1YLZA

X-ray crystallographic structure of ctx-m-14 beta-lactamase complexed with ceftazidime-like boronic acid
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
263
structure length
263
Chain Sequence
b'QTSAVQQKLAALEKSSGGRLGVALIDTADNTQVLYRGDERFPMCSTSKVMAAAAVLKQSETQKQLLNQPVEIKPADLVNYNPIAEKHVNGTMTLAELSAAALQYSDNTAMNKLIAQLGGPGGVTAFARAIGDETFRLDRTEPTLNTAIPGDPRDTTTPRAMAQTLRQLTLGHALGETQRAQLVTWLKGNTTGAASIRAGLPTSWTVGDKTGSGDYGTTNDIAVIWPQGRAPLVLVTYFTQPQQNAESRRDVLASAARIIAEGL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-LACTAMASE CTX-M-14
molecule tags Hydrolase
source organism Escherichia coli
publication title Structure, Function, and Inhibition along the Reaction Coordinate of CTX-M beta-Lactamases.
pubmed doi rcsb
total genus 98
structure length 263
sequence length 263
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2005-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1ylzA00
2Y2MA 3M2JA 3WS2A 1KDWA 1O07A 2HP5A 4KZ9A 2J9OA 5CRFA 1MWTA 1WYBA 5FAOA 4A5RA 1FCMA 2H5SA 4NETA 4OONA 5HX9A 2Y2JA 5EVIC 2WUQA 2QPNA 2Y4AA 4DKIA 3WWXA 4EV4A 4KZAA 2ZC5B 1NZOA 3IXGA 4P85A 1K55A 2I72A 3NY4A 4OQ0A 2Y59A 1ES5A 1NXYA 4PMAA 4IVKA 4KENB 4R4RA 2WAFA 4JPMA 4HEFA 4OPZA 4E3KA 4OLGA 4MNRA 1TVFA 3PBSA 4KZ4A 2WZZA 4BJPA 3IF6A 5FSRA 3LCEA 4X56A 2XLNA 5EECA 1NYYA 1WYCA 3UDIA 3UNWA 3VP3A 2Y2GA 3MKFA 1JWPA 4LCMA 3BFGA 4IBRA 3ZCZA 3PBTA 4KG2A 5DF8A 5GHXA 3OPPA 3UDXA 1KVLA 1J9MA 2HP9A 5CXWA 3W4PA 1K57C 4KQRA 4FCFA 5J8XA 1KVMA 5FQIA 3RJUA 3HLFA 3CG5A 1H8YA 2XFSA 5FQQA 3W4OA 4S2PA 3CZDA 4BD1A 1XGIA 2XEPA 5HAPA 1TDGA 2C6WB 1YLWA 5JYOA 5CHUA 1YT4A 4E3LA 3C4OA 1I5QA 2ZC7A 1K55C 4HBUA 4K0WA 4ZDXA 1W8QA 5FI6A 1C3BA 4B4XA 1ES3A 2JCHA 2Y2KA 4QHCA 4WBGA 5GLDA 5FQJA 4ZJ1A 1ERQA 3LY4A 4ZJ3A 2ZQ8A 4DE1A 3O87A 4XXRA 5A92A 4OOYA 1JTGA 1LL9A 1OMEA 4EBNA 5CTMA 5FATA 4F94A 3Q7VA 2WZXA 1GCEA 3OPRA 1H8ZA 1FCOA 1DJBA 3B3XA 1PW8A 4LV0A 5GLCA 5CECA 1SCWA 3HVFA 1BULA 3GRJA 3BLSA 1IYPA 2XH9A 3V3SA 5JYPA 1JTDA 1Y54A 3M6BA 3UE0A 4B88A 3VOZA 1K56D 4U0XA 3BECA 4E3NA 4GKUA 3ZG7B 2OV5A 5EVIB 3GMWA 3N8SA 1L0DA 2OSUA 3PBQA 4E6WA 4IBXA 2H10A 4OKPA 1BLCA 3OZHA 1MKIA 5EE8A 3VFFA 1DY6A 4M3KA 4OQGA 1CK3A 3ZNYA 1N9BA 3OPHA 5DF7A 3O88A 3UPNA 3ZVWA 1MWRA 3HUOA 4LCLA 3V3RA 4IVIA 3WS1A 1W79A 1BT5A 3DW0A 1MY8A 2J9PA 3MFDA 3NDEA 3UPPA 2ZQCA 4JXWA 5M18A 2BLSA 3OPLA 5CGSA 4CJNA 1NYMA 5FQ9A 1WE4A 1YLYA 1L0GA 2ZM8A 3A3FA 4OPQA 1QMEA 4UHUA 5EVID 4P0MA 4ZBEA 2ZQ9A 3FZCA 1GHPA 1SKFA 3G35A 1KE3A 2WKEA 2X02A 3NIAA 4KG5A 4R4SA 3TG9A 2DNSA 4UA6A 4YINA 3SH9A 2WGWA 1JVJA 2H0TA 1K6SA 1XX2A 1ONHA 3IF6B 1BLHA 3ZFZA 4X55A 3VP0A 3S1YA 4JBFA 3S22A 1ERMA 4S2NC 3PBRA 3IH9A 1S0WA 1XGJA 1K25A 4X68A 3PBNA 3WRTA 4KZ8A 1BLSA 3WS0A 1ONGA 1IYQA 4KZ3A 2OLVA 4QU3A 3D4FA 3W4QA 4H8RA 1ES2A 4UA9A 1HTZA 1YLZA 4EBLA 5F83A 4OLDA 4XUXA 4GD6A 1ESUA 5AQBA 5AQAA 3HUNA 4WEJA 3Q7VB 2FFFB 3I7JA 3NC8A 3ZG0A 1SHVA 3VP4A 1XA1A 5AQ7A 2Q9NA 1K38A 3IXBA 3G31A 5F1GA 1M40A 1K57A 3HUMA 4X6TA 5DVAA 4N9KA 2J7VA 4DE0A 1E3UD 4S2LA 5GHYA 3ITBA 4KQQA 4XUZA 4WZ4A 3HLDA 4S2NA 1KGEA 1ZKJA 1KDSA 4LV3A 3SS5A 4JF6A 3GR2A 1LI0A 3N8LA 2XD5A 2ZM0A 3V50A 1BUEA 5DF9A 2RL3A 1SDNA 3W8KA 1KE4A 3GTCA 5E2EA 3IXDA 2XR0A 3N4IA 4QY6A 1PW1A 1EROA 1ALQA 4EWFA 5KSHA 3HBRA 5BOHA 1W5DA 1TEMA 1ZG4A 4RX2A 1MXOA 3LO7A 2OLUA 5A91A 3EQVA 5HL1A 3IF5A 1FQGA 3ZDJA 5CEBA 1K4EA 1LHYA 2Y2QA 4MBHA 4WZ5A 2HDSA 3IWQA 2V1ZA 3TSGA 1L2SA 3VOYA 2ZJ9A 1IEMA 4JF5A 4KZ7A 4R23A 2EFUA 4S2IA 2JBFA 5CEDA 2V2FF 3AGDA 1PWDA 3GVBA 3GV9A 5KZHA 5TR7A 4N1HA 2EX8A 3MBZA 4GN2A 1K54A 4PPRA 4LENA 2Y2LA 5D3OA 4WMCD 5M19A 2G2UA 5KMWA 4P87A 3VP1A 1H5XA 3HLEA 1E4DA 3M6HA 1QMFA 1YLJA 2ZM2A 3E2KA 3AGFA 4PM7A 3SS4A 4OP5A 3BFEA 3G30A 4DDYA 1MPLA 3PAEA 4U3TA 2Y2NA 3OCNA 3UO9A 5KSCA 5FI7A 3SH7A 1CEGA 1JWVA 3WS5A 4ZAMA 3UDFA 4FH2A 4PM8A 3PAGA 1MWSA 2G2WA 4OVDA 1I2WA 3QNBA 3VMAA 5EVLA 3N8RA 4RX3A 3JYIA 1RP5A 4WEKA 2PU4A 2IWDA 3G34A 3MZEA 4GD8A 2Z2LB 3ZNTA 1YMXA 4R1GA 5GLAA 4BENA 2Q9MA 1XP4A 2HDQA 1L0FA 3PBOA 1PZPA 4E3MA 4FD8A 3IHBA 1U60A 4MBKA 4HESA 4FSFA 3IXHA 4WYYA 5E2HA 4P6BA 4GB7A 5HFOA 3SOIA 3UPOA 2DRWA 3MZDA 3Q1FA 4DF6A 3C4PA 2HDUA 2BG1A 3A3EA 4PM5A 1GA0A 1ZG6A 2V20A 4KQOA 2WAEA 4RYEA 1FCNA 1PYYA 1ESIA 2WGIA 3MZFA 2XD1A 2ZD8A 3VSKA 1GHMA 4QD4A 4QY5A 4KZ6A 5HAQA 1E3UA 1AXBA 1GA9A 4Y0UA 5FASA 1NJ4A 4X53A 3P09A 5GHZA 1IYOA 2GDNA 4K91A 1LL5A 2ZC4B 3HLBA 2PU2A 3IH8A 2XGNA 5AQ9A 3GQZA 4YFMA 4JXSA 4C6YA 3Q7ZA 5FAPA 1RGZA 3RXWA 4DXCA 5A93A 3QHYA 1BZAA 2P9VB 1LLBA 1YLPA 1YQSA 3BFFA 3EQUA 1K6RA 3ZGAB 5DTSA 5DTTA 3G2ZA 3S4XA 2A3UA 5TGFA 4Y0TA 5L2FA 3UE3A 3WRZA 1ZC2A 3IF6C 5A90A 3P98A 5IHVA 4E6XA 4OP8A 3O86A 1CI9A 3FV7A 2IWBA 4S2MA 1IELA 3FKVA 3DWKA 5TFQA 1Q2PA 5FQMA 3CJMA 5CHJA 1CEFA 1YLTA 5CTNA 1CI8A 3OCLA 2ZC3B 4JXVA 3BFCA 2QZ6A 1BSGA 1MWUA 2WADA 2Z2MB 1IYSA 2HPBA 3UN7A 4S2JA 3ZG5A 1FSYA 2R9XA 1XA7A 3HLGA 3C5AA 1K54C 3Q82A 2PBYA 4MEZA 5F82A 3C7UA 2C5WB 3HLCA 4WM9A 5GLBA 3HL9A 4JLFA 4R0QA 3VSLA 1PWCA 1NZUA 2QMIA 1L0EA 2ZQDA 4OOMA 1M6KA 4LV1A 4R3JA 4KG6A 1PI5A 4BL2A 4C75A 2DCFA 5HAIA 1VM1A 3IWOA 3ZG8B 4OPYA 1PI4A 1Q2QA 2FFYA 3CMZA 2EXBA 3Q07A 4MBFA 2JC7A 2ZLYA 4GNUA 4Z9QA 5EOOA 4ZTKA 3A3JA 4OQIA 5HARA 3MXSA 4N92A 4DE3A 4Q8IA 4BD0A 1KE0A 1XPBA 5EPHA 1K56A 2XQZA 3RXXA 1IKGA 3BM6A 3ZG9B 3V5MA 3BFDA 3QNCA 3BYDA 1RGYA 2X01A 3LY3A 4ID4A 5FA7A 4OOLA 5GL9A 4UA7A 4S2OA 2Y2IA 4WELA 3V39A 5E2GA 1LI9A 1NY0A 2E8IA 4B4ZA 3OC2A 1G6AA 1W7FA 1FR1A 1YMSA 2ZQAA 3A3DA 3GSGA 3NDGA 1HZOA 2Y2HA 2Y55A 3G32A 3MXRA 4OQHA 3PTEA 3A3IA 4JKTA 3UY6A 2CC1A 4NK3A 1DJCA 1PWGA 5FDHA 4LV2A 1FSWA 1TDLA 4Y7PA 4GDNA 2VGJA 1N4OA 1EWZA 1PZOA 1SDEA 4DDSA 1S6RA 2J8YA 1XXMA 1G68A 3ISGA 2HDRA 1O7EA 5FI2A 5M1AA 3TOIA 1NRFA 3N6IA 1I2SA 4N9LA 2H0YA 2ZMAA 3LEZA 3M2KA 3IQAA 2X71A 4WMCA 3N7WA 4E3OA 2WGVA 2ZC6B 5E43A 4QB8A 2RCXA 4BLMA 3NCKA 4FH4A 1JWZA 1PIOA 4CPKA 2EX2A 4DRTA 1BLPA 3IWIA 2B5RA 2WKHA 3Q81A 3FKWA 4K0XA 4X69A 1K4FA 3G2YA 3SH8A 2HP6A 4D2OA 4QJGA 1HD8A 3BLMA 1FOFA 5I94A 3DTMA 1E25A 3ITAA 1VQQA 3BRMA 2P9VA 3WS4A 4L0LA 4GOGA 2WGWB 4Y0OA 2VGKA 1IKIA 3DWZA 4RA7A 3IHAA 2EFXA 4GDBA 2XFTA 4DXBA 3O3VA 4E3JA 2EX6A 2XF3A 3MKEA 5F1FA 4PM6A 1KGGA 4BL3A 3IT9A 3HREA 5U47A 2WKIA 4OH0A 3AGEA 4EBPA 4OPRA 2ZQ7A 1Z6FA 1YM1A 2JE5A 3G4PA 1XKZA 2WK0A 5G18A 4EQIA 4WZ5C 1W8YA 2A49A 5E2FA 1GHIA 3SS3A 1ES4A 4ZJ2A 3UE1A 1MBLA 3VFHA 4E3IA 1EI5A 2XK1A 5EVIA 2EX9A 3E2LA 2WYXA 4JF4A 2Y2PA 5FQKA 1BTLA 2P74A 5FAQA 4JXGA 4S2KA 4R3BA 2Y2OA 5DTKA 4MLLA 1HVBA 5CHMA 3NBLA 2EXAA 4N1XA 4GZBA 5HW3A 4PM9A 3VP2A 1FR6A 1KGFA 5CGWA 4RVAA 1RCJA 2UWXA 4U0TA 4DE2A 5EOEA 4KZBA 4KZ5A 3ZVTA 2IWCA 3BEBA 4HBTA 3FYZA 5EUAA 4O7DA 2R9WA 4C3QA 4EUZA 3FWLA 4IEDA 3ZHHA 5CGXA 1DJAA 3HLWA 4UAAA 5CERA 2Y91A 3C7VA 4BQMA 2XDMA 3NI9A
chains in the Genus database with same CATH superfamily
2Y2MA 3WS2A 1KDWA 1O07A 2J9OA 5CRFA 1TD5A 5FAOA 4NETA 4F3LA 1ACFA 1N9NA 2Y4AA 3E0YA 4DKIA 4EV4A 3A0RA 4P85A 3NY4A 3QP5A 1ES5A 4OLGA 4EXOA 4BBTA 3UDIA 3T50A 2Y2GA 1JWPA 4I3AA 4PKYA 1J9MA 4XT2B 3SZTA 3W4PA 1K57C 4ESPA 3BW6A 2W1RA 3UB5P 5FQQA 3W4OA 4XT2A 3CZDA 1XGIA 2XEPA 4Y3IA 5HAPA 1TDGA 5G4YA 5JYOA 3MQ0A 3C4OA 1I5QA 4K0WA 4ZRRA 1H0MA 1ES3A 1TS7A 2JCHA 4WBGA 1ERQA 5G4ZA 4OOYA 3QP1A 2R78A 1OMEA 2O9AA 5FATA 5DKLA 2WZXA 1GCEA 1OTDA 3MFXA 3OPRA 1DJBA 4IJGA 1PW8A 3T4JA 1BULA 3GRJA 3BLSA 1Y54A 3UB7A 3RTYA 3VOZA 4P6ZS 4E3NA 3ZG7B 5F6AA 3N8SA 2OSUA 2H10A 4OKPA 3A0SA 3OZHA 5EE8A 4OQGA 2OOLA 3PR6A 3T12B 1MWRA 4G3KA 4IVIA 1MY8A 2EA9A 5M18A 2GZAA 3OPLA 1BYWA 4X1MA 3EGXC 1L0GA 3A3FA 5EVID 4P0MA 4FOFA 2ZQ9A 3FZCA 2WKEA 4KG5A 2D01A 3RFBA 2WGWA 2H0TA 3IF6B 4NXEA 2PT7A 4DMZA 2KDKA 2K31A 2B95A 3S22A 1S0WA 1XGJA 4MN7A 1BLSA 4HY8A 3BJNA 4KZ3A 2FZ0A 3W4QA 4EBLA 4OLDA 4XUXA 4GD6A 5AQBA 5AQAA 1YAXA 3VOLA 3LGOA 3I7JA 3NC8A 3ZG0A 3PHYA 5GHYA 4WN5A 1SKOA 1KDSA 2V0UA 1CJFA 3N8LA 2XD5A 3DTEA 1BUEA 3EWKA 2VV8A 4BMWA 3FG8A 3IXDA 4ARZB 4FUWA 3KYZA 3EQVA 5HL1A 4HOIA 3ZDJA 5IU1A 2V1ZA 2ZJ9A 4KZ7A 4JF5A 2EFUA 2VK3A 1PRQA 3UB9A 4N1HA 2EX8A 4GN2A 5DFYA 4PPRA 1P97A 4LENA 5FL3A 2Y2LA 1XJ2A 1OTBA 4LFUA 2G2UA 3VP1A 4X53A 3SS4A 1YLJA 1NRJA 4JGRA 1JWVA 3H82A 4ZAMA 3UDFA 3PAGA 4OVDA 3VMAA 5IT5A 1RP5A 3LR0A 2LB5A 3IX3A 4BBUA 2JN7A 4R1GA 3TRCA 1PZPA 4HESA 3IXHA 1YKDA 3NOPC 3SOIA 2DRWA 3MZDA 3C4PA 2HDUA 2BG1A 4PM5A 4ETXA 1PYYA 5HWWA 2WGIA 3MZFA 4LRXC 2ZD8A 2Z6CA 3VSKA 4QD4A 4MMNA 4LGWA 2IA2A 3P09A 5GHZA 2GDNA 5F68A 1LL5A 2ZL1A 3CLOA 4H6JA 4EETB 5AQ9A 3GQZA 2BTFP 4EERA 1RGZA 3KYQA 2V0WA 1LLBA 1YQSA 4D60A 5DTTA 3S4XA 4Y0TA 5TGFA 4MDZA 2KX6A 5L2FA 3P98A 2W3DA 3DWKA 1Q2PA 3F1PB 3B47A 3L9KA 4JXVA 3BFCA 3MQQA 2PYRA 2Z2MB 1IYSA 3UN7A 4CLCD 4Q0IA 1FSYA 1XA7A 3HLGA 1K54C 3Q82A 4MEZA 5F82A 3IBRA 2QMIA 1NZUA 3IBJA 1L0EA 4OOMA 2PR6A 1PI5A 4BL2A 1PI4A 2J3WA 2OWHA 2EXBA 4O0PA 2ZLYA 4GNUA 4JGQA 4DE3A 4EEPA 1GSXA 3ZG9B 1K56A 3RXXA 3BFDA 3MSHA 3LY3A 3IX4A 2A2LA 2Y2IA 4S2OA 4WELA 3ICYA 5E2GA 3V39A 2E8IA 3C38A 4CLCE 3OC2A 1VETA 1W7FA 2ZQAA 5DJTA 3GSGA 3F1NA 1HZOA 2Y55A 3G32A 4OQHA 2XRNA 4JKTA 1X0OA 1EW0A 5EVEA 4LV2A 1FSWA 4CLCB 1TDLA 4Y7PA 1N4OA 2LB9A 1S6RA 3UB6A 3N6IA 1I2SA 3T1QB 2X71A 3N7WA 3UMEA 4E3OA 5E43A 2RCXA 4BLMA 3Q81A 3TE8A 1K4FA 3SH8A 2HP6A 4K08A 4II7A 4G3VA 5F69A 3WS4A 4I39A 2ZMVA 3O3VA 5F1FA 3EOIA 5HDCA 1KGGA 3IT9A 4OPRA 1S67L 1GHIA 1ES4A 4ZJ2A 2OWJA 3KSGA 5FQKA 2PD8A 2Y2OA 5DTKA 4MLLA 3CUEC 1HVBA 5CHMA 3H82B 4GZBA 5J4EA 1TF1A 3VP2A 1LSXA 4Y2FA 1KGFA 5CGWA 1K0KA 4RVAA 4O01A 5HDDA 4KZBA 5EM1A 5J3WA 4IEDA 3ZHHA 3HCYA 4A5RA 2W3HA 1FCMA 4OONA 4I38A 2WUQA 4EW7A 4AFIA 3WWXA 4KZAA 4BWIA 3IXGA 2I72A 5HWTA 1DP8A 2Y59A 1NXYA 4IVKA 4JPMA 2PRFA 5AJGA 3NJAA 2A24B 3LIDA 1W63M 2XLNA 1NYYA 3GECA 3UNWA 3BFGA 4IBRA 3ZCZA 1SKOB 5GHXA 5FEFA 3F1NB 3UDXA 1KVLA 4NXFA 4R70A 5CXWA 5J8XA 3LI9A 3RJUA 1LSWA 1H8YA 2XFSA 3JPUA 1PFLA 4BD1A 4Q0JA 3BY9A 2ZOHA 2C6WB 1YLWA 4E3LA 3O5YA 2V8FA 1W8QA 5FI6A 3U2AA 2Y2KA 5GLDA 4ZJ1A 3LIBA 3LY4A 2J3TD 2VZWA 2L0WA 2ZQ8A 1G28A 5A92A 3SW1A 4EBNA 2QHKA 5CTMA 1SCWA 1V9YA 2XH9A 4B93A 3M6BA 4B88A 4GKUA 4IBXA 4M3KA 5DF7A 3IS2A 3WS1A 3OBFA 3NDEA 3UPPA 4JXWA 4UHUA 4GCZA 4ZBEA 4CLCA 3MXQA 3S7QA 5HPIA 4X1LA 2DNSA 4WL9A 1JVJA 1BLHA 1VEUA 3T4KA 4HJ6A 4X55A 3S1YA 3IH9A 4X68A 1K25A 3PBNA 4KZ8A 2OLVA 3JVVA 4HJ3A 4UA9A 2WKQA 4HP9A 4ETZA 5FEGA 4KUKA 1K38A 3FC7A 4MN5A 3F1PA 2NUPC 3P01A 2VX8A 4X6TA 2HV1A 2J7VA 2VGLS 4DE0A 4S2LA 1UGUA 4HP4A 1LL8A 4S2NA 1ZKJA 4LV3A 3SS5A 3V50A 1IFQA 1KE4A 3GTCA 4QWOA 1S66L 2XR0A 5KSHA 3CHWP 1ZG4A 3IF5A 1S1YA 2Y2QA 3H7WA 4LRZE 4MBHA 2HDSA 2HF6A 1L2SA 4R23A 4S2IA 1DRMA 2V2FF 4GJ4A 1PWDA 2OAQ1 4G3WA 1GSWA 4WMCD 5M19A 3HLEA 1TS8A 3M6HA 3AGFA 4OP5A 2EWWA 3BFEA 3G30A 3UO9A 1VETB 1YSPA 3WS5A 3MQOA 2G2WA 4IUKA 5EVLA 1MKMA 3N8RA 2M7UA 4WEKA 2IWDA 3MZEA 1L0FA 3PBOA 4E3MA 4FD8A 4FSFA 5EM0A 1J3WA 4P6BA 5HFOA 1D1JA 3Q1FA 4DF6A 3A3EA 3G6OA 4KQOA 3UE6A 2A24A 1DP6A 2XD1A 2O9CA 4QY5A 4KZ6A 4Y0UA 2AVXA 3HLBA 2Y79A 2PU2A 3MMHA 2XGNA 5AVEA 4JXSA 4C6YA 4UQIM 3QHYA 5IS1A 4R3AA 1YLPA 2PDRA 1K6RA 2A3UA 2PD7A 5IHVA 4E6XA 3BQAA 1YPRA 3IX8A 1CI9A 3O86A 4S2MA 3FKVA 1W63Q 3CJMA 2PR5A 1CQAA 2ZC3B 2J80A 1VEUB 5DJUA 2W0NA 3E4PA 1L3LA 4S2JA 4PHTA 5GLBA 4JLFA 1PWCA 1M6KA 4R3JA 4KG6A 1YSQA 3C8CA 1VM1A 5LBRA 1OJ5A 5EOOA 1OPXA 3A3JA 4OQIA 3EEAA 4N92A 2XQZA 3BM6A 3V5MA 3QNCA 4JGOA 2X01A 4OOLA 2K7SA 4UA7A 5AVFA 4ARZA 3S7NA 3E4QA 3NDGA 1FR1A 2XA7S 2Y2HA 3A3IA 4NK3A 1DJCA 5FDHA 3T1XA 4GS9B 3LR5A 3EEHA 4DDSA 2J8YA 5FI2A 1G68A 5M1AA 1O7EA 5K5BA 2H0YA 2WGVA 4QB8A 4FH4A 1JWZA 4CPKA 2EX2A 3QP2A 3CAXA 5TBMA 2B5RA 1GSVA 2JKTI 2HZ5A 3LI8A 5C5KA 1HD8A 3E4OA 1CF0A 5I94A 3ITAA 4DJ3A 4F3LB 2B02A 4GOGA 1A0KA 1MZUA 4Y17A 2VGKA 3DWZA 4GDBA 4E3JA 3DAVA 3HREA 5U47A 4OH0A 3AGEA 3EGDC 2VA0A 5G18A 4WZ5C 2A49A 3GDIA 5E2FA 2XROA 4YWZA 3V67A 1G5UA 2XK1A 2Y2PA 2PYPA 2P74A 4JXGA 2VKSA 4S2KA 2EXAA 4N1XA 1JNUA 4RQ9A 1RCJA 2UWXA 4DE2A 2BASA 5EOEA 3BWLA 5EUAA 3CWFA 2R9WA 3QP6A 5J7EA 5CGXA 1DJAA 4UAAA 5CERA 4HHDA 3KSHA 3F1OB 3NI9A 4HIAA 3H7WB 1WYBA 1FIKA 2Y2JA 5EVIC 3R4KA 2ZL1B 4OQ0A 1TS0A 4PMAA 4HEFA 4OPZA 4E3KA 4MNRA 1TVFA 4KZ4A 3IF6A 5FSRA 5EECA 3VP3A 4LCMA 3PBTA 4KG2A 5DF8A 2WKPA 2UV0E 5HWVA 2V1BA 2J3TC 4KQRA 1KVMA 2W3GA 3S7PA 2Y8HA 5CHUA 2ZC7A 3LEQA 4ZDXA 5HPFA 1C3BA 4KUOA 4B4XA 4QHCA 5FQJA 4ZJ3A 2GJ3A 4DE1A 3O87A 3LIEA 2V8CA 3Q7VA 1FCOA 4LV0A 5GLCA 3A0VA 3V3SA 4UQIS 5JYPA 1JTDA 1Y28A 2QJ5A 1K56D 2VGLM 3BECA 2OV5A 3GMWA 1L0DA 2DMWA 3T4TA 3C2WA 1BLCA 3VFFA 1DY6A 4GHIB 1N9BA 3ZVWA 4LCLA 1W79A 1BT5A 3MFDA 2B18A 2ZQCA 2GX5A 1T1BA 4NEED 5HZHA 2HGVA 5CGSA 4CJNA 5FQ9A 1YLYA 4OPQA 1N9LA 1PNEA 1SKFA 1KE3A 2X02A 3T1RA 4I3JA 4YINA 3SH9A 1ONHA 3K3CA 3VP0A 4JBFA 1ERMA 3PBRA 1G6OA 3WS0A 1ONGA 1IYQA 4KQDA 1N9OA 1YLZA 1P9RA 1ESUA 3LUQA 2FFFB 4ME4A 1H8MA 1SHVA 2JKRI 1F98A 3NOUC 1K57A 2NUTC 3HUMA 4N9KA 5F5YA 1E3UD 3ITBA 3B33A 4KQQA 4XUZA 3HLDA 2HJ9C 3TJZC 2QYBA 4JF6A 3ULFA 1F5MA 3GR2A 1LI0A 3CITA 3NECA 5DF9A 5HD5A 2RL3A 3W8KA 3D9YA 1VB6A 1EROA 1ALQA 4EWFA 3HBRA 3LICA 2OLUA 5A91A 1FQGA 4CLCC 3VE4A 4LLOB 4WZ5A 3IWQA 3TSGA 2YKHA 2XSSA 1ZHHB 1IEMA 3VOYA 5CEDA 3AGDA 3GVBA 1K54A 2EWVA 2O9BA 1WA9A 1UWNX 1H5XA 4Y0OA 1E4DA 1QMFA 3E2KA 2ZM2A 1Z09A 4PM7A 1TS6A 4DDYA 4R6LA 5FI7A 3SH7A 1CEGA 2KOIA 4FH2A 4H6JB 4PM8A 1MWSA 1I2WA 3QNBA 4M4XA 4RX3A 2PU4A 3G34A 5HSQA 4GD8A 4BENA 2Z2LB 3ZNTA 1YMXA 1XP4A 2P08A 1STZA 3IHBA 1U60A 2INWA 5E2HA 2ACGA 1D7EA 3UPOA 2OAP1 3UB8A 2WAEA 5L10A 1ESIA 1GHMA 3BY8A 5HAQA 1GA9A 1IYOA 3T1SA 3IH8A 3L7HA 3Q7ZA 5FAPA 3T4QA 2QKPA 4DXCA 5A93A 3T4LA 3MR0A 3EQUA 1S1ZA 3ZGAB 5DTSA 2PAVP 1Y4OA 3UE3A 3WRZA 1ZC2A 3IF6C 5A90A 3FV7A 3MF0A 1XJ6A 1IELA 5FQMA 1CEFA 1S4RA 1SZVA 3LR3A 3OCLA 2W3EA 1D06A 4L9EA 1MWUA 2WADA 3ZG5A 3LIFA 2PBYA 3C7UA 3HLCA 3H9WA 3HL9A 3VSLA 4R0QA 2QJ7A 4LV1A 3UMDA 4HH2A 2DCFA 2ZOIA 3CMZA 5L8MA 3Q07A 4YOFA 1V9ZA 4Z9QA 2WKRA 4Q8IA 4PAUA 1DP9A 4BD0A 1KE0A 4E04A 1IKGA 4HH3A 4I5SA 4ID4A 1LSVA 3OLOA 4HJ4A 1NY0A 4LRYC 3W2ZA 2L4RA 2K2NA 1S4SA 3PTEA 2JKRM 3DTKA 2CC1A 1F9IA 5CX7A 2W27A 4Y5FA 5L07A 4GDNA 2VGJA 1SDEA 3ISGA 2HDRA 5L09A 1NRFA 4N9LA 4GS9A 2ZMAA 3M2KA 3IQAA 4WMCA 1AWIA 4NXBA 1OTEA 3NCKA 1PIOA 3FKWA 2W1TB 4D2OA 2D02A 4QJGA 3KSFA 1FOFA 1E25A 1VQQA 3BRMA 1ODVA 5DKKA 4L0LA 4RA7A 3IHAA 1MC0A 2O0YA 2EX6A 5FDSA 3MKEA 4PM6A 3RH8B 2WKIA 4GW9A 4WLAA 2FH5A 2ZQ7A 1YM1A 2JE5A 3MJQA 2WK0A 4EQIA 1W8YA 3SS3A 3CI6A 1MBLA 3VFHA 4NXGA 1EI5A 4DJ2A 4Y15A 1BTLA 5DFXA 2QWSA 2JHEA 3E98A 5HW3A 1P0ZA 4PM9A 4UEYA 2V9AA 4U0TA 3K2NA 4BBVA 4KZ5A 4Q0HA 3ZVTA 3BEBA 3FYZA 4NG2A 3HLWA 2Y91A 4BQMA 2XDMA 3M2JA 2HP5A 4KZ9A 1MWTA 2H5SA 3LYXA 5HX9A 2QPNA 1OTIA 3OOVA 1VHMA 1NZOA 2ZC5B 1XFNA 1HLUP 3K3DA 1K55A 4CQHA 4QPRA 5HL6A 4R4RA 4KENB 2WAFA 3PBSA 2WZZA 4BJPA 3IS2B 3LCEA 4X56A 4L9FA 1WYCA 4WF0A 3MKFA 3OPPA 2HP9A 1NLYA 4FCFA 5A8BA 5FQIA 3HLFA 3CG5A 3TW8A 4S2PA 5MC7A 1YT4A 2H28A 1K55C 4HBUA 2E8JA 4XXRA 3KX0X 1JTGA 1LL9A 4F94A 1H8ZA 3B3XA 1H3QA 5CECA 3HVFA 4I3IA 1LT0A 1IYPA 4Y13A 2MJ6A 3UE0A 4U0XA 2P04A 4P6ZM 5EVIB 3PBQA 4E6WA 1MKIA 4HI4A 1CK3A 3ZNYA 4DN0A 3OPHA 3UPNA 3O88A 3HUOA 3V3RA 3LR4A 3DW0A 2J9PA 3C30A 2BLSA 1NYMA 1WE4A 2ZM8A 1QMEA 2CMNA 1GHPA 3G35A 3NIAA 4R4SA 3TG9A 4UA6A 3D72A 1OT9A 1K6SA 1XX2A 3R7WA 3ZFZA 3NOTC 4HNBA 4EESA 4WUJA 1OTAA 4S2NC 2PBDP 3WRTA 2Z6DA 4QU3A 3D4FA 4H8RA 1ES2A 1HTZA 5F83A 3MS6A 3JVUA 3HUNA 4WEJA 2VV6A 3Q7VB 3ZQ5A 3VP4A 3VV4A 1XA1A 5AQ7A 3S7OA 2Q9NA 3IXBA 3G31A 5F1GA 1M40A 5DVAA 2ZMFA 2KLIA 4WZ4A 1KGEA 3KO6A 4FTXA 1P9WA 2I9VA 2ZM0A 3FPWA 2ZBBA 1SDNA 5E2EA 4X25A 3N4IA 4QY6A 1PW1A 1NWZA 5BOHA 1W5DA 1TEMA 4RX2A 1MXOA 2G7UA 3LO7A 3QP8A 5CEBA 1K4EA 1LHYA 2JKTM 3BQ8A 1XJ3A 5I5LA 2W1TA 2JBFA 4EEUA 2M7VA 4B9OA 3GV9A 5KZHA 5TR7A 1T19A 3MBZA 5TJJA 2VEAA 5D3OA 5KMWA 4P87A 3VE3A 3NULA 1MPLA 3PAEA 4O8GA 2Y2NA 3OCNA 4U3TA 5KSCA 4EQ1A 3CPTB 2Q0OA 4IUHA 1FILA 3JYIA 5GLAA 3FPVA 2Q9MA 2HDQA 2V1AA 1T18A 4EUVA 4MBKA 4PKYG 4WYYA 3LFVA 4GB7A 2VLGA 1GA0A 1ZG6A 2V20A 4RYEA 1FCNA 5EV0A 2W3FA 4IHQA 3NHQA 1E3UA 1AXBA 4HQAA 5FASA 1NJ4A 4K91A 1ZTUA 2ZC4B 2L1MA 4YFMA 1OJGA 3RXWA 1BZAA 2P9VB 3BFFA 1XJ4A 3G2ZA 1OT6A 2JKFA 4OP8A 2IWBA 5TFQA 5CHJA 1YLTA 5CTNA 1CI8A 2QZ6A 1BSGA 2HPBA 1NLZA 3QP4A 3U4LP 2M1CA 2R9XA 3C5AA 3DBAA 3PYPA 2C5WB 4WM9A 2ZQDA 3HJKA 2GNXA 4C75A 4MN6A 5HAIA 3IWOA 3ZG8B 4OPYA 1Q2QA 2FFYA 4GHIA 4MBFA 4ZTKA 2JC7A 5HARA 3MXSA 1XPBA 5EPHA 3BYDA 1RGYA 5FA7A 5GL9A 2P7JA 1LI9A 4B4ZA 1UWPX 3LIAA 1G6AA 1YMSA 3A3DA 3DTIA 3MXRA 3D3OA 4YNRA 4NKPA 3R7WB 4JGPA 3UY6A 1PWGA 3ZYTA 5HDSA 5KIZA 3CUEA 1EWZA 1PZOA 1XXMA 1T1CA 3TOIA 5EFWA 3P7NA 3LEZA 2ZC6B 1XFQA 4DRTA 1BLPA 3F1OA 3IWIA 2WKHA 3KSIA 4MCWA 4K0XA 4X69A 3G2YA 3PXPA 2YKFA 3BLMA 4Z1WA 2O99A 3DTMA 2VV7A 1T1AA 2P9VA 2WGWB 1IKIA 4LPZA 2EFXA 2HJEA 2XFTA 4DXBA 2XF3A 4R38A 4BL3A 2JKGA 3KYEA 4GLQA 3CPTA 4EBPA 1Z6FA 3G4PA 1XKZA 3T4SA 3UE1A 4L9GA 3HJIA 4E3IA 5EVIA 2EX9A 3E2LA 2WYXA 4JF4A 5HD3A 2VJWA 5FAQA 4R3BA 3B42A 3NBLA 3T4OA 1FR6A 1F2KA 2IWCA 4HBTA 4EU0A 4O7DA 4C3QA 1KOUA 4EUZA 2XA7M 3FWLA 2PHYA 1IOUA 3C7VA 5TBMB
chains in the Genus database with same CATH topology
2Y2MA 3M2JA 3WS2A 1KDWA 1O07A 2HP5A 4KZ9A 2J9OA 5CRFA 1MWTA 1WYBA 5FAOA 4A5RA 1FCMA 2H5SA 4NETA 4OONA 5HX9A 2Y2JA 5EVIC 2WUQA 2QPNA 2Y4AA 4DKIA 3WWXA 4EV4A 4KZAA 2ZC5B 1NZOA 3IXGA 4P85A 1K55A 2I72A 3NY4A 4OQ0A 2Y59A 1ES5A 1NXYA 4PMAA 4IVKA 4KENB 4R4RA 2WAFA 4JPMA 4HEFA 4OPZA 4E3KA 4OLGA 4MNRA 1TVFA 3PBSA 4KZ4A 2WZZA 4BJPA 3IF6A 5FSRA 3LCEA 4X56A 2XLNA 5EECA 1NYYA 1WYCA 3UDIA 3UNWA 3VP3A 2Y2GA 3MKFA 1JWPA 4LCMA 3BFGA 4IBRA 3ZCZA 3PBTA 4KG2A 5DF8A 5GHXA 3OPPA 3UDXA 1KVLA 1J9MA 2HP9A 5CXWA 3W4PA 1K57C 4KQRA 4FCFA 5J8XA 1KVMA 5FQIA 3RJUA 3HLFA 3CG5A 1H8YA 2XFSA 5FQQA 3W4OA 4S2PA 3CZDA 4BD1A 1XGIA 2XEPA 5HAPA 1TDGA 2C6WB 1YLWA 5JYOA 5CHUA 1YT4A 4E3LA 3C4OA 1I5QA 2ZC7A 1K55C 4HBUA 4K0WA 4ZDXA 1W8QA 5FI6A 1C3BA 4B4XA 1ES3A 2JCHA 2Y2KA 4QHCA 4WBGA 5GLDA 5FQJA 4ZJ1A 1ERQA 3LY4A 4ZJ3A 2ZQ8A 4DE1A 3O87A 4XXRA 5A92A 4OOYA 1JTGA 1LL9A 1OMEA 4EBNA 5CTMA 5FATA 4F94A 3Q7VA 2WZXA 1GCEA 3OPRA 1H8ZA 1FCOA 1DJBA 3B3XA 1PW8A 4LV0A 5GLCA 5CECA 1SCWA 3HVFA 1BULA 3GRJA 3BLSA 1IYPA 2XH9A 3V3SA 5JYPA 1JTDA 1Y54A 3M6BA 3UE0A 4B88A 3VOZA 1K56D 4U0XA 3BECA 4E3NA 4GKUA 3ZG7B 2OV5A 5EVIB 3GMWA 3N8SA 1L0DA 2OSUA 3PBQA 4E6WA 4IBXA 2H10A 4OKPA 1BLCA 3OZHA 1MKIA 5EE8A 3VFFA 1DY6A 4M3KA 4OQGA 1CK3A 3ZNYA 1N9BA 3OPHA 5DF7A 3O88A 3UPNA 3ZVWA 1MWRA 3HUOA 4LCLA 3V3RA 4IVIA 3WS1A 1W79A 1BT5A 3DW0A 1MY8A 2J9PA 3MFDA 3NDEA 3UPPA 2ZQCA 4JXWA 5M18A 2BLSA 3OPLA 5CGSA 4CJNA 1NYMA 5FQ9A 1WE4A 1YLYA 1L0GA 2ZM8A 3A3FA 4OPQA 1QMEA 4UHUA 5EVID 4P0MA 4ZBEA 2ZQ9A 3FZCA 1GHPA 1SKFA 3G35A 1KE3A 2WKEA 2X02A 3NIAA 4KG5A 4R4SA 3TG9A 2DNSA 4UA6A 4YINA 3SH9A 2WGWA 1JVJA 2H0TA 1K6SA 1XX2A 1ONHA 3IF6B 1BLHA 3ZFZA 4X55A 3VP0A 3S1YA 4JBFA 3S22A 1ERMA 4S2NC 3PBRA 3IH9A 1S0WA 1XGJA 1K25A 4X68A 3PBNA 3WRTA 4KZ8A 1BLSA 3WS0A 1ONGA 1IYQA 4KZ3A 2OLVA 4QU3A 3D4FA 3W4QA 4H8RA 1ES2A 4UA9A 1HTZA 1YLZA 4EBLA 5F83A 4OLDA 4XUXA 4GD6A 1ESUA 5AQBA 5AQAA 3HUNA 4WEJA 3Q7VB 2FFFB 3I7JA 3NC8A 3ZG0A 1SHVA 3VP4A 1XA1A 5AQ7A 2Q9NA 1K38A 3IXBA 3G31A 5F1GA 1M40A 1K57A 3HUMA 4X6TA 5DVAA 4N9KA 2J7VA 4DE0A 1E3UD 4S2LA 5GHYA 3ITBA 4KQQA 4XUZA 4WZ4A 3HLDA 4S2NA 1KGEA 1ZKJA 1KDSA 4LV3A 3SS5A 4JF6A 3GR2A 1LI0A 3N8LA 2XD5A 2ZM0A 3V50A 1BUEA 5DF9A 2RL3A 1SDNA 3W8KA 1KE4A 3GTCA 5E2EA 3IXDA 2XR0A 3N4IA 4QY6A 1PW1A 1EROA 1ALQA 4EWFA 5KSHA 3HBRA 5BOHA 1W5DA 1TEMA 1ZG4A 4RX2A 1MXOA 3LO7A 2OLUA 5A91A 3EQVA 5HL1A 3IF5A 1FQGA 3ZDJA 5CEBA 1K4EA 1LHYA 2Y2QA 4MBHA 4WZ5A 2HDSA 3IWQA 2V1ZA 3TSGA 1L2SA 3VOYA 2ZJ9A 1IEMA 4JF5A 4KZ7A 4R23A 2EFUA 4S2IA 2JBFA 5CEDA 2V2FF 3AGDA 1PWDA 3GVBA 3GV9A 5KZHA 5TR7A 4N1HA 2EX8A 3MBZA 4GN2A 1K54A 4PPRA 4LENA 2Y2LA 5D3OA 4WMCD 5M19A 2G2UA 5KMWA 4P87A 3VP1A 1H5XA 3HLEA 1E4DA 3M6HA 1QMFA 1YLJA 2ZM2A 3E2KA 3AGFA 4PM7A 3SS4A 4OP5A 3BFEA 3G30A 4DDYA 1MPLA 3PAEA 4U3TA 2Y2NA 3OCNA 3UO9A 5KSCA 5FI7A 3SH7A 1CEGA 1JWVA 3WS5A 4ZAMA 3UDFA 4FH2A 4PM8A 3PAGA 1MWSA 2G2WA 4OVDA 1I2WA 3QNBA 3VMAA 5EVLA 3N8RA 4RX3A 3JYIA 1RP5A 4WEKA 2PU4A 2IWDA 3G34A 3MZEA 4GD8A 2Z2LB 3ZNTA 1YMXA 4R1GA 5GLAA 4BENA 2Q9MA 1XP4A 2HDQA 1L0FA 3PBOA 1PZPA 4E3MA 4FD8A 3IHBA 1U60A 4MBKA 4HESA 4FSFA 3IXHA 4WYYA 5E2HA 4P6BA 4GB7A 5HFOA 3SOIA 3UPOA 2DRWA 3MZDA 3Q1FA 4DF6A 3C4PA 2HDUA 2BG1A 3A3EA 4PM5A 1GA0A 1ZG6A 2V20A 4KQOA 2WAEA 4RYEA 1FCNA 1PYYA 1ESIA 2WGIA 3MZFA 2XD1A 2ZD8A 3VSKA 1GHMA 4QD4A 4QY5A 4KZ6A 5HAQA 1E3UA 1AXBA 1GA9A 4Y0UA 5FASA 1NJ4A 4X53A 3P09A 5GHZA 1IYOA 2GDNA 4K91A 1LL5A 2ZC4B 3HLBA 2PU2A 3IH8A 2XGNA 5AQ9A 3GQZA 4YFMA 4JXSA 4C6YA 3Q7ZA 5FAPA 1RGZA 3RXWA 4DXCA 5A93A 3QHYA 1BZAA 2P9VB 1LLBA 1YLPA 1YQSA 3BFFA 3EQUA 1K6RA 3ZGAB 5DTSA 5DTTA 3G2ZA 3S4XA 2A3UA 5TGFA 4Y0TA 5L2FA 3UE3A 3WRZA 1ZC2A 3IF6C 5A90A 3P98A 5IHVA 4E6XA 4OP8A 3O86A 1CI9A 3FV7A 2IWBA 4S2MA 1IELA 3FKVA 3DWKA 5TFQA 1Q2PA 5FQMA 3CJMA 5CHJA 1CEFA 1YLTA 5CTNA 1CI8A 3OCLA 2ZC3B 4JXVA 3BFCA 2QZ6A 1BSGA 1MWUA 2WADA 2Z2MB 1IYSA 2HPBA 3UN7A 4S2JA 3ZG5A 1FSYA 2R9XA 1XA7A 3HLGA 3C5AA 1K54C 3Q82A 2PBYA 4MEZA 5F82A 3C7UA 2C5WB 3HLCA 4WM9A 5GLBA 3HL9A 4JLFA 4R0QA 3VSLA 1PWCA 1NZUA 2QMIA 1L0EA 2ZQDA 4OOMA 1M6KA 4LV1A 4R3JA 4KG6A 1PI5A 4BL2A 4C75A 2DCFA 5HAIA 1VM1A 3IWOA 3ZG8B 4OPYA 1PI4A 1Q2QA 2FFYA 3CMZA 2EXBA 3Q07A 4MBFA 2JC7A 2ZLYA 4GNUA 4Z9QA 5EOOA 4ZTKA 3A3JA 4OQIA 5HARA 3MXSA 4N92A 4DE3A 4Q8IA 4BD0A 1KE0A 1XPBA 5EPHA 1K56A 2XQZA 3RXXA 1IKGA 3BM6A 3ZG9B 3V5MA 3BFDA 3QNCA 3BYDA 1RGYA 2X01A 3LY3A 4ID4A 5FA7A 4OOLA 5GL9A 4UA7A 4S2OA 2Y2IA 4WELA 3V39A 5E2GA 1LI9A 1NY0A 2E8IA 4B4ZA 3OC2A 1G6AA 1W7FA 1FR1A 1YMSA 2ZQAA 3A3DA 3GSGA 3NDGA 1HZOA 2Y2HA 2Y55A 3G32A 3MXRA 4OQHA 3PTEA 3A3IA 4JKTA 3UY6A 2CC1A 4NK3A 1DJCA 1PWGA 5FDHA 4LV2A 1FSWA 1TDLA 4Y7PA 4GDNA 2VGJA 1N4OA 1EWZA 1PZOA 1SDEA 4DDSA 1S6RA 2J8YA 1XXMA 1G68A 3ISGA 2HDRA 1O7EA 5FI2A 5M1AA 3TOIA 1NRFA 3N6IA 1I2SA 4N9LA 2H0YA 2ZMAA 3LEZA 3M2KA 3IQAA 2X71A 4WMCA 3N7WA 4E3OA 2WGVA 2ZC6B 5E43A 4QB8A 2RCXA 4BLMA 3NCKA 4FH4A 1JWZA 1PIOA 4CPKA 2EX2A 4DRTA 1BLPA 3IWIA 2B5RA 2WKHA 3Q81A 3FKWA 4K0XA 4X69A 1K4FA 3G2YA 3SH8A 2HP6A 4D2OA 4QJGA 1HD8A 3BLMA 1FOFA 5I94A 3DTMA 1E25A 3ITAA 1VQQA 3BRMA 2P9VA 3WS4A 4L0LA 4GOGA 2WGWB 4Y0OA 2VGKA 1IKIA 3DWZA 4RA7A 3IHAA 2EFXA 4GDBA 2XFTA 4DXBA 3O3VA 4E3JA 2EX6A 2XF3A 3MKEA 5F1FA 4PM6A 1KGGA 4BL3A 3IT9A 3HREA 5U47A 2WKIA 4OH0A 3AGEA 4EBPA 4OPRA 2ZQ7A 1Z6FA 1YM1A 2JE5A 3G4PA 1XKZA 2WK0A 5G18A 4EQIA 4WZ5C 1W8YA 2A49A 5E2FA 1GHIA 3SS3A 1ES4A 4ZJ2A 3UE1A 1MBLA 3VFHA 4E3IA 1EI5A 2XK1A 5EVIA 2EX9A 3E2LA 2WYXA 4JF4A 2Y2PA 5FQKA 1BTLA 2P74A 5FAQA 4JXGA 4S2KA 4R3BA 2Y2OA 5DTKA 4MLLA 1HVBA 5CHMA 3NBLA 2EXAA 4N1XA 4GZBA 5HW3A 4PM9A 3VP2A 1FR6A 1KGFA 5CGWA 4RVAA 1RCJA 2UWXA 4U0TA 4DE2A 5EOEA 4KZBA 4KZ5A 3ZVTA 2IWCA 3BEBA 4HBTA 3FYZA 5EUAA 4O7DA 2R9WA 4C3QA 4EUZA 3FWLA 4IEDA 3ZHHA 5CGXA 1DJAA 3HLWA 4UAAA 5CERA 2Y91A 3C7VA 4BQMA 2XDMA 3NI9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y2M A;  3M2J A;  3WS2 A;  1KDW A;  1O07 A;  2HP5 A;  4KZ9 A;  2J9O A;  5CRF A;  1MWT A;  1WYB A;  5FAO A;  4A5R A;  1FCM A;  2H5S A;  4NET A;  4OON A;  5HX9 A;  2Y2J A;  5EVI C;  2WUQ A;  2QPN A;  2Y4A A;  4DKI A;  3WWX A;  4EV4 A;  4KZA A;  2ZC5 B;  1NZO A;  3IXG A;  4P85 A;  1K55 A;  2I72 A;  3NY4 A;  4OQ0 A;  2Y59 A;  1ES5 A;  1NXY A;  4PMA A;  4IVK A;  4KEN B;  4R4R A;  2WAF A;  4JPM A;  4HEF A;  4OPZ A;  4E3K A;  4OLG A;  4MNR A;  1TVF A;  3PBS A;  4KZ4 A;  2WZZ A;  4BJP A;  3IF6 A;  5FSR A;  3LCE A;  4X56 A;  2XLN A;  5EEC A;  1NYY A;  1WYC A;  3UDI A;  3UNW A;  3VP3 A;  2Y2G A;  3MKF A;  1JWP A;  4LCM A;  3BFG A;  4IBR A;  3ZCZ A;  3PBT A;  4KG2 A;  5DF8 A;  5GHX A;  3OPP A;  3UDX A;  1KVL A;  1J9M A;  2HP9 A;  5CXW A;  3W4P A;  1K57 C;  4KQR A;  4FCF A;  5J8X A;  1KVM A;  5FQI A;  3RJU A;  3HLF A;  3CG5 A;  1H8Y A;  2XFS A;  5FQQ A;  3W4O A;  4S2P A;  3CZD A;  4BD1 A;  1XGI A;  2XEP A;  5HAP A;  1TDG A;  2C6W B;  1YLW A;  5JYO A;  5CHU A;  1YT4 A;  4E3L A;  3C4O A;  1I5Q A;  2ZC7 A;  1K55 C;  4HBU A;  4K0W A;  4ZDX A;  1W8Q A;  5FI6 A;  1C3B A;  4B4X A;  1ES3 A;  2JCH A;  2Y2K A;  4QHC A;  4WBG A;  5GLD A;  5FQJ A;  4ZJ1 A;  1ERQ A;  3LY4 A;  4ZJ3 A;  2ZQ8 A;  4DE1 A;  3O87 A;  4XXR A;  5A92 A;  4OOY A;  1JTG A;  1LL9 A;  1OME A;  4EBN A;  5CTM A;  5FAT A;  4F94 A;  3Q7V A;  2WZX A;  1GCE A;  3OPR A;  1H8Z A;  1FCO A;  1DJB A;  3B3X A;  1PW8 A;  4LV0 A;  5GLC A;  5CEC A;  1SCW A;  3HVF A;  1BUL A;  3GRJ A;  3BLS A;  1IYP A;  2XH9 A;  3V3S A;  5JYP A;  1JTD A;  1Y54 A;  3M6B A;  3UE0 A;  4B88 A;  3VOZ A;  1K56 D;  4U0X A;  3BEC A;  4E3N A;  4GKU A;  3ZG7 B;  2OV5 A;  5EVI B;  3GMW A;  3N8S A;  1L0D A;  2OSU A;  3PBQ A;  4E6W A;  4IBX A;  2H10 A;  4OKP A;  1BLC A;  3OZH A;  1MKI A;  5EE8 A;  3VFF A;  1DY6 A;  4M3K A;  4OQG A;  1CK3 A;  3ZNY A;  1N9B A;  3OPH A;  5DF7 A;  3O88 A;  3UPN A;  3ZVW A;  1MWR A;  3HUO A;  4LCL A;  3V3R A;  4IVI A;  3WS1 A;  1W79 A;  1BT5 A;  3DW0 A;  1MY8 A;  2J9P A;  3MFD A;  3NDE A;  3UPP A;  2ZQC A;  4JXW A;  5M18 A;  2BLS A;  3OPL A;  5CGS A;  4CJN A;  1NYM A;  5FQ9 A;  1WE4 A;  1YLY A;  1L0G A;  2ZM8 A;  3A3F A;  4OPQ A;  1QME A;  4UHU A;  5EVI D;  4P0M A;  4ZBE A;  2ZQ9 A;  3FZC A;  1GHP A;  1SKF A;  3G35 A;  1KE3 A;  2WKE A;  2X02 A;  3NIA A;  4KG5 A;  4R4S A;  3TG9 A;  2DNS A;  4UA6 A;  4YIN A;  3SH9 A;  2WGW A;  1JVJ A;  2H0T A;  1K6S A;  1XX2 A;  1ONH A;  3IF6 B;  1BLH A;  3ZFZ A;  4X55 A;  3VP0 A;  3S1Y A;  4JBF A;  3S22 A;  1ERM A;  4S2N C;  3PBR A;  3IH9 A;  1S0W A;  1XGJ A;  1K25 A;  4X68 A;  3PBN A;  3WRT A;  4KZ8 A;  1BLS A;  3WS0 A;  1ONG A;  1IYQ A;  4KZ3 A;  2OLV A;  4QU3 A;  3D4F A;  3W4Q A;  4H8R A;  1ES2 A;  4UA9 A;  1HTZ A;  1YLZ A;  4EBL A;  5F83 A;  4OLD A;  4XUX A;  4GD6 A;  1ESU A;  5AQB A;  5AQA A;  3HUN A;  4WEJ A;  3Q7V B;  2FFF B;  3I7J A;  3NC8 A;  3ZG0 A;  1SHV A;  3VP4 A;  1XA1 A;  5AQ7 A;  2Q9N A;  1K38 A;  3IXB A;  3G31 A;  5F1G A;  1M40 A;  1K57 A;  3HUM A;  4X6T A;  5DVA A;  4N9K A;  2J7V A;  4DE0 A;  1E3U D;  4S2L A;  5GHY A;  3ITB A;  4KQQ A;  4XUZ A;  4WZ4 A;  3HLD A;  4S2N A;  1KGE A;  1ZKJ A;  1KDS A;  4LV3 A;  3SS5 A;  4JF6 A;  3GR2 A;  1LI0 A;  3N8L A;  2XD5 A;  2ZM0 A;  3V50 A;  1BUE A;  5DF9 A;  2RL3 A;  1SDN A;  3W8K A;  1KE4 A;  3GTC A;  5E2E A;  3IXD A;  2XR0 A;  3N4I A;  4QY6 A;  1PW1 A;  1ERO A;  1ALQ A;  4EWF A;  5KSH A;  3HBR A;  5BOH A;  1W5D A;  1TEM A;  1ZG4 A;  4RX2 A;  1MXO A;  3LO7 A;  2OLU A;  5A91 A;  3EQV A;  5HL1 A;  3IF5 A;  1FQG A;  3ZDJ A;  5CEB A;  1K4E A;  1LHY A;  2Y2Q A;  4MBH A;  4WZ5 A;  2HDS A;  3IWQ A;  2V1Z A;  3TSG A;  1L2S A;  3VOY A;  2ZJ9 A;  1IEM A;  4JF5 A;  4KZ7 A;  4R23 A;  2EFU A;  4S2I A;  2JBF A;  5CED A;  2V2F F;  3AGD A;  1PWD A;  3GVB A;  3GV9 A;  5KZH A;  5TR7 A;  4N1H A;  2EX8 A;  3MBZ A;  4GN2 A;  1K54 A;  4PPR A;  4LEN A;  2Y2L A;  5D3O A;  4WMC D;  5M19 A;  2G2U A;  5KMW A;  4P87 A;  3VP1 A;  1H5X A;  3HLE A;  1E4D A;  3M6H A;  1QMF A;  1YLJ A;  2ZM2 A;  3E2K A;  3AGF A;  4PM7 A;  3SS4 A;  4OP5 A;  3BFE A;  3G30 A;  4DDY A;  1MPL A;  3PAE A;  4U3T A;  2Y2N A;  3OCN A;  3UO9 A;  5KSC A;  5FI7 A;  3SH7 A;  1CEG A;  1JWV A;  3WS5 A;  4ZAM A;  3UDF A;  4FH2 A;  4PM8 A;  3PAG A;  1MWS A;  2G2W A;  4OVD A;  1I2W A;  3QNB A;  3VMA A;  5EVL A;  3N8R A;  4RX3 A;  3JYI A;  1RP5 A;  4WEK A;  2PU4 A;  2IWD A;  3G34 A;  3MZE A;  4GD8 A;  2Z2L B;  3ZNT A;  1YMX A;  4R1G A;  5GLA A;  4BEN A;  2Q9M A;  1XP4 A;  2HDQ A;  1L0F A;  3PBO A;  1PZP A;  4E3M A;  4FD8 A;  3IHB A;  1U60 A;  4MBK A;  4HES A;  4FSF A;  3IXH A;  4WYY A;  5E2H A;  4P6B A;  4GB7 A;  5HFO A;  3SOI A;  3UPO A;  2DRW A;  3MZD A;  3Q1F A;  4DF6 A;  3C4P A;  2HDU A;  2BG1 A;  3A3E A;  4PM5 A;  1GA0 A;  1ZG6 A;  2V20 A;  4KQO A;  2WAE A;  4RYE A;  1FCN A;  1PYY A;  1ESI A;  2WGI A;  3MZF A;  2XD1 A;  2ZD8 A;  3VSK A;  1GHM A;  4QD4 A;  4QY5 A;  4KZ6 A;  5HAQ A;  1E3U A;  1AXB A;  1GA9 A;  4Y0U A;  5FAS A;  1NJ4 A;  4X53 A;  3P09 A;  5GHZ A;  1IYO A;  2GDN A;  4K91 A;  1LL5 A;  2ZC4 B;  3HLB A;  2PU2 A;  3IH8 A;  2XGN A;  5AQ9 A;  3GQZ A;  4YFM A;  4JXS A;  4C6Y A;  3Q7Z A;  5FAP A;  1RGZ A;  3RXW A;  4DXC A;  5A93 A;  3QHY A;  1BZA A;  2P9V B;  1LLB A;  1YLP A;  1YQS A;  3BFF A;  3EQU A;  1K6R A;  3ZGA B;  5DTS A;  5DTT A;  3G2Z A;  3S4X A;  2A3U A;  5TGF A;  4Y0T A;  5L2F A;  3UE3 A;  3WRZ A;  1ZC2 A;  3IF6 C;  5A90 A;  3P98 A;  5IHV A;  4E6X A;  4OP8 A;  3O86 A;  1CI9 A;  3FV7 A;  2IWB A;  4S2M A;  1IEL A;  3FKV A;  3DWK A;  5TFQ A;  1Q2P A;  5FQM A;  3CJM A;  5CHJ A;  1CEF A;  1YLT A;  5CTN A;  1CI8 A;  3OCL A;  2ZC3 B;  4JXV A;  3BFC A;  2QZ6 A;  1BSG A;  1MWU A;  2WAD A;  2Z2M B;  1IYS A;  2HPB A;  3UN7 A;  4S2J A;  3ZG5 A;  1FSY A;  2R9X A;  1XA7 A;  3HLG A;  3C5A A;  1K54 C;  3Q82 A;  2PBY A;  4MEZ A;  5F82 A;  3C7U A;  2C5W B;  3HLC A;  4WM9 A;  5GLB A;  3HL9 A;  4JLF A;  4R0Q A;  3VSL A;  1PWC A;  1NZU A;  2QMI A;  1L0E A;  2ZQD A;  4OOM A;  1M6K A;  4LV1 A;  4R3J A;  4KG6 A;  1PI5 A;  4BL2 A;  4C75 A;  2DCF A;  5HAI A;  1VM1 A;  3IWO A;  3ZG8 B;  4OPY A;  1PI4 A;  1Q2Q A;  2FFY A;  3CMZ A;  2EXB A;  3Q07 A;  4MBF A;  2JC7 A;  2ZLY A;  4GNU A;  4Z9Q A;  5EOO A;  4ZTK A;  3A3J A;  4OQI A;  5HAR A;  3MXS A;  4N92 A;  4DE3 A;  4Q8I A;  4BD0 A;  1KE0 A;  1XPB A;  5EPH A;  1K56 A;  2XQZ A;  3RXX A;  1IKG A;  3BM6 A;  3ZG9 B;  3V5M A;  3BFD A;  3QNC A;  3BYD A;  1RGY A;  2X01 A;  3LY3 A;  4ID4 A;  5FA7 A;  4OOL A;  5GL9 A;  4UA7 A;  4S2O A;  2Y2I A;  4WEL A;  3V39 A;  5E2G A;  1LI9 A;  1NY0 A;  2E8I A;  4B4Z A;  3OC2 A;  1G6A A;  1W7F A;  1FR1 A;  1YMS A;  2ZQA A;  3A3D A;  3GSG A;  3NDG A;  1HZO A;  2Y2H A;  2Y55 A;  3G32 A;  3MXR A;  4OQH A;  3PTE A;  3A3I A;  4JKT A;  3UY6 A;  2CC1 A;  4NK3 A;  1DJC A;  1PWG A;  5FDH A;  4LV2 A;  1FSW A;  1TDL A;  4Y7P A;  4GDN A;  2VGJ A;  1N4O A;  1EWZ A;  1PZO A;  1SDE A;  4DDS A;  1S6R A;  2J8Y A;  1XXM A;  1G68 A;  3ISG A;  2HDR A;  1O7E A;  5FI2 A;  5M1A A;  3TOI A;  1NRF A;  3N6I A;  1I2S A;  4N9L A;  2H0Y A;  2ZMA A;  3LEZ A;  3M2K A;  3IQA A;  2X71 A;  4WMC A;  3N7W A;  4E3O A;  2WGV A;  2ZC6 B;  5E43 A;  4QB8 A;  2RCX A;  4BLM A;  3NCK A;  4FH4 A;  1JWZ A;  1PIO A;  4CPK A;  2EX2 A;  4DRT A;  1BLP A;  3IWI A;  2B5R A;  2WKH A;  3Q81 A;  3FKW A;  4K0X A;  4X69 A;  1K4F A;  3G2Y A;  3SH8 A;  2HP6 A;  4D2O A;  4QJG A;  1HD8 A;  3BLM A;  1FOF A;  5I94 A;  3DTM A;  1E25 A;  3ITA A;  1VQQ A;  3BRM A;  2P9V A;  3WS4 A;  4L0L A;  4GOG A;  2WGW B;  4Y0O A;  2VGK A;  1IKI A;  3DWZ A;  4RA7 A;  3IHA A;  2EFX A;  4GDB A;  2XFT A;  4DXB A;  3O3V A;  4E3J A;  2EX6 A;  2XF3 A;  3MKE A;  5F1F A;  4PM6 A;  1KGG A;  4BL3 A;  3IT9 A;  3HRE A;  5U47 A;  2WKI A;  4OH0 A;  3AGE A;  4EBP A;  4OPR A;  2ZQ7 A;  1Z6F A;  1YM1 A;  2JE5 A;  3G4P A;  1XKZ A;  2WK0 A;  5G18 A;  4EQI A;  4WZ5 C;  1W8Y A;  2A49 A;  5E2F A;  1GHI A;  3SS3 A;  1ES4 A;  4ZJ2 A;  3UE1 A;  1MBL A;  3VFH A;  4E3I A;  1EI5 A;  2XK1 A;  5EVI A;  2EX9 A;  3E2L A;  2WYX A;  4JF4 A;  2Y2P A;  5FQK A;  1BTL A;  2P74 A;  5FAQ A;  4JXG A;  4S2K A;  4R3B A;  2Y2O A;  5DTK A;  4MLL A;  1HVB A;  5CHM A;  3NBL A;  2EXA A;  4N1X A;  4GZB A;  5HW3 A;  4PM9 A;  3VP2 A;  1FR6 A;  1KGF A;  5CGW A;  4RVA A;  1RCJ A;  2UWX A;  4U0T A;  4DE2 A;  5EOE A;  4KZB A;  4KZ5 A;  3ZVT A;  2IWC A;  3BEB A;  4HBT A;  3FYZ A;  5EUA A;  4O7D A;  2R9W A;  4C3Q A;  4EUZ A;  3FWL A;  4IED A;  3ZHH A;  5CGX A;  1DJA A;  3HLW A;  4UAA A;  5CER A;  2Y91 A;  3C7V A;  4BQM A;  2XDM A;  3NI9 A; 
#chains in the Genus database with same CATH topology
 2Y2M A;  3WS2 A;  1KDW A;  1O07 A;  2J9O A;  5CRF A;  1TD5 A;  5FAO A;  4NET A;  4F3L A;  1ACF A;  1N9N A;  2Y4A A;  3E0Y A;  4DKI A;  4EV4 A;  3A0R A;  4P85 A;  3NY4 A;  3QP5 A;  1ES5 A;  4OLG A;  4EXO A;  4BBT A;  3UDI A;  3T50 A;  2Y2G A;  1JWP A;  4I3A A;  4PKY A;  1J9M A;  4XT2 B;  3SZT A;  3W4P A;  1K57 C;  4ESP A;  3BW6 A;  2W1R A;  3UB5 P;  5FQQ A;  3W4O A;  4XT2 A;  3CZD A;  1XGI A;  2XEP A;  4Y3I A;  5HAP A;  1TDG A;  5G4Y A;  5JYO A;  3MQ0 A;  3C4O A;  1I5Q A;  4K0W A;  4ZRR A;  1H0M A;  1ES3 A;  1TS7 A;  2JCH A;  4WBG A;  1ERQ A;  5G4Z A;  4OOY A;  3QP1 A;  2R78 A;  1OME A;  2O9A A;  5FAT A;  5DKL A;  2WZX A;  1GCE A;  1OTD A;  3MFX A;  3OPR A;  1DJB A;  4IJG A;  1PW8 A;  3T4J A;  1BUL A;  3GRJ A;  3BLS A;  1Y54 A;  3UB7 A;  3RTY A;  3VOZ A;  4P6Z S;  4E3N A;  3ZG7 B;  5F6A A;  3N8S A;  2OSU A;  2H10 A;  4OKP A;  3A0S A;  3OZH A;  5EE8 A;  4OQG A;  2OOL A;  3PR6 A;  3T12 B;  1MWR A;  4G3K A;  4IVI A;  1MY8 A;  2EA9 A;  5M18 A;  2GZA A;  3OPL A;  1BYW A;  4X1M A;  3EGX C;  1L0G A;  3A3F A;  5EVI D;  4P0M A;  4FOF A;  2ZQ9 A;  3FZC A;  2WKE A;  4KG5 A;  2D01 A;  3RFB A;  2WGW A;  2H0T A;  3IF6 B;  4NXE A;  2PT7 A;  4DMZ A;  2KDK A;  2K31 A;  2B95 A;  3S22 A;  1S0W A;  1XGJ A;  4MN7 A;  1BLS A;  4HY8 A;  3BJN A;  4KZ3 A;  2FZ0 A;  3W4Q A;  4EBL A;  4OLD A;  4XUX A;  4GD6 A;  5AQB A;  5AQA A;  1YAX A;  3VOL A;  3LGO A;  3I7J A;  3NC8 A;  3ZG0 A;  3PHY A;  5GHY A;  4WN5 A;  1SKO A;  1KDS A;  2V0U A;  1CJF A;  3N8L A;  2XD5 A;  3DTE A;  1BUE A;  3EWK A;  2VV8 A;  4BMW A;  3FG8 A;  3IXD A;  4ARZ B;  4FUW A;  3KYZ A;  3EQV A;  5HL1 A;  4HOI A;  3ZDJ A;  5IU1 A;  2V1Z A;  2ZJ9 A;  4KZ7 A;  4JF5 A;  2EFU A;  2VK3 A;  1PRQ A;  3UB9 A;  4N1H A;  2EX8 A;  4GN2 A;  5DFY A;  4PPR A;  1P97 A;  4LEN A;  5FL3 A;  2Y2L A;  1XJ2 A;  1OTB A;  4LFU A;  2G2U A;  3VP1 A;  4X53 A;  3SS4 A;  1YLJ A;  1NRJ A;  4JGR A;  1JWV A;  3H82 A;  4ZAM A;  3UDF A;  3PAG A;  4OVD A;  3VMA A;  5IT5 A;  1RP5 A;  3LR0 A;  2LB5 A;  3IX3 A;  4BBU A;  2JN7 A;  4R1G A;  3TRC A;  1PZP A;  4HES A;  3IXH A;  1YKD A;  3NOP C;  3SOI A;  2DRW A;  3MZD A;  3C4P A;  2HDU A;  2BG1 A;  4PM5 A;  4ETX A;  1PYY A;  5HWW A;  2WGI A;  3MZF A;  4LRX C;  2ZD8 A;  2Z6C A;  3VSK A;  4QD4 A;  4MMN A;  4LGW A;  2IA2 A;  3P09 A;  5GHZ A;  2GDN A;  5F68 A;  1LL5 A;  2ZL1 A;  3CLO A;  4H6J A;  4EET B;  5AQ9 A;  3GQZ A;  2BTF P;  4EER A;  1RGZ A;  3KYQ A;  2V0W A;  1LLB A;  1YQS A;  4D60 A;  5DTT A;  3S4X A;  4Y0T A;  5TGF A;  4MDZ A;  2KX6 A;  5L2F A;  3P98 A;  2W3D A;  3DWK A;  1Q2P A;  3F1P B;  3B47 A;  3L9K A;  4JXV A;  3BFC A;  3MQQ A;  2PYR A;  2Z2M B;  1IYS A;  3UN7 A;  4CLC D;  4Q0I A;  1FSY A;  1XA7 A;  3HLG A;  1K54 C;  3Q82 A;  4MEZ A;  5F82 A;  3IBR A;  2QMI A;  1NZU A;  3IBJ A;  1L0E A;  4OOM A;  2PR6 A;  1PI5 A;  4BL2 A;  1PI4 A;  2J3W A;  2OWH A;  2EXB A;  4O0P A;  2ZLY A;  4GNU A;  4JGQ A;  4DE3 A;  4EEP A;  1GSX A;  3ZG9 B;  1K56 A;  3RXX A;  3BFD A;  3MSH A;  3LY3 A;  3IX4 A;  2A2L A;  2Y2I A;  4S2O A;  4WEL A;  3ICY A;  5E2G A;  3V39 A;  2E8I A;  3C38 A;  4CLC E;  3OC2 A;  1VET A;  1W7F A;  2ZQA A;  5DJT A;  3GSG A;  3F1N A;  1HZO A;  2Y55 A;  3G32 A;  4OQH A;  2XRN A;  4JKT A;  1X0O A;  1EW0 A;  5EVE A;  4LV2 A;  1FSW A;  4CLC B;  1TDL A;  4Y7P A;  1N4O A;  2LB9 A;  1S6R A;  3UB6 A;  3N6I A;  1I2S A;  3T1Q B;  2X71 A;  3N7W A;  3UME A;  4E3O A;  5E43 A;  2RCX A;  4BLM A;  3Q81 A;  3TE8 A;  1K4F A;  3SH8 A;  2HP6 A;  4K08 A;  4II7 A;  4G3V A;  5F69 A;  3WS4 A;  4I39 A;  2ZMV A;  3O3V A;  5F1F A;  3EOI A;  5HDC A;  1KGG A;  3IT9 A;  4OPR A;  1S67 L;  1GHI A;  1ES4 A;  4ZJ2 A;  2OWJ A;  3KSG A;  5FQK A;  2PD8 A;  2Y2O A;  5DTK A;  4MLL A;  3CUE C;  1HVB A;  5CHM A;  3H82 B;  4GZB A;  5J4E A;  1TF1 A;  3VP2 A;  1LSX A;  4Y2F A;  1KGF A;  5CGW A;  1K0K A;  4RVA A;  4O01 A;  5HDD A;  4KZB A;  5EM1 A;  5J3W A;  4IED A;  3ZHH A;  3HCY A;  4A5R A;  2W3H A;  1FCM A;  4OON A;  4I38 A;  2WUQ A;  4EW7 A;  4AFI A;  3WWX A;  4KZA A;  4BWI A;  3IXG A;  2I72 A;  5HWT A;  1DP8 A;  2Y59 A;  1NXY A;  4IVK A;  4JPM A;  2PRF A;  5AJG A;  3NJA A;  2A24 B;  3LID A;  1W63 M;  2XLN A;  1NYY A;  3GEC A;  3UNW A;  3BFG A;  4IBR A;  3ZCZ A;  1SKO B;  5GHX A;  5FEF A;  3F1N B;  3UDX A;  1KVL A;  4NXF A;  4R70 A;  5CXW A;  5J8X A;  3LI9 A;  3RJU A;  1LSW A;  1H8Y A;  2XFS A;  3JPU A;  1PFL A;  4BD1 A;  4Q0J A;  3BY9 A;  2ZOH A;  2C6W B;  1YLW A;  4E3L A;  3O5Y A;  2V8F A;  1W8Q A;  5FI6 A;  3U2A A;  2Y2K A;  5GLD A;  4ZJ1 A;  3LIB A;  3LY4 A;  2J3T D;  2VZW A;  2L0W A;  2ZQ8 A;  1G28 A;  5A92 A;  3SW1 A;  4EBN A;  2QHK A;  5CTM A;  1SCW A;  1V9Y A;  2XH9 A;  4B93 A;  3M6B A;  4B88 A;  4GKU A;  4IBX A;  4M3K A;  5DF7 A;  3IS2 A;  3WS1 A;  3OBF A;  3NDE A;  3UPP A;  4JXW A;  4UHU A;  4GCZ A;  4ZBE A;  4CLC A;  3MXQ A;  3S7Q A;  5HPI A;  4X1L A;  2DNS A;  4WL9 A;  1JVJ A;  1BLH A;  1VEU A;  3T4K A;  4HJ6 A;  4X55 A;  3S1Y A;  3IH9 A;  4X68 A;  1K25 A;  3PBN A;  4KZ8 A;  2OLV A;  3JVV A;  4HJ3 A;  4UA9 A;  2WKQ A;  4HP9 A;  4ETZ A;  5FEG A;  4KUK A;  1K38 A;  3FC7 A;  4MN5 A;  3F1P A;  2NUP C;  3P01 A;  2VX8 A;  4X6T A;  2HV1 A;  2J7V A;  2VGL S;  4DE0 A;  4S2L A;  1UGU A;  4HP4 A;  1LL8 A;  4S2N A;  1ZKJ A;  4LV3 A;  3SS5 A;  3V50 A;  1IFQ A;  1KE4 A;  3GTC A;  4QWO A;  1S66 L;  2XR0 A;  5KSH A;  3CHW P;  1ZG4 A;  3IF5 A;  1S1Y A;  2Y2Q A;  3H7W A;  4LRZ E;  4MBH A;  2HDS A;  2HF6 A;  1L2S A;  4R23 A;  4S2I A;  1DRM A;  2V2F F;  4GJ4 A;  1PWD A;  2OAQ 1;  4G3W A;  1GSW A;  4WMC D;  5M19 A;  3HLE A;  1TS8 A;  3M6H A;  3AGF A;  4OP5 A;  2EWW A;  3BFE A;  3G30 A;  3UO9 A;  1VET B;  1YSP A;  3WS5 A;  3MQO A;  2G2W A;  4IUK A;  5EVL A;  1MKM A;  3N8R A;  2M7U A;  4WEK A;  2IWD A;  3MZE A;  1L0F A;  3PBO A;  4E3M A;  4FD8 A;  4FSF A;  5EM0 A;  1J3W A;  4P6B A;  5HFO A;  1D1J A;  3Q1F A;  4DF6 A;  3A3E A;  3G6O A;  4KQO A;  3UE6 A;  2A24 A;  1DP6 A;  2XD1 A;  2O9C A;  4QY5 A;  4KZ6 A;  4Y0U A;  2AVX A;  3HLB A;  2Y79 A;  2PU2 A;  3MMH A;  2XGN A;  5AVE A;  4JXS A;  4C6Y A;  4UQI M;  3QHY A;  5IS1 A;  4R3A A;  1YLP A;  2PDR A;  1K6R A;  2A3U A;  2PD7 A;  5IHV A;  4E6X A;  3BQA A;  1YPR A;  3IX8 A;  1CI9 A;  3O86 A;  4S2M A;  3FKV A;  1W63 Q;  3CJM A;  2PR5 A;  1CQA A;  2ZC3 B;  2J80 A;  1VEU B;  5DJU A;  2W0N A;  3E4P A;  1L3L A;  4S2J A;  4PHT A;  5GLB A;  4JLF A;  1PWC A;  1M6K A;  4R3J A;  4KG6 A;  1YSQ A;  3C8C A;  1VM1 A;  5LBR A;  1OJ5 A;  5EOO A;  1OPX A;  3A3J A;  4OQI A;  3EEA A;  4N92 A;  2XQZ A;  3BM6 A;  3V5M A;  3QNC A;  4JGO A;  2X01 A;  4OOL A;  2K7S A;  4UA7 A;  5AVF A;  4ARZ A;  3S7N A;  3E4Q A;  3NDG A;  1FR1 A;  2XA7 S;  2Y2H A;  3A3I A;  4NK3 A;  1DJC A;  5FDH A;  3T1X A;  4GS9 B;  3LR5 A;  3EEH A;  4DDS A;  2J8Y A;  5FI2 A;  1G68 A;  5M1A A;  1O7E A;  5K5B A;  2H0Y A;  2WGV A;  4QB8 A;  4FH4 A;  1JWZ A;  4CPK A;  2EX2 A;  3QP2 A;  3CAX A;  5TBM A;  2B5R A;  1GSV A;  2JKT I;  2HZ5 A;  3LI8 A;  5C5K A;  1HD8 A;  3E4O A;  1CF0 A;  5I94 A;  3ITA A;  4DJ3 A;  4F3L B;  2B02 A;  4GOG A;  1A0K A;  1MZU A;  4Y17 A;  2VGK A;  3DWZ A;  4GDB A;  4E3J A;  3DAV A;  3HRE A;  5U47 A;  4OH0 A;  3AGE A;  3EGD C;  2VA0 A;  5G18 A;  4WZ5 C;  2A49 A;  3GDI A;  5E2F A;  2XRO A;  4YWZ A;  3V67 A;  1G5U A;  2XK1 A;  2Y2P A;  2PYP A;  2P74 A;  4JXG A;  2VKS A;  4S2K A;  2EXA A;  4N1X A;  1JNU A;  4RQ9 A;  1RCJ A;  2UWX A;  4DE2 A;  2BAS A;  5EOE A;  3BWL A;  5EUA A;  3CWF A;  2R9W A;  3QP6 A;  5J7E A;  5CGX A;  1DJA A;  4UAA A;  5CER A;  4HHD A;  3KSH A;  3F1O B;  3NI9 A;  4HIA A;  3H7W B;  1WYB A;  1FIK A;  2Y2J A;  5EVI C;  3R4K A;  2ZL1 B;  4OQ0 A;  1TS0 A;  4PMA A;  4HEF A;  4OPZ A;  4E3K A;  4MNR A;  1TVF A;  4KZ4 A;  3IF6 A;  5FSR A;  5EEC A;  3VP3 A;  4LCM A;  3PBT A;  4KG2 A;  5DF8 A;  2WKP A;  2UV0 E;  5HWV A;  2V1B A;  2J3T C;  4KQR A;  1KVM A;  2W3G A;  3S7P A;  2Y8H A;  5CHU A;  2ZC7 A;  3LEQ A;  4ZDX A;  5HPF A;  1C3B A;  4KUO A;  4B4X A;  4QHC A;  5FQJ A;  4ZJ3 A;  2GJ3 A;  4DE1 A;  3O87 A;  3LIE A;  2V8C A;  3Q7V A;  1FCO A;  4LV0 A;  5GLC A;  3A0V A;  3V3S A;  4UQI S;  5JYP A;  1JTD A;  1Y28 A;  2QJ5 A;  1K56 D;  2VGL M;  3BEC A;  2OV5 A;  3GMW A;  1L0D A;  2DMW A;  3T4T A;  3C2W A;  1BLC A;  3VFF A;  1DY6 A;  4GHI B;  1N9B A;  3ZVW A;  4LCL A;  1W79 A;  1BT5 A;  3MFD A;  2B18 A;  2ZQC A;  2GX5 A;  1T1B A;  4NEE D;  5HZH A;  2HGV A;  5CGS A;  4CJN A;  5FQ9 A;  1YLY A;  4OPQ A;  1N9L A;  1PNE A;  1SKF A;  1KE3 A;  2X02 A;  3T1R A;  4I3J A;  4YIN A;  3SH9 A;  1ONH A;  3K3C A;  3VP0 A;  4JBF A;  1ERM A;  3PBR A;  1G6O A;  3WS0 A;  1ONG A;  1IYQ A;  4KQD A;  1N9O A;  1YLZ A;  1P9R A;  1ESU A;  3LUQ A;  2FFF B;  4ME4 A;  1H8M A;  1SHV A;  2JKR I;  1F98 A;  3NOU C;  1K57 A;  2NUT C;  3HUM A;  4N9K A;  5F5Y A;  1E3U D;  3ITB A;  3B33 A;  4KQQ A;  4XUZ A;  3HLD A;  2HJ9 C;  3TJZ C;  2QYB A;  4JF6 A;  3ULF A;  1F5M A;  3GR2 A;  1LI0 A;  3CIT A;  3NEC A;  5DF9 A;  5HD5 A;  2RL3 A;  3W8K A;  3D9Y A;  1VB6 A;  1ERO A;  1ALQ A;  4EWF A;  3HBR A;  3LIC A;  2OLU A;  5A91 A;  1FQG A;  4CLC C;  3VE4 A;  4LLO B;  4WZ5 A;  3IWQ A;  3TSG A;  2YKH A;  2XSS A;  1ZHH B;  1IEM A;  3VOY A;  5CED A;  3AGD A;  3GVB A;  1K54 A;  2EWV A;  2O9B A;  1WA9 A;  1UWN X;  1H5X A;  4Y0O A;  1E4D A;  1QMF A;  3E2K A;  2ZM2 A;  1Z09 A;  4PM7 A;  1TS6 A;  4DDY A;  4R6L A;  5FI7 A;  3SH7 A;  1CEG A;  2KOI A;  4FH2 A;  4H6J B;  4PM8 A;  1MWS A;  1I2W A;  3QNB A;  4M4X A;  4RX3 A;  2PU4 A;  3G34 A;  5HSQ A;  4GD8 A;  4BEN A;  2Z2L B;  3ZNT A;  1YMX A;  1XP4 A;  2P08 A;  1STZ A;  3IHB A;  1U60 A;  2INW A;  5E2H A;  2ACG A;  1D7E A;  3UPO A;  2OAP 1;  3UB8 A;  2WAE A;  5L10 A;  1ESI A;  1GHM A;  3BY8 A;  5HAQ A;  1GA9 A;  1IYO A;  3T1S A;  3IH8 A;  3L7H A;  3Q7Z A;  5FAP A;  3T4Q A;  2QKP A;  4DXC A;  5A93 A;  3T4L A;  3MR0 A;  3EQU A;  1S1Z A;  3ZGA B;  5DTS A;  2PAV P;  1Y4O A;  3UE3 A;  3WRZ A;  1ZC2 A;  3IF6 C;  5A90 A;  3FV7 A;  3MF0 A;  1XJ6 A;  1IEL A;  5FQM A;  1CEF A;  1S4R A;  1SZV A;  3LR3 A;  3OCL A;  2W3E A;  1D06 A;  4L9E A;  1MWU A;  2WAD A;  3ZG5 A;  3LIF A;  2PBY A;  3C7U A;  3HLC A;  3H9W A;  3HL9 A;  3VSL A;  4R0Q A;  2QJ7 A;  4LV1 A;  3UMD A;  4HH2 A;  2DCF A;  2ZOI A;  3CMZ A;  5L8M A;  3Q07 A;  4YOF A;  1V9Z A;  4Z9Q A;  2WKR A;  4Q8I A;  4PAU A;  1DP9 A;  4BD0 A;  1KE0 A;  4E04 A;  1IKG A;  4HH3 A;  4I5S A;  4ID4 A;  1LSV A;  3OLO A;  4HJ4 A;  1NY0 A;  4LRY C;  3W2Z A;  2L4R A;  2K2N A;  1S4S A;  3PTE A;  2JKR M;  3DTK A;  2CC1 A;  1F9I A;  5CX7 A;  2W27 A;  4Y5F A;  5L07 A;  4GDN A;  2VGJ A;  1SDE A;  3ISG A;  2HDR A;  5L09 A;  1NRF A;  4N9L A;  4GS9 A;  2ZMA A;  3M2K A;  3IQA A;  4WMC A;  1AWI A;  4NXB A;  1OTE A;  3NCK A;  1PIO A;  3FKW A;  2W1T B;  4D2O A;  2D02 A;  4QJG A;  3KSF A;  1FOF A;  1E25 A;  1VQQ A;  3BRM A;  1ODV A;  5DKK A;  4L0L A;  4RA7 A;  3IHA A;  1MC0 A;  2O0Y A;  2EX6 A;  5FDS A;  3MKE A;  4PM6 A;  3RH8 B;  2WKI A;  4GW9 A;  4WLA A;  2FH5 A;  2ZQ7 A;  1YM1 A;  2JE5 A;  3MJQ A;  2WK0 A;  4EQI A;  1W8Y A;  3SS3 A;  3CI6 A;  1MBL A;  3VFH A;  4NXG A;  1EI5 A;  4DJ2 A;  4Y15 A;  1BTL A;  5DFX A;  2QWS A;  2JHE A;  3E98 A;  5HW3 A;  1P0Z A;  4PM9 A;  4UEY A;  2V9A A;  4U0T A;  3K2N A;  4BBV A;  4KZ5 A;  4Q0H A;  3ZVT A;  3BEB A;  3FYZ A;  4NG2 A;  3HLW A;  2Y91 A;  4BQM A;  2XDM A;  3M2J A;  2HP5 A;  4KZ9 A;  1MWT A;  2H5S A;  3LYX A;  5HX9 A;  2QPN A;  1OTI A;  3OOV A;  1VHM A;  1NZO A;  2ZC5 B;  1XFN A;  1HLU P;  3K3D A;  1K55 A;  4CQH A;  4QPR A;  5HL6 A;  4R4R A;  4KEN B;  2WAF A;  3PBS A;  2WZZ A;  4BJP A;  3IS2 B;  3LCE A;  4X56 A;  4L9F A;  1WYC A;  4WF0 A;  3MKF A;  3OPP A;  2HP9 A;  1NLY A;  4FCF A;  5A8B A;  5FQI A;  3HLF A;  3CG5 A;  3TW8 A;  4S2P A;  5MC7 A;  1YT4 A;  2H28 A;  1K55 C;  4HBU A;  2E8J A;  4XXR A;  3KX0 X;  1JTG A;  1LL9 A;  4F94 A;  1H8Z A;  3B3X A;  1H3Q A;  5CEC A;  3HVF A;  4I3I A;  1LT0 A;  1IYP A;  4Y13 A;  2MJ6 A;  3UE0 A;  4U0X A;  2P04 A;  4P6Z M;  5EVI B;  3PBQ A;  4E6W A;  1MKI A;  4HI4 A;  1CK3 A;  3ZNY A;  4DN0 A;  3OPH A;  3UPN A;  3O88 A;  3HUO A;  3V3R A;  3LR4 A;  3DW0 A;  2J9P A;  3C30 A;  2BLS A;  1NYM A;  1WE4 A;  2ZM8 A;  1QME A;  2CMN A;  1GHP A;  3G35 A;  3NIA A;  4R4S A;  3TG9 A;  4UA6 A;  3D72 A;  1OT9 A;  1K6S A;  1XX2 A;  3R7W A;  3ZFZ A;  3NOT C;  4HNB A;  4EES A;  4WUJ A;  1OTA A;  4S2N C;  2PBD P;  3WRT A;  2Z6D A;  4QU3 A;  3D4F A;  4H8R A;  1ES2 A;  1HTZ A;  5F83 A;  3MS6 A;  3JVU A;  3HUN A;  4WEJ A;  2VV6 A;  3Q7V B;  3ZQ5 A;  3VP4 A;  3VV4 A;  1XA1 A;  5AQ7 A;  3S7O A;  2Q9N A;  3IXB A;  3G31 A;  5F1G A;  1M40 A;  5DVA A;  2ZMF A;  2KLI A;  4WZ4 A;  1KGE A;  3KO6 A;  4FTX A;  1P9W A;  2I9V A;  2ZM0 A;  3FPW A;  2ZBB A;  1SDN A;  5E2E A;  4X25 A;  3N4I A;  4QY6 A;  1PW1 A;  1NWZ A;  5BOH A;  1W5D A;  1TEM A;  4RX2 A;  1MXO A;  2G7U A;  3LO7 A;  3QP8 A;  5CEB A;  1K4E A;  1LHY A;  2JKT M;  3BQ8 A;  1XJ3 A;  5I5L A;  2W1T A;  2JBF A;  4EEU A;  2M7V A;  4B9O A;  3GV9 A;  5KZH A;  5TR7 A;  1T19 A;  3MBZ A;  5TJJ A;  2VEA A;  5D3O A;  5KMW A;  4P87 A;  3VE3 A;  3NUL A;  1MPL A;  3PAE A;  4O8G A;  2Y2N A;  3OCN A;  4U3T A;  5KSC A;  4EQ1 A;  3CPT B;  2Q0O A;  4IUH A;  1FIL A;  3JYI A;  5GLA A;  3FPV A;  2Q9M A;  2HDQ A;  2V1A A;  1T18 A;  4EUV A;  4MBK A;  4PKY G;  4WYY A;  3LFV A;  4GB7 A;  2VLG A;  1GA0 A;  1ZG6 A;  2V20 A;  4RYE A;  1FCN A;  5EV0 A;  2W3F A;  4IHQ A;  3NHQ A;  1E3U A;  1AXB A;  4HQA A;  5FAS A;  1NJ4 A;  4K91 A;  1ZTU A;  2ZC4 B;  2L1M A;  4YFM A;  1OJG A;  3RXW A;  1BZA A;  2P9V B;  3BFF A;  1XJ4 A;  3G2Z A;  1OT6 A;  2JKF A;  4OP8 A;  2IWB A;  5TFQ A;  5CHJ A;  1YLT A;  5CTN A;  1CI8 A;  2QZ6 A;  1BSG A;  2HPB A;  1NLZ A;  3QP4 A;  3U4L P;  2M1C A;  2R9X A;  3C5A A;  3DBA A;  3PYP A;  2C5W B;  4WM9 A;  2ZQD A;  3HJK A;  2GNX A;  4C75 A;  4MN6 A;  5HAI A;  3IWO A;  3ZG8 B;  4OPY A;  1Q2Q A;  2FFY A;  4GHI A;  4MBF A;  4ZTK A;  2JC7 A;  5HAR A;  3MXS A;  1XPB A;  5EPH A;  3BYD A;  1RGY A;  5FA7 A;  5GL9 A;  2P7J A;  1LI9 A;  4B4Z A;  1UWP X;  3LIA A;  1G6A A;  1YMS A;  3A3D A;  3DTI A;  3MXR A;  3D3O A;  4YNR A;  4NKP A;  3R7W B;  4JGP A;  3UY6 A;  1PWG A;  3ZYT A;  5HDS A;  5KIZ A;  3CUE A;  1EWZ A;  1PZO A;  1XXM A;  1T1C A;  3TOI A;  5EFW A;  3P7N A;  3LEZ A;  2ZC6 B;  1XFQ A;  4DRT A;  1BLP A;  3F1O A;  3IWI A;  2WKH A;  3KSI A;  4MCW A;  4K0X A;  4X69 A;  3G2Y A;  3PXP A;  2YKF A;  3BLM A;  4Z1W A;  2O99 A;  3DTM A;  2VV7 A;  1T1A A;  2P9V A;  2WGW B;  1IKI A;  4LPZ A;  2EFX A;  2HJE A;  2XFT A;  4DXB A;  2XF3 A;  4R38 A;  4BL3 A;  2JKG A;  3KYE A;  4GLQ A;  3CPT A;  4EBP A;  1Z6F A;  3G4P A;  1XKZ A;  3T4S A;  3UE1 A;  4L9G A;  3HJI A;  4E3I A;  5EVI A;  2EX9 A;  3E2L A;  2WYX A;  4JF4 A;  5HD3 A;  2VJW A;  5FAQ A;  4R3B A;  3B42 A;  3NBL A;  3T4O A;  1FR6 A;  1F2K A;  2IWC A;  4HBT A;  4EU0 A;  4O7D A;  4C3Q A;  1KOU A;  4EUZ A;  2XA7 M;  3FWL A;  2PHY A;  1IOU A;  3C7V A;  5TBM B; 
#chains in the Genus database with same CATH homology
 2Y2M A;  3M2J A;  3WS2 A;  1KDW A;  1O07 A;  2HP5 A;  4KZ9 A;  2J9O A;  5CRF A;  1MWT A;  1WYB A;  5FAO A;  4A5R A;  1FCM A;  2H5S A;  4NET A;  4OON A;  5HX9 A;  2Y2J A;  5EVI C;  2WUQ A;  2QPN A;  2Y4A A;  4DKI A;  3WWX A;  4EV4 A;  4KZA A;  2ZC5 B;  1NZO A;  3IXG A;  4P85 A;  1K55 A;  2I72 A;  3NY4 A;  4OQ0 A;  2Y59 A;  1ES5 A;  1NXY A;  4PMA A;  4IVK A;  4KEN B;  4R4R A;  2WAF A;  4JPM A;  4HEF A;  4OPZ A;  4E3K A;  4OLG A;  4MNR A;  1TVF A;  3PBS A;  4KZ4 A;  2WZZ A;  4BJP A;  3IF6 A;  5FSR A;  3LCE A;  4X56 A;  2XLN A;  5EEC A;  1NYY A;  1WYC A;  3UDI A;  3UNW A;  3VP3 A;  2Y2G A;  3MKF A;  1JWP A;  4LCM A;  3BFG A;  4IBR A;  3ZCZ A;  3PBT A;  4KG2 A;  5DF8 A;  5GHX A;  3OPP A;  3UDX A;  1KVL A;  1J9M A;  2HP9 A;  5CXW A;  3W4P A;  1K57 C;  4KQR A;  4FCF A;  5J8X A;  1KVM A;  5FQI A;  3RJU A;  3HLF A;  3CG5 A;  1H8Y A;  2XFS A;  5FQQ A;  3W4O A;  4S2P A;  3CZD A;  4BD1 A;  1XGI A;  2XEP A;  5HAP A;  1TDG A;  2C6W B;  1YLW A;  5JYO A;  5CHU A;  1YT4 A;  4E3L A;  3C4O A;  1I5Q A;  2ZC7 A;  1K55 C;  4HBU A;  4K0W A;  4ZDX A;  1W8Q A;  5FI6 A;  1C3B A;  4B4X A;  1ES3 A;  2JCH A;  2Y2K A;  4QHC A;  4WBG A;  5GLD A;  5FQJ A;  4ZJ1 A;  1ERQ A;  3LY4 A;  4ZJ3 A;  2ZQ8 A;  4DE1 A;  3O87 A;  4XXR A;  5A92 A;  4OOY A;  1JTG A;  1LL9 A;  1OME A;  4EBN A;  5CTM A;  5FAT A;  4F94 A;  3Q7V A;  2WZX A;  1GCE A;  3OPR A;  1H8Z A;  1FCO A;  1DJB A;  3B3X A;  1PW8 A;  4LV0 A;  5GLC A;  5CEC A;  1SCW A;  3HVF A;  1BUL A;  3GRJ A;  3BLS A;  1IYP A;  2XH9 A;  3V3S A;  5JYP A;  1JTD A;  1Y54 A;  3M6B A;  3UE0 A;  4B88 A;  3VOZ A;  1K56 D;  4U0X A;  3BEC A;  4E3N A;  4GKU A;  3ZG7 B;  2OV5 A;  5EVI B;  3GMW A;  3N8S A;  1L0D A;  2OSU A;  3PBQ A;  4E6W A;  4IBX A;  2H10 A;  4OKP A;  1BLC A;  3OZH A;  1MKI A;  5EE8 A;  3VFF A;  1DY6 A;  4M3K A;  4OQG A;  1CK3 A;  3ZNY A;  1N9B A;  3OPH A;  5DF7 A;  3O88 A;  3UPN A;  3ZVW A;  1MWR A;  3HUO A;  4LCL A;  3V3R A;  4IVI A;  3WS1 A;  1W79 A;  1BT5 A;  3DW0 A;  1MY8 A;  2J9P A;  3MFD A;  3NDE A;  3UPP A;  2ZQC A;  4JXW A;  5M18 A;  2BLS A;  3OPL A;  5CGS A;  4CJN A;  1NYM A;  5FQ9 A;  1WE4 A;  1YLY A;  1L0G A;  2ZM8 A;  3A3F A;  4OPQ A;  1QME A;  4UHU A;  5EVI D;  4P0M A;  4ZBE A;  2ZQ9 A;  3FZC A;  1GHP A;  1SKF A;  3G35 A;  1KE3 A;  2WKE A;  2X02 A;  3NIA A;  4KG5 A;  4R4S A;  3TG9 A;  2DNS A;  4UA6 A;  4YIN A;  3SH9 A;  2WGW A;  1JVJ A;  2H0T A;  1K6S A;  1XX2 A;  1ONH A;  3IF6 B;  1BLH A;  3ZFZ A;  4X55 A;  3VP0 A;  3S1Y A;  4JBF A;  3S22 A;  1ERM A;  4S2N C;  3PBR A;  3IH9 A;  1S0W A;  1XGJ A;  1K25 A;  4X68 A;  3PBN A;  3WRT A;  4KZ8 A;  1BLS A;  3WS0 A;  1ONG A;  1IYQ A;  4KZ3 A;  2OLV A;  4QU3 A;  3D4F A;  3W4Q A;  4H8R A;  1ES2 A;  4UA9 A;  1HTZ A;  1YLZ A;  4EBL A;  5F83 A;  4OLD A;  4XUX A;  4GD6 A;  1ESU A;  5AQB A;  5AQA A;  3HUN A;  4WEJ A;  3Q7V B;  2FFF B;  3I7J A;  3NC8 A;  3ZG0 A;  1SHV A;  3VP4 A;  1XA1 A;  5AQ7 A;  2Q9N A;  1K38 A;  3IXB A;  3G31 A;  5F1G A;  1M40 A;  1K57 A;  3HUM A;  4X6T A;  5DVA A;  4N9K A;  2J7V A;  4DE0 A;  1E3U D;  4S2L A;  5GHY A;  3ITB A;  4KQQ A;  4XUZ A;  4WZ4 A;  3HLD A;  4S2N A;  1KGE A;  1ZKJ A;  1KDS A;  4LV3 A;  3SS5 A;  4JF6 A;  3GR2 A;  1LI0 A;  3N8L A;  2XD5 A;  2ZM0 A;  3V50 A;  1BUE A;  5DF9 A;  2RL3 A;  1SDN A;  3W8K A;  1KE4 A;  3GTC A;  5E2E A;  3IXD A;  2XR0 A;  3N4I A;  4QY6 A;  1PW1 A;  1ERO A;  1ALQ A;  4EWF A;  5KSH A;  3HBR A;  5BOH A;  1W5D A;  1TEM A;  1ZG4 A;  4RX2 A;  1MXO A;  3LO7 A;  2OLU A;  5A91 A;  3EQV A;  5HL1 A;  3IF5 A;  1FQG A;  3ZDJ A;  5CEB A;  1K4E A;  1LHY A;  2Y2Q A;  4MBH A;  4WZ5 A;  2HDS A;  3IWQ A;  2V1Z A;  3TSG A;  1L2S A;  3VOY A;  2ZJ9 A;  1IEM A;  4JF5 A;  4KZ7 A;  4R23 A;  2EFU A;  4S2I A;  2JBF A;  5CED A;  2V2F F;  3AGD A;  1PWD A;  3GVB A;  3GV9 A;  5KZH A;  5TR7 A;  4N1H A;  2EX8 A;  3MBZ A;  4GN2 A;  1K54 A;  4PPR A;  4LEN A;  2Y2L A;  5D3O A;  4WMC D;  5M19 A;  2G2U A;  5KMW A;  4P87 A;  3VP1 A;  1H5X A;  3HLE A;  1E4D A;  3M6H A;  1QMF A;  1YLJ A;  2ZM2 A;  3E2K A;  3AGF A;  4PM7 A;  3SS4 A;  4OP5 A;  3BFE A;  3G30 A;  4DDY A;  1MPL A;  3PAE A;  4U3T A;  2Y2N A;  3OCN A;  3UO9 A;  5KSC A;  5FI7 A;  3SH7 A;  1CEG A;  1JWV A;  3WS5 A;  4ZAM A;  3UDF A;  4FH2 A;  4PM8 A;  3PAG A;  1MWS A;  2G2W A;  4OVD A;  1I2W A;  3QNB A;  3VMA A;  5EVL A;  3N8R A;  4RX3 A;  3JYI A;  1RP5 A;  4WEK A;  2PU4 A;  2IWD A;  3G34 A;  3MZE A;  4GD8 A;  2Z2L B;  3ZNT A;  1YMX A;  4R1G A;  5GLA A;  4BEN A;  2Q9M A;  1XP4 A;  2HDQ A;  1L0F A;  3PBO A;  1PZP A;  4E3M A;  4FD8 A;  3IHB A;  1U60 A;  4MBK A;  4HES A;  4FSF A;  3IXH A;  4WYY A;  5E2H A;  4P6B A;  4GB7 A;  5HFO A;  3SOI A;  3UPO A;  2DRW A;  3MZD A;  3Q1F A;  4DF6 A;  3C4P A;  2HDU A;  2BG1 A;  3A3E A;  4PM5 A;  1GA0 A;  1ZG6 A;  2V20 A;  4KQO A;  2WAE A;  4RYE A;  1FCN A;  1PYY A;  1ESI A;  2WGI A;  3MZF A;  2XD1 A;  2ZD8 A;  3VSK A;  1GHM A;  4QD4 A;  4QY5 A;  4KZ6 A;  5HAQ A;  1E3U A;  1AXB A;  1GA9 A;  4Y0U A;  5FAS A;  1NJ4 A;  4X53 A;  3P09 A;  5GHZ A;  1IYO A;  2GDN A;  4K91 A;  1LL5 A;  2ZC4 B;  3HLB A;  2PU2 A;  3IH8 A;  2XGN A;  5AQ9 A;  3GQZ A;  4YFM A;  4JXS A;  4C6Y A;  3Q7Z A;  5FAP A;  1RGZ A;  3RXW A;  4DXC A;  5A93 A;  3QHY A;  1BZA A;  2P9V B;  1LLB A;  1YLP A;  1YQS A;  3BFF A;  3EQU A;  1K6R A;  3ZGA B;  5DTS A;  5DTT A;  3G2Z A;  3S4X A;  2A3U A;  5TGF A;  4Y0T A;  5L2F A;  3UE3 A;  3WRZ A;  1ZC2 A;  3IF6 C;  5A90 A;  3P98 A;  5IHV A;  4E6X A;  4OP8 A;  3O86 A;  1CI9 A;  3FV7 A;  2IWB A;  4S2M A;  1IEL A;  3FKV A;  3DWK A;  5TFQ A;  1Q2P A;  5FQM A;  3CJM A;  5CHJ A;  1CEF A;  1YLT A;  5CTN A;  1CI8 A;  3OCL A;  2ZC3 B;  4JXV A;  3BFC A;  2QZ6 A;  1BSG A;  1MWU A;  2WAD A;  2Z2M B;  1IYS A;  2HPB A;  3UN7 A;  4S2J A;  3ZG5 A;  1FSY A;  2R9X A;  1XA7 A;  3HLG A;  3C5A A;  1K54 C;  3Q82 A;  2PBY A;  4MEZ A;  5F82 A;  3C7U A;  2C5W B;  3HLC A;  4WM9 A;  5GLB A;  3HL9 A;  4JLF A;  4R0Q A;  3VSL A;  1PWC A;  1NZU A;  2QMI A;  1L0E A;  2ZQD A;  4OOM A;  1M6K A;  4LV1 A;  4R3J A;  4KG6 A;  1PI5 A;  4BL2 A;  4C75 A;  2DCF A;  5HAI A;  1VM1 A;  3IWO A;  3ZG8 B;  4OPY A;  1PI4 A;  1Q2Q A;  2FFY A;  3CMZ A;  2EXB A;  3Q07 A;  4MBF A;  2JC7 A;  2ZLY A;  4GNU A;  4Z9Q A;  5EOO A;  4ZTK A;  3A3J A;  4OQI A;  5HAR A;  3MXS A;  4N92 A;  4DE3 A;  4Q8I A;  4BD0 A;  1KE0 A;  1XPB A;  5EPH A;  1K56 A;  2XQZ A;  3RXX A;  1IKG A;  3BM6 A;  3ZG9 B;  3V5M A;  3BFD A;  3QNC A;  3BYD A;  1RGY A;  2X01 A;  3LY3 A;  4ID4 A;  5FA7 A;  4OOL A;  5GL9 A;  4UA7 A;  4S2O A;  2Y2I A;  4WEL A;  3V39 A;  5E2G A;  1LI9 A;  1NY0 A;  2E8I A;  4B4Z A;  3OC2 A;  1G6A A;  1W7F A;  1FR1 A;  1YMS A;  2ZQA A;  3A3D A;  3GSG A;  3NDG A;  1HZO A;  2Y2H A;  2Y55 A;  3G32 A;  3MXR A;  4OQH A;  3PTE A;  3A3I A;  4JKT A;  3UY6 A;  2CC1 A;  4NK3 A;  1DJC A;  1PWG A;  5FDH A;  4LV2 A;  1FSW A;  1TDL A;  4Y7P A;  4GDN A;  2VGJ A;  1N4O A;  1EWZ A;  1PZO A;  1SDE A;  4DDS A;  1S6R A;  2J8Y A;  1XXM A;  1G68 A;  3ISG A;  2HDR A;  1O7E A;  5FI2 A;  5M1A A;  3TOI A;  1NRF A;  3N6I A;  1I2S A;  4N9L A;  2H0Y A;  2ZMA A;  3LEZ A;  3M2K A;  3IQA A;  2X71 A;  4WMC A;  3N7W A;  4E3O A;  2WGV A;  2ZC6 B;  5E43 A;  4QB8 A;  2RCX A;  4BLM A;  3NCK A;  4FH4 A;  1JWZ A;  1PIO A;  4CPK A;  2EX2 A;  4DRT A;  1BLP A;  3IWI A;  2B5R A;  2WKH A;  3Q81 A;  3FKW A;  4K0X A;  4X69 A;  1K4F A;  3G2Y A;  3SH8 A;  2HP6 A;  4D2O A;  4QJG A;  1HD8 A;  3BLM A;  1FOF A;  5I94 A;  3DTM A;  1E25 A;  3ITA A;  1VQQ A;  3BRM A;  2P9V A;  3WS4 A;  4L0L A;  4GOG A;  2WGW B;  4Y0O A;  2VGK A;  1IKI A;  3DWZ A;  4RA7 A;  3IHA A;  2EFX A;  4GDB A;  2XFT A;  4DXB A;  3O3V A;  4E3J A;  2EX6 A;  2XF3 A;  3MKE A;  5F1F A;  4PM6 A;  1KGG A;  4BL3 A;  3IT9 A;  3HRE A;  5U47 A;  2WKI A;  4OH0 A;  3AGE A;  4EBP A;  4OPR A;  2ZQ7 A;  1Z6F A;  1YM1 A;  2JE5 A;  3G4P A;  1XKZ A;  2WK0 A;  5G18 A;  4EQI A;  4WZ5 C;  1W8Y A;  2A49 A;  5E2F A;  1GHI A;  3SS3 A;  1ES4 A;  4ZJ2 A;  3UE1 A;  1MBL A;  3VFH A;  4E3I A;  1EI5 A;  2XK1 A;  5EVI A;  2EX9 A;  3E2L A;  2WYX A;  4JF4 A;  2Y2P A;  5FQK A;  1BTL A;  2P74 A;  5FAQ A;  4JXG A;  4S2K A;  4R3B A;  2Y2O A;  5DTK A;  4MLL A;  1HVB A;  5CHM A;  3NBL A;  2EXA A;  4N1X A;  4GZB A;  5HW3 A;  4PM9 A;  3VP2 A;  1FR6 A;  1KGF A;  5CGW A;  4RVA A;  1RCJ A;  2UWX A;  4U0T A;  4DE2 A;  5EOE A;  4KZB A;  4KZ5 A;  3ZVT A;  2IWC A;  3BEB A;  4HBT A;  3FYZ A;  5EUA A;  4O7D A;  2R9W A;  4C3Q A;  4EUZ A;  3FWL A;  4IED A;  3ZHH A;  5CGX A;  1DJA A;  3HLW A;  4UAA A;  5CER A;  2Y91 A;  3C7V A;  4BQM A;  2XDM A;  3NI9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...