1YLZA

X-ray crystallographic structure of ctx-m-14 beta-lactamase complexed with ceftazidime-like boronic acid
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
263
structure length
263
Chain Sequence
QTSAVQQKLAALEKSSGGRLGVALIDTADNTQVLYRGDERFPMCSTSKVMAAAAVLKQSETQKQLLNQPVEIKPADLVNYNPIAEKHVNGTMTLAELSAAALQYSDNTAMNKLIAQLGGPGGVTAFARAIGDETFRLDRTEPTLNTAIPGDPRDTTTPRAMAQTLRQLTLGHALGETQRAQLVTWLKGNTTGAASIRAGLPTSWTVGDKTGSGDYGTTNDIAVIWPQGRAPLVLVTYFTQPQQNAESRRDVLASAARIIAEGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-LACTAMASE CTX-M-14
publication title Structure, Function, and Inhibition along the Reaction Coordinate of CTX-M beta-Lactamases.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 98
structure length 263
sequence length 263
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2005-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1ylzA00
2ZQDA 1YMSA 3MKEA 4KG2A 3OPRA 5CHUA 3MZEA 1GCEA 1YM1A 4KZ7A 1ZC2A 3BYDA 4KZ3A 3ZVTA 3G4PA 3G30A 2XD1A 3JYIA 4R4SA 4GN2A 1PW8A 4F94A 3EQUA 3G32A 4ZTKA 1K56D 1NZUA 3W4QA 4E3JA 5J8XA 4JF4A 3O87A 3V3SA 4JXSA 2WGVA 2OV5A 2Y2OA 3PBRA 5CHJA 4PM9A 1EROA 5FI2A 3VSLA 4GDBA 3UDFA 4JXGA 1K25A 2WAEA 4IVKA 4E3LA 2I72A 4WELA 2Y2GA 3C5AA 5DTTA 5M1AA 3RJUA 4QJGA 4OLGA 4DDYA 3UN7A 1HD8A 2ZC4B 3O88A 4IBRA 4Q8IA 3G35A 5DF9A 5HFOA 2C5WB 3Q82A 3IXBA 3NC8A 2ZLYA 3D4FA 1LHYA 3SS5A 1FSYA 3OPHA 2XK1A 2G2UA 3IF5A 4S2NA 3UPNA 2ZC7A 4JXWA 3NDEA 1WYBA 1PWDA 4ZJ3A 4BJPA 3HLFA 2XDMA 4LCMA 1NY0A 3W4OA 5JYOA 4P87A 4OP8A 3RXWA 5KSHA 1U60A 3UO9A 1ZKJA 4OPQA 1L0GA 2GDNA 4IVIA 4E3NA 1M40A 2OLUA 3QHYA 4RYEA 3ITAA 4OPRA 1N4OA 4UA6A 1XA7A 3LEZA 1IELA 1BZAA 2VGKA 3O3VA 5EOEA 2EX6A 1E25A 4PMAA 3Q7VA 3BLSA 1ALQA 1HVBA 5AQAA 1ZG6A 5F82A 1GHPA 1FCMA 1K54A 2ZC5B 3MXRA 1S6RA 1IYPA 4C75A 2WAFA 4R1GA 1Y54A 3PAEA 4MLLA 2V2FF 4DE0A 5F1FA 5JYPA 2XR0A 3BFGA 4XUXA 4H8RA 1XKZA 3BM6A 2DRWA 2R9XA 1I2SA 3PBQA 4GNUA 4LENA 4S2IA 3TSGA 3WRZA 2JCHA 4EBPA 2Y2NA 3N8RA 4GDNA 5DTSA 3N8SA 4MNRA 4UAAA 4ZDXA 3BEBA 1ESIA 1LLBA 4OQHA 5I94A 1AXBA 3NIAA 1K38A 4WMCD 1OMEA 4BD1A 4OOLA 4KZ6A 3NCKA 2ZC6B 2J8YA 4WZ5A 3HLGA 3WS4A 3HUNA 3HLCA 4JBFA 5FSRA 2XD5A 1L2SA 3LY4A 3WS1A 2ZQ9A 4B88A 3M2KA 5E2FA 2R9WA 4OONA 3VP3A 3ZCZA 2Y2MA 3HLEA 3Q07A 1TEMA 2DNSA 3E2LA 4OP5A 2WZXA 2OSUA 4OQGA 3Q1FA 3MKFA 5E43A 2ZM2A 3GMWA 1PZPA 2Y2KA 4LV2A 3S1YA 4DE2A 4DKIA 4WEKA 3IH9A 3IHBA 2EX2A 3BECA 4OQ0A 3CJMA 3Q81A 1O07A 4RX2A 4FH2A 1Q2PA 1IEMA 1SCWA 2H0YA 2WGIA 3GR2A 1ERQA 3UDXA 4E3OA 2V20A 4N9LA 5EE8A 3QNBA 2Y4AA 3HVFA 4A5RA 4B4XA 4UA9A 5DTKA 5DF8A 1KE0A 1CI8A 1IYSA 3N8LA 4GOGA 4K91A 2WKHA 1CEFA 1KE3A 3UY6A 3ZHHA 1YLPA 4E3KA 1YLTA 2X02A 1PWCA 4EUZA 3AGDA 5CHMA 4LV1A 2XFTA 5EVID 2OLVA 4IEDA 4X53A 1JTGA 4JF5A 3CZDA 3ZNTA 3CG5A 3EQVA 2Y2IA 4E6XA 2WADA 5FQQA 5G18A 1W5DA 4QU3A 1K6SA 3PBTA 4OQIA 2Y2QA 3VSKA 2Y91A 4HBTA 3FKVA 3VP4A 4ZJ1A 4CJNA 2J9PA 1YLJA 4KQOA 4DDSA 1KGGA 4D2OA 2H10A 4FD8A 4C6YA 1CEGA 1MWRA 4S2NC 1BUEA 2B5RA 2QPNA 1PW1A 3HUMA 2EFXA 3O86A 4S2KA 3GTCA 4DE3A 4EBLA 4MEZA 1K55C 3V39A 3BFFA 3P98A 3VP2A 3VOYA 1BSGA 3ZGAB 1RCJA 3LCEA 4RA7A 4K0WA 3G2YA 4JF6A 4OOYA 4S2PA 1EWZA 4DF6A 1K56A 3SOIA 4M3KA 3UE1A 2Y2PA 2BG1A 1RP5A 5TFQA 4KZ8A 1YMXA 4FSFA 4CPKA 1K54C 1K4FA 3Q7VB 3IWIA 4BD0A 1O7EA 4JKTA 3SS4A 3VFFA 2QZ6A 4OVDA 1XPBA 3SH9A 5EOOA 5CGXA 1XGJA 5E2HA 1K55A 1ES3A 2H0TA 5EVLA 2HP6A 1S0WA 4KZBA 4N1XA 4R4RA 4GD6A 3N7WA 4PM8A 3ZDJA 1ES5A 4RVAA 1H8YA 4QHCA 3ZG5A 3VOZA 3GVBA 4KZ9A 2EXBA 4NK3A 4WEJA 3BFCA 4GB7A 1PWGA 2A49A 2VGJA 5TGFA 1MWTA 4WZ5C 2Y2LA 1ERMA 5FASA 3LO7A 3GQZA 1K57C 2J9OA 3NBLA 2IWBA 1G68A 2ZQCA 4IBXA 5CGWA 1MKIA 1J9MA 1FOFA 1DY6A 1ONGA 3C7UA 2WKIA 3TOIA 1DJAA 4HEFA 4K0XA 5FQKA 2PU2A 5CEBA 1YLYA 1LL9A 2ZD8A 4BQMA 4DXCA 1BLSA 1SDEA 3UPPA 4JLFA 3OCNA 3M6BA 4GZBA 4C3QA 2HP5A 3MZDA 4N9KA 3UPOA 5KMWA 4KZAA 1FQGA 4U0TA 3UE3A 3NI9A 3IXHA 5HW3A 5HARA 3C4PA 1K57A 1DJCA 1M6KA 4UA7A 1BLPA 5TR7A 2HDRA 1IKIA 4S2OA 3IQAA 2Q9NA 4P85A 3GSGA 1JWVA 5HAIA 1BTLA 1I5QA 3P09A 2RCXA 5A92A 4WMCA 5GL9A 4BL3A 2Y59A 3WS0A 1NYYA 2P9VA 3MBZA 3ZNYA 1JWZA 1PIOA 1FCOA 3ZFZA 3G34A 3E2KA 2WK0A 3FV7A 5E2GA 3C7VA 1K6RA 1YLWA 3C4OA 2PBYA 3PBNA 4OH0A 1MWSA 3IH8A 5E2EA 1IYOA 1HTZA 3NDGA 2HP9A 3A3IA 3OCLA 3VMAA 4BL2A 3ZG9B 2HDUA 3VP0A 4QD4A 1VM1A 3HLBA 1LI9A 1PZOA 5FQJA 1E3UD 3N6IA 5FA7A 5EVIC 3OPPA 1ES4A 4GD8A 3W4PA 3RXXA 2A3UA 5FI6A 5HAPA 3Q7ZA 1ESUA 2WYXA 5EVIB 2CC1A 5AQBA 2IWDA 1CK3A 1W8QA 2J7VA 2IWCA 2Y2HA 2ZQ8A 4FH4A 2EX9A 2ZM0A 1E3UA 1L0FA 4ZBEA 4DXBA 1YT4A 5FI7A 1IKGA 1NYMA 2EX8A 1I2WA 3FZCA 4KQQA 1CI9A 3AGEA 1ZG4A 3HREA 4BENA 1GHMA 4R0QA 2RL3A 4YFMA 3B3XA 3VFHA 4N1HA 4Y0OA 5F1GA 3G31A 3BFDA 5A90A 2HDQA 1KDWA 5FAOA 4Y0TA 5EUAA 1DJBA 3HL9A 4KQRA 5EVIA 3NY4A 5FAPA 4QY6A 3FKWA 2EFUA 1G6AA 4DE1A 1N9BA 3A3FA 1TDLA 3A3JA 2C6WB 3SS3A 1GA0A 4OKPA 5F83A 1RGZA 1W8YA 3WWXA 5A93A 2JE5A 3IF6A 1FR1A 4QB8A 3TG9A 5GHZA 4ID4A 3SH8A 3ZG7B 4N92A 1QMEA 4S2JA 2XLNA 1ONHA 3WRTA 4EQIA 2XQZA 4WYYA 5L2FA 1BLCA 1SDNA 2ZQ7A 1BLHA 3W8KA 5AQ7A 4PM5A 1MY8A 3S22A 3MFDA 3MZFA 3IHAA 5FQ9A 1GA9A 2ZC3B 4E3MA 5CRFA 1FR6A 1MBLA 4RX3A 2WGWB 3DW0A 3AGFA 4GKUA 4Y0UA 3ZG0A 4S2LA 2E8IA 5FAQA 2HDSA 4MBKA 2XH9A 1YQSA 5HAQA 4OPZA 4PM6A 3A3DA 4MBHA 3WS5A 3S4XA 5DF7A 2UWXA 3ZG8B 2Q9MA 2BLSA 2XF3A 3GV9A 1FCNA 1XGIA 5FQMA 5A91A 5EPHA 5AQ9A 4XUZA 2WKEA 4R23A 4B4ZA 3DTMA 5KSCA 2WGWA 5BOHA 4U3TA 5DVAA 1WE4A 4KZ5A 2V1ZA 1NZOA 2XFSA 3HLDA 4XXRA 1E4DA 2JBFA 3QNCA 3UDIA 3V5MA 4HBUA 4OLDA 4L0LA 2HPBA 2ZM8A 4KENB 5KZHA 1C3BA 4EWFA 1VQQA 1JVJA 3UE0A 4EV4A 5CEDA 1WYCA 1SKFA 3MXSA 3DWKA 3HUOA 2ZMAA 4QY5A 4WZ4A 5D3OA 3ISGA 4PPRA 4U0XA 1NXYA 4P0MA 5FQIA 2JC7A 1FSWA 2P9VB 3BLMA 1K4EA 1XX2A 3FWLA 1L0EA 3M6HA 4DRTA 1RGYA 5GHXA 3OC2A 1H8ZA 2Y2JA 4LV3A 4UHUA 1PI5A 3M2JA 4S2MA 5FDHA 1Q2QA 1QMFA 2ZQAA 5CTMA 2WUQA 2FFFB 2X71A 1KDSA 1KGFA 3IXGA 5HL1A 1PI4A 2FFYA 1XP4A 2XGNA 4EBNA 2XEPA 1ES2A 3PTEA 4WM9A 1BULA 2H5SA 4P6BA 1PYYA 3LY3A 4HESA 5CERA 5GLCA 1KGEA 1BT5A 3ITBA 4YINA 5HX9A 1KVMA 4X56A 1IYQA 5GLAA 3CMZA 1W7FA 4BLMA 1JTDA 1YLZA 1LL5A 5FATA 2ZJ9A 4LCLA 4OOMA 3OPLA 4PM7A 5GLDA 2G2WA 1MPLA 1JWPA 3BFEA 1NJ4A 3I7JA 1EI5A 5GLBA 1NRFA 4JPMA 3V50A 4E6WA 3HLWA 5M19A 3HBRA 2PU4A 4R3JA 4O7DA 1W79A 3WS2A 3G2ZA 3ZVWA 4MBFA 2QMIA 5CECA 4LV0A 4X69A 2WZZA 3A3EA 3FYZA 4KG5A 3IF6C 2X01A 3PAGA 1KVLA 4JXVA 3VP1A 2Y55A 4FCFA 3V3RA 4E3IA 3UNWA 3OZHA 3IF6B 4X55A 3IWQA 3IXDA 3SH7A 4Z9QA 5IHVA 4ZJ2A 4X68A 5CXWA 1XXMA 3N4IA 1SHVA 4R3BA 1MXOA 1TDGA 4KG6A 4X6TA 4Y7PA 4NETA 3DWZA 5CGSA 5M18A 2Z2MB 3IT9A 5EECA 4ZAMA 1HZOA 3PBSA 1TVFA 1L0DA 2P74A 1H5XA 5GHYA 4WBGA 2EXAA 1GHIA 1KE4A 1XA1A 2Z2LB 4KZ4A 1Z6FA 3IWOA 3PBOA 5CTNA 2DCFA 3BRMA 4OPYA 1MWUA 3GRJA 5U47A 1LI0A
chains in the Genus database with same CATH superfamily
2ZQDA 3MKEA 4GHIB 1GCEA 1ZC2A 1S66L 2CMNA 3IX8A 2JKRM 4GN2A 1PW8A 4F94A 3EQUA 3W4QA 4E3JA 3S7NA 3V3SA 4JXSA 2OV5A 5CHJA 3S7OA 3UDFA 3UMDA 4GS9B 2WAEA 4IVKA 4HH2A 3RJUA 3UN7A 4Q8IA 3O88A 5DF9A 2C5WB 3Q82A 4E04A 3D4FA 1LHYA 4G3KA 3IF5A 4S2NA 2V1AA 4OP8A 1U60A 3UO9A 1L0GA 3ITAA 2VV8A 4UA6A 3LEZA 3O3VA 4LRXC 1HVBA 4ETZA 2BASA 5F82A 1GHPA 4IJGA 4NXGA 1S6RA 5HPFA 3MQOA 2WAFA 3PAEA 3HCYA 5JYPA 2XR0A 1D7EA 3PBQA 4GNUA 4LENA 4EBPA 2JCHA 2Y2NA 3T1SA 3N8RA 5DTSA 4H6JB 4K08A 1ESIA 1LLBA 4OQHA 2OWHA 1K38A 5HD5A 2INWA 4HI4A 2ZC6B 3HUNA 4JBFA 4B88A 1L2SA 3LY4A 4O01A 5E2FA 4Y3IA 2NUPC 2W1TB 3HLEA 4OP5A 2OSUA 3Q1FA 2VX8A 3TRCA 2Y2KA 1V9YA 2PDRA 3IHBA 4WEKA 2EX2A 1O07A 1Q2PA 2H0YA 3GR2A 4E3OA 4N9LA 2VGLM 3EEHA 3HVFA 3ULFA 2XRNA 2QWSA 4LPZA 5AVEA 2W3FA 1KE0A 1IYSA 1CEFA 1KE3A 4YOFA 3D3OA 3UY6A 3P7NA 1YLPA 2HJEA 4EUZA 4NXFA 4CLCC 5CHMA 2PRFA 2VGLS 3IBJA 4X53A 3CZDA 4CLCB 2Y2IA 2W3HA 5FQQA 3T1QB 4HBTA 4KQOA 2H10A 1BUEA 3HUMA 1PW1A 2PBDP 3O86A 3GTCA 3NHQA 3MMHA 4MEZA 1CF0A 1RCJA 3IS2B 5LBRA 3G2YA 4JF6A 4OOYA 3SOIA 3S7QA 2Y2PA 1RP5A 5TFQA 4KZ8A 3MFXA 2E8JA 4G3VA 3LR5A 1XGJA 5EVLA 1K55A 2J3TC 1G6OA 2Z6DA 2VK3A 4HHDA 4N1XA 1H8YA 3GVBA 4WEJA 3BFCA 2GJ3A 4WZ5C 5FASA 4FTXA 3L7HA 3BJNA 3R7WA 5CGWA 4DJ3A 4II7A 5TBMA 3UB5P 5F68A 5EM0A 3F1OB 3C7UA 4JGPA 4HH3A 4JLFA 3M6BA 4GZBA 3MZDA 5L07A 3H9WA 3C4PA 2A24A 5HARA 1BLPA 2L0WA 3S7PA 2K31A 1IKIA 3IQAA 5A8BA 2Q9NA 1TS7A 4P85A 3GSGA 1I5QA 3P09A 4Z1WA 3H82A 3WS0A 1NYYA 1JWZA 1PIOA 3ZFZA 5E2GA 1K6RA 1MWSA 3VP0A 5FQJA 1E3UD 5FA7A 1OT6A 1LL8A 5EVIC 3OPPA 3RXXA 2A3UA 5HAPA 3Q7ZA 1ESUA 1DP6A 2WYXA 5EVIB 2J7VA 2ZQ8A 4UEYA 2GX5A 2EX9A 4ZBEA 5J4EA 3T4KA 1I2WA 3FZCA 4MN5A 4EEPA 1CI9A 3FC7A 3HREA 4BENA 4YFMA 3G31A 2WKPA 4Y0TA 3HL9A 2JN7A 2P04A 1G6AA 1N9BA 5CX7A 3IX4A 3SS3A 1GA0A 4OKPA 5A93A 1OJGA 3H7WA 4KQDA 3ZG7B 1QMEA 1ONHA 3WRTA 3O5YA 2ZQ7A 2VA0A 1PNEA 4PM5A 1MY8A 5AJGA 5FQ9A 1F98A 4E3MA 1MBLA 4RX3A 3PYPA 1J3WA 4HP9A 1STZA 2XH9A 1YQSA 5HAQA 4OPZA 3T4LA 5A91A 1BYWA 1H3QA 3L9KA 3IX3A 4GS9A 1OTAA 2V1ZA 3HLDA 2JBFA 1SZVA 5MC7A 4L0LA 2ZM8A 4HQAA 1XJ2A 3F1PB 4YNRA 3KSHA 5DKKA 3HUOA 2J3TD 4WZ4A 3T12B 4EQ1A 2XSSA 3CUEC 5FQIA 2JC7A 1FSWA 1VHMA 3CAXA 5HDCA 3BLMA 2QYBA 5FL3A 3OC2A 2Y2JA 3KO6A 5IS1A 5FDHA 2FFFB 2X71A 1KDSA 1VB6A 3A0SA 3T4QA 1PI4A 2AVXA 1XP4A 2KOIA 1ES2A 1TS6A 2V0WA 1PYYA 5HX9A 1LT0A 2HF6A 1IYQA 3CMZA 1JTDA 5FATA 4LCLA 1L3LA 3OPLA 5GLDA 1MPLA 1NJ4A 1NRFA 4JPMA 2I9VA 4E6WA 3LIEA 3HBRA 2PU4A 4O7DA 2QMIA 2WZZA 1ZHHB 3A3EA 3IF6C 4E3IA 3UNWA 3IF6B 3SH7A 4Z9QA 4ZJ2A 3CLOA 5CXWA 1XXMA 3NJAA 3N4IA 4X6TA 2Z2MB 3IT9A 1L0DA 2P74A 5GHYA 1XA1A 1KE4A 1VETA 4OPYA 4UA9A 5U47A 4I3JA 4KZ7A 1MZUA 4KZ3A 5G4YA 3ZVTA 4Y17A 2XD1A 3FG8A 3QP8A 4L9FA 4R4SA 3C8CA 3G32A 4ZTKA 1NZUA 5J8XA 4D60A 3O87A 2WGVA 3VSLA 4JXGA 4E3LA 4WELA 5DTTA 4P6ZM 3RFBA 5HFOA 2V8CA 2ZLYA 3OPHA 3UPNA 2ZC7A 3A0VA 4ZJ3A 2JKTM 3KSGA 4FUWA 1ZKJA 2D01A 4OPQA 1M40A 2OLUA 3QHYA 4M4XA 3TE8A 4CQHA 1N4OA 1BZAA 2P08A 3BLSA 5AQAA 3P01A 1ZG6A 1FCMA 5F6AA 1IYPA 1D06A 3VE4A 1Y54A 2Q0OA 1XKZA 3BM6A 3BQ8A 2R9XA 3R4KA 3N8SA 4MNRA 4UAAA 4ZDXA 1XJ6A 3BEBA 5I94A 4OOLA 2VV7A 4WZ5A 3HLCA 3LGOA 5FSRA 3B33A 3WS1A 2ZQ9A 3M2KA 1H0MA 2WZXA 2YKFA 3ZYTA 2OAQ1 3KSIA 5E43A 1PZPA 4LV2A 4DE2A 3IH9A 3CJMA 4RX2A 2OWJA 3B42A 5G4ZA 3UDXA 2WKRA 2ZBBA 4A5RA 5HWWA 2HZ5A 4X25A 5DTKA 1CI8A 3N8LA 4K91A 4WUJA 4E3KA 1PRQA 2X02A 1PWCA 3AGDA 4HJ4A 2OLVA 1F9IA 3ZNTA 4LRYC 4E6XA 2WADA 4Y2FA 1K6SA 2PD8A 2B18A 3LI8A 4KUOA 4Y5FA 5HPIA 3VP4A 1GSWA 1P9WA 4DDSA 1KGGA 1HLUP 4C6YA 1CEGA 1MWRA 2QPNA 2EFXA 3TJZC 3BFFA 3P98A 3VP2A 4RA7A 3F1NA 4K0WA 4S2PA 4DF6A 1A0KA 4M3KA 1YMXA 2VLGA 3E98A 5HZHA 2MJ6A 4PHTA 2ZL1B 1K54C 1G28A 1K4FA 3IWIA 4F3LA 4JGQA 4BD0A 2QZ6A 4HOIA 5CGXA 5AVFA 5E2HA 4XT2A 1Y4OA 4KZBA 4R4RA 3ZDJA 3VOZA 2EXBA 3EWKA 2A49A 5TGFA 1ERMA 3LO7A 3QP2A 1K57C 2J9OA 3NBLA 2IWBA 1MKIA 1D1JA 1J9MA 1FOFA 4JGRA 4EU0A 3VV4A 1DY6A 1LSVA 3JVVA 3LR0A 4HEFA 4K0XA 4UQIM 4LRZE 5CEBA 1BLSA 1SDEA 3CHWP 3UPPA 3OCNA 2VKSA 3UE3A 3NI9A 5HW3A 2HDRA 4S2OA 3QP6A 1JWVA 5HAIA 4UQIS 1BTLA 2RCXA 5A92A 2O9AA 2Y59A 3PHYA 3ZNYA 3T1XA 3CUEA 2HJ9C 3E2KA 3A0RA 1YLWA 2PBYA 3PBNA 4OH0A 3VMAA 4BL2A 2V8FA 2HDUA 2OOLA 3LIBA 3HJIA 1PZOA 2PAVP 3N6IA 3W4PA 3TW8A 3W2ZA 5FI6A 4I3IA 2WKQA 5AQBA 1CK3A 1W8QA 2ZM0A 4Y15A 5I5LA 1OPXA 1OTEA 1IKGA 1S4RA 5K5BA 4KQQA 2RL3A 3B3XA 4Y0OA 1T18A 1KDWA 3OOVA 5FEGA 5EUAA 3NY4A 3BY9A 4QY6A 2O9CA 1TDLA 2C6WB 1W8YA 3IF6A 5GHZA 4ID4A 3SH8A 4LFUA 4S2JA 2XQZA 4WYYA 2KDKA 5EFWA 2FZ0A 4G3WA 4I38A 3S22A 2ZOIA 3RTYA 2WGWB 3T1RA 3ZG0A 4YWZA 2GZAA 1SKOA 3S4XA 1W63M 1XGIA 5FQMA 3PXPA 4B4ZA 3DTMA 1WE4A 1NZOA 2XFSA 3UDIA 3V5MA 1E4DA 4OLDA 2NUTC 2HPBA 5FDSA 4EWFA 2EWVA 1WYCA 3MXSA 3DWKA 2ZMAA 4PPRA 1NXYA 2P9VB 1XJ4A 1K4EA 3M6HA 4DRTA 1RGYA 4LV3A 1JNUA 1Q2QA 1QMFA 3E4OA 3T50A 3LI9A 2PHYA 2FFYA 2B95A 2KLIA 4I5SA 4WM9A 2XEPA 4EBNA 4P6BA 1BULA 5CERA 1KGEA 1KVMA 3CWFA 2VJWA 5GLAA 1W7FA 4BLMA 1YLZA 5J7EA 1LSWA 3GECA 2KX6A 4WF0A 3MQQA 3QP4A 2G2WA 2UV0E 2PT7A 1P97A 1OTBA 4HP4A 5IT5A 3C30A 5M19A 3G2ZA 2EA9A 3BW6A 4X69A 3FYZA 4KG5A 3PAGA 1KVLA 3VP1A 1YPRA 3V3RA 2LB5A 4X55A 3IXDA 4NXEA 5IHVA 3CPTA 4X68A 1TDGA 4KG6A 4NETA 4ARZA 1H5XA 2JKGA 2Z2LB 1Z6FA 1XFNA 2R78A 3PBOA 5CTNA 4CLCD 3UB7A 3UMEA 1YMSA 5CHUA 5DJUA 3FPWA 1YM1A 3BYDA 3C2WA 3LR4A 4I39A 1N9LA 5C5KA 4LGWA 1T1AA 2XA7M 1GSXA 4R6LA 2JKRI 3PBRA 3NULA 4GHIA 4GDBA 1CQAA 2I72A 2Y2GA 3C5AA 4OLGA 1HD8A 2ZC4B 4IBRA 3G35A 3E4QA 1XJ3A 2LB9A 4GCZA 2XK1A 2G2UA 2XA7S 1PWDA 3HLFA 2XDMA 3EEAA 2V9AA 4P87A 3RXWA 5KSHA 4ETXA 1KOUA 4RYEA 4OPRA 1NWZA 5HSQA 1EW0A 2EX6A 4PMAA 1NLYA 1K54A 2ZC5B 3DAVA 2W3EA 4DE0A 4MLLA 2V2FF 5F1FA 4EXOA 4H8RA 2DRWA 1I2SA 3TSGA 3WRZA 4AFIA 4GDNA 4DMZA 1FIKA 3LFVA 4L9GA 3NIAA 4WMCD 4KZ6A 3WS4A 2J8YA 3D9YA 4L9EA 2XD5A 2R9WA 4OONA 3ZCZA 3Q07A 1TEMA 3E2LA 4H6JA 3E4PA 4OQGA 1T19A 1CJFA 1S1YA 2ZM2A 4DKIA 4OQ0A 3LICA 4FH2A 1IEMA 1ERQA 4X1LA 4B93A 4ESPA 5FEFA 2V20A 5EE8A 3QNBA 4MDZA 1YKDA 4MMNA 2W1TA 4B4XA 2VV6A 5DF8A 2O9BA 2WKHA 3T4TA 4Q0IA 1YLTA 2VZWA 4RQ9A 5EVID 1JTGA 3PR6A 5L8MA 3EQVA 4PAUA 1W5DA 3PBTA 2W1RA 3VSKA 2Y91A 3FKVA 4ZJ1A 3UE6A 2J9PA 1YLJA 5L10A 4FD8A 1ODVA 5DFXA 3JVUA 4CLCA 4DE3A 2DMWA 1K55C 3FPVA 1BSGA 3ZGAB 4EEUA 2XROA 3LCEA 1G5UA 1EWZA 3UE1A 2BG1A 3VE3A 2M7VA 3V67A 1S1ZA 2JHEA 3Q7VB 1O7EA 4JKTA 1P9RA 3SH9A 1UWPX 3IS2A 3NOUC 1ES3A 1XFQA 2HP6A 4P6ZS 3R7WB 1S0WA 5DJTA 2ZOHA 5TBMB 4GD6A 3MF0A 4PM8A 4RVAA 1WA9A 4KZ9A 4NK3A 1GSVA 1YAXA 1PWGA 4NG2A 4BMWA 2Y2LA 1PFLA 2HGVA 1G68A 2ZQCA 2A24B 3IBRA 5L09A 1ONGA 2GNXA 2WKIA 3TOIA 5FQKA 2PU2A 1YLYA 1LL9A 4DXCA 3H82B 4C3QA 2HP5A 3MS6A 3T4SA 3UPOA 1FQGA 3KSFA 4U0TA 3C38A 3IXHA 1M6KA 4UA7A 4O8GA 3KYZA 3F1OA 5F69A 4WMCA 3LEQA 5GL9A 4BL3A 2O99A 1TF1A 2P9VA 3MBZA 2L1MA 1FCOA 3G34A 3CI6A 3FV7A 2J80A 3C7VA 2QJ5A 3IH8A 1IYOA 1HTZA 3A3IA 2G7UA 3UB6A 4QD4A 1VM1A 1LI9A 4HJ6A 3UB9A 4WLAA 5HL6A 1ES4A 4GD8A 1LSXA 2W3GA 4EERA 2Y2HA 4FH4A 1P0ZA 4DXBA 1L0FA 1T1BA 1YT4A 1NYMA 2EX8A 3AGEA 1ZG4A 3H7WB 4R0QA 4N1HA 5F1GA 3BFDA 2HDQA 3K2NA 4O0PA 1DJBA 2ZMVA 5EVIA 2V1BA 1DRMA 4R70A 3A3FA 3A3JA 4BBVA 5F83A 2A2LA 4PKYG 3WWXA 1FR1A 3TG9A 4B9OA 2XLNA 2OAP1 1SDNA 1BLHA 5HDDA 1Z09A 5AQ7A 3B47A 2PYPA 3MFDA 3IHAA 2ZC3B 5CRFA 1FR6A 1Y28A 4GJ4A 3AGFA 4GKUA 4QPRA 4Y0UA 4S2LA 2E8IA 5FAQA 2HDSA 4MBKA 4PM6A 3A3DA 3WS5A 3NOTC 4GLQA 3ZG8B 2Q9MA 2BLSA 2XF3A 5EPHA 5AQ9A 2L4RA 4R23A 1K0KA 5BOHA 2O0YA 4KZ5A 3E0YA 4XXRA 1IOUA 1C3BA 1VQQA 4QWOA 1H8MA 2J3WA 4EESA 5D3OA 4QY5A 3NECA 3ISGA 3EGDC 3CITA 2EWWA 1L0EA 1H8ZA 4UHUA 1PI5A 2ZQAA 2WUQA 1KGFA 3IXGA 2PR5A 3F1PA 5HL1A 3PTEA 2M1CA 4HESA 5HWVA 2V0UA 2W27A 3ITBA 3MR0A 2Z6CA 1LL5A 2ZJ9A 4OOMA 4JGOA 1JWPA 3EGXC 3I7JA 1EI5A 5GLBA 3V50A 3HLWA 1W79A 3WS2A 3GDIA 5CECA 2X01A 4MN7A 1VETB 2Y55A 2ACGA 3OZHA 1YSQA 1SHVA 1MC0A 1MXOA 4FOFA 3DWZA 5CGSA 5EECA 3PBSA 4WBGA 2EXAA 4KZ4A 2DCFA 1MWUA 3GRJA 3SW1A 4KG2A 3OPRA 3MZEA 3BQAA 3G4PA 2H28A 3G30A 3JYIA 1K56D 4JF4A 1VEUB 2Y2OA 5FI2A 4PM9A 1EROA 3ICYA 1K25A 5M1AA 4QJGA 4DDYA 3DTEA 3SZTA 1V9ZA 3U2AA 3IXBA 3NC8A 3SS5A 1FSYA 4EW7A 4JXWA 3NDEA 1WYBA 2M7UA 4BJPA 5F5YA 4LCMA 1NY0A 3MJQA 3W4OA 5JYOA 2B02A 4BBUA 2GDNA 4IVIA 4E3NA 1MKMA 1YSPA 1XA7A 1IELA 2JKTI 2VGKA 4BWIA 3LYXA 5EOEA 1E25A 3Q7VA 1ALQA 2BTFP 4EETB 5HWTA 4NEED 3MXRA 3DTKA 4IUHA 4R1GA 4LLOB 4C75A 3BFGA 4XUXA 4S2IA 4I3AA 5J3WA 2QKPA 1AXBA 3T4JA 4Q0JA 1UWNX 1OMEA 4BD1A 3NCKA 3HLGA 2ZMFA 3VP3A 2Y2MA 2DNSA 4HNBA 1OTDA 3MKFA 2QHKA 3GMWA 3S1YA 4WL9A 3BECA 2PR6A 3Q81A 1X0OA 1SCWA 2WGIA 2Y4AA 4Y13A 2IA2A 4GOGA 4DJ2A 3ZHHA 1F2KA 3ZQ5A 4LV1A 2XFTA 1N9OA 4IEDA 4JF5A 4GW9A 3CG5A 1TS8A 5G18A 4QU3A 4OQIA 3OBFA 2Y2QA 3QP5A 3F1NB 4CJNA 4R38A 4D2OA 1AWIA 1TD5A 4S2NC 2B5RA 4ZRRA 4S2KA 4EBLA 4F3LB 3V39A 3VOYA 2P7JA 4CLCE 4XT2B 1K56A 3LIDA 4FSFA 1OTIA 4CPKA 3K3DA 4HIAA 4BBTA 3SS4A 3VFFA 4OVDA 1XPBA 2FH5A 5EOOA 1N9NA 2H0TA 4PKYA 3BY8A 1OT9A 3N7WA 1ES5A 4QHCA 3MSHA 3ZG5A 2ZL1A 2D02A 1NRJA 4GB7A 5TJJA 2VGJA 1MWTA 3GQZA 3RH8B 3KYQA 4IBXA 3LUQA 1DJAA 3D72A 2ZD8A 3MXQA 4BQMA 3BWLA 4N9KA 5KMWA 2JKFA 4KZAA 4WN5A 1K57A 1DJCA 5TR7A 4X1MA 1ZTUA 2W0NA 4EUVA 2PD7A 3T4OA 1W63Q 2WK0A 3C4OA 5E2EA 3NDGA 3OCLA 2HP9A 3ZG9B 4NKPA 3HLBA 3G6OA 1F5MA 1S67L 2CC1A 2IWDA 2IWCA 5EVEA 1E3UA 3MQ0A 5FI7A 4MCWA 1GHMA 3VFHA 5HD3A 5A90A 5FAOA 4KQRA 5DKLA 2PYRA 5FAPA 3FKWA 2EFUA 4R3AA 4DE1A 5EM1A 4NXBA 1RGZA 2JE5A 4QB8A 4N92A 1DP9A 4EQIA 2K7SA 1SKOB 4ME4A 5L2FA 1BLCA 3W8KA 5KIZA 4KUKA 1NLZA 3VOLA 3HJKA 1OJ5A 3MZFA 1GA9A 4IHQA 3DW0A 3UB8A 4MBHA 5DFYA 5DF7A 2UWXA 1FILA 3GV9A 1FCNA 3EOIA 2W3DA 4XUZA 2WKEA 3LIFA 1VEUA 1DP8A 3LR3A 2Y8HA 5KSCA 2WGWA 4U3TA 5HDSA 5DVAA 1IFQA 3OLOA 3DBAA 3QNCA 4HBUA 4KENB 5KZHA 3K3CA 4HY8A 1JVJA 3UE0A 4EV4A 4Q0HA 5CEDA 1SKFA 2YKHA 4U0XA 4P0MA 1UGUA 1T1CA 1XX2A 3FWLA 5GHXA 3M2JA 3KYEA 4S2MA 5CTMA 3DTIA 2XGNA 2H5SA 2Y79A 3QP1A 3LY3A 5GLCA 3KX0X 1ACFA 1BT5A 4YINA 4X56A 3U4LP 2HV1A 4DN0A 5EV0A 4PM7A 3BFEA 3NOPC 5IU1A 3CPTB 4R3JA 3ZVWA 4MBFA 2VEAA 4ARZB 4LV0A 3JPUA 4HJ3A 4JXVA 4FCFA 3IWQA 1TS0A 2K2NA 4Y7PA 4R3BA 1S4SA 2QJ7A 5M18A 4ZAMA 1HZOA 1TVFA 4MN6A 3LIAA 1GHIA 4IUKA 3IWOA 3BRMA 1LI0A
chains in the Genus database with same CATH topology
2ZQDA 1YMSA 3MKEA 4KG2A 3OPRA 5CHUA 3MZEA 1GCEA 1YM1A 4KZ7A 1ZC2A 3BYDA 4KZ3A 3ZVTA 3G4PA 3G30A 2XD1A 3JYIA 4R4SA 4GN2A 1PW8A 4F94A 3EQUA 3G32A 4ZTKA 1K56D 1NZUA 3W4QA 4E3JA 5J8XA 4JF4A 3O87A 3V3SA 4JXSA 2WGVA 2OV5A 2Y2OA 3PBRA 5CHJA 4PM9A 1EROA 5FI2A 3VSLA 4GDBA 3UDFA 4JXGA 1K25A 2WAEA 4IVKA 4E3LA 2I72A 4WELA 2Y2GA 3C5AA 5DTTA 5M1AA 3RJUA 4QJGA 4OLGA 4DDYA 3UN7A 1HD8A 2ZC4B 3O88A 4IBRA 4Q8IA 3G35A 5DF9A 5HFOA 2C5WB 3Q82A 3IXBA 3NC8A 2ZLYA 3D4FA 1LHYA 3SS5A 1FSYA 3OPHA 2XK1A 2G2UA 3IF5A 4S2NA 3UPNA 2ZC7A 4JXWA 3NDEA 1WYBA 1PWDA 4ZJ3A 4BJPA 3HLFA 2XDMA 4LCMA 1NY0A 3W4OA 5JYOA 4P87A 4OP8A 3RXWA 5KSHA 1U60A 3UO9A 1ZKJA 4OPQA 1L0GA 2GDNA 4IVIA 4E3NA 1M40A 2OLUA 3QHYA 4RYEA 3ITAA 4OPRA 1N4OA 4UA6A 1XA7A 3LEZA 1IELA 1BZAA 2VGKA 3O3VA 5EOEA 2EX6A 1E25A 4PMAA 3Q7VA 3BLSA 1ALQA 1HVBA 5AQAA 1ZG6A 5F82A 1GHPA 1FCMA 1K54A 2ZC5B 3MXRA 1S6RA 1IYPA 4C75A 2WAFA 4R1GA 1Y54A 3PAEA 4MLLA 2V2FF 4DE0A 5F1FA 5JYPA 2XR0A 3BFGA 4XUXA 4H8RA 1XKZA 3BM6A 2DRWA 2R9XA 1I2SA 3PBQA 4GNUA 4LENA 4S2IA 3TSGA 3WRZA 2JCHA 4EBPA 2Y2NA 3N8RA 4GDNA 5DTSA 3N8SA 4MNRA 4UAAA 4ZDXA 3BEBA 1ESIA 1LLBA 4OQHA 5I94A 1AXBA 3NIAA 1K38A 4WMCD 1OMEA 4BD1A 4OOLA 4KZ6A 3NCKA 2ZC6B 2J8YA 4WZ5A 3HLGA 3WS4A 3HUNA 3HLCA 4JBFA 5FSRA 2XD5A 1L2SA 3LY4A 3WS1A 2ZQ9A 4B88A 3M2KA 5E2FA 2R9WA 4OONA 3VP3A 3ZCZA 2Y2MA 3HLEA 3Q07A 1TEMA 2DNSA 3E2LA 4OP5A 2WZXA 2OSUA 4OQGA 3Q1FA 3MKFA 5E43A 2ZM2A 3GMWA 1PZPA 2Y2KA 4LV2A 3S1YA 4DE2A 4DKIA 4WEKA 3IH9A 3IHBA 2EX2A 3BECA 4OQ0A 3CJMA 3Q81A 1O07A 4RX2A 4FH2A 1Q2PA 1IEMA 1SCWA 2H0YA 2WGIA 3GR2A 1ERQA 3UDXA 4E3OA 2V20A 4N9LA 5EE8A 3QNBA 2Y4AA 3HVFA 4A5RA 4B4XA 4UA9A 5DTKA 5DF8A 1KE0A 1CI8A 1IYSA 3N8LA 4GOGA 4K91A 2WKHA 1CEFA 1KE3A 3UY6A 3ZHHA 1YLPA 4E3KA 1YLTA 2X02A 1PWCA 4EUZA 3AGDA 5CHMA 4LV1A 2XFTA 5EVID 2OLVA 4IEDA 4X53A 1JTGA 4JF5A 3CZDA 3ZNTA 3CG5A 3EQVA 2Y2IA 4E6XA 2WADA 5FQQA 5G18A 1W5DA 4QU3A 1K6SA 3PBTA 4OQIA 2Y2QA 3VSKA 2Y91A 4HBTA 3FKVA 3VP4A 4ZJ1A 4CJNA 2J9PA 1YLJA 4KQOA 4DDSA 1KGGA 4D2OA 2H10A 4FD8A 4C6YA 1CEGA 1MWRA 4S2NC 1BUEA 2B5RA 2QPNA 1PW1A 3HUMA 2EFXA 3O86A 4S2KA 3GTCA 4DE3A 4EBLA 4MEZA 1K55C 3V39A 3BFFA 3P98A 3VP2A 3VOYA 1BSGA 3ZGAB 1RCJA 3LCEA 4RA7A 4K0WA 3G2YA 4JF6A 4OOYA 4S2PA 1EWZA 4DF6A 1K56A 3SOIA 4M3KA 3UE1A 2Y2PA 2BG1A 1RP5A 5TFQA 4KZ8A 1YMXA 4FSFA 4CPKA 1K54C 1K4FA 3Q7VB 3IWIA 4BD0A 1O7EA 4JKTA 3SS4A 3VFFA 2QZ6A 4OVDA 1XPBA 3SH9A 5EOOA 5CGXA 1XGJA 5E2HA 1K55A 1ES3A 2H0TA 5EVLA 2HP6A 1S0WA 4KZBA 4N1XA 4R4RA 4GD6A 3N7WA 4PM8A 3ZDJA 1ES5A 4RVAA 1H8YA 4QHCA 3ZG5A 3VOZA 3GVBA 4KZ9A 2EXBA 4NK3A 4WEJA 3BFCA 4GB7A 1PWGA 2A49A 2VGJA 5TGFA 1MWTA 4WZ5C 2Y2LA 1ERMA 5FASA 3LO7A 3GQZA 1K57C 2J9OA 3NBLA 2IWBA 1G68A 2ZQCA 4IBXA 5CGWA 1MKIA 1J9MA 1FOFA 1DY6A 1ONGA 3C7UA 2WKIA 3TOIA 1DJAA 4HEFA 4K0XA 5FQKA 2PU2A 5CEBA 1YLYA 1LL9A 2ZD8A 4BQMA 4DXCA 1BLSA 1SDEA 3UPPA 4JLFA 3OCNA 3M6BA 4GZBA 4C3QA 2HP5A 3MZDA 4N9KA 3UPOA 5KMWA 4KZAA 1FQGA 4U0TA 3UE3A 3NI9A 3IXHA 5HW3A 5HARA 3C4PA 1K57A 1DJCA 1M6KA 4UA7A 1BLPA 5TR7A 2HDRA 1IKIA 4S2OA 3IQAA 2Q9NA 4P85A 3GSGA 1JWVA 5HAIA 1BTLA 1I5QA 3P09A 2RCXA 5A92A 4WMCA 5GL9A 4BL3A 2Y59A 3WS0A 1NYYA 2P9VA 3MBZA 3ZNYA 1JWZA 1PIOA 1FCOA 3ZFZA 3G34A 3E2KA 2WK0A 3FV7A 5E2GA 3C7VA 1K6RA 1YLWA 3C4OA 2PBYA 3PBNA 4OH0A 1MWSA 3IH8A 5E2EA 1IYOA 1HTZA 3NDGA 2HP9A 3A3IA 3OCLA 3VMAA 4BL2A 3ZG9B 2HDUA 3VP0A 4QD4A 1VM1A 3HLBA 1LI9A 1PZOA 5FQJA 1E3UD 3N6IA 5FA7A 5EVIC 3OPPA 1ES4A 4GD8A 3W4PA 3RXXA 2A3UA 5FI6A 5HAPA 3Q7ZA 1ESUA 2WYXA 5EVIB 2CC1A 5AQBA 2IWDA 1CK3A 1W8QA 2J7VA 2IWCA 2Y2HA 2ZQ8A 4FH4A 2EX9A 2ZM0A 1E3UA 1L0FA 4ZBEA 4DXBA 1YT4A 5FI7A 1IKGA 1NYMA 2EX8A 1I2WA 3FZCA 4KQQA 1CI9A 3AGEA 1ZG4A 3HREA 4BENA 1GHMA 4R0QA 2RL3A 4YFMA 3B3XA 3VFHA 4N1HA 4Y0OA 5F1GA 3G31A 3BFDA 5A90A 2HDQA 1KDWA 5FAOA 4Y0TA 5EUAA 1DJBA 3HL9A 4KQRA 5EVIA 3NY4A 5FAPA 4QY6A 3FKWA 2EFUA 1G6AA 4DE1A 1N9BA 3A3FA 1TDLA 3A3JA 2C6WB 3SS3A 1GA0A 4OKPA 5F83A 1RGZA 1W8YA 3WWXA 5A93A 2JE5A 3IF6A 1FR1A 4QB8A 3TG9A 5GHZA 4ID4A 3SH8A 3ZG7B 4N92A 1QMEA 4S2JA 2XLNA 1ONHA 3WRTA 4EQIA 2XQZA 4WYYA 5L2FA 1BLCA 1SDNA 2ZQ7A 1BLHA 3W8KA 5AQ7A 4PM5A 1MY8A 3S22A 3MFDA 3MZFA 3IHAA 5FQ9A 1GA9A 2ZC3B 4E3MA 5CRFA 1FR6A 1MBLA 4RX3A 2WGWB 3DW0A 3AGFA 4GKUA 4Y0UA 3ZG0A 4S2LA 2E8IA 5FAQA 2HDSA 4MBKA 2XH9A 1YQSA 5HAQA 4OPZA 4PM6A 3A3DA 4MBHA 3WS5A 3S4XA 5DF7A 2UWXA 3ZG8B 2Q9MA 2BLSA 2XF3A 3GV9A 1FCNA 1XGIA 5FQMA 5A91A 5EPHA 5AQ9A 4XUZA 2WKEA 4R23A 4B4ZA 3DTMA 5KSCA 2WGWA 5BOHA 4U3TA 5DVAA 1WE4A 4KZ5A 2V1ZA 1NZOA 2XFSA 3HLDA 4XXRA 1E4DA 2JBFA 3QNCA 3UDIA 3V5MA 4HBUA 4OLDA 4L0LA 2HPBA 2ZM8A 4KENB 5KZHA 1C3BA 4EWFA 1VQQA 1JVJA 3UE0A 4EV4A 5CEDA 1WYCA 1SKFA 3MXSA 3DWKA 3HUOA 2ZMAA 4QY5A 4WZ4A 5D3OA 3ISGA 4PPRA 4U0XA 1NXYA 4P0MA 5FQIA 2JC7A 1FSWA 2P9VB 3BLMA 1K4EA 1XX2A 3FWLA 1L0EA 3M6HA 4DRTA 1RGYA 5GHXA 3OC2A 1H8ZA 2Y2JA 4LV3A 4UHUA 1PI5A 3M2JA 4S2MA 5FDHA 1Q2QA 1QMFA 2ZQAA 5CTMA 2WUQA 2FFFB 2X71A 1KDSA 1KGFA 3IXGA 5HL1A 1PI4A 2FFYA 1XP4A 2XGNA 4EBNA 2XEPA 1ES2A 3PTEA 4WM9A 1BULA 2H5SA 4P6BA 1PYYA 3LY3A 4HESA 5CERA 5GLCA 1KGEA 1BT5A 3ITBA 4YINA 5HX9A 1KVMA 4X56A 1IYQA 5GLAA 3CMZA 1W7FA 4BLMA 1JTDA 1YLZA 1LL5A 5FATA 2ZJ9A 4LCLA 4OOMA 3OPLA 4PM7A 5GLDA 2G2WA 1MPLA 1JWPA 3BFEA 1NJ4A 3I7JA 1EI5A 5GLBA 1NRFA 4JPMA 3V50A 4E6WA 3HLWA 5M19A 3HBRA 2PU4A 4R3JA 4O7DA 1W79A 3WS2A 3G2ZA 3ZVWA 4MBFA 2QMIA 5CECA 4LV0A 4X69A 2WZZA 3A3EA 3FYZA 4KG5A 3IF6C 2X01A 3PAGA 1KVLA 4JXVA 3VP1A 2Y55A 4FCFA 3V3RA 4E3IA 3UNWA 3OZHA 3IF6B 4X55A 3IWQA 3IXDA 3SH7A 4Z9QA 5IHVA 4ZJ2A 4X68A 5CXWA 1XXMA 3N4IA 1SHVA 4R3BA 1MXOA 1TDGA 4KG6A 4X6TA 4Y7PA 4NETA 3DWZA 5CGSA 5M18A 2Z2MB 3IT9A 5EECA 4ZAMA 1HZOA 3PBSA 1TVFA 1L0DA 2P74A 1H5XA 5GHYA 4WBGA 2EXAA 1GHIA 1KE4A 1XA1A 2Z2LB 4KZ4A 1Z6FA 3IWOA 3PBOA 5CTNA 2DCFA 3BRMA 4OPYA 1MWUA 3GRJA 5U47A 1LI0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZQD A;  1YMS A;  3MKE A;  4KG2 A;  3OPR A;  5CHU A;  3MZE A;  1GCE A;  1YM1 A;  4KZ7 A;  1ZC2 A;  3BYD A;  4KZ3 A;  3ZVT A;  3G4P A;  3G30 A;  2XD1 A;  3JYI A;  4R4S A;  4GN2 A;  1PW8 A;  4F94 A;  3EQU A;  3G32 A;  4ZTK A;  1K56 D;  1NZU A;  3W4Q A;  4E3J A;  5J8X A;  4JF4 A;  3O87 A;  3V3S A;  4JXS A;  2WGV A;  2OV5 A;  2Y2O A;  3PBR A;  5CHJ A;  4PM9 A;  1ERO A;  5FI2 A;  3VSL A;  4GDB A;  3UDF A;  4JXG A;  1K25 A;  2WAE A;  4IVK A;  4E3L A;  2I72 A;  4WEL A;  2Y2G A;  3C5A A;  5DTT A;  5M1A A;  3RJU A;  4QJG A;  4OLG A;  4DDY A;  3UN7 A;  1HD8 A;  2ZC4 B;  3O88 A;  4IBR A;  4Q8I A;  3G35 A;  5DF9 A;  5HFO A;  2C5W B;  3Q82 A;  3IXB A;  3NC8 A;  2ZLY A;  3D4F A;  1LHY A;  3SS5 A;  1FSY A;  3OPH A;  2XK1 A;  2G2U A;  3IF5 A;  4S2N A;  3UPN A;  2ZC7 A;  4JXW A;  3NDE A;  1WYB A;  1PWD A;  4ZJ3 A;  4BJP A;  3HLF A;  2XDM A;  4LCM A;  1NY0 A;  3W4O A;  5JYO A;  4P87 A;  4OP8 A;  3RXW A;  5KSH A;  1U60 A;  3UO9 A;  1ZKJ A;  4OPQ A;  1L0G A;  2GDN A;  4IVI A;  4E3N A;  1M40 A;  2OLU A;  3QHY A;  4RYE A;  3ITA A;  4OPR A;  1N4O A;  4UA6 A;  1XA7 A;  3LEZ A;  1IEL A;  1BZA A;  2VGK A;  3O3V A;  5EOE A;  2EX6 A;  1E25 A;  4PMA A;  3Q7V A;  3BLS A;  1ALQ A;  1HVB A;  5AQA A;  1ZG6 A;  5F82 A;  1GHP A;  1FCM A;  1K54 A;  2ZC5 B;  3MXR A;  1S6R A;  1IYP A;  4C75 A;  2WAF A;  4R1G A;  1Y54 A;  3PAE A;  4MLL A;  2V2F F;  4DE0 A;  5F1F A;  5JYP A;  2XR0 A;  3BFG A;  4XUX A;  4H8R A;  1XKZ A;  3BM6 A;  2DRW A;  2R9X A;  1I2S A;  3PBQ A;  4GNU A;  4LEN A;  4S2I A;  3TSG A;  3WRZ A;  2JCH A;  4EBP A;  2Y2N A;  3N8R A;  4GDN A;  5DTS A;  3N8S A;  4MNR A;  4UAA A;  4ZDX A;  3BEB A;  1ESI A;  1LLB A;  4OQH A;  5I94 A;  1AXB A;  3NIA A;  1K38 A;  4WMC D;  1OME A;  4BD1 A;  4OOL A;  4KZ6 A;  3NCK A;  2ZC6 B;  2J8Y A;  4WZ5 A;  3HLG A;  3WS4 A;  3HUN A;  3HLC A;  4JBF A;  5FSR A;  2XD5 A;  1L2S A;  3LY4 A;  3WS1 A;  2ZQ9 A;  4B88 A;  3M2K A;  5E2F A;  2R9W A;  4OON A;  3VP3 A;  3ZCZ A;  2Y2M A;  3HLE A;  3Q07 A;  1TEM A;  2DNS A;  3E2L A;  4OP5 A;  2WZX A;  2OSU A;  4OQG A;  3Q1F A;  3MKF A;  5E43 A;  2ZM2 A;  3GMW A;  1PZP A;  2Y2K A;  4LV2 A;  3S1Y A;  4DE2 A;  4DKI A;  4WEK A;  3IH9 A;  3IHB A;  2EX2 A;  3BEC A;  4OQ0 A;  3CJM A;  3Q81 A;  1O07 A;  4RX2 A;  4FH2 A;  1Q2P A;  1IEM A;  1SCW A;  2H0Y A;  2WGI A;  3GR2 A;  1ERQ A;  3UDX A;  4E3O A;  2V20 A;  4N9L A;  5EE8 A;  3QNB A;  2Y4A A;  3HVF A;  4A5R A;  4B4X A;  4UA9 A;  5DTK A;  5DF8 A;  1KE0 A;  1CI8 A;  1IYS A;  3N8L A;  4GOG A;  4K91 A;  2WKH A;  1CEF A;  1KE3 A;  3UY6 A;  3ZHH A;  1YLP A;  4E3K A;  1YLT A;  2X02 A;  1PWC A;  4EUZ A;  3AGD A;  5CHM A;  4LV1 A;  2XFT A;  5EVI D;  2OLV A;  4IED A;  4X53 A;  1JTG A;  4JF5 A;  3CZD A;  3ZNT A;  3CG5 A;  3EQV A;  2Y2I A;  4E6X A;  2WAD A;  5FQQ A;  5G18 A;  1W5D A;  4QU3 A;  1K6S A;  3PBT A;  4OQI A;  2Y2Q A;  3VSK A;  2Y91 A;  4HBT A;  3FKV A;  3VP4 A;  4ZJ1 A;  4CJN A;  2J9P A;  1YLJ A;  4KQO A;  4DDS A;  1KGG A;  4D2O A;  2H10 A;  4FD8 A;  4C6Y A;  1CEG A;  1MWR A;  4S2N C;  1BUE A;  2B5R A;  2QPN A;  1PW1 A;  3HUM A;  2EFX A;  3O86 A;  4S2K A;  3GTC A;  4DE3 A;  4EBL A;  4MEZ A;  1K55 C;  3V39 A;  3BFF A;  3P98 A;  3VP2 A;  3VOY A;  1BSG A;  3ZGA B;  1RCJ A;  3LCE A;  4RA7 A;  4K0W A;  3G2Y A;  4JF6 A;  4OOY A;  4S2P A;  1EWZ A;  4DF6 A;  1K56 A;  3SOI A;  4M3K A;  3UE1 A;  2Y2P A;  2BG1 A;  1RP5 A;  5TFQ A;  4KZ8 A;  1YMX A;  4FSF A;  4CPK A;  1K54 C;  1K4F A;  3Q7V B;  3IWI A;  4BD0 A;  1O7E A;  4JKT A;  3SS4 A;  3VFF A;  2QZ6 A;  4OVD A;  1XPB A;  3SH9 A;  5EOO A;  5CGX A;  1XGJ A;  5E2H A;  1K55 A;  1ES3 A;  2H0T A;  5EVL A;  2HP6 A;  1S0W A;  4KZB A;  4N1X A;  4R4R A;  4GD6 A;  3N7W A;  4PM8 A;  3ZDJ A;  1ES5 A;  4RVA A;  1H8Y A;  4QHC A;  3ZG5 A;  3VOZ A;  3GVB A;  4KZ9 A;  2EXB A;  4NK3 A;  4WEJ A;  3BFC A;  4GB7 A;  1PWG A;  2A49 A;  2VGJ A;  5TGF A;  1MWT A;  4WZ5 C;  2Y2L A;  1ERM A;  5FAS A;  3LO7 A;  3GQZ A;  1K57 C;  2J9O A;  3NBL A;  2IWB A;  1G68 A;  2ZQC A;  4IBX A;  5CGW A;  1MKI A;  1J9M A;  1FOF A;  1DY6 A;  1ONG A;  3C7U A;  2WKI A;  3TOI A;  1DJA A;  4HEF A;  4K0X A;  5FQK A;  2PU2 A;  5CEB A;  1YLY A;  1LL9 A;  2ZD8 A;  4BQM A;  4DXC A;  1BLS A;  1SDE A;  3UPP A;  4JLF A;  3OCN A;  3M6B A;  4GZB A;  4C3Q A;  2HP5 A;  3MZD A;  4N9K A;  3UPO A;  5KMW A;  4KZA A;  1FQG A;  4U0T A;  3UE3 A;  3NI9 A;  3IXH A;  5HW3 A;  5HAR A;  3C4P A;  1K57 A;  1DJC A;  1M6K A;  4UA7 A;  1BLP A;  5TR7 A;  2HDR A;  1IKI A;  4S2O A;  3IQA A;  2Q9N A;  4P85 A;  3GSG A;  1JWV A;  5HAI A;  1BTL A;  1I5Q A;  3P09 A;  2RCX A;  5A92 A;  4WMC A;  5GL9 A;  4BL3 A;  2Y59 A;  3WS0 A;  1NYY A;  2P9V A;  3MBZ A;  3ZNY A;  1JWZ A;  1PIO A;  1FCO A;  3ZFZ A;  3G34 A;  3E2K A;  2WK0 A;  3FV7 A;  5E2G A;  3C7V A;  1K6R A;  1YLW A;  3C4O A;  2PBY A;  3PBN A;  4OH0 A;  1MWS A;  3IH8 A;  5E2E A;  1IYO A;  1HTZ A;  3NDG A;  2HP9 A;  3A3I A;  3OCL A;  3VMA A;  4BL2 A;  3ZG9 B;  2HDU A;  3VP0 A;  4QD4 A;  1VM1 A;  3HLB A;  1LI9 A;  1PZO A;  5FQJ A;  1E3U D;  3N6I A;  5FA7 A;  5EVI C;  3OPP A;  1ES4 A;  4GD8 A;  3W4P A;  3RXX A;  2A3U A;  5FI6 A;  5HAP A;  3Q7Z A;  1ESU A;  2WYX A;  5EVI B;  2CC1 A;  5AQB A;  2IWD A;  1CK3 A;  1W8Q A;  2J7V A;  2IWC A;  2Y2H A;  2ZQ8 A;  4FH4 A;  2EX9 A;  2ZM0 A;  1E3U A;  1L0F A;  4ZBE A;  4DXB A;  1YT4 A;  5FI7 A;  1IKG A;  1NYM A;  2EX8 A;  1I2W A;  3FZC A;  4KQQ A;  1CI9 A;  3AGE A;  1ZG4 A;  3HRE A;  4BEN A;  1GHM A;  4R0Q A;  2RL3 A;  4YFM A;  3B3X A;  3VFH A;  4N1H A;  4Y0O A;  5F1G A;  3G31 A;  3BFD A;  5A90 A;  2HDQ A;  1KDW A;  5FAO A;  4Y0T A;  5EUA A;  1DJB A;  3HL9 A;  4KQR A;  5EVI A;  3NY4 A;  5FAP A;  4QY6 A;  3FKW A;  2EFU A;  1G6A A;  4DE1 A;  1N9B A;  3A3F A;  1TDL A;  3A3J A;  2C6W B;  3SS3 A;  1GA0 A;  4OKP A;  5F83 A;  1RGZ A;  1W8Y A;  3WWX A;  5A93 A;  2JE5 A;  3IF6 A;  1FR1 A;  4QB8 A;  3TG9 A;  5GHZ A;  4ID4 A;  3SH8 A;  3ZG7 B;  4N92 A;  1QME A;  4S2J A;  2XLN A;  1ONH A;  3WRT A;  4EQI A;  2XQZ A;  4WYY A;  5L2F A;  1BLC A;  1SDN A;  2ZQ7 A;  1BLH A;  3W8K A;  5AQ7 A;  4PM5 A;  1MY8 A;  3S22 A;  3MFD A;  3MZF A;  3IHA A;  5FQ9 A;  1GA9 A;  2ZC3 B;  4E3M A;  5CRF A;  1FR6 A;  1MBL A;  4RX3 A;  2WGW B;  3DW0 A;  3AGF A;  4GKU A;  4Y0U A;  3ZG0 A;  4S2L A;  2E8I A;  5FAQ A;  2HDS A;  4MBK A;  2XH9 A;  1YQS A;  5HAQ A;  4OPZ A;  4PM6 A;  3A3D A;  4MBH A;  3WS5 A;  3S4X A;  5DF7 A;  2UWX A;  3ZG8 B;  2Q9M A;  2BLS A;  2XF3 A;  3GV9 A;  1FCN A;  1XGI A;  5FQM A;  5A91 A;  5EPH A;  5AQ9 A;  4XUZ A;  2WKE A;  4R23 A;  4B4Z A;  3DTM A;  5KSC A;  2WGW A;  5BOH A;  4U3T A;  5DVA A;  1WE4 A;  4KZ5 A;  2V1Z A;  1NZO A;  2XFS A;  3HLD A;  4XXR A;  1E4D A;  2JBF A;  3QNC A;  3UDI A;  3V5M A;  4HBU A;  4OLD A;  4L0L A;  2HPB A;  2ZM8 A;  4KEN B;  5KZH A;  1C3B A;  4EWF A;  1VQQ A;  1JVJ A;  3UE0 A;  4EV4 A;  5CED A;  1WYC A;  1SKF A;  3MXS A;  3DWK A;  3HUO A;  2ZMA A;  4QY5 A;  4WZ4 A;  5D3O A;  3ISG A;  4PPR A;  4U0X A;  1NXY A;  4P0M A;  5FQI A;  2JC7 A;  1FSW A;  2P9V B;  3BLM A;  1K4E A;  1XX2 A;  3FWL A;  1L0E A;  3M6H A;  4DRT A;  1RGY A;  5GHX A;  3OC2 A;  1H8Z A;  2Y2J A;  4LV3 A;  4UHU A;  1PI5 A;  3M2J A;  4S2M A;  5FDH A;  1Q2Q A;  1QMF A;  2ZQA A;  5CTM A;  2WUQ A;  2FFF B;  2X71 A;  1KDS A;  1KGF A;  3IXG A;  5HL1 A;  1PI4 A;  2FFY A;  1XP4 A;  2XGN A;  4EBN A;  2XEP A;  1ES2 A;  3PTE A;  4WM9 A;  1BUL A;  2H5S A;  4P6B A;  1PYY A;  3LY3 A;  4HES A;  5CER A;  5GLC A;  1KGE A;  1BT5 A;  3ITB A;  4YIN A;  5HX9 A;  1KVM A;  4X56 A;  1IYQ A;  5GLA A;  3CMZ A;  1W7F A;  4BLM A;  1JTD A;  1YLZ A;  1LL5 A;  5FAT A;  2ZJ9 A;  4LCL A;  4OOM A;  3OPL A;  4PM7 A;  5GLD A;  2G2W A;  1MPL A;  1JWP A;  3BFE A;  1NJ4 A;  3I7J A;  1EI5 A;  5GLB A;  1NRF A;  4JPM A;  3V50 A;  4E6W A;  3HLW A;  5M19 A;  3HBR A;  2PU4 A;  4R3J A;  4O7D A;  1W79 A;  3WS2 A;  3G2Z A;  3ZVW A;  4MBF A;  2QMI A;  5CEC A;  4LV0 A;  4X69 A;  2WZZ A;  3A3E A;  3FYZ A;  4KG5 A;  3IF6 C;  2X01 A;  3PAG A;  1KVL A;  4JXV A;  3VP1 A;  2Y55 A;  4FCF A;  3V3R A;  4E3I A;  3UNW A;  3OZH A;  3IF6 B;  4X55 A;  3IWQ A;  3IXD A;  3SH7 A;  4Z9Q A;  5IHV A;  4ZJ2 A;  4X68 A;  5CXW A;  1XXM A;  3N4I A;  1SHV A;  4R3B A;  1MXO A;  1TDG A;  4KG6 A;  4X6T A;  4Y7P A;  4NET A;  3DWZ A;  5CGS A;  5M18 A;  2Z2M B;  3IT9 A;  5EEC A;  4ZAM A;  1HZO A;  3PBS A;  1TVF A;  1L0D A;  2P74 A;  1H5X A;  5GHY A;  4WBG A;  2EXA A;  1GHI A;  1KE4 A;  1XA1 A;  2Z2L B;  4KZ4 A;  1Z6F A;  3IWO A;  3PBO A;  5CTN A;  2DCF A;  3BRM A;  4OPY A;  1MWU A;  3GRJ A;  5U47 A;  1LI0 A; 
#chains in the Genus database with same CATH topology
 2ZQD A;  3MKE A;  4GHI B;  1GCE A;  1ZC2 A;  1S66 L;  2CMN A;  3IX8 A;  2JKR M;  4GN2 A;  1PW8 A;  4F94 A;  3EQU A;  3W4Q A;  4E3J A;  3S7N A;  3V3S A;  4JXS A;  2OV5 A;  5CHJ A;  3S7O A;  3UDF A;  3UMD A;  4GS9 B;  2WAE A;  4IVK A;  4HH2 A;  3RJU A;  3UN7 A;  4Q8I A;  3O88 A;  5DF9 A;  2C5W B;  3Q82 A;  4E04 A;  3D4F A;  1LHY A;  4G3K A;  3IF5 A;  4S2N A;  2V1A A;  4OP8 A;  1U60 A;  3UO9 A;  1L0G A;  3ITA A;  2VV8 A;  4UA6 A;  3LEZ A;  3O3V A;  4LRX C;  1HVB A;  4ETZ A;  2BAS A;  5F82 A;  1GHP A;  4IJG A;  4NXG A;  1S6R A;  5HPF A;  3MQO A;  2WAF A;  3PAE A;  3HCY A;  5JYP A;  2XR0 A;  1D7E A;  3PBQ A;  4GNU A;  4LEN A;  4EBP A;  2JCH A;  2Y2N A;  3T1S A;  3N8R A;  5DTS A;  4H6J B;  4K08 A;  1ESI A;  1LLB A;  4OQH A;  2OWH A;  1K38 A;  5HD5 A;  2INW A;  4HI4 A;  2ZC6 B;  3HUN A;  4JBF A;  4B88 A;  1L2S A;  3LY4 A;  4O01 A;  5E2F A;  4Y3I A;  2NUP C;  2W1T B;  3HLE A;  4OP5 A;  2OSU A;  3Q1F A;  2VX8 A;  3TRC A;  2Y2K A;  1V9Y A;  2PDR A;  3IHB A;  4WEK A;  2EX2 A;  1O07 A;  1Q2P A;  2H0Y A;  3GR2 A;  4E3O A;  4N9L A;  2VGL M;  3EEH A;  3HVF A;  3ULF A;  2XRN A;  2QWS A;  4LPZ A;  5AVE A;  2W3F A;  1KE0 A;  1IYS A;  1CEF A;  1KE3 A;  4YOF A;  3D3O A;  3UY6 A;  3P7N A;  1YLP A;  2HJE A;  4EUZ A;  4NXF A;  4CLC C;  5CHM A;  2PRF A;  2VGL S;  3IBJ A;  4X53 A;  3CZD A;  4CLC B;  2Y2I A;  2W3H A;  5FQQ A;  3T1Q B;  4HBT A;  4KQO A;  2H10 A;  1BUE A;  3HUM A;  1PW1 A;  2PBD P;  3O86 A;  3GTC A;  3NHQ A;  3MMH A;  4MEZ A;  1CF0 A;  1RCJ A;  3IS2 B;  5LBR A;  3G2Y A;  4JF6 A;  4OOY A;  3SOI A;  3S7Q A;  2Y2P A;  1RP5 A;  5TFQ A;  4KZ8 A;  3MFX A;  2E8J A;  4G3V A;  3LR5 A;  1XGJ A;  5EVL A;  1K55 A;  2J3T C;  1G6O A;  2Z6D A;  2VK3 A;  4HHD A;  4N1X A;  1H8Y A;  3GVB A;  4WEJ A;  3BFC A;  2GJ3 A;  4WZ5 C;  5FAS A;  4FTX A;  3L7H A;  3BJN A;  3R7W A;  5CGW A;  4DJ3 A;  4II7 A;  5TBM A;  3UB5 P;  5F68 A;  5EM0 A;  3F1O B;  3C7U A;  4JGP A;  4HH3 A;  4JLF A;  3M6B A;  4GZB A;  3MZD A;  5L07 A;  3H9W A;  3C4P A;  2A24 A;  5HAR A;  1BLP A;  2L0W A;  3S7P A;  2K31 A;  1IKI A;  3IQA A;  5A8B A;  2Q9N A;  1TS7 A;  4P85 A;  3GSG A;  1I5Q A;  3P09 A;  4Z1W A;  3H82 A;  3WS0 A;  1NYY A;  1JWZ A;  1PIO A;  3ZFZ A;  5E2G A;  1K6R A;  1MWS A;  3VP0 A;  5FQJ A;  1E3U D;  5FA7 A;  1OT6 A;  1LL8 A;  5EVI C;  3OPP A;  3RXX A;  2A3U A;  5HAP A;  3Q7Z A;  1ESU A;  1DP6 A;  2WYX A;  5EVI B;  2J7V A;  2ZQ8 A;  4UEY A;  2GX5 A;  2EX9 A;  4ZBE A;  5J4E A;  3T4K A;  1I2W A;  3FZC A;  4MN5 A;  4EEP A;  1CI9 A;  3FC7 A;  3HRE A;  4BEN A;  4YFM A;  3G31 A;  2WKP A;  4Y0T A;  3HL9 A;  2JN7 A;  2P04 A;  1G6A A;  1N9B A;  5CX7 A;  3IX4 A;  3SS3 A;  1GA0 A;  4OKP A;  5A93 A;  1OJG A;  3H7W A;  4KQD A;  3ZG7 B;  1QME A;  1ONH A;  3WRT A;  3O5Y A;  2ZQ7 A;  2VA0 A;  1PNE A;  4PM5 A;  1MY8 A;  5AJG A;  5FQ9 A;  1F98 A;  4E3M A;  1MBL A;  4RX3 A;  3PYP A;  1J3W A;  4HP9 A;  1STZ A;  2XH9 A;  1YQS A;  5HAQ A;  4OPZ A;  3T4L A;  5A91 A;  1BYW A;  1H3Q A;  3L9K A;  3IX3 A;  4GS9 A;  1OTA A;  2V1Z A;  3HLD A;  2JBF A;  1SZV A;  5MC7 A;  4L0L A;  2ZM8 A;  4HQA A;  1XJ2 A;  3F1P B;  4YNR A;  3KSH A;  5DKK A;  3HUO A;  2J3T D;  4WZ4 A;  3T12 B;  4EQ1 A;  2XSS A;  3CUE C;  5FQI A;  2JC7 A;  1FSW A;  1VHM A;  3CAX A;  5HDC A;  3BLM A;  2QYB A;  5FL3 A;  3OC2 A;  2Y2J A;  3KO6 A;  5IS1 A;  5FDH A;  2FFF B;  2X71 A;  1KDS A;  1VB6 A;  3A0S A;  3T4Q A;  1PI4 A;  2AVX A;  1XP4 A;  2KOI A;  1ES2 A;  1TS6 A;  2V0W A;  1PYY A;  5HX9 A;  1LT0 A;  2HF6 A;  1IYQ A;  3CMZ A;  1JTD A;  5FAT A;  4LCL A;  1L3L A;  3OPL A;  5GLD A;  1MPL A;  1NJ4 A;  1NRF A;  4JPM A;  2I9V A;  4E6W A;  3LIE A;  3HBR A;  2PU4 A;  4O7D A;  2QMI A;  2WZZ A;  1ZHH B;  3A3E A;  3IF6 C;  4E3I A;  3UNW A;  3IF6 B;  3SH7 A;  4Z9Q A;  4ZJ2 A;  3CLO A;  5CXW A;  1XXM A;  3NJA A;  3N4I A;  4X6T A;  2Z2M B;  3IT9 A;  1L0D A;  2P74 A;  5GHY A;  1XA1 A;  1KE4 A;  1VET A;  4OPY A;  4UA9 A;  5U47 A;  4I3J A;  4KZ7 A;  1MZU A;  4KZ3 A;  5G4Y A;  3ZVT A;  4Y17 A;  2XD1 A;  3FG8 A;  3QP8 A;  4L9F A;  4R4S A;  3C8C A;  3G32 A;  4ZTK A;  1NZU A;  5J8X A;  4D60 A;  3O87 A;  2WGV A;  3VSL A;  4JXG A;  4E3L A;  4WEL A;  5DTT A;  4P6Z M;  3RFB A;  5HFO A;  2V8C A;  2ZLY A;  3OPH A;  3UPN A;  2ZC7 A;  3A0V A;  4ZJ3 A;  2JKT M;  3KSG A;  4FUW A;  1ZKJ A;  2D01 A;  4OPQ A;  1M40 A;  2OLU A;  3QHY A;  4M4X A;  3TE8 A;  4CQH A;  1N4O A;  1BZA A;  2P08 A;  3BLS A;  5AQA A;  3P01 A;  1ZG6 A;  1FCM A;  5F6A A;  1IYP A;  1D06 A;  3VE4 A;  1Y54 A;  2Q0O A;  1XKZ A;  3BM6 A;  3BQ8 A;  2R9X A;  3R4K A;  3N8S A;  4MNR A;  4UAA A;  4ZDX A;  1XJ6 A;  3BEB A;  5I94 A;  4OOL A;  2VV7 A;  4WZ5 A;  3HLC A;  3LGO A;  5FSR A;  3B33 A;  3WS1 A;  2ZQ9 A;  3M2K A;  1H0M A;  2WZX A;  2YKF A;  3ZYT A;  2OAQ 1;  3KSI A;  5E43 A;  1PZP A;  4LV2 A;  4DE2 A;  3IH9 A;  3CJM A;  4RX2 A;  2OWJ A;  3B42 A;  5G4Z A;  3UDX A;  2WKR A;  2ZBB A;  4A5R A;  5HWW A;  2HZ5 A;  4X25 A;  5DTK A;  1CI8 A;  3N8L A;  4K91 A;  4WUJ A;  4E3K A;  1PRQ A;  2X02 A;  1PWC A;  3AGD A;  4HJ4 A;  2OLV A;  1F9I A;  3ZNT A;  4LRY C;  4E6X A;  2WAD A;  4Y2F A;  1K6S A;  2PD8 A;  2B18 A;  3LI8 A;  4KUO A;  4Y5F A;  5HPI A;  3VP4 A;  1GSW A;  1P9W A;  4DDS A;  1KGG A;  1HLU P;  4C6Y A;  1CEG A;  1MWR A;  2QPN A;  2EFX A;  3TJZ C;  3BFF A;  3P98 A;  3VP2 A;  4RA7 A;  3F1N A;  4K0W A;  4S2P A;  4DF6 A;  1A0K A;  4M3K A;  1YMX A;  2VLG A;  3E98 A;  5HZH A;  2MJ6 A;  4PHT A;  2ZL1 B;  1K54 C;  1G28 A;  1K4F A;  3IWI A;  4F3L A;  4JGQ A;  4BD0 A;  2QZ6 A;  4HOI A;  5CGX A;  5AVF A;  5E2H A;  4XT2 A;  1Y4O A;  4KZB A;  4R4R A;  3ZDJ A;  3VOZ A;  2EXB A;  3EWK A;  2A49 A;  5TGF A;  1ERM A;  3LO7 A;  3QP2 A;  1K57 C;  2J9O A;  3NBL A;  2IWB A;  1MKI A;  1D1J A;  1J9M A;  1FOF A;  4JGR A;  4EU0 A;  3VV4 A;  1DY6 A;  1LSV A;  3JVV A;  3LR0 A;  4HEF A;  4K0X A;  4UQI M;  4LRZ E;  5CEB A;  1BLS A;  1SDE A;  3CHW P;  3UPP A;  3OCN A;  2VKS A;  3UE3 A;  3NI9 A;  5HW3 A;  2HDR A;  4S2O A;  3QP6 A;  1JWV A;  5HAI A;  4UQI S;  1BTL A;  2RCX A;  5A92 A;  2O9A A;  2Y59 A;  3PHY A;  3ZNY A;  3T1X A;  3CUE A;  2HJ9 C;  3E2K A;  3A0R A;  1YLW A;  2PBY A;  3PBN A;  4OH0 A;  3VMA A;  4BL2 A;  2V8F A;  2HDU A;  2OOL A;  3LIB A;  3HJI A;  1PZO A;  2PAV P;  3N6I A;  3W4P A;  3TW8 A;  3W2Z A;  5FI6 A;  4I3I A;  2WKQ A;  5AQB A;  1CK3 A;  1W8Q A;  2ZM0 A;  4Y15 A;  5I5L A;  1OPX A;  1OTE A;  1IKG A;  1S4R A;  5K5B A;  4KQQ A;  2RL3 A;  3B3X A;  4Y0O A;  1T18 A;  1KDW A;  3OOV A;  5FEG A;  5EUA A;  3NY4 A;  3BY9 A;  4QY6 A;  2O9C A;  1TDL A;  2C6W B;  1W8Y A;  3IF6 A;  5GHZ A;  4ID4 A;  3SH8 A;  4LFU A;  4S2J A;  2XQZ A;  4WYY A;  2KDK A;  5EFW A;  2FZ0 A;  4G3W A;  4I38 A;  3S22 A;  2ZOI A;  3RTY A;  2WGW B;  3T1R A;  3ZG0 A;  4YWZ A;  2GZA A;  1SKO A;  3S4X A;  1W63 M;  1XGI A;  5FQM A;  3PXP A;  4B4Z A;  3DTM A;  1WE4 A;  1NZO A;  2XFS A;  3UDI A;  3V5M A;  1E4D A;  4OLD A;  2NUT C;  2HPB A;  5FDS A;  4EWF A;  2EWV A;  1WYC A;  3MXS A;  3DWK A;  2ZMA A;  4PPR A;  1NXY A;  2P9V B;  1XJ4 A;  1K4E A;  3M6H A;  4DRT A;  1RGY A;  4LV3 A;  1JNU A;  1Q2Q A;  1QMF A;  3E4O A;  3T50 A;  3LI9 A;  2PHY A;  2FFY A;  2B95 A;  2KLI A;  4I5S A;  4WM9 A;  2XEP A;  4EBN A;  4P6B A;  1BUL A;  5CER A;  1KGE A;  1KVM A;  3CWF A;  2VJW A;  5GLA A;  1W7F A;  4BLM A;  1YLZ A;  5J7E A;  1LSW A;  3GEC A;  2KX6 A;  4WF0 A;  3MQQ A;  3QP4 A;  2G2W A;  2UV0 E;  2PT7 A;  1P97 A;  1OTB A;  4HP4 A;  5IT5 A;  3C30 A;  5M19 A;  3G2Z A;  2EA9 A;  3BW6 A;  4X69 A;  3FYZ A;  4KG5 A;  3PAG A;  1KVL A;  3VP1 A;  1YPR A;  3V3R A;  2LB5 A;  4X55 A;  3IXD A;  4NXE A;  5IHV A;  3CPT A;  4X68 A;  1TDG A;  4KG6 A;  4NET A;  4ARZ A;  1H5X A;  2JKG A;  2Z2L B;  1Z6F A;  1XFN A;  2R78 A;  3PBO A;  5CTN A;  4CLC D;  3UB7 A;  3UME A;  1YMS A;  5CHU A;  5DJU A;  3FPW A;  1YM1 A;  3BYD A;  3C2W A;  3LR4 A;  4I39 A;  1N9L A;  5C5K A;  4LGW A;  1T1A A;  2XA7 M;  1GSX A;  4R6L A;  2JKR I;  3PBR A;  3NUL A;  4GHI A;  4GDB A;  1CQA A;  2I72 A;  2Y2G A;  3C5A A;  4OLG A;  1HD8 A;  2ZC4 B;  4IBR A;  3G35 A;  3E4Q A;  1XJ3 A;  2LB9 A;  4GCZ A;  2XK1 A;  2G2U A;  2XA7 S;  1PWD A;  3HLF A;  2XDM A;  3EEA A;  2V9A A;  4P87 A;  3RXW A;  5KSH A;  4ETX A;  1KOU A;  4RYE A;  4OPR A;  1NWZ A;  5HSQ A;  1EW0 A;  2EX6 A;  4PMA A;  1NLY A;  1K54 A;  2ZC5 B;  3DAV A;  2W3E A;  4DE0 A;  4MLL A;  2V2F F;  5F1F A;  4EXO A;  4H8R A;  2DRW A;  1I2S A;  3TSG A;  3WRZ A;  4AFI A;  4GDN A;  4DMZ A;  1FIK A;  3LFV A;  4L9G A;  3NIA A;  4WMC D;  4KZ6 A;  3WS4 A;  2J8Y A;  3D9Y A;  4L9E A;  2XD5 A;  2R9W A;  4OON A;  3ZCZ A;  3Q07 A;  1TEM A;  3E2L A;  4H6J A;  3E4P A;  4OQG A;  1T19 A;  1CJF A;  1S1Y A;  2ZM2 A;  4DKI A;  4OQ0 A;  3LIC A;  4FH2 A;  1IEM A;  1ERQ A;  4X1L A;  4B93 A;  4ESP A;  5FEF A;  2V20 A;  5EE8 A;  3QNB A;  4MDZ A;  1YKD A;  4MMN A;  2W1T A;  4B4X A;  2VV6 A;  5DF8 A;  2O9B A;  2WKH A;  3T4T A;  4Q0I A;  1YLT A;  2VZW A;  4RQ9 A;  5EVI D;  1JTG A;  3PR6 A;  5L8M A;  3EQV A;  4PAU A;  1W5D A;  3PBT A;  2W1R A;  3VSK A;  2Y91 A;  3FKV A;  4ZJ1 A;  3UE6 A;  2J9P A;  1YLJ A;  5L10 A;  4FD8 A;  1ODV A;  5DFX A;  3JVU A;  4CLC A;  4DE3 A;  2DMW A;  1K55 C;  3FPV A;  1BSG A;  3ZGA B;  4EEU A;  2XRO A;  3LCE A;  1G5U A;  1EWZ A;  3UE1 A;  2BG1 A;  3VE3 A;  2M7V A;  3V67 A;  1S1Z A;  2JHE A;  3Q7V B;  1O7E A;  4JKT A;  1P9R A;  3SH9 A;  1UWP X;  3IS2 A;  3NOU C;  1ES3 A;  1XFQ A;  2HP6 A;  4P6Z S;  3R7W B;  1S0W A;  5DJT A;  2ZOH A;  5TBM B;  4GD6 A;  3MF0 A;  4PM8 A;  4RVA A;  1WA9 A;  4KZ9 A;  4NK3 A;  1GSV A;  1YAX A;  1PWG A;  4NG2 A;  4BMW A;  2Y2L A;  1PFL A;  2HGV A;  1G68 A;  2ZQC A;  2A24 B;  3IBR A;  5L09 A;  1ONG A;  2GNX A;  2WKI A;  3TOI A;  5FQK A;  2PU2 A;  1YLY A;  1LL9 A;  4DXC A;  3H82 B;  4C3Q A;  2HP5 A;  3MS6 A;  3T4S A;  3UPO A;  1FQG A;  3KSF A;  4U0T A;  3C38 A;  3IXH A;  1M6K A;  4UA7 A;  4O8G A;  3KYZ A;  3F1O A;  5F69 A;  4WMC A;  3LEQ A;  5GL9 A;  4BL3 A;  2O99 A;  1TF1 A;  2P9V A;  3MBZ A;  2L1M A;  1FCO A;  3G34 A;  3CI6 A;  3FV7 A;  2J80 A;  3C7V A;  2QJ5 A;  3IH8 A;  1IYO A;  1HTZ A;  3A3I A;  2G7U A;  3UB6 A;  4QD4 A;  1VM1 A;  1LI9 A;  4HJ6 A;  3UB9 A;  4WLA A;  5HL6 A;  1ES4 A;  4GD8 A;  1LSX A;  2W3G A;  4EER A;  2Y2H A;  4FH4 A;  1P0Z A;  4DXB A;  1L0F A;  1T1B A;  1YT4 A;  1NYM A;  2EX8 A;  3AGE A;  1ZG4 A;  3H7W B;  4R0Q A;  4N1H A;  5F1G A;  3BFD A;  2HDQ A;  3K2N A;  4O0P A;  1DJB A;  2ZMV A;  5EVI A;  2V1B A;  1DRM A;  4R70 A;  3A3F A;  3A3J A;  4BBV A;  5F83 A;  2A2L A;  4PKY G;  3WWX A;  1FR1 A;  3TG9 A;  4B9O A;  2XLN A;  2OAP 1;  1SDN A;  1BLH A;  5HDD A;  1Z09 A;  5AQ7 A;  3B47 A;  2PYP A;  3MFD A;  3IHA A;  2ZC3 B;  5CRF A;  1FR6 A;  1Y28 A;  4GJ4 A;  3AGF A;  4GKU A;  4QPR A;  4Y0U A;  4S2L A;  2E8I A;  5FAQ A;  2HDS A;  4MBK A;  4PM6 A;  3A3D A;  3WS5 A;  3NOT C;  4GLQ A;  3ZG8 B;  2Q9M A;  2BLS A;  2XF3 A;  5EPH A;  5AQ9 A;  2L4R A;  4R23 A;  1K0K A;  5BOH A;  2O0Y A;  4KZ5 A;  3E0Y A;  4XXR A;  1IOU A;  1C3B A;  1VQQ A;  4QWO A;  1H8M A;  2J3W A;  4EES A;  5D3O A;  4QY5 A;  3NEC A;  3ISG A;  3EGD C;  3CIT A;  2EWW A;  1L0E A;  1H8Z A;  4UHU A;  1PI5 A;  2ZQA A;  2WUQ A;  1KGF A;  3IXG A;  2PR5 A;  3F1P A;  5HL1 A;  3PTE A;  2M1C A;  4HES A;  5HWV A;  2V0U A;  2W27 A;  3ITB A;  3MR0 A;  2Z6C A;  1LL5 A;  2ZJ9 A;  4OOM A;  4JGO A;  1JWP A;  3EGX C;  3I7J A;  1EI5 A;  5GLB A;  3V50 A;  3HLW A;  1W79 A;  3WS2 A;  3GDI A;  5CEC A;  2X01 A;  4MN7 A;  1VET B;  2Y55 A;  2ACG A;  3OZH A;  1YSQ A;  1SHV A;  1MC0 A;  1MXO A;  4FOF A;  3DWZ A;  5CGS A;  5EEC A;  3PBS A;  4WBG A;  2EXA A;  4KZ4 A;  2DCF A;  1MWU A;  3GRJ A;  3SW1 A;  4KG2 A;  3OPR A;  3MZE A;  3BQA A;  3G4P A;  2H28 A;  3G30 A;  3JYI A;  1K56 D;  4JF4 A;  1VEU B;  2Y2O A;  5FI2 A;  4PM9 A;  1ERO A;  3ICY A;  1K25 A;  5M1A A;  4QJG A;  4DDY A;  3DTE A;  3SZT A;  1V9Z A;  3U2A A;  3IXB A;  3NC8 A;  3SS5 A;  1FSY A;  4EW7 A;  4JXW A;  3NDE A;  1WYB A;  2M7U A;  4BJP A;  5F5Y A;  4LCM A;  1NY0 A;  3MJQ A;  3W4O A;  5JYO A;  2B02 A;  4BBU A;  2GDN A;  4IVI A;  4E3N A;  1MKM A;  1YSP A;  1XA7 A;  1IEL A;  2JKT I;  2VGK A;  4BWI A;  3LYX A;  5EOE A;  1E25 A;  3Q7V A;  1ALQ A;  2BTF P;  4EET B;  5HWT A;  4NEE D;  3MXR A;  3DTK A;  4IUH A;  4R1G A;  4LLO B;  4C75 A;  3BFG A;  4XUX A;  4S2I A;  4I3A A;  5J3W A;  2QKP A;  1AXB A;  3T4J A;  4Q0J A;  1UWN X;  1OME A;  4BD1 A;  3NCK A;  3HLG A;  2ZMF A;  3VP3 A;  2Y2M A;  2DNS A;  4HNB A;  1OTD A;  3MKF A;  2QHK A;  3GMW A;  3S1Y A;  4WL9 A;  3BEC A;  2PR6 A;  3Q81 A;  1X0O A;  1SCW A;  2WGI A;  2Y4A A;  4Y13 A;  2IA2 A;  4GOG A;  4DJ2 A;  3ZHH A;  1F2K A;  3ZQ5 A;  4LV1 A;  2XFT A;  1N9O A;  4IED A;  4JF5 A;  4GW9 A;  3CG5 A;  1TS8 A;  5G18 A;  4QU3 A;  4OQI A;  3OBF A;  2Y2Q A;  3QP5 A;  3F1N B;  4CJN A;  4R38 A;  4D2O A;  1AWI A;  1TD5 A;  4S2N C;  2B5R A;  4ZRR A;  4S2K A;  4EBL A;  4F3L B;  3V39 A;  3VOY A;  2P7J A;  4CLC E;  4XT2 B;  1K56 A;  3LID A;  4FSF A;  1OTI A;  4CPK A;  3K3D A;  4HIA A;  4BBT A;  3SS4 A;  3VFF A;  4OVD A;  1XPB A;  2FH5 A;  5EOO A;  1N9N A;  2H0T A;  4PKY A;  3BY8 A;  1OT9 A;  3N7W A;  1ES5 A;  4QHC A;  3MSH A;  3ZG5 A;  2ZL1 A;  2D02 A;  1NRJ A;  4GB7 A;  5TJJ A;  2VGJ A;  1MWT A;  3GQZ A;  3RH8 B;  3KYQ A;  4IBX A;  3LUQ A;  1DJA A;  3D72 A;  2ZD8 A;  3MXQ A;  4BQM A;  3BWL A;  4N9K A;  5KMW A;  2JKF A;  4KZA A;  4WN5 A;  1K57 A;  1DJC A;  5TR7 A;  4X1M A;  1ZTU A;  2W0N A;  4EUV A;  2PD7 A;  3T4O A;  1W63 Q;  2WK0 A;  3C4O A;  5E2E A;  3NDG A;  3OCL A;  2HP9 A;  3ZG9 B;  4NKP A;  3HLB A;  3G6O A;  1F5M A;  1S67 L;  2CC1 A;  2IWD A;  2IWC A;  5EVE A;  1E3U A;  3MQ0 A;  5FI7 A;  4MCW A;  1GHM A;  3VFH A;  5HD3 A;  5A90 A;  5FAO A;  4KQR A;  5DKL A;  2PYR A;  5FAP A;  3FKW A;  2EFU A;  4R3A A;  4DE1 A;  5EM1 A;  4NXB A;  1RGZ A;  2JE5 A;  4QB8 A;  4N92 A;  1DP9 A;  4EQI A;  2K7S A;  1SKO B;  4ME4 A;  5L2F A;  1BLC A;  3W8K A;  5KIZ A;  4KUK A;  1NLZ A;  3VOL A;  3HJK A;  1OJ5 A;  3MZF A;  1GA9 A;  4IHQ A;  3DW0 A;  3UB8 A;  4MBH A;  5DFY A;  5DF7 A;  2UWX A;  1FIL A;  3GV9 A;  1FCN A;  3EOI A;  2W3D A;  4XUZ A;  2WKE A;  3LIF A;  1VEU A;  1DP8 A;  3LR3 A;  2Y8H A;  5KSC A;  2WGW A;  4U3T A;  5HDS A;  5DVA A;  1IFQ A;  3OLO A;  3DBA A;  3QNC A;  4HBU A;  4KEN B;  5KZH A;  3K3C A;  4HY8 A;  1JVJ A;  3UE0 A;  4EV4 A;  4Q0H A;  5CED A;  1SKF A;  2YKH A;  4U0X A;  4P0M A;  1UGU A;  1T1C A;  1XX2 A;  3FWL A;  5GHX A;  3M2J A;  3KYE A;  4S2M A;  5CTM A;  3DTI A;  2XGN A;  2H5S A;  2Y79 A;  3QP1 A;  3LY3 A;  5GLC A;  3KX0 X;  1ACF A;  1BT5 A;  4YIN A;  4X56 A;  3U4L P;  2HV1 A;  4DN0 A;  5EV0 A;  4PM7 A;  3BFE A;  3NOP C;  5IU1 A;  3CPT B;  4R3J A;  3ZVW A;  4MBF A;  2VEA A;  4ARZ B;  4LV0 A;  3JPU A;  4HJ3 A;  4JXV A;  4FCF A;  3IWQ A;  1TS0 A;  2K2N A;  4Y7P A;  4R3B A;  1S4S A;  2QJ7 A;  5M18 A;  4ZAM A;  1HZO A;  1TVF A;  4MN6 A;  3LIA A;  1GHI A;  4IUK A;  3IWO A;  3BRM A;  1LI0 A; 
#chains in the Genus database with same CATH homology
 2ZQD A;  1YMS A;  3MKE A;  4KG2 A;  3OPR A;  5CHU A;  3MZE A;  1GCE A;  1YM1 A;  4KZ7 A;  1ZC2 A;  3BYD A;  4KZ3 A;  3ZVT A;  3G4P A;  3G30 A;  2XD1 A;  3JYI A;  4R4S A;  4GN2 A;  1PW8 A;  4F94 A;  3EQU A;  3G32 A;  4ZTK A;  1K56 D;  1NZU A;  3W4Q A;  4E3J A;  5J8X A;  4JF4 A;  3O87 A;  3V3S A;  4JXS A;  2WGV A;  2OV5 A;  2Y2O A;  3PBR A;  5CHJ A;  4PM9 A;  1ERO A;  5FI2 A;  3VSL A;  4GDB A;  3UDF A;  4JXG A;  1K25 A;  2WAE A;  4IVK A;  4E3L A;  2I72 A;  4WEL A;  2Y2G A;  3C5A A;  5DTT A;  5M1A A;  3RJU A;  4QJG A;  4OLG A;  4DDY A;  3UN7 A;  1HD8 A;  2ZC4 B;  3O88 A;  4IBR A;  4Q8I A;  3G35 A;  5DF9 A;  5HFO A;  2C5W B;  3Q82 A;  3IXB A;  3NC8 A;  2ZLY A;  3D4F A;  1LHY A;  3SS5 A;  1FSY A;  3OPH A;  2XK1 A;  2G2U A;  3IF5 A;  4S2N A;  3UPN A;  2ZC7 A;  4JXW A;  3NDE A;  1WYB A;  1PWD A;  4ZJ3 A;  4BJP A;  3HLF A;  2XDM A;  4LCM A;  1NY0 A;  3W4O A;  5JYO A;  4P87 A;  4OP8 A;  3RXW A;  5KSH A;  1U60 A;  3UO9 A;  1ZKJ A;  4OPQ A;  1L0G A;  2GDN A;  4IVI A;  4E3N A;  1M40 A;  2OLU A;  3QHY A;  4RYE A;  3ITA A;  4OPR A;  1N4O A;  4UA6 A;  1XA7 A;  3LEZ A;  1IEL A;  1BZA A;  2VGK A;  3O3V A;  5EOE A;  2EX6 A;  1E25 A;  4PMA A;  3Q7V A;  3BLS A;  1ALQ A;  1HVB A;  5AQA A;  1ZG6 A;  5F82 A;  1GHP A;  1FCM A;  1K54 A;  2ZC5 B;  3MXR A;  1S6R A;  1IYP A;  4C75 A;  2WAF A;  4R1G A;  1Y54 A;  3PAE A;  4MLL A;  2V2F F;  4DE0 A;  5F1F A;  5JYP A;  2XR0 A;  3BFG A;  4XUX A;  4H8R A;  1XKZ A;  3BM6 A;  2DRW A;  2R9X A;  1I2S A;  3PBQ A;  4GNU A;  4LEN A;  4S2I A;  3TSG A;  3WRZ A;  2JCH A;  4EBP A;  2Y2N A;  3N8R A;  4GDN A;  5DTS A;  3N8S A;  4MNR A;  4UAA A;  4ZDX A;  3BEB A;  1ESI A;  1LLB A;  4OQH A;  5I94 A;  1AXB A;  3NIA A;  1K38 A;  4WMC D;  1OME A;  4BD1 A;  4OOL A;  4KZ6 A;  3NCK A;  2ZC6 B;  2J8Y A;  4WZ5 A;  3HLG A;  3WS4 A;  3HUN A;  3HLC A;  4JBF A;  5FSR A;  2XD5 A;  1L2S A;  3LY4 A;  3WS1 A;  2ZQ9 A;  4B88 A;  3M2K A;  5E2F A;  2R9W A;  4OON A;  3VP3 A;  3ZCZ A;  2Y2M A;  3HLE A;  3Q07 A;  1TEM A;  2DNS A;  3E2L A;  4OP5 A;  2WZX A;  2OSU A;  4OQG A;  3Q1F A;  3MKF A;  5E43 A;  2ZM2 A;  3GMW A;  1PZP A;  2Y2K A;  4LV2 A;  3S1Y A;  4DE2 A;  4DKI A;  4WEK A;  3IH9 A;  3IHB A;  2EX2 A;  3BEC A;  4OQ0 A;  3CJM A;  3Q81 A;  1O07 A;  4RX2 A;  4FH2 A;  1Q2P A;  1IEM A;  1SCW A;  2H0Y A;  2WGI A;  3GR2 A;  1ERQ A;  3UDX A;  4E3O A;  2V20 A;  4N9L A;  5EE8 A;  3QNB A;  2Y4A A;  3HVF A;  4A5R A;  4B4X A;  4UA9 A;  5DTK A;  5DF8 A;  1KE0 A;  1CI8 A;  1IYS A;  3N8L A;  4GOG A;  4K91 A;  2WKH A;  1CEF A;  1KE3 A;  3UY6 A;  3ZHH A;  1YLP A;  4E3K A;  1YLT A;  2X02 A;  1PWC A;  4EUZ A;  3AGD A;  5CHM A;  4LV1 A;  2XFT A;  5EVI D;  2OLV A;  4IED A;  4X53 A;  1JTG A;  4JF5 A;  3CZD A;  3ZNT A;  3CG5 A;  3EQV A;  2Y2I A;  4E6X A;  2WAD A;  5FQQ A;  5G18 A;  1W5D A;  4QU3 A;  1K6S A;  3PBT A;  4OQI A;  2Y2Q A;  3VSK A;  2Y91 A;  4HBT A;  3FKV A;  3VP4 A;  4ZJ1 A;  4CJN A;  2J9P A;  1YLJ A;  4KQO A;  4DDS A;  1KGG A;  4D2O A;  2H10 A;  4FD8 A;  4C6Y A;  1CEG A;  1MWR A;  4S2N C;  1BUE A;  2B5R A;  2QPN A;  1PW1 A;  3HUM A;  2EFX A;  3O86 A;  4S2K A;  3GTC A;  4DE3 A;  4EBL A;  4MEZ A;  1K55 C;  3V39 A;  3BFF A;  3P98 A;  3VP2 A;  3VOY A;  1BSG A;  3ZGA B;  1RCJ A;  3LCE A;  4RA7 A;  4K0W A;  3G2Y A;  4JF6 A;  4OOY A;  4S2P A;  1EWZ A;  4DF6 A;  1K56 A;  3SOI A;  4M3K A;  3UE1 A;  2Y2P A;  2BG1 A;  1RP5 A;  5TFQ A;  4KZ8 A;  1YMX A;  4FSF A;  4CPK A;  1K54 C;  1K4F A;  3Q7V B;  3IWI A;  4BD0 A;  1O7E A;  4JKT A;  3SS4 A;  3VFF A;  2QZ6 A;  4OVD A;  1XPB A;  3SH9 A;  5EOO A;  5CGX A;  1XGJ A;  5E2H A;  1K55 A;  1ES3 A;  2H0T A;  5EVL A;  2HP6 A;  1S0W A;  4KZB A;  4N1X A;  4R4R A;  4GD6 A;  3N7W A;  4PM8 A;  3ZDJ A;  1ES5 A;  4RVA A;  1H8Y A;  4QHC A;  3ZG5 A;  3VOZ A;  3GVB A;  4KZ9 A;  2EXB A;  4NK3 A;  4WEJ A;  3BFC A;  4GB7 A;  1PWG A;  2A49 A;  2VGJ A;  5TGF A;  1MWT A;  4WZ5 C;  2Y2L A;  1ERM A;  5FAS A;  3LO7 A;  3GQZ A;  1K57 C;  2J9O A;  3NBL A;  2IWB A;  1G68 A;  2ZQC A;  4IBX A;  5CGW A;  1MKI A;  1J9M A;  1FOF A;  1DY6 A;  1ONG A;  3C7U A;  2WKI A;  3TOI A;  1DJA A;  4HEF A;  4K0X A;  5FQK A;  2PU2 A;  5CEB A;  1YLY A;  1LL9 A;  2ZD8 A;  4BQM A;  4DXC A;  1BLS A;  1SDE A;  3UPP A;  4JLF A;  3OCN A;  3M6B A;  4GZB A;  4C3Q A;  2HP5 A;  3MZD A;  4N9K A;  3UPO A;  5KMW A;  4KZA A;  1FQG A;  4U0T A;  3UE3 A;  3NI9 A;  3IXH A;  5HW3 A;  5HAR A;  3C4P A;  1K57 A;  1DJC A;  1M6K A;  4UA7 A;  1BLP A;  5TR7 A;  2HDR A;  1IKI A;  4S2O A;  3IQA A;  2Q9N A;  4P85 A;  3GSG A;  1JWV A;  5HAI A;  1BTL A;  1I5Q A;  3P09 A;  2RCX A;  5A92 A;  4WMC A;  5GL9 A;  4BL3 A;  2Y59 A;  3WS0 A;  1NYY A;  2P9V A;  3MBZ A;  3ZNY A;  1JWZ A;  1PIO A;  1FCO A;  3ZFZ A;  3G34 A;  3E2K A;  2WK0 A;  3FV7 A;  5E2G A;  3C7V A;  1K6R A;  1YLW A;  3C4O A;  2PBY A;  3PBN A;  4OH0 A;  1MWS A;  3IH8 A;  5E2E A;  1IYO A;  1HTZ A;  3NDG A;  2HP9 A;  3A3I A;  3OCL A;  3VMA A;  4BL2 A;  3ZG9 B;  2HDU A;  3VP0 A;  4QD4 A;  1VM1 A;  3HLB A;  1LI9 A;  1PZO A;  5FQJ A;  1E3U D;  3N6I A;  5FA7 A;  5EVI C;  3OPP A;  1ES4 A;  4GD8 A;  3W4P A;  3RXX A;  2A3U A;  5FI6 A;  5HAP A;  3Q7Z A;  1ESU A;  2WYX A;  5EVI B;  2CC1 A;  5AQB A;  2IWD A;  1CK3 A;  1W8Q A;  2J7V A;  2IWC A;  2Y2H A;  2ZQ8 A;  4FH4 A;  2EX9 A;  2ZM0 A;  1E3U A;  1L0F A;  4ZBE A;  4DXB A;  1YT4 A;  5FI7 A;  1IKG A;  1NYM A;  2EX8 A;  1I2W A;  3FZC A;  4KQQ A;  1CI9 A;  3AGE A;  1ZG4 A;  3HRE A;  4BEN A;  1GHM A;  4R0Q A;  2RL3 A;  4YFM A;  3B3X A;  3VFH A;  4N1H A;  4Y0O A;  5F1G A;  3G31 A;  3BFD A;  5A90 A;  2HDQ A;  1KDW A;  5FAO A;  4Y0T A;  5EUA A;  1DJB A;  3HL9 A;  4KQR A;  5EVI A;  3NY4 A;  5FAP A;  4QY6 A;  3FKW A;  2EFU A;  1G6A A;  4DE1 A;  1N9B A;  3A3F A;  1TDL A;  3A3J A;  2C6W B;  3SS3 A;  1GA0 A;  4OKP A;  5F83 A;  1RGZ A;  1W8Y A;  3WWX A;  5A93 A;  2JE5 A;  3IF6 A;  1FR1 A;  4QB8 A;  3TG9 A;  5GHZ A;  4ID4 A;  3SH8 A;  3ZG7 B;  4N92 A;  1QME A;  4S2J A;  2XLN A;  1ONH A;  3WRT A;  4EQI A;  2XQZ A;  4WYY A;  5L2F A;  1BLC A;  1SDN A;  2ZQ7 A;  1BLH A;  3W8K A;  5AQ7 A;  4PM5 A;  1MY8 A;  3S22 A;  3MFD A;  3MZF A;  3IHA A;  5FQ9 A;  1GA9 A;  2ZC3 B;  4E3M A;  5CRF A;  1FR6 A;  1MBL A;  4RX3 A;  2WGW B;  3DW0 A;  3AGF A;  4GKU A;  4Y0U A;  3ZG0 A;  4S2L A;  2E8I A;  5FAQ A;  2HDS A;  4MBK A;  2XH9 A;  1YQS A;  5HAQ A;  4OPZ A;  4PM6 A;  3A3D A;  4MBH A;  3WS5 A;  3S4X A;  5DF7 A;  2UWX A;  3ZG8 B;  2Q9M A;  2BLS A;  2XF3 A;  3GV9 A;  1FCN A;  1XGI A;  5FQM A;  5A91 A;  5EPH A;  5AQ9 A;  4XUZ A;  2WKE A;  4R23 A;  4B4Z A;  3DTM A;  5KSC A;  2WGW A;  5BOH A;  4U3T A;  5DVA A;  1WE4 A;  4KZ5 A;  2V1Z A;  1NZO A;  2XFS A;  3HLD A;  4XXR A;  1E4D A;  2JBF A;  3QNC A;  3UDI A;  3V5M A;  4HBU A;  4OLD A;  4L0L A;  2HPB A;  2ZM8 A;  4KEN B;  5KZH A;  1C3B A;  4EWF A;  1VQQ A;  1JVJ A;  3UE0 A;  4EV4 A;  5CED A;  1WYC A;  1SKF A;  3MXS A;  3DWK A;  3HUO A;  2ZMA A;  4QY5 A;  4WZ4 A;  5D3O A;  3ISG A;  4PPR A;  4U0X A;  1NXY A;  4P0M A;  5FQI A;  2JC7 A;  1FSW A;  2P9V B;  3BLM A;  1K4E A;  1XX2 A;  3FWL A;  1L0E A;  3M6H A;  4DRT A;  1RGY A;  5GHX A;  3OC2 A;  1H8Z A;  2Y2J A;  4LV3 A;  4UHU A;  1PI5 A;  3M2J A;  4S2M A;  5FDH A;  1Q2Q A;  1QMF A;  2ZQA A;  5CTM A;  2WUQ A;  2FFF B;  2X71 A;  1KDS A;  1KGF A;  3IXG A;  5HL1 A;  1PI4 A;  2FFY A;  1XP4 A;  2XGN A;  4EBN A;  2XEP A;  1ES2 A;  3PTE A;  4WM9 A;  1BUL A;  2H5S A;  4P6B A;  1PYY A;  3LY3 A;  4HES A;  5CER A;  5GLC A;  1KGE A;  1BT5 A;  3ITB A;  4YIN A;  5HX9 A;  1KVM A;  4X56 A;  1IYQ A;  5GLA A;  3CMZ A;  1W7F A;  4BLM A;  1JTD A;  1YLZ A;  1LL5 A;  5FAT A;  2ZJ9 A;  4LCL A;  4OOM A;  3OPL A;  4PM7 A;  5GLD A;  2G2W A;  1MPL A;  1JWP A;  3BFE A;  1NJ4 A;  3I7J A;  1EI5 A;  5GLB A;  1NRF A;  4JPM A;  3V50 A;  4E6W A;  3HLW A;  5M19 A;  3HBR A;  2PU4 A;  4R3J A;  4O7D A;  1W79 A;  3WS2 A;  3G2Z A;  3ZVW A;  4MBF A;  2QMI A;  5CEC A;  4LV0 A;  4X69 A;  2WZZ A;  3A3E A;  3FYZ A;  4KG5 A;  3IF6 C;  2X01 A;  3PAG A;  1KVL A;  4JXV A;  3VP1 A;  2Y55 A;  4FCF A;  3V3R A;  4E3I A;  3UNW A;  3OZH A;  3IF6 B;  4X55 A;  3IWQ A;  3IXD A;  3SH7 A;  4Z9Q A;  5IHV A;  4ZJ2 A;  4X68 A;  5CXW A;  1XXM A;  3N4I A;  1SHV A;  4R3B A;  1MXO A;  1TDG A;  4KG6 A;  4X6T A;  4Y7P A;  4NET A;  3DWZ A;  5CGS A;  5M18 A;  2Z2M B;  3IT9 A;  5EEC A;  4ZAM A;  1HZO A;  3PBS A;  1TVF A;  1L0D A;  2P74 A;  1H5X A;  5GHY A;  4WBG A;  2EXA A;  1GHI A;  1KE4 A;  1XA1 A;  2Z2L B;  4KZ4 A;  1Z6F A;  3IWO A;  3PBO A;  5CTN A;  2DCF A;  3BRM A;  4OPY A;  1MWU A;  3GRJ A;  5U47 A;  1LI0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...