1OTBA

Wild type photoactive yellow protein, p63 at 295k
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
125
structure length
125
Chain Sequence
MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photoactive yellow protein
publication title Short hydrogen bonds in photoactive yellow protein.
pubmed doi rcsb
source organism Halorhodospira halophila
molecule tags Signaling protein
total genus 37
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2003-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1otbA00
2GJ3A 1LSXA 3NOTC 3F1OA 3EEHA 1OT6A 3MFXA 3LI9A 1F98A 2BASA 1Y28A 4B9OA 5IS1A 4EEUA 1DP9A 2PHYA 5DJTA 3GDIA 2OWHA 1LSVA 1TS7A 4KUKA 4R6LA 3F1NB 4EQ1A 1S66L 4GW9A 1OTDA 1WA9A 4XT2A 1D06A 3LIAA 4MN6A 1GSWA 1LT0A 3BY9A 4KUOA 3NJAA 1N9OA 1N9LA 2WKQA 4R3AA 4LLOB 5AVFA 2CMNA 3KX0X 3IS2A 1DP8A 4DJ2A 1P0ZA 4L9GA 2PYPA 3LIFA 2V0WA 3UB9A 4GS9B 2W0NA 2PR5A 4HHDA 5HD5A 1MZUA 4GHIB 3VE3A 3NHQA 1EW0A 2OWJA 1NWZA 4DJ3A 2R78A 4BBTA 3E4OA 5KIZA 1XFNA 2V9AA 4HJ4A 4H6JA 3NOUC 3F1OB 2OOLA 3H82B 4PKYA 2WKPA 2D02A 2PYRA 1JNUA 2VEAA 2J80A 4BBUA 3FG8A 2L0WA 2V0UA 5F6AA 2P7JA 5HWTA 2YKFA 1OTAA 3CLOA 3VOLA 3LI8A 4I3JA 3UE6A 1OT9A 5HWWA 2ZOIA 5DKLA 5J7EA 4XT2B 4KQDA 1T1AA 2WKRA 1XJ2A 4NXBA 4HOIA 2QHKA 3P7NA 1T1CA 4LRZE 4GCZA 1S4SA 2QWSA 4K08A 5F68A 3IS2B 5HD3A 5DKKA 1KOUA 3EWKA 3MQQA 5AVEA 4LRXC 3H82A 3PYPA 3UB8A 1TS0A 3E4QA 2PR6A 3F1PA 2Z6CA 3UMDA 4H6JB 1V9YA 1OJ5A 1T19A 1D7EA 3BY8A 4HJ6A 4JGQA 4EESA 1XJ3A 4EXOA 3T50A 5F69A 4RQ9A 1F9IA 3UB6A 1OTIA 4I3IA 2PD8A 4PKYG 2Z6DA 4WF0A 3IBRA 3VE4A 3HJKA 2D01A 4WUJA 5HDSA 4R70A 3HJIA 3ULFA 1GSVA 1S4RA 2VV8A 1T18A 2L4RA 2KDKA 1UWPX 1DP6A 4E04A 4L9FA 2VV6A 5G4YA 3MXQA 4WLAA 2PDRA 2VLGA 1LL8A 4WL9A 5A8BA 4HI4A 1S1ZA 4EEPA 3H7WB 5HWVA 5HDCA 1LSWA 5G4ZA 2JHEA 2A24B 3F1PB 1V9ZA 1GSXA 5IU1A 3LYXA 4JGRA 4NXFA 3H9WA 4EETB 5EFWA 1X0OA 2KX6A 1XFQA 1UGUA 1BYWA 4F3LA 2H28A 2QKPA 2VV7A 4LRYC 1OJGA 3A0SA 1XJ6A 2L1MA 3H7WA 3C2WA 3B33A 1VB6A 3K3CA 2QJ5A 2A24A 1T1BA 4JGOA 1S67L 4MN5A 2M1CA 1XJ4A 5DJUA 1TS8A 3ICYA 4I5SA 4EW7A 1P97A 4I39A 4EERA 4HP4A 3BWLA 2V1AA 3MR0A 2INWA 2HV1A 5TBMA 2ZBBA 3MQOA 4HIAA 3PHYA 5HZHA 5I5LA 2K7SA 3MJQA 1OTEA 4HH3A 3SW1A 4NXGA 3LUQA 4BBVA 3RTYA 2ZOHA 3RH8B 4JGPA 3ZQ5A 4L9EA 4R38A 3CAXA 4YWZA 3LIBA 2EA9A 4F3LB 2I9VA 3OLOA 4LPZA 3G6OA 2W27A 4HQAA 3FC7A 3K3DA 4I3AA 5HSQA 3CWFA 1UWNX 5J4EA 3C8CA 2JN7A 4HJ3A 3F1NA 3A0VA 2PD7A 4HH2A 1N9NA 3NOPC 3A0RA 3LIEA 3GECA 1DRMA 5J3WA 1TS6A 2QJ7A 2B02A 4M4XA 2V1BA 3UMEA 3UB7A 4WN5A 5HDDA 4HP9A 4I38A 1S1YA 5TBMB 3LICA 3D72A 1OTBA 4GS9A 4HY8A 3E4PA 4GHIA 3LIDA 4NXEA 4HNBA 1G28A 2YKHA 1ODVA 5F5YA
chains in the Genus database with same CATH superfamily
2E8IA 3HLWA 5CGSA 4G3WA 2W1TB 3F1OA 1F5MA 1OT6A 2PBYA 5KSHA 1F98A 3P09A 4E3KA 4DE0A 3RJUA 4PM6A 3Q82A 2O9CA 5HL6A 5FASA 5KMWA 5DJTA 1K55A 3PBSA 1ESUA 2HDSA 3KYQA 1LSVA 1Q2QA 1TS7A 4HBTA 3F1NB 3HVFA 1GHPA 5EVIC 4KZAA 2WAFA 1FCOA 4U0XA 4XT2A 4UAAA 2MJ6A 3EGDC 4LV3A 4CLCA 1H3QA 4BENA 4KUOA 3ITAA 1N9OA 4LV0A 5DTKA 4P87A 4DE1A 5FATA 1KVMA 2XF3A 4R3AA 1K6RA 3E2KA 4WZ5A 4R3JA 2CMNA 4FD8A 2ZD8A 3UB9A 4OQHA 1NRJA 4GS9B 1SKOA 1C3BA 1BZAA 4GHIB 2WUQA 2JKRM 1M40A 1NWZA 3IHAA 4QY6A 4HBUA 4MLLA 3NULA 2ZC6B 4JF4A 1J3WA 1PWGA 3FPWA 3FWLA 4N9LA 3O86A 3T4LA 3IBJA 1H8YA 2PYRA 4BBUA 2VEAA 2J80A 4O8GA 5A90A 2L0WA 1ONHA 5EOOA 3AGEA 3PBTA 3QP8A 4RVAA 2YKFA 1BSGA 3OPHA 2W3HA 1ZHHB 1OT9A 1LI9A 2IA2A 4KQDA 5EM1A 5GLCA 2J3TC 2XGNA 4K0XA 2AVXA 2GZAA 1T1CA 3WS1A 4D2OA 3DTMA 5AQ9A 2QWSA 3BQAA 1SCWA 2ZM8A 3NIAA 1ERQA 3IS2B 4LRXC 1ZG4A 3P01A 1AXBA 3VP2A 4GKUA 3AGFA 3UB8A 3JVVA 3HL9A 3VOZA 1D1JA 3N8RA 4CLCE 3NDEA 3F1PA 1ES3A 4B4ZA 4H6JB 1V9YA 3MSHA 4WEKA 2HP5A 2ZQ8A 1BLSA 4G3VA 1NYYA 3U2AA 1D7EA 4ZJ3A 3PR6A 4EXOA 4JXSA 3C38A 1F9IA 4I3IA 4DDYA 5A93A 2PD8A 2Z6DA 1YKDA 2XDMA 4OOMA 3ZDJA 5FI7A 3HJKA 5HX9A 4Y5FA 3VFFA 3IXGA 2D01A 5CGXA 1PIOA 1WYBA 4R70A 2JKTM 5DF8A 5L10A 1W8QA 5L8MA 3A3IA 4CQHA 5DVAA 3T1XA 4GDBA 1K4FA 2Z2LB 1CQAA 3UY6A 5CHUA 2J8YA 5I94A 3SH9A 3MQ0A 4MBFA 2KDKA 4E04A 4E3LA 4N1XA 3B42A 4FUWA 2ZL1A 5FQMA 3MXQA 3T1RA 4MEZA 1K57A 4ZAMA 5A8BA 3K2NA 2VX8A 3BLMA 4MCWA 4YFMA 1LSWA 1SZVA 5HDCA 4JPMA 4KZ8A 3O5YA 2W3GA 2Y2IA 5GHYA 1PWCA 5TFQA 4NXFA 4UEYA 1YSQA 4X68A 1KDSA 1LLBA 3GV9A 1Q2PA 2Y4AA 4DDSA 1BYWA 2EFXA 2A2LA 1E3UD 1EWZA 4CPKA 1NXYA 4Q0HA 1XJ6A 2L1MA 1L2SA 4Q0IA 2RCXA 3G4PA 2IWCA 1YLZA 1O7EA 1VB6A 2FFFB 3K3CA 1PI4A 1T1BA 3NI9A 4DMZA 1TF1A 2Q9MA 3IWQA 5EVEA 3ZHHA 1XJ4A 4Y0OA 1TS8A 4I5SA 5EVIB 1I2WA 3A3DA 1P97A 3C7VA 4I39A 3UO9A 2H0YA 5F83A 3MFDA 5CRFA 3A3EA 2V1AA 3BQ8A 3C4PA 3S1YA 5TBMA 5E43A 5HZHA 1A0KA 5I5LA 3MJQA 4GDNA 2BTFP 4LFUA 1LL9A 3SW1A 5F1GA 3FPVA 1HTZA 1PFLA 3MF0A 3ZNTA 3VOYA 2ZC3B 2ZOHA 4JGPA 3ZQ5A 4YNRA 3WRZA 1KGGA 4E3OA 4L9EA 2XA7S 4IBRA 5FAQA 2W1TA 3QNBA 4C75A 4EU0A 1Y54A 1K54A 1YLJA 4KG2A 2Y2GA 2P08A 3PAGA 4LPZA 1K6SA 2VZWA 2XH9A 3FC7A 1NRFA 2Y2OA 1KGEA 5E2EA 3K3DA 4EUVA 4KG5A 1UWNX 1N4OA 3MKEA 5J4EA 3F1NA 4JF5A 3SS4A 1MWUA 3LR3A 1N9NA 3NOPC 3EEAA 4DF6A 3MXRA 1DRMA 2NUPC 2B5RA 4QWOA 1W79A 5FAOA 5AJGA 4PM5A 4NEED 3UB7A 5EUAA 3KYZA 4U0TA 1NYMA 1SDNA 2XEPA 5K5BA 2WZZA 5CERA 4GS9A 3E4PA 5MC7A 4GB7A 4GHIA 3T4JA 5HW3A 1G5UA 4YOFA 3ZG0A 5DFYA 1RCJA 4FH2A 4AFIA 2XLNA 4DE3A 1XA1A 3CITA 3T12B 1YPRA 5F5YA 2K2NA 3SZTA 1PZPA 4EBNA 1FR6A 4ZJ1A 3JYIA 1LSXA 1ONGA 3NOTC 3BLSA 5L07A 2OAQ1 2IWDA 2BASA 1Y28A 3WWXA 4B9OA 3BFEA 1CEFA 5GHZA 3W4PA 2X71A 2QZ6A 2OWHA 2JCHA 1L3LA 2XD5A 4EQ1A 3LCEA 1S66L 5DTTA 3E98A 1WA9A 1D06A 3SOIA 1GSWA 4N9KA 1LT0A 5FQIA 3MXSA 2ZC5B 2WKQA 2HP9A 3CJMA 3CPTB 3KX0X 2JKRI 3IS2A 4IHQA 4S2NA 4QJGA 1IYOA 1IYSA 1L0DA 1W8YA 5HPIA 3A3FA 3NHQA 1N9BA 1QMFA 1SKFA 4XUZA 3T4KA 4BBTA 5KIZA 4HJ4A 3IXBA 4BL3A 1I5QA 4H6JA 2B95A 4LENA 3IF6C 1LI0A 3Q07A 4KZ6A 3Q81A 4PKYA 3HUMA 2D02A 3LY4A 3MZFA 2P7JA 1MWSA 4XXRA 1OTAA 3DAVA 3CLOA 4JF6A 3VOLA 1PW1A 2LB5A 1P9RA 3UE6A 5EECA 4IUKA 3KO6A 4UQIS 3BFCA 2WKIA 2Q9NA 3IH9A 4Z9QA 5FSRA 3PXPA 3G2ZA 4X25A 1ZTUA 4OPZA 2QHKA 1DY6A 5L09A 4GCZA 1S4SA 4S2LA 3ZFZA 1KOUA 1TD5A 3IF5A 3MQQA 1PWDA 3EGXC 3CG5A 3H82A 3N6IA 2P9VB 3ISGA 3TRCA 4GN2A 2HGVA 2XD1A 1K56A 3UMDA 5BOHA 1BLHA 4HJ6A 2J9OA 3W8KA 4O01A 4JGQA 2HJEA 2FH5A 4RQ9A 4MBKA 2QYBA 3A3JA 3TG9A 4UA9A 2JKTI 2JBFA 1NZOA 2JE5A 4QB8A 1WE4A 4X53A 2WADA 3VE4A 5HAIA 4K0WA 1TVFA 2G7UA 3CI6A 3LR5A 3P98A 2Y91A 5E2FA 3BW6A 4ZRRA 3M2JA 4E3MA 3NC8A 2PU2A 3VSLA 1HD8A 1FR1A 1S4RA 1M6KA 2C6WB 3UDIA 1XGJA 1DP6A 2VV6A 4ZJ2A 3LO7A 3HLGA 4EWFA 2Y2KA 1WYCA 2ZMVA 1Z09A 1JWPA 2G2WA 5FI6A 4FTXA 5EVIA 2UWXA 4WMCA 3QHYA 3H7WB 1U60A 1JWZA 1G68A 1G6OA 1YAXA 3GVBA 5FI2A 1K4EA 1W7FA 3LYXA 3HUOA 1P9WA 4F94A 2XA7M 4PHTA 1KE4A 3UN7A 3QP2A 1VETB 2Y2LA 4DRTA 5EFWA 3D3OA 4E6XA 5JYPA 1FSWA 1BUEA 1PI5A 3V39A 1FQGA 2KX6A 4Y3IA 4B93A 1L0FA 3WS4A 4OOYA 3OPLA 2Y2MA 3N4IA 5HPFA 4GD6A 4OQ0A 4WM9A 4EUZA 3LFVA 1ACFA 4FCFA 1E4DA 3C2WA 4H8RA 2WGWB 2Y2PA 4WYYA 2A49A 4K91A 5IHVA 2A24A 4C6YA 2EX6A 3BM6A 3RXWA 4PAUA 2VK3A 1ZC2A 5D3OA 3VFHA 1S67L 3IHBA 3W4OA 2M1CA 3FYZA 5EE8A 1L0EA 2HP6A 1TEMA 3AGDA 5DJUA 2H10A 4EW7A 3S7NA 5AQAA 2CC1A 2X02A 5M1AA 1NJ4A 4JKTA 5DFXA 3MKFA 3VP4A 1SDEA 1XXMA 2ZBBA 1TDGA 1OTEA 4HH3A 2GDNA 4NXGA 5FQQA 1DJCA 3T4OA 3KSFA 2PAVP 3UDFA 2WGIA 4EQIA 2R9WA 1MBLA 4PPRA 3L9KA 1ES5A 1SHVA 3OPPA 3CAXA 3WRTA 4YWZA 2EX2A 4F3LB 2NUTC 3OBFA 1PNEA 3QP5A 3KSHA 2I9VA 3NDGA 4X55A 5FDSA 4R4SA 3G6OA 4FOFA 3IF6B 3OCLA 4EBLA 5HSQA 3CWFA 1S0WA 3N8LA 4OPRA 3GSGA 3C8CA 1H0MA 3VSKA 3NBLA 2IWBA 2EFUA 2DNSA 4D60A 3EOIA 3A0VA 2PD7A 4R3BA 2ZM2A 3GECA 3T1SA 3GTCA 1CF0A 4P6ZM 2HPBA 4M4XA 2V1BA 3UMEA 1YLWA 3DBAA 4R4RA 3CPTA 1CEGA 4OP5A 1ZKJA 5HDDA 4I38A 1YLYA 2HDRA 1HZOA 5FDHA 3HCYA 1XP4A 5HAQA 3D72A 3KYEA 4OQGA 1I2SA 1IYPA 1MKIA 3BJNA 4E3NA 4CLCB 1IFQA 3IX8A 3UNWA 4HNBA 4ESPA 4DE2A 4X6TA 1MKMA 1ERMA 3ZG9B 4WELA 3IX4A 2GJ3A 4GLQA 3FZCA 1XKZA 1TDLA 1IKGA 4CJNA 4S2PA 2BLSA 5A92A 2PHYA 4EV4A 3OZHA 3S4XA 2GX5A 2J3WA 4UQIM 5LBRA 3HLDA 3HLCA 4KUKA 2JKFA 4R6LA 3RFBA 1O07A 3PAEA 3C4OA 4OOLA 1OTDA 3MMHA 2V20A 4MN6A 3SH8A 3KSGA 2HJ9C 3UE3A 3LY3A 1N9LA 4OPQA 3VV4A 4LLOB 5CEBA 1GHIA 3UE0A 4ID4A 2XROA 4B4XA 4BMWA 1DP8A 1ES4A 4L0LA 4DJ2A 2PYPA 3LIFA 4RA7A 2JC7A 2W0NA 4HHDA 3C5AA 3IWOA 3CUEC 3O88A 2P9VA 5HD5A 5A91A 5M19A 5IT5A 4ME4A 4Y13A 4R1GA 4GNUA 2OWJA 3FKWA 4DJ3A 5HAPA 1HLUP 2R78A 3QNCA 1YMXA 3T1QB 1RGYA 1H8ZA 2V9AA 5C5KA 1BLCA 4ARZB 3VP1A 2OOLA 3S7OA 2ZC7A 3M6HA 3DWKA 5EV0A 3OPRA 2WKHA 4ZTKA 1CJFA 2KOIA 3WS5A 2Y2NA 1XPBA 2WKPA 4NG2A 1JNUA 3V3SA 3R4KA 2H5SA 2VJWA 3HLBA 4JLFA 4BJPA 4UHUA 5EOEA 1MWRA 1BTLA 4OKPA 1K25A 2ZJ9A 3LI8A 2ZQ9A 3TSGA 2ZOIA 2I72A 3ZGAB 2K31A 1T1AA 5CTMA 1MC0A 2WKRA 2W3EA 3NY4A 4GJ4A 4PM8A 4RX2A 1XJ2A 3QP4A 3BYDA 4IUHA 3ZCZA 2GNXA 2EX9A 3NECA 1HVBA 4EBPA 5TJJA 4X1LA 2DCFA 4KG6A 1ZG6A 2ZLYA 1IELA 3PYPA 5CGWA 3L7HA 1TS0A 3E4QA 4Y2FA 5FQJA 1MPLA 2PRFA 2X01A 1ESIA 2XFTA 4MBHA 4CLCD 2A3UA 2V2FF 2Z6CA 1E3UA 3O3VA 4S2IA 2XQZA 2Y79A 4LCLA 1K0KA 3ZVWA 5FEFA 5F82A 4OLGA 5CX7A 1VETA 2JKGA 1XJ3A 3T50A 1E25A 5GLAA 3UB6A 4FSFA 1OMEA 4OP8A 4KZ7A 3IBRA 5DF7A 5CECA 1GHMA 5GL9A 3M2KA 4WUJA 5E2GA 2EWWA 4P6ZS 2V8CA 3ZG5A 5FEGA 3IWIA 3HJIA 3ULFA 1GSVA 2LB9A 4E3IA 2VV8A 2WGWA 4DXBA 1K38A 2L4RA 1UWPX 4BD1A 2OLUA 2Y2QA 4X69A 5G18A 2EXAA 3G30A 2Y55A 2PDRA 2VLGA 4WZ4A 4WL9A 2OSUA 2Y59A 1EI5A 4R0QA 5DF9A 4HI4A 3PBNA 5E2HA 4EEPA 4JXWA 1H5XA 4KZ5A 2JHEA 5G4ZA 2HZ5A 4HESA 5AQ7A 2PT7A 3RXXA 5HL1A 1GSXA 2J9PA 3Q7VB 4U3TA 1K55C 2B18A 2VKSA 1JTDA 4B88A 3DWZA 4PMAA 3KSIA 4P0MA 1X0OA 1PZOA 3BEBA 4NK3A 5J8XA 4MNRA 3PTEA 1STZA 4OH0A 3IXHA 2ZC4B 5FQ9A 4BLMA 1KE3A 1IOUA 1UGUA 3NCKA 4F3LA 4CLCC 1YSPA 3T4TA 4DKIA 3IQAA 3IF6A 1RP5A 3B33A 2E8JA 4QPRA 2QJ5A 5HFOA 4IEDA 2P04A 2P74A 2EXBA 5JYOA 3PBRA 2J3TD 4GZBA 3HREA 5GLBA 3ICYA 1PYYA 1YLTA 1Z6FA 1VHMA 1CI8A 4Y7PA 4EERA 3CHWP 3BWLA 3MR0A 4X1MA 2INWA 3R7WB 1CK3A 2O0YA 3VP3A 4HIAA 5KSCA 2QMIA 2K7SA 4KZBA 3HLEA 3LUQA 3SH7A 1KE0A 1MXOA 2WKEA 1G6AA 3HUNA 3RH8B 2HDQA 2VGLS 5FL3A 4R38A 2EWVA 3LIBA 2EA9A 4OPYA 2VGKA 5EVLA 3IT9A 1H8MA 2XR0A 2W3DA 5GLDA 5FAPA 4HQAA 4MMNA 1XGIA 2ZQDA 1CI9A 1FOFA 2UV0E 3I7JA 1ALQA 2JN7A 2XFSA 4OVDA 2H0TA 5TR7A 1EROA 3OCNA 1FILA 1LHYA 4JBFA 4KENB 2O99A 1YQSA 3MS6A 4E3JA 3UPPA 3A0RA 2ZQAA 4KQRA 1XA7A 3LIEA 5J3WA 2ACGA 2FFYA 1TS6A 4GOGA 3TE8A 4IBXA 4GD8A 2ZMAA 3UPOA 4N92A 4P6BA 4RYEA 1VEUB 2G2UA 3OC2A 4HP9A 3HBRA 3G35A 3LEZA 3T4QA 4HY8A 4BWIA 2QPNA 5M18A 3ZG8B 3DTEA 3LIDA 3S7QA 3V3RA 3GRJA 3OOVA 2YKHA 3DW0A 1AWIA 4RX3A 4WBGA 3E2LA 4MDZA 4ARZA 3G2YA 1J9MA 3EEHA 3MFXA 3LI9A 3N8SA 3LR4A 4NKPA 5IS1A 1NLZA 4QU3A 4EEUA 1DP9A 5FQKA 4JXVA 4LV1A 3EQVA 3QP1A 3LR0A 3GDIA 4QY5A 1QMEA 4KZ9A 4OLDA 1K57C 4N1HA 4GW9A 3MZDA 2HDUA 2ZM0A 3SS3A 3G31A 3GR2A 3LIAA 4Y0TA 1NLYA 3BY9A 2DRWA 3NJAA 2WAEA 1KDWA 5AVFA 1P0ZA 4L9GA 3WS0A 2V0WA 2WGVA 2PR5A 3ZG7B 1MZUA 3VE3A 1XX2A 1PW8A 4QD4A 2OLVA 1EW0A 3CZDA 2ZQ7A 1DJAA 3E4OA 1XFNA 4NETA 3EQUA 3NOUC 3F1OB 4HEFA 3H82B 4S2OA 5CHJA 4JXGA 1OPXA 3DTIA 3QP6A 3FG8A 3E0YA 5CXWA 2V0UA 5F6AA 4Y17A 2Q0OA 3G34A 2Z2MB 5HWTA 4IJGA 4ETZA 4ETXA 2C5WB 3DTKA 4I3JA 5L2FA 5HWWA 5DKLA 5J7EA 4XT2B 3LEQA 2RL3A 4OQIA 2OV5A 4NXBA 3BFGA 4HOIA 3P7NA 4LRZE 4S2MA 4ZBEA 1DJBA 3VP0A 4K08A 5F68A 3FV7A 5KZHA 5HD3A 5DKKA 3ZVTA 3EWKA 1YMSA 5AVEA 2WZXA 3V67A 4A5RA 1SKOB 2EX8A 2J7VA 4S2JA 4BD0A 4WEJA 2PR6A 1JVJA 4LCMA 1K54C 3Q7ZA 1KGFA 5EPHA 1YLPA 1RGZA 4YINA 1OJ5A 1T19A 3Q7VA 4II7A 3BY8A 3C7UA 1JTGA 4EESA 5F69A 3IX3A 1OTIA 1FCNA 2VGJA 4PKYG 1L0GA 4WF0A 5DTSA 4OONA 5HDSA 4Y15A 3HLFA 3D4FA 3JVUA 1IKIA 3TJZC 1NY0A 3ITBA 1T18A 1FCMA 3O87A 4L9FA 2O9AA 2ZMFA 2OAP1 5G4YA 4KZ4A 3V50A 4WLAA 1BLPA 2FZ0A 1LL8A 4UA6A 4KQOA 5EM0A 5GHXA 4G3KA 2O9BA 3VMAA 2V8FA 1S1ZA 3LGOA 4FH4A 4IVIA 1IEMA 4Q8IA 2M7VA 2BG1A 2Y2HA 1GA9A 5HWVA 4BL2A 3R7WA 4E6WA 2A24B 3WS2A 3F1PB 3BFFA 3MZEA 1GCEA 3BECA 1V9ZA 2VGLM 1FSYA 5IU1A 2V1ZA 2VA0A 3U4LP 4JGRA 3D9YA 3H9WA 4LV2A 2M7UA 4EETB 5U47A 4Y0UA 1KVLA 3CUEA 1F2KA 1XFQA 3CMZA 5TGFA 2H28A 2QKPA 2VV7A 4LRYC 1K56D 1OJGA 3N7WA 3A0SA 5CEDA 1LL5A 1MWTA 3JPUA 1MY8A 3H7WA 5HARA 5FA7A 3V5MA 3B3XA 1YT4A 5AQBA 4C3QA 3PBQA 1JWVA 4S2NC 4JGOA 3PBOA 5F1FA 4Q0JA 2ZL1B 2DMWA 3B47A 4UA7A 4DN0A 4MN5A 4PM9A 3ZYTA 3BFDA 1PRQA 1W63M 1VM1A 3S22A 4M3KA 1VQQA 3ZNYA 3MBZA 4HP4A 3UDXA 1VEUA 4MN7A 2HV1A 2Y8HA 2HF6A 4KZ3A 3MQOA 3PHYA 1Y4OA 2W3FA 4LGWA 4BBVA 2W1RA 3GMWA 3RTYA 3G32A 2Y2JA 3UPNA 5EVID 4WMCD 3S7PA 1YM1A 3Q1FA 3T4SA 1GA0A 3OLOA 2PU4A 2XSSA 3M6BA 4IVKA 2W27A 2WYXA 4I3AA 1ES2A 2XK1A 4HJ3A 1W5DA 4Z1WA 4P85A 4HH2A 4QHCA 4PM7A 3GQZA 3C30A 1W63Q 4BQMA 1IYQA 4O7DA 2QJ7A 2B02A 4X56A 1BT5A 4XUXA 5CTNA 4KQQA 2XRNA 4R23A 3SS5A 1NZUA 3BRMA 1FIKA 3W4QA 4WN5A 2PBDP 1S1YA 2ZQCA 5TBMB 3W2ZA 2KLIA 3FKVA 3LICA 1OTBA 3IXDA 1BULA 5CHMA 3UE1A 4ZDXA 3UB5P 3TW8A 4DXCA 2R9XA 1S6RA 4WZ5C 4NXEA 4O0PA 1G28A 2WK0A 3TOIA 4S2KA 1ODVA 3IH8A
chains in the Genus database with same CATH topology
4MDZA 2GJ3A 4ARZA 4G3WA 4GLQA 1LSXA 2W1TB 3NOTC 3F1OA 3EEHA 1F5MA 1OT6A 3MFXA 2OAQ1 1F98A 3LI9A 5KSHA 2BASA 3LR4A 4NKPA 1Y28A 5F5YA 4B9OA 5IS1A 1NLZA 4EEUA 2O9CA 1DP9A 5HL6A 2PHYA 5DJTA 2GX5A 2J3WA 3EQVA 3LR0A 4UQIM 3GDIA 5LBRA 3PBSA 2OWHA 3KYQA 1LSVA 1TS7A 4KUKA 4R6LA 3F1NB 4EQ1A 1S66L 3RFBA 4GW9A 4OOLA 1OTDA 3E98A 1WA9A 4XT2A 1D06A 3MMHA 3LIAA 4MN6A 1GSWA 1NLYA 1LT0A 2MJ6A 3EGDC 3KSGA 4CLCA 1H3QA 2HJ9C 3BY9A 4KUOA 3UE3A 3NJAA 1N9OA 1N9LA 2WKQA 3VV4A 4R3AA 4LLOB 5AVFA 2XROA 2CMNA 3KX0X 2JKRI 3IS2A 4BMWA 1DP8A 4L0LA 4DJ2A 1P0ZA 4L9GA 2PYPA 3LIFA 2V0WA 4IHQA 3UB9A 1NRJA 4GS9B 2W0NA 2PR5A 4HHDA 3CUEC 5HD5A 1MZUA 4GHIB 3VE3A 5IT5A 2JKRM 5HPIA 3NHQA 4ME4A 1EW0A 2OWJA 1NWZA 4DJ3A 2R78A 3T4KA 4BBTA 3E4OA 5KIZA 1XFNA 2V9AA 5C5KA 4HJ4A 3EQUA 4H6JA 4ARZB 3NOUC 3F1OB 2OOLA 3S7OA 3FPWA 3H82B 2KOIA 3T4LA 3IBJA 4PKYA 1OPXA 2WKPA 2D02A 2PYRA 1JNUA 2VEAA 2J80A 4BBUA 3R4KA 4O8GA 2VJWA 3FG8A 2L0WA 3E0YA 4BJPA 2V0UA 5F6AA 2P7JA 3PBTA 5HWTA 4IJGA 4ETZA 2YKFA 4ETXA 1OTAA 3CLOA 3VOLA 2LB5A 3LI8A 1P9RA 4I3JA 2W3HA 1ZHHB 3UE6A 1OT9A 4IUKA 5HWWA 2ZOIA 3KO6A 5DKLA 5J7EA 4XT2B 4UQIS 2IA2A 2K31A 4KQDA 1T1AA 2J3TC 1MC0A 2WKRA 2W3EA 4GJ4A 3PXPA 1XJ2A 4NXBA 1ZTUA 2GZAA 4HOIA 2QHKA 3P7NA 1T1CA 4LRZE 4GCZA 4IUHA 1S4SA 2QWSA 3BQAA 4K08A 2GNXA 5F68A 3IS2B 5HD3A 5DKKA 1KOUA 1TD5A 3EWKA 3MQQA 5AVEA 4LRXC 3V67A 5TJJA 3EGXC 3P01A 3H82A 3PYPA 3UB8A 4WEJA 3JVVA 1TS0A 3E4QA 2PR6A 4Y2FA 4CLCE 3TRCA 2HGVA 4CLCD 3F1PA 2Z6CA 3UMDA 4H6JB 1V9YA 2Y79A 4WEKA 1OJ5A 1T19A 4G3VA 3U2AA 1D7EA 4II7A 3BY8A 4HJ6A 3PR6A 5CX7A 4O01A 4JGQA 2HJEA 4EESA 1XJ3A 4EXOA 3T50A 5F69A 2FH5A 3C38A 4RQ9A 1F9IA 2QYBA 1OTIA 4I3IA 3UB6A 2PD8A 4FSFA 4PKYG 2Z6DA 1YKDA 2JKTI 4OOMA 4WF0A 3IBRA 3VE4A 3HJKA 4Y5FA 2G7UA 3CI6A 3LR5A 2D01A 4WUJA 5HDSA 4R70A 3BW6A 2JKTM 4ZRRA 2EWWA 5L8MA 4P6ZS 3JVUA 4CQHA 3HJIA 3ULFA 3TJZC 1GSVA 1S4RA 2LB9A 2VV8A 1T18A 3MQ0A 2L4RA 2KDKA 1UWPX 1DP6A 4E04A 4L9FA 2O9AA 2VV6A 2ZMFA 3B42A 2OAP1 5G4YA 3MXQA 4WLAA 2PDRA 2FZ0A 2VLGA 1LL8A 4WL9A 2ZMVA 4KQOA 5A8BA 4G3KA 2O9BA 3K2NA 5DF9A 4HI4A 3PBNA 1S1ZA 4EEPA 3H7WB 2VX8A 2M7VA 4MCWA 5HWVA 1LSWA 5G4ZA 2JHEA 5HDCA 3R7WA 1G6OA 2A24B 1YAXA 3F1PB 2PT7A 1V9ZA 2VGLM 1GSXA 3O5YA 2W3GA 5IU1A 3LYXA 2VA0A 1P9WA 2B18A 2VKSA 2XA7M 4JGRA 4PHTA 4NXFA 3H9WA 2M7UA 4EETB 3KSIA 5EFWA 1X0OA 3D3OA 4UEYA 1STZA 3CUEA 1YSQA 2KX6A 4Y3IA 4B93A 1XFQA 1IOUA 1UGUA 1BYWA 4F3LA 2H28A 4CLCC 2QKPA 2VV7A 4LRYC 1OJGA 5HPFA 1YSPA 3A0SA 2A2LA 3T4TA 4Q0HA 1XJ6A 2L1MA 4Q0IA 3LFVA 3H7WA 3C2WA 3B33A 1VB6A 4QPRA 3K3CA 2QJ5A 3PBQA 2P04A 2A24A 1T1BA 4JGOA 3PBOA 4Q0JA 3PBRA 4PAUA 4DMZA 2DMWA 3B47A 4DN0A 1S67L 4MN5A 1TF1A 2J3TD 2M1CA 3ZYTA 1XJ4A 5DJUA 1TS8A 3ICYA 1W63M 4I5SA 4EW7A 3S7NA 1P97A 4I39A 1VHMA 4EERA 4HP4A 3BWLA 2V1AA 3MR0A 3BQ8A 2INWA 4MN7A 3R7WB 5DFXA 2HV1A 2O0YA 2Y8HA 2HF6A 5TBMA 2ZBBA 3MQOA 4HIAA 3PHYA 5HZHA 5I5LA 2K7SA 3MJQA 1OTEA 4HH3A 2W3FA 3SW1A 4NXGA 3FPVA 3LUQA 3T4OA 3KSFA 3MF0A 2W1RA 4BBVA 3RTYA 2ZOHA 3RH8B 4JGPA 2VGLS 3ZQ5A 4YNRA 5FL3A 4L9EA 4R38A 3S7PA 2EWVA 2XA7S 3CAXA 4YWZA 3LIBA 2EA9A 2W1TA 3T4SA 1H8MA 4EU0A 4F3LB 2NUTC 3OBFA 3KSHA 2I9VA 2P08A 3OLOA 4LPZA 2XSSA 2W3DA 3G6OA 4FOFA 2VZWA 2W27A 4HQAA 4MMNA 3FC7A 3OCLA 3K3DA 4I3AA 4EUVA 5HSQA 3CWFA 1UWNX 5J4EA 3C8CA 2JN7A 4HJ3A 3F1NA 4Z1WA 3EOIA 3OCNA 3A0VA 2PD7A 4HH2A 2O99A 3LR3A 1N9NA 3NOPC 3A0RA 3EEAA 3C30A 1W63Q 3LIEA 3GECA 1DRMA 5J3WA 2NUPC 1TS6A 3TE8A 4P6ZM 2QJ7A 2B02A 5AJGA 2XRNA 4M4XA 2V1BA 3UMEA 4NEED 3UB7A 3DBAA 4WN5A 3OC2A 5HDDA 3KYZA 4HP9A 4I38A 1S1YA 5K5BA 5TBMB 3W2ZA 3HCYA 2KLIA 3LICA 3T4QA 3D72A 1OTBA 4GS9A 4HY8A 4BWIA 3E4PA 5MC7A 4GHIA 3T4JA 4YOFA 3BJNA 5DFYA 4CLCB 3TW8A 1IFQA 3LIDA 4AFIA 3S7QA 4NXEA 4O0PA 4HNBA 3OOVA 1G28A 2YKHA 1ODVA 1MKMA 3CITA 4WELA 2K2NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GJ3 A;  1LSX A;  3NOT C;  3F1O A;  3EEH A;  1OT6 A;  3MFX A;  3LI9 A;  1F98 A;  2BAS A;  1Y28 A;  4B9O A;  5IS1 A;  4EEU A;  1DP9 A;  2PHY A;  5DJT A;  3GDI A;  2OWH A;  1LSV A;  1TS7 A;  4KUK A;  4R6L A;  3F1N B;  4EQ1 A;  1S66 L;  4GW9 A;  1OTD A;  1WA9 A;  4XT2 A;  1D06 A;  3LIA A;  4MN6 A;  1GSW A;  1LT0 A;  3BY9 A;  4KUO A;  3NJA A;  1N9O A;  1N9L A;  2WKQ A;  4R3A A;  4LLO B;  5AVF A;  2CMN A;  3KX0 X;  3IS2 A;  1DP8 A;  4DJ2 A;  1P0Z A;  4L9G A;  2PYP A;  3LIF A;  2V0W A;  3UB9 A;  4GS9 B;  2W0N A;  2PR5 A;  4HHD A;  5HD5 A;  1MZU A;  4GHI B;  3VE3 A;  3NHQ A;  1EW0 A;  2OWJ A;  1NWZ A;  4DJ3 A;  2R78 A;  4BBT A;  3E4O A;  5KIZ A;  1XFN A;  2V9A A;  4HJ4 A;  4H6J A;  3NOU C;  3F1O B;  2OOL A;  3H82 B;  4PKY A;  2WKP A;  2D02 A;  2PYR A;  1JNU A;  2VEA A;  2J80 A;  4BBU A;  3FG8 A;  2L0W A;  2V0U A;  5F6A A;  2P7J A;  5HWT A;  2YKF A;  1OTA A;  3CLO A;  3VOL A;  3LI8 A;  4I3J A;  3UE6 A;  1OT9 A;  5HWW A;  2ZOI A;  5DKL A;  5J7E A;  4XT2 B;  4KQD A;  1T1A A;  2WKR A;  1XJ2 A;  4NXB A;  4HOI A;  2QHK A;  3P7N A;  1T1C A;  4LRZ E;  4GCZ A;  1S4S A;  2QWS A;  4K08 A;  5F68 A;  3IS2 B;  5HD3 A;  5DKK A;  1KOU A;  3EWK A;  3MQQ A;  5AVE A;  4LRX C;  3H82 A;  3PYP A;  3UB8 A;  1TS0 A;  3E4Q A;  2PR6 A;  3F1P A;  2Z6C A;  3UMD A;  4H6J B;  1V9Y A;  1OJ5 A;  1T19 A;  1D7E A;  3BY8 A;  4HJ6 A;  4JGQ A;  4EES A;  1XJ3 A;  4EXO A;  3T50 A;  5F69 A;  4RQ9 A;  1F9I A;  3UB6 A;  1OTI A;  4I3I A;  2PD8 A;  4PKY G;  2Z6D A;  4WF0 A;  3IBR A;  3VE4 A;  3HJK A;  2D01 A;  4WUJ A;  5HDS A;  4R70 A;  3HJI A;  3ULF A;  1GSV A;  1S4R A;  2VV8 A;  1T18 A;  2L4R A;  2KDK A;  1UWP X;  1DP6 A;  4E04 A;  4L9F A;  2VV6 A;  5G4Y A;  3MXQ A;  4WLA A;  2PDR A;  2VLG A;  1LL8 A;  4WL9 A;  5A8B A;  4HI4 A;  1S1Z A;  4EEP A;  3H7W B;  5HWV A;  5HDC A;  1LSW A;  5G4Z A;  2JHE A;  2A24 B;  3F1P B;  1V9Z A;  1GSX A;  5IU1 A;  3LYX A;  4JGR A;  4NXF A;  3H9W A;  4EET B;  5EFW A;  1X0O A;  2KX6 A;  1XFQ A;  1UGU A;  1BYW A;  4F3L A;  2H28 A;  2QKP A;  2VV7 A;  4LRY C;  1OJG A;  3A0S A;  1XJ6 A;  2L1M A;  3H7W A;  3C2W A;  3B33 A;  1VB6 A;  3K3C A;  2QJ5 A;  2A24 A;  1T1B A;  4JGO A;  1S67 L;  4MN5 A;  2M1C A;  1XJ4 A;  5DJU A;  1TS8 A;  3ICY A;  4I5S A;  4EW7 A;  1P97 A;  4I39 A;  4EER A;  4HP4 A;  3BWL A;  2V1A A;  3MR0 A;  2INW A;  2HV1 A;  5TBM A;  2ZBB A;  3MQO A;  4HIA A;  3PHY A;  5HZH A;  5I5L A;  2K7S A;  3MJQ A;  1OTE A;  4HH3 A;  3SW1 A;  4NXG A;  3LUQ A;  4BBV A;  3RTY A;  2ZOH A;  3RH8 B;  4JGP A;  3ZQ5 A;  4L9E A;  4R38 A;  3CAX A;  4YWZ A;  3LIB A;  2EA9 A;  4F3L B;  2I9V A;  3OLO A;  4LPZ A;  3G6O A;  2W27 A;  4HQA A;  3FC7 A;  3K3D A;  4I3A A;  5HSQ A;  3CWF A;  1UWN X;  5J4E A;  3C8C A;  2JN7 A;  4HJ3 A;  3F1N A;  3A0V A;  2PD7 A;  4HH2 A;  1N9N A;  3NOP C;  3A0R A;  3LIE A;  3GEC A;  1DRM A;  5J3W A;  1TS6 A;  2QJ7 A;  2B02 A;  4M4X A;  2V1B A;  3UME A;  3UB7 A;  4WN5 A;  5HDD A;  4HP9 A;  4I38 A;  1S1Y A;  5TBM B;  3LIC A;  3D72 A;  1OTB A;  4GS9 A;  4HY8 A;  3E4P A;  4GHI A;  3LID A;  4NXE A;  4HNB A;  1G28 A;  2YKH A;  1ODV A;  5F5Y A; 
#chains in the Genus database with same CATH topology
 2E8I A;  3HLW A;  5CGS A;  4G3W A;  2W1T B;  3F1O A;  1F5M A;  1OT6 A;  2PBY A;  5KSH A;  1F98 A;  3P09 A;  4E3K A;  4DE0 A;  3RJU A;  4PM6 A;  3Q82 A;  2O9C A;  5HL6 A;  5FAS A;  5KMW A;  5DJT A;  1K55 A;  3PBS A;  1ESU A;  2HDS A;  3KYQ A;  1LSV A;  1Q2Q A;  1TS7 A;  4HBT A;  3F1N B;  3HVF A;  1GHP A;  5EVI C;  4KZA A;  2WAF A;  1FCO A;  4U0X A;  4XT2 A;  4UAA A;  2MJ6 A;  3EGD C;  4LV3 A;  4CLC A;  1H3Q A;  4BEN A;  4KUO A;  3ITA A;  1N9O A;  4LV0 A;  5DTK A;  4P87 A;  4DE1 A;  5FAT A;  1KVM A;  2XF3 A;  4R3A A;  1K6R A;  3E2K A;  4WZ5 A;  4R3J A;  2CMN A;  4FD8 A;  2ZD8 A;  3UB9 A;  4OQH A;  1NRJ A;  4GS9 B;  1SKO A;  1C3B A;  1BZA A;  4GHI B;  2WUQ A;  2JKR M;  1M40 A;  1NWZ A;  3IHA A;  4QY6 A;  4HBU A;  4MLL A;  3NUL A;  2ZC6 B;  4JF4 A;  1J3W A;  1PWG A;  3FPW A;  3FWL A;  4N9L A;  3O86 A;  3T4L A;  3IBJ A;  1H8Y A;  2PYR A;  4BBU A;  2VEA A;  2J80 A;  4O8G A;  5A90 A;  2L0W A;  1ONH A;  5EOO A;  3AGE A;  3PBT A;  3QP8 A;  4RVA A;  2YKF A;  1BSG A;  3OPH A;  2W3H A;  1ZHH B;  1OT9 A;  1LI9 A;  2IA2 A;  4KQD A;  5EM1 A;  5GLC A;  2J3T C;  2XGN A;  4K0X A;  2AVX A;  2GZA A;  1T1C A;  3WS1 A;  4D2O A;  3DTM A;  5AQ9 A;  2QWS A;  3BQA A;  1SCW A;  2ZM8 A;  3NIA A;  1ERQ A;  3IS2 B;  4LRX C;  1ZG4 A;  3P01 A;  1AXB A;  3VP2 A;  4GKU A;  3AGF A;  3UB8 A;  3JVV A;  3HL9 A;  3VOZ A;  1D1J A;  3N8R A;  4CLC E;  3NDE A;  3F1P A;  1ES3 A;  4B4Z A;  4H6J B;  1V9Y A;  3MSH A;  4WEK A;  2HP5 A;  2ZQ8 A;  1BLS A;  4G3V A;  1NYY A;  3U2A A;  1D7E A;  4ZJ3 A;  3PR6 A;  4EXO A;  4JXS A;  3C38 A;  1F9I A;  4I3I A;  4DDY A;  5A93 A;  2PD8 A;  2Z6D A;  1YKD A;  2XDM A;  4OOM A;  3ZDJ A;  5FI7 A;  3HJK A;  5HX9 A;  4Y5F A;  3VFF A;  3IXG A;  2D01 A;  5CGX A;  1PIO A;  1WYB A;  4R70 A;  2JKT M;  5DF8 A;  5L10 A;  1W8Q A;  5L8M A;  3A3I A;  4CQH A;  5DVA A;  3T1X A;  4GDB A;  1K4F A;  2Z2L B;  1CQA A;  3UY6 A;  5CHU A;  2J8Y A;  5I94 A;  3SH9 A;  3MQ0 A;  4MBF A;  2KDK A;  4E04 A;  4E3L A;  4N1X A;  3B42 A;  4FUW A;  2ZL1 A;  5FQM A;  3MXQ A;  3T1R A;  4MEZ A;  1K57 A;  4ZAM A;  5A8B A;  3K2N A;  2VX8 A;  3BLM A;  4MCW A;  4YFM A;  1LSW A;  1SZV A;  5HDC A;  4JPM A;  4KZ8 A;  3O5Y A;  2W3G A;  2Y2I A;  5GHY A;  1PWC A;  5TFQ A;  4NXF A;  4UEY A;  1YSQ A;  4X68 A;  1KDS A;  1LLB A;  3GV9 A;  1Q2P A;  2Y4A A;  4DDS A;  1BYW A;  2EFX A;  2A2L A;  1E3U D;  1EWZ A;  4CPK A;  1NXY A;  4Q0H A;  1XJ6 A;  2L1M A;  1L2S A;  4Q0I A;  2RCX A;  3G4P A;  2IWC A;  1YLZ A;  1O7E A;  1VB6 A;  2FFF B;  3K3C A;  1PI4 A;  1T1B A;  3NI9 A;  4DMZ A;  1TF1 A;  2Q9M A;  3IWQ A;  5EVE A;  3ZHH A;  1XJ4 A;  4Y0O A;  1TS8 A;  4I5S A;  5EVI B;  1I2W A;  3A3D A;  1P97 A;  3C7V A;  4I39 A;  3UO9 A;  2H0Y A;  5F83 A;  3MFD A;  5CRF A;  3A3E A;  2V1A A;  3BQ8 A;  3C4P A;  3S1Y A;  5TBM A;  5E43 A;  5HZH A;  1A0K A;  5I5L A;  3MJQ A;  4GDN A;  2BTF P;  4LFU A;  1LL9 A;  3SW1 A;  5F1G A;  3FPV A;  1HTZ A;  1PFL A;  3MF0 A;  3ZNT A;  3VOY A;  2ZC3 B;  2ZOH A;  4JGP A;  3ZQ5 A;  4YNR A;  3WRZ A;  1KGG A;  4E3O A;  4L9E A;  2XA7 S;  4IBR A;  5FAQ A;  2W1T A;  3QNB A;  4C75 A;  4EU0 A;  1Y54 A;  1K54 A;  1YLJ A;  4KG2 A;  2Y2G A;  2P08 A;  3PAG A;  4LPZ A;  1K6S A;  2VZW A;  2XH9 A;  3FC7 A;  1NRF A;  2Y2O A;  1KGE A;  5E2E A;  3K3D A;  4EUV A;  4KG5 A;  1UWN X;  1N4O A;  3MKE A;  5J4E A;  3F1N A;  4JF5 A;  3SS4 A;  1MWU A;  3LR3 A;  1N9N A;  3NOP C;  3EEA A;  4DF6 A;  3MXR A;  1DRM A;  2NUP C;  2B5R A;  4QWO A;  1W79 A;  5FAO A;  5AJG A;  4PM5 A;  4NEE D;  3UB7 A;  5EUA A;  3KYZ A;  4U0T A;  1NYM A;  1SDN A;  2XEP A;  5K5B A;  2WZZ A;  5CER A;  4GS9 A;  3E4P A;  5MC7 A;  4GB7 A;  4GHI A;  3T4J A;  5HW3 A;  1G5U A;  4YOF A;  3ZG0 A;  5DFY A;  1RCJ A;  4FH2 A;  4AFI A;  2XLN A;  4DE3 A;  1XA1 A;  3CIT A;  3T12 B;  1YPR A;  5F5Y A;  2K2N A;  3SZT A;  1PZP A;  4EBN A;  1FR6 A;  4ZJ1 A;  3JYI A;  1LSX A;  1ONG A;  3NOT C;  3BLS A;  5L07 A;  2OAQ 1;  2IWD A;  2BAS A;  1Y28 A;  3WWX A;  4B9O A;  3BFE A;  1CEF A;  5GHZ A;  3W4P A;  2X71 A;  2QZ6 A;  2OWH A;  2JCH A;  1L3L A;  2XD5 A;  4EQ1 A;  3LCE A;  1S66 L;  5DTT A;  3E98 A;  1WA9 A;  1D06 A;  3SOI A;  1GSW A;  4N9K A;  1LT0 A;  5FQI A;  3MXS A;  2ZC5 B;  2WKQ A;  2HP9 A;  3CJM A;  3CPT B;  3KX0 X;  2JKR I;  3IS2 A;  4IHQ A;  4S2N A;  4QJG A;  1IYO A;  1IYS A;  1L0D A;  1W8Y A;  5HPI A;  3A3F A;  3NHQ A;  1N9B A;  1QMF A;  1SKF A;  4XUZ A;  3T4K A;  4BBT A;  5KIZ A;  4HJ4 A;  3IXB A;  4BL3 A;  1I5Q A;  4H6J A;  2B95 A;  4LEN A;  3IF6 C;  1LI0 A;  3Q07 A;  4KZ6 A;  3Q81 A;  4PKY A;  3HUM A;  2D02 A;  3LY4 A;  3MZF A;  2P7J A;  1MWS A;  4XXR A;  1OTA A;  3DAV A;  3CLO A;  4JF6 A;  3VOL A;  1PW1 A;  2LB5 A;  1P9R A;  3UE6 A;  5EEC A;  4IUK A;  3KO6 A;  4UQI S;  3BFC A;  2WKI A;  2Q9N A;  3IH9 A;  4Z9Q A;  5FSR A;  3PXP A;  3G2Z A;  4X25 A;  1ZTU A;  4OPZ A;  2QHK A;  1DY6 A;  5L09 A;  4GCZ A;  1S4S A;  4S2L A;  3ZFZ A;  1KOU A;  1TD5 A;  3IF5 A;  3MQQ A;  1PWD A;  3EGX C;  3CG5 A;  3H82 A;  3N6I A;  2P9V B;  3ISG A;  3TRC A;  4GN2 A;  2HGV A;  2XD1 A;  1K56 A;  3UMD A;  5BOH A;  1BLH A;  4HJ6 A;  2J9O A;  3W8K A;  4O01 A;  4JGQ A;  2HJE A;  2FH5 A;  4RQ9 A;  4MBK A;  2QYB A;  3A3J A;  3TG9 A;  4UA9 A;  2JKT I;  2JBF A;  1NZO A;  2JE5 A;  4QB8 A;  1WE4 A;  4X53 A;  2WAD A;  3VE4 A;  5HAI A;  4K0W A;  1TVF A;  2G7U A;  3CI6 A;  3LR5 A;  3P98 A;  2Y91 A;  5E2F A;  3BW6 A;  4ZRR A;  3M2J A;  4E3M A;  3NC8 A;  2PU2 A;  3VSL A;  1HD8 A;  1FR1 A;  1S4R A;  1M6K A;  2C6W B;  3UDI A;  1XGJ A;  1DP6 A;  2VV6 A;  4ZJ2 A;  3LO7 A;  3HLG A;  4EWF A;  2Y2K A;  1WYC A;  2ZMV A;  1Z09 A;  1JWP A;  2G2W A;  5FI6 A;  4FTX A;  5EVI A;  2UWX A;  4WMC A;  3QHY A;  3H7W B;  1U60 A;  1JWZ A;  1G68 A;  1G6O A;  1YAX A;  3GVB A;  5FI2 A;  1K4E A;  1W7F A;  3LYX A;  3HUO A;  1P9W A;  4F94 A;  2XA7 M;  4PHT A;  1KE4 A;  3UN7 A;  3QP2 A;  1VET B;  2Y2L A;  4DRT A;  5EFW A;  3D3O A;  4E6X A;  5JYP A;  1FSW A;  1BUE A;  1PI5 A;  3V39 A;  1FQG A;  2KX6 A;  4Y3I A;  4B93 A;  1L0F A;  3WS4 A;  4OOY A;  3OPL A;  2Y2M A;  3N4I A;  5HPF A;  4GD6 A;  4OQ0 A;  4WM9 A;  4EUZ A;  3LFV A;  1ACF A;  4FCF A;  1E4D A;  3C2W A;  4H8R A;  2WGW B;  2Y2P A;  4WYY A;  2A49 A;  4K91 A;  5IHV A;  2A24 A;  4C6Y A;  2EX6 A;  3BM6 A;  3RXW A;  4PAU A;  2VK3 A;  1ZC2 A;  5D3O A;  3VFH A;  1S67 L;  3IHB A;  3W4O A;  2M1C A;  3FYZ A;  5EE8 A;  1L0E A;  2HP6 A;  1TEM A;  3AGD A;  5DJU A;  2H10 A;  4EW7 A;  3S7N A;  5AQA A;  2CC1 A;  2X02 A;  5M1A A;  1NJ4 A;  4JKT A;  5DFX A;  3MKF A;  3VP4 A;  1SDE A;  1XXM A;  2ZBB A;  1TDG A;  1OTE A;  4HH3 A;  2GDN A;  4NXG A;  5FQQ A;  1DJC A;  3T4O A;  3KSF A;  2PAV P;  3UDF A;  2WGI A;  4EQI A;  2R9W A;  1MBL A;  4PPR A;  3L9K A;  1ES5 A;  1SHV A;  3OPP A;  3CAX A;  3WRT A;  4YWZ A;  2EX2 A;  4F3L B;  2NUT C;  3OBF A;  1PNE A;  3QP5 A;  3KSH A;  2I9V A;  3NDG A;  4X55 A;  5FDS A;  4R4S A;  3G6O A;  4FOF A;  3IF6 B;  3OCL A;  4EBL A;  5HSQ A;  3CWF A;  1S0W A;  3N8L A;  4OPR A;  3GSG A;  3C8C A;  1H0M A;  3VSK A;  3NBL A;  2IWB A;  2EFU A;  2DNS A;  4D60 A;  3EOI A;  3A0V A;  2PD7 A;  4R3B A;  2ZM2 A;  3GEC A;  3T1S A;  3GTC A;  1CF0 A;  4P6Z M;  2HPB A;  4M4X A;  2V1B A;  3UME A;  1YLW A;  3DBA A;  4R4R A;  3CPT A;  1CEG A;  4OP5 A;  1ZKJ A;  5HDD A;  4I38 A;  1YLY A;  2HDR A;  1HZO A;  5FDH A;  3HCY A;  1XP4 A;  5HAQ A;  3D72 A;  3KYE A;  4OQG A;  1I2S A;  1IYP A;  1MKI A;  3BJN A;  4E3N A;  4CLC B;  1IFQ A;  3IX8 A;  3UNW A;  4HNB A;  4ESP A;  4DE2 A;  4X6T A;  1MKM A;  1ERM A;  3ZG9 B;  4WEL A;  3IX4 A;  2GJ3 A;  4GLQ A;  3FZC A;  1XKZ A;  1TDL A;  1IKG A;  4CJN A;  4S2P A;  2BLS A;  5A92 A;  2PHY A;  4EV4 A;  3OZH A;  3S4X A;  2GX5 A;  2J3W A;  4UQI M;  5LBR A;  3HLD A;  3HLC A;  4KUK A;  2JKF A;  4R6L A;  3RFB A;  1O07 A;  3PAE A;  3C4O A;  4OOL A;  1OTD A;  3MMH A;  2V20 A;  4MN6 A;  3SH8 A;  3KSG A;  2HJ9 C;  3UE3 A;  3LY3 A;  1N9L A;  4OPQ A;  3VV4 A;  4LLO B;  5CEB A;  1GHI A;  3UE0 A;  4ID4 A;  2XRO A;  4B4X A;  4BMW A;  1DP8 A;  1ES4 A;  4L0L A;  4DJ2 A;  2PYP A;  3LIF A;  4RA7 A;  2JC7 A;  2W0N A;  4HHD A;  3C5A A;  3IWO A;  3CUE C;  3O88 A;  2P9V A;  5HD5 A;  5A91 A;  5M19 A;  5IT5 A;  4ME4 A;  4Y13 A;  4R1G A;  4GNU A;  2OWJ A;  3FKW A;  4DJ3 A;  5HAP A;  1HLU P;  2R78 A;  3QNC A;  1YMX A;  3T1Q B;  1RGY A;  1H8Z A;  2V9A A;  5C5K A;  1BLC A;  4ARZ B;  3VP1 A;  2OOL A;  3S7O A;  2ZC7 A;  3M6H A;  3DWK A;  5EV0 A;  3OPR A;  2WKH A;  4ZTK A;  1CJF A;  2KOI A;  3WS5 A;  2Y2N A;  1XPB A;  2WKP A;  4NG2 A;  1JNU A;  3V3S A;  3R4K A;  2H5S A;  2VJW A;  3HLB A;  4JLF A;  4BJP A;  4UHU A;  5EOE A;  1MWR A;  1BTL A;  4OKP A;  1K25 A;  2ZJ9 A;  3LI8 A;  2ZQ9 A;  3TSG A;  2ZOI A;  2I72 A;  3ZGA B;  2K31 A;  1T1A A;  5CTM A;  1MC0 A;  2WKR A;  2W3E A;  3NY4 A;  4GJ4 A;  4PM8 A;  4RX2 A;  1XJ2 A;  3QP4 A;  3BYD A;  4IUH A;  3ZCZ A;  2GNX A;  2EX9 A;  3NEC A;  1HVB A;  4EBP A;  5TJJ A;  4X1L A;  2DCF A;  4KG6 A;  1ZG6 A;  2ZLY A;  1IEL A;  3PYP A;  5CGW A;  3L7H A;  1TS0 A;  3E4Q A;  4Y2F A;  5FQJ A;  1MPL A;  2PRF A;  2X01 A;  1ESI A;  2XFT A;  4MBH A;  4CLC D;  2A3U A;  2V2F F;  2Z6C A;  1E3U A;  3O3V A;  4S2I A;  2XQZ A;  2Y79 A;  4LCL A;  1K0K A;  3ZVW A;  5FEF A;  5F82 A;  4OLG A;  5CX7 A;  1VET A;  2JKG A;  1XJ3 A;  3T50 A;  1E25 A;  5GLA A;  3UB6 A;  4FSF A;  1OME A;  4OP8 A;  4KZ7 A;  3IBR A;  5DF7 A;  5CEC A;  1GHM A;  5GL9 A;  3M2K A;  4WUJ A;  5E2G A;  2EWW A;  4P6Z S;  2V8C A;  3ZG5 A;  5FEG A;  3IWI A;  3HJI A;  3ULF A;  1GSV A;  2LB9 A;  4E3I A;  2VV8 A;  2WGW A;  4DXB A;  1K38 A;  2L4R A;  1UWP X;  4BD1 A;  2OLU A;  2Y2Q A;  4X69 A;  5G18 A;  2EXA A;  3G30 A;  2Y55 A;  2PDR A;  2VLG A;  4WZ4 A;  4WL9 A;  2OSU A;  2Y59 A;  1EI5 A;  4R0Q A;  5DF9 A;  4HI4 A;  3PBN A;  5E2H A;  4EEP A;  4JXW A;  1H5X A;  4KZ5 A;  2JHE A;  5G4Z A;  2HZ5 A;  4HES A;  5AQ7 A;  2PT7 A;  3RXX A;  5HL1 A;  1GSX A;  2J9P A;  3Q7V B;  4U3T A;  1K55 C;  2B18 A;  2VKS A;  1JTD A;  4B88 A;  3DWZ A;  4PMA A;  3KSI A;  4P0M A;  1X0O A;  1PZO A;  3BEB A;  4NK3 A;  5J8X A;  4MNR A;  3PTE A;  1STZ A;  4OH0 A;  3IXH A;  2ZC4 B;  5FQ9 A;  4BLM A;  1KE3 A;  1IOU A;  1UGU A;  3NCK A;  4F3L A;  4CLC C;  1YSP A;  3T4T A;  4DKI A;  3IQA A;  3IF6 A;  1RP5 A;  3B33 A;  2E8J A;  4QPR A;  2QJ5 A;  5HFO A;  4IED A;  2P04 A;  2P74 A;  2EXB A;  5JYO A;  3PBR A;  2J3T D;  4GZB A;  3HRE A;  5GLB A;  3ICY A;  1PYY A;  1YLT A;  1Z6F A;  1VHM A;  1CI8 A;  4Y7P A;  4EER A;  3CHW P;  3BWL A;  3MR0 A;  4X1M A;  2INW A;  3R7W B;  1CK3 A;  2O0Y A;  3VP3 A;  4HIA A;  5KSC A;  2QMI A;  2K7S A;  4KZB A;  3HLE A;  3LUQ A;  3SH7 A;  1KE0 A;  1MXO A;  2WKE A;  1G6A A;  3HUN A;  3RH8 B;  2HDQ A;  2VGL S;  5FL3 A;  4R38 A;  2EWV A;  3LIB A;  2EA9 A;  4OPY A;  2VGK A;  5EVL A;  3IT9 A;  1H8M A;  2XR0 A;  2W3D A;  5GLD A;  5FAP A;  4HQA A;  4MMN A;  1XGI A;  2ZQD A;  1CI9 A;  1FOF A;  2UV0 E;  3I7J A;  1ALQ A;  2JN7 A;  2XFS A;  4OVD A;  2H0T A;  5TR7 A;  1ERO A;  3OCN A;  1FIL A;  1LHY A;  4JBF A;  4KEN B;  2O99 A;  1YQS A;  3MS6 A;  4E3J A;  3UPP A;  3A0R A;  2ZQA A;  4KQR A;  1XA7 A;  3LIE A;  5J3W A;  2ACG A;  2FFY A;  1TS6 A;  4GOG A;  3TE8 A;  4IBX A;  4GD8 A;  2ZMA A;  3UPO A;  4N92 A;  4P6B A;  4RYE A;  1VEU B;  2G2U A;  3OC2 A;  4HP9 A;  3HBR A;  3G35 A;  3LEZ A;  3T4Q A;  4HY8 A;  4BWI A;  2QPN A;  5M18 A;  3ZG8 B;  3DTE A;  3LID A;  3S7Q A;  3V3R A;  3GRJ A;  3OOV A;  2YKH A;  3DW0 A;  1AWI A;  4RX3 A;  4WBG A;  3E2L A;  4MDZ A;  4ARZ A;  3G2Y A;  1J9M A;  3EEH A;  3MFX A;  3LI9 A;  3N8S A;  3LR4 A;  4NKP A;  5IS1 A;  1NLZ A;  4QU3 A;  4EEU A;  1DP9 A;  5FQK A;  4JXV A;  4LV1 A;  3EQV A;  3QP1 A;  3LR0 A;  3GDI A;  4QY5 A;  1QME A;  4KZ9 A;  4OLD A;  1K57 C;  4N1H A;  4GW9 A;  3MZD A;  2HDU A;  2ZM0 A;  3SS3 A;  3G31 A;  3GR2 A;  3LIA A;  4Y0T A;  1NLY A;  3BY9 A;  2DRW A;  3NJA A;  2WAE A;  1KDW A;  5AVF A;  1P0Z A;  4L9G A;  3WS0 A;  2V0W A;  2WGV A;  2PR5 A;  3ZG7 B;  1MZU A;  3VE3 A;  1XX2 A;  1PW8 A;  4QD4 A;  2OLV A;  1EW0 A;  3CZD A;  2ZQ7 A;  1DJA A;  3E4O A;  1XFN A;  4NET A;  3EQU A;  3NOU C;  3F1O B;  4HEF A;  3H82 B;  4S2O A;  5CHJ A;  4JXG A;  1OPX A;  3DTI A;  3QP6 A;  3FG8 A;  3E0Y A;  5CXW A;  2V0U A;  5F6A A;  4Y17 A;  2Q0O A;  3G34 A;  2Z2M B;  5HWT A;  4IJG A;  4ETZ A;  4ETX A;  2C5W B;  3DTK A;  4I3J A;  5L2F A;  5HWW A;  5DKL A;  5J7E A;  4XT2 B;  3LEQ A;  2RL3 A;  4OQI A;  2OV5 A;  4NXB A;  3BFG A;  4HOI A;  3P7N A;  4LRZ E;  4S2M A;  4ZBE A;  1DJB A;  3VP0 A;  4K08 A;  5F68 A;  3FV7 A;  5KZH A;  5HD3 A;  5DKK A;  3ZVT A;  3EWK A;  1YMS A;  5AVE A;  2WZX A;  3V67 A;  4A5R A;  1SKO B;  2EX8 A;  2J7V A;  4S2J A;  4BD0 A;  4WEJ A;  2PR6 A;  1JVJ A;  4LCM A;  1K54 C;  3Q7Z A;  1KGF A;  5EPH A;  1YLP A;  1RGZ A;  4YIN A;  1OJ5 A;  1T19 A;  3Q7V A;  4II7 A;  3BY8 A;  3C7U A;  1JTG A;  4EES A;  5F69 A;  3IX3 A;  1OTI A;  1FCN A;  2VGJ A;  4PKY G;  1L0G A;  4WF0 A;  5DTS A;  4OON A;  5HDS A;  4Y15 A;  3HLF A;  3D4F A;  3JVU A;  1IKI A;  3TJZ C;  1NY0 A;  3ITB A;  1T18 A;  1FCM A;  3O87 A;  4L9F A;  2O9A A;  2ZMF A;  2OAP 1;  5G4Y A;  4KZ4 A;  3V50 A;  4WLA A;  1BLP A;  2FZ0 A;  1LL8 A;  4UA6 A;  4KQO A;  5EM0 A;  5GHX A;  4G3K A;  2O9B A;  3VMA A;  2V8F A;  1S1Z A;  3LGO A;  4FH4 A;  4IVI A;  1IEM A;  4Q8I A;  2M7V A;  2BG1 A;  2Y2H A;  1GA9 A;  5HWV A;  4BL2 A;  3R7W A;  4E6W A;  2A24 B;  3WS2 A;  3F1P B;  3BFF A;  3MZE A;  1GCE A;  3BEC A;  1V9Z A;  2VGL M;  1FSY A;  5IU1 A;  2V1Z A;  2VA0 A;  3U4L P;  4JGR A;  3D9Y A;  3H9W A;  4LV2 A;  2M7U A;  4EET B;  5U47 A;  4Y0U A;  1KVL A;  3CUE A;  1F2K A;  1XFQ A;  3CMZ A;  5TGF A;  2H28 A;  2QKP A;  2VV7 A;  4LRY C;  1K56 D;  1OJG A;  3N7W A;  3A0S A;  5CED A;  1LL5 A;  1MWT A;  3JPU A;  1MY8 A;  3H7W A;  5HAR A;  5FA7 A;  3V5M A;  3B3X A;  1YT4 A;  5AQB A;  4C3Q A;  3PBQ A;  1JWV A;  4S2N C;  4JGO A;  3PBO A;  5F1F A;  4Q0J A;  2ZL1 B;  2DMW A;  3B47 A;  4UA7 A;  4DN0 A;  4MN5 A;  4PM9 A;  3ZYT A;  3BFD A;  1PRQ A;  1W63 M;  1VM1 A;  3S22 A;  4M3K A;  1VQQ A;  3ZNY A;  3MBZ A;  4HP4 A;  3UDX A;  1VEU A;  4MN7 A;  2HV1 A;  2Y8H A;  2HF6 A;  4KZ3 A;  3MQO A;  3PHY A;  1Y4O A;  2W3F A;  4LGW A;  4BBV A;  2W1R A;  3GMW A;  3RTY A;  3G32 A;  2Y2J A;  3UPN A;  5EVI D;  4WMC D;  3S7P A;  1YM1 A;  3Q1F A;  3T4S A;  1GA0 A;  3OLO A;  2PU4 A;  2XSS A;  3M6B A;  4IVK A;  2W27 A;  2WYX A;  4I3A A;  1ES2 A;  2XK1 A;  4HJ3 A;  1W5D A;  4Z1W A;  4P85 A;  4HH2 A;  4QHC A;  4PM7 A;  3GQZ A;  3C30 A;  1W63 Q;  4BQM A;  1IYQ A;  4O7D A;  2QJ7 A;  2B02 A;  4X56 A;  1BT5 A;  4XUX A;  5CTN A;  4KQQ A;  2XRN A;  4R23 A;  3SS5 A;  1NZU A;  3BRM A;  1FIK A;  3W4Q A;  4WN5 A;  2PBD P;  1S1Y A;  2ZQC A;  5TBM B;  3W2Z A;  2KLI A;  3FKV A;  3LIC A;  1OTB A;  3IXD A;  1BUL A;  5CHM A;  3UE1 A;  4ZDX A;  3UB5 P;  3TW8 A;  4DXC A;  2R9X A;  1S6R A;  4WZ5 C;  4NXE A;  4O0P A;  1G28 A;  2WK0 A;  3TOI A;  4S2K A;  1ODV A;  3IH8 A; 
#chains in the Genus database with same CATH homology
 4MDZ A;  2GJ3 A;  4ARZ A;  4G3W A;  4GLQ A;  1LSX A;  2W1T B;  3NOT C;  3F1O A;  3EEH A;  1F5M A;  1OT6 A;  3MFX A;  2OAQ 1;  1F98 A;  3LI9 A;  5KSH A;  2BAS A;  3LR4 A;  4NKP A;  1Y28 A;  5F5Y A;  4B9O A;  5IS1 A;  1NLZ A;  4EEU A;  2O9C A;  1DP9 A;  5HL6 A;  2PHY A;  5DJT A;  2GX5 A;  2J3W A;  3EQV A;  3LR0 A;  4UQI M;  3GDI A;  5LBR A;  3PBS A;  2OWH A;  3KYQ A;  1LSV A;  1TS7 A;  4KUK A;  4R6L A;  3F1N B;  4EQ1 A;  1S66 L;  3RFB A;  4GW9 A;  4OOL A;  1OTD A;  3E98 A;  1WA9 A;  4XT2 A;  1D06 A;  3MMH A;  3LIA A;  4MN6 A;  1GSW A;  1NLY A;  1LT0 A;  2MJ6 A;  3EGD C;  3KSG A;  4CLC A;  1H3Q A;  2HJ9 C;  3BY9 A;  4KUO A;  3UE3 A;  3NJA A;  1N9O A;  1N9L A;  2WKQ A;  3VV4 A;  4R3A A;  4LLO B;  5AVF A;  2XRO A;  2CMN A;  3KX0 X;  2JKR I;  3IS2 A;  4BMW A;  1DP8 A;  4L0L A;  4DJ2 A;  1P0Z A;  4L9G A;  2PYP A;  3LIF A;  2V0W A;  4IHQ A;  3UB9 A;  1NRJ A;  4GS9 B;  2W0N A;  2PR5 A;  4HHD A;  3CUE C;  5HD5 A;  1MZU A;  4GHI B;  3VE3 A;  5IT5 A;  2JKR M;  5HPI A;  3NHQ A;  4ME4 A;  1EW0 A;  2OWJ A;  1NWZ A;  4DJ3 A;  2R78 A;  3T4K A;  4BBT A;  3E4O A;  5KIZ A;  1XFN A;  2V9A A;  5C5K A;  4HJ4 A;  3EQU A;  4H6J A;  4ARZ B;  3NOU C;  3F1O B;  2OOL A;  3S7O A;  3FPW A;  3H82 B;  2KOI A;  3T4L A;  3IBJ A;  4PKY A;  1OPX A;  2WKP A;  2D02 A;  2PYR A;  1JNU A;  2VEA A;  2J80 A;  4BBU A;  3R4K A;  4O8G A;  2VJW A;  3FG8 A;  2L0W A;  3E0Y A;  4BJP A;  2V0U A;  5F6A A;  2P7J A;  3PBT A;  5HWT A;  4IJG A;  4ETZ A;  2YKF A;  4ETX A;  1OTA A;  3CLO A;  3VOL A;  2LB5 A;  3LI8 A;  1P9R A;  4I3J A;  2W3H A;  1ZHH B;  3UE6 A;  1OT9 A;  4IUK A;  5HWW A;  2ZOI A;  3KO6 A;  5DKL A;  5J7E A;  4XT2 B;  4UQI S;  2IA2 A;  2K31 A;  4KQD A;  1T1A A;  2J3T C;  1MC0 A;  2WKR A;  2W3E A;  4GJ4 A;  3PXP A;  1XJ2 A;  4NXB A;  1ZTU A;  2GZA A;  4HOI A;  2QHK A;  3P7N A;  1T1C A;  4LRZ E;  4GCZ A;  4IUH A;  1S4S A;  2QWS A;  3BQA A;  4K08 A;  2GNX A;  5F68 A;  3IS2 B;  5HD3 A;  5DKK A;  1KOU A;  1TD5 A;  3EWK A;  3MQQ A;  5AVE A;  4LRX C;  3V67 A;  5TJJ A;  3EGX C;  3P01 A;  3H82 A;  3PYP A;  3UB8 A;  4WEJ A;  3JVV A;  1TS0 A;  3E4Q A;  2PR6 A;  4Y2F A;  4CLC E;  3TRC A;  2HGV A;  4CLC D;  3F1P A;  2Z6C A;  3UMD A;  4H6J B;  1V9Y A;  2Y79 A;  4WEK A;  1OJ5 A;  1T19 A;  4G3V A;  3U2A A;  1D7E A;  4II7 A;  3BY8 A;  4HJ6 A;  3PR6 A;  5CX7 A;  4O01 A;  4JGQ A;  2HJE A;  4EES A;  1XJ3 A;  4EXO A;  3T50 A;  5F69 A;  2FH5 A;  3C38 A;  4RQ9 A;  1F9I A;  2QYB A;  1OTI A;  4I3I A;  3UB6 A;  2PD8 A;  4FSF A;  4PKY G;  2Z6D A;  1YKD A;  2JKT I;  4OOM A;  4WF0 A;  3IBR A;  3VE4 A;  3HJK A;  4Y5F A;  2G7U A;  3CI6 A;  3LR5 A;  2D01 A;  4WUJ A;  5HDS A;  4R70 A;  3BW6 A;  2JKT M;  4ZRR A;  2EWW A;  5L8M A;  4P6Z S;  3JVU A;  4CQH A;  3HJI A;  3ULF A;  3TJZ C;  1GSV A;  1S4R A;  2LB9 A;  2VV8 A;  1T18 A;  3MQ0 A;  2L4R A;  2KDK A;  1UWP X;  1DP6 A;  4E04 A;  4L9F A;  2O9A A;  2VV6 A;  2ZMF A;  3B42 A;  2OAP 1;  5G4Y A;  3MXQ A;  4WLA A;  2PDR A;  2FZ0 A;  2VLG A;  1LL8 A;  4WL9 A;  2ZMV A;  4KQO A;  5A8B A;  4G3K A;  2O9B A;  3K2N A;  5DF9 A;  4HI4 A;  3PBN A;  1S1Z A;  4EEP A;  3H7W B;  2VX8 A;  2M7V A;  4MCW A;  5HWV A;  1LSW A;  5G4Z A;  2JHE A;  5HDC A;  3R7W A;  1G6O A;  2A24 B;  1YAX A;  3F1P B;  2PT7 A;  1V9Z A;  2VGL M;  1GSX A;  3O5Y A;  2W3G A;  5IU1 A;  3LYX A;  2VA0 A;  1P9W A;  2B18 A;  2VKS A;  2XA7 M;  4JGR A;  4PHT A;  4NXF A;  3H9W A;  2M7U A;  4EET B;  3KSI A;  5EFW A;  1X0O A;  3D3O A;  4UEY A;  1STZ A;  3CUE A;  1YSQ A;  2KX6 A;  4Y3I A;  4B93 A;  1XFQ A;  1IOU A;  1UGU A;  1BYW A;  4F3L A;  2H28 A;  4CLC C;  2QKP A;  2VV7 A;  4LRY C;  1OJG A;  5HPF A;  1YSP A;  3A0S A;  2A2L A;  3T4T A;  4Q0H A;  1XJ6 A;  2L1M A;  4Q0I A;  3LFV A;  3H7W A;  3C2W A;  3B33 A;  1VB6 A;  4QPR A;  3K3C A;  2QJ5 A;  3PBQ A;  2P04 A;  2A24 A;  1T1B A;  4JGO A;  3PBO A;  4Q0J A;  3PBR A;  4PAU A;  4DMZ A;  2DMW A;  3B47 A;  4DN0 A;  1S67 L;  4MN5 A;  1TF1 A;  2J3T D;  2M1C A;  3ZYT A;  1XJ4 A;  5DJU A;  1TS8 A;  3ICY A;  1W63 M;  4I5S A;  4EW7 A;  3S7N A;  1P97 A;  4I39 A;  1VHM A;  4EER A;  4HP4 A;  3BWL A;  2V1A A;  3MR0 A;  3BQ8 A;  2INW A;  4MN7 A;  3R7W B;  5DFX A;  2HV1 A;  2O0Y A;  2Y8H A;  2HF6 A;  5TBM A;  2ZBB A;  3MQO A;  4HIA A;  3PHY A;  5HZH A;  5I5L A;  2K7S A;  3MJQ A;  1OTE A;  4HH3 A;  2W3F A;  3SW1 A;  4NXG A;  3FPV A;  3LUQ A;  3T4O A;  3KSF A;  3MF0 A;  2W1R A;  4BBV A;  3RTY A;  2ZOH A;  3RH8 B;  4JGP A;  2VGL S;  3ZQ5 A;  4YNR A;  5FL3 A;  4L9E A;  4R38 A;  3S7P A;  2EWV A;  2XA7 S;  3CAX A;  4YWZ A;  3LIB A;  2EA9 A;  2W1T A;  3T4S A;  1H8M A;  4EU0 A;  4F3L B;  2NUT C;  3OBF A;  3KSH A;  2I9V A;  2P08 A;  3OLO A;  4LPZ A;  2XSS A;  2W3D A;  3G6O A;  4FOF A;  2VZW A;  2W27 A;  4HQA A;  4MMN A;  3FC7 A;  3OCL A;  3K3D A;  4I3A A;  4EUV A;  5HSQ A;  3CWF A;  1UWN X;  5J4E A;  3C8C A;  2JN7 A;  4HJ3 A;  3F1N A;  4Z1W A;  3EOI A;  3OCN A;  3A0V A;  2PD7 A;  4HH2 A;  2O99 A;  3LR3 A;  1N9N A;  3NOP C;  3A0R A;  3EEA A;  3C30 A;  1W63 Q;  3LIE A;  3GEC A;  1DRM A;  5J3W A;  2NUP C;  1TS6 A;  3TE8 A;  4P6Z M;  2QJ7 A;  2B02 A;  5AJG A;  2XRN A;  4M4X A;  2V1B A;  3UME A;  4NEE D;  3UB7 A;  3DBA A;  4WN5 A;  3OC2 A;  5HDD A;  3KYZ A;  4HP9 A;  4I38 A;  1S1Y A;  5K5B A;  5TBM B;  3W2Z A;  3HCY A;  2KLI A;  3LIC A;  3T4Q A;  3D72 A;  1OTB A;  4GS9 A;  4HY8 A;  4BWI A;  3E4P A;  5MC7 A;  4GHI A;  3T4J A;  4YOF A;  3BJN A;  5DFY A;  4CLC B;  3TW8 A;  1IFQ A;  3LID A;  4AFI A;  3S7Q A;  4NXE A;  4O0P A;  4HNB A;  3OOV A;  1G28 A;  2YKH A;  1ODV A;  1MKM A;  3CIT A;  4WEL A;  2K2N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...