1OTBA

Wild type photoactive yellow protein, p63 at 295k
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
125
structure length
125
Chain Sequence
MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photoactive yellow protein
publication title Short hydrogen bonds in photoactive yellow protein.
pubmed doi rcsb
source organism Halorhodospira halophila
molecule tags Signaling protein
total genus 37
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2003-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1otbA00
2I9VA 4JGRA 4L9EA 2QWSA 4HJ3A 4RQ9A 4GS9B 3ULFA 3E4QA 2PYRA 4LRYC 1S4SA 1OT9A 5KIZA 2OWJA 1NWZA 1WA9A 1UWPX 4EETB 1OTIA 2GJ3A 4HH3A 3HJIA 4R3AA 5J4EA 1XJ4A 3K3DA 1N9OA 3B33A 3BWLA 3ICYA 4I38A 5HWWA 4NXEA 1OTAA 2WKRA 3BY9A 4WF0A 5HDDA 5J7EA 3FG8A 1V9YA 3F1OB 1P0ZA 5I5LA 3UB9A 3UB6A 1TS0A 4MN6A 2QJ5A 3LI8A 2OWHA 1T1BA 3LI9A 3P7NA 4KUKA 4BBVA 1XJ3A 1S67L 1LL8A 2V0WA 2PR6A 3NOUC 5DJTA 5DKKA 5F6AA 4I3AA 4LRXC 2PD7A 2M1CA 3F1OA 4M4XA 2YKHA 3D72A 4I5SA 3MR0A 2EA9A 3LIEA 4EEPA 5DKLA 4LPZA 5HWVA 2VV7A 3LIFA 3H7WA 3F1PB 1EW0A 3OLOA 2BASA 1UGUA 4HIAA 1XJ2A 3K3CA 4XT2B 3T50A 1TS8A 4I39A 2B02A 3LIBA 1VB6A 5G4ZA 3LIAA 4GHIA 4R70A 1LSVA 2QHKA 1DP6A 5DJUA 5J3WA 2YKFA 4L9FA 4HJ4A 4F3LB 2V1BA 1D7EA 2D02A 4XT2A 4BBUA 2L4RA 1OTBA 2VV8A 3H82B 3MFXA 3GDIA 1F9IA 3G6OA 4L9GA 2CMNA 4F3LA 3C8CA 4DJ2A 4WUJA 3BY8A 4LLOB 3E4OA 4JGOA 3H82A 4NXFA 4GS9A 3KX0X 2PYPA 2PD8A 2QJ7A 1T19A 3A0VA 3FC7A 4NXGA 2INWA 1OJ5A 1LSWA 1OTEA 5F68A 4HY8A 4EW7A 5G4YA 5AVFA 2J80A 5F69A 2ZBBA 1GSXA 3MXQA 3A0RA 1KOUA 1XFQA 4WLAA 4H6JB 1LT0A 2VEAA 1XFNA 4MN5A 5HSQA 2PDRA 4HJ6A 4E04A 1GSVA 1UWNX 3EEHA 2JN7A 4EQ1A 3LICA 3IBRA 3SW1A 1Y28A 4EERA 1GSWA 1DRMA 4I3IA 4I3JA 2V1AA 1XJ6A 3PHYA 2K7SA 4HP9A 3MQOA 1DP9A 4WL9A 3C2WA 5TBMB 1V9ZA 3NOPC 5EFWA 2H28A 3F1PA 3CWFA 4JGPA 4WN5A 3E4PA 1T1AA 3CAXA 3F1NB 1F98A 1P97A 4R38A 2V0UA 3UB7A 3A0SA 5HDSA 1OJGA 2P7JA 3NHQA 3UB8A 1DP8A 4DJ3A 1N9LA 2VLGA 3F1NA 3UMEA 2ZOHA 2R78A 3CLOA 3MJQA 4K08A 2W0NA 3VOLA 1BYWA 4KUOA 1MZUA 1S4RA 4YWZA 2KX6A 3NOTC 2PR5A 5HD5A 1D06A 3IS2B 5HDCA 3ZQ5A 2A24B 5F5YA 1TS6A 4PKYG 2Z6DA 4GCZA 4HP4A 4B9OA 5IU1A 2W27A 4LRZE 2V9AA 2QKPA 3RTYA 3LUQA 4GW9A 3IS2A 4EESA 5AVEA 5HD3A 2A24A 4NXBA 2WKPA 1N9NA 1OT6A 3H7WB 3LIDA 2JHEA 1LSXA 3LYXA 3EWKA 3GECA 3VE3A 3UE6A 2ZOIA 2OOLA 4HQAA 3HJKA 4HOIA 4PKYA 2HV1A 2WKQA 4R6LA 4H6JA 2KDKA 1S66L 3NJAA 3MQQA 4EEUA 4EXOA 1ODVA 1TS7A 2L0WA 5HWTA 4GHIB 2Z6CA 3PYPA 3RH8B 2L1MA 2VV6A 1G28A 5A8BA 1OTDA 4HHDA 1JNUA 4KQDA 4BBTA 3UMDA 1S1ZA 3VE4A 4HH2A 5IS1A 3H9WA 2D01A 1S1YA 5TBMA 1X0OA 4HNBA 4JGQA 1T1CA 2PHYA 4HI4A 1T18A 5HZHA
chains in the Genus database with same CATH superfamily
4WZ5C 3HVFA 1YMXA 3VOYA 4EBNA 1DJAA 3V3RA 4OLDA 3PR6A 2PU2A 4KG5A 4NEED 2X71A 2DCFA 3MQ0A 2PYRA 1FOFA 4YFMA 5KIZA 2OWJA 4DMZA 5EE8A 4C75A 2GJ3A 3NULA 2V20A 4U0XA 1XJ4A 1K4EA 1ZG4A 1N9OA 3T4KA 3L9KA 1YLTA 5HWWA 4GZBA 3W4QA 2WKRA 3QNBA 4WF0A 1A0KA 2J9PA 4S2KA 3ZG9B 1IOUA 5J7EA 5BOHA 1NZOA 1K6RA 3IT9A 1V9YA 2VX8A 3MZEA 2KOIA 3UB9A 1P9WA 4P6ZS 5E2HA 2JKGA 3T12B 2HP5A 2QJ5A 1O07A 2OWHA 1H3QA 3GQZA 5EM1A 3CUEA 3IWOA 1BUEA 2PR6A 5DJTA 2GNXA 3NC8A 3SH7A 4I3AA 4LRXC 3VOZA 1YKDA 1DJBA 4JLFA 2M1CA 4EBPA 4G3VA 2Y2NA 3MR0A 2EA9A 5DKLA 2VV7A 1FR6A 3DTMA 3H7WA 3BLSA 1CEFA 2XQZA 2M7UA 4QWOA 2BASA 1KGEA 1PWCA 3B42A 3VFHA 4KQOA 4UQIM 4GDNA 5TFQA 2WADA 4XT2B 3HREA 1TS8A 2XROA 2ZM0A 4Z9QA 1SKFA 4BL2A 3D3OA 1KGFA 3G30A 3K2NA 3AGDA 3ZFZA 4GOGA 3NY4A 3FKWA 2H10A 5DTTA 4WELA 1K56D 1S6RA 1HZOA 3IXBA 4HJ4A 4Q0IA 5CHJA 2D02A 1XA7A 4XT2A 3Q7ZA 4R3JA 4S2MA 1E3UD 1ZG6A 2J3TC 2RL3A 3LR5A 2HF6A 4LFUA 4UAAA 2ZC6B 4FUWA 3S4XA 4MBHA 1YLYA 4HBTA 3G6OA 1NXYA 1JVJA 1PW8A 2FH5A 5L8MA 3A3DA 4UA6A 1PZOA 4RX3A 4ME4A 4EQIA 4ZAMA 3BFEA 3VV4A 4Y0TA 4QJGA 4IVKA 2BG1A 1VHMA 4BWIA 2ZMFA 4GS9A 3ZG7B 4EUVA 2Z2MB 2PYPA 2W3GA 2P04A 1WYCA 1T19A 4OOYA 2J7VA 2Y2MA 5E43A 4FCFA 3GTCA 2HDQA 1FILA 1OTEA 2FFFB 4EUZA 4EW7A 1VEUB 4HESA 4ZJ2A 4PMAA 5FDHA 2Y2IA 5F69A 3MBZA 3R7WB 4O0PA 3LFVA 5AQ7A 3A0RA 1TVFA 4Z1WA 1CQAA 4WLAA 3VP0A 1NJ4A 5M18A 4Q8IA 1LT0A 2WK0A 5HFOA 4BMWA 4MN5A 1RGZA 4MNRA 1KE4A 2K2NA 1LL5A 4M3KA 4UA9A 3W8KA 3EEHA 2JN7A 1DJCA 4ESPA 2ZM2A 4ZDXA 2OLUA 3IBRA 4PM7A 1IYSA 1DRMA 2VGLM 1XJ6A 2K7SA 4HP9A 4WZ4A 1P9RA 1ZHHB 3S7PA 2W1RA 2W3HA 1K38A 5HX9A 3HLBA 2Y4AA 3CZDA 3F1PA 1Z6FA 3ITBA 3E4PA 3V39A 1PZPA 3MMHA 1QMEA 4NETA 2GX5A 3IHBA 1G6AA 3ZVWA 2ZQ9A 4II7A 3UNWA 1EROA 4R0QA 1BT5A 2ZMVA 4X1LA 1N9LA 3S7QA 3W4OA 5FAPA 3S7NA 2J3TD 3CLOA 3MJQA 5EVIB 2W0NA 2ZL1B 4PM9A 5FDSA 4G3KA 4GD6A 2XD5A 2G2WA 1ONGA 2ZC7A 4DDYA 3QHYA 3SS5A 4P6BA 2IA2A 5HD5A 3CITA 1MWTA 5FQIA 3Q7VA 1L0FA 3MXRA 5HDCA 5L07A 1HLUP 2Z2LB 4FD8A 3T4LA 2ZL1A 3KYZA 4PAUA 4MBKA 1FCOA 3MXSA 1Q2QA 4OONA 2X01A 4UQIS 4WEKA 1YMSA 4P0MA 4O01A 5E2FA 5F1FA 2WKPA 1IYQA 1N9NA 2EXBA 3CI6A 1K0KA 5A93A 4HOIA 4PKYA 3N8LA 3ZVTA 3A3JA 2DMWA 4BLMA 5FQKA 3BQAA 4KQQA 2EWWA 3PYPA 2EX8A 4OPRA 3BYDA 1OTDA 4Y2FA 3JYIA 1JNUA 2VGJA 5TR7A 4N92A 4S2IA 4Y0OA 2HDRA 1S1ZA 4ZJ1A 3IXHA 4U0TA 4E3OA 5HAIA 3N8SA 5IS1A 5AQBA 1W63M 2MJ6A 3BFDA 1S1YA 4CLCB 5TBMA 3U2AA 2Y79A 1ESUA 3WS1A 4HNBA 2K31A 3HUOA 1YPRA 4N9LA 4K91A 3BM6A 3IWQA 2HJEA 4JXGA 1T18A 3DWKA 3UY6A 1WYBA 2Y55A 3G4PA 5DF7A 2QWSA 3IQAA 4CLCA 4HJ3A 2OV5A 2W1TB 3O3VA 3FZCA 3E4QA 1MY8A 4MDZA 4DDSA 2WZXA 1OT9A 1FSYA 1BLCA 2J9OA 4OPQA 4MCWA 1OTIA 5EECA 3HJIA 5J4EA 3K3DA 3E2KA 4PHTA 1XPBA 2EXAA 3OBFA 1FCMA 4O7DA 4X1MA 2H5SA 3FG8A 3WS0A 3OPPA 4KZ5A 2GZAA 3F1OB 1P0ZA 2VGLS 5I5LA 1L0GA 1TD5A 4Y17A 3OOVA 4LENA 3HL9A 4PM6A 3OPLA 1G6OA 2A49A 4DE3A 4IBXA 5C5KA 3P7NA 1M40A 3NBLA 1EI5A 2W3EA 4KUKA 4BBVA 3M6BA 3I7JA 4OQ0A 2V0WA 4ZBEA 5CHMA 5DKKA 2XR0A 5F6AA 1Q2PA 1K6SA 3F1OA 3WS2A 4M4XA 4X69A 1J9MA 3CPTB 1MXOA 2V2FF 4EEPA 3GR2A 4E6XA 1ERMA 5HWVA 3LIFA 2XGNA 4JF5A 4QB8A 3TJZC 3HUNA 4DE0A 5HW3A 1EW0A 4MMNA 3OLOA 4B93A 1I2SA 1UGUA 5TJJA 4OLGA 1Y54A 2Y59A 1XJ2A 1E4DA 3K3CA 3N7WA 1VB6A 2XK1A 5DF8A 3V3SA 5G4ZA 4CQHA 1H8MA 4E3KA 4S2NA 5FI7A 4B88A 4XXRA 4C6YA 4DF6A 1DP6A 4GJ4A 3ITAA 4L9FA 3EGDC 3GVBA 2V1BA 1OMEA 1D7EA 3QP1A 1ACFA 4OQIA 4GB7A 4KZAA 1L2SA 2HDUA 5GHYA 3GV9A 3NI9A 3GDIA 1PWDA 5DTSA 2CMNA 3C8CA 4X25A 3O5YA 3TOIA 3EOIA 2CC1A 4OP8A 1MBLA 3IF5A 5TGFA 2ZQ8A 1MWRA 3JPUA 3E4OA 5CRFA 1F5MA 3AGFA 3EQVA 4L0LA 2WKIA 3KX0X 2PD8A 2UV0E 3VMAA 4LV0A 3FC7A 3IBJA 1XGIA 5F82A 2ZQAA 5HPFA 2NUTC 4E3IA 4E3MA 4HY8A 4RVAA 1G68A 3HUMA 2JBFA 1E25A 4IUHA 4PM8A 3QP5A 4QU3A 1EWZA 3HLEA 1YQSA 5CERA 2ZBBA 1GSXA 2P08A 2XRNA 2Y2GA 5CEBA 4H6JB 4Y15A 2VEAA 3LEQA 1XFNA 2XDMA 3C5AA 3M2KA 1Y4OA 3IH8A 5HSQA 2PDRA 2XLNA 4HJ6A 1GHPA 4E04A 3N4IA 1PI5A 1UWNX 3HLWA 3S22A 1H8YA 1NLZA 3SW1A 3ZHHA 4BD0A 4KQRA 4OQHA 1IELA 3CUEC 4DN0A 4OKPA 5E2EA 4DXBA 4WL9A 3C7VA 3BFCA 3ZYTA 4X68A 3NIAA 4KZ7A 1L0DA 2H28A 3D4FA 4KZ8A 2H0TA 3LR0A 4WN5A 2B95A 4DRTA 2HZ5A 1BZAA 2FFYA 5CGWA 3UB7A 3GRJA 3VP2A 5GHZA 4MN7A 5U47A 3A0SA 3EEAA 3OZHA 4EV4A 1NLYA 1ZTUA 2JCHA 3PBTA 5J8XA 1DP8A 5GLAA 3OPRA 1W79A 2ZQDA 2ZOHA 1FQGA 2PRFA 4K08A 1FCNA 4KUOA 2PAVP 1MZUA 3PBOA 1S4RA 4MEZA 1ES4A 1SDNA 2BTFP 2O9BA 3O88A 3BLMA 4S2LA 5HPIA 1D06A 1BULA 3IS2B 4JXWA 3LGOA 4A5RA 5F5YA 3MZDA 3MZFA 4PKYG 1GA0A 5FEFA 2EX2A 4GCZA 1RGYA 4OOLA 5IU1A 2W27A 5GHXA 4N9KA 5A91A 3C4PA 4QD4A 1NYMA 3IS2A 4YOFA 1ES2A 2WYXA 3RJUA 3G34A 4NXBA 1NZUA 1CI9A 5CECA 3PAGA 3DW0A 3PAEA 4LCMA 1LSXA 1LI9A 5FEGA 3UE1A 1VEUA 3Q07A 4BJPA 3EWKA 3GECA 4LGWA 3N8RA 2OOLA 4JF6A 4X53A 3R7WA 3HJKA 5DF9A 1IYPA 4JPMA 2E8JA 2C6WB 3G35A 3C7UA 1S66L 5FQQA 4EEUA 4ARZB 3UPOA 5FI6A 2FZ0A 3IX3A 1TS7A 4GHIB 4R4SA 2L1MA 1XXMA 1PFLA 3ZNYA 5EVEA 1G28A 3WS4A 2ZC4B 4BBTA 4N1XA 3PBRA 1AWIA 1S0WA 3DTEA 3KYQA 3MKEA 3DWZA 1MKIA 1PRQA 4ARZA 1O7EA 5HL1A 4R3BA 2Y91A 4WYYA 3CMZA 2BLSA 1T1CA 2PHYA 2PT7A 4RYEA 2VA0A 3TG9A 4HI4A 4IJGA 4IUKA 5HZHA 5CHUA 2WGWA 4UHUA 1KDWA 1M6KA 5EM0A 5K5BA 1K54A 4JGRA 2XEPA 3T4SA 3O87A 2QYBA 1AXBA 3ZNTA 1S4SA 5JYOA 1YM1A 4EBLA 1FIKA 3AGEA 1NWZA 1WA9A 1UWPX 1WE4A 4HH3A 1BTLA 2R9XA 4R3AA 1OPXA 5EVIA 4WMCA 3BWLA 3P09A 4Y3IA 1K54C 4Y5FA 4OPYA 2PU4A 3CJMA 2J3WA 4F94A 3GMWA 5G18A 4KG2A 3U4LP 4KZ6A 3LEZA 4KENB 4OQGA 3IWIA 3UB6A 2I72A 1TS0A 3VP3A 1ES3A 4NG2A 4KZ3A 4MN6A 3LI8A 1T1BA 1IEMA 3LI9A 3P01A 4LV3A 3Q81A 5EVIC 1XJ3A 3MF0A 1S67L 3VSKA 1LL8A 2Y2HA 1K25A 4RX2A 2EFXA 4P87A 5GLCA 5HAQA 2YKHA 4DE1A 4K0XA 3UPNA 4I5SA 5E2GA 4GNUA 4Y7PA 3GSGA 2WGVA 2X02A 1L0EA 4OP5A 2XFSA 4FH4A 4U3TA 2WUQA 3S7OA 4KZ9A 4GKUA 3UB5P 3FWLA 4LV1A 2WZZA 3T50A 5CTMA 3IXGA 4I39A 3LIBA 4LCLA 4D2OA 3S1YA 2JKRI 4JXSA 3B47A 3NCKA 2EX6A 2IWCA 3OC2A 4R70A 1YLJA 5DFXA 3DTIA 5DJUA 5J3WA 1RCJA 1H0MA 3G2ZA 2VV8A 3MFDA 2B5RA 3FKVA 4R4RA 3MFXA 1GA9A 5FQJA 1IKIA 3OPHA 2JKFA 4CLCE 5EUAA 4L9GA 2Y2OA 3G31A 3KSGA 1KVMA 1I5QA 3Q1FA 3BY8A 4LLOB 4MLLA 2NUPC 3IX8A 5I94A 2Y2JA 1W5DA 5LBRA 2W1TA 2WAFA 4CLCC 1MKMA 2QJ7A 3A0VA 3VP1A 3JVUA 1RP5A 4NXGA 1LSWA 4LV2A 5F68A 3A3EA 2PBDP 4ZJ3A 5AVFA 1CEGA 2J80A 3HCYA 1N4OA 3MXQA 1LL9A 1KOUA 1XFQA 3ZGAB 1KE0A 4P85A 3WRTA 1STZA 1VM1A 5A90A 3KO6A 1GSVA 2VGKA 4AFIA 1PW1A 2Q0OA 3RXXA 3FPVA 3LICA 1J3WA 1K56A 5EPHA 1Y28A 3V67A 1GSWA 4I3IA 1JWVA 4I3JA 4EWFA 2ZM8A 1U60A 4GN2A 1E3UA 3MQOA 2W3FA 3T4JA 4IVIA 3C2WA 4Y0UA 2Y2LA 4X55A 3CPTA 3NOPC 5EFWA 4S2OA 3WS5A 3NDEA 4E3LA 3CWFA 4JGPA 2OSUA 3D9YA 4R23A 1T1AA 5L2FA 3CAXA 3F1NB 1F98A 1G5UA 3QP2A 3OCNA 2Y2QA 5DVAA 2V0UA 2ZMAA 3DBAA 3TW8A 4GLQA 4QY6A 2WKEA 3FV7A 2JKRM 2XSSA 2P7JA 3NHQA 4S2NC 3F1NA 3UMEA 1BSGA 2ZQCA 3W2ZA 2O0YA 2R78A 3LCEA 3VFFA 1ZC2A 3VOLA 1ESIA 2XFTA 1BYWA 3O86A 4NK3A 1PWGA 4YWZA 1PI4A 3CG5A 5EOOA 4E3NA 2KX6A 1I2WA 1VQQA 1YLWA 1H8ZA 1W7FA 3B3XA 3UDIA 4UEYA 3R4KA 2LB9A 1PYYA 3RXWA 1TS6A 3E2LA 4CLCD 4HP4A 2IWDA 4LRZE 2V9AA 5F1GA 2QKPA 5AQ9A 1NYYA 1W8QA 5HAPA 3RTYA 3LUQA 4GW9A 5D3OA 1KE3A 4EESA 3KYEA 5AVEA 3HLGA 1OT6A 5GL9A 3H7WB 3FYZA 5GLBA 4HEFA 5KSCA 3VE3A 1NY0A 2O99A 2ZOIA 3M6HA 1QMFA 2HV1A 1N9BA 5HARA 3JVVA 4R6LA 4H6JA 3KSFA 4EXOA 1SKOB 3IF6B 4ZTKA 3T4TA 2WKHA 1JTDA 2VJWA 3M2JA 5HWTA 1FR1A 4NKPA 3RH8B 1LI0A 5A8BA 3ISGA 4QY5A 4IBRA 5KMWA 3VE4A 3KSIA 4D60A 3SZTA 1NRJA 4E3JA 2C5WB 4HH2A 4UA7A 2G2UA 1ALQA 1SKOA 1ERQA 3IF6A 5HL6A 3T4QA 4K0WA 2XA7M 2EX9A 1SZVA 2B18A 2Y2PA 5EV0A 4YNRA 5F83A 3CHWP 3HLCA 5FATA 2QMIA 2JKTI 1BLPA 3DTKA 3PBQA 4CJNA 5IT5A 4HBUA 3V50A 2I9VA 4E6WA 4L9EA 3N6IA 2O9CA 4RQ9A 1W8YA 4ETXA 4GS9B 3WRZA 3PTEA 3ULFA 3IF6C 4LRYC 4JXVA 3ZG8B 3PBSA 4EETB 5CXWA 3P98A 3VSLA 2GDNA 3B33A 3C30A 2Q9MA 3E0YA 4I38A 3ICYA 4NXEA 1OTAA 3L7HA 4BQMA 5KZHA 3BY9A 2EFUA 5HDDA 3SH8A 5FQMA 1D1JA 5FQ9A 5GLDA 3TE8A 5DFYA 4B4ZA 4JKTA 4IEDA 3T4OA 4JF4A 3LY4A 4KZBA 5MC7A 3IHAA 2R9WA 4BENA 3C4OA 1XP4A 3BQ8A 1C3BA 3SOIA 1MPLA 3NOUC 4EU0A 3G2YA 3FPWA 3A3IA 2XD1A 1K4FA 2PD7A 5DTKA 3D72A 2XH9A 1XKZA 2WAEA 3UDFA 3LIEA 4LPZA 3SH9A 2LB5A 1SCWA 3F1PB 3PXPA 2V1ZA 4DXCA 2DRWA 1DY6A 3BFGA 1ZKJA 5L09A 1ONHA 4HIAA 2WGIA 1Z09A 4ID4A 2B02A 3UE3A 3IXDA 5AQAA 3BRMA 3LIAA 4GHIA 1LSVA 1FSWA 2UWXA 5AJGA 1XX2A 1YT4A 3MKFA 2QHKA 2QZ6A 2YKFA 1KVLA 4F3LB 4OVDA 1K55A 4QPRA 1XA1A 4Q0HA 4XUXA 2Y8HA 4BBUA 2L4RA 1OTBA 2W3DA 2ZC5B 4FOFA 3H82B 1PNEA 5M1AA 1MWSA 4XUZA 1MWUA 1IYOA 1K57A 3BW6A 5FASA 1F9IA 2IWBA 3Q7VB 5FSRA 2VK3A 5CX7A 4F3LA 4N1HA 4DJ2A 1BLHA 4WUJA 3KSHA 4PPRA 2M7VA 2JKTM 2A2LA 3HLFA 3HLDA 4OOMA 1ES5A 1K55C 1IKGA 3T1XA 2JC7A 4JGOA 1JWZA 3H82A 4NXFA 2OAQ1 3LR3A 3VP4A 3ZDJA 5L10A 3T1RA 1K57C 3QP8A 5EVLA 5CEDA 3C38A 2INWA 3WWXA 5FI2A 1OJ5A 1CI8A 2HDSA 3E98A 4WM9A 4QHCA 5G4YA 5A92A 1CJFA 1TDGA 2A3UA 3Q82A 2PBYA 2Y2KA 3UPPA 1KGGA 2DNSA 3BFFA 3DAVA 1KDSA 2VZWA 3QP4A 3LR4A 3LO7A 4ZRRA 2H0YA 2V8CA 2HPBA 4S2JA 3BECA 2KLIA 2V8FA 2P74A 1GHIA 4EQ1A 1CK3A 2XA7S 5KSHA 1XGJA 1LHYA 3G32A 1TEMA 4GD8A 4S2PA 4EERA 4RA7A 4OPZA 2V1AA 3PHYA 5CTNA 4P6ZM 3T1SA 1BLSA 1DP9A 1GCEA 4O8GA 5TBMB 1V9ZA 1SHVA 1IFQA 3LY3A 1HD8A 3QNCA 4PM5A 4CPKA 3ZG5A 2ZJ9A 4DE2A 4YINA 3RFBA 1P97A 5M19A 4R1GA 4R38A 1W63Q 5HDSA 5CGSA 3SS4A 1OJGA 3BJNA 1YLZA 3UO9A 3UB8A 3A3FA 2ZLYA 2XF3A 1TF1A 4DJ3A 4H8RA 2VLGA 3EQUA 3OCLA 3NECA 2G7UA 2ZC3B 4IHQA 3T1QB 1H5XA 4ETZA 1F2KA 4Y13A 4WEJA 5JYPA 2HP9A 3HBRA 3NOTC 2HP6A 4BL3A 2PR5A 3IH9A 2JE5A 3EGXC 3MS6A 3ZQ5A 2A24B 3V5MA 4Q0JA 2QPNA 4WBGA 3PBNA 4JBFA 1L3LA 2Z6DA 3QP6A 4B9OA 4C3QA 2HJ9C 2Q9NA 1GHMA 2OAP1 3NDGA 2E8IA 1HTZA 1YLPA 4X6TA 2VKSA 3MSHA 4KZ4A 1SDEA 5HD3A 2A24A 1VETB 4FH2A 1MC0A 3UN7A 3LIDA 5IHVA 5EVID 3UE0A 2JHEA 1LLBA 4WMCD 3ZG0A 2RCXA 3SS3A 3LYXA 3UE6A 2ZD8A 2HGVA 4HQAA 1HVBA 2P9VB 4DKIA 4FSFA 2WKQA 1YSPA 4FTXA 2KDKA 1JTGA 2J8YA 3NJAA 1NRFA 3MQQA 1ODVA 4BD1A 1VETA 2L0WA 1JWPA 1PIOA 2Z6CA 3ZCZA 2VV6A 4X56A 4HHDA 4KQDA 5FAQA 1CF0A 2P9VA 3UMDA 1YAXA 4WZ5A 4B4XA 3IX4A 2O9AA 3TSGA 5FL3A 4OH0A 2WGWB 2ZQ7A 4GDBA 1TDLA 3H9WA 2EWVA 5FAOA 2D01A 5FA7A 3BEBA 5EOEA 3TRCA 3W4PA 1X0OA 4G3WA 4JGQA 3UDXA 2AVXA 1YSQA 2OLVA 5CGXA 4KG6A 2ACGA 4MBFA
chains in the Genus database with same CATH topology
5K5BA 2I9VA 4JGRA 4L9EA 2QWSA 3T4SA 4CLCA 2O9CA 4HJ3A 4RQ9A 4ETXA 3PR6A 4GS9B 2QYBA 2W1TB 4NEED 3ULFA 3MQ0A 3E4QA 2PYRA 4MDZA 4LRYC 1S4SA 1OT9A 5KIZA 2OWJA 3PBSA 4DMZA 1NWZA 1WA9A 1UWPX 4EETB 4MCWA 1OTIA 2GJ3A 4HH3A 3HJIA 4R3AA 5J4EA 1OPXA 1XJ4A 3K3DA 1N9OA 3T4KA 3B33A 4PHTA 3C30A 3E0YA 3BWLA 3ICYA 4I38A 3OBFA 5HWWA 4Y3IA 4NXEA 1OTAA 2WKRA 4Y5FA 3BY9A 4WF0A 1IOUA 5HDDA 5J7EA 3FG8A 3TE8A 1V9YA 2J3WA 2VX8A 5DFYA 2KOIA 2GZAA 3F1OB 3T4OA 1P0ZA 2VGLS 5I5LA 3UB9A 1P9WA 1TS0A 4P6ZS 3UB6A 5MC7A 1TD5A 3OOVA 4MN6A 2QJ5A 3LI8A 2OWHA 1T1BA 1G6OA 1H3QA 3LI9A 5C5KA 3BQ8A 3P7NA 3P01A 4KUKA 2W3EA 4BBVA 1XJ3A 3CUEA 3MF0A 1S67L 1LL8A 2V0WA 2PR6A 3NOUC 5DJTA 2GNXA 4EU0A 5DKKA 5F6AA 3FPWA 4I3AA 4LRXC 2PD7A 1YKDA 2M1CA 3F1OA 4M4XA 2YKHA 4G3VA 3D72A 4I5SA 3MR0A 2EA9A 3LIEA 4EEPA 5DKLA 4LPZA 5HWVA 2VV7A 3LIFA 2LB5A 3H7WA 3TJZC 3F1PB 3PXPA 1EW0A 2M7UA 4MMNA 3OLOA 3S7OA 2BASA 4B93A 1UGUA 5TJJA 3B42A 4HIAA 4KQOA 4UQIM 1XJ2A 3K3CA 4XT2B 3T50A 1TS8A 2XROA 4I39A 2B02A 3LIBA 3UE3A 3D3OA 2JKRI 1VB6A 3K2NA 3B47A 5G4ZA 4CQHA 1H8MA 3LIAA 3OC2A 4GHIA 4R70A 1LSVA 5AJGA 4WELA 5DFXA 2QHKA 1DP6A 4GJ4A 5DJUA 5J3WA 2YKFA 4L9FA 4HJ4A 4Q0IA 3EGDC 4F3LB 2V1BA 4QPRA 1D7EA 2D02A 4XT2A 4Q0HA 2Y8HA 2J3TC 4BBUA 2L4RA 1OTBA 2W3DA 2VV8A 3LR5A 4FOFA 3H82B 2HF6A 3MFXA 3GDIA 3BW6A 1F9IA 4CLCE 3G6OA 4L9GA 3KSGA 2CMNA 5CX7A 4F3LA 3C8CA 2FH5A 5L8MA 4DJ2A 4WUJA 3O5YA 3KSHA 2M7VA 2JKTM 2A2LA 4ME4A 4OOMA 3EOIA 3VV4A 3BY8A 4LLOB 1VHMA 3E4OA 2NUPC 4BWIA 1F5MA 2ZMFA 4JGOA 3H82A 4NXFA 3EQVA 4GS9A 5LBRA 2W1TA 4L0LA 4EUVA 2OAQ1 3LR3A 4CLCC 3KX0X 2PYPA 2W3GA 2P04A 2PD8A 1MKMA 2QJ7A 1T19A 3A0VA 3FC7A 3IBJA 3JVUA 3C38A 4NXGA 5HPFA 2INWA 2NUTC 1OJ5A 3E98A 1LSWA 1OTEA 5F68A 4HY8A 4EW7A 5G4YA 5AVFA 2J80A 4IUHA 5F69A 3R7WB 3HCYA 4O0PA 2ZBBA 3LFVA 1GSXA 3MXQA 3A0RA 2P08A 4Z1WA 2XRNA 1KOUA 1XFQA 2VZWA 4WLAA 3LR4A 4H6JB 1LT0A 2VEAA 1XFNA 4BMWA 1STZA 4ZRRA 4MN5A 5HSQA 2PDRA 4HJ6A 4E04A 3KO6A 1GSVA 2K2NA 4AFIA 2KLIA 1UWNX 3EEHA 2JN7A 3FPVA 4EQ1A 2XA7S 3LICA 5KSHA 3IBRA 1NLZA 3SW1A 1Y28A 4EERA 3V67A 1GSWA 1DRMA 4I3IA 2VGLM 4I3JA 3CUEC 4DN0A 2V1AA 1XJ6A 3PHYA 4P6ZM 2K7SA 4HP9A 3MQOA 2W3FA 1DP9A 3T4JA 4WL9A 4O8GA 1P9RA 1ZHHB 3C2WA 5TBMB 3ZYTA 1V9ZA 3S7PA 2W1RA 2W3HA 3NOPC 5EFWA 1IFQA 2H28A 3F1PA 3LR0A 3CWFA 4JGPA 4WN5A 3E4PA 1T1AA 3CAXA 3F1NB 1F98A 3MMHA 3RFBA 2GX5A 1P97A 3OCNA 4R38A 1W63Q 2V0UA 3UB7A 3DBAA 4II7A 4MN7A 3TW8A 3A0SA 4GLQA 5HDSA 3EEAA 1OJGA 3BJNA 1NLYA 1ZTUA 2JKRM 3PBTA 2XSSA 2P7JA 2ZMVA 3NHQA 1DP8A 3UB8A 1TF1A 4DJ3A 1N9LA 2VLGA 3EQUA 3OCLA 3F1NA 3UMEA 2G7UA 2ZOHA 3S7QA 3W2ZA 2O0YA 4IHQA 2R78A 3S7NA 2J3TD 3CLOA 3MJQA 4K08A 4ETZA 2W0NA 3VOLA 1BYWA 4G3KA 4WEJA 4KUOA 1MZUA 3PBOA 1S4RA 4YWZA 2KX6A 3NOTC 2IA2A 2O9BA 2PR5A 5HD5A 5HPIA 1D06A 3CITA 3IS2B 3EGXC 5HDCA 4UEYA 2A24B 3ZQ5A 4Q0JA 3T4LA 3R4KA 2LB9A 5F5YA 3PBNA 1TS6A 3KYZA 4PKYG 2Z6DA 4PAUA 4CLCD 4GCZA 4HP4A 4B9OA 4OOLA 2HJ9C 5IU1A 2W27A 2OAP1 4LRZE 2V9AA 2QKPA 3RTYA 3LUQA 4GW9A 3IS2A 4UQIS 4YOFA 4EESA 2VKSA 4WEKA 5AVEA 4O01A 5HD3A 2A24A 4NXBA 2WKPA 1N9NA 1OT6A 1MC0A 3H7WB 3CI6A 3LIDA 2JHEA 1LSXA 4BJPA 3LYXA 3EWKA 3GECA 3VE3A 3UE6A 2O99A 2ZOIA 2HGVA 2OOLA 4HQAA 3R7WA 3HJKA 4HOIA 4PKYA 5DF9A 4FSFA 2HV1A 2WKQA 1YSPA 3JVVA 4R6LA 4H6JA 2KDKA 2DMWA 3KSFA 1S66L 3NJAA 3MQQA 4EEUA 4ARZB 4EXOA 3BQAA 1ODVA 2FZ0A 3T4TA 1TS7A 2L0WA 2VJWA 5HWTA 2EWWA 4GHIB 4NKPA 2Z6CA 3PYPA 3RH8B 2L1MA 2VV6A 1G28A 5A8BA 1OTDA 4Y2FA 4HHDA 1JNUA 4KQDA 4BBTA 3UMDA 3PBRA 1YAXA 1S1ZA 3VE4A 3KSIA 2O9AA 5FL3A 1NRJA 3KYQA 4HH2A 5IS1A 4ARZA 1W63M 3H9WA 2EWVA 2D01A 2MJ6A 1S1YA 4CLCB 5HL6A 3T4QA 5TBMA 2XA7M 3TRCA 3U2AA 2Y79A 1X0OA 2B18A 4G3WA 4HNBA 4YNRA 2K31A 4JGQA 1T1CA 2PHYA 2PT7A 2JKTI 2VA0A 3PBQA 4HI4A 4IJGA 2HJEA 4IUKA 1YSQA 1T18A 5HZHA 5IT5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I9V A;  4JGR A;  4L9E A;  2QWS A;  4HJ3 A;  4RQ9 A;  4GS9 B;  3ULF A;  3E4Q A;  2PYR A;  4LRY C;  1S4S A;  1OT9 A;  5KIZ A;  2OWJ A;  1NWZ A;  1WA9 A;  1UWP X;  4EET B;  1OTI A;  2GJ3 A;  4HH3 A;  3HJI A;  4R3A A;  5J4E A;  1XJ4 A;  3K3D A;  1N9O A;  3B33 A;  3BWL A;  3ICY A;  4I38 A;  5HWW A;  4NXE A;  1OTA A;  2WKR A;  3BY9 A;  4WF0 A;  5HDD A;  5J7E A;  3FG8 A;  1V9Y A;  3F1O B;  1P0Z A;  5I5L A;  3UB9 A;  3UB6 A;  1TS0 A;  4MN6 A;  2QJ5 A;  3LI8 A;  2OWH A;  1T1B A;  3LI9 A;  3P7N A;  4KUK A;  4BBV A;  1XJ3 A;  1S67 L;  1LL8 A;  2V0W A;  2PR6 A;  3NOU C;  5DJT A;  5DKK A;  5F6A A;  4I3A A;  4LRX C;  2PD7 A;  2M1C A;  3F1O A;  4M4X A;  2YKH A;  3D72 A;  4I5S A;  3MR0 A;  2EA9 A;  3LIE A;  4EEP A;  5DKL A;  4LPZ A;  5HWV A;  2VV7 A;  3LIF A;  3H7W A;  3F1P B;  1EW0 A;  3OLO A;  2BAS A;  1UGU A;  4HIA A;  1XJ2 A;  3K3C A;  4XT2 B;  3T50 A;  1TS8 A;  4I39 A;  2B02 A;  3LIB A;  1VB6 A;  5G4Z A;  3LIA A;  4GHI A;  4R70 A;  1LSV A;  2QHK A;  1DP6 A;  5DJU A;  5J3W A;  2YKF A;  4L9F A;  4HJ4 A;  4F3L B;  2V1B A;  1D7E A;  2D02 A;  4XT2 A;  4BBU A;  2L4R A;  1OTB A;  2VV8 A;  3H82 B;  3MFX A;  3GDI A;  1F9I A;  3G6O A;  4L9G A;  2CMN A;  4F3L A;  3C8C A;  4DJ2 A;  4WUJ A;  3BY8 A;  4LLO B;  3E4O A;  4JGO A;  3H82 A;  4NXF A;  4GS9 A;  3KX0 X;  2PYP A;  2PD8 A;  2QJ7 A;  1T19 A;  3A0V A;  3FC7 A;  4NXG A;  2INW A;  1OJ5 A;  1LSW A;  1OTE A;  5F68 A;  4HY8 A;  4EW7 A;  5G4Y A;  5AVF A;  2J80 A;  5F69 A;  2ZBB A;  1GSX A;  3MXQ A;  3A0R A;  1KOU A;  1XFQ A;  4WLA A;  4H6J B;  1LT0 A;  2VEA A;  1XFN A;  4MN5 A;  5HSQ A;  2PDR A;  4HJ6 A;  4E04 A;  1GSV A;  1UWN X;  3EEH A;  2JN7 A;  4EQ1 A;  3LIC A;  3IBR A;  3SW1 A;  1Y28 A;  4EER A;  1GSW A;  1DRM A;  4I3I A;  4I3J A;  2V1A A;  1XJ6 A;  3PHY A;  2K7S A;  4HP9 A;  3MQO A;  1DP9 A;  4WL9 A;  3C2W A;  5TBM B;  1V9Z A;  3NOP C;  5EFW A;  2H28 A;  3F1P A;  3CWF A;  4JGP A;  4WN5 A;  3E4P A;  1T1A A;  3CAX A;  3F1N B;  1F98 A;  1P97 A;  4R38 A;  2V0U A;  3UB7 A;  3A0S A;  5HDS A;  1OJG A;  2P7J A;  3NHQ A;  3UB8 A;  1DP8 A;  4DJ3 A;  1N9L A;  2VLG A;  3F1N A;  3UME A;  2ZOH A;  2R78 A;  3CLO A;  3MJQ A;  4K08 A;  2W0N A;  3VOL A;  1BYW A;  4KUO A;  1MZU A;  1S4R A;  4YWZ A;  2KX6 A;  3NOT C;  2PR5 A;  5HD5 A;  1D06 A;  3IS2 B;  5HDC A;  3ZQ5 A;  2A24 B;  5F5Y A;  1TS6 A;  4PKY G;  2Z6D A;  4GCZ A;  4HP4 A;  4B9O A;  5IU1 A;  2W27 A;  4LRZ E;  2V9A A;  2QKP A;  3RTY A;  3LUQ A;  4GW9 A;  3IS2 A;  4EES A;  5AVE A;  5HD3 A;  2A24 A;  4NXB A;  2WKP A;  1N9N A;  1OT6 A;  3H7W B;  3LID A;  2JHE A;  1LSX A;  3LYX A;  3EWK A;  3GEC A;  3VE3 A;  3UE6 A;  2ZOI A;  2OOL A;  4HQA A;  3HJK A;  4HOI A;  4PKY A;  2HV1 A;  2WKQ A;  4R6L A;  4H6J A;  2KDK A;  1S66 L;  3NJA A;  3MQQ A;  4EEU A;  4EXO A;  1ODV A;  1TS7 A;  2L0W A;  5HWT A;  4GHI B;  2Z6C A;  3PYP A;  3RH8 B;  2L1M A;  2VV6 A;  1G28 A;  5A8B A;  1OTD A;  4HHD A;  1JNU A;  4KQD A;  4BBT A;  3UMD A;  1S1Z A;  3VE4 A;  4HH2 A;  5IS1 A;  3H9W A;  2D01 A;  1S1Y A;  5TBM A;  1X0O A;  4HNB A;  4JGQ A;  1T1C A;  2PHY A;  4HI4 A;  1T18 A;  5HZH A; 
#chains in the Genus database with same CATH topology
 4WZ5 C;  3HVF A;  1YMX A;  3VOY A;  4EBN A;  1DJA A;  3V3R A;  4OLD A;  3PR6 A;  2PU2 A;  4KG5 A;  4NEE D;  2X71 A;  2DCF A;  3MQ0 A;  2PYR A;  1FOF A;  4YFM A;  5KIZ A;  2OWJ A;  4DMZ A;  5EE8 A;  4C75 A;  2GJ3 A;  3NUL A;  2V20 A;  4U0X A;  1XJ4 A;  1K4E A;  1ZG4 A;  1N9O A;  3T4K A;  3L9K A;  1YLT A;  5HWW A;  4GZB A;  3W4Q A;  2WKR A;  3QNB A;  4WF0 A;  1A0K A;  2J9P A;  4S2K A;  3ZG9 B;  1IOU A;  5J7E A;  5BOH A;  1NZO A;  1K6R A;  3IT9 A;  1V9Y A;  2VX8 A;  3MZE A;  2KOI A;  3UB9 A;  1P9W A;  4P6Z S;  5E2H A;  2JKG A;  3T12 B;  2HP5 A;  2QJ5 A;  1O07 A;  2OWH A;  1H3Q A;  3GQZ A;  5EM1 A;  3CUE A;  3IWO A;  1BUE A;  2PR6 A;  5DJT A;  2GNX A;  3NC8 A;  3SH7 A;  4I3A A;  4LRX C;  3VOZ A;  1YKD A;  1DJB A;  4JLF A;  2M1C A;  4EBP A;  4G3V A;  2Y2N A;  3MR0 A;  2EA9 A;  5DKL A;  2VV7 A;  1FR6 A;  3DTM A;  3H7W A;  3BLS A;  1CEF A;  2XQZ A;  2M7U A;  4QWO A;  2BAS A;  1KGE A;  1PWC A;  3B42 A;  3VFH A;  4KQO A;  4UQI M;  4GDN A;  5TFQ A;  2WAD A;  4XT2 B;  3HRE A;  1TS8 A;  2XRO A;  2ZM0 A;  4Z9Q A;  1SKF A;  4BL2 A;  3D3O A;  1KGF A;  3G30 A;  3K2N A;  3AGD A;  3ZFZ A;  4GOG A;  3NY4 A;  3FKW A;  2H10 A;  5DTT A;  4WEL A;  1K56 D;  1S6R A;  1HZO A;  3IXB A;  4HJ4 A;  4Q0I A;  5CHJ A;  2D02 A;  1XA7 A;  4XT2 A;  3Q7Z A;  4R3J A;  4S2M A;  1E3U D;  1ZG6 A;  2J3T C;  2RL3 A;  3LR5 A;  2HF6 A;  4LFU A;  4UAA A;  2ZC6 B;  4FUW A;  3S4X A;  4MBH A;  1YLY A;  4HBT A;  3G6O A;  1NXY A;  1JVJ A;  1PW8 A;  2FH5 A;  5L8M A;  3A3D A;  4UA6 A;  1PZO A;  4RX3 A;  4ME4 A;  4EQI A;  4ZAM A;  3BFE A;  3VV4 A;  4Y0T A;  4QJG A;  4IVK A;  2BG1 A;  1VHM A;  4BWI A;  2ZMF A;  4GS9 A;  3ZG7 B;  4EUV A;  2Z2M B;  2PYP A;  2W3G A;  2P04 A;  1WYC A;  1T19 A;  4OOY A;  2J7V A;  2Y2M A;  5E43 A;  4FCF A;  3GTC A;  2HDQ A;  1FIL A;  1OTE A;  2FFF B;  4EUZ A;  4EW7 A;  1VEU B;  4HES A;  4ZJ2 A;  4PMA A;  5FDH A;  2Y2I A;  5F69 A;  3MBZ A;  3R7W B;  4O0P A;  3LFV A;  5AQ7 A;  3A0R A;  1TVF A;  4Z1W A;  1CQA A;  4WLA A;  3VP0 A;  1NJ4 A;  5M18 A;  4Q8I A;  1LT0 A;  2WK0 A;  5HFO A;  4BMW A;  4MN5 A;  1RGZ A;  4MNR A;  1KE4 A;  2K2N A;  1LL5 A;  4M3K A;  4UA9 A;  3W8K A;  3EEH A;  2JN7 A;  1DJC A;  4ESP A;  2ZM2 A;  4ZDX A;  2OLU A;  3IBR A;  4PM7 A;  1IYS A;  1DRM A;  2VGL M;  1XJ6 A;  2K7S A;  4HP9 A;  4WZ4 A;  1P9R A;  1ZHH B;  3S7P A;  2W1R A;  2W3H A;  1K38 A;  5HX9 A;  3HLB A;  2Y4A A;  3CZD A;  3F1P A;  1Z6F A;  3ITB A;  3E4P A;  3V39 A;  1PZP A;  3MMH A;  1QME A;  4NET A;  2GX5 A;  3IHB A;  1G6A A;  3ZVW A;  2ZQ9 A;  4II7 A;  3UNW A;  1ERO A;  4R0Q A;  1BT5 A;  2ZMV A;  4X1L A;  1N9L A;  3S7Q A;  3W4O A;  5FAP A;  3S7N A;  2J3T D;  3CLO A;  3MJQ A;  5EVI B;  2W0N A;  2ZL1 B;  4PM9 A;  5FDS A;  4G3K A;  4GD6 A;  2XD5 A;  2G2W A;  1ONG A;  2ZC7 A;  4DDY A;  3QHY A;  3SS5 A;  4P6B A;  2IA2 A;  5HD5 A;  3CIT A;  1MWT A;  5FQI A;  3Q7V A;  1L0F A;  3MXR A;  5HDC A;  5L07 A;  1HLU P;  2Z2L B;  4FD8 A;  3T4L A;  2ZL1 A;  3KYZ A;  4PAU A;  4MBK A;  1FCO A;  3MXS A;  1Q2Q A;  4OON A;  2X01 A;  4UQI S;  4WEK A;  1YMS A;  4P0M A;  4O01 A;  5E2F A;  5F1F A;  2WKP A;  1IYQ A;  1N9N A;  2EXB A;  3CI6 A;  1K0K A;  5A93 A;  4HOI A;  4PKY A;  3N8L A;  3ZVT A;  3A3J A;  2DMW A;  4BLM A;  5FQK A;  3BQA A;  4KQQ A;  2EWW A;  3PYP A;  2EX8 A;  4OPR A;  3BYD A;  1OTD A;  4Y2F A;  3JYI A;  1JNU A;  2VGJ A;  5TR7 A;  4N92 A;  4S2I A;  4Y0O A;  2HDR A;  1S1Z A;  4ZJ1 A;  3IXH A;  4U0T A;  4E3O A;  5HAI A;  3N8S A;  5IS1 A;  5AQB A;  1W63 M;  2MJ6 A;  3BFD A;  1S1Y A;  4CLC B;  5TBM A;  3U2A A;  2Y79 A;  1ESU A;  3WS1 A;  4HNB A;  2K31 A;  3HUO A;  1YPR A;  4N9L A;  4K91 A;  3BM6 A;  3IWQ A;  2HJE A;  4JXG A;  1T18 A;  3DWK A;  3UY6 A;  1WYB A;  2Y55 A;  3G4P A;  5DF7 A;  2QWS A;  3IQA A;  4CLC A;  4HJ3 A;  2OV5 A;  2W1T B;  3O3V A;  3FZC A;  3E4Q A;  1MY8 A;  4MDZ A;  4DDS A;  2WZX A;  1OT9 A;  1FSY A;  1BLC A;  2J9O A;  4OPQ A;  4MCW A;  1OTI A;  5EEC A;  3HJI A;  5J4E A;  3K3D A;  3E2K A;  4PHT A;  1XPB A;  2EXA A;  3OBF A;  1FCM A;  4O7D A;  4X1M A;  2H5S A;  3FG8 A;  3WS0 A;  3OPP A;  4KZ5 A;  2GZA A;  3F1O B;  1P0Z A;  2VGL S;  5I5L A;  1L0G A;  1TD5 A;  4Y17 A;  3OOV A;  4LEN A;  3HL9 A;  4PM6 A;  3OPL A;  1G6O A;  2A49 A;  4DE3 A;  4IBX A;  5C5K A;  3P7N A;  1M40 A;  3NBL A;  1EI5 A;  2W3E A;  4KUK A;  4BBV A;  3M6B A;  3I7J A;  4OQ0 A;  2V0W A;  4ZBE A;  5CHM A;  5DKK A;  2XR0 A;  5F6A A;  1Q2P A;  1K6S A;  3F1O A;  3WS2 A;  4M4X A;  4X69 A;  1J9M A;  3CPT B;  1MXO A;  2V2F F;  4EEP A;  3GR2 A;  4E6X A;  1ERM A;  5HWV A;  3LIF A;  2XGN A;  4JF5 A;  4QB8 A;  3TJZ C;  3HUN A;  4DE0 A;  5HW3 A;  1EW0 A;  4MMN A;  3OLO A;  4B93 A;  1I2S A;  1UGU A;  5TJJ A;  4OLG A;  1Y54 A;  2Y59 A;  1XJ2 A;  1E4D A;  3K3C A;  3N7W A;  1VB6 A;  2XK1 A;  5DF8 A;  3V3S A;  5G4Z A;  4CQH A;  1H8M A;  4E3K A;  4S2N A;  5FI7 A;  4B88 A;  4XXR A;  4C6Y A;  4DF6 A;  1DP6 A;  4GJ4 A;  3ITA A;  4L9F A;  3EGD C;  3GVB A;  2V1B A;  1OME A;  1D7E A;  3QP1 A;  1ACF A;  4OQI A;  4GB7 A;  4KZA A;  1L2S A;  2HDU A;  5GHY A;  3GV9 A;  3NI9 A;  3GDI A;  1PWD A;  5DTS A;  2CMN A;  3C8C A;  4X25 A;  3O5Y A;  3TOI A;  3EOI A;  2CC1 A;  4OP8 A;  1MBL A;  3IF5 A;  5TGF A;  2ZQ8 A;  1MWR A;  3JPU A;  3E4O A;  5CRF A;  1F5M A;  3AGF A;  3EQV A;  4L0L A;  2WKI A;  3KX0 X;  2PD8 A;  2UV0 E;  3VMA A;  4LV0 A;  3FC7 A;  3IBJ A;  1XGI A;  5F82 A;  2ZQA A;  5HPF A;  2NUT C;  4E3I A;  4E3M A;  4HY8 A;  4RVA A;  1G68 A;  3HUM A;  2JBF A;  1E25 A;  4IUH A;  4PM8 A;  3QP5 A;  4QU3 A;  1EWZ A;  3HLE A;  1YQS A;  5CER A;  2ZBB A;  1GSX A;  2P08 A;  2XRN A;  2Y2G A;  5CEB A;  4H6J B;  4Y15 A;  2VEA A;  3LEQ A;  1XFN A;  2XDM A;  3C5A A;  3M2K A;  1Y4O A;  3IH8 A;  5HSQ A;  2PDR A;  2XLN A;  4HJ6 A;  1GHP A;  4E04 A;  3N4I A;  1PI5 A;  1UWN X;  3HLW A;  3S22 A;  1H8Y A;  1NLZ A;  3SW1 A;  3ZHH A;  4BD0 A;  4KQR A;  4OQH A;  1IEL A;  3CUE C;  4DN0 A;  4OKP A;  5E2E A;  4DXB A;  4WL9 A;  3C7V A;  3BFC A;  3ZYT A;  4X68 A;  3NIA A;  4KZ7 A;  1L0D A;  2H28 A;  3D4F A;  4KZ8 A;  2H0T A;  3LR0 A;  4WN5 A;  2B95 A;  4DRT A;  2HZ5 A;  1BZA A;  2FFY A;  5CGW A;  3UB7 A;  3GRJ A;  3VP2 A;  5GHZ A;  4MN7 A;  5U47 A;  3A0S A;  3EEA A;  3OZH A;  4EV4 A;  1NLY A;  1ZTU A;  2JCH A;  3PBT A;  5J8X A;  1DP8 A;  5GLA A;  3OPR A;  1W79 A;  2ZQD A;  2ZOH A;  1FQG A;  2PRF A;  4K08 A;  1FCN A;  4KUO A;  2PAV P;  1MZU A;  3PBO A;  1S4R A;  4MEZ A;  1ES4 A;  1SDN A;  2BTF P;  2O9B A;  3O88 A;  3BLM A;  4S2L A;  5HPI A;  1D06 A;  1BUL A;  3IS2 B;  4JXW A;  3LGO A;  4A5R A;  5F5Y A;  3MZD A;  3MZF A;  4PKY G;  1GA0 A;  5FEF A;  2EX2 A;  4GCZ A;  1RGY A;  4OOL A;  5IU1 A;  2W27 A;  5GHX A;  4N9K A;  5A91 A;  3C4P A;  4QD4 A;  1NYM A;  3IS2 A;  4YOF A;  1ES2 A;  2WYX A;  3RJU A;  3G34 A;  4NXB A;  1NZU A;  1CI9 A;  5CEC A;  3PAG A;  3DW0 A;  3PAE A;  4LCM A;  1LSX A;  1LI9 A;  5FEG A;  3UE1 A;  1VEU A;  3Q07 A;  4BJP A;  3EWK A;  3GEC A;  4LGW A;  3N8R A;  2OOL A;  4JF6 A;  4X53 A;  3R7W A;  3HJK A;  5DF9 A;  1IYP A;  4JPM A;  2E8J A;  2C6W B;  3G35 A;  3C7U A;  1S66 L;  5FQQ A;  4EEU A;  4ARZ B;  3UPO A;  5FI6 A;  2FZ0 A;  3IX3 A;  1TS7 A;  4GHI B;  4R4S A;  2L1M A;  1XXM A;  1PFL A;  3ZNY A;  5EVE A;  1G28 A;  3WS4 A;  2ZC4 B;  4BBT A;  4N1X A;  3PBR A;  1AWI A;  1S0W A;  3DTE A;  3KYQ A;  3MKE A;  3DWZ A;  1MKI A;  1PRQ A;  4ARZ A;  1O7E A;  5HL1 A;  4R3B A;  2Y91 A;  4WYY A;  3CMZ A;  2BLS A;  1T1C A;  2PHY A;  2PT7 A;  4RYE A;  2VA0 A;  3TG9 A;  4HI4 A;  4IJG A;  4IUK A;  5HZH A;  5CHU A;  2WGW A;  4UHU A;  1KDW A;  1M6K A;  5EM0 A;  5K5B A;  1K54 A;  4JGR A;  2XEP A;  3T4S A;  3O87 A;  2QYB A;  1AXB A;  3ZNT A;  1S4S A;  5JYO A;  1YM1 A;  4EBL A;  1FIK A;  3AGE A;  1NWZ A;  1WA9 A;  1UWP X;  1WE4 A;  4HH3 A;  1BTL A;  2R9X A;  4R3A A;  1OPX A;  5EVI A;  4WMC A;  3BWL A;  3P09 A;  4Y3I A;  1K54 C;  4Y5F A;  4OPY A;  2PU4 A;  3CJM A;  2J3W A;  4F94 A;  3GMW A;  5G18 A;  4KG2 A;  3U4L P;  4KZ6 A;  3LEZ A;  4KEN B;  4OQG A;  3IWI A;  3UB6 A;  2I72 A;  1TS0 A;  3VP3 A;  1ES3 A;  4NG2 A;  4KZ3 A;  4MN6 A;  3LI8 A;  1T1B A;  1IEM A;  3LI9 A;  3P01 A;  4LV3 A;  3Q81 A;  5EVI C;  1XJ3 A;  3MF0 A;  1S67 L;  3VSK A;  1LL8 A;  2Y2H A;  1K25 A;  4RX2 A;  2EFX A;  4P87 A;  5GLC A;  5HAQ A;  2YKH A;  4DE1 A;  4K0X A;  3UPN A;  4I5S A;  5E2G A;  4GNU A;  4Y7P A;  3GSG A;  2WGV A;  2X02 A;  1L0E A;  4OP5 A;  2XFS A;  4FH4 A;  4U3T A;  2WUQ A;  3S7O A;  4KZ9 A;  4GKU A;  3UB5 P;  3FWL A;  4LV1 A;  2WZZ A;  3T50 A;  5CTM A;  3IXG A;  4I39 A;  3LIB A;  4LCL A;  4D2O A;  3S1Y A;  2JKR I;  4JXS A;  3B47 A;  3NCK A;  2EX6 A;  2IWC A;  3OC2 A;  4R70 A;  1YLJ A;  5DFX A;  3DTI A;  5DJU A;  5J3W A;  1RCJ A;  1H0M A;  3G2Z A;  2VV8 A;  3MFD A;  2B5R A;  3FKV A;  4R4R A;  3MFX A;  1GA9 A;  5FQJ A;  1IKI A;  3OPH A;  2JKF A;  4CLC E;  5EUA A;  4L9G A;  2Y2O A;  3G31 A;  3KSG A;  1KVM A;  1I5Q A;  3Q1F A;  3BY8 A;  4LLO B;  4MLL A;  2NUP C;  3IX8 A;  5I94 A;  2Y2J A;  1W5D A;  5LBR A;  2W1T A;  2WAF A;  4CLC C;  1MKM A;  2QJ7 A;  3A0V A;  3VP1 A;  3JVU A;  1RP5 A;  4NXG A;  1LSW A;  4LV2 A;  5F68 A;  3A3E A;  2PBD P;  4ZJ3 A;  5AVF A;  1CEG A;  2J80 A;  3HCY A;  1N4O A;  3MXQ A;  1LL9 A;  1KOU A;  1XFQ A;  3ZGA B;  1KE0 A;  4P85 A;  3WRT A;  1STZ A;  1VM1 A;  5A90 A;  3KO6 A;  1GSV A;  2VGK A;  4AFI A;  1PW1 A;  2Q0O A;  3RXX A;  3FPV A;  3LIC A;  1J3W A;  1K56 A;  5EPH A;  1Y28 A;  3V67 A;  1GSW A;  4I3I A;  1JWV A;  4I3J A;  4EWF A;  2ZM8 A;  1U60 A;  4GN2 A;  1E3U A;  3MQO A;  2W3F A;  3T4J A;  4IVI A;  3C2W A;  4Y0U A;  2Y2L A;  4X55 A;  3CPT A;  3NOP C;  5EFW A;  4S2O A;  3WS5 A;  3NDE A;  4E3L A;  3CWF A;  4JGP A;  2OSU A;  3D9Y A;  4R23 A;  1T1A A;  5L2F A;  3CAX A;  3F1N B;  1F98 A;  1G5U A;  3QP2 A;  3OCN A;  2Y2Q A;  5DVA A;  2V0U A;  2ZMA A;  3DBA A;  3TW8 A;  4GLQ A;  4QY6 A;  2WKE A;  3FV7 A;  2JKR M;  2XSS A;  2P7J A;  3NHQ A;  4S2N C;  3F1N A;  3UME A;  1BSG A;  2ZQC A;  3W2Z A;  2O0Y A;  2R78 A;  3LCE A;  3VFF A;  1ZC2 A;  3VOL A;  1ESI A;  2XFT A;  1BYW A;  3O86 A;  4NK3 A;  1PWG A;  4YWZ A;  1PI4 A;  3CG5 A;  5EOO A;  4E3N A;  2KX6 A;  1I2W A;  1VQQ A;  1YLW A;  1H8Z A;  1W7F A;  3B3X A;  3UDI A;  4UEY A;  3R4K A;  2LB9 A;  1PYY A;  3RXW A;  1TS6 A;  3E2L A;  4CLC D;  4HP4 A;  2IWD A;  4LRZ E;  2V9A A;  5F1G A;  2QKP A;  5AQ9 A;  1NYY A;  1W8Q A;  5HAP A;  3RTY A;  3LUQ A;  4GW9 A;  5D3O A;  1KE3 A;  4EES A;  3KYE A;  5AVE A;  3HLG A;  1OT6 A;  5GL9 A;  3H7W B;  3FYZ A;  5GLB A;  4HEF A;  5KSC A;  3VE3 A;  1NY0 A;  2O99 A;  2ZOI A;  3M6H A;  1QMF A;  2HV1 A;  1N9B A;  5HAR A;  3JVV A;  4R6L A;  4H6J A;  3KSF A;  4EXO A;  1SKO B;  3IF6 B;  4ZTK A;  3T4T A;  2WKH A;  1JTD A;  2VJW A;  3M2J A;  5HWT A;  1FR1 A;  4NKP A;  3RH8 B;  1LI0 A;  5A8B A;  3ISG A;  4QY5 A;  4IBR A;  5KMW A;  3VE4 A;  3KSI A;  4D60 A;  3SZT A;  1NRJ A;  4E3J A;  2C5W B;  4HH2 A;  4UA7 A;  2G2U A;  1ALQ A;  1SKO A;  1ERQ A;  3IF6 A;  5HL6 A;  3T4Q A;  4K0W A;  2XA7 M;  2EX9 A;  1SZV A;  2B18 A;  2Y2P A;  5EV0 A;  4YNR A;  5F83 A;  3CHW P;  3HLC A;  5FAT A;  2QMI A;  2JKT I;  1BLP A;  3DTK A;  3PBQ A;  4CJN A;  5IT5 A;  4HBU A;  3V50 A;  2I9V A;  4E6W A;  4L9E A;  3N6I A;  2O9C A;  4RQ9 A;  1W8Y A;  4ETX A;  4GS9 B;  3WRZ A;  3PTE A;  3ULF A;  3IF6 C;  4LRY C;  4JXV A;  3ZG8 B;  3PBS A;  4EET B;  5CXW A;  3P98 A;  3VSL A;  2GDN A;  3B33 A;  3C30 A;  2Q9M A;  3E0Y A;  4I38 A;  3ICY A;  4NXE A;  1OTA A;  3L7H A;  4BQM A;  5KZH A;  3BY9 A;  2EFU A;  5HDD A;  3SH8 A;  5FQM A;  1D1J A;  5FQ9 A;  5GLD A;  3TE8 A;  5DFY A;  4B4Z A;  4JKT A;  4IED A;  3T4O A;  4JF4 A;  3LY4 A;  4KZB A;  5MC7 A;  3IHA A;  2R9W A;  4BEN A;  3C4O A;  1XP4 A;  3BQ8 A;  1C3B A;  3SOI A;  1MPL A;  3NOU C;  4EU0 A;  3G2Y A;  3FPW A;  3A3I A;  2XD1 A;  1K4F A;  2PD7 A;  5DTK A;  3D72 A;  2XH9 A;  1XKZ A;  2WAE A;  3UDF A;  3LIE A;  4LPZ A;  3SH9 A;  2LB5 A;  1SCW A;  3F1P B;  3PXP A;  2V1Z A;  4DXC A;  2DRW A;  1DY6 A;  3BFG A;  1ZKJ A;  5L09 A;  1ONH A;  4HIA A;  2WGI A;  1Z09 A;  4ID4 A;  2B02 A;  3UE3 A;  3IXD A;  5AQA A;  3BRM A;  3LIA A;  4GHI A;  1LSV A;  1FSW A;  2UWX A;  5AJG A;  1XX2 A;  1YT4 A;  3MKF A;  2QHK A;  2QZ6 A;  2YKF A;  1KVL A;  4F3L B;  4OVD A;  1K55 A;  4QPR A;  1XA1 A;  4Q0H A;  4XUX A;  2Y8H A;  4BBU A;  2L4R A;  1OTB A;  2W3D A;  2ZC5 B;  4FOF A;  3H82 B;  1PNE A;  5M1A A;  1MWS A;  4XUZ A;  1MWU A;  1IYO A;  1K57 A;  3BW6 A;  5FAS A;  1F9I A;  2IWB A;  3Q7V B;  5FSR A;  2VK3 A;  5CX7 A;  4F3L A;  4N1H A;  4DJ2 A;  1BLH A;  4WUJ A;  3KSH A;  4PPR A;  2M7V A;  2JKT M;  2A2L A;  3HLF A;  3HLD A;  4OOM A;  1ES5 A;  1K55 C;  1IKG A;  3T1X A;  2JC7 A;  4JGO A;  1JWZ A;  3H82 A;  4NXF A;  2OAQ 1;  3LR3 A;  3VP4 A;  3ZDJ A;  5L10 A;  3T1R A;  1K57 C;  3QP8 A;  5EVL A;  5CED A;  3C38 A;  2INW A;  3WWX A;  5FI2 A;  1OJ5 A;  1CI8 A;  2HDS A;  3E98 A;  4WM9 A;  4QHC A;  5G4Y A;  5A92 A;  1CJF A;  1TDG A;  2A3U A;  3Q82 A;  2PBY A;  2Y2K A;  3UPP A;  1KGG A;  2DNS A;  3BFF A;  3DAV A;  1KDS A;  2VZW A;  3QP4 A;  3LR4 A;  3LO7 A;  4ZRR A;  2H0Y A;  2V8C A;  2HPB A;  4S2J A;  3BEC A;  2KLI A;  2V8F A;  2P74 A;  1GHI A;  4EQ1 A;  1CK3 A;  2XA7 S;  5KSH A;  1XGJ A;  1LHY A;  3G32 A;  1TEM A;  4GD8 A;  4S2P A;  4EER A;  4RA7 A;  4OPZ A;  2V1A A;  3PHY A;  5CTN A;  4P6Z M;  3T1S A;  1BLS A;  1DP9 A;  1GCE A;  4O8G A;  5TBM B;  1V9Z A;  1SHV A;  1IFQ A;  3LY3 A;  1HD8 A;  3QNC A;  4PM5 A;  4CPK A;  3ZG5 A;  2ZJ9 A;  4DE2 A;  4YIN A;  3RFB A;  1P97 A;  5M19 A;  4R1G A;  4R38 A;  1W63 Q;  5HDS A;  5CGS A;  3SS4 A;  1OJG A;  3BJN A;  1YLZ A;  3UO9 A;  3UB8 A;  3A3F A;  2ZLY A;  2XF3 A;  1TF1 A;  4DJ3 A;  4H8R A;  2VLG A;  3EQU A;  3OCL A;  3NEC A;  2G7U A;  2ZC3 B;  4IHQ A;  3T1Q B;  1H5X A;  4ETZ A;  1F2K A;  4Y13 A;  4WEJ A;  5JYP A;  2HP9 A;  3HBR A;  3NOT C;  2HP6 A;  4BL3 A;  2PR5 A;  3IH9 A;  2JE5 A;  3EGX C;  3MS6 A;  3ZQ5 A;  2A24 B;  3V5M A;  4Q0J A;  2QPN A;  4WBG A;  3PBN A;  4JBF A;  1L3L A;  2Z6D A;  3QP6 A;  4B9O A;  4C3Q A;  2HJ9 C;  2Q9N A;  1GHM A;  2OAP 1;  3NDG A;  2E8I A;  1HTZ A;  1YLP A;  4X6T A;  2VKS A;  3MSH A;  4KZ4 A;  1SDE A;  5HD3 A;  2A24 A;  1VET B;  4FH2 A;  1MC0 A;  3UN7 A;  3LID A;  5IHV A;  5EVI D;  3UE0 A;  2JHE A;  1LLB A;  4WMC D;  3ZG0 A;  2RCX A;  3SS3 A;  3LYX A;  3UE6 A;  2ZD8 A;  2HGV A;  4HQA A;  1HVB A;  2P9V B;  4DKI A;  4FSF A;  2WKQ A;  1YSP A;  4FTX A;  2KDK A;  1JTG A;  2J8Y A;  3NJA A;  1NRF A;  3MQQ A;  1ODV A;  4BD1 A;  1VET A;  2L0W A;  1JWP A;  1PIO A;  2Z6C A;  3ZCZ A;  2VV6 A;  4X56 A;  4HHD A;  4KQD A;  5FAQ A;  1CF0 A;  2P9V A;  3UMD A;  1YAX A;  4WZ5 A;  4B4X A;  3IX4 A;  2O9A A;  3TSG A;  5FL3 A;  4OH0 A;  2WGW B;  2ZQ7 A;  4GDB A;  1TDL A;  3H9W A;  2EWV A;  5FAO A;  2D01 A;  5FA7 A;  3BEB A;  5EOE A;  3TRC A;  3W4P A;  1X0O A;  4G3W A;  4JGQ A;  3UDX A;  2AVX A;  1YSQ A;  2OLV A;  5CGX A;  4KG6 A;  2ACG A;  4MBF A; 
#chains in the Genus database with same CATH homology
 5K5B A;  2I9V A;  4JGR A;  4L9E A;  2QWS A;  3T4S A;  4CLC A;  2O9C A;  4HJ3 A;  4RQ9 A;  4ETX A;  3PR6 A;  4GS9 B;  2QYB A;  2W1T B;  4NEE D;  3ULF A;  3MQ0 A;  3E4Q A;  2PYR A;  4MDZ A;  4LRY C;  1S4S A;  1OT9 A;  5KIZ A;  2OWJ A;  3PBS A;  4DMZ A;  1NWZ A;  1WA9 A;  1UWP X;  4EET B;  4MCW A;  1OTI A;  2GJ3 A;  4HH3 A;  3HJI A;  4R3A A;  5J4E A;  1OPX A;  1XJ4 A;  3K3D A;  1N9O A;  3T4K A;  3B33 A;  4PHT A;  3C30 A;  3E0Y A;  3BWL A;  3ICY A;  4I38 A;  3OBF A;  5HWW A;  4Y3I A;  4NXE A;  1OTA A;  2WKR A;  4Y5F A;  3BY9 A;  4WF0 A;  1IOU A;  5HDD A;  5J7E A;  3FG8 A;  3TE8 A;  1V9Y A;  2J3W A;  2VX8 A;  5DFY A;  2KOI A;  2GZA A;  3F1O B;  3T4O A;  1P0Z A;  2VGL S;  5I5L A;  3UB9 A;  1P9W A;  1TS0 A;  4P6Z S;  3UB6 A;  5MC7 A;  1TD5 A;  3OOV A;  4MN6 A;  2QJ5 A;  3LI8 A;  2OWH A;  1T1B A;  1G6O A;  1H3Q A;  3LI9 A;  5C5K A;  3BQ8 A;  3P7N A;  3P01 A;  4KUK A;  2W3E A;  4BBV A;  1XJ3 A;  3CUE A;  3MF0 A;  1S67 L;  1LL8 A;  2V0W A;  2PR6 A;  3NOU C;  5DJT A;  2GNX A;  4EU0 A;  5DKK A;  5F6A A;  3FPW A;  4I3A A;  4LRX C;  2PD7 A;  1YKD A;  2M1C A;  3F1O A;  4M4X A;  2YKH A;  4G3V A;  3D72 A;  4I5S A;  3MR0 A;  2EA9 A;  3LIE A;  4EEP A;  5DKL A;  4LPZ A;  5HWV A;  2VV7 A;  3LIF A;  2LB5 A;  3H7W A;  3TJZ C;  3F1P B;  3PXP A;  1EW0 A;  2M7U A;  4MMN A;  3OLO A;  3S7O A;  2BAS A;  4B93 A;  1UGU A;  5TJJ A;  3B42 A;  4HIA A;  4KQO A;  4UQI M;  1XJ2 A;  3K3C A;  4XT2 B;  3T50 A;  1TS8 A;  2XRO A;  4I39 A;  2B02 A;  3LIB A;  3UE3 A;  3D3O A;  2JKR I;  1VB6 A;  3K2N A;  3B47 A;  5G4Z A;  4CQH A;  1H8M A;  3LIA A;  3OC2 A;  4GHI A;  4R70 A;  1LSV A;  5AJG A;  4WEL A;  5DFX A;  2QHK A;  1DP6 A;  4GJ4 A;  5DJU A;  5J3W A;  2YKF A;  4L9F A;  4HJ4 A;  4Q0I A;  3EGD C;  4F3L B;  2V1B A;  4QPR A;  1D7E A;  2D02 A;  4XT2 A;  4Q0H A;  2Y8H A;  2J3T C;  4BBU A;  2L4R A;  1OTB A;  2W3D A;  2VV8 A;  3LR5 A;  4FOF A;  3H82 B;  2HF6 A;  3MFX A;  3GDI A;  3BW6 A;  1F9I A;  4CLC E;  3G6O A;  4L9G A;  3KSG A;  2CMN A;  5CX7 A;  4F3L A;  3C8C A;  2FH5 A;  5L8M A;  4DJ2 A;  4WUJ A;  3O5Y A;  3KSH A;  2M7V A;  2JKT M;  2A2L A;  4ME4 A;  4OOM A;  3EOI A;  3VV4 A;  3BY8 A;  4LLO B;  1VHM A;  3E4O A;  2NUP C;  4BWI A;  1F5M A;  2ZMF A;  4JGO A;  3H82 A;  4NXF A;  3EQV A;  4GS9 A;  5LBR A;  2W1T A;  4L0L A;  4EUV A;  2OAQ 1;  3LR3 A;  4CLC C;  3KX0 X;  2PYP A;  2W3G A;  2P04 A;  2PD8 A;  1MKM A;  2QJ7 A;  1T19 A;  3A0V A;  3FC7 A;  3IBJ A;  3JVU A;  3C38 A;  4NXG A;  5HPF A;  2INW A;  2NUT C;  1OJ5 A;  3E98 A;  1LSW A;  1OTE A;  5F68 A;  4HY8 A;  4EW7 A;  5G4Y A;  5AVF A;  2J80 A;  4IUH A;  5F69 A;  3R7W B;  3HCY A;  4O0P A;  2ZBB A;  3LFV A;  1GSX A;  3MXQ A;  3A0R A;  2P08 A;  4Z1W A;  2XRN A;  1KOU A;  1XFQ A;  2VZW A;  4WLA A;  3LR4 A;  4H6J B;  1LT0 A;  2VEA A;  1XFN A;  4BMW A;  1STZ A;  4ZRR A;  4MN5 A;  5HSQ A;  2PDR A;  4HJ6 A;  4E04 A;  3KO6 A;  1GSV A;  2K2N A;  4AFI A;  2KLI A;  1UWN X;  3EEH A;  2JN7 A;  3FPV A;  4EQ1 A;  2XA7 S;  3LIC A;  5KSH A;  3IBR A;  1NLZ A;  3SW1 A;  1Y28 A;  4EER A;  3V67 A;  1GSW A;  1DRM A;  4I3I A;  2VGL M;  4I3J A;  3CUE C;  4DN0 A;  2V1A A;  1XJ6 A;  3PHY A;  4P6Z M;  2K7S A;  4HP9 A;  3MQO A;  2W3F A;  1DP9 A;  3T4J A;  4WL9 A;  4O8G A;  1P9R A;  1ZHH B;  3C2W A;  5TBM B;  3ZYT A;  1V9Z A;  3S7P A;  2W1R A;  2W3H A;  3NOP C;  5EFW A;  1IFQ A;  2H28 A;  3F1P A;  3LR0 A;  3CWF A;  4JGP A;  4WN5 A;  3E4P A;  1T1A A;  3CAX A;  3F1N B;  1F98 A;  3MMH A;  3RFB A;  2GX5 A;  1P97 A;  3OCN A;  4R38 A;  1W63 Q;  2V0U A;  3UB7 A;  3DBA A;  4II7 A;  4MN7 A;  3TW8 A;  3A0S A;  4GLQ A;  5HDS A;  3EEA A;  1OJG A;  3BJN A;  1NLY A;  1ZTU A;  2JKR M;  3PBT A;  2XSS A;  2P7J A;  2ZMV A;  3NHQ A;  1DP8 A;  3UB8 A;  1TF1 A;  4DJ3 A;  1N9L A;  2VLG A;  3EQU A;  3OCL A;  3F1N A;  3UME A;  2G7U A;  2ZOH A;  3S7Q A;  3W2Z A;  2O0Y A;  4IHQ A;  2R78 A;  3S7N A;  2J3T D;  3CLO A;  3MJQ A;  4K08 A;  4ETZ A;  2W0N A;  3VOL A;  1BYW A;  4G3K A;  4WEJ A;  4KUO A;  1MZU A;  3PBO A;  1S4R A;  4YWZ A;  2KX6 A;  3NOT C;  2IA2 A;  2O9B A;  2PR5 A;  5HD5 A;  5HPI A;  1D06 A;  3CIT A;  3IS2 B;  3EGX C;  5HDC A;  4UEY A;  2A24 B;  3ZQ5 A;  4Q0J A;  3T4L A;  3R4K A;  2LB9 A;  5F5Y A;  3PBN A;  1TS6 A;  3KYZ A;  4PKY G;  2Z6D A;  4PAU A;  4CLC D;  4GCZ A;  4HP4 A;  4B9O A;  4OOL A;  2HJ9 C;  5IU1 A;  2W27 A;  2OAP 1;  4LRZ E;  2V9A A;  2QKP A;  3RTY A;  3LUQ A;  4GW9 A;  3IS2 A;  4UQI S;  4YOF A;  4EES A;  2VKS A;  4WEK A;  5AVE A;  4O01 A;  5HD3 A;  2A24 A;  4NXB A;  2WKP A;  1N9N A;  1OT6 A;  1MC0 A;  3H7W B;  3CI6 A;  3LID A;  2JHE A;  1LSX A;  4BJP A;  3LYX A;  3EWK A;  3GEC A;  3VE3 A;  3UE6 A;  2O99 A;  2ZOI A;  2HGV A;  2OOL A;  4HQA A;  3R7W A;  3HJK A;  4HOI A;  4PKY A;  5DF9 A;  4FSF A;  2HV1 A;  2WKQ A;  1YSP A;  3JVV A;  4R6L A;  4H6J A;  2KDK A;  2DMW A;  3KSF A;  1S66 L;  3NJA A;  3MQQ A;  4EEU A;  4ARZ B;  4EXO A;  3BQA A;  1ODV A;  2FZ0 A;  3T4T A;  1TS7 A;  2L0W A;  2VJW A;  5HWT A;  2EWW A;  4GHI B;  4NKP A;  2Z6C A;  3PYP A;  3RH8 B;  2L1M A;  2VV6 A;  1G28 A;  5A8B A;  1OTD A;  4Y2F A;  4HHD A;  1JNU A;  4KQD A;  4BBT A;  3UMD A;  3PBR A;  1YAX A;  1S1Z A;  3VE4 A;  3KSI A;  2O9A A;  5FL3 A;  1NRJ A;  3KYQ A;  4HH2 A;  5IS1 A;  4ARZ A;  1W63 M;  3H9W A;  2EWV A;  2D01 A;  2MJ6 A;  1S1Y A;  4CLC B;  5HL6 A;  3T4Q A;  5TBM A;  2XA7 M;  3TRC A;  3U2A A;  2Y79 A;  1X0O A;  2B18 A;  4G3W A;  4HNB A;  4YNR A;  2K31 A;  4JGQ A;  1T1C A;  2PHY A;  2PT7 A;  2JKT I;  2VA0 A;  3PBQ A;  4HI4 A;  4IJG A;  2HJE A;  4IUK A;  1YSQ A;  1T18 A;  5HZH A;  5IT5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...