1OTBA

Wild type photoactive yellow protein, p63 at 295k
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
125
structure length
125
Chain Sequence
MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Photoactive yellow protein
publication title Short hydrogen bonds in photoactive yellow protein.
pubmed doi rcsb
source organism Halorhodospira halophila
total genus 37
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2003-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1otbA00
4NXFA 2L0WA 1LL8A 1D7EA 3K3CA 4EQ1A 4KQDA 3UB8A 3H9WA 1DP8A 3VOLA 3UE6A 1LSVA 1EW0A 3MJQA 1XJ4A 4F3LA 4BBTA 1OJ5A 3H7WA 2JHEA 1OT6A 1S66L 4HP9A 3F1OA 3E4QA 1XFQA 2EA9A 3BY9A 2QHKA 4EEPA 4WN5A 5I5LA 1OTIA 3A0RA 1OTEA 5AVFA 3PHYA 5G4ZA 4R6LA 1TS8A 3LYXA 4GHIB 4NXBA 3MR0A 1OTDA 1S4RA 3LI9A 4KUOA 4H6JB 1S4SA 4HQAA 1P0ZA 4HOIA 4HH3A 3NJAA 2VV6A 1UWPX 2PD8A 1UGUA 2ZBBA 5DJUA 3EEHA 3GECA 5EFWA 2V1AA 1OJGA 2INWA 4H6JA 1GSXA 4EXOA 2Z6DA 4R3AA 4HI4A 2QJ7A 4LRZE 2YKHA 1BYWA 4HH2A 3MQOA 4F3LB 1F9IA 3FC7A 3EWKA 4DJ2A 3H7WB 4RQ9A 4M4XA 4MN5A 3D72A 3NOPC 2M1CA 3IS2A 3NOTC 1N9NA 3A0VA 3H82A 3ZQ5A 1F98A 4I3IA 4HHDA 2PD7A 4EETB 2VEAA 1LSWA 4GCZA 3K3DA 2B02A 3FG8A 3UB9A 1XFNA 2K7SA 1TS6A 1DP6A 3PYPA 4JGRA 4KUKA 4NXGA 4PKYA 2ZOIA 5HZHA 4LLOB 3OLOA 4HP4A 4EW7A 1X0OA 1D06A 5A8BA 4GS9B 3IBRA 3UMDA 2ZOHA 4GW9A 2JN7A 4R38A 5HD3A 3C2WA 4JGPA 4HNBA 1T1BA 2OWJA 1WA9A 3LICA 3MXQA 4I3AA 1VB6A 4BBVA 1XJ2A 5HSQA 2GJ3A 5F69A 3ULFA 1P97A 3LIEA 1NWZA 2QWSA 4WL9A 4BBUA 4LPZA 4DJ3A 4GS9A 3HJIA 3LIDA 3UMEA 4I39A 3LUQA 5G4YA 4I5SA 4XT2B 3E4OA 1UWNX 5HDCA 4LRYC 3LIAA 5J3WA 4JGQA 1S67L 4HJ6A 3VE3A 4HY8A 2PHYA 4HJ4A 3SW1A 2L4RA 3IS2B 2R78A 5HWWA 4MN6A 2V9AA 1N9OA 2BASA 3H82B 1JNUA 1OTBA 3LIBA 5HWVA 2KX6A 2W27A 5DJTA 1ODVA 3VE4A 3E4PA 1T19A 2PDRA 4R70A 5DKLA 2V0UA 4XT2A 1S1ZA 4K08A 3KX0X 5IS1A 1XJ3A 1GSVA 2QJ5A 3C8CA 4E04A 5DKKA 3F1PA 2A24B 3LIFA 2V1BA 5KIZA 2VV8A 1LSXA 1V9ZA 3MFXA 5F6AA 2VV7A 2I9VA 3P7NA 3LI8A 5TBMA 1KOUA 2V0WA 4YWZA 4NXEA 5J4EA 2W0NA 1TS7A 1MZUA 1GSWA 1TS0A 2PYRA 3UB7A 3B33A 3RTYA 2A24A 5HDDA 5HD5A 3NHQA 4PKYG 1DRMA 3A0SA 5IU1A 1OT9A 1S1YA 4L9FA 1V9YA 3CWFA 5HWTA 4I38A 2WKPA 2OOLA 4I3JA 2Z6CA 2J80A 2QKPA 1T1AA 2WKQA 3CLOA 2OWHA 2CMNA 3MQQA 3ICYA 1OTAA 1N9LA 3GDIA 3F1NB 4L9GA 5F5YA 4HIAA 5AVEA 2PR6A 4EESA 1XJ6A 2PYPA 4WLAA 1Y28A 2H28A 3T50A 1DP9A 3UB6A 2HV1A 4JGOA 2WKRA 3BWLA 4L9EA 1LT0A 4LRXC 3NOUC 5J7EA 3F1PB 2P7JA 3RH8B 2D01A 4GHIA 4HJ3A 3BY8A 1T1CA 5HDSA 3F1NA 2L1MA 2YKFA 3HJKA 5F68A 3CAXA 5TBMB 2PR5A 4WUJA 3G6OA 1T18A 4B9OA 4EERA 2D02A 4WF0A 2KDKA 2VLGA 3F1OB 1G28A 4EEUA
chains in the Genus database with same CATH superfamily
4NXFA 3BFEA 2L0WA 1LL8A 3IF6C 2HZ5A 2QPNA 2XA7S 5E2HA 2HP9A 3H9WA 2PU2A 3VOLA 3W2ZA 4E3JA 4JF6A 3OCLA 2JKRI 3T4OA 3M6BA 1XJ4A 2HJ9C 1TVFA 1MWUA 5FQQA 2P9VA 2E8IA 2JHEA 3HBRA 2Y2JA 1VEUB 2EA9A 1SKFA 1ES2A 1MKMA 3T1QB 2MJ6A 4GB7A 4E3OA 2QHKA 3PR6A 1VM1A 3VOZA 5CGSA 3A0RA 5KZHA 3V5MA 1BLSA 3BFCA 1XXMA 2OLVA 1YLTA 3NBLA 2WKIA 2XSSA 5FSRA 5DTSA 1CF0A 3MR0A 3Q07A 4CLCD 2ZMFA 4ME4A 4JXSA 4XUXA 3HUMA 1W79A 2JC7A 1YLYA 5FASA 2Y2NA 1NYMA 2UWXA 5HL1A 4HH3A 1EI5A 4KZBA 1SZVA 4BJPA 1UWPX 3OPRA 2ZJ9A 2VGKA 3T4TA 3MKEA 1J9MA 3L7HA 4QY6A 2LB5A 3BM6A 4DE3A 3CZDA 3GECA 3VP2A 2V1AA 5HPFA 1NY0A 3LR3A 4U3TA 3ITAA 3GMWA 4RX2A 3SS4A 4CLCC 4OPZA 2P04A 3ZNYA 1BLCA 4JF4A 5KMWA 3BFGA 1U60A 1ONHA 1ZG4A 4DE2A 4AFIA 5HAPA 3MQOA 4F3LB 1F9IA 2Z2MB 3NY4A 4GD6A 2RCXA 3D72A 1P9RA 4EBLA 5HAIA 4MN7A 3H82A 5CEBA 4I3IA 4ARZA 1LSWA 2XFSA 4S2NA 3IXDA 2I72A 3ZFZA 3K3DA 5A90A 2PRFA 3JVUA 2HGVA 2Q0OA 1L0FA 1YPRA 3QHYA 4NXGA 1K25A 1YSPA 3HLDA 5EOOA 3HUNA 3LFVA 3P01A 3IF6A 1K54C 2GZAA 1TDLA 1XX2A 5HD3A 4KZ8A 3C2WA 4B4XA 4HNBA 4O8GA 3BQ8A 1VB6A 1XJ2A 2ZQ8A 3K2NA 5HSQA 3OC2A 3ZVWA 4QU3A 3OPPA 4GZBA 2GJ3A 3EGDC 5F69A 1P97A 4N1XA 2ZL1A 2O99A 5GL9A 4BBUA 3TOIA 4OOYA 1YMXA 4S2PA 3HJIA 3WS0A 2Y2LA 4HBTA 2XRNA 4JKTA 3KYQA 3G34A 3M2KA 4I5SA 1FR1A 4XT2B 3E4OA 1STZA 4UA6A 4LRYC 3SH9A 1FQGA 4HY8A 2WUQA 3IS2B 4LV2A 2BASA 4WEKA 1OTBA 5FATA 5DVAA 3GR2A 1VHMA 4MNRA 1MC0A 3UPOA 1W5DA 4R70A 3WRTA 1K57C 3TRCA 3MS6A 5TFQA 3LR4A 1S1ZA 2X71A 4C6YA 2W1TB 2Y55A 2Y59A 3R7WB 3M2JA 4JXGA 4DXCA 2W3FA 1K4FA 1KE0A 1PW1A 5E2EA 3O87A 4CQHA 3VSLA 4MEZA 2Y4AA 4C3QA 4CLCA 1H8MA 4Y17A 3NI9A 5FI2A 3HLEA 2BG1A 5F6AA 4YOFA 3P7NA 1GHMA 4ZRRA 3B42A 3LI8A 5J8XA 5HAQA 4O7DA 3MBZA 1TS0A 4ESPA 1YMSA 2A24A 5HD5A 3V67A 3G2ZA 3S7QA 1PYYA 4OPYA 4PKYG 5D3OA 3IXGA 3CG5A 3LR0A 4KENB 2WKHA 1D1JA 3CWFA 1EROA 5I94A 4LENA 2ZM8A 5AQBA 2J80A 1KE3A 2QKPA 4BD0A 4WBGA 1T1AA 3CLOA 3CUEC 3VSKA 4R23A 3ICYA 1IKIA 1E4DA 4PM7A 4PM8A 1HTZA 3MKFA 4BMWA 2XQZA 5F1FA 3DTIA 3KYEA 3FKVA 1OPXA 2WZZA 1K54A 3AGFA 2CC1A 4DF6A 4S2KA 4EESA 3CHWP 4O01A 1XJ6A 2PYPA 4KZ5A 4WLAA 5FQJA 4KQRA 4QJGA 2JBFA 1AXBA 5DF9A 3UB6A 4JGOA 2Y2MA 1PI4A 4X1MA 3A3JA 4LRXC 3NOUC 2ZM2A 5GHZA 4II7A 5CGXA 4JPMA 4GLQA 5FQ9A 2VKSA 3N8SA 3F1NA 2YKFA 2B5RA 2O9BA 5E2GA 2W3HA 4EUZA 3D9YA 4EWFA 4QD4A 2PR5A 4K91A 4WUJA 3BFDA 1T18A 4WM9A 3UE0A 4EERA 4UQIM 5L07A 3ZVTA 3MQ0A 2JE5A 3B47A 4EBNA 1K57A 4WELA 3QP1A 4KQDA 2DNSA 4NETA 1TF1A 4X69A 3D3OA 4RX3A 4WEJA 4YINA 3DTEA 1I2WA 1EW0A 4F3LA 4BBTA 3C7VA 1S66L 2RL3A 4N9KA 3DAVA 1W8QA 3FWLA 3F1OA 1BTLA 3E4QA 1K55C 3BY9A 2OLUA 3WWXA 3ITBA 3PBNA 4RYEA 4G3WA 3C4PA 2V1ZA 4OOLA 5I5LA 5IT5A 5KSHA 4ZAMA 4L0LA 4P6ZM 3QP6A 3ZDJA 1L0EA 2V2FF 4FOFA 2EWVA 2WGWB 1TD5A 1S4RA 3LI9A 4H6JB 3IWOA 1F2KA 2JKTI 4IBRA 5FQMA 3AGDA 1XP4A 4KZAA 3ZG8B 4QB8A 4KZ7A 1WYBA 3BEBA 3WS2A 2XGNA 2VJWA 3ZG5A 3KSHA 2IWBA 3TE8A 1SDNA 1BT5A 3FPVA 4X53A 4MCWA 3A3DA 4KZ9A 2ZQAA 3IX8A 3CUEA 3N7WA 4OONA 2PU4A 3KO6A 4M3KA 4KQQA 1NXYA 2OV5A 1E25A 2Z6DA 4WZ5C 4HI4A 2QJ7A 3QP5A 4KG2A 3CI6A 4IBXA 3ZGAB 4IUKA 4DDSA 3HL9A 1XA7A 1BYWA 3IBJA 4S2JA 4NEED 5FI7A 1PZPA 3FC7A 3H7WB 3VP3A 4LV1A 3T4JA 3EQUA 4MN5A 3VOYA 1NYYA 4K0XA 5EV0A 3IS2A 4PMAA 1DJAA 1GCEA 1F98A 4KZ4A 4EETB 1W7FA 3A3FA 4WZ4A 1L2SA 4GCZA 2JCHA 4GN2A 5FDSA 3Q7VA 1I5QA 4UQIS 5A92A 5CECA 2IA2A 5CGWA 5EPHA 3PYPA 1P9WA 4JGRA 4KUKA 2W1TA 4R3JA 1K6RA 2ZOIA 2VGLM 1ZTUA 3R7WA 2QMIA 1K56D 1VETB 4KG5A 4OLDA 4EUVA 4Y0TA 3G4PA 4HP4A 5E2FA 1D06A 4GS9B 1IELA 3OPHA 3CITA 4S2OA 1GA0A 2P08A 2ZOHA 4OQHA 3S7NA 3PBTA 3EOIA 1MWTA 2OWJA 1JWVA 1S6RA 3S4XA 3KSFA 3JVVA 4OQGA 2HPBA 1YLWA 2XDMA 3ULFA 5FAPA 4FH4A 4EQIA 1MXOA 2H5SA 2E8JA 5DTTA 2HDSA 4LPZA 1K4EA 2ZQDA 1K55A 2ZMVA 3VP1A 4P6ZS 3CPTB 4JGQA 4E3NA 1S67L 3HCYA 3T4SA 4MBHA 1PFLA 2L4RA 2X01A 2R78A 4MN6A 2V9AA 5FA7A 4YNRA 4Q0HA 3LIBA 2VGJA 1KDSA 5DJTA 1ODVA 4X6TA 3VE4A 3E4PA 4N9LA 2V0UA 1BSGA 1SCWA 2Z2LB 3PBRA 3RJUA 1E3UD 1PWDA 4GD8A 4NKPA 2G7UA 3O86A 1TEMA 3IX4A 1IYOA 5FEGA 1C3BA 2G2UA 3UDIA 2WK0A 1BLPA 5IS1A 2XLNA 1XJ3A 2QJ5A 3C8CA 4R3BA 5DFXA 3BJNA 4NG2A 4WZ5A 3LIFA 1XPBA 2W1RA 1N4OA 4H8RA 3A3EA 2XF3A 4HESA 2VV8A 1K0KA 1LSXA 3MXRA 2Y2PA 1V9ZA 2ZQCA 3C30A 3I7JA 2GNXA 4UHUA 4YWZA 2W0NA 1HVBA 3IX3A 1GSWA 3GRJA 5GLBA 4B88A 1G6AA 2B95A 3NHQA 3OBFA 1NRFA 3BFFA 1DRMA 3ZYTA 5IU1A 1FSWA 1S1YA 3RXXA 2BTFP 1IYQA 1V9YA 4GDNA 3B3XA 4A5RA 3IXBA 1RP5A 1IFQA 4ZJ2A 2OOLA 3IWQA 2EX8A 2ZLYA 4Y2FA 2XD5A 2CMNA 3HLFA 4R4RA 4GNUA 4N92A 4KG6A 3RXWA 4QPRA 5EUAA 3DWZA 3IHBA 5CTMA 4HIAA 5AVEA 2B18A 1CEGA 1XGJA 1Y28A 2H28A 3T50A 5FAOA 4XUZA 1BUEA 5FI6A 3BWLA 3Q1FA 4L9EA 1LT0A 2W3DA 2H0YA 1CQAA 1G68A 5GLCA 2P7JA 2D01A 4DRTA 2WGWA 4JXVA 3PXPA 2L1MA 1K56A 4UAAA 4UEYA 1FCNA 4ETZA 3P98A 3CAXA 1LL9A 4IEDA 5FQIA 4X55A 2C5WB 5HFOA 2EXBA 3N8RA 2PBYA 4PHTA 1MY8A 5CERA 1CI8A 2KDKA 1XKZA 2VLGA 2LB9A 4IJGA 1YM1A 3VFFA 2EX6A 3G32A 2PBDP 1FIKA 4ZTKA 3GTCA 1D7EA 1H8YA 3K3CA 3AGEA 5FAQA 3UB8A 5L09A 4OVDA 3LEZA 5F83A 1ZC2A 3T4QA 1LSVA 1LLBA 1JTDA 3MJQA 1OJ5A 3H7WA 3KSGA 4Y0UA 1OT6A 1TDGA 3NDEA 1ONGA 4HP9A 5CXWA 1XFQA 2ZMAA 4B4ZA 1PWCA 2X02A 4OQIA 4JF5A 3IT9A 2ZM0A 3DWKA 1ES3A 3JYIA 2WGIA 2J8YA 4BENA 1KGEA 2XK1A 1PI5A 3OOVA 4X1LA 2A2LA 1GA9A 1NLYA 5AVFA 2XEPA 4R6LA 1TS8A 1E3UA 4K0WA 4GHIB 4FCFA 1OTDA 1IEMA 3NIAA 4UA9A 4KUOA 3UNWA 1VEUA 1P0ZA 4ID4A 5GLDA 3BQAA 5HPIA 2BLSA 4P6BA 4KZ6A 4OP8A 1VETA 3NJAA 4C75A 3SS5A 4PM9A 1FCOA 4P85A 4DKIA 3ZG9B 1XGIA 4NK3A 2PD8A 4HEFA 4IHQA 3HUOA 4LGWA 3KYZA 1L0DA 3EEHA 3GSGA 2Y2OA 5DF7A 3E2KA 3PBOA 1DJCA 4IUHA 3IH9A 3SOIA 2INWA 3G31A 3O88A 2WADA 4MLLA 4EXOA 1W63M 1L3LA 4PPRA 3EGXC 4B93A 1NRJA 3BLMA 4R3AA 1G5UA 2ZC6B 3IQAA 4LRZE 4GDBA 4YFMA 4BL2A 4CPKA 4HH2A 2V8CA 5EVIB 3CPTA 5GHYA 4D60A 2WGVA 4DJ2A 4RQ9A 3FV7A 2XA7M 1JTGA 4E3IA 1YLZA 5CHMA 3NOPC 2M1CA 3NOTC 4LCLA 1F5MA 4Z1WA 1N9NA 3A0VA 3M6HA 3ZQ5A 4HHDA 2VEAA 4S2LA 1CEFA 1YT4A 3HLCA 4R4SA 2O9CA 2B02A 3FG8A 4Z9QA 5TGFA 3ZCZA 3WS5A 1NLZA 5EVLA 5M18A 2K7SA 1TS6A 2JKGA 1ALQA 5EM1A 1H5XA 1FOFA 1VQQA 2ZL1B 1N9BA 1WE4A 3OLOA 4XXRA 4Y7PA 5A8BA 4Y5FA 4GW9A 2NUTC 2JN7A 4JGPA 1T1BA 3MXQA 1ACFA 1H3QA 4I3AA 4O0PA 3IH8A 1SKOB 3QP2A 3FKWA 2WZXA 3LIEA 2Q9NA 3N4IA 4LCMA 2J9PA 4Y15A 3NULA 1PW8A 4LFUA 3PBSA 3LIDA 3UMEA 3R4KA 4I39A 3LUQA 2NUPC 3NECA 3W8KA 5HX9A 3TW8A 4FTXA 5EVID 1RGZA 3IWIA 5HDCA 5J3WA 2HDUA 2UV0E 3OCNA 5A91A 4HJ4A 1Y4OA 1JNUA 1H8ZA 3ZG0A 5EE8A 3UE1A 5HWVA 2R9WA 3C7UA 2KX6A 1EWZA 3MSHA 3LR5A 1FCMA 1T19A 2PDRA 3D4FA 5DKLA 5FDHA 2XROA 3E0YA 3IHAA 4JLFA 2OAP1 3PAGA 4XT2A 4OP5A 4K08A 3S1YA 3UB5P 4Q8IA 5TR7A 4OQ0A 4MMNA 2FZ0A 2EFXA 5EVEA 1YKDA 3VP4A 1ESIA 1DY6A 5EECA 2A3UA 4G3KA 4EV4A 1O07A 5MC7A 1IKGA 4E04A 4ZJ1A 2A24B 2V8FA 5HW3A 3T1SA 2A49A 2V1BA 4BQMA 2GX5A 3TJZC 3FPWA 3NC8A 1S0WA 1RCJA 2DCFA 4WYYA 1JWZA 4E3MA 4EBPA 2VV7A 2I9VA 2IWCA 1W8YA 3GVBA 2V0WA 5EOEA 5J4EA 1CJFA 2ZD8A 4CJNA 3DTMA 3MZFA 5E43A 3UE3A 4E3LA 2ZQ9A 2PYRA 1H0MA 2C6WB 3FZCA 1ERQA 3ZHHA 2FFFB 3ZNTA 1PZOA 3GV9A 4EU0A 4Q0IA 2WKPA 4OH0A 2WKQA 3HLBA 4MBFA 5IHVA 1BULA 1RGYA 1OTAA 4DE1A 3GDIA 5JYOA 3F1NB 4L9GA 3EQVA 2Q9MA 5BOHA 4WMCD 1ERMA 2PR6A 4KQOA 1MWSA 3UDFA 5AQ7A 1DP9A 2JKRM 2KLIA 2HV1A 2ZQ7A 3CMZA 4R0QA 3VV4A 1HD8A 4DMZA 2AVXA 3SS3A 1L0GA 3T4KA 3F1PB 3RH8B 4GHIA 1YAXA 2Y91A 1T1CA 1FILA 5HDSA 3CJMA 5FQKA 5K5BA 5CTNA 3HJKA 2XH9A 1NJ4A 3MZEA 5TBMB 3UDXA 5C5KA 1NZOA 5F82A 4X25A 4U0XA 4RVAA 4B9OA 2Y2KA 2JKFA 3V39A 2WAFA 5FEFA 1Z6FA 3RFBA 1W63Q 3OZHA 3F1OB 1G28A 4EEUA 3N6IA 5L10A 4EQ1A 4Y13A 4BL3A 1ZG6A 3QP8A 4P87A 2ZC7A 1DP8A 3UE6A 2EX9A 3E98A 1CI9A 2QYBA 2DRWA 3BW6A 1O7EA 2VK3A 4UA7A 3LGOA 4JBFA 5LBRA 1ES4A 5EVIA 3IF5A 1YQSA 1ZHHB 2Y2IA 4DE0A 3SH8A 1SDEA 1QMFA 1YSQA 3DBAA 5AQ9A 3PBQA 2WAEA 4EEPA 4WN5A 1MKIA 3OPLA 2VGLS 5TJJA 2EWWA 1OTIA 2ZC5B 1OTEA 1KGGA 3FYZA 1MPLA 1Q2QA 2J3WA 3PHYA 4QY5A 5G4ZA 1YLPA 3BLSA 2J9OA 3HREA 3VP0A 3LYXA 5GLAA 5CHJA 4NXBA 3TG9A 4LV0A 3T12B 5KSCA 3Q7ZA 1S4SA 4HQAA 5A93A 2QZ6A 1JVJA 4HOIA 4OKPA 3MMHA 4E3KA 2VV6A 2HDRA 5EM0A 3Q81A 4HBUA 1YLJA 4R1GA 1UGUA 3TSGA 2ZBBA 5DJUA 3O5YA 5AJGA 2W3EA 5EFWA 1OJGA 1SKOA 3P09A 4H6JA 4PM6A 3UPNA 1Y54A 1GSXA 2HP5A 1ZKJA 1BZAA 3W4QA 3UPPA 3U2AA 3MXSA 4FH2A 5AQAA 4FUWA 1IYSA 3Q7VB 2YKHA 1PWGA 4IVIA 2ZC3B 4KZ3A 4Q0JA 2Y2HA 3EWKA 2P9VB 4M4XA 2WKEA 5G18A 4RA7A 1G6OA 1DJBA 2PAVP 3BRMA 3T1RA 2PD7A 1NZUA 2K31A 4ZJ3A 1PRQA 3UB9A 3WS4A 3S22A 4MBKA 3V50A 3U4LP 2EFUA 1XFNA 4ZBEA 4WMCA 3G30A 4FD8A 1DP6A 4Y3IA 3L9KA 4PKYA 5M19A 2G2WA 4DDYA 2XD1A 1IYPA 2VA0A 1KE4A 5HZHA 4LLOB 3WRZA 4EW7A 1I2SA 1X0OA 2V20A 3UN7A 1AWIA 1FSYA 2Y2QA 1A0KA 1ES5A 3IBRA 3UMDA 2PT7A 4E6WA 1MBLA 1BLHA 2ZC4B 2H10A 4R38A 1ESUA 5FL3A 5U47A 2DMWA 3LCEA 3O3VA 2EXAA 1WA9A 1KVLA 3LICA 3EEAA 4BBVA 3T4LA 3G35A 1K38A 3SH7A 2HJEA 3LEQA 1NWZA 2QWSA 2M7VA 1KGFA 4OPQA 4WL9A 2ACGA 5F1GA 4DJ3A 5M1AA 2VX8A 3LY4A 4GS9A 2HDQA 3MFDA 1HZOA 4DXBA 5G4YA 5HARA 1OMEA 2OAQ1 4G3VA 3GQZA 1J3WA 1UWNX 4IVKA 3LIAA 4E6XA 1GHIA 4HJ6A 3VE3A 1XA1A 2PHYA 3SW1A 5HWWA 1Q2PA 1N9OA 4MDZA 3HVFA 4S2MA 3H82B 5HL6A 1LI9A 3E2LA 2M7UA 2W27A 4ARZB 3N8LA 5L8MA 4X56A 3QNCA 2XR0A 5CEDA 3S7OA 3HLWA 3QNBA 3KX0X 3DTKA 2Y8HA 3LY3A 1M40A 5DF8A 2HF6A 2KOIA 1GSVA 3DW0A 2Y79A 3W4PA 1CK3A 2WYXA 2OSUA 2K2NA 1K6SA 4CLCE 4P0MA 1M6KA 5DKKA 3F1PA 2J7VA 3A3IA 1Z09A 3Q82A 3IF6B 4ZDXA 3QP4A 5KIZA 1LHYA 4F94A 4Y0OA 3MFXA 1QMEA 1IOUA 4OOMA 3VMAA 4BD1A 4ETXA 3HLGA 5TBMA 1KOUA 3V3SA 4NXEA 4JXWA 1TS7A 1FR6A 1MZUA 4PAUA 2HP6A 5CX7A 3ISGA 3UB7A 3B33A 3RTYA 4DN0A 5HDDA 2R9XA 3NDGA 5CRFA 1HLUP 2GDNA 3A0SA 3BYDA 3WS1A 1OT9A 3S7PA 1JWPA 4L9FA 4U0TA 5HWTA 4QHCA 3VFHA 3KSIA 4I38A 4BWIA 2EX2A 2H0TA 3MZDA 4I3JA 4GKUA 4N1HA 2Z6CA 2O0YA 3LO7A 4S2IA 3V3RA 5L2FA 2P74A 3IXHA 4QWOA 2OWHA 3MQQA 2FH5A 2VZWA 5GHXA 1N9LA 4OPRA 5CHUA 4FSFA 5F5YA 4GOGA 3JPUA 3UO9A 3C5AA 1PIOA 2J3TD 2IWDA 2O9AA 2W3GA 1KDWA 5DTKA 2WKRA 4BLMA 2FFYA 5DFYA 5J7EA 1PNEA 4PM5A 3C38A 4X68A 4HJ3A 4CLCB 3UY6A 3BY8A 1LL5A 3G2YA 4OLGA 4D2OA 1GHPA 3PAEA 4GJ4A 5F68A 4S2NC 1MWRA 1LI0A 5JYPA 3G6OA 3T1XA 5EVIC 3MF0A 2D02A 2XFTA 3ZG7B 2Y2GA 4WF0A 1KVMA 1SHVA 2J3TC 3BECA 3SZTA 2JKTM 3PTEA 3C4OA 3NCKA 4LV3A 3W4OA 1WYCA
chains in the Genus database with same CATH topology
4NXFA 2L0WA 1LL8A 2XA7S 4WELA 1D7EA 3K3CA 4EQ1A 4KQDA 3UB8A 1TF1A 3H9WA 1DP8A 3D3OA 4WEJA 3VOLA 3W2ZA 3UE6A 3E98A 2QYBA 3OCLA 3BW6A 2JKRI 3T4QA 5LBRA 1LSVA 3T4OA 1EW0A 3MJQA 1XJ4A 2HJ9C 4F3LA 4BBTA 1ZHHB 1OJ5A 3H7WA 3KSGA 2JHEA 1OT6A 1S66L 4HP9A 3F1OA 3E4QA 1XFQA 2EA9A 1YSQA 3BY9A 3DBAA 1MKMA 3PBQA 3PBNA 2MJ6A 2QHKA 3PR6A 4EEPA 4G3WA 4WN5A 2VGLS 5TJJA 4OOLA 2EWWA 5I5LA 5IT5A 1OTIA 3A0RA 5KSHA 1OTEA 3OOVA 2A2LA 4L0LA 1NLYA 5AVFA 4P6ZM 2J3WA 3PHYA 5G4ZA 4R6LA 4FOFA 1TS8A 3LYXA 2XSSA 4GHIB 2EWVA 4NXBA 3MR0A 1TD5A 1OTDA 1S4RA 2ZMFA 3LI9A 4ME4A 4KUOA 4CLCD 4H6JB 1S4SA 4HQAA 1P0ZA 5HPIA 3BQAA 4HOIA 2JKTI 3MMHA 4HH3A 3NJAA 2VV6A 4BJPA 1UWPX 3T4TA 2PD8A 2VJWA 1UGUA 4IHQA 3KSHA 2LB5A 2ZBBA 5DJUA 3TE8A 3KYZA 3EEHA 3FPVA 3PBOA 4MCWA 3O5YA 3GECA 5AJGA 2W3EA 4IUHA 5EFWA 2V1AA 1OJGA 3CUEA 2INWA 5HPFA 4H6JA 3LR3A 1GSXA 3KO6A 4EXOA 1W63M 3EGXC 4B93A 3U2AA 2Z6DA 1NRJA 4R3AA 4HI4A 4CLCC 2QJ7A 2P04A 4LRZE 3CI6A 4IUKA 2YKHA 1BYWA 4HH2A 4Q0JA 4AFIA 3MQOA 4F3LB 3IBJA 4NEED 1F9IA 3FC7A 3EWKA 4DJ2A 3H7WB 4RQ9A 4M4XA 2XA7M 3T4JA 3EQUA 4MN5A 3D72A 3NOPC 1P9RA 2M1CA 3IS2A 1G6OA 4MN7A 3NOTC 1F5MA 4Z1WA 1N9NA 3A0VA 3H82A 3ZQ5A 1F98A 4I3IA 4HHDA 2PD7A 4EETB 2VEAA 4ARZA 1LSWA 4GCZA 2O9CA 2K31A 3K3DA 2B02A 3FG8A 3UB9A 3JVUA 2HGVA 4UQIS 1XFNA 1NLZA 2IA2A 2K7SA 1TS6A 1DP6A 3PYPA 1P9WA 4JGRA 4KUKA 2W1TA 4NXGA 4Y3IA 4PKYA 2ZOIA 2VGLM 1ZTUA 3R7WA 1YSPA 2VA0A 5HZHA 4LLOB 3OLOA 4EUVA 4HP4A 4EW7A 1X0OA 1D06A 3LFVA 5A8BA 4GS9B 3IBRA 3UMDA 3CITA 2PT7A 3P01A 4Y5FA 2GZAA 2P08A 2ZOHA 4GW9A 2NUTC 2JN7A 3S7NA 3PBTA 4R38A 5HD3A 3C2WA 4JGPA 5FL3A 3EOIA 2DMWA 4HNBA 4O8GA 1T1BA 2OWJA 1WA9A 3LICA 3MXQA 1H3QA 1VB6A 3BQ8A 3EEAA 1XJ2A 4I3AA 3K2NA 4O0PA 4BBVA 5HSQA 3KSFA 3JVVA 3OC2A 3T4LA 2HJEA 2GJ3A 3EGDC 5F69A 1P97A 3ULFA 3LIEA 1NWZA 2O99A 2QWSA 2M7VA 4WL9A 4BBUA 4LPZA 4DJ3A 2VX8A 4GS9A 2ZMVA 3HJIA 2XRNA 3PBSA 3KYQA 3LIDA 3UMEA 3R4KA 4P6ZS 4I39A 3LUQA 2NUPC 5G4YA 4I5SA 2OAQ1 3TW8A 4XT2B 4G3VA 3E4OA 1STZA 1UWNX 5HDCA 4LRYC 3LIAA 5J3WA 4JGQA 1S67L 4HJ6A 3HCYA 3T4SA 3OCNA 3VE3A 4HY8A 2PHYA 4HJ4A 3SW1A 2L4RA 3IS2B 2R78A 5HWWA 4MN6A 2V9AA 4YNRA 1N9OA 4MDZA 2BASA 4WEKA 5HL6A 3H82B 1JNUA 4Q0HA 1OTBA 3LIBA 2M7UA 5HWVA 1VHMA 2KX6A 2W27A 4ARZB 5DJTA 1MC0A 1ODVA 3VE4A 3LR5A 3E4PA 5L8MA 1T19A 2PDRA 4R70A 5DKLA 2V0UA 2XROA 3E0YA 3PBRA 3TRCA 3S7OA 2OAP1 3LR4A 4NKPA 4XT2A 1S1ZA 4K08A 3KX0X 2G7UA 2Y8HA 2W1TB 4MMNA 5IS1A 2FZ0A 2HF6A 2KOIA 3R7WB 1YKDA 1GSVA 1XJ3A 2Y79A 2QJ5A 2W3FA 3C8CA 4G3KA 5DFXA 2K2NA 5MC7A 3BJNA 4CLCE 4CQHA 4E04A 5DKKA 3F1PA 2A24B 3LIFA 2W1RA 4CLCA 1H8MA 2V1BA 5KIZA 2GX5A 3TJZC 2VV8A 3FPWA 1LSXA 1V9ZA 3C30A 3MFXA 5F6AA 4YOFA 2GNXA 2VV7A 2I9VA 3P7NA 4OOMA 4ZRRA 3B42A 3LI8A 4ETXA 1IOUA 5TBMA 1KOUA 2V0WA 4YWZA 4NXEA 5J4EA 2W0NA 1TS7A 1MZUA 4PAUA 1GSWA 3UE3A 1TS0A 2PYRA 5CX7A 3UB7A 3B33A 3RTYA 2A24A 4DN0A 5HDDA 5HD5A 3NHQA 3V67A 3OBFA 3S7QA 4PKYG 1DRMA 3ZYTA 3A0SA 5IU1A 1OT9A 3LR0A 1S1YA 3S7PA 4L9FA 1V9YA 4EU0A 3CWFA 5HWTA 4Q0IA 3KSIA 4I38A 1IFQA 4BWIA 2WKPA 2OOLA 4I3JA 2Z6CA 2J80A 2QKPA 2O0YA 1T1AA 2WKQA 4Y2FA 3CLOA 2OWHA 2CMNA 3CUEC 3MQQA 2FH5A 2VZWA 3ICYA 1OTAA 1N9LA 4QPRA 3GDIA 4FSFA 3F1NB 4L9GA 5F5YA 3EQVA 4BMWA 4HIAA 1OPXA 5AVEA 2PR6A 4EESA 2B18A 4O01A 4KQOA 1XJ6A 2PYPA 4WLAA 1Y28A 2H28A 3T50A 2J3TD 1DP9A 2JKRM 2KLIA 5DF9A 3UB6A 2O9AA 2W3GA 2HV1A 3VV4A 4JGOA 2WKRA 3BWLA 4L9EA 4DMZA 1LT0A 2W3DA 4LRXC 5DFYA 3NOUC 5J7EA 3T4KA 3F1PB 2P7JA 3C38A 4II7A 3RH8B 2D01A 4GHIA 4HJ3A 1YAXA 4GLQA 3PXPA 4CLCB 3BY8A 1T1CA 5HDSA 2VKSA 3F1NA 2L1MA 4UEYA 2YKFA 5K5BA 3HJKA 4ETZA 4GJ4A 5F68A 2O9BA 2W3HA 3CAXA 5TBMB 5C5KA 2PR5A 4WUJA 3G6OA 3MF0A 1T18A 4B9OA 4EERA 4PHTA 2D02A 4UQIM 4WF0A 3MQ0A 2KDKA 2J3TC 2VLGA 2LB9A 4IJGA 2JKTM 3B47A 3RFBA 1W63Q 3F1OB 1G28A 4EEUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NXF A;  2L0W A;  1LL8 A;  1D7E A;  3K3C A;  4EQ1 A;  4KQD A;  3UB8 A;  3H9W A;  1DP8 A;  3VOL A;  3UE6 A;  1LSV A;  1EW0 A;  3MJQ A;  1XJ4 A;  4F3L A;  4BBT A;  1OJ5 A;  3H7W A;  2JHE A;  1OT6 A;  1S66 L;  4HP9 A;  3F1O A;  3E4Q A;  1XFQ A;  2EA9 A;  3BY9 A;  2QHK A;  4EEP A;  4WN5 A;  5I5L A;  1OTI A;  3A0R A;  1OTE A;  5AVF A;  3PHY A;  5G4Z A;  4R6L A;  1TS8 A;  3LYX A;  4GHI B;  4NXB A;  3MR0 A;  1OTD A;  1S4R A;  3LI9 A;  4KUO A;  4H6J B;  1S4S A;  4HQA A;  1P0Z A;  4HOI A;  4HH3 A;  3NJA A;  2VV6 A;  1UWP X;  2PD8 A;  1UGU A;  2ZBB A;  5DJU A;  3EEH A;  3GEC A;  5EFW A;  2V1A A;  1OJG A;  2INW A;  4H6J A;  1GSX A;  4EXO A;  2Z6D A;  4R3A A;  4HI4 A;  2QJ7 A;  4LRZ E;  2YKH A;  1BYW A;  4HH2 A;  3MQO A;  4F3L B;  1F9I A;  3FC7 A;  3EWK A;  4DJ2 A;  3H7W B;  4RQ9 A;  4M4X A;  4MN5 A;  3D72 A;  3NOP C;  2M1C A;  3IS2 A;  3NOT C;  1N9N A;  3A0V A;  3H82 A;  3ZQ5 A;  1F98 A;  4I3I A;  4HHD A;  2PD7 A;  4EET B;  2VEA A;  1LSW A;  4GCZ A;  3K3D A;  2B02 A;  3FG8 A;  3UB9 A;  1XFN A;  2K7S A;  1TS6 A;  1DP6 A;  3PYP A;  4JGR A;  4KUK A;  4NXG A;  4PKY A;  2ZOI A;  5HZH A;  4LLO B;  3OLO A;  4HP4 A;  4EW7 A;  1X0O A;  1D06 A;  5A8B A;  4GS9 B;  3IBR A;  3UMD A;  2ZOH A;  4GW9 A;  2JN7 A;  4R38 A;  5HD3 A;  3C2W A;  4JGP A;  4HNB A;  1T1B A;  2OWJ A;  1WA9 A;  3LIC A;  3MXQ A;  4I3A A;  1VB6 A;  4BBV A;  1XJ2 A;  5HSQ A;  2GJ3 A;  5F69 A;  3ULF A;  1P97 A;  3LIE A;  1NWZ A;  2QWS A;  4WL9 A;  4BBU A;  4LPZ A;  4DJ3 A;  4GS9 A;  3HJI A;  3LID A;  3UME A;  4I39 A;  3LUQ A;  5G4Y A;  4I5S A;  4XT2 B;  3E4O A;  1UWN X;  5HDC A;  4LRY C;  3LIA A;  5J3W A;  4JGQ A;  1S67 L;  4HJ6 A;  3VE3 A;  4HY8 A;  2PHY A;  4HJ4 A;  3SW1 A;  2L4R A;  3IS2 B;  2R78 A;  5HWW A;  4MN6 A;  2V9A A;  1N9O A;  2BAS A;  3H82 B;  1JNU A;  1OTB A;  3LIB A;  5HWV A;  2KX6 A;  2W27 A;  5DJT A;  1ODV A;  3VE4 A;  3E4P A;  1T19 A;  2PDR A;  4R70 A;  5DKL A;  2V0U A;  4XT2 A;  1S1Z A;  4K08 A;  3KX0 X;  5IS1 A;  1XJ3 A;  1GSV A;  2QJ5 A;  3C8C A;  4E04 A;  5DKK A;  3F1P A;  2A24 B;  3LIF A;  2V1B A;  5KIZ A;  2VV8 A;  1LSX A;  1V9Z A;  3MFX A;  5F6A A;  2VV7 A;  2I9V A;  3P7N A;  3LI8 A;  5TBM A;  1KOU A;  2V0W A;  4YWZ A;  4NXE A;  5J4E A;  2W0N A;  1TS7 A;  1MZU A;  1GSW A;  1TS0 A;  2PYR A;  3UB7 A;  3B33 A;  3RTY A;  2A24 A;  5HDD A;  5HD5 A;  3NHQ A;  4PKY G;  1DRM A;  3A0S A;  5IU1 A;  1OT9 A;  1S1Y A;  4L9F A;  1V9Y A;  3CWF A;  5HWT A;  4I38 A;  2WKP A;  2OOL A;  4I3J A;  2Z6C A;  2J80 A;  2QKP A;  1T1A A;  2WKQ A;  3CLO A;  2OWH A;  2CMN A;  3MQQ A;  3ICY A;  1OTA A;  1N9L A;  3GDI A;  3F1N B;  4L9G A;  5F5Y A;  4HIA A;  5AVE A;  2PR6 A;  4EES A;  1XJ6 A;  2PYP A;  4WLA A;  1Y28 A;  2H28 A;  3T50 A;  1DP9 A;  3UB6 A;  2HV1 A;  4JGO A;  2WKR A;  3BWL A;  4L9E A;  1LT0 A;  4LRX C;  3NOU C;  5J7E A;  3F1P B;  2P7J A;  3RH8 B;  2D01 A;  4GHI A;  4HJ3 A;  3BY8 A;  1T1C A;  5HDS A;  3F1N A;  2L1M A;  2YKF A;  3HJK A;  5F68 A;  3CAX A;  5TBM B;  2PR5 A;  4WUJ A;  3G6O A;  1T18 A;  4B9O A;  4EER A;  2D02 A;  4WF0 A;  2KDK A;  2VLG A;  3F1O B;  1G28 A;  4EEU A; 
#chains in the Genus database with same CATH topology
 4NXF A;  3BFE A;  2L0W A;  1LL8 A;  3IF6 C;  2HZ5 A;  2QPN A;  2XA7 S;  5E2H A;  2HP9 A;  3H9W A;  2PU2 A;  3VOL A;  3W2Z A;  4E3J A;  4JF6 A;  3OCL A;  2JKR I;  3T4O A;  3M6B A;  1XJ4 A;  2HJ9 C;  1TVF A;  1MWU A;  5FQQ A;  2P9V A;  2E8I A;  2JHE A;  3HBR A;  2Y2J A;  1VEU B;  2EA9 A;  1SKF A;  1ES2 A;  1MKM A;  3T1Q B;  2MJ6 A;  4GB7 A;  4E3O A;  2QHK A;  3PR6 A;  1VM1 A;  3VOZ A;  5CGS A;  3A0R A;  5KZH A;  3V5M A;  1BLS A;  3BFC A;  1XXM A;  2OLV A;  1YLT A;  3NBL A;  2WKI A;  2XSS A;  5FSR A;  5DTS A;  1CF0 A;  3MR0 A;  3Q07 A;  4CLC D;  2ZMF A;  4ME4 A;  4JXS A;  4XUX A;  3HUM A;  1W79 A;  2JC7 A;  1YLY A;  5FAS A;  2Y2N A;  1NYM A;  2UWX A;  5HL1 A;  4HH3 A;  1EI5 A;  4KZB A;  1SZV A;  4BJP A;  1UWP X;  3OPR A;  2ZJ9 A;  2VGK A;  3T4T A;  3MKE A;  1J9M A;  3L7H A;  4QY6 A;  2LB5 A;  3BM6 A;  4DE3 A;  3CZD A;  3GEC A;  3VP2 A;  2V1A A;  5HPF A;  1NY0 A;  3LR3 A;  4U3T A;  3ITA A;  3GMW A;  4RX2 A;  3SS4 A;  4CLC C;  4OPZ A;  2P04 A;  3ZNY A;  1BLC A;  4JF4 A;  5KMW A;  3BFG A;  1U60 A;  1ONH A;  1ZG4 A;  4DE2 A;  4AFI A;  5HAP A;  3MQO A;  4F3L B;  1F9I A;  2Z2M B;  3NY4 A;  4GD6 A;  2RCX A;  3D72 A;  1P9R A;  4EBL A;  5HAI A;  4MN7 A;  3H82 A;  5CEB A;  4I3I A;  4ARZ A;  1LSW A;  2XFS A;  4S2N A;  3IXD A;  2I72 A;  3ZFZ A;  3K3D A;  5A90 A;  2PRF A;  3JVU A;  2HGV A;  2Q0O A;  1L0F A;  1YPR A;  3QHY A;  4NXG A;  1K25 A;  1YSP A;  3HLD A;  5EOO A;  3HUN A;  3LFV A;  3P01 A;  3IF6 A;  1K54 C;  2GZA A;  1TDL A;  1XX2 A;  5HD3 A;  4KZ8 A;  3C2W A;  4B4X A;  4HNB A;  4O8G A;  3BQ8 A;  1VB6 A;  1XJ2 A;  2ZQ8 A;  3K2N A;  5HSQ A;  3OC2 A;  3ZVW A;  4QU3 A;  3OPP A;  4GZB A;  2GJ3 A;  3EGD C;  5F69 A;  1P97 A;  4N1X A;  2ZL1 A;  2O99 A;  5GL9 A;  4BBU A;  3TOI A;  4OOY A;  1YMX A;  4S2P A;  3HJI A;  3WS0 A;  2Y2L A;  4HBT A;  2XRN A;  4JKT A;  3KYQ A;  3G34 A;  3M2K A;  4I5S A;  1FR1 A;  4XT2 B;  3E4O A;  1STZ A;  4UA6 A;  4LRY C;  3SH9 A;  1FQG A;  4HY8 A;  2WUQ A;  3IS2 B;  4LV2 A;  2BAS A;  4WEK A;  1OTB A;  5FAT A;  5DVA A;  3GR2 A;  1VHM A;  4MNR A;  1MC0 A;  3UPO A;  1W5D A;  4R70 A;  3WRT A;  1K57 C;  3TRC A;  3MS6 A;  5TFQ A;  3LR4 A;  1S1Z A;  2X71 A;  4C6Y A;  2W1T B;  2Y55 A;  2Y59 A;  3R7W B;  3M2J A;  4JXG A;  4DXC A;  2W3F A;  1K4F A;  1KE0 A;  1PW1 A;  5E2E A;  3O87 A;  4CQH A;  3VSL A;  4MEZ A;  2Y4A A;  4C3Q A;  4CLC A;  1H8M A;  4Y17 A;  3NI9 A;  5FI2 A;  3HLE A;  2BG1 A;  5F6A A;  4YOF A;  3P7N A;  1GHM A;  4ZRR A;  3B42 A;  3LI8 A;  5J8X A;  5HAQ A;  4O7D A;  3MBZ A;  1TS0 A;  4ESP A;  1YMS A;  2A24 A;  5HD5 A;  3V67 A;  3G2Z A;  3S7Q A;  1PYY A;  4OPY A;  4PKY G;  5D3O A;  3IXG A;  3CG5 A;  3LR0 A;  4KEN B;  2WKH A;  1D1J A;  3CWF A;  1ERO A;  5I94 A;  4LEN A;  2ZM8 A;  5AQB A;  2J80 A;  1KE3 A;  2QKP A;  4BD0 A;  4WBG A;  1T1A A;  3CLO A;  3CUE C;  3VSK A;  4R23 A;  3ICY A;  1IKI A;  1E4D A;  4PM7 A;  4PM8 A;  1HTZ A;  3MKF A;  4BMW A;  2XQZ A;  5F1F A;  3DTI A;  3KYE A;  3FKV A;  1OPX A;  2WZZ A;  1K54 A;  3AGF A;  2CC1 A;  4DF6 A;  4S2K A;  4EES A;  3CHW P;  4O01 A;  1XJ6 A;  2PYP A;  4KZ5 A;  4WLA A;  5FQJ A;  4KQR A;  4QJG A;  2JBF A;  1AXB A;  5DF9 A;  3UB6 A;  4JGO A;  2Y2M A;  1PI4 A;  4X1M A;  3A3J A;  4LRX C;  3NOU C;  2ZM2 A;  5GHZ A;  4II7 A;  5CGX A;  4JPM A;  4GLQ A;  5FQ9 A;  2VKS A;  3N8S A;  3F1N A;  2YKF A;  2B5R A;  2O9B A;  5E2G A;  2W3H A;  4EUZ A;  3D9Y A;  4EWF A;  4QD4 A;  2PR5 A;  4K91 A;  4WUJ A;  3BFD A;  1T18 A;  4WM9 A;  3UE0 A;  4EER A;  4UQI M;  5L07 A;  3ZVT A;  3MQ0 A;  2JE5 A;  3B47 A;  4EBN A;  1K57 A;  4WEL A;  3QP1 A;  4KQD A;  2DNS A;  4NET A;  1TF1 A;  4X69 A;  3D3O A;  4RX3 A;  4WEJ A;  4YIN A;  3DTE A;  1I2W A;  1EW0 A;  4F3L A;  4BBT A;  3C7V A;  1S66 L;  2RL3 A;  4N9K A;  3DAV A;  1W8Q A;  3FWL A;  3F1O A;  1BTL A;  3E4Q A;  1K55 C;  3BY9 A;  2OLU A;  3WWX A;  3ITB A;  3PBN A;  4RYE A;  4G3W A;  3C4P A;  2V1Z A;  4OOL A;  5I5L A;  5IT5 A;  5KSH A;  4ZAM A;  4L0L A;  4P6Z M;  3QP6 A;  3ZDJ A;  1L0E A;  2V2F F;  4FOF A;  2EWV A;  2WGW B;  1TD5 A;  1S4R A;  3LI9 A;  4H6J B;  3IWO A;  1F2K A;  2JKT I;  4IBR A;  5FQM A;  3AGD A;  1XP4 A;  4KZA A;  3ZG8 B;  4QB8 A;  4KZ7 A;  1WYB A;  3BEB A;  3WS2 A;  2XGN A;  2VJW A;  3ZG5 A;  3KSH A;  2IWB A;  3TE8 A;  1SDN A;  1BT5 A;  3FPV A;  4X53 A;  4MCW A;  3A3D A;  4KZ9 A;  2ZQA A;  3IX8 A;  3CUE A;  3N7W A;  4OON A;  2PU4 A;  3KO6 A;  4M3K A;  4KQQ A;  1NXY A;  2OV5 A;  1E25 A;  2Z6D A;  4WZ5 C;  4HI4 A;  2QJ7 A;  3QP5 A;  4KG2 A;  3CI6 A;  4IBX A;  3ZGA B;  4IUK A;  4DDS A;  3HL9 A;  1XA7 A;  1BYW A;  3IBJ A;  4S2J A;  4NEE D;  5FI7 A;  1PZP A;  3FC7 A;  3H7W B;  3VP3 A;  4LV1 A;  3T4J A;  3EQU A;  4MN5 A;  3VOY A;  1NYY A;  4K0X A;  5EV0 A;  3IS2 A;  4PMA A;  1DJA A;  1GCE A;  1F98 A;  4KZ4 A;  4EET B;  1W7F A;  3A3F A;  4WZ4 A;  1L2S A;  4GCZ A;  2JCH A;  4GN2 A;  5FDS A;  3Q7V A;  1I5Q A;  4UQI S;  5A92 A;  5CEC A;  2IA2 A;  5CGW A;  5EPH A;  3PYP A;  1P9W A;  4JGR A;  4KUK A;  2W1T A;  4R3J A;  1K6R A;  2ZOI A;  2VGL M;  1ZTU A;  3R7W A;  2QMI A;  1K56 D;  1VET B;  4KG5 A;  4OLD A;  4EUV A;  4Y0T A;  3G4P A;  4HP4 A;  5E2F A;  1D06 A;  4GS9 B;  1IEL A;  3OPH A;  3CIT A;  4S2O A;  1GA0 A;  2P08 A;  2ZOH A;  4OQH A;  3S7N A;  3PBT A;  3EOI A;  1MWT A;  2OWJ A;  1JWV A;  1S6R A;  3S4X A;  3KSF A;  3JVV A;  4OQG A;  2HPB A;  1YLW A;  2XDM A;  3ULF A;  5FAP A;  4FH4 A;  4EQI A;  1MXO A;  2H5S A;  2E8J A;  5DTT A;  2HDS A;  4LPZ A;  1K4E A;  2ZQD A;  1K55 A;  2ZMV A;  3VP1 A;  4P6Z S;  3CPT B;  4JGQ A;  4E3N A;  1S67 L;  3HCY A;  3T4S A;  4MBH A;  1PFL A;  2L4R A;  2X01 A;  2R78 A;  4MN6 A;  2V9A A;  5FA7 A;  4YNR A;  4Q0H A;  3LIB A;  2VGJ A;  1KDS A;  5DJT A;  1ODV A;  4X6T A;  3VE4 A;  3E4P A;  4N9L A;  2V0U A;  1BSG A;  1SCW A;  2Z2L B;  3PBR A;  3RJU A;  1E3U D;  1PWD A;  4GD8 A;  4NKP A;  2G7U A;  3O86 A;  1TEM A;  3IX4 A;  1IYO A;  5FEG A;  1C3B A;  2G2U A;  3UDI A;  2WK0 A;  1BLP A;  5IS1 A;  2XLN A;  1XJ3 A;  2QJ5 A;  3C8C A;  4R3B A;  5DFX A;  3BJN A;  4NG2 A;  4WZ5 A;  3LIF A;  1XPB A;  2W1R A;  1N4O A;  4H8R A;  3A3E A;  2XF3 A;  4HES A;  2VV8 A;  1K0K A;  1LSX A;  3MXR A;  2Y2P A;  1V9Z A;  2ZQC A;  3C30 A;  3I7J A;  2GNX A;  4UHU A;  4YWZ A;  2W0N A;  1HVB A;  3IX3 A;  1GSW A;  3GRJ A;  5GLB A;  4B88 A;  1G6A A;  2B95 A;  3NHQ A;  3OBF A;  1NRF A;  3BFF A;  1DRM A;  3ZYT A;  5IU1 A;  1FSW A;  1S1Y A;  3RXX A;  2BTF P;  1IYQ A;  1V9Y A;  4GDN A;  3B3X A;  4A5R A;  3IXB A;  1RP5 A;  1IFQ A;  4ZJ2 A;  2OOL A;  3IWQ A;  2EX8 A;  2ZLY A;  4Y2F A;  2XD5 A;  2CMN A;  3HLF A;  4R4R A;  4GNU A;  4N92 A;  4KG6 A;  3RXW A;  4QPR A;  5EUA A;  3DWZ A;  3IHB A;  5CTM A;  4HIA A;  5AVE A;  2B18 A;  1CEG A;  1XGJ A;  1Y28 A;  2H28 A;  3T50 A;  5FAO A;  4XUZ A;  1BUE A;  5FI6 A;  3BWL A;  3Q1F A;  4L9E A;  1LT0 A;  2W3D A;  2H0Y A;  1CQA A;  1G68 A;  5GLC A;  2P7J A;  2D01 A;  4DRT A;  2WGW A;  4JXV A;  3PXP A;  2L1M A;  1K56 A;  4UAA A;  4UEY A;  1FCN A;  4ETZ A;  3P98 A;  3CAX A;  1LL9 A;  4IED A;  5FQI A;  4X55 A;  2C5W B;  5HFO A;  2EXB A;  3N8R A;  2PBY A;  4PHT A;  1MY8 A;  5CER A;  1CI8 A;  2KDK A;  1XKZ A;  2VLG A;  2LB9 A;  4IJG A;  1YM1 A;  3VFF A;  2EX6 A;  3G32 A;  2PBD P;  1FIK A;  4ZTK A;  3GTC A;  1D7E A;  1H8Y A;  3K3C A;  3AGE A;  5FAQ A;  3UB8 A;  5L09 A;  4OVD A;  3LEZ A;  5F83 A;  1ZC2 A;  3T4Q A;  1LSV A;  1LLB A;  1JTD A;  3MJQ A;  1OJ5 A;  3H7W A;  3KSG A;  4Y0U A;  1OT6 A;  1TDG A;  3NDE A;  1ONG A;  4HP9 A;  5CXW A;  1XFQ A;  2ZMA A;  4B4Z A;  1PWC A;  2X02 A;  4OQI A;  4JF5 A;  3IT9 A;  2ZM0 A;  3DWK A;  1ES3 A;  3JYI A;  2WGI A;  2J8Y A;  4BEN A;  1KGE A;  2XK1 A;  1PI5 A;  3OOV A;  4X1L A;  2A2L A;  1GA9 A;  1NLY A;  5AVF A;  2XEP A;  4R6L A;  1TS8 A;  1E3U A;  4K0W A;  4GHI B;  4FCF A;  1OTD A;  1IEM A;  3NIA A;  4UA9 A;  4KUO A;  3UNW A;  1VEU A;  1P0Z A;  4ID4 A;  5GLD A;  3BQA A;  5HPI A;  2BLS A;  4P6B A;  4KZ6 A;  4OP8 A;  1VET A;  3NJA A;  4C75 A;  3SS5 A;  4PM9 A;  1FCO A;  4P85 A;  4DKI A;  3ZG9 B;  1XGI A;  4NK3 A;  2PD8 A;  4HEF A;  4IHQ A;  3HUO A;  4LGW A;  3KYZ A;  1L0D A;  3EEH A;  3GSG A;  2Y2O A;  5DF7 A;  3E2K A;  3PBO A;  1DJC A;  4IUH A;  3IH9 A;  3SOI A;  2INW A;  3G31 A;  3O88 A;  2WAD A;  4MLL A;  4EXO A;  1W63 M;  1L3L A;  4PPR A;  3EGX C;  4B93 A;  1NRJ A;  3BLM A;  4R3A A;  1G5U A;  2ZC6 B;  3IQA A;  4LRZ E;  4GDB A;  4YFM A;  4BL2 A;  4CPK A;  4HH2 A;  2V8C A;  5EVI B;  3CPT A;  5GHY A;  4D60 A;  2WGV A;  4DJ2 A;  4RQ9 A;  3FV7 A;  2XA7 M;  1JTG A;  4E3I A;  1YLZ A;  5CHM A;  3NOP C;  2M1C A;  3NOT C;  4LCL A;  1F5M A;  4Z1W A;  1N9N A;  3A0V A;  3M6H A;  3ZQ5 A;  4HHD A;  2VEA A;  4S2L A;  1CEF A;  1YT4 A;  3HLC A;  4R4S A;  2O9C A;  2B02 A;  3FG8 A;  4Z9Q A;  5TGF A;  3ZCZ A;  3WS5 A;  1NLZ A;  5EVL A;  5M18 A;  2K7S A;  1TS6 A;  2JKG A;  1ALQ A;  5EM1 A;  1H5X A;  1FOF A;  1VQQ A;  2ZL1 B;  1N9B A;  1WE4 A;  3OLO A;  4XXR A;  4Y7P A;  5A8B A;  4Y5F A;  4GW9 A;  2NUT C;  2JN7 A;  4JGP A;  1T1B A;  3MXQ A;  1ACF A;  1H3Q A;  4I3A A;  4O0P A;  3IH8 A;  1SKO B;  3QP2 A;  3FKW A;  2WZX A;  3LIE A;  2Q9N A;  3N4I A;  4LCM A;  2J9P A;  4Y15 A;  3NUL A;  1PW8 A;  4LFU A;  3PBS A;  3LID A;  3UME A;  3R4K A;  4I39 A;  3LUQ A;  2NUP C;  3NEC A;  3W8K A;  5HX9 A;  3TW8 A;  4FTX A;  5EVI D;  1RGZ A;  3IWI A;  5HDC A;  5J3W A;  2HDU A;  2UV0 E;  3OCN A;  5A91 A;  4HJ4 A;  1Y4O A;  1JNU A;  1H8Z A;  3ZG0 A;  5EE8 A;  3UE1 A;  5HWV A;  2R9W A;  3C7U A;  2KX6 A;  1EWZ A;  3MSH A;  3LR5 A;  1FCM A;  1T19 A;  2PDR A;  3D4F A;  5DKL A;  5FDH A;  2XRO A;  3E0Y A;  3IHA A;  4JLF A;  2OAP 1;  3PAG A;  4XT2 A;  4OP5 A;  4K08 A;  3S1Y A;  3UB5 P;  4Q8I A;  5TR7 A;  4OQ0 A;  4MMN A;  2FZ0 A;  2EFX A;  5EVE A;  1YKD A;  3VP4 A;  1ESI A;  1DY6 A;  5EEC A;  2A3U A;  4G3K A;  4EV4 A;  1O07 A;  5MC7 A;  1IKG A;  4E04 A;  4ZJ1 A;  2A24 B;  2V8F A;  5HW3 A;  3T1S A;  2A49 A;  2V1B A;  4BQM A;  2GX5 A;  3TJZ C;  3FPW A;  3NC8 A;  1S0W A;  1RCJ A;  2DCF A;  4WYY A;  1JWZ A;  4E3M A;  4EBP A;  2VV7 A;  2I9V A;  2IWC A;  1W8Y A;  3GVB A;  2V0W A;  5EOE A;  5J4E A;  1CJF A;  2ZD8 A;  4CJN A;  3DTM A;  3MZF A;  5E43 A;  3UE3 A;  4E3L A;  2ZQ9 A;  2PYR A;  1H0M A;  2C6W B;  3FZC A;  1ERQ A;  3ZHH A;  2FFF B;  3ZNT A;  1PZO A;  3GV9 A;  4EU0 A;  4Q0I A;  2WKP A;  4OH0 A;  2WKQ A;  3HLB A;  4MBF A;  5IHV A;  1BUL A;  1RGY A;  1OTA A;  4DE1 A;  3GDI A;  5JYO A;  3F1N B;  4L9G A;  3EQV A;  2Q9M A;  5BOH A;  4WMC D;  1ERM A;  2PR6 A;  4KQO A;  1MWS A;  3UDF A;  5AQ7 A;  1DP9 A;  2JKR M;  2KLI A;  2HV1 A;  2ZQ7 A;  3CMZ A;  4R0Q A;  3VV4 A;  1HD8 A;  4DMZ A;  2AVX A;  3SS3 A;  1L0G A;  3T4K A;  3F1P B;  3RH8 B;  4GHI A;  1YAX A;  2Y91 A;  1T1C A;  1FIL A;  5HDS A;  3CJM A;  5FQK A;  5K5B A;  5CTN A;  3HJK A;  2XH9 A;  1NJ4 A;  3MZE A;  5TBM B;  3UDX A;  5C5K A;  1NZO A;  5F82 A;  4X25 A;  4U0X A;  4RVA A;  4B9O A;  2Y2K A;  2JKF A;  3V39 A;  2WAF A;  5FEF A;  1Z6F A;  3RFB A;  1W63 Q;  3OZH A;  3F1O B;  1G28 A;  4EEU A;  3N6I A;  5L10 A;  4EQ1 A;  4Y13 A;  4BL3 A;  1ZG6 A;  3QP8 A;  4P87 A;  2ZC7 A;  1DP8 A;  3UE6 A;  2EX9 A;  3E98 A;  1CI9 A;  2QYB A;  2DRW A;  3BW6 A;  1O7E A;  2VK3 A;  4UA7 A;  3LGO A;  4JBF A;  5LBR A;  1ES4 A;  5EVI A;  3IF5 A;  1YQS A;  1ZHH B;  2Y2I A;  4DE0 A;  3SH8 A;  1SDE A;  1QMF A;  1YSQ A;  3DBA A;  5AQ9 A;  3PBQ A;  2WAE A;  4EEP A;  4WN5 A;  1MKI A;  3OPL A;  2VGL S;  5TJJ A;  2EWW A;  1OTI A;  2ZC5 B;  1OTE A;  1KGG A;  3FYZ A;  1MPL A;  1Q2Q A;  2J3W A;  3PHY A;  4QY5 A;  5G4Z A;  1YLP A;  3BLS A;  2J9O A;  3HRE A;  3VP0 A;  3LYX A;  5GLA A;  5CHJ A;  4NXB A;  3TG9 A;  4LV0 A;  3T12 B;  5KSC A;  3Q7Z A;  1S4S A;  4HQA A;  5A93 A;  2QZ6 A;  1JVJ A;  4HOI A;  4OKP A;  3MMH A;  4E3K A;  2VV6 A;  2HDR A;  5EM0 A;  3Q81 A;  4HBU A;  1YLJ A;  4R1G A;  1UGU A;  3TSG A;  2ZBB A;  5DJU A;  3O5Y A;  5AJG A;  2W3E A;  5EFW A;  1OJG A;  1SKO A;  3P09 A;  4H6J A;  4PM6 A;  3UPN A;  1Y54 A;  1GSX A;  2HP5 A;  1ZKJ A;  1BZA A;  3W4Q A;  3UPP A;  3U2A A;  3MXS A;  4FH2 A;  5AQA A;  4FUW A;  1IYS A;  3Q7V B;  2YKH A;  1PWG A;  4IVI A;  2ZC3 B;  4KZ3 A;  4Q0J A;  2Y2H A;  3EWK A;  2P9V B;  4M4X A;  2WKE A;  5G18 A;  4RA7 A;  1G6O A;  1DJB A;  2PAV P;  3BRM A;  3T1R A;  2PD7 A;  1NZU A;  2K31 A;  4ZJ3 A;  1PRQ A;  3UB9 A;  3WS4 A;  3S22 A;  4MBK A;  3V50 A;  3U4L P;  2EFU A;  1XFN A;  4ZBE A;  4WMC A;  3G30 A;  4FD8 A;  1DP6 A;  4Y3I A;  3L9K A;  4PKY A;  5M19 A;  2G2W A;  4DDY A;  2XD1 A;  1IYP A;  2VA0 A;  1KE4 A;  5HZH A;  4LLO B;  3WRZ A;  4EW7 A;  1I2S A;  1X0O A;  2V20 A;  3UN7 A;  1AWI A;  1FSY A;  2Y2Q A;  1A0K A;  1ES5 A;  3IBR A;  3UMD A;  2PT7 A;  4E6W A;  1MBL A;  1BLH A;  2ZC4 B;  2H10 A;  4R38 A;  1ESU A;  5FL3 A;  5U47 A;  2DMW A;  3LCE A;  3O3V A;  2EXA A;  1WA9 A;  1KVL A;  3LIC A;  3EEA A;  4BBV A;  3T4L A;  3G35 A;  1K38 A;  3SH7 A;  2HJE A;  3LEQ A;  1NWZ A;  2QWS A;  2M7V A;  1KGF A;  4OPQ A;  4WL9 A;  2ACG A;  5F1G A;  4DJ3 A;  5M1A A;  2VX8 A;  3LY4 A;  4GS9 A;  2HDQ A;  3MFD A;  1HZO A;  4DXB A;  5G4Y A;  5HAR A;  1OME A;  2OAQ 1;  4G3V A;  3GQZ A;  1J3W A;  1UWN X;  4IVK A;  3LIA A;  4E6X A;  1GHI A;  4HJ6 A;  3VE3 A;  1XA1 A;  2PHY A;  3SW1 A;  5HWW A;  1Q2P A;  1N9O A;  4MDZ A;  3HVF A;  4S2M A;  3H82 B;  5HL6 A;  1LI9 A;  3E2L A;  2M7U A;  2W27 A;  4ARZ B;  3N8L A;  5L8M A;  4X56 A;  3QNC A;  2XR0 A;  5CED A;  3S7O A;  3HLW A;  3QNB A;  3KX0 X;  3DTK A;  2Y8H A;  3LY3 A;  1M40 A;  5DF8 A;  2HF6 A;  2KOI A;  1GSV A;  3DW0 A;  2Y79 A;  3W4P A;  1CK3 A;  2WYX A;  2OSU A;  2K2N A;  1K6S A;  4CLC E;  4P0M A;  1M6K A;  5DKK A;  3F1P A;  2J7V A;  3A3I A;  1Z09 A;  3Q82 A;  3IF6 B;  4ZDX A;  3QP4 A;  5KIZ A;  1LHY A;  4F94 A;  4Y0O A;  3MFX A;  1QME A;  1IOU A;  4OOM A;  3VMA A;  4BD1 A;  4ETX A;  3HLG A;  5TBM A;  1KOU A;  3V3S A;  4NXE A;  4JXW A;  1TS7 A;  1FR6 A;  1MZU A;  4PAU A;  2HP6 A;  5CX7 A;  3ISG A;  3UB7 A;  3B33 A;  3RTY A;  4DN0 A;  5HDD A;  2R9X A;  3NDG A;  5CRF A;  1HLU P;  2GDN A;  3A0S A;  3BYD A;  3WS1 A;  1OT9 A;  3S7P A;  1JWP A;  4L9F A;  4U0T A;  5HWT A;  4QHC A;  3VFH A;  3KSI A;  4I38 A;  4BWI A;  2EX2 A;  2H0T A;  3MZD A;  4I3J A;  4GKU A;  4N1H A;  2Z6C A;  2O0Y A;  3LO7 A;  4S2I A;  3V3R A;  5L2F A;  2P74 A;  3IXH A;  4QWO A;  2OWH A;  3MQQ A;  2FH5 A;  2VZW A;  5GHX A;  1N9L A;  4OPR A;  5CHU A;  4FSF A;  5F5Y A;  4GOG A;  3JPU A;  3UO9 A;  3C5A A;  1PIO A;  2J3T D;  2IWD A;  2O9A A;  2W3G A;  1KDW A;  5DTK A;  2WKR A;  4BLM A;  2FFY A;  5DFY A;  5J7E A;  1PNE A;  4PM5 A;  3C38 A;  4X68 A;  4HJ3 A;  4CLC B;  3UY6 A;  3BY8 A;  1LL5 A;  3G2Y A;  4OLG A;  4D2O A;  1GHP A;  3PAE A;  4GJ4 A;  5F68 A;  4S2N C;  1MWR A;  1LI0 A;  5JYP A;  3G6O A;  3T1X A;  5EVI C;  3MF0 A;  2D02 A;  2XFT A;  3ZG7 B;  2Y2G A;  4WF0 A;  1KVM A;  1SHV A;  2J3T C;  3BEC A;  3SZT A;  2JKT M;  3PTE A;  3C4O A;  3NCK A;  4LV3 A;  3W4O A;  1WYC A; 
#chains in the Genus database with same CATH homology
 4NXF A;  2L0W A;  1LL8 A;  2XA7 S;  4WEL A;  1D7E A;  3K3C A;  4EQ1 A;  4KQD A;  3UB8 A;  1TF1 A;  3H9W A;  1DP8 A;  3D3O A;  4WEJ A;  3VOL A;  3W2Z A;  3UE6 A;  3E98 A;  2QYB A;  3OCL A;  3BW6 A;  2JKR I;  3T4Q A;  5LBR A;  1LSV A;  3T4O A;  1EW0 A;  3MJQ A;  1XJ4 A;  2HJ9 C;  4F3L A;  4BBT A;  1ZHH B;  1OJ5 A;  3H7W A;  3KSG A;  2JHE A;  1OT6 A;  1S66 L;  4HP9 A;  3F1O A;  3E4Q A;  1XFQ A;  2EA9 A;  1YSQ A;  3BY9 A;  3DBA A;  1MKM A;  3PBQ A;  3PBN A;  2MJ6 A;  2QHK A;  3PR6 A;  4EEP A;  4G3W A;  4WN5 A;  2VGL S;  5TJJ A;  4OOL A;  2EWW A;  5I5L A;  5IT5 A;  1OTI A;  3A0R A;  5KSH A;  1OTE A;  3OOV A;  2A2L A;  4L0L A;  1NLY A;  5AVF A;  4P6Z M;  2J3W A;  3PHY A;  5G4Z A;  4R6L A;  4FOF A;  1TS8 A;  3LYX A;  2XSS A;  4GHI B;  2EWV A;  4NXB A;  3MR0 A;  1TD5 A;  1OTD A;  1S4R A;  2ZMF A;  3LI9 A;  4ME4 A;  4KUO A;  4CLC D;  4H6J B;  1S4S A;  4HQA A;  1P0Z A;  5HPI A;  3BQA A;  4HOI A;  2JKT I;  3MMH A;  4HH3 A;  3NJA A;  2VV6 A;  4BJP A;  1UWP X;  3T4T A;  2PD8 A;  2VJW A;  1UGU A;  4IHQ A;  3KSH A;  2LB5 A;  2ZBB A;  5DJU A;  3TE8 A;  3KYZ A;  3EEH A;  3FPV A;  3PBO A;  4MCW A;  3O5Y A;  3GEC A;  5AJG A;  2W3E A;  4IUH A;  5EFW A;  2V1A A;  1OJG A;  3CUE A;  2INW A;  5HPF A;  4H6J A;  3LR3 A;  1GSX A;  3KO6 A;  4EXO A;  1W63 M;  3EGX C;  4B93 A;  3U2A A;  2Z6D A;  1NRJ A;  4R3A A;  4HI4 A;  4CLC C;  2QJ7 A;  2P04 A;  4LRZ E;  3CI6 A;  4IUK A;  2YKH A;  1BYW A;  4HH2 A;  4Q0J A;  4AFI A;  3MQO A;  4F3L B;  3IBJ A;  4NEE D;  1F9I A;  3FC7 A;  3EWK A;  4DJ2 A;  3H7W B;  4RQ9 A;  4M4X A;  2XA7 M;  3T4J A;  3EQU A;  4MN5 A;  3D72 A;  3NOP C;  1P9R A;  2M1C A;  3IS2 A;  1G6O A;  4MN7 A;  3NOT C;  1F5M A;  4Z1W A;  1N9N A;  3A0V A;  3H82 A;  3ZQ5 A;  1F98 A;  4I3I A;  4HHD A;  2PD7 A;  4EET B;  2VEA A;  4ARZ A;  1LSW A;  4GCZ A;  2O9C A;  2K31 A;  3K3D A;  2B02 A;  3FG8 A;  3UB9 A;  3JVU A;  2HGV A;  4UQI S;  1XFN A;  1NLZ A;  2IA2 A;  2K7S A;  1TS6 A;  1DP6 A;  3PYP A;  1P9W A;  4JGR A;  4KUK A;  2W1T A;  4NXG A;  4Y3I A;  4PKY A;  2ZOI A;  2VGL M;  1ZTU A;  3R7W A;  1YSP A;  2VA0 A;  5HZH A;  4LLO B;  3OLO A;  4EUV A;  4HP4 A;  4EW7 A;  1X0O A;  1D06 A;  3LFV A;  5A8B A;  4GS9 B;  3IBR A;  3UMD A;  3CIT A;  2PT7 A;  3P01 A;  4Y5F A;  2GZA A;  2P08 A;  2ZOH A;  4GW9 A;  2NUT C;  2JN7 A;  3S7N A;  3PBT A;  4R38 A;  5HD3 A;  3C2W A;  4JGP A;  5FL3 A;  3EOI A;  2DMW A;  4HNB A;  4O8G A;  1T1B A;  2OWJ A;  1WA9 A;  3LIC A;  3MXQ A;  1H3Q A;  1VB6 A;  3BQ8 A;  3EEA A;  1XJ2 A;  4I3A A;  3K2N A;  4O0P A;  4BBV A;  5HSQ A;  3KSF A;  3JVV A;  3OC2 A;  3T4L A;  2HJE A;  2GJ3 A;  3EGD C;  5F69 A;  1P97 A;  3ULF A;  3LIE A;  1NWZ A;  2O99 A;  2QWS A;  2M7V A;  4WL9 A;  4BBU A;  4LPZ A;  4DJ3 A;  2VX8 A;  4GS9 A;  2ZMV A;  3HJI A;  2XRN A;  3PBS A;  3KYQ A;  3LID A;  3UME A;  3R4K A;  4P6Z S;  4I39 A;  3LUQ A;  2NUP C;  5G4Y A;  4I5S A;  2OAQ 1;  3TW8 A;  4XT2 B;  4G3V A;  3E4O A;  1STZ A;  1UWN X;  5HDC A;  4LRY C;  3LIA A;  5J3W A;  4JGQ A;  1S67 L;  4HJ6 A;  3HCY A;  3T4S A;  3OCN A;  3VE3 A;  4HY8 A;  2PHY A;  4HJ4 A;  3SW1 A;  2L4R A;  3IS2 B;  2R78 A;  5HWW A;  4MN6 A;  2V9A A;  4YNR A;  1N9O A;  4MDZ A;  2BAS A;  4WEK A;  5HL6 A;  3H82 B;  1JNU A;  4Q0H A;  1OTB A;  3LIB A;  2M7U A;  5HWV A;  1VHM A;  2KX6 A;  2W27 A;  4ARZ B;  5DJT A;  1MC0 A;  1ODV A;  3VE4 A;  3LR5 A;  3E4P A;  5L8M A;  1T19 A;  2PDR A;  4R70 A;  5DKL A;  2V0U A;  2XRO A;  3E0Y A;  3PBR A;  3TRC A;  3S7O A;  2OAP 1;  3LR4 A;  4NKP A;  4XT2 A;  1S1Z A;  4K08 A;  3KX0 X;  2G7U A;  2Y8H A;  2W1T B;  4MMN A;  5IS1 A;  2FZ0 A;  2HF6 A;  2KOI A;  3R7W B;  1YKD A;  1GSV A;  1XJ3 A;  2Y79 A;  2QJ5 A;  2W3F A;  3C8C A;  4G3K A;  5DFX A;  2K2N A;  5MC7 A;  3BJN A;  4CLC E;  4CQH A;  4E04 A;  5DKK A;  3F1P A;  2A24 B;  3LIF A;  2W1R A;  4CLC A;  1H8M A;  2V1B A;  5KIZ A;  2GX5 A;  3TJZ C;  2VV8 A;  3FPW A;  1LSX A;  1V9Z A;  3C30 A;  3MFX A;  5F6A A;  4YOF A;  2GNX A;  2VV7 A;  2I9V A;  3P7N A;  4OOM A;  4ZRR A;  3B42 A;  3LI8 A;  4ETX A;  1IOU A;  5TBM A;  1KOU A;  2V0W A;  4YWZ A;  4NXE A;  5J4E A;  2W0N A;  1TS7 A;  1MZU A;  4PAU A;  1GSW A;  3UE3 A;  1TS0 A;  2PYR A;  5CX7 A;  3UB7 A;  3B33 A;  3RTY A;  2A24 A;  4DN0 A;  5HDD A;  5HD5 A;  3NHQ A;  3V67 A;  3OBF A;  3S7Q A;  4PKY G;  1DRM A;  3ZYT A;  3A0S A;  5IU1 A;  1OT9 A;  3LR0 A;  1S1Y A;  3S7P A;  4L9F A;  1V9Y A;  4EU0 A;  3CWF A;  5HWT A;  4Q0I A;  3KSI A;  4I38 A;  1IFQ A;  4BWI A;  2WKP A;  2OOL A;  4I3J A;  2Z6C A;  2J80 A;  2QKP A;  2O0Y A;  1T1A A;  2WKQ A;  4Y2F A;  3CLO A;  2OWH A;  2CMN A;  3CUE C;  3MQQ A;  2FH5 A;  2VZW A;  3ICY A;  1OTA A;  1N9L A;  4QPR A;  3GDI A;  4FSF A;  3F1N B;  4L9G A;  5F5Y A;  3EQV A;  4BMW A;  4HIA A;  1OPX A;  5AVE A;  2PR6 A;  4EES A;  2B18 A;  4O01 A;  4KQO A;  1XJ6 A;  2PYP A;  4WLA A;  1Y28 A;  2H28 A;  3T50 A;  2J3T D;  1DP9 A;  2JKR M;  2KLI A;  5DF9 A;  3UB6 A;  2O9A A;  2W3G A;  2HV1 A;  3VV4 A;  4JGO A;  2WKR A;  3BWL A;  4L9E A;  4DMZ A;  1LT0 A;  2W3D A;  4LRX C;  5DFY A;  3NOU C;  5J7E A;  3T4K A;  3F1P B;  2P7J A;  3C38 A;  4II7 A;  3RH8 B;  2D01 A;  4GHI A;  4HJ3 A;  1YAX A;  4GLQ A;  3PXP A;  4CLC B;  3BY8 A;  1T1C A;  5HDS A;  2VKS A;  3F1N A;  2L1M A;  4UEY A;  2YKF A;  5K5B A;  3HJK A;  4ETZ A;  4GJ4 A;  5F68 A;  2O9B A;  2W3H A;  3CAX A;  5TBM B;  5C5K A;  2PR5 A;  4WUJ A;  3G6O A;  3MF0 A;  1T18 A;  4B9O A;  4EER A;  4PHT A;  2D02 A;  4UQI M;  4WF0 A;  3MQ0 A;  2KDK A;  2J3T C;  2VLG A;  2LB9 A;  4IJG A;  2JKT M;  3B47 A;  3RFB A;  1W63 Q;  3F1O B;  1G28 A;  4EEU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...