLNA 3V67A 2INWA 4DF6A 2DRWA 1GHPA 1LSVA 2Y2MA 3GSGA 3R4KA 3VP1A 3ZGAB 4MBHA 3VOZA 2YKFA 3ICYA 1IOUA 5EPHA 2JN7A 5M18A 1Q2PA 2H5SA 3CUEC 2HGVA 5AQAA 4JXVA 2H10A 4JGOA 3EGXC 3Q7VA 4ZRRA 5G18A 4DKIA 2O9BA 4LV0A 4YWZA 1EI5A 5TBMA 3QHYA 4FH4A 5EECA 4CJNA 2XDMA 3C7VA 1ZG4A 4EUZA 5FEGA 5M19A 1OTDA 2DCFA 1G6AA 5CXWA 2NUPC 1Z09A 5M1AA 5EVID 3OPRA 1K54C 3BECA 4R6LA 3NC8A 5CHJA 5G4ZA 4R4RA 4AFIA 4UAAA 3HLDA 4E3OA 3PTEA 4CLCA 1KE4A 1BTLA 2GX5A 3NBLA 2XR0A 3R7WA 3ITBA 1VEUA 3GR2A 1GA0A 3MXRA 4KZ6A 5D3OA 1DJBA 1K57C 3SOIA 1FCNA 3T1QB 3JVUA 2P08A 4EWFA 1L3LA 1NYYA 2WZZA 3HUOA 1TS8A 2Y2PA 4IBRA 4LRXC 5DKKA 2RCXA 3WS1A 4HP9A 5KIZA 3C8CA 2Y2OA 4QPRA 3UO9A 1NY0A 2VGLM 1K55C 1VQQA 4S2KA 3AGFA 4K91A 1GSVA 3G32A 4HOIA 3SS5A 4GJ4A 4OPYA 5TJJA 4ID4A 2XQZA 3SS3A 3N8SA 2OLUA 3C7UA 4X1LA 4DE0A 1JNUA 4IJGA 3QP6A 1E3UA 4NXFA 1NXYA 1PZOA 5DJTA 2GDNA 1H8YA 3PBSA 3ZQ5A 4R3JA 1J3WA 3IXHA 3UB6A 1EW0A 1K4FA 2PU4A 3M6HA 3WRTA 1SKFA 2EX6A 3L7HA 4LPZA 4B93A 2FFFB 2QJ7A 1HTZA 5CERA 2Y2KA 5G4YA 2ZLYA 3W4OA 3MQ0A 3H82B 4H8RA 4I38A 1J9MA 3ISGA 4EEUA 1N9NA 3F1PB 5HDCA 3GRJA 4X68A 2V8CA 4QHCA 4JPMA 3CLOA 5HDDA 4FSFA 3SW1A 4X1MA 4YFMA 2PAVP 2X02A 3W4QA 4O8GA 3DWZA 1XJ3A 2J3TC 2VLGA 3LO7A 2B95A 3OCNA 4HBUA 4X69A 5A92A 2BG1A 1XA7A 3EEAA 4OKPA 1TS0A 1CQAA 1KE3A 1IYQA 3IWIA 4WZ5C 4R70A 5EVIC 1OJGA 1S0WA 4KUKA 3ZFZA 4BJPA 1JWZA 1PW8A 3KX0X 3S1YA 2BASA 4S2MA 1W7FA 1ZTUA 5F1GA 4K0XA 2CMNA 2HJ9C 1ES2A 4UA6A 3EQVA 3DBAA 1E25A 1OMEA 5FQQA 1U60A 3MKFA 3S7OA 3MZEA 4UQIS 1GA9A 2KLIA 4E3KA 5L07A 4BENA 1ES4A 2VX8A 1E4DA 4WUJA 3L9KA 2HP6A 2JKGA 5AQBA 3ITAA 3C30A 2V2FF 4ZDXA 1IYPA 1G5UA 5FSRA 2HP5A 2PR5A 3DWKA 3GTCA 3E4OA 3T1XA 1YKDA 3H82A 1ES3A 3V3SA 2PBDP 5GL9A 2KDKA 2WGVA 4P0MA 3HVFA 4OOLA 3F1PA 4OPZA 4OQHA 3IBRA 3E0YA 5E2EA 4N1XA 1G6OA 2ZQ9A 3H7WB 1XX2A 2W3HA 1L0FA 2V0WA 5K5BA 4BBUA 2WKQA 4EBLA 3BEBA 4WF0A 1MKIA 1SZVA 5GLBA 3T4OA 5DFYA 1XPBA 1DJAA 2JBFA 2HP9A 4DN0A 3UB7A 3WS0A 4BL2A 3BY8A 3P01A 1D7EA 3DTMA 1YPRA 1CEGA 3BFDA 5CECA 1W8QA 3C38A 2K7SA 1MZUA 4XT2B 3VE4A 3LFVA 1H8MA 5HFOA 3A3DA 5L8MA 5DTTA 1C3BA 5DTSA 2XFTA 5GLDA 2JKTI 4H6JA 4P6ZS 2H0TA 2B18A 3MXSA 4DMZA 3Q81A 1YM1A 3ULFA 4GCZA 2CC1A 1FILA 3CMZA 4OH0A 4KZ9A 2V20A 4HI4A 5GHZA 2BLSA 2IA2A 2O99A 2WKHA 1IEMA 1G28A 2J9OA 1PI5A 3M2JA 5CHUA 4WZ4A 3PBRA 3E4PA 1P97A 2M7UA 5GHYA 5CTNA 3BJNA 1NWZA 1PNEA 1ERQA 3LYXA 4LGWA 3QP4A 1ODVA 5TFQA 4Y3IA 4CLCC 2PD7A 4PM6A 1XA1A 3QP2A 5JYPA 4CLCE 3CG5A 4F3LB 3N4IA 5CHMA 2I72A 2QYBA 3UB5P 3MMHA 3K3DA 2UWXA 4HP4A 2EFXA 3G35A 4K0WA 1JTDA 2AVXA 4JGPA 3N7WA 5HD3A 3MJQA 4LFUA 5F68A 5A91A 2C6WB 1EROA 2OWHA 3OPLA 3A3FA 4O0PA 2LB5A 3UMDA 3UDXA 3UMEA 1FR1A 4FTXA 5KSCA 3MQQA 5HWTA 2XD5A 1CEFA 2WKIA 3W4PA 2LB9A 4HIAA 2ZQ8A 2NUTC 2Y79A 4O01A 3FZCA 3IS2B 3EQUA 5EOEA 1LSXA 5F69A 1LL5A 3WS5A 4C75A 3QP8A 4IBXA 4WELA 3CJMA 1VHMA 4M3KA 2PD8A 3CAXA 5FDSA 1LLBA 4KZ8A 5GLAA 3B42A 1ES5A 3F1OB 2ZMFA 4JXGA 4KG2A 5L09A 5CEBA 2W3DA 4XT2A 2IWDA 1T1CA 4WLAA 1XJ6A 2G2WA 5CRFA 4BBVA 4BD1A 5FQKA 4D60A 2JKRI 1V9YA 5FQMA 1PWGA 3HBRA 5TR7A 2WYXA 4KUOA 3PBQA 4PAUA 4R1GA 4RYEA 1SDNA 4EBNA 5LBRA 1PZPA 2L0WA 1NLZA 1DY6A 1V9ZA 1MWUA 4I3JA 1XGJA 2QPNA 3UNWA 1RGYA 4HH2A 3C4PA 3JYIA 4G3VA 4PKYG 3BY9A 3T4TA 1N4OA 2J3TD 2I9VA 3VSLA 4OOYA 3U2AA 3LI8A 4WN5A 5I5LA 4QY6A 2L1MA 3EGDC 4LCMA 4R4SA 3U4LP 2FZ0A 3LICA 4F3LA 2C5WB 2OOLA 1SHVA 4E3LA 3NIAA 4ARZB 4IUHA 2ZOHA 3O3VA 3RH8B 2IWCA 2VV8A 4R3AA 5FI7A 3O88A 4KZ4A 1ACFA 1PI4A 1S6RA 2M1CA 4HHDA 2Y2NA 3BM6A 4G3KA 1W79A 2B5RA 1GHIA 2WK0A 4O7DA 3KYZA 3V50A 4QJGA 5FAPA 2HDRA 1K56D 2P74A 4A5RA 5AQ9A 4YOFA 2PYRA 4U0TA 1RCJA 1S67L 3AGDA 3MZFA 1XFQA 1KGFA 5CGXA 3SS4A 1T18A 3IS2A 1S1YA 2EX2A 4UQIM 3NECA 2ZC6B 4FH2A 4F94A 5HZHA 4Z1WA 4HJ4A 1O07A 2W3GA 1GSXA 3IH8A 1BUEA 1XJ4A 1FCOA 3PAGA 4M4XA 3OZHA 3T1RA 1LI9A 3F1OA 4MMNA 3FKVA 1D06A 3ZDJA 2H0YA 3BQAA 3BW6A 4KQRA 1PW1A 1YSPA 3IH9A 2KX6A 1KDWA 1ESUA 4WL9A 3N8LA 4HESA 3AGEA 4WYYA 1HZOA 4DE3A 3ZNYA 2JCHA 3Q07A 1NYMA 1IFQA 3HJIA 3GVBA 2BTFP 4II7A 5HARA 2R9WA 3V5MA 1VB6A 2G7UA 5F83A 5L2FA 4UHUA 3HJKA 3IF6C 4GW9A 1XXMA 4Y7PA 3BRMA 3FPVA 3LR3A 4JGQA 4I39A 1QMFA 3NY4A 2VKSA 3NOTC 4PKYA 2EA9A 4Q0JA 3OLOA 1N9OA 4RX3A 1JVJA 1K4EA 1IKGA 1WYBA 3HUMA 5F82A 5FDHA 3VE3A 3ZG8B 2OWJA 3G30A 1NLYA 3UE6A 1CF0A 4GDNA 1TVFA 3FG8A 1IYOA 1NRFA 4GDBA 4P6ZM 4KENB 2EFUA 3E2KA 1L0EA 3HCYA 4R23A 3E98A 2EWWA 3FC7A 2EWVA 2A3UA 2XA7S 3KSFA 4ETXA 4NXEA 4X6TA 1YLZA 2W3EA 4OP5A 4KQDA 5FL3A 2YKHA 4ZAMA 4KZ7A 4K08A 3BFFA 2QKPA 4RA7A 2J80A 3G34A 3UB9A 2PR6A 5DKLA 4IEDA 1EWZA 1STZA 1Q2QA 1XFNA 3VP4A 5HAIA 2XGNA 1X0OA 2R9XA 3IHAA 2WZXA 1DP6A 4PM8A 3EOIA 3IXBA 1DP8A 3W8KA 3HLCA 1Y4OA 2WAFA 1BLHA 4WM9A 5FAQA 4CLCD 2PRFA 4PM5A 3SH7A 1PIOA 2PU2A 5IU1A 3MZDA 1K54A 3V39A 4BD0A 1WYCA 3MBZA 4Y0UA 3UDFA 4NKPA 2X71A 1K38A 3FV7A 3BLMA 5HAQA 3ZCZA 3WS2A 4Q0IA 1JWPA 1YLPA 2JE5A 3JPUA 3UE0A 5HW3A 4G3WA 4I5SA 4MN7A 2W0NA 4JLFA 3Q7ZA 1H3QA 2A2LA 2E8JA 4KQOA 2WGIA 2R78A 2D02A 3G31A 1A0KA 3G6OA 3LIFA 3F1NB 3WRZA 4B9OA 3V3RA 1NRJA 3UE3A 5EUAA 4HNBA 4X55A 2G2UA 5I94A 1MBLA 2V8FA 3RXWA 4DRTA 4EUVA 3MXQA 4LV1A 4E3MA 1S4RA 2PHYA 2WADA 4C3QA 5EVIB 5E2GA 4CPKA 5E43A 2OAP1 2VA0A 1KVMA 3MR0A 3VMAA 2ZL1B 4Q8IA 1F2KA 4XXRA 1YQSA 1E3UD 1W63Q 1QMEA 3C5AA 4JF6A 2RL3A 1KE0A 4DE2A 1H5XA 2HZ5A 1K6RA 4ESPA 4Y17A 4OLDA 1GCEA 5HL6A 4DDYA 1ZHHB 1YLWA 3LIAA 4MN6A 3SH9A 4KZBA 4Y5FA 4WEKA 4Z9QA 5U47A 4WMCA 3KYEA 2ZQAA 4GD8A 4L9GA 4BQMA 5FAOA 1RGZA 5HL1A 3UDIA 4OQIA 3IWQA 5DTKA 1OTEA 1F98A 2WAEA 2HF6A 2W1RA 1CI9A 2HPBA 3IHBA 4DDSA 4S2NA 1BLCA 2UV0E 3NDEA 3MQOA 3LUQA 4MCWA 3K2NA 2W1TB 3UPOA 4BMWA 5FQJA 3IX4A 4FCFA 1VM1A 4EXOA 1BLSA 4BWIA 3VOYA 5FI6A 1ZG6A 5EOOA 1PRQA 2Y2LA 3HLFA 4E04A 4S2LA 3FPWA 4Y0TA 4PMAA 2ZC3B 3DTKA 1F5MA 4P87A 1Y54A 4UA9A 2J9PA 3PBTA 2W27A 4JGRA 1JWVA 3M2KA 3ZG5A 1NJ4A 2B02A 1OT6A 2VV6A 1GSWA 3TOIA 3PBOA 3CITA 1LL9A 3QNCA 2VGKA 1K25A 3A3EA 3F1NA 4MNRA 4LLOB 3DW0A 1PWCA 2V1BA 4MDZA 4QWOA 1FQGA 1MWSA 2JKFA 2XK1A 3RXXA 2Y2JA 4BLMA 5GLCA 1T1BA 3S7NA 2Z6CA 4GLQA 1HLUP 1G68A 1IKIA 2V1ZA 4E6WA 3Q7VB 4QB8A 5HSQA 1OT9A 2HDUA 3ZYTA 1CI8A 2ZMAA 5IHVA 2O9AA 3PR6A 3IX8A 4B4ZA 3IF5A 3B3XA 5DF9A 2QWSA 4OONA 3UPPA 4LV3A 2QMIA 4GS9B 4Y15A 2ZD8A 3CI6A 5J7EA 2ACGA 2P04A 3H7WA 4XUXA 4GNUA 1LSWA 1N9LA 1I2WA 3BFEA 3HLBA 3TRCA 5A90A 1K0KA 1MXOA 1XJ2A 3ZG9B 1UWNX 5HWVA 3GDIA 3T4QA 1LHYA 4Y0OA 4IUKA 2ZJ9A 1NZOA 1FCMA 3M6BA 4GB7A 3VFFA 5DJUA 4GOGA 4ZTKA 4HEFA 2W1TA 3B33A 5CX7A 2XROA 4EV4A 3S7QA 3D3OA 3OPHA 5E2FA 4HJ3A 3C2WA 5EM0A 4ZJ2A 4HBTA 1YLYA 3WWXA 1KGEA 4UEYA 5J3WA 5DVAA 5MC7A 2XFSA 2ZC5B 1KDSA 1ALQA 4FUWA 3OBFA 3LY4A 2V9AA 4HJ6A 3D72A 5A93A
chains in the Genus database with same CATH topology
3Q07A 4P6BA 3HUNA 1FSYA 3A3IA 2ZM8A 4BJPA 1JWZA 1NYMA 1Z6FA 3GQZA 4N92A 1PW8A 4PPRA 3GVBA 2Z2LB 4KQQA 4OVDA 5HARA 2R9WA 4LCLA 3V5MA 3S1YA 4S2MA 5HAPA 1W7FA 5F83A 2PBYA 5F1GA 5FATA 4K0XA 4KZAA 2DNSA 5L2FA 4UHUA 2QZ6A 4B88A 1ES2A 1MWRA 4UA6A 2WUQA 3EQVA 3IF6C 1E25A 5JYOA 1XXMA 4Y7PA 3BRMA 1OMEA 3LY3A 4JBFA 5FQQA 1U60A 2Y2IA 3ZG7B 2VGJA 4OPQA 1QMFA 3MKFA 4WZ5A 3MZEA 3NY4A 5CGWA 5DF7A 1GA9A 5EVIA 4E3KA 4U3TA 1YLTA 1YT4A 4BENA 2HDSA 3D4FA 1ES4A 4PM7A 5CGSA 1E4DA 4RX3A 1JVJA 2A49A 2Y59A 1K4EA 1IKGA 2HP6A 1WYBA 2ZC7A 4KG5A 3HUMA 5F82A 1NZUA 1K56A 2Y2HA 5FDHA 1PWDA 1DJCA 3ZG8B 5AQBA 4IVKA 5GHXA 3G30A 3ITAA 4DE1A 5KMWA 1YMSA 4FD8A 4E3JA 4E6XA 2Q9NA 4YINA 4GDNA 5DF8A 1TVFA 2V2FF 4ZDXA 1IYOA 1NRFA 1IYPA 1TEMA 4GDBA 5FSRA 2HP5A 2E8IA 2WKEA 4KENB 2EFUA 1SCWA 3E2KA 1L0EA 3DWKA 3GTCA 1M40A 1ES3A 3TSGA 2Y4AA 4R23A 1YLJA 1I5QA 4E3NA 3V3SA 5GL9A 1BLPA 3HLEA 3A3JA 2WGVA 4P0MA 5FQ9A 4C6YA 3HVFA 4OOLA 1H8ZA 4OPZA 4OQHA 2A3UA 2OV5A 2FFYA 4OQ0A 2ZM2A 5E2EA 4N1XA 4GN2A 4QY5A 3IXGA 4X6TA 2ZQ9A 1YLZA 4BL3A 3VFHA 4B4XA 4OP5A 4R0QA 5FI2A 1N9BA 1TDGA 3UPNA 1XX2A 1KVLA 4QD4A 1L0FA 4ZAMA 3NCKA 4KZ7A 4N1HA 1W8YA 3IWOA 1RP5A 4P85A 5F1FA 3BFFA 1BULA 3IXDA 2J8YA 4RA7A 5CTMA 2IWBA 4EBLA 5KZHA 3BEBA 3IQAA 1MKIA 4WBGA 3G34A 3BYDA 2EX9A 5GLBA 1XPBA 4N9KA 4OQGA 1DJAA 4IEDA 4D2OA 4WEJA 2JBFA 1EWZA 2ZQ7A 1Q2QA 2HP9A 3VP4A 4EBPA 5HAIA 2XEPA 2XGNA 3RJUA 1W5DA 3VSKA 3UN7A 5CEDA 3ZHHA 3WS0A 1IYSA 2R9XA 4DXCA 4DXBA 3IHAA 2WZXA 4BL2A 1WE4A 4PM8A 2Y91A 3IXBA 3PBNA 4WMCD 3O87A 3W8KA 3DTMA 3HLCA 2WAFA 1HD8A 1L2SA 1ONGA 1TDLA 1CEGA 1BLHA 3BFDA 4WM9A 1W8QA 5FAQA 5CECA 1FSWA 1PYYA 4KZ5A 3VP3A 1ESIA 1PIOA 3SH7A 4PM5A 2PU2A 4LV2A 4NK3A 3MZDA 2OLVA 4GZBA 1K54A 3V39A 4BD0A 1WYCA 3E2LA 5HFOA 1SDEA 3MBZA 3A3DA 2Z2MB 4KG6A 4RVAA 4Y0UA 3UDFA 4GKUA 3HREA 5DTTA 1C3BA 1L0DA 2X71A 3ZVWA 1K38A 3BFCA 3FV7A 3PAEA 5DTSA 2XFTA 5GLDA 1MPLA 2H0TA 2Y2QA 3G2YA 3BLMA 5HAQA 4ZJ1A 3MXSA 5E2HA 3Q81A 1YM1A 3WS2A 3ZCZA 4X53A 2X01A 1HVBA 2ZM0A 1JWPA 1YLPA 4S2OA 3ZNTA 2CC1A 2JE5A 3CMZA 3UE0A 5HW3A 4OH0A 4KZ9A 2V20A 4L0LA 4MBKA 3SH8A 2XLNA 2XF3A 4DF6A 4JLFA 2DRWA 1GHPA 5GHZA 3Q7ZA 4GD6A 2BLSA 2P9VB 2Y2MA 3GSGA 2ZQDA 2WKHA 4KQOA 2WGIA 3VP1A 3ZGAB 1IEMA 2J9OA 4N9LA 1PI5A 3M2JA 4MBHA 3ZG0A 5CHUA 3G31A 4PM9A 3VOZA 3I7JA 3HLGA 4WZ4A 3PBRA 5EPHA 5M18A 1Q2PA 3WRZA 3V3RA 5GHYA 5CTNA 3UE3A 5EUAA 2H5SA 4X55A 1ERQA 2G2UA 3GMWA 5I94A 1MBLA 5EVLA 3RXWA 5EE8A 4LENA 5AQAA 4DRTA 4JXVA 2H10A 4LV1A 4E3MA 3Q7VA 5TFQA 1CK3A 2WADA 4C3QA 3MKEA 5G18A 5EVIB 4DKIA 1AXBA 4U0XA 4LV0A 4PM6A 2Y2GA 1XA1A 3CZDA 5JYPA 5E2GA 3CG5A 4CPKA 5E43A 3N4IA 5CHMA 1EI5A 2I72A 1XGIA 3QHYA 4FH4A 2WGWB 1KVMA 5EECA 2UWXA 3VMAA 4CJNA 4Q8IA 4XXRA 2XDMA 3C7VA 1YQSA 2EFXA 1E3UD 1ZG4A 3G35A 3Q82A 4JKTA 4K0WA 4S2NC 4EUZA 5M19A 1QMEA 3C5AA 4JF6A 2RL3A 1KE0A 1JTDA 4DE2A 2ZC4B 2DCFA 3MFDA 1H5XA 3N7WA 1ZKJA 1K6RA 3IF6B 1G6AA 5CXWA 4OLDA 1GCEA 5A91A 2C6WB 1YMXA 4DDYA 1EROA 1YLWA 3OPLA 3A3FA 5M1AA 2EX8A 3SH9A 3LEZA 5EVID 3OPRA 1K54C 3BECA 1M6KA 3NC8A 4KZBA 5CHJA 5FA7A 4R4RA 2EXAA 4WEKA 4Z9QA 5U47A 3UDXA 4WMCA 4GD8A 2ZQAA 4UAAA 3P09A 3HLDA 3QNBA 1FR1A 4E3OA 5KSCA 2XD5A 2OSUA 3PTEA 1BZAA 5FAOA 4BQMA 1CEFA 1KE4A 5J8XA 1RGZA 2WKIA 3OC2A 1BTLA 1ZC2A 5HL1A 3W4PA 1FR6A 3NBLA 4MBFA 3UDIA 4OQIA 3UE1A 3IWQA 2ZQ8A 5DTKA 3WS4A 4E3IA 2XR0A 3FZCA 3EQUA 3ITBA 2WAEA 1L0GA 5EOEA 3GR2A 1GA0A 3MXRA 1CI9A 4JF5A 2HPBA 3FKWA 3IHBA 4DDSA 4KZ6A 3FWLA 4S2NA 5D3OA 1BLCA 1LL5A 3WS5A 1DJBA 4C75A 1K57C 4NETA 2Q9MA 3SOIA 1FCNA 5FASA 4IBXA 3NDEA 4ZBEA 4WELA 3CJMA 4JXWA 4M3KA 4MEZA 4EWFA 1GHMA 3UPOA 1XP4A 5FQJA 1K6SA 1NYYA 2JC7A 1LLBA 4KZ8A 5GLAA 1ES5A 2WZZA 4FCFA 4JXGA 3HUOA 4KG2A 5CEBA 1VM1A 2Y2PA 1BLSA 2IWDA 3VOYA 5FI6A 4IBRA 1ZG6A 5EOOA 3VP0A 5BOHA 2G2WA 4R3BA 3HL9A 2RCXA 5CRFA 2Y2LA 3HLFA 3WS1A 4BD1A 3OCLA 5FQKA 4OPRA 4S2LA 2Y2OA 1XKZA 3UO9A 5FQMA 1NY0A 4Y0TA 1PWGA 3HBRA 5TR7A 1K55C 2WYXA 1VQQA 4PMAA 3PBQA 4R1GA 1IELA 1K57A 1MY8A 3AGFA 4K91A 4RYEA 4S2KA 3G32A 1SDNA 2ZC3B 4EBNA 4P87A 3SS5A 1MWTA 1Y54A 4OPYA 4UA9A 2ZQCA 1BSGA 1PZPA 2J9PA 1DY6A 3PBTA 3VP2A 1MWUA 4ID4A 1JWVA 2XQZA 3M2KA 1NJ4A 3ZG5A 4IVIA 1ONHA 2P9VA 3SS3A 3N8SA 2OLUA 3TOIA 3C7UA 1XGJA 2QPNA 3PBOA 4S2IA 3G4PA 4DE0A 1LL9A 5FQIA 3UNWA 3QNCA 4X56A 2XD1A 1RGYA 2VGKA 1E3UA 3C4PA 4MLLA 1K25A 1NXYA 3A3EA 1PZOA 3JYIA 3N6IA 4MNRA 3S4XA 4UA7A 3DW0A 4JF4A 1N4OA 1PWCA 2GDNA 3HLWA 1H8YA 4KZ3A 1LI0A 3OPPA 1FQGA 3PBSA 3VSLA 4OOYA 1MWSA 4R3JA 3IXHA 1JTGA 4JXSA 5TGFA 2XK1A 3RXXA 1K4FA 1K55A 2PU4A 3M6HA 1KGGA 1BT5A 2Y2JA 3WRTA 4BLMA 5GLCA 1SKFA 2EX6A 4QY6A 4LCMA 4R4SA 2EXBA 1G68A 2XH9A 2FFFB 1IKIA 2V1ZA 2C5WB 1SHVA 4E6WA 3Q7VB 4QB8A 4E3LA 2HDUA 2WGWA 1CI8A 1O7EA 1HTZA 3NIAA 3LCEA 3O3VA 2ZMAA 3FYZA 5IHVA 4B4ZA 5AQ7A 1FOFA 2IWCA 3B3XA 3IF5A 4EQIA 5CERA 5DF9A 2Y2KA 5FI7A 4OONA 4ZJ3A 3UPPA 4LV3A 2QMIA 2ZLYA 3O88A 3TG9A 3W4OA 3IF6A 4XUZA 2ZD8A 5KSHA 4H8RA 4KZ4A 1PI4A 1S6RA 1J9MA 2Y2NA 3ISGA 4S2PA 3BM6A 1W79A 2B5RA 1GHIA 2WK0A 3GRJA 4XUXA 4O7DA 4GNUA 4X68A 3V50A 3NDGA 4QHCA 4QJGA 4JPMA 5FAPA 2HDRA 1K56D 1I2WA 2P74A 3BFEA 4A5RA 5AQ9A 4FSFA 2Y55A 2J7VA 3HLBA 4U0TA 1RCJA 3AGDA 2HDQA 5A90A 4OLGA 3MZFA 3ZVTA 1MXOA 1KGFA 5CGXA 3ZG9B 3SS4A 4YFMA 2EX2A 2X02A 3IT9A 1LHYA 3N8RA 4RX2A 3W4QA 2ZC6B 4FH2A 4Y0OA 4F94A 2ZJ9A 1NZOA 3DWZA 1FCMA 1O07A 3M6BA 3P98A 4GB7A 3C4OA 3BLSA 3LO7A 3VFFA 3IH8A 4GOGA 4ZTKA 3OCNA 1BUEA 4HBUA 4X69A 4HEFA 3O86A 5A92A 2BG1A 1FCOA 4EV4A 3PAGA 4QU3A 3OZHA 3OPHA 1LI9A 1XA7A 4OOMA 5E2FA 4ZJ2A 4HBTA 3S22A 3FKVA 1YLYA 3BFGA 3WWXA 1KGEA 3ZDJA 1ERMA 1I2SA 2H0YA 3NI9A 4OKPA 4KQRA 3G2ZA 4S2JA 1KE3A 5DVAA 3Q1FA 4OP8A 1PW1A 3IH9A 1IYQA 2XFSA 2ZC5B 1KDWA 1KDSA 1ALQA 3GV9A 3IWIA 4WZ5C 5HX9A 1ESUA 3N8LA 3LY4A 4HESA 5EVIC 3AGEA 4WYYA 1HZOA 3UY6A 4DE3A 1S0WA 3ZNYA 2JCHA 5A93A 3ZFZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q07 A;  4P6B A;  3HUN A;  1FSY A;  3A3I A;  2ZM8 A;  4BJP A;  1JWZ A;  1NYM A;  1Z6F A;  3GQZ A;  4N92 A;  1PW8 A;  4PPR A;  3GVB A;  2Z2L B;  4KQQ A;  4OVD A;  5HAR A;  2R9W A;  4LCL A;  3V5M A;  3S1Y A;  4S2M A;  5HAP A;  1W7F A;  5F83 A;  2PBY A;  5F1G A;  5FAT A;  4K0X A;  4KZA A;  2DNS A;  5L2F A;  4UHU A;  2QZ6 A;  4B88 A;  1ES2 A;  1MWR A;  4UA6 A;  2WUQ A;  3EQV A;  3IF6 C;  1E25 A;  5JYO A;  1XXM A;  4Y7P A;  3BRM A;  1OME A;  3LY3 A;  4JBF A;  5FQQ A;  1U60 A;  2Y2I A;  3ZG7 B;  2VGJ A;  4OPQ A;  1QMF A;  3MKF A;  4WZ5 A;  3MZE A;  3NY4 A;  5CGW A;  5DF7 A;  1GA9 A;  5EVI A;  4E3K A;  4U3T A;  1YLT A;  1YT4 A;  4BEN A;  2HDS A;  3D4F A;  1ES4 A;  4PM7 A;  5CGS A;  1E4D A;  4RX3 A;  1JVJ A;  2A49 A;  2Y59 A;  1K4E A;  1IKG A;  2HP6 A;  1WYB A;  2ZC7 A;  4KG5 A;  3HUM A;  5F82 A;  1NZU A;  1K56 A;  2Y2H A;  5FDH A;  1PWD A;  1DJC A;  3ZG8 B;  5AQB A;  4IVK A;  5GHX A;  3G30 A;  3ITA A;  4DE1 A;  5KMW A;  1YMS A;  4FD8 A;  4E3J A;  4E6X A;  2Q9N A;  4YIN A;  4GDN A;  5DF8 A;  1TVF A;  2V2F F;  4ZDX A;  1IYO A;  1NRF A;  1IYP A;  1TEM A;  4GDB A;  5FSR A;  2HP5 A;  2E8I A;  2WKE A;  4KEN B;  2EFU A;  1SCW A;  3E2K A;  1L0E A;  3DWK A;  3GTC A;  1M40 A;  1ES3 A;  3TSG A;  2Y4A A;  4R23 A;  1YLJ A;  1I5Q A;  4E3N A;  3V3S A;  5GL9 A;  1BLP A;  3HLE A;  3A3J A;  2WGV A;  4P0M A;  5FQ9 A;  4C6Y A;  3HVF A;  4OOL A;  1H8Z A;  4OPZ A;  4OQH A;  2A3U A;  2OV5 A;  2FFY A;  4OQ0 A;  2ZM2 A;  5E2E A;  4N1X A;  4GN2 A;  4QY5 A;  3IXG A;  4X6T A;  2ZQ9 A;  1YLZ A;  4BL3 A;  3VFH A;  4B4X A;  4OP5 A;  4R0Q A;  5FI2 A;  1N9B A;  1TDG A;  3UPN A;  1XX2 A;  1KVL A;  4QD4 A;  1L0F A;  4ZAM A;  3NCK A;  4KZ7 A;  4N1H A;  1W8Y A;  3IWO A;  1RP5 A;  4P85 A;  5F1F A;  3BFF A;  1BUL A;  3IXD A;  2J8Y A;  4RA7 A;  5CTM A;  2IWB A;  4EBL A;  5KZH A;  3BEB A;  3IQA A;  1MKI A;  4WBG A;  3G34 A;  3BYD A;  2EX9 A;  5GLB A;  1XPB A;  4N9K A;  4OQG A;  1DJA A;  4IED A;  4D2O A;  4WEJ A;  2JBF A;  1EWZ A;  2ZQ7 A;  1Q2Q A;  2HP9 A;  3VP4 A;  4EBP A;  5HAI A;  2XEP A;  2XGN A;  3RJU A;  1W5D A;  3VSK A;  3UN7 A;  5CED A;  3ZHH A;  3WS0 A;  1IYS A;  2R9X A;  4DXC A;  4DXB A;  3IHA A;  2WZX A;  4BL2 A;  1WE4 A;  4PM8 A;  2Y91 A;  3IXB A;  3PBN A;  4WMC D;  3O87 A;  3W8K A;  3DTM A;  3HLC A;  2WAF A;  1HD8 A;  1L2S A;  1ONG A;  1TDL A;  1CEG A;  1BLH A;  3BFD A;  4WM9 A;  1W8Q A;  5FAQ A;  5CEC A;  1FSW A;  1PYY A;  4KZ5 A;  3VP3 A;  1ESI A;  1PIO A;  3SH7 A;  4PM5 A;  2PU2 A;  4LV2 A;  4NK3 A;  3MZD A;  2OLV A;  4GZB A;  1K54 A;  3V39 A;  4BD0 A;  1WYC A;  3E2L A;  5HFO A;  1SDE A;  3MBZ A;  3A3D A;  2Z2M B;  4KG6 A;  4RVA A;  4Y0U A;  3UDF A;  4GKU A;  3HRE A;  5DTT A;  1C3B A;  1L0D A;  2X71 A;  3ZVW A;  1K38 A;  3BFC A;  3FV7 A;  3PAE A;  5DTS A;  2XFT A;  5GLD A;  1MPL A;  2H0T A;  2Y2Q A;  3G2Y A;  3BLM A;  5HAQ A;  4ZJ1 A;  3MXS A;  5E2H A;  3Q81 A;  1YM1 A;  3WS2 A;  3ZCZ A;  4X53 A;  2X01 A;  1HVB A;  2ZM0 A;  1JWP A;  1YLP A;  4S2O A;  3ZNT A;  2CC1 A;  2JE5 A;  3CMZ A;  3UE0 A;  5HW3 A;  4OH0 A;  4KZ9 A;  2V20 A;  4L0L A;  4MBK A;  3SH8 A;  2XLN A;  2XF3 A;  4DF6 A;  4JLF A;  2DRW A;  1GHP A;  5GHZ A;  3Q7Z A;  4GD6 A;  2BLS A;  2P9V B;  2Y2M A;  3GSG A;  2ZQD A;  2WKH A;  4KQO A;  2WGI A;  3VP1 A;  3ZGA B;  1IEM A;  2J9O A;  4N9L A;  1PI5 A;  3M2J A;  4MBH A;  3ZG0 A;  5CHU A;  3G31 A;  4PM9 A;  3VOZ A;  3I7J A;  3HLG A;  4WZ4 A;  3PBR A;  5EPH A;  5M18 A;  1Q2P A;  3WRZ A;  3V3R A;  5GHY A;  5CTN A;  3UE3 A;  5EUA A;  2H5S A;  4X55 A;  1ERQ A;  2G2U A;  3GMW A;  5I94 A;  1MBL A;  5EVL A;  3RXW A;  5EE8 A;  4LEN A;  5AQA A;  4DRT A;  4JXV A;  2H10 A;  4LV1 A;  4E3M A;  3Q7V A;  5TFQ A;  1CK3 A;  2WAD A;  4C3Q A;  3MKE A;  5G18 A;  5EVI B;  4DKI A;  1AXB A;  4U0X A;  4LV0 A;  4PM6 A;  2Y2G A;  1XA1 A;  3CZD A;  5JYP A;  5E2G A;  3CG5 A;  4CPK A;  5E43 A;  3N4I A;  5CHM A;  1EI5 A;  2I72 A;  1XGI A;  3QHY A;  4FH4 A;  2WGW B;  1KVM A;  5EEC A;  2UWX A;  3VMA A;  4CJN A;  4Q8I A;  4XXR A;  2XDM A;  3C7V A;  1YQS A;  2EFX A;  1E3U D;  1ZG4 A;  3G35 A;  3Q82 A;  4JKT A;  4K0W A;  4S2N C;  4EUZ A;  5M19 A;  1QME A;  3C5A A;  4JF6 A;  2RL3 A;  1KE0 A;  1JTD A;  4DE2 A;  2ZC4 B;  2DCF A;  3MFD A;  1H5X A;  3N7W A;  1ZKJ A;  1K6R A;  3IF6 B;  1G6A A;  5CXW A;  4OLD A;  1GCE A;  5A91 A;  2C6W B;  1YMX A;  4DDY A;  1ERO A;  1YLW A;  3OPL A;  3A3F A;  5M1A A;  2EX8 A;  3SH9 A;  3LEZ A;  5EVI D;  3OPR A;  1K54 C;  3BEC A;  1M6K A;  3NC8 A;  4KZB A;  5CHJ A;  5FA7 A;  4R4R A;  2EXA A;  4WEK A;  4Z9Q A;  5U47 A;  3UDX A;  4WMC A;  4GD8 A;  2ZQA A;  4UAA A;  3P09 A;  3HLD A;  3QNB A;  1FR1 A;  4E3O A;  5KSC A;  2XD5 A;  2OSU A;  3PTE A;  1BZA A;  5FAO A;  4BQM A;  1CEF A;  1KE4 A;  5J8X A;  1RGZ A;  2WKI A;  3OC2 A;  1BTL A;  1ZC2 A;  5HL1 A;  3W4P A;  1FR6 A;  3NBL A;  4MBF A;  3UDI A;  4OQI A;  3UE1 A;  3IWQ A;  2ZQ8 A;  5DTK A;  3WS4 A;  4E3I A;  2XR0 A;  3FZC A;  3EQU A;  3ITB A;  2WAE A;  1L0G A;  5EOE A;  3GR2 A;  1GA0 A;  3MXR A;  1CI9 A;  4JF5 A;  2HPB A;  3FKW A;  3IHB A;  4DDS A;  4KZ6 A;  3FWL A;  4S2N A;  5D3O A;  1BLC A;  1LL5 A;  3WS5 A;  1DJB A;  4C75 A;  1K57 C;  4NET A;  2Q9M A;  3SOI A;  1FCN A;  5FAS A;  4IBX A;  3NDE A;  4ZBE A;  4WEL A;  3CJM A;  4JXW A;  4M3K A;  4MEZ A;  4EWF A;  1GHM A;  3UPO A;  1XP4 A;  5FQJ A;  1K6S A;  1NYY A;  2JC7 A;  1LLB A;  4KZ8 A;  5GLA A;  1ES5 A;  2WZZ A;  4FCF A;  4JXG A;  3HUO A;  4KG2 A;  5CEB A;  1VM1 A;  2Y2P A;  1BLS A;  2IWD A;  3VOY A;  5FI6 A;  4IBR A;  1ZG6 A;  5EOO A;  3VP0 A;  5BOH A;  2G2W A;  4R3B A;  3HL9 A;  2RCX A;  5CRF A;  2Y2L A;  3HLF A;  3WS1 A;  4BD1 A;  3OCL A;  5FQK A;  4OPR A;  4S2L A;  2Y2O A;  1XKZ A;  3UO9 A;  5FQM A;  1NY0 A;  4Y0T A;  1PWG A;  3HBR A;  5TR7 A;  1K55 C;  2WYX A;  1VQQ A;  4PMA A;  3PBQ A;  4R1G A;  1IEL A;  1K57 A;  1MY8 A;  3AGF A;  4K91 A;  4RYE A;  4S2K A;  3G32 A;  1SDN A;  2ZC3 B;  4EBN A;  4P87 A;  3SS5 A;  1MWT A;  1Y54 A;  4OPY A;  4UA9 A;  2ZQC A;  1BSG A;  1PZP A;  2J9P A;  1DY6 A;  3PBT A;  3VP2 A;  1MWU A;  4ID4 A;  1JWV A;  2XQZ A;  3M2K A;  1NJ4 A;  3ZG5 A;  4IVI A;  1ONH A;  2P9V A;  3SS3 A;  3N8S A;  2OLU A;  3TOI A;  3C7U A;  1XGJ A;  2QPN A;  3PBO A;  4S2I A;  3G4P A;  4DE0 A;  1LL9 A;  5FQI A;  3UNW A;  3QNC A;  4X56 A;  2XD1 A;  1RGY A;  2VGK A;  1E3U A;  3C4P A;  4MLL A;  1K25 A;  1NXY A;  3A3E A;  1PZO A;  3JYI A;  3N6I A;  4MNR A;  3S4X A;  4UA7 A;  3DW0 A;  4JF4 A;  1N4O A;  1PWC A;  2GDN A;  3HLW A;  1H8Y A;  4KZ3 A;  1LI0 A;  3OPP A;  1FQG A;  3PBS A;  3VSL A;  4OOY A;  1MWS A;  4R3J A;  3IXH A;  1JTG A;  4JXS A;  5TGF A;  2XK1 A;  3RXX A;  1K4F A;  1K55 A;  2PU4 A;  3M6H A;  1KGG A;  1BT5 A;  2Y2J A;  3WRT A;  4BLM A;  5GLC A;  1SKF A;  2EX6 A;  4QY6 A;  4LCM A;  4R4S A;  2EXB A;  1G68 A;  2XH9 A;  2FFF B;  1IKI A;  2V1Z A;  2C5W B;  1SHV A;  4E6W A;  3Q7V B;  4QB8 A;  4E3L A;  2HDU A;  2WGW A;  1CI8 A;  1O7E A;  1HTZ A;  3NIA A;  3LCE A;  3O3V A;  2ZMA A;  3FYZ A;  5IHV A;  4B4Z A;  5AQ7 A;  1FOF A;  2IWC A;  3B3X A;  3IF5 A;  4EQI A;  5CER A;  5DF9 A;  2Y2K A;  5FI7 A;  4OON A;  4ZJ3 A;  3UPP A;  4LV3 A;  2QMI A;  2ZLY A;  3O88 A;  3TG9 A;  3W4O A;  3IF6 A;  4XUZ A;  2ZD8 A;  5KSH A;  4H8R A;  4KZ4 A;  1PI4 A;  1S6R A;  1J9M A;  2Y2N A;  3ISG A;  4S2P A;  3BM6 A;  1W79 A;  2B5R A;  1GHI A;  2WK0 A;  3GRJ A;  4XUX A;  4O7D A;  4GNU A;  4X68 A;  3V50 A;  3NDG A;  4QHC A;  4QJG A;  4JPM A;  5FAP A;  2HDR A;  1K56 D;  1I2W A;  2P74 A;  3BFE A;  4A5R A;  5AQ9 A;  4FSF A;  2Y55 A;  2J7V A;  3HLB A;  4U0T A;  1RCJ A;  3AGD A;  2HDQ A;  5A90 A;  4OLG A;  3MZF A;  3ZVT A;  1MXO A;  1KGF A;  5CGX A;  3ZG9 B;  3SS4 A;  4YFM A;  2EX2 A;  2X02 A;  3IT9 A;  1LHY A;  3N8R A;  4RX2 A;  3W4Q A;  2ZC6 B;  4FH2 A;  4Y0O A;  4F94 A;  2ZJ9 A;  1NZO A;  3DWZ A;  1FCM A;  1O07 A;  3M6B A;  3P98 A;  4GB7 A;  3C4O A;  3BLS A;  3LO7 A;  3VFF A;  3IH8 A;  4GOG A;  4ZTK A;  3OCN A;  1BUE A;  4HBU A;  4X69 A;  4HEF A;  3O86 A;  5A92 A;  2BG1 A;  1FCO A;  4EV4 A;  3PAG A;  4QU3 A;  3OZH A;  3OPH A;  1LI9 A;  1XA7 A;  4OOM A;  5E2F A;  4ZJ2 A;  4HBT A;  3S22 A;  3FKV A;  1YLY A;  3BFG A;  3WWX A;  1KGE A;  3ZDJ A;  1ERM A;  1I2S A;  2H0Y A;  3NI9 A;  4OKP A;  4KQR A;  3G2Z A;  4S2J A;  1KE3 A;  5DVA A;  3Q1F A;  4OP8 A;  1PW1 A;  3IH9 A;  1IYQ A;  2XFS A;  2ZC5 B;  1KDW A;  1KDS A;  1ALQ A;  3GV9 A;  3IWI A;  4WZ5 C;  5HX9 A;  1ESU A;  3N8L A;  3LY4 A;  4HES A;  5EVI C;  3AGE A;  4WYY A;  1HZO A;  3UY6 A;  4DE3 A;  1S0W A;  3ZNY A;  2JCH A;  5A93 A;  3ZFZ A; 
#chains in the Genus database with same CATH topology
 3HUN A;  3PYP A;  1FSY A;  3CWF A;  2HV1 A;  4PPR A;  3GQZ A;  4N92 A;  4KQQ A;  4OVD A;  4LCL A;  3IX3 A;  2PBY A;  5FAT A;  3VOL A;  3OOV A;  4KZA A;  4EQ1 A;  5HDS A;  3T12 B;  1SKO B;  4RQ9 A;  1YSQ A;  2KOI A;  4LRY C;  4JBF A;  1LT0 A;  3KYQ A;  2FH5 A;  3BWL A;  3T4K A;  2ZOI A;  4U3T A;  1YT4 A;  3GEC A;  3A0S A;  2HDS A;  3D4F A;  1CJF A;  2J3W A;  2WKP A;  5CGS A;  2V1A A;  4KG5 A;  1NZU A;  4LRZ E;  1PWD A;  1DJC A;  4IHQ A;  4IVK A;  4DE1 A;  1YMS A;  4FD8 A;  4E6X A;  2Q9N A;  5DF8 A;  4YNR A;  2E8I A;  1SCW A;  4GS9 A;  1M40 A;  5EFW A;  2Y4A A;  3TSG A;  4E3N A;  1D1J A;  3HLE A;  5IT5 A;  1H8Z A;  4NG2 A;  5HPI A;  1OPX A;  2OV5 A;  2FFY A;  2ZM2 A;  2Q0O A;  4QY5 A;  4BL3 A;  5L10 A;  3LID A;  3VFH A;  1TDG A;  2JHE A;  3NCK A;  4N1H A;  1W8Y A;  1RP5 A;  1BUL A;  5CTM A;  2IWB A;  4WBG A;  3BYD A;  4Y2F A;  5HPF A;  4OQG A;  4I3I A;  1W5D A;  3VSK A;  3UN7 A;  5CED A;  3MS6 A;  4DXB A;  4EES A;  3PBN A;  3O87 A;  1HD8 A;  1L2S A;  1ONG A;  1TDL A;  1FSW A;  1P9R A;  1PYY A;  3VP3 A;  1ESI A;  1Y28 A;  2OLV A;  2VK3 A;  2WKR A;  3QP1 A;  1TD5 A;  3E2L A;  1S4S A;  4KG6 A;  3HRE A;  3ZVW A;  3BFC A;  3PAE A;  3P7N A;  1H0M A;  2L4R A;  1S66 L;  4ZJ1 A;  5E2H A;  3EEH A;  2X01 A;  1HVB A;  4HQA A;  4S2O A;  1AWI A;  3ZNT A;  3CPT B;  3T50 A;  4L0L A;  2XF3 A;  5AVE A;  1SKO A;  4PHT A;  4GD6 A;  2P9V B;  2ZQD A;  3DTI A;  4I3A A;  4N9L A;  3ZG0 A;  4PM9 A;  2GZA A;  3NHQ A;  3I7J A;  3HLG A;  3NJA A;  2P7J A;  3DTE A;  3KSH A;  3TJZ C;  3GMW A;  5EVL A;  5EE8 A;  4LEN A;  4MN5 A;  4EER A;  1TS6 A;  1CK3 A;  4ARZ A;  3MKE A;  1AXB A;  4U0X A;  2Y2G A;  3CZD A;  3MFX A;  4L9F A;  1XGI A;  2WGW B;  1YAX A;  3E4Q A;  3KSG A;  3A0R A;  4S2N C;  1PFL A;  3Q82 A;  4JKT A;  1UGU A;  4DJ2 A;  2ZC4 B;  3MFD A;  1P9W A;  3B47 A;  1ZKJ A;  3IF6 B;  3LGO A;  1YMX A;  2ZBB A;  2EX8 A;  3LEZ A;  3CUE A;  1M6K A;  5FA7 A;  2QJ5 A;  2EXA A;  3P09 A;  2VEA A;  3QNB A;  2OSU A;  5J8X A;  1BZA A;  5AJG A;  3OC2 A;  1ZC2 A;  1F9I A;  1FR6 A;  4MBF A;  2D01 A;  3KO6 A;  3UE1 A;  3WS4 A;  4E3I A;  2PT7 A;  1L0G A;  3KSI A;  4JF5 A;  3FKW A;  1UWP X;  3FWL A;  1VET B;  3RTY A;  4NET A;  2Q9M A;  3TE8 A;  5FAS A;  4ZBE A;  3NUL A;  4JXW A;  4MEZ A;  4NEE D;  1GHM A;  1XP4 A;  1K6S A;  1OJ5 A;  2JC7 A;  1OTB A;  2HJE A;  3RFB A;  5F5Y A;  3VP0 A;  4ETZ A;  5BOH A;  4R3B A;  2K2N A;  3HL9 A;  3T4S A;  2K31 A;  3LR0 A;  3OCL A;  4OPR A;  5A8B A;  1XKZ A;  1BYW A;  1DRM A;  1IEL A;  1K57 A;  1MY8 A;  3CPT A;  1MWT A;  4H6J B;  2ZQC A;  1BSG A;  3TW8 A;  3VP2 A;  3LEQ A;  4L9E A;  2DMW A;  4IVI A;  1P0Z A;  1ONH A;  2P9V A;  2Z6D A;  1T1A A;  4S2I A;  3G4P A;  5FQI A;  2O9C A;  4X56 A;  2XD1 A;  4MLL A;  3N6I A;  3S4X A;  4UA7 A;  2XSS A;  4JF4 A;  4Y13 A;  1LL8 A;  3HLW A;  4KZ3 A;  1LI0 A;  2A24 B;  3OPP A;  4ME4 A;  4EEP A;  1S1Z A;  1JTG A;  4JXS A;  4HY8 A;  5TGF A;  1K55 A;  1KGG A;  1BT5 A;  2GNX A;  2V0U A;  2PDR A;  2EXB A;  2H28 A;  2XH9 A;  5C5K A;  1MC0 A;  2WGW A;  1O7E A;  2GJ3 A;  3LCE A;  3FYZ A;  5AQ7 A;  3W2Z A;  1FOF A;  4EQI A;  1DP9 A;  5HWW A;  5J4E A;  4ZJ3 A;  3TG9 A;  3IF6 A;  4XUZ A;  2QHK A;  5KSH A;  2OAQ 1;  4BBT A;  4S2P A;  4X25 A;  2M7V A;  3LIB A;  3JVV A;  3NDG A;  2VGL S;  2VV7 A;  2JKT M;  2PYP A;  2Y55 A;  2J7V A;  2HDQ A;  4OLG A;  4GHI B;  3ZVT A;  5AVF A;  3NOP C;  5DFX A;  3IT9 A;  1W63 M;  3N8R A;  4RX2 A;  5HD5 A;  3O5Y A;  1VET A;  3P98 A;  3C4O A;  3BLS A;  3MSH A;  2VJW A;  3DAV A;  3O86 A;  4QU3 A;  5F6A A;  4OOM A;  3T4J A;  3H9W A;  1T19 A;  3S22 A;  3T1S A;  3BFG A;  1ERM A;  1I2S A;  3NI9 A;  3G2Z A;  4S2J A;  2XRN A;  5EM1 A;  3Q1F A;  4OP8 A;  3GV9 A;  5HX9 A;  3UY6 A;  3CHW P;  4P6B A;  4FOF A;  3A3I A;  2ZM8 A;  3EWK A;  1Z6F A;  2Z2L B;  5HAP A;  4NXG A;  2DNS A;  3SZT A;  3D9Y A;  2QZ6 A;  4B88 A;  1MWR A;  4EET B;  2WUQ A;  3BQ8 A;  5JYO A;  3LY3 A;  2Y2I A;  3ZG7 B;  2VGJ A;  3LR4 A;  4OPQ A;  4WZ5 A;  2A24 A;  3VV4 A;  5CGW A;  5DF7 A;  5EVI A;  2W3F A;  3PXP A;  1YLT A;  5FEF A;  3IBJ A;  4PM7 A;  3LR5 A;  4HH3 A;  2A49 A;  2Y59 A;  2ZC7 A;  2Y2H A;  1K56 A;  2ZL1 A;  3QP5 A;  5GHX A;  5KMW A;  4E3J A;  4YIN A;  1FIK A;  5EVE A;  3K3C A;  5TBM B;  1TEM A;  4EU0 A;  2O0Y A;  2WKE A;  1KOU A;  1YLJ A;  1I5Q A;  1BLP A;  2VZW A;  3A3J A;  5FQ9 A;  4C6Y A;  4DJ3 A;  1OTI A;  4OQ0 A;  4GN2 A;  2JKR M;  3NOU C;  3IXG A;  4R38 A;  4EW7 A;  4B4X A;  4R0Q A;  5FI2 A;  1N9B A;  3UPN A;  4GHI A;  1KVL A;  4QD4 A;  4CLC B;  3IWO A;  4P85 A;  5F1F A;  3IXD A;  2J8Y A;  5KZH A;  3IQA A;  5EV0 A;  2EX9 A;  3R7W B;  4N9K A;  3S7P A;  1VEU B;  4D2O A;  4WEJ A;  3LI9 A;  3LIE A;  2ZQ7 A;  4EBP A;  2XEP A;  3RJU A;  3ZHH A;  1WA9 A;  1IYS A;  4DXC A;  4Q0H A;  1MKM A;  1TF1 A;  1WE4 A;  3MF0 A;  2Y91 A;  4WMC D;  2Y8H A;  2MJ6 A;  1OTA A;  4KZ5 A;  4CQH A;  4LV2 A;  4NK3 A;  4GZB A;  2XA7 M;  2ZMV A;  1SDE A;  2Z2M B;  4RVA A;  4GKU A;  1L0D A;  5IS1 A;  1MPL A;  1TS7 A;  2Y2Q A;  3G2Y A;  3A0V A;  3UB8 A;  4X53 A;  2ZM0 A;  4NXB A;  3T4L A;  3PHY A;  4MBK A;  3SH8 A;  2XLN A;  3V67 A;  2INW A;  4DF6 A;  2DRW A;  1GHP A;  1LSV A;  2Y2M A;  3GSG A;  3R4K A;  3VP1 A;  3ZGA B;  4MBH A;  3VOZ A;  2YKF A;  3ICY A;  1IOU A;  5EPH A;  2JN7 A;  5M18 A;  1Q2P A;  2H5S A;  3CUE C;  2HGV A;  5AQA A;  4JXV A;  2H10 A;  4JGO A;  3EGX C;  3Q7V A;  4ZRR A;  5G18 A;  4DKI A;  2O9B A;  4LV0 A;  4YWZ A;  1EI5 A;  5TBM A;  3QHY A;  4FH4 A;  5EEC A;  4CJN A;  2XDM A;  3C7V A;  1ZG4 A;  4EUZ A;  5FEG A;  5M19 A;  1OTD A;  2DCF A;  1G6A A;  5CXW A;  2NUP C;  1Z09 A;  5M1A A;  5EVI D;  3OPR A;  1K54 C;  3BEC A;  4R6L A;  3NC8 A;  5CHJ A;  5G4Z A;  4R4R A;  4AFI A;  4UAA A;  3HLD A;  4E3O A;  3PTE A;  4CLC A;  1KE4 A;  1BTL A;  2GX5 A;  3NBL A;  2XR0 A;  3R7W A;  3ITB A;  1VEU A;  3GR2 A;  1GA0 A;  3MXR A;  4KZ6 A;  5D3O A;  1DJB A;  1K57 C;  3SOI A;  1FCN A;  3T1Q B;  3JVU A;  2P08 A;  4EWF A;  1L3L A;  1NYY A;  2WZZ A;  3HUO A;  1TS8 A;  2Y2P A;  4IBR A;  4LRX C;  5DKK A;  2RCX A;  3WS1 A;  4HP9 A;  5KIZ A;  3C8C A;  2Y2O A;  4QPR A;  3UO9 A;  1NY0 A;  2VGL M;  1K55 C;  1VQQ A;  4S2K A;  3AGF A;  4K91 A;  1GSV A;  3G32 A;  4HOI A;  3SS5 A;  4GJ4 A;  4OPY A;  5TJJ A;  4ID4 A;  2XQZ A;  3SS3 A;  3N8S A;  2OLU A;  3C7U A;  4X1L A;  4DE0 A;  1JNU A;  4IJG A;  3QP6 A;  1E3U A;  4NXF A;  1NXY A;  1PZO A;  5DJT A;  2GDN A;  1H8Y A;  3PBS A;  3ZQ5 A;  4R3J A;  1J3W A;  3IXH A;  3UB6 A;  1EW0 A;  1K4F A;  2PU4 A;  3M6H A;  3WRT A;  1SKF A;  2EX6 A;  3L7H A;  4LPZ A;  4B93 A;  2FFF B;  2QJ7 A;  1HTZ A;  5CER A;  2Y2K A;  5G4Y A;  2ZLY A;  3W4O A;  3MQ0 A;  3H82 B;  4H8R A;  4I38 A;  1J9M A;  3ISG A;  4EEU A;  1N9N A;  3F1P B;  5HDC A;  3GRJ A;  4X68 A;  2V8C A;  4QHC A;  4JPM A;  3CLO A;  5HDD A;  4FSF A;  3SW1 A;  4X1M A;  4YFM A;  2PAV P;  2X02 A;  3W4Q A;  4O8G A;  3DWZ A;  1XJ3 A;  2J3T C;  2VLG A;  3LO7 A;  2B95 A;  3OCN A;  4HBU A;  4X69 A;  5A92 A;  2BG1 A;  1XA7 A;  3EEA A;  4OKP A;  1TS0 A;  1CQA A;  1KE3 A;  1IYQ A;  3IWI A;  4WZ5 C;  4R70 A;  5EVI C;  1OJG A;  1S0W A;  4KUK A;  3ZFZ A;  4BJP A;  1JWZ A;  1PW8 A;  3KX0 X;  3S1Y A;  2BAS A;  4S2M A;  1W7F A;  1ZTU A;  5F1G A;  4K0X A;  2CMN A;  2HJ9 C;  1ES2 A;  4UA6 A;  3EQV A;  3DBA A;  1E25 A;  1OME A;  5FQQ A;  1U60 A;  3MKF A;  3S7O A;  3MZE A;  4UQI S;  1GA9 A;  2KLI A;  4E3K A;  5L07 A;  4BEN A;  1ES4 A;  2VX8 A;  1E4D A;  4WUJ A;  3L9K A;  2HP6 A;  2JKG A;  5AQB A;  3ITA A;  3C30 A;  2V2F F;  4ZDX A;  1IYP A;  1G5U A;  5FSR A;  2HP5 A;  2PR5 A;  3DWK A;  3GTC A;  3E4O A;  3T1X A;  1YKD A;  3H82 A;  1ES3 A;  3V3S A;  2PBD P;  5GL9 A;  2KDK A;  2WGV A;  4P0M A;  3HVF A;  4OOL A;  3F1P A;  4OPZ A;  4OQH A;  3IBR A;  3E0Y A;  5E2E A;  4N1X A;  1G6O A;  2ZQ9 A;  3H7W B;  1XX2 A;  2W3H A;  1L0F A;  2V0W A;  5K5B A;  4BBU A;  2WKQ A;  4EBL A;  3BEB A;  4WF0 A;  1MKI A;  1SZV A;  5GLB A;  3T4O A;  5DFY A;  1XPB A;  1DJA A;  2JBF A;  2HP9 A;  4DN0 A;  3UB7 A;  3WS0 A;  4BL2 A;  3BY8 A;  3P01 A;  1D7E A;  3DTM A;  1YPR A;  1CEG A;  3BFD A;  5CEC A;  1W8Q A;  3C38 A;  2K7S A;  1MZU A;  4XT2 B;  3VE4 A;  3LFV A;  1H8M A;  5HFO A;  3A3D A;  5L8M A;  5DTT A;  1C3B A;  5DTS A;  2XFT A;  5GLD A;  2JKT I;  4H6J A;  4P6Z S;  2H0T A;  2B18 A;  3MXS A;  4DMZ A;  3Q81 A;  1YM1 A;  3ULF A;  4GCZ A;  2CC1 A;  1FIL A;  3CMZ A;  4OH0 A;  4KZ9 A;  2V20 A;  4HI4 A;  5GHZ A;  2BLS A;  2IA2 A;  2O99 A;  2WKH A;  1IEM A;  1G28 A;  2J9O A;  1PI5 A;  3M2J A;  5CHU A;  4WZ4 A;  3PBR A;  3E4P A;  1P97 A;  2M7U A;  5GHY A;  5CTN A;  3BJN A;  1NWZ A;  1PNE A;  1ERQ A;  3LYX A;  4LGW A;  3QP4 A;  1ODV A;  5TFQ A;  4Y3I A;  4CLC C;  2PD7 A;  4PM6 A;  1XA1 A;  3QP2 A;  5JYP A;  4CLC E;  3CG5 A;  4F3L B;  3N4I A;  5CHM A;  2I72 A;  2QYB A;  3UB5 P;  3MMH A;  3K3D A;  2UWX A;  4HP4 A;  2EFX A;  3G35 A;  4K0W A;  1JTD A;  2AVX A;  4JGP A;  3N7W A;  5HD3 A;  3MJQ A;  4LFU A;  5F68 A;  5A91 A;  2C6W B;  1ERO A;  2OWH A;  3OPL A;  3A3F A;  4O0P A;  2LB5 A;  3UMD A;  3UDX A;  3UME A;  1FR1 A;  4FTX A;  5KSC A;  3MQQ A;  5HWT A;  2XD5 A;  1CEF A;  2WKI A;  3W4P A;  2LB9 A;  4HIA A;  2ZQ8 A;  2NUT C;  2Y79 A;  4O01 A;  3FZC A;  3IS2 B;  3EQU A;  5EOE A;  1LSX A;  5F69 A;  1LL5 A;  3WS5 A;  4C75 A;  3QP8 A;  4IBX A;  4WEL A;  3CJM A;  1VHM A;  4M3K A;  2PD8 A;  3CAX A;  5FDS A;  1LLB A;  4KZ8 A;  5GLA A;  3B42 A;  1ES5 A;  3F1O B;  2ZMF A;  4JXG A;  4KG2 A;  5L09 A;  5CEB A;  2W3D A;  4XT2 A;  2IWD A;  1T1C A;  4WLA A;  1XJ6 A;  2G2W A;  5CRF A;  4BBV A;  4BD1 A;  5FQK A;  4D60 A;  2JKR I;  1V9Y A;  5FQM A;  1PWG A;  3HBR A;  5TR7 A;  2WYX A;  4KUO A;  3PBQ A;  4PAU A;  4R1G A;  4RYE A;  1SDN A;  4EBN A;  5LBR A;  1PZP A;  2L0W A;  1NLZ A;  1DY6 A;  1V9Z A;  1MWU A;  4I3J A;  1XGJ A;  2QPN A;  3UNW A;  1RGY A;  4HH2 A;  3C4P A;  3JYI A;  4G3V A;  4PKY G;  3BY9 A;  3T4T A;  1N4O A;  2J3T D;  2I9V A;  3VSL A;  4OOY A;  3U2A A;  3LI8 A;  4WN5 A;  5I5L A;  4QY6 A;  2L1M A;  3EGD C;  4LCM A;  4R4S A;  3U4L P;  2FZ0 A;  3LIC A;  4F3L A;  2C5W B;  2OOL A;  1SHV A;  4E3L A;  3NIA A;  4ARZ B;  4IUH A;  2ZOH A;  3O3V A;  3RH8 B;  2IWC A;  2VV8 A;  4R3A A;  5FI7 A;  3O88 A;  4KZ4 A;  1ACF A;  1PI4 A;  1S6R A;  2M1C A;  4HHD A;  2Y2N A;  3BM6 A;  4G3K A;  1W79 A;  2B5R A;  1GHI A;  2WK0 A;  4O7D A;  3KYZ A;  3V50 A;  4QJG A;  5FAP A;  2HDR A;  1K56 D;  2P74 A;  4A5R A;  5AQ9 A;  4YOF A;  2PYR A;  4U0T A;  1RCJ A;  1S67 L;  3AGD A;  3MZF A;  1XFQ A;  1KGF A;  5CGX A;  3SS4 A;  1T18 A;  3IS2 A;  1S1Y A;  2EX2 A;  4UQI M;  3NEC A;  2ZC6 B;  4FH2 A;  4F94 A;  5HZH A;  4Z1W A;  4HJ4 A;  1O07 A;  2W3G A;  1GSX A;  3IH8 A;  1BUE A;  1XJ4 A;  1FCO A;  3PAG A;  4M4X A;  3OZH A;  3T1R A;  1LI9 A;  3F1O A;  4MMN A;  3FKV A;  1D06 A;  3ZDJ A;  2H0Y A;  3BQA A;  3BW6 A;  4KQR A;  1PW1 A;  1YSP A;  3IH9 A;  2KX6 A;  1KDW A;  1ESU A;  4WL9 A;  3N8L A;  4HES A;  3AGE A;  4WYY A;  1HZO A;  4DE3 A;  3ZNY A;  2JCH A;  3Q07 A;  1NYM A;  1IFQ A;  3HJI A;  3GVB A;  2BTF P;  4II7 A;  5HAR A;  2R9W A;  3V5M A;  1VB6 A;  2G7U A;  5F83 A;  5L2F A;  4UHU A;  3HJK A;  3IF6 C;  4GW9 A;  1XXM A;  4Y7P A;  3BRM A;  3FPV A;  3LR3 A;  4JGQ A;  4I39 A;  1QMF A;  3NY4 A;  2VKS A;  3NOT C;  4PKY A;  2EA9 A;  4Q0J A;  3OLO A;  1N9O A;  4RX3 A;  1JVJ A;  1K4E A;  1IKG A;  1WYB A;  3HUM A;  5F82 A;  5FDH A;  3VE3 A;  3ZG8 B;  2OWJ A;  3G30 A;  1NLY A;  3UE6 A;  1CF0 A;  4GDN A;  1TVF A;  3FG8 A;  1IYO A;  1NRF A;  4GDB A;  4P6Z M;  4KEN B;  2EFU A;  3E2K A;  1L0E A;  3HCY A;  4R23 A;  3E98 A;  2EWW A;  3FC7 A;  2EWV A;  2A3U A;  2XA7 S;  3KSF A;  4ETX A;  4NXE A;  4X6T A;  1YLZ A;  2W3E A;  4OP5 A;  4KQD A;  5FL3 A;  2YKH A;  4ZAM A;  4KZ7 A;  4K08 A;  3BFF A;  2QKP A;  4RA7 A;  2J80 A;  3G34 A;  3UB9 A;  2PR6 A;  5DKL A;  4IED A;  1EWZ A;  1STZ A;  1Q2Q A;  1XFN A;  3VP4 A;  5HAI A;  2XGN A;  1X0O A;  2R9X A;  3IHA A;  2WZX A;  1DP6 A;  4PM8 A;  3EOI A;  3IXB A;  1DP8 A;  3W8K A;  3HLC A;  1Y4O A;  2WAF A;  1BLH A;  4WM9 A;  5FAQ A;  4CLC D;  2PRF A;  4PM5 A;  3SH7 A;  1PIO A;  2PU2 A;  5IU1 A;  3MZD A;  1K54 A;  3V39 A;  4BD0 A;  1WYC A;  3MBZ A;  4Y0U A;  3UDF A;  4NKP A;  2X71 A;  1K38 A;  3FV7 A;  3BLM A;  5HAQ A;  3ZCZ A;  3WS2 A;  4Q0I A;  1JWP A;  1YLP A;  2JE5 A;  3JPU A;  3UE0 A;  5HW3 A;  4G3W A;  4I5S A;  4MN7 A;  2W0N A;  4JLF A;  3Q7Z A;  1H3Q A;  2A2L A;  2E8J A;  4KQO A;  2WGI A;  2R78 A;  2D02 A;  3G31 A;  1A0K A;  3G6O A;  3LIF A;  3F1N B;  3WRZ A;  4B9O A;  3V3R A;  1NRJ A;  3UE3 A;  5EUA A;  4HNB A;  4X55 A;  2G2U A;  5I94 A;  1MBL A;  2V8F A;  3RXW A;  4DRT A;  4EUV A;  3MXQ A;  4LV1 A;  4E3M A;  1S4R A;  2PHY A;  2WAD A;  4C3Q A;  5EVI B;  5E2G A;  4CPK A;  5E43 A;  2OAP 1;  2VA0 A;  1KVM A;  3MR0 A;  3VMA A;  2ZL1 B;  4Q8I A;  1F2K A;  4XXR A;  1YQS A;  1E3U D;  1W63 Q;  1QME A;  3C5A A;  4JF6 A;  2RL3 A;  1KE0 A;  4DE2 A;  1H5X A;  2HZ5 A;  1K6R A;  4ESP A;  4Y17 A;  4OLD A;  1GCE A;  5HL6 A;  4DDY A;  1ZHH B;  1YLW A;  3LIA A;  4MN6 A;  3SH9 A;  4KZB A;  4Y5F A;  4WEK A;  4Z9Q A;  5U47 A;  4WMC A;  3KYE A;  2ZQA A;  4GD8 A;  4L9G A;  4BQM A;  5FAO A;  1RGZ A;  5HL1 A;  3UDI A;  4OQI A;  3IWQ A;  5DTK A;  1OTE A;  1F98 A;  2WAE A;  2HF6 A;  2W1R A;  1CI9 A;  2HPB A;  3IHB A;  4DDS A;  4S2N A;  1BLC A;  2UV0 E;  3NDE A;  3MQO A;  3LUQ A;  4MCW A;  3K2N A;  2W1T B;  3UPO A;  4BMW A;  5FQJ A;  3IX4 A;  4FCF A;  1VM1 A;  4EXO A;  1BLS A;  4BWI A;  3VOY A;  5FI6 A;  1ZG6 A;  5EOO A;  1PRQ A;  2Y2L A;  3HLF A;  4E04 A;  4S2L A;  3FPW A;  4Y0T A;  4PMA A;  2ZC3 B;  3DTK A;  1F5M A;  4P87 A;  1Y54 A;  4UA9 A;  2J9P A;  3PBT A;  2W27 A;  4JGR A;  1JWV A;  3M2K A;  3ZG5 A;  1NJ4 A;  2B02 A;  1OT6 A;  2VV6 A;  1GSW A;  3TOI A;  3PBO A;  3CIT A;  1LL9 A;  3QNC A;  2VGK A;  1K25 A;  3A3E A;  3F1N A;  4MNR A;  4LLO B;  3DW0 A;  1PWC A;  2V1B A;  4MDZ A;  4QWO A;  1FQG A;  1MWS A;  2JKF A;  2XK1 A;  3RXX A;  2Y2J A;  4BLM A;  5GLC A;  1T1B A;  3S7N A;  2Z6C A;  4GLQ A;  1HLU P;  1G68 A;  1IKI A;  2V1Z A;  4E6W A;  3Q7V B;  4QB8 A;  5HSQ A;  1OT9 A;  2HDU A;  3ZYT A;  1CI8 A;  2ZMA A;  5IHV A;  2O9A A;  3PR6 A;  3IX8 A;  4B4Z A;  3IF5 A;  3B3X A;  5DF9 A;  2QWS A;  4OON A;  3UPP A;  4LV3 A;  2QMI A;  4GS9 B;  4Y15 A;  2ZD8 A;  3CI6 A;  5J7E A;  2ACG A;  2P04 A;  3H7W A;  4XUX A;  4GNU A;  1LSW A;  1N9L A;  1I2W A;  3BFE A;  3HLB A;  3TRC A;  5A90 A;  1K0K A;  1MXO A;  1XJ2 A;  3ZG9 B;  1UWN X;  5HWV A;  3GDI A;  3T4Q A;  1LHY A;  4Y0O A;  4IUK A;  2ZJ9 A;  1NZO A;  1FCM A;  3M6B A;  4GB7 A;  3VFF A;  5DJU A;  4GOG A;  4ZTK A;  4HEF A;  2W1T A;  3B33 A;  5CX7 A;  2XRO A;  4EV4 A;  3S7Q A;  3D3O A;  3OPH A;  5E2F A;  4HJ3 A;  3C2W A;  5EM0 A;  4ZJ2 A;  4HBT A;  1YLY A;  3WWX A;  1KGE A;  4UEY A;  5J3W A;  5DVA A;  5MC7 A;  2XFS A;  2ZC5 B;  1KDS A;  1ALQ A;  4FUW A;  3OBF A;  3LY4 A;  2V9A A;  4HJ6 A;  3D72 A;  5A93 A; 
#chains in the Genus database with same CATH homology
 3Q07 A;  4P6B A;  3HUN A;  1FSY A;  3A3I A;  2ZM8 A;  4BJP A;  1JWZ A;  1NYM A;  1Z6F A;  3GQZ A;  4N92 A;  1PW8 A;  4PPR A;  3GVB A;  2Z2L B;  4KQQ A;  4OVD A;  5HAR A;  2R9W A;  4LCL A;  3V5M A;  3S1Y A;  4S2M A;  5HAP A;  1W7F A;  5F83 A;  2PBY A;  5F1G A;  5FAT A;  4K0X A;  4KZA A;  2DNS A;  5L2F A;  4UHU A;  2QZ6 A;  4B88 A;  1ES2 A;  1MWR A;  4UA6 A;  2WUQ A;  3EQV A;  3IF6 C;  1E25 A;  5JYO A;  1XXM A;  4Y7P A;  3BRM A;  1OME A;  3LY3 A;  4JBF A;  5FQQ A;  1U60 A;  2Y2I A;  3ZG7 B;  2VGJ A;  4OPQ A;  1QMF A;  3MKF A;  4WZ5 A;  3MZE A;  3NY4 A;  5CGW A;  5DF7 A;  1GA9 A;  5EVI A;  4E3K A;  4U3T A;  1YLT A;  1YT4 A;  4BEN A;  2HDS A;  3D4F A;  1ES4 A;  4PM7 A;  5CGS A;  1E4D A;  4RX3 A;  1JVJ A;  2A49 A;  2Y59 A;  1K4E A;  1IKG A;  2HP6 A;  1WYB A;  2ZC7 A;  4KG5 A;  3HUM A;  5F82 A;  1NZU A;  1K56 A;  2Y2H A;  5FDH A;  1PWD A;  1DJC A;  3ZG8 B;  5AQB A;  4IVK A;  5GHX A;  3G30 A;  3ITA A;  4DE1 A;  5KMW A;  1YMS A;  4FD8 A;  4E3J A;  4E6X A;  2Q9N A;  4YIN A;  4GDN A;  5DF8 A;  1TVF A;  2V2F F;  4ZDX A;  1IYO A;  1NRF A;  1IYP A;  1TEM A;  4GDB A;  5FSR A;  2HP5 A;  2E8I A;  2WKE A;  4KEN B;  2EFU A;  1SCW A;  3E2K A;  1L0E A;  3DWK A;  3GTC A;  1M40 A;  1ES3 A;  3TSG A;  2Y4A A;  4R23 A;  1YLJ A;  1I5Q A;  4E3N A;  3V3S A;  5GL9 A;  1BLP A;  3HLE A;  3A3J A;  2WGV A;  4P0M A;  5FQ9 A;  4C6Y A;  3HVF A;  4OOL A;  1H8Z A;  4OPZ A;  4OQH A;  2A3U A;  2OV5 A;  2FFY A;  4OQ0 A;  2ZM2 A;  5E2E A;  4N1X A;  4GN2 A;  4QY5 A;  3IXG A;  4X6T A;  2ZQ9 A;  1YLZ A;  4BL3 A;  3VFH A;  4B4X A;  4OP5 A;  4R0Q A;  5FI2 A;  1N9B A;  1TDG A;  3UPN A;  1XX2 A;  1KVL A;  4QD4 A;  1L0F A;  4ZAM A;  3NCK A;  4KZ7 A;  4N1H A;  1W8Y A;  3IWO A;  1RP5 A;  4P85 A;  5F1F A;  3BFF A;  1BUL A;  3IXD A;  2J8Y A;  4RA7 A;  5CTM A;  2IWB A;  4EBL A;  5KZH A;  3BEB A;  3IQA A;  1MKI A;  4WBG A;  3G34 A;  3BYD A;  2EX9 A;  5GLB A;  1XPB A;  4N9K A;  4OQG A;  1DJA A;  4IED A;  4D2O A;  4WEJ A;  2JBF A;  1EWZ A;  2ZQ7 A;  1Q2Q A;  2HP9 A;  3VP4 A;  4EBP A;  5HAI A;  2XEP A;  2XGN A;  3RJU A;  1W5D A;  3VSK A;  3UN7 A;  5CED A;  3ZHH A;  3WS0 A;  1IYS A;  2R9X A;  4DXC A;  4DXB A;  3IHA A;  2WZX A;  4BL2 A;  1WE4 A;  4PM8 A;  2Y91 A;  3IXB A;  3PBN A;  4WMC D;  3O87 A;  3W8K A;  3DTM A;  3HLC A;  2WAF A;  1HD8 A;  1L2S A;  1ONG A;  1TDL A;  1CEG A;  1BLH A;  3BFD A;  4WM9 A;  1W8Q A;  5FAQ A;  5CEC A;  1FSW A;  1PYY A;  4KZ5 A;  3VP3 A;  1ESI A;  1PIO A;  3SH7 A;  4PM5 A;  2PU2 A;  4LV2 A;  4NK3 A;  3MZD A;  2OLV A;  4GZB A;  1K54 A;  3V39 A;  4BD0 A;  1WYC A;  3E2L A;  5HFO A;  1SDE A;  3MBZ A;  3A3D A;  2Z2M B;  4KG6 A;  4RVA A;  4Y0U A;  3UDF A;  4GKU A;  3HRE A;  5DTT A;  1C3B A;  1L0D A;  2X71 A;  3ZVW A;  1K38 A;  3BFC A;  3FV7 A;  3PAE A;  5DTS A;  2XFT A;  5GLD A;  1MPL A;  2H0T A;  2Y2Q A;  3G2Y A;  3BLM A;  5HAQ A;  4ZJ1 A;  3MXS A;  5E2H A;  3Q81 A;  1YM1 A;  3WS2 A;  3ZCZ A;  4X53 A;  2X01 A;  1HVB A;  2ZM0 A;  1JWP A;  1YLP A;  4S2O A;  3ZNT A;  2CC1 A;  2JE5 A;  3CMZ A;  3UE0 A;  5HW3 A;  4OH0 A;  4KZ9 A;  2V20 A;  4L0L A;  4MBK A;  3SH8 A;  2XLN A;  2XF3 A;  4DF6 A;  4JLF A;  2DRW A;  1GHP A;  5GHZ A;  3Q7Z A;  4GD6 A;  2BLS A;  2P9V B;  2Y2M A;  3GSG A;  2ZQD A;  2WKH A;  4KQO A;  2WGI A;  3VP1 A;  3ZGA B;  1IEM A;  2J9O A;  4N9L A;  1PI5 A;  3M2J A;  4MBH A;  3ZG0 A;  5CHU A;  3G31 A;  4PM9 A;  3VOZ A;  3I7J A;  3HLG A;  4WZ4 A;  3PBR A;  5EPH A;  5M18 A;  1Q2P A;  3WRZ A;  3V3R A;  5GHY A;  5CTN A;  3UE3 A;  5EUA A;  2H5S A;  4X55 A;  1ERQ A;  2G2U A;  3GMW A;  5I94 A;  1MBL A;  5EVL A;  3RXW A;  5EE8 A;  4LEN A;  5AQA A;  4DRT A;  4JXV A;  2H10 A;  4LV1 A;  4E3M A;  3Q7V A;  5TFQ A;  1CK3 A;  2WAD A;  4C3Q A;  3MKE A;  5G18 A;  5EVI B;  4DKI A;  1AXB A;  4U0X A;  4LV0 A;  4PM6 A;  2Y2G A;  1XA1 A;  3CZD A;  5JYP A;  5E2G A;  3CG5 A;  4CPK A;  5E43 A;  3N4I A;  5CHM A;  1EI5 A;  2I72 A;  1XGI A;  3QHY A;  4FH4 A;  2WGW B;  1KVM A;  5EEC A;  2UWX A;  3VMA A;  4CJN A;  4Q8I A;  4XXR A;  2XDM A;  3C7V A;  1YQS A;  2EFX A;  1E3U D;  1ZG4 A;  3G35 A;  3Q82 A;  4JKT A;  4K0W A;  4S2N C;  4EUZ A;  5M19 A;  1QME A;  3C5A A;  4JF6 A;  2RL3 A;  1KE0 A;  1JTD A;  4DE2 A;  2ZC4 B;  2DCF A;  3MFD A;  1H5X A;  3N7W A;  1ZKJ A;  1K6R A;  3IF6 B;  1G6A A;  5CXW A;  4OLD A;  1GCE A;  5A91 A;  2C6W B;  1YMX A;  4DDY A;  1ERO A;  1YLW A;  3OPL A;  3A3F A;  5M1A A;  2EX8 A;  3SH9 A;  3LEZ A;  5EVI D;  3OPR A;  1K54 C;  3BEC A;  1M6K A;  3NC8 A;  4KZB A;  5CHJ A;  5FA7 A;  4R4R A;  2EXA A;  4WEK A;  4Z9Q A;  5U47 A;  3UDX A;  4WMC A;  4GD8 A;  2ZQA A;  4UAA A;  3P09 A;  3HLD A;  3QNB A;  1FR1 A;  4E3O A;  5KSC A;  2XD5 A;  2OSU A;  3PTE A;  1BZA A;  5FAO A;  4BQM A;  1CEF A;  1KE4 A;  5J8X A;  1RGZ A;  2WKI A;  3OC2 A;  1BTL A;  1ZC2 A;  5HL1 A;  3W4P A;  1FR6 A;  3NBL A;  4MBF A;  3UDI A;  4OQI A;  3UE1 A;  3IWQ A;  2ZQ8 A;  5DTK A;  3WS4 A;  4E3I A;  2XR0 A;  3FZC A;  3EQU A;  3ITB A;  2WAE A;  1L0G A;  5EOE A;  3GR2 A;  1GA0 A;  3MXR A;  1CI9 A;  4JF5 A;  2HPB A;  3FKW A;  3IHB A;  4DDS A;  4KZ6 A;  3FWL A;  4S2N A;  5D3O A;  1BLC A;  1LL5 A;  3WS5 A;  1DJB A;  4C75 A;  1K57 C;  4NET A;  2Q9M A;  3SOI A;  1FCN A;  5FAS A;  4IBX A;  3NDE A;  4ZBE A;  4WEL A;  3CJM A;  4JXW A;  4M3K A;  4MEZ A;  4EWF A;  1GHM A;  3UPO A;  1XP4 A;  5FQJ A;  1K6S A;  1NYY A;  2JC7 A;  1LLB A;  4KZ8 A;  5GLA A;  1ES5 A;  2WZZ A;  4FCF A;  4JXG A;  3HUO A;  4KG2 A;  5CEB A;  1VM1 A;  2Y2P A;  1BLS A;  2IWD A;  3VOY A;  5FI6 A;  4IBR A;  1ZG6 A;  5EOO A;  3VP0 A;  5BOH A;  2G2W A;  4R3B A;  3HL9 A;  2RCX A;  5CRF A;  2Y2L A;  3HLF A;  3WS1 A;  4BD1 A;  3OCL A;  5FQK A;  4OPR A;  4S2L A;  2Y2O A;  1XKZ A;  3UO9 A;  5FQM A;  1NY0 A;  4Y0T A;  1PWG A;  3HBR A;  5TR7 A;  1K55 C;  2WYX A;  1VQQ A;  4PMA A;  3PBQ A;  4R1G A;  1IEL A;  1K57 A;  1MY8 A;  3AGF A;  4K91 A;  4RYE A;  4S2K A;  3G32 A;  1SDN A;  2ZC3 B;  4EBN A;  4P87 A;  3SS5 A;  1MWT A;  1Y54 A;  4OPY A;  4UA9 A;  2ZQC A;  1BSG A;  1PZP A;  2J9P A;  1DY6 A;  3PBT A;  3VP2 A;  1MWU A;  4ID4 A;  1JWV A;  2XQZ A;  3M2K A;  1NJ4 A;  3ZG5 A;  4IVI A;  1ONH A;  2P9V A;  3SS3 A;  3N8S A;  2OLU A;  3TOI A;  3C7U A;  1XGJ A;  2QPN A;  3PBO A;  4S2I A;  3G4P A;  4DE0 A;  1LL9 A;  5FQI A;  3UNW A;  3QNC A;  4X56 A;  2XD1 A;  1RGY A;  2VGK A;  1E3U A;  3C4P A;  4MLL A;  1K25 A;  1NXY A;  3A3E A;  1PZO A;  3JYI A;  3N6I A;  4MNR A;  3S4X A;  4UA7 A;  3DW0 A;  4JF4 A;  1N4O A;  1PWC A;  2GDN A;  3HLW A;  1H8Y A;  4KZ3 A;  1LI0 A;  3OPP A;  1FQG A;  3PBS A;  3VSL A;  4OOY A;  1MWS A;  4R3J A;  3IXH A;  1JTG A;  4JXS A;  5TGF A;  2XK1 A;  3RXX A;  1K4F A;  1K55 A;  2PU4 A;  3M6H A;  1KGG A;  1BT5 A;  2Y2J A;  3WRT A;  4BLM A;  5GLC A;  1SKF A;  2EX6 A;  4QY6 A;  4LCM A;  4R4S A;  2EXB A;  1G68 A;  2XH9 A;  2FFF B;  1IKI A;  2V1Z A;  2C5W B;  1SHV A;  4E6W A;  3Q7V B;  4QB8 A;  4E3L A;  2HDU A;  2WGW A;  1CI8 A;  1O7E A;  1HTZ A;  3NIA A;  3LCE A;  3O3V A;  2ZMA A;  3FYZ A;  5IHV A;  4B4Z A;  5AQ7 A;  1FOF A;  2IWC A;  3B3X A;  3IF5 A;  4EQI A;  5CER A;  5DF9 A;  2Y2K A;  5FI7 A;  4OON A;  4ZJ3 A;  3UPP A;  4LV3 A;  2QMI A;  2ZLY A;  3O88 A;  3TG9 A;  3W4O A;  3IF6 A;  4XUZ A;  2ZD8 A;  5KSH A;  4H8R A;  4KZ4 A;  1PI4 A;  1S6R A;  1J9M A;  2Y2N A;  3ISG A;  4S2P A;  3BM6 A;  1W79 A;  2B5R A;  1GHI A;  2WK0 A;  3GRJ A;  4XUX A;  4O7D A;  4GNU A;  4X68 A;  3V50 A;  3NDG A;  4QHC A;  4QJG A;  4JPM A;  5FAP A;  2HDR A;  1K56 D;  1I2W A;  2P74 A;  3BFE A;  4A5R A;  5AQ9 A;  4FSF A;  2Y55 A;  2J7V A;  3HLB A;  4U0T A;  1RCJ A;  3AGD A;  2HDQ A;  5A90 A;  4OLG A;  3MZF A;  3ZVT A;  1MXO A;  1KGF A;  5CGX A;  3ZG9 B;  3SS4 A;  4YFM A;  2EX2 A;  2X02 A;  3IT9 A;  1LHY A;  3N8R A;  4RX2 A;  3W4Q A;  2ZC6 B;  4FH2 A;  4Y0O A;  4F94 A;  2ZJ9 A;  1NZO A;  3DWZ A;  1FCM A;  1O07 A;  3M6B A;  3P98 A;  4GB7 A;  3C4O A;  3BLS A;  3LO7 A;  3VFF A;  3IH8 A;  4GOG A;  4ZTK A;  3OCN A;  1BUE A;  4HBU A;  4X69 A;  4HEF A;  3O86 A;  5A92 A;  2BG1 A;  1FCO A;  4EV4 A;  3PAG A;  4QU3 A;  3OZH A;  3OPH A;  1LI9 A;  1XA7 A;  4OOM A;  5E2F A;  4ZJ2 A;  4HBT A;  3S22 A;  3FKV A;  1YLY A;  3BFG A;  3WWX A;  1KGE A;  3ZDJ A;  1ERM A;  1I2S A;  2H0Y A;  3NI9 A;  4OKP A;  4KQR A;  3G2Z A;  4S2J A;  1KE3 A;  5DVA A;  3Q1F A;  4OP8 A;  1PW1 A;  3IH9 A;  1IYQ A;  2XFS A;  2ZC5 B;  1KDW A;  1KDS A;  1ALQ A;  3GV9 A;  3IWI A;  4WZ5 C;  5HX9 A;  1ESU A;  3N8L A;  3LY4 A;  4HES A;  5EVI C;  3AGE A;  4WYY A;  1HZO A;  3UY6 A;  4DE3 A;  1S0W A;  3ZNY A;  2JCH A;  5A93 A;  3ZFZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...