1OTBA

Wild type photoactive yellow protein, p63 at 295k
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
125
structure length
125
Chain Sequence
MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Short hydrogen bonds in photoactive yellow protein.
pubmed doi rcsb
source organism Halorhodospira halophila
molecule tags Signaling protein
molecule keywords Photoactive yellow protein
total genus 37
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2003-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1otbA00
4HNBA 5HWVA 1TS0A 3F1OB 2PR6A 3LIEA 3D72A 3LIDA 4L9EA 2A24A 3E4OA 1V9YA 3MR0A 5F68A 2V9AA 5HWTA 1MZUA 1OTDA 3CLOA 2VLGA 4I38A 4KQDA 4MN5A 5I5LA 3VE4A 3ZQ5A 4WUJA 1T1CA 4HI4A 4NXGA 5TBMA 2L0WA 2ZOHA 3VE3A 3FG8A 1S66L 3RTYA 4DJ3A 1Y28A 1S1ZA 1TS6A 2R78A 4DJ2A 4JGQA 5HDCA 4F3LB 4LPZA 3GDIA 4HHDA 4I3AA 3LI9A 5AVFA 1D06A 3KX0X 4M4XA 1T1AA 4LRXC 4PKYG 5J7EA 2V0WA 4GW9A 3RH8B 4WL9A 4XT2A 4LRZE 5G4YA 5HZHA 5DKKA 4H6JB 1NWZA 1T19A 2PD7A 3NJAA 4BBTA 1N9NA 2QKPA 3PYPA 4K08A 2WKPA 5F5YA 1UGUA 2JHEA 1S67L 4HIAA 4L9FA 1JNUA 4EEPA 4EETB 4EQ1A 2WKRA 3EEHA 1D7EA 4NXFA 4KUOA 2PHYA 3F1OA 4GHIA 3K3DA 2H28A 4HH3A 4XT2B 3ICYA 3F1NA 3C8CA 1EW0A 3E4PA 1LSVA 4HQAA 2QJ7A 3LYXA 1OTAA 3UE6A 2I9VA 3UMEA 5HSQA 2QJ5A 3UB8A 4BBVA 4HJ4A 1OT6A 1XJ3A 4R70A 3LIFA 4HJ6A 2OOLA 2PYRA 3NOPC 4JGRA 4LLOB 3NOTC 1TS7A 2QHKA 3MQOA 3UMDA 4I3IA 5DJUA 1LSXA 3T50A 4RQ9A 1N9LA 2WKQA 3G6OA 3HJKA 1OTIA 4GCZA 1XJ2A 3F1PB 5IU1A 4JGOA 2PDRA 4EERA 1GSXA 1DP6A 2BASA 1V9ZA 2L1MA 4R3AA 4R38A 3LICA 4I39A 4WF0A 3UB7A 2YKHA 4GS9B 2OWHA 5DJTA 5DKLA 2V0UA 5A8BA 4NXBA 5KIZA 1WA9A 2KX6A 1OT9A 1S1YA 2D01A 2M1CA 2GJ3A 3HJIA 1OJ5A 4HOIA 3CWFA 1S4RA 5AVEA 2PR5A 3A0RA 1P97A 1XFQA 3MQQA 3OLOA 3F1NB 2QWSA 3IS2A 3MJQA 4EXOA 2W27A 1GSWA 3A0VA 4HY8A 1X0OA 4B9OA 2YKFA 1UWPX 2B02A 1DRMA 2L4RA 3P7NA 5TBMB 1ODVA 1GSVA 1S4SA 3MFXA 1F98A 2K7SA 2V1AA 2Z6CA 3MXQA 4WN5A 2VV7A 1P0ZA 2D02A 3IBRA 3VOLA 4I3JA 1VB6A 4EW7A 4HP4A 1DP8A 2VV6A 3K3CA 4H6JA 2Z6DA 3CAXA 5HWWA 3IS2B 1DP9A 1LSWA 2HV1A 3E4QA 3H82A 3LIBA 3LUQA 4HP9A 4I5SA 2VEAA 4KUKA 5F6AA 5F69A 2CMNA 1T1BA 1G28A 2V1BA 1UWNX 3H7WA 2VV8A 3H82B 3C2WA 2OWJA 4HH2A 3H7WB 4GHIB 4R6LA 5HDSA 3ULFA 4NXEA 4GS9A 5HD3A 2JN7A 5J3WA 4YWZA 1OJGA 3BWLA 1OTBA 3BY9A 2J80A 1F9IA 4MN6A 2KDKA 1TS8A 4HJ3A 4WLAA 3UB9A 3A0SA 1OTEA 2EA9A 5HDDA 3EWKA 3F1PA 4BBUA 4E04A 2INWA 3SW1A 2ZBBA 5HD5A 1N9OA 1XFNA 2PD8A 2PYPA 2ZOIA 4PKYA 4EEUA 3LI8A 5G4ZA 2A24B 3PHYA 4L9GA 5EFWA 4EESA 5IS1A 1XJ6A 2W0NA 4JGPA 1LT0A 1XJ4A 5J4EA 4LRYC 3GECA 3LIAA 3B33A 3NHQA 1BYWA 1LL8A 2P7JA 3H9WA 3FC7A 4F3LA 3BY8A 1T18A 1KOUA 3NOUC 3UB6A
chains in the Genus database with same CATH superfamily
4RX2A 4WBGA 2A24A 2EFUA 1H3QA 1W63M 2JKRM 2W3FA 3FG8A 1S66L 2ZQ8A 1EI5A 1TS6A 4KENB 1ZG4A 3KX0X 3MXRA 4UHUA 2G2WA 5DTKA 4PM6A 1N9NA 4A5RA 2WKPA 4O01A 2Y91A 1JNUA 4II7A 2WKRA 3GV9A 3CPTB 5HAPA 3ICYA 1Q2PA 2PU2A 3QP8A 3M6BA 3UMEA 4DE2A 3IQAA 2J9PA 4LV3A 1CK3A 3MMHA 3MBZA 3T4LA 4I3IA 3T50A 2QZ6A 4GCZA 4UAAA 5DFXA 3G34A 1Z6FA 4DXBA 1K0KA 2Y8HA 1KE0A 5J8XA 3WS4A 2M1CA 1JWPA 3HJIA 1RP5A 3MQQA 3S7OA 2Y2HA 4KG6A 1UWPX 1S0WA 2XF3A 3O3VA 1IOUA 4H6JA 2VV6A 1CJFA 1LSWA 4DJ2A 4WEJA 3G35A 2HDRA 2NUTC 4GDNA 3CUEC 1YMSA 2WGIA 1F9IA 3TOIA 3G31A 1L0EA 3PHYA 3UO9A 4GD8A 3BFFA 4X53A 4Y7PA 1IFQA 1PZPA 2P7JA 3SH7A 4NKPA 4UA9A 1MZUA 3MZEA 4XXRA 1GCEA 2FH5A 2HPBA 5EECA 5CTNA 2Y2LA 1ZG6A 4HHDA 3LI9A 3ZG5A 2BLSA 3T12B 3BECA 4XT2A 3VOZA 3HUNA 1YLYA 3TRCA 3Q82A 2B95A 1NWZA 2QKPA 1BLCA 4EBNA 2HGVA 1UGUA 4BD1A 4LFUA 4NXFA 4P0MA 3BFEA 4GDBA 3S7NA 3C8CA 4WYYA 2VKSA 4K0WA 4ID4A 3OPRA 3DWKA 3IHBA 4QY5A 1HVBA 2KOIA 4PAUA 1PW1A 2J8YA 3HJKA 3MS6A 1YLPA 4CLCD 1JVJA 4G3KA 3LICA 3EGDC 4LENA 4OQGA 4S2MA 3S7QA 1XXMA 1CEFA 4KQOA 2KX6A 1S1YA 3CWFA 3KSFA 1XFQA 4HY8A 5CRFA 3T4JA 2YKFA 3D9YA 1PRQA 1WYBA 3CAXA 3QNBA 1DP9A 4I5SA 4HP9A 3LUQA 4KUKA 5FI7A 3QP4A 4R6LA 5FEFA 1K56D 3SS4A 4NG2A 4MMNA 1OTEA 5CERA 1KGGA 1BZAA 1K6RA 3UPPA 5J4EA 2JKTM 2ZQAA 3FPWA 4LRYC 4ETZA 4F3LA 3NOUC 1O07A 4DE1A 3ZNTA 2J9OA 4OPQA 3P01A 3ZQ5A 2Y2PA 5FQKA 4PHTA 1GHMA 1Y54A 4JF4A 1T1AA 2P08A 2E8JA 4FOFA 4KZ6A 4BJPA 5F82A 4EBLA 4H8RA 5FI2A 4BWIA 1MWSA 2PBDP 1EW0A 4Y3IA 3NDEA 3ITBA 3HUMA 1I5QA 5TR7A 4Y0TA 4MN7A 1LSXA 2Y2GA 4DDSA 2YKHA 2OWHA 4KG5A 5CXWA 3M2KA 3HL9A 1MPLA 3IS2A 4S2IA 3IHAA 4B9OA 3IBJA 2L4RA 2J3TC 3U2AA 1VEUA 2Q9MA 3OPHA 2JKTI 2P9VB 4R4RA 2K7SA 2GX5A 4WELA 2IWBA 5GHYA 3ZVWA 5L09A 5HX9A 3A3DA 2WGWA 2VGJA 2WKEA 3ZYTA 1G6OA 3BWLA 3JVUA 5TGFA 2VK3A 1FR6A 4OQHA 3OPLA 2V2FF 4HJ3A 3UE1A 3A3FA 4EV4A 3SW1A 2JE5A 5EVLA 2PD8A 2EX9A 1WE4A 2A24B 3A3IA 1NLYA 3KSGA 1LT0A 4MBHA 1YSPA 4R3BA 3V3RA 3LIEA 1SHVA 1YT4A 4N9LA 2IWCA 5FI6A 5FDHA 3IH9A 3IWQA 1N4OA 1CI9A 1P9RA 5HDCA 4I3AA 3N8SA 1D06A 2NUPC 3CPTA 4X55A 4YINA 5FATA 2OLUA 3N8RA 1T19A 3MF0A 2X02A 1YSQA 5FAPA 4U3TA 4Y17A 1KE3A 4Q8IA 4D2OA 1NYYA 2JKGA 2WGWB 5FQIA 1BT5A 1ESUA 1M6KA 5L10A 2XSSA 5DJUA 3G6OA 3F1PB 1E25A 5DF9A 3G30A 3UB7A 1DJCA 2W1TA 5EV0A 5AQAA 4HOIA 5E2HA 4DDYA 5HAQA 4OQ0A 2PAVP 1IKIA 1YLJA 4KQRA 3C5AA 4KZ3A 3AGFA 3DWZA 1VETB 2RL3A 1NRFA 4E3LA 4GZBA 1IYQA 1W8QA 2JKFA 3RXXA 1PIOA 4Y2FA 4XUXA 4DXCA 5HDDA 3NULA 4GJ4A 3C4PA 4U0TA 4N9KA 3ZGAB 4JXWA 4P6ZS 3G2ZA 3ZNYA 3ZG8B 4C3QA 3HVFA 1ES2A 4PMAA 4IUHA 4IVKA 3FC7A 2ZOHA 1T18A 3F1OB 3UN7A 3LY4A 3D72A 5M18A 3JPUA 3LR5A 4S2KA 3ZVTA 1Y28A 2B18A 3Q07A 3DTIA 4RVAA 4DN0A 4N1XA 2JHEA 5I94A 4E6XA 1LSVA 4IHQA 3UE6A 1XJ3A 2XRNA 2PYRA 1PWDA 2WKIA 5FQJA 2P74A 2WK0A 1PFLA 3PBOA 1NY0A 5FA7A 4HESA 3VFHA 4Z1WA 4GS9B 1MKMA 2V0UA 2PRFA 1OT9A 2PR5A 5HL1A 4O8GA 1Y4OA 1K4EA 3P7NA 3KYZA 1MBLA 1JTDA 4OLDA 5CECA 1P0ZA 3HLFA 5HZHA 4Q0HA 5F6AA 1M40A 2Q9NA 4EEUA 4ESPA 4IJGA 4UA6A 3A0SA 1IYPA 2EA9A 4BMWA 3N8LA 1W8YA 3CG5A 1XKZA 4MEZA 5AQ7A 3NI9A 5FAQA 1TS0A 5CHUA 2H5SA 3E4OA 3MR0A 4UA7A 1SDEA 4KQDA 3RFBA 1D1JA 4EWFA 4JGQA 4S2LA 1K54C 1HD8A 4LV1A 2PD7A 4X1MA 3D3OA 4X68A 3EEHA 2QYBA 2PHYA 1IELA 2H28A 4QJGA 2VJWA 3E4PA 3FPVA 3UB8A 4HJ4A 5DF8A 4D60A 3BLSA 3WWXA 3OZHA 3IXGA 3LY3A 3ZHHA 3QP6A 2L1MA 2EXAA 4DE0A 2FFYA 2M7VA 3A0RA 3UB6A 2QWSA 1YAXA 2HJEA 1ONHA 3UDIA 2JKRI 2Y79A 1X0OA 3MKFA 3CITA 4JKTA 3R4KA 4KZ7A 4QB8A 1F98A 3SH8A 3IBRA 5FQMA 2ZMVA 1NRJA 2ZC4B 3HCYA 5E43A 1G5UA 5EUAA 2UV0E 3ULFA 4GS9A 4RYEA 1OJGA 4R23A 4ZTKA 4MN6A 2V8FA 4GKUA 5G4ZA 3GSGA 3BFDA 4CLCA 3DTMA 4B4XA 1BYWA 4OKPA 5EM1A 4DMZA 3OOVA 5F68A 1K54A 2VLGA 3IX4A 4E3KA 2VX8A 2L0WA 1G68A 4MDZA 5EE8A 1GHIA 5HPFA 1VM1A 3NECA 1Q2QA 2PT7A 5DKKA 5BOHA 4U0XA 3IF6A 4S2OA 5GLCA 2GNXA 4DE3A 3EQVA 2A3UA 3Q7ZA 4KG2A 4GHIA 1FSWA 4HQAA 3LYXA 3CZDA 5FQ9A 2XROA 2X71A 3BLMA 4UEYA 4X25A 3O88A 3IF6B 1N9LA 3RJUA 2MJ6A 4LCMA 1XJ2A 3EQUA 5GLAA 1GSXA 4P6ZM 5JYPA 2R9XA 1SKFA 2Y59A 3IX3A 1MXOA 4CPKA 4NXBA 5KIZA 1WA9A 2WAFA 4B88A 3E98A 1OJ5A 5IT5A 5CGXA 4QD4A 1YM1A 2O0YA 3TJZC 4S2NA 3PR6A 3S22A 2V1AA 1MWRA 4BBVA 3E2KA 3ZFZA 3V3SA 1MWUA 3H82B 3H7WB 4OP5A 5U47A 3HBRA 1SKOB 4FTXA 4FD8A 5F83A 3UB9A 4K91A 4OOLA 4WZ5C 5D3OA 2ZD8A 2VGKA 4CLCB 4PM9A 2ZL1A 3C7VA 2DMWA 3PTEA 1QMEA 2EWWA 5MC7A 1A0KA 1YLTA 4HNBA 4BQMA 2PR6A 1STZA 3DW0A 1V9YA 3CLOA 4WUJA 1T1CA 4FCFA 5F1GA 4F3LB 4PKYG 4GW9A 1BSGA 1JWVA 3HUOA 5F5YA 3SS3A 4HBTA 4OPRA 3OC2A 3D4FA 1L2SA 2VGLS 3QP2A 1PI4A 3IX8A 5IHVA 1H8MA 3W4PA 4LLOB 1LL5A 2QHKA 1L0DA 1PZOA 3DTEA 5IU1A 5DVAA 4OQIA 3EGXC 4R3AA 2WKHA 4Q0IA 3GR2A 3MFDA 4QPRA 4YOFA 2W3HA 1DJAA 1MWTA 3MXQA 2Z6CA 4QHCA 5J7EA 1BUEA 4EUVA 4EUZA 1VB6A 3ZG9B 3K3CA 4E3IA 3AGEA 5GL9A 1DJBA 3P98A 3WS2A 5HL6A 2K2NA 3JYIA 1NZUA 4GOGA 3PBQA 2KDKA 3V5MA 3F1PA 3GQZA 1FQGA 4E04A 3HLBA 2V1ZA 1N9OA 3LI8A 5E2GA 3WS5A 4DF6A 1XJ6A 4JF5A 4NETA 4KZAA 3MZFA 4O7DA 3GECA 5TJJA 1ZTUA 3GMWA 1YKDA 3LIDA 1FSYA 4E6WA 4MN5A 1OTDA 5I5LA 3HREA 1KDSA 5K5BA 4HBUA 3T4OA 2KLIA 2IWDA 5GHZA 4M4XA 3EOIA 3TE8A 5G18A 5FQQA 4H6JB 1RGYA 2RCXA 4HIAA 1SCWA 1JTGA 5A92A 3DAVA 4BLMA 4ARZB 4EBPA 4PM8A 3NDGA 3NOPC 4O0PA 3MQOA 4RQ9A 2Y2JA 3T4SA 3EEAA 3A3JA 3CI6A 4N1HA 4DRTA 1BLPA 1KVMA 2R9WA 2ZQCA 5AJGA 1P97A 5CHJA 1P9WA 1ALQA 4E3OA 3UE3A 4HP4A 2Z6DA 4C6YA 1NYMA 2VA0A 5F69A 2CMNA 2EX2A 3C2WA 2E8IA 1FCNA 4CJNA 4YWZA 2PBYA 4Y0UA 1QMFA 4P6BA 2WAEA 1I2WA 2XD5A 2WZXA 1XGJA 5HW3A 5L07A 5DF7A 2WGVA 5HFOA 4AFIA 3CMZA 4PM7A 3R7WB 2ZC6B 3Q81A 2J7VA 3CHWP 3MQ0A 1BLSA 2HP5A 1NXYA 5EM0A 5KSCA 2Z2MB 5FDSA 1K6SA 4B4ZA 1ES5A 4NXGA 1H8YA 2V20A 4Y13A 1LHYA 2H0TA 4JXGA 3T1XA 3WS0A 1ZKJA 3AGDA 4KUOA 3K3DA 2H0YA 1ERMA 4Q0JA 4IBRA 4L0LA 3L7HA 2QJ5A 2ZM8A 1TS7A 2Y2MA 5FSRA 4EERA 4MCWA 5CEDA 2D01A 1TVFA 3CJMA 4E3MA 1K56A 3WS1A 2B02A 3B3XA 2Y2QA 1ODVA 1VHMA 1GSVA 3BM6A 4GD6A 1E3UD 1H5XA 3FV7A 5DFYA 4DKIA 2HV1A 2X01A 4FSFA 3C38A 4WLAA 2ZMFA 2HP9A 1L0FA 3LCEA 2Q0OA 3UY6A 2HZ5A 2OAQ1 2OAP1 1IYOA 1U60A 2C6WB 5A91A 2HJ9C 2VGLM 4WMCD 2B5RA 3OCNA 4N92A 3B33A 3NHQA 1GHPA 3PYPA 4QU3A 3N7WA 3Q1FA 3C7UA 2GDNA 3G4PA 4KZ8A 4Y15A 2XA7S 3ZDJA 4OVDA 3LEZA 1IYSA 4KZBA 3NJAA 3VP3A 4ZAMA 3HLGA 5CEBA 3WRTA 2DCFA 4ME4A 5AQBA 4IVIA 3BW6A 5EVIC 1XA7A 1E4DA 2QJ7A 1MKIA 1TDGA 1K55A 3IF5A 1ACFA 2I72A 3LIFA 4Y0OA 3UMDA 2HP6A 4PPRA 4JBFA 4WM9A 5EVIB 3WRZA 3S4XA 3BFCA 1CQAA 2DNSA 1KGEA 3PBSA 2Y4AA 3KYEA 4RX3A 3L9KA 3MXSA 3I7JA 3Q7VA 2W27A 2XLNA 4KZ5A 5GLBA 5HPIA 2ZM0A 3ZG0A 1S4SA 4PM5A 5M19A 3NBLA 2ZC3B 3NY4A 4MBKA 4LV0A 4UQIS 4E3JA 2Y2NA 2VV8A 4HH2A 3W4OA 1ES3A 2HDUA 3OPPA 1F5MA 2ZLYA 1TS8A 1NLZA 2WYXA 3EWKA 3IWOA 4BBUA 1FILA 5HD5A 1XFNA 2PYPA 2EWVA 2H10A 5EFWA 3C4OA 1ERQA 1ES4A 1NZOA 3IT9A 3LEQA 2O9CA 4OP8A 5HAIA 1IEMA 3H9WA 3SOIA 3HLEA 1G6AA 5HWTA 2EX6A 2G2UA 4P85A 2ZQDA 1XX2A 4JPMA 5LBRA 2R78A 1FOFA 3GDIA 4OH0A 2JBFA 5DTTA 4X69A 4ZBEA 4BBTA 4ZJ3A 4ZRRA 3BFGA 1Z09A 1PWCA 1ESIA 1K57A 2WZZA 4EU0A 1OT6A 3FKVA 1AWIA 3PBNA 4JGRA 4IEDA 1KE4A 1L3LA 2XA7M 2BASA 4E3NA 4R38A 3KSHA 4I39A 4WF0A 2OV5A 2QMIA 5DJTA 2G7UA 1ZC2A 3W4QA 2WUQA 3UE0A 2A49A 3T1SA 3GVBA 4GN2A 1VEUB 3O87A 4OPYA 5TFQA 1K57C 3MKEA 5L8MA 3E4QA 4X1LA 3DBAA 1TF1A 4R3JA 2OWJA 5HDSA 3E2LA 3MZDA 1OTBA 5A90A 3BY9A 2LB5A 1OMEA 2XEPA 2ZBBA 3SZTA 1K4FA 2ZOIA 4MNRA 4LV2A 1PW8A 4IBXA 2DRWA 2W0NA 1XJ4A 2PU4A 4OPZA 4ARZA 4HEFA 3BY8A 1KOUA 2ZMAA 4ETXA 4GLQA 3VP0A 2J3WA 4I38A 1XA1A 2JCHA 4G3VA 1HZOA 4QY6A 3RTYA 3S7PA 3QP5A 3T1RA 1KGFA 5AVFA 2CC1A 3FZCA 3TSGA 3T4QA 5GLDA 1W79A 3B47A 2ACGA 1TD5A 1FCOA 4EETB 4EEPA 4L9FA 4R0QA 4CLCE 1D7EA 4Z9QA 1E3UA 3PBTA 3ITAA 3U4LP 2VZWA 4QWOA 3LR4A 4R4SA 4M3KA 5CGSA 1GA9A 1H0MA 3O5YA 1XGIA 4NK3A 1JWZA 2WKQA 1OTIA 2P04A 3OCLA 3UDFA 3TW8A 4OOYA 3C30A 5AVEA 3R7WA 3T4TA 4X6TA 3PXPA 4ZDXA 1CI8A 1I2SA 2GZAA 2HDQA 4Y5FA 3HLDA 4P87A 4I3JA 2Y55A 1DP8A 5HWWA 1ONGA 1CF0A 4DJ3A 1T1BA 1G28A 3IXDA 2JN7A 3T1QB 2INWA 5KZHA 3FKWA 4L9GA 4LCLA 1SZVA 2EXBA 4G3WA 1K38A 3M2JA 2W1RA 2XR0A 1LL8A 5CX7A 5HWVA 1AXBA 3N6IA 4JLFA 4CLCC 1IKGA 1S1ZA 3HLCA 1N9BA 2V0WA 1SDNA 3RH8B 4EQIA 3P09A 2ZM2A 3LR0A 4OONA 1O7EA 1S67L 3PAGA 4EQ1A 5E2FA 3G2YA 3F1OA 3BQ8A 2Y2KA 3F1NA 3UDXA 4BL3A 4IUKA 3GTCA 1C3BA 3LFVA 4R70A 5EOEA 2OOLA 2ZJ9A 3NOTC 2LB9A 4KZ9A 3TG9A 1YLWA 4FH2A 1OPXA 2PDRA 4WMCA 2OLVA 3V39A 1V9ZA 4KZ4A 5F1FA 5FASA 4C75A 5DKLA 5A8BA 5M1AA 4MLLA 4MBFA 2GJ3A 3KSIA 4EXOA 5CTMA 3MJQA 5FL3A 1DY6A 1DRMA 1S6RA 4YFMA 4NEED 2VV7A 4EW7A 3PAEA 2HF6A 1J3WA 5TBMB 1UWNX 3JVVA 5GHXA 4GHIB 2XDMA 4XUZA 4NXEA 5HD3A 1LLBA 5J3WA 2O9AA 3G32A 4JXSA 1HTZA 2BG1A 3NC8A 2J3TD 3KYQA 4WEKA 1PNEA 2ZQ7A 3LO7A 3LR3A 1BLHA 2O9BA 1NJ4A 1MY8A 1FR1A 3S1YA 3T4KA 1EWZA 1TEMA 1WYCA 2FFFB 5CGWA 5C5KA 4JGPA 3V67A 3BJNA 3QHYA 1W5DA 4X56A 5A93A 2ZL1B 2JC7A 5KSHA 4BENA 3V50A 2XD1A 3BEBA 4K0XA 5AQ9A 2C5WB 1K25A 3FYZA 3QNCA 2V9AA 3IXBA 2Y2IA 3ISGA 3ZG7B 4HI4A 3IWIA 3VE3A 4GNUA 1MC0A 3LGOA 1YMXA 4LRXC 2XH9A 5EOOA 4BD0A 4WL9A 3DTKA 2EX8A 5CHMA 3SS5A 4S2PA 5JYOA 5HARA 5FEGA 4B93A 2Z2LB 2FZ0A 1SKOA 4S2JA 3BQAA 4HH3A 4XT2B 2XK1A 4RA7A 1LI0A 1OTAA 1YPRA 2XFTA 1LL9A 1FCMA 1K55C 1RCJA 4HJ6A 2W3EA 2W3DA 3O86A 1PI5A 1XPBA 2W3GA 5L2FA 3VOLA 4JGOA 3IH8A 1DP6A 2OSUA 3BYDA 3VSKA 3IXHA 1J9MA 1YLZA 1LI9A 1W63Q 2HDSA 3OLOA 3F1NB 1VETA 3A0VA 3VP2A 4UQIM 4OOMA 3W8KA 3VFFA 2D02A 3K2NA 3VMAA 3UB5P 3LIBA 5TBMA 4JF6A 3CUEA 3MSHA 2J80A 3BRMA 3GRJA 5EVIA 1F2KA 4EESA 2QPNA 3RXWA 3VP4A 5E2EA 2K31A 5EVEA 3UPOA 2ZC7A 5FAOA 2ZQ9A 3HLWA 3SH9A 3UPNA 5DTSA 1CEGA 4L9EA 3OBFA 1KVLA 1PYYA 2WADA 4FH4A 3NCKA 3VE4A 2ZC5B 5EVID 4LPZA 3FWLA 2UWXA 2W1TB 4CQHA 3NIAA 1TDLA 4LRZE 5G4YA 1FIKA 3ZCZA 4OLGA 4F94A 3M6HA 4LGWA 4FUWA 4K08A 3B42A 4YNRA 4WZ4A 1GA0A 2V8CA 4BL2A 3KO6A 2XGNA 3IF6C 5KMWA 2M7UA 5HSQA 2I9VA 2BTFP 4KQQA 1EROA 1ZHHB 1YQSA 1W7FA 3A3EA 3W2ZA 3N4IA 4JXVA 3VOYA 2XQZA 1L0GA 3VP1A 2O99A 1BTLA 1S4RA 1BULA 1GSWA 5EPHA 2Y2OA 4GB7A 3PBRA 4R1GA 3MFXA 4WN5A 3QP1A 3Q7VB 3IS2B 3H82A 2XFSA 2VEAA 4S2NC 3H7WA 2V1BA 1VQQA 1XP4A 2IA2A 2P9VA 1HLUP 3VSLA 1H8ZA 1PWGA 2A2LA 1KDWA 3E0YA 3UNWA 4PKYA 1RGZA 5IS1A 4ZJ2A 3VV4A 4ZJ1A 2AVXA 2EFXA 3LIAA 4WZ5A
chains in the Genus database with same CATH topology
1ZTUA 1YKDA 3F1OB 3LIDA 3D72A 4GLQA 2A24A 2J3WA 4I38A 1OTDA 4MN5A 1H3QA 5I5LA 1W63M 2JKRM 2W3FA 4G3VA 5K5BA 3T4OA 3LR5A 3FG8A 2KLIA 1S66L 3RTYA 3S7PA 1Y28A 1TS6A 2B18A 5AVFA 3KX0X 4M4XA 3EOIA 3TE8A 3T4QA 4H6JB 3B47A 4DN0A 1TD5A 1N9NA 2WKPA 4O01A 4EEPA 2JHEA 4HIAA 4EETB 4L9FA 1JNUA 4II7A 2WKRA 4CLCE 1D7EA 3PBTA 3ICYA 2VZWA 3LR4A 1LSVA 4ARZB 4IHQA 3UE6A 3UMEA 1XJ3A 2XRNA 2PYRA 3MMHA 3NOPC 4O0PA 3MQOA 3O5YA 3T4LA 4I3IA 3T50A 4RQ9A 4GCZA 2WKQA 1OTIA 2P04A 3PBOA 5DFXA 3EEAA 3T4SA 3CI6A 2Y8HA 4Z1WA 3OCLA 4GS9B 1MKMA 3TW8A 2V0UA 1OT9A 2M1CA 3HJIA 5AJGA 3C30A 5AVEA 3R7WA 2PR5A 3T4TA 1P97A 3MQQA 4O8GA 3S7OA 3PXPA 1P9WA 1UWPX 3P7NA 2GZAA 4Y5FA 3KYZA 1IOUA 1P0ZA 3UE3A 4I3JA 4HP4A 1DP8A 2VV6A 4H6JA 5HWWA 2Z6DA 4Q0HA 5HZHA 1LSWA 4DJ2A 4WEJA 5F6AA 2VA0A 5F69A 2CMNA 1T1BA 1G28A 4DJ3A 4EEUA 2NUTC 3C2WA 3CUEC 2JN7A 4YWZA 4IJGA 1F9IA 3A0SA 2EA9A 4BMWA 2INWA 3PHYA 4L9GA 4AFIA 4G3WA 3R7WB 2W1RA 1LL8A 1IFQA 2P7JA 3MQ0A 5CX7A 5HWVA 1TS0A 4NKPA 3E4OA 3MR0A 4CLCC 1MZUA 4KQDA 2FH5A 3RFBA 4NXGA 1T18A 1S1ZA 4JGQA 4HHDA 3LI9A 2V0WA 3RH8B 4XT2A 3TRCA 1NWZA 2PD7A 3LR0A 3D3OA 2QKPA 2HGVA 1UGUA 1S67L 4EQ1A 3EEHA 4NXFA 2QYBA 4KUOA 2PHYA 3F1OA 3BQ8A 3K3DA 2H28A 3S7NA 3F1NA 3C8CA 4IUKA 2VKSA 4Q0JA 2VJWA 3E4PA 4L0LA 3FPVA 2QJ5A 3UB8A 3LFVA 4HJ4A 4R70A 2OOLA 3NOTC 1TS7A 2LB9A 2KOIA 4PAUA 3HJKA 4EERA 1OPXA 2PDRA 4CLCD 4G3KA 1V9ZA 2L1MA 3LICA 3EGDC 4MCWA 3S7QA 5DKLA 5A8BA 4KQOA 2KX6A 1S1YA 2D01A 2GJ3A 2M7VA 3CWFA 3KSFA 3A0RA 3UB6A 1XFQA 3KSIA 4EXOA 2QWSA 1YAXA 3MJQA 2HJEA 5FL3A 2JKRI 2Y79A 4HY8A 3T4JA 1X0OA 2YKFA 2B02A 3CITA 1DRMA 3R4KA 1ODVA 1VHMA 1GSVA 1F98A 4NEED 2VV7A 5DFYA 4EW7A 3IBRA 2ZMVA 3CAXA 1DP9A 1NRJA 2HF6A 2HV1A 4HP9A 4I5SA 3LUQA 3HCYA 4KUKA 5TBMB 1UWNX 4FSFA 3JVVA 4R6LA 4GHIB 3ULFA 4NXEA 4GS9A 5HD3A 5J3WA 2O9AA 1OJGA 4MN6A 3C38A 4MMNA 4WLAA 2ZMFA 1OTEA 2J3TD 3KYQA 4WEKA 3LR3A 2O9BA 2OAQ1 2OAP1 5G4ZA 3T4KA 2HJ9C 2VGLM 5C5KA 4JGPA 3V67A 3BJNA 3OCNA 4CLCA 5J4EA 2JKTM 3FPWA 4LRYC 5KSHA 4ETZA 3B33A 3NHQA 1BYWA 3PYPA 4F3LA 3NOUC 4DMZA 3OOVA 3P01A 5F68A 2V9AA 2XA7S 2VLGA 3ZQ5A 2VX8A 4HI4A 2L0WA 3VE3A 1MC0A 4MDZA 4PHTA 5HPFA 1T1AA 4LRXC 2P08A 4WL9A 2PT7A 5DKKA 4FOFA 4BJPA 3NJAA 2GNXA 4B93A 2FZ0A 3EQVA 4BWIA 4ME4A 4GHIA 3BQAA 4HH3A 4XT2B 3BW6A 1EW0A 4Y3IA 4HQAA 2QJ7A 3LYXA 1OTAA 2XROA 3LIFA 4HJ6A 2W3EA 2W3DA 4UEYA 3UMDA 4MN7A 1LSXA 2W3GA 1N9LA 3VOLA 2MJ6A 1XJ2A 4JGOA 3EQUA 1GSXA 4P6ZM 1DP6A 3PBSA 2YKHA 2OWHA 4NXBA 5KIZA 1WA9A 3E98A 1OJ5A 5IT5A 1W63Q 3OLOA 3F1NB 3IS2A 2W27A 3A0VA 4B9OA 2O0YA 4UQIM 3TJZC 5HPIA 3IBJA 3PR6A 2L4RA 2J3TC 3U2AA 1S4SA 4OOMA 2JKTI 2K7SA 2V1AA 2D02A 2GX5A 3K2NA 4WELA 5TJJA 3LIBA 5TBMA 4BBVA 4UQIS 3H82B 2VV8A 4HH2A 3H7WB 3ZYTA 1G6OA 3CUEA 3BWLA 1F5MA 3JVUA 2J80A 1TS8A 4HJ3A 3UB9A 1NLZA 3EWKA 4BBUA 3SW1A 4OOLA 5HD5A 2PD8A 1XFNA 2PYPA 2EWVA 2A24B 5EFWA 4EESA 4CLCB 1NLYA 3KSGA 1LT0A 2K31A 1YSPA 2DMWA 2O9CA 2EWWA 3H9WA 5MC7A 4HNBA 3LIEA 2PR6A 4L9EA 3OBFA 1STZA 1V9YA 5HWTA 3CLOA 3VE4A 4WUJA 1T1CA 1P9RA 5LBRA 2R78A 4F3LB 5HDCA 4LPZA 3GDIA 4I3AA 1D06A 2NUPC 4PKYG 2W1TB 4GW9A 4CQHA 4LRZE 5G4YA 1T19A 3MF0A 4BBTA 1YSQA 4K08A 4ZRRA 5F5YA 3B42A 4YNRA 3OC2A 3KO6A 2M7UA 2VGLS 4EU0A 5HSQA 2I9VA 1OT6A 1H8MA 3PBNA 1ZHHB 4JGRA 4LLOB 2QHKA 2XSSA 5DJUA 3W2ZA 3G6OA 3F1PB 5IU1A 5DF9A 2XA7M 2BASA 3EGXC 4R38A 3KSHA 4R3AA 3UB7A 4I39A 4WF0A 5DJTA 2G7UA 2W1TA 2O99A 4HOIA 1S4RA 4Q0IA 4QPRA 4YOFA 1GSWA 2W3HA 3PBRA 3MFXA 3MXQA 2Z6CA 4WN5A 5J7EA 4EUVA 1VB6A 5L8MA 3K3CA 3IS2B 3E4QA 3H82A 2VEAA 3H7WA 2V1BA 1TF1A 3DBAA 2OWJA 5HDSA 2K2NA 5HL6A 3PBQA 2IA2A 1OTBA 3BY9A 4Y2FA 2KDKA 2LB5A 5HDDA 3F1PA 4E04A 2A2LA 4GJ4A 2ZBBA 1N9OA 3E0YA 2ZOIA 4PKYA 3LI8A 5IS1A 4P6ZS 1XJ6A 2W0NA 1XJ4A 3VV4A 3GECA 3LIAA 4ARZA 4IUHA 3FC7A 3BY8A 2ZOHA 1KOUA 4ETXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HNB A;  5HWV A;  1TS0 A;  3F1O B;  2PR6 A;  3LIE A;  3D72 A;  3LID A;  4L9E A;  2A24 A;  3E4O A;  1V9Y A;  3MR0 A;  5F68 A;  2V9A A;  5HWT A;  1MZU A;  1OTD A;  3CLO A;  2VLG A;  4I38 A;  4KQD A;  4MN5 A;  5I5L A;  3VE4 A;  3ZQ5 A;  4WUJ A;  1T1C A;  4HI4 A;  4NXG A;  5TBM A;  2L0W A;  2ZOH A;  3VE3 A;  3FG8 A;  1S66 L;  3RTY A;  4DJ3 A;  1Y28 A;  1S1Z A;  1TS6 A;  2R78 A;  4DJ2 A;  4JGQ A;  5HDC A;  4F3L B;  4LPZ A;  3GDI A;  4HHD A;  4I3A A;  3LI9 A;  5AVF A;  1D06 A;  3KX0 X;  4M4X A;  1T1A A;  4LRX C;  4PKY G;  5J7E A;  2V0W A;  4GW9 A;  3RH8 B;  4WL9 A;  4XT2 A;  4LRZ E;  5G4Y A;  5HZH A;  5DKK A;  4H6J B;  1NWZ A;  1T19 A;  2PD7 A;  3NJA A;  4BBT A;  1N9N A;  2QKP A;  3PYP A;  4K08 A;  2WKP A;  5F5Y A;  1UGU A;  2JHE A;  1S67 L;  4HIA A;  4L9F A;  1JNU A;  4EEP A;  4EET B;  4EQ1 A;  2WKR A;  3EEH A;  1D7E A;  4NXF A;  4KUO A;  2PHY A;  3F1O A;  4GHI A;  3K3D A;  2H28 A;  4HH3 A;  4XT2 B;  3ICY A;  3F1N A;  3C8C A;  1EW0 A;  3E4P A;  1LSV A;  4HQA A;  2QJ7 A;  3LYX A;  1OTA A;  3UE6 A;  2I9V A;  3UME A;  5HSQ A;  2QJ5 A;  3UB8 A;  4BBV A;  4HJ4 A;  1OT6 A;  1XJ3 A;  4R70 A;  3LIF A;  4HJ6 A;  2OOL A;  2PYR A;  3NOP C;  4JGR A;  4LLO B;  3NOT C;  1TS7 A;  2QHK A;  3MQO A;  3UMD A;  4I3I A;  5DJU A;  1LSX A;  3T50 A;  4RQ9 A;  1N9L A;  2WKQ A;  3G6O A;  3HJK A;  1OTI A;  4GCZ A;  1XJ2 A;  3F1P B;  5IU1 A;  4JGO A;  2PDR A;  4EER A;  1GSX A;  1DP6 A;  2BAS A;  1V9Z A;  2L1M A;  4R3A A;  4R38 A;  3LIC A;  4I39 A;  4WF0 A;  3UB7 A;  2YKH A;  4GS9 B;  2OWH A;  5DJT A;  5DKL A;  2V0U A;  5A8B A;  4NXB A;  5KIZ A;  1WA9 A;  2KX6 A;  1OT9 A;  1S1Y A;  2D01 A;  2M1C A;  2GJ3 A;  3HJI A;  1OJ5 A;  4HOI A;  3CWF A;  1S4R A;  5AVE A;  2PR5 A;  3A0R A;  1P97 A;  1XFQ A;  3MQQ A;  3OLO A;  3F1N B;  2QWS A;  3IS2 A;  3MJQ A;  4EXO A;  2W27 A;  1GSW A;  3A0V A;  4HY8 A;  1X0O A;  4B9O A;  2YKF A;  1UWP X;  2B02 A;  1DRM A;  2L4R A;  3P7N A;  5TBM B;  1ODV A;  1GSV A;  1S4S A;  3MFX A;  1F98 A;  2K7S A;  2V1A A;  2Z6C A;  3MXQ A;  4WN5 A;  2VV7 A;  1P0Z A;  2D02 A;  3IBR A;  3VOL A;  4I3J A;  1VB6 A;  4EW7 A;  4HP4 A;  1DP8 A;  2VV6 A;  3K3C A;  4H6J A;  2Z6D A;  3CAX A;  5HWW A;  3IS2 B;  1DP9 A;  1LSW A;  2HV1 A;  3E4Q A;  3H82 A;  3LIB A;  3LUQ A;  4HP9 A;  4I5S A;  2VEA A;  4KUK A;  5F6A A;  5F69 A;  2CMN A;  1T1B A;  1G28 A;  2V1B A;  1UWN X;  3H7W A;  2VV8 A;  3H82 B;  3C2W A;  2OWJ A;  4HH2 A;  3H7W B;  4GHI B;  4R6L A;  5HDS A;  3ULF A;  4NXE A;  4GS9 A;  5HD3 A;  2JN7 A;  5J3W A;  4YWZ A;  1OJG A;  3BWL A;  1OTB A;  3BY9 A;  2J80 A;  1F9I A;  4MN6 A;  2KDK A;  1TS8 A;  4HJ3 A;  4WLA A;  3UB9 A;  3A0S A;  1OTE A;  2EA9 A;  5HDD A;  3EWK A;  3F1P A;  4BBU A;  4E04 A;  2INW A;  3SW1 A;  2ZBB A;  5HD5 A;  1N9O A;  1XFN A;  2PD8 A;  2PYP A;  2ZOI A;  4PKY A;  4EEU A;  3LI8 A;  5G4Z A;  2A24 B;  3PHY A;  4L9G A;  5EFW A;  4EES A;  5IS1 A;  1XJ6 A;  2W0N A;  4JGP A;  1LT0 A;  1XJ4 A;  5J4E A;  4LRY C;  3GEC A;  3LIA A;  3B33 A;  3NHQ A;  1BYW A;  1LL8 A;  2P7J A;  3H9W A;  3FC7 A;  4F3L A;  3BY8 A;  1T18 A;  1KOU A;  3NOU C;  3UB6 A; 
#chains in the Genus database with same CATH topology
 4RX2 A;  4WBG A;  2A24 A;  2EFU A;  1H3Q A;  1W63 M;  2JKR M;  2W3F A;  3FG8 A;  1S66 L;  2ZQ8 A;  1EI5 A;  1TS6 A;  4KEN B;  1ZG4 A;  3KX0 X;  3MXR A;  4UHU A;  2G2W A;  5DTK A;  4PM6 A;  1N9N A;  4A5R A;  2WKP A;  4O01 A;  2Y91 A;  1JNU A;  4II7 A;  2WKR A;  3GV9 A;  3CPT B;  5HAP A;  3ICY A;  1Q2P A;  2PU2 A;  3QP8 A;  3M6B A;  3UME A;  4DE2 A;  3IQA A;  2J9P A;  4LV3 A;  1CK3 A;  3MMH A;  3MBZ A;  3T4L A;  4I3I A;  3T50 A;  2QZ6 A;  4GCZ A;  4UAA A;  5DFX A;  3G34 A;  1Z6F A;  4DXB A;  1K0K A;  2Y8H A;  1KE0 A;  5J8X A;  3WS4 A;  2M1C A;  1JWP A;  3HJI A;  1RP5 A;  3MQQ A;  3S7O A;  2Y2H A;  4KG6 A;  1UWP X;  1S0W A;  2XF3 A;  3O3V A;  1IOU A;  4H6J A;  2VV6 A;  1CJF A;  1LSW A;  4DJ2 A;  4WEJ A;  3G35 A;  2HDR A;  2NUT C;  4GDN A;  3CUE C;  1YMS A;  2WGI A;  1F9I A;  3TOI A;  3G31 A;  1L0E A;  3PHY A;  3UO9 A;  4GD8 A;  3BFF A;  4X53 A;  4Y7P A;  1IFQ A;  1PZP A;  2P7J A;  3SH7 A;  4NKP A;  4UA9 A;  1MZU A;  3MZE A;  4XXR A;  1GCE A;  2FH5 A;  2HPB A;  5EEC A;  5CTN A;  2Y2L A;  1ZG6 A;  4HHD A;  3LI9 A;  3ZG5 A;  2BLS A;  3T12 B;  3BEC A;  4XT2 A;  3VOZ A;  3HUN A;  1YLY A;  3TRC A;  3Q82 A;  2B95 A;  1NWZ A;  2QKP A;  1BLC A;  4EBN A;  2HGV A;  1UGU A;  4BD1 A;  4LFU A;  4NXF A;  4P0M A;  3BFE A;  4GDB A;  3S7N A;  3C8C A;  4WYY A;  2VKS A;  4K0W A;  4ID4 A;  3OPR A;  3DWK A;  3IHB A;  4QY5 A;  1HVB A;  2KOI A;  4PAU A;  1PW1 A;  2J8Y A;  3HJK A;  3MS6 A;  1YLP A;  4CLC D;  1JVJ A;  4G3K A;  3LIC A;  3EGD C;  4LEN A;  4OQG A;  4S2M A;  3S7Q A;  1XXM A;  1CEF A;  4KQO A;  2KX6 A;  1S1Y A;  3CWF A;  3KSF A;  1XFQ A;  4HY8 A;  5CRF A;  3T4J A;  2YKF A;  3D9Y A;  1PRQ A;  1WYB A;  3CAX A;  3QNB A;  1DP9 A;  4I5S A;  4HP9 A;  3LUQ A;  4KUK A;  5FI7 A;  3QP4 A;  4R6L A;  5FEF A;  1K56 D;  3SS4 A;  4NG2 A;  4MMN A;  1OTE A;  5CER A;  1KGG A;  1BZA A;  1K6R A;  3UPP A;  5J4E A;  2JKT M;  2ZQA A;  3FPW A;  4LRY C;  4ETZ A;  4F3L A;  3NOU C;  1O07 A;  4DE1 A;  3ZNT A;  2J9O A;  4OPQ A;  3P01 A;  3ZQ5 A;  2Y2P A;  5FQK A;  4PHT A;  1GHM A;  1Y54 A;  4JF4 A;  1T1A A;  2P08 A;  2E8J A;  4FOF A;  4KZ6 A;  4BJP A;  5F82 A;  4EBL A;  4H8R A;  5FI2 A;  4BWI A;  1MWS A;  2PBD P;  1EW0 A;  4Y3I A;  3NDE A;  3ITB A;  3HUM A;  1I5Q A;  5TR7 A;  4Y0T A;  4MN7 A;  1LSX A;  2Y2G A;  4DDS A;  2YKH A;  2OWH A;  4KG5 A;  5CXW A;  3M2K A;  3HL9 A;  1MPL A;  3IS2 A;  4S2I A;  3IHA A;  4B9O A;  3IBJ A;  2L4R A;  2J3T C;  3U2A A;  1VEU A;  2Q9M A;  3OPH A;  2JKT I;  2P9V B;  4R4R A;  2K7S A;  2GX5 A;  4WEL A;  2IWB A;  5GHY A;  3ZVW A;  5L09 A;  5HX9 A;  3A3D A;  2WGW A;  2VGJ A;  2WKE A;  3ZYT A;  1G6O A;  3BWL A;  3JVU A;  5TGF A;  2VK3 A;  1FR6 A;  4OQH A;  3OPL A;  2V2F F;  4HJ3 A;  3UE1 A;  3A3F A;  4EV4 A;  3SW1 A;  2JE5 A;  5EVL A;  2PD8 A;  2EX9 A;  1WE4 A;  2A24 B;  3A3I A;  1NLY A;  3KSG A;  1LT0 A;  4MBH A;  1YSP A;  4R3B A;  3V3R A;  3LIE A;  1SHV A;  1YT4 A;  4N9L A;  2IWC A;  5FI6 A;  5FDH A;  3IH9 A;  3IWQ A;  1N4O A;  1CI9 A;  1P9R A;  5HDC A;  4I3A A;  3N8S A;  1D06 A;  2NUP C;  3CPT A;  4X55 A;  4YIN A;  5FAT A;  2OLU A;  3N8R A;  1T19 A;  3MF0 A;  2X02 A;  1YSQ A;  5FAP A;  4U3T A;  4Y17 A;  1KE3 A;  4Q8I A;  4D2O A;  1NYY A;  2JKG A;  2WGW B;  5FQI A;  1BT5 A;  1ESU A;  1M6K A;  5L10 A;  2XSS A;  5DJU A;  3G6O A;  3F1P B;  1E25 A;  5DF9 A;  3G30 A;  3UB7 A;  1DJC A;  2W1T A;  5EV0 A;  5AQA A;  4HOI A;  5E2H A;  4DDY A;  5HAQ A;  4OQ0 A;  2PAV P;  1IKI A;  1YLJ A;  4KQR A;  3C5A A;  4KZ3 A;  3AGF A;  3DWZ A;  1VET B;  2RL3 A;  1NRF A;  4E3L A;  4GZB A;  1IYQ A;  1W8Q A;  2JKF A;  3RXX A;  1PIO A;  4Y2F A;  4XUX A;  4DXC A;  5HDD A;  3NUL A;  4GJ4 A;  3C4P A;  4U0T A;  4N9K A;  3ZGA B;  4JXW A;  4P6Z S;  3G2Z A;  3ZNY A;  3ZG8 B;  4C3Q A;  3HVF A;  1ES2 A;  4PMA A;  4IUH A;  4IVK A;  3FC7 A;  2ZOH A;  1T18 A;  3F1O B;  3UN7 A;  3LY4 A;  3D72 A;  5M18 A;  3JPU A;  3LR5 A;  4S2K A;  3ZVT A;  1Y28 A;  2B18 A;  3Q07 A;  3DTI A;  4RVA A;  4DN0 A;  4N1X A;  2JHE A;  5I94 A;  4E6X A;  1LSV A;  4IHQ A;  3UE6 A;  1XJ3 A;  2XRN A;  2PYR A;  1PWD A;  2WKI A;  5FQJ A;  2P74 A;  2WK0 A;  1PFL A;  3PBO A;  1NY0 A;  5FA7 A;  4HES A;  3VFH A;  4Z1W A;  4GS9 B;  1MKM A;  2V0U A;  2PRF A;  1OT9 A;  2PR5 A;  5HL1 A;  4O8G A;  1Y4O A;  1K4E A;  3P7N A;  3KYZ A;  1MBL A;  1JTD A;  4OLD A;  5CEC A;  1P0Z A;  3HLF A;  5HZH A;  4Q0H A;  5F6A A;  1M40 A;  2Q9N A;  4EEU A;  4ESP A;  4IJG A;  4UA6 A;  3A0S A;  1IYP A;  2EA9 A;  4BMW A;  3N8L A;  1W8Y A;  3CG5 A;  1XKZ A;  4MEZ A;  5AQ7 A;  3NI9 A;  5FAQ A;  1TS0 A;  5CHU A;  2H5S A;  3E4O A;  3MR0 A;  4UA7 A;  1SDE A;  4KQD A;  3RFB A;  1D1J A;  4EWF A;  4JGQ A;  4S2L A;  1K54 C;  1HD8 A;  4LV1 A;  2PD7 A;  4X1M A;  3D3O A;  4X68 A;  3EEH A;  2QYB A;  2PHY A;  1IEL A;  2H28 A;  4QJG A;  2VJW A;  3E4P A;  3FPV A;  3UB8 A;  4HJ4 A;  5DF8 A;  4D60 A;  3BLS A;  3WWX A;  3OZH A;  3IXG A;  3LY3 A;  3ZHH A;  3QP6 A;  2L1M A;  2EXA A;  4DE0 A;  2FFY A;  2M7V A;  3A0R A;  3UB6 A;  2QWS A;  1YAX A;  2HJE A;  1ONH A;  3UDI A;  2JKR I;  2Y79 A;  1X0O A;  3MKF A;  3CIT A;  4JKT A;  3R4K A;  4KZ7 A;  4QB8 A;  1F98 A;  3SH8 A;  3IBR A;  5FQM A;  2ZMV A;  1NRJ A;  2ZC4 B;  3HCY A;  5E43 A;  1G5U A;  5EUA A;  2UV0 E;  3ULF A;  4GS9 A;  4RYE A;  1OJG A;  4R23 A;  4ZTK A;  4MN6 A;  2V8F A;  4GKU A;  5G4Z A;  3GSG A;  3BFD A;  4CLC A;  3DTM A;  4B4X A;  1BYW A;  4OKP A;  5EM1 A;  4DMZ A;  3OOV A;  5F68 A;  1K54 A;  2VLG A;  3IX4 A;  4E3K A;  2VX8 A;  2L0W A;  1G68 A;  4MDZ A;  5EE8 A;  1GHI A;  5HPF A;  1VM1 A;  3NEC A;  1Q2Q A;  2PT7 A;  5DKK A;  5BOH A;  4U0X A;  3IF6 A;  4S2O A;  5GLC A;  2GNX A;  4DE3 A;  3EQV A;  2A3U A;  3Q7Z A;  4KG2 A;  4GHI A;  1FSW A;  4HQA A;  3LYX A;  3CZD A;  5FQ9 A;  2XRO A;  2X71 A;  3BLM A;  4UEY A;  4X25 A;  3O88 A;  3IF6 B;  1N9L A;  3RJU A;  2MJ6 A;  4LCM A;  1XJ2 A;  3EQU A;  5GLA A;  1GSX A;  4P6Z M;  5JYP A;  2R9X A;  1SKF A;  2Y59 A;  3IX3 A;  1MXO A;  4CPK A;  4NXB A;  5KIZ A;  1WA9 A;  2WAF A;  4B88 A;  3E98 A;  1OJ5 A;  5IT5 A;  5CGX A;  4QD4 A;  1YM1 A;  2O0Y A;  3TJZ C;  4S2N A;  3PR6 A;  3S22 A;  2V1A A;  1MWR A;  4BBV A;  3E2K A;  3ZFZ A;  3V3S A;  1MWU A;  3H82 B;  3H7W B;  4OP5 A;  5U47 A;  3HBR A;  1SKO B;  4FTX A;  4FD8 A;  5F83 A;  3UB9 A;  4K91 A;  4OOL A;  4WZ5 C;  5D3O A;  2ZD8 A;  2VGK A;  4CLC B;  4PM9 A;  2ZL1 A;  3C7V A;  2DMW A;  3PTE A;  1QME A;  2EWW A;  5MC7 A;  1A0K A;  1YLT A;  4HNB A;  4BQM A;  2PR6 A;  1STZ A;  3DW0 A;  1V9Y A;  3CLO A;  4WUJ A;  1T1C A;  4FCF A;  5F1G A;  4F3L B;  4PKY G;  4GW9 A;  1BSG A;  1JWV A;  3HUO A;  5F5Y A;  3SS3 A;  4HBT A;  4OPR A;  3OC2 A;  3D4F A;  1L2S A;  2VGL S;  3QP2 A;  1PI4 A;  3IX8 A;  5IHV A;  1H8M A;  3W4P A;  4LLO B;  1LL5 A;  2QHK A;  1L0D A;  1PZO A;  3DTE A;  5IU1 A;  5DVA A;  4OQI A;  3EGX C;  4R3A A;  2WKH A;  4Q0I A;  3GR2 A;  3MFD A;  4QPR A;  4YOF A;  2W3H A;  1DJA A;  1MWT A;  3MXQ A;  2Z6C A;  4QHC A;  5J7E A;  1BUE A;  4EUV A;  4EUZ A;  1VB6 A;  3ZG9 B;  3K3C A;  4E3I A;  3AGE A;  5GL9 A;  1DJB A;  3P98 A;  3WS2 A;  5HL6 A;  2K2N A;  3JYI A;  1NZU A;  4GOG A;  3PBQ A;  2KDK A;  3V5M A;  3F1P A;  3GQZ A;  1FQG A;  4E04 A;  3HLB A;  2V1Z A;  1N9O A;  3LI8 A;  5E2G A;  3WS5 A;  4DF6 A;  1XJ6 A;  4JF5 A;  4NET A;  4KZA A;  3MZF A;  4O7D A;  3GEC A;  5TJJ A;  1ZTU A;  3GMW A;  1YKD A;  3LID A;  1FSY A;  4E6W A;  4MN5 A;  1OTD A;  5I5L A;  3HRE A;  1KDS A;  5K5B A;  4HBU A;  3T4O A;  2KLI A;  2IWD A;  5GHZ A;  4M4X A;  3EOI A;  3TE8 A;  5G18 A;  5FQQ A;  4H6J B;  1RGY A;  2RCX A;  4HIA A;  1SCW A;  1JTG A;  5A92 A;  3DAV A;  4BLM A;  4ARZ B;  4EBP A;  4PM8 A;  3NDG A;  3NOP C;  4O0P A;  3MQO A;  4RQ9 A;  2Y2J A;  3T4S A;  3EEA A;  3A3J A;  3CI6 A;  4N1H A;  4DRT A;  1BLP A;  1KVM A;  2R9W A;  2ZQC A;  5AJG A;  1P97 A;  5CHJ A;  1P9W A;  1ALQ A;  4E3O A;  3UE3 A;  4HP4 A;  2Z6D A;  4C6Y A;  1NYM A;  2VA0 A;  5F69 A;  2CMN A;  2EX2 A;  3C2W A;  2E8I A;  1FCN A;  4CJN A;  4YWZ A;  2PBY A;  4Y0U A;  1QMF A;  4P6B A;  2WAE A;  1I2W A;  2XD5 A;  2WZX A;  1XGJ A;  5HW3 A;  5L07 A;  5DF7 A;  2WGV A;  5HFO A;  4AFI A;  3CMZ A;  4PM7 A;  3R7W B;  2ZC6 B;  3Q81 A;  2J7V A;  3CHW P;  3MQ0 A;  1BLS A;  2HP5 A;  1NXY A;  5EM0 A;  5KSC A;  2Z2M B;  5FDS A;  1K6S A;  4B4Z A;  1ES5 A;  4NXG A;  1H8Y A;  2V20 A;  4Y13 A;  1LHY A;  2H0T A;  4JXG A;  3T1X A;  3WS0 A;  1ZKJ A;  3AGD A;  4KUO A;  3K3D A;  2H0Y A;  1ERM A;  4Q0J A;  4IBR A;  4L0L A;  3L7H A;  2QJ5 A;  2ZM8 A;  1TS7 A;  2Y2M A;  5FSR A;  4EER A;  4MCW A;  5CED A;  2D01 A;  1TVF A;  3CJM A;  4E3M A;  1K56 A;  3WS1 A;  2B02 A;  3B3X A;  2Y2Q A;  1ODV A;  1VHM A;  1GSV A;  3BM6 A;  4GD6 A;  1E3U D;  1H5X A;  3FV7 A;  5DFY A;  4DKI A;  2HV1 A;  2X01 A;  4FSF A;  3C38 A;  4WLA A;  2ZMF A;  2HP9 A;  1L0F A;  3LCE A;  2Q0O A;  3UY6 A;  2HZ5 A;  2OAQ 1;  2OAP 1;  1IYO A;  1U60 A;  2C6W B;  5A91 A;  2HJ9 C;  2VGL M;  4WMC D;  2B5R A;  3OCN A;  4N92 A;  3B33 A;  3NHQ A;  1GHP A;  3PYP A;  4QU3 A;  3N7W A;  3Q1F A;  3C7U A;  2GDN A;  3G4P A;  4KZ8 A;  4Y15 A;  2XA7 S;  3ZDJ A;  4OVD A;  3LEZ A;  1IYS A;  4KZB A;  3NJA A;  3VP3 A;  4ZAM A;  3HLG A;  5CEB A;  3WRT A;  2DCF A;  4ME4 A;  5AQB A;  4IVI A;  3BW6 A;  5EVI C;  1XA7 A;  1E4D A;  2QJ7 A;  1MKI A;  1TDG A;  1K55 A;  3IF5 A;  1ACF A;  2I72 A;  3LIF A;  4Y0O A;  3UMD A;  2HP6 A;  4PPR A;  4JBF A;  4WM9 A;  5EVI B;  3WRZ A;  3S4X A;  3BFC A;  1CQA A;  2DNS A;  1KGE A;  3PBS A;  2Y4A A;  3KYE A;  4RX3 A;  3L9K A;  3MXS A;  3I7J A;  3Q7V A;  2W27 A;  2XLN A;  4KZ5 A;  5GLB A;  5HPI A;  2ZM0 A;  3ZG0 A;  1S4S A;  4PM5 A;  5M19 A;  3NBL A;  2ZC3 B;  3NY4 A;  4MBK A;  4LV0 A;  4UQI S;  4E3J A;  2Y2N A;  2VV8 A;  4HH2 A;  3W4O A;  1ES3 A;  2HDU A;  3OPP A;  1F5M A;  2ZLY A;  1TS8 A;  1NLZ A;  2WYX A;  3EWK A;  3IWO A;  4BBU A;  1FIL A;  5HD5 A;  1XFN A;  2PYP A;  2EWV A;  2H10 A;  5EFW A;  3C4O A;  1ERQ A;  1ES4 A;  1NZO A;  3IT9 A;  3LEQ A;  2O9C A;  4OP8 A;  5HAI A;  1IEM A;  3H9W A;  3SOI A;  3HLE A;  1G6A A;  5HWT A;  2EX6 A;  2G2U A;  4P85 A;  2ZQD A;  1XX2 A;  4JPM A;  5LBR A;  2R78 A;  1FOF A;  3GDI A;  4OH0 A;  2JBF A;  5DTT A;  4X69 A;  4ZBE A;  4BBT A;  4ZJ3 A;  4ZRR A;  3BFG A;  1Z09 A;  1PWC A;  1ESI A;  1K57 A;  2WZZ A;  4EU0 A;  1OT6 A;  3FKV A;  1AWI A;  3PBN A;  4JGR A;  4IED A;  1KE4 A;  1L3L A;  2XA7 M;  2BAS A;  4E3N A;  4R38 A;  3KSH A;  4I39 A;  4WF0 A;  2OV5 A;  2QMI A;  5DJT A;  2G7U A;  1ZC2 A;  3W4Q A;  2WUQ A;  3UE0 A;  2A49 A;  3T1S A;  3GVB A;  4GN2 A;  1VEU B;  3O87 A;  4OPY A;  5TFQ A;  1K57 C;  3MKE A;  5L8M A;  3E4Q A;  4X1L A;  3DBA A;  1TF1 A;  4R3J A;  2OWJ A;  5HDS A;  3E2L A;  3MZD A;  1OTB A;  5A90 A;  3BY9 A;  2LB5 A;  1OME A;  2XEP A;  2ZBB A;  3SZT A;  1K4F A;  2ZOI A;  4MNR A;  4LV2 A;  1PW8 A;  4IBX A;  2DRW A;  2W0N A;  1XJ4 A;  2PU4 A;  4OPZ A;  4ARZ A;  4HEF A;  3BY8 A;  1KOU A;  2ZMA A;  4ETX A;  4GLQ A;  3VP0 A;  2J3W A;  4I38 A;  1XA1 A;  2JCH A;  4G3V A;  1HZO A;  4QY6 A;  3RTY A;  3S7P A;  3QP5 A;  3T1R A;  1KGF A;  5AVF A;  2CC1 A;  3FZC A;  3TSG A;  3T4Q A;  5GLD A;  1W79 A;  3B47 A;  2ACG A;  1TD5 A;  1FCO A;  4EET B;  4EEP A;  4L9F A;  4R0Q A;  4CLC E;  1D7E A;  4Z9Q A;  1E3U A;  3PBT A;  3ITA A;  3U4L P;  2VZW A;  4QWO A;  3LR4 A;  4R4S A;  4M3K A;  5CGS A;  1GA9 A;  1H0M A;  3O5Y A;  1XGI A;  4NK3 A;  1JWZ A;  2WKQ A;  1OTI A;  2P04 A;  3OCL A;  3UDF A;  3TW8 A;  4OOY A;  3C30 A;  5AVE A;  3R7W A;  3T4T A;  4X6T A;  3PXP A;  4ZDX A;  1CI8 A;  1I2S A;  2GZA A;  2HDQ A;  4Y5F A;  3HLD A;  4P87 A;  4I3J A;  2Y55 A;  1DP8 A;  5HWW A;  1ONG A;  1CF0 A;  4DJ3 A;  1T1B A;  1G28 A;  3IXD A;  2JN7 A;  3T1Q B;  2INW A;  5KZH A;  3FKW A;  4L9G A;  4LCL A;  1SZV A;  2EXB A;  4G3W A;  1K38 A;  3M2J A;  2W1R A;  2XR0 A;  1LL8 A;  5CX7 A;  5HWV A;  1AXB A;  3N6I A;  4JLF A;  4CLC C;  1IKG A;  1S1Z A;  3HLC A;  1N9B A;  2V0W A;  1SDN A;  3RH8 B;  4EQI A;  3P09 A;  2ZM2 A;  3LR0 A;  4OON A;  1O7E A;  1S67 L;  3PAG A;  4EQ1 A;  5E2F A;  3G2Y A;  3F1O A;  3BQ8 A;  2Y2K A;  3F1N A;  3UDX A;  4BL3 A;  4IUK A;  3GTC A;  1C3B A;  3LFV A;  4R70 A;  5EOE A;  2OOL A;  2ZJ9 A;  3NOT C;  2LB9 A;  4KZ9 A;  3TG9 A;  1YLW A;  4FH2 A;  1OPX A;  2PDR A;  4WMC A;  2OLV A;  3V39 A;  1V9Z A;  4KZ4 A;  5F1F A;  5FAS A;  4C75 A;  5DKL A;  5A8B A;  5M1A A;  4MLL A;  4MBF A;  2GJ3 A;  3KSI A;  4EXO A;  5CTM A;  3MJQ A;  5FL3 A;  1DY6 A;  1DRM A;  1S6R A;  4YFM A;  4NEE D;  2VV7 A;  4EW7 A;  3PAE A;  2HF6 A;  1J3W A;  5TBM B;  1UWN X;  3JVV A;  5GHX A;  4GHI B;  2XDM A;  4XUZ A;  4NXE A;  5HD3 A;  1LLB A;  5J3W A;  2O9A A;  3G32 A;  4JXS A;  1HTZ A;  2BG1 A;  3NC8 A;  2J3T D;  3KYQ A;  4WEK A;  1PNE A;  2ZQ7 A;  3LO7 A;  3LR3 A;  1BLH A;  2O9B A;  1NJ4 A;  1MY8 A;  1FR1 A;  3S1Y A;  3T4K A;  1EWZ A;  1TEM A;  1WYC A;  2FFF B;  5CGW A;  5C5K A;  4JGP A;  3V67 A;  3BJN A;  3QHY A;  1W5D A;  4X56 A;  5A93 A;  2ZL1 B;  2JC7 A;  5KSH A;  4BEN A;  3V50 A;  2XD1 A;  3BEB A;  4K0X A;  5AQ9 A;  2C5W B;  1K25 A;  3FYZ A;  3QNC A;  2V9A A;  3IXB A;  2Y2I A;  3ISG A;  3ZG7 B;  4HI4 A;  3IWI A;  3VE3 A;  4GNU A;  1MC0 A;  3LGO A;  1YMX A;  4LRX C;  2XH9 A;  5EOO A;  4BD0 A;  4WL9 A;  3DTK A;  2EX8 A;  5CHM A;  3SS5 A;  4S2P A;  5JYO A;  5HAR A;  5FEG A;  4B93 A;  2Z2L B;  2FZ0 A;  1SKO A;  4S2J A;  3BQA A;  4HH3 A;  4XT2 B;  2XK1 A;  4RA7 A;  1LI0 A;  1OTA A;  1YPR A;  2XFT A;  1LL9 A;  1FCM A;  1K55 C;  1RCJ A;  4HJ6 A;  2W3E A;  2W3D A;  3O86 A;  1PI5 A;  1XPB A;  2W3G A;  5L2F A;  3VOL A;  4JGO A;  3IH8 A;  1DP6 A;  2OSU A;  3BYD A;  3VSK A;  3IXH A;  1J9M A;  1YLZ A;  1LI9 A;  1W63 Q;  2HDS A;  3OLO A;  3F1N B;  1VET A;  3A0V A;  3VP2 A;  4UQI M;  4OOM A;  3W8K A;  3VFF A;  2D02 A;  3K2N A;  3VMA A;  3UB5 P;  3LIB A;  5TBM A;  4JF6 A;  3CUE A;  3MSH A;  2J80 A;  3BRM A;  3GRJ A;  5EVI A;  1F2K A;  4EES A;  2QPN A;  3RXW A;  3VP4 A;  5E2E A;  2K31 A;  5EVE A;  3UPO A;  2ZC7 A;  5FAO A;  2ZQ9 A;  3HLW A;  3SH9 A;  3UPN A;  5DTS A;  1CEG A;  4L9E A;  3OBF A;  1KVL A;  1PYY A;  2WAD A;  4FH4 A;  3NCK A;  3VE4 A;  2ZC5 B;  5EVI D;  4LPZ A;  3FWL A;  2UWX A;  2W1T B;  4CQH A;  3NIA A;  1TDL A;  4LRZ E;  5G4Y A;  1FIK A;  3ZCZ A;  4OLG A;  4F94 A;  3M6H A;  4LGW A;  4FUW A;  4K08 A;  3B42 A;  4YNR A;  4WZ4 A;  1GA0 A;  2V8C A;  4BL2 A;  3KO6 A;  2XGN A;  3IF6 C;  5KMW A;  2M7U A;  5HSQ A;  2I9V A;  2BTF P;  4KQQ A;  1ERO A;  1ZHH B;  1YQS A;  1W7F A;  3A3E A;  3W2Z A;  3N4I A;  4JXV A;  3VOY A;  2XQZ A;  1L0G A;  3VP1 A;  2O99 A;  1BTL A;  1S4R A;  1BUL A;  1GSW A;  5EPH A;  2Y2O A;  4GB7 A;  3PBR A;  4R1G A;  3MFX A;  4WN5 A;  3QP1 A;  3Q7V B;  3IS2 B;  3H82 A;  2XFS A;  2VEA A;  4S2N C;  3H7W A;  2V1B A;  1VQQ A;  1XP4 A;  2IA2 A;  2P9V A;  1HLU P;  3VSL A;  1H8Z A;  1PWG A;  2A2L A;  1KDW A;  3E0Y A;  3UNW A;  4PKY A;  1RGZ A;  5IS1 A;  4ZJ2 A;  3VV4 A;  4ZJ1 A;  2AVX A;  2EFX A;  3LIA A;  4WZ5 A; 
#chains in the Genus database with same CATH homology
 1ZTU A;  1YKD A;  3F1O B;  3LID A;  3D72 A;  4GLQ A;  2A24 A;  2J3W A;  4I38 A;  1OTD A;  4MN5 A;  1H3Q A;  5I5L A;  1W63 M;  2JKR M;  2W3F A;  4G3V A;  5K5B A;  3T4O A;  3LR5 A;  3FG8 A;  2KLI A;  1S66 L;  3RTY A;  3S7P A;  1Y28 A;  1TS6 A;  2B18 A;  5AVF A;  3KX0 X;  4M4X A;  3EOI A;  3TE8 A;  3T4Q A;  4H6J B;  3B47 A;  4DN0 A;  1TD5 A;  1N9N A;  2WKP A;  4O01 A;  4EEP A;  2JHE A;  4HIA A;  4EET B;  4L9F A;  1JNU A;  4II7 A;  2WKR A;  4CLC E;  1D7E A;  3PBT A;  3ICY A;  2VZW A;  3LR4 A;  1LSV A;  4ARZ B;  4IHQ A;  3UE6 A;  3UME A;  1XJ3 A;  2XRN A;  2PYR A;  3MMH A;  3NOP C;  4O0P A;  3MQO A;  3O5Y A;  3T4L A;  4I3I A;  3T50 A;  4RQ9 A;  4GCZ A;  2WKQ A;  1OTI A;  2P04 A;  3PBO A;  5DFX A;  3EEA A;  3T4S A;  3CI6 A;  2Y8H A;  4Z1W A;  3OCL A;  4GS9 B;  1MKM A;  3TW8 A;  2V0U A;  1OT9 A;  2M1C A;  3HJI A;  5AJG A;  3C30 A;  5AVE A;  3R7W A;  2PR5 A;  3T4T A;  1P97 A;  3MQQ A;  4O8G A;  3S7O A;  3PXP A;  1P9W A;  1UWP X;  3P7N A;  2GZA A;  4Y5F A;  3KYZ A;  1IOU A;  1P0Z A;  3UE3 A;  4I3J A;  4HP4 A;  1DP8 A;  2VV6 A;  4H6J A;  5HWW A;  2Z6D A;  4Q0H A;  5HZH A;  1LSW A;  4DJ2 A;  4WEJ A;  5F6A A;  2VA0 A;  5F69 A;  2CMN A;  1T1B A;  1G28 A;  4DJ3 A;  4EEU A;  2NUT C;  3C2W A;  3CUE C;  2JN7 A;  4YWZ A;  4IJG A;  1F9I A;  3A0S A;  2EA9 A;  4BMW A;  2INW A;  3PHY A;  4L9G A;  4AFI A;  4G3W A;  3R7W B;  2W1R A;  1LL8 A;  1IFQ A;  2P7J A;  3MQ0 A;  5CX7 A;  5HWV A;  1TS0 A;  4NKP A;  3E4O A;  3MR0 A;  4CLC C;  1MZU A;  4KQD A;  2FH5 A;  3RFB A;  4NXG A;  1T18 A;  1S1Z A;  4JGQ A;  4HHD A;  3LI9 A;  2V0W A;  3RH8 B;  4XT2 A;  3TRC A;  1NWZ A;  2PD7 A;  3LR0 A;  3D3O A;  2QKP A;  2HGV A;  1UGU A;  1S67 L;  4EQ1 A;  3EEH A;  4NXF A;  2QYB A;  4KUO A;  2PHY A;  3F1O A;  3BQ8 A;  3K3D A;  2H28 A;  3S7N A;  3F1N A;  3C8C A;  4IUK A;  2VKS A;  4Q0J A;  2VJW A;  3E4P A;  4L0L A;  3FPV A;  2QJ5 A;  3UB8 A;  3LFV A;  4HJ4 A;  4R70 A;  2OOL A;  3NOT C;  1TS7 A;  2LB9 A;  2KOI A;  4PAU A;  3HJK A;  4EER A;  1OPX A;  2PDR A;  4CLC D;  4G3K A;  1V9Z A;  2L1M A;  3LIC A;  3EGD C;  4MCW A;  3S7Q A;  5DKL A;  5A8B A;  4KQO A;  2KX6 A;  1S1Y A;  2D01 A;  2GJ3 A;  2M7V A;  3CWF A;  3KSF A;  3A0R A;  3UB6 A;  1XFQ A;  3KSI A;  4EXO A;  2QWS A;  1YAX A;  3MJQ A;  2HJE A;  5FL3 A;  2JKR I;  2Y79 A;  4HY8 A;  3T4J A;  1X0O A;  2YKF A;  2B02 A;  3CIT A;  1DRM A;  3R4K A;  1ODV A;  1VHM A;  1GSV A;  1F98 A;  4NEE D;  2VV7 A;  5DFY A;  4EW7 A;  3IBR A;  2ZMV A;  3CAX A;  1DP9 A;  1NRJ A;  2HF6 A;  2HV1 A;  4HP9 A;  4I5S A;  3LUQ A;  3HCY A;  4KUK A;  5TBM B;  1UWN X;  4FSF A;  3JVV A;  4R6L A;  4GHI B;  3ULF A;  4NXE A;  4GS9 A;  5HD3 A;  5J3W A;  2O9A A;  1OJG A;  4MN6 A;  3C38 A;  4MMN A;  4WLA A;  2ZMF A;  1OTE A;  2J3T D;  3KYQ A;  4WEK A;  3LR3 A;  2O9B A;  2OAQ 1;  2OAP 1;  5G4Z A;  3T4K A;  2HJ9 C;  2VGL M;  5C5K A;  4JGP A;  3V67 A;  3BJN A;  3OCN A;  4CLC A;  5J4E A;  2JKT M;  3FPW A;  4LRY C;  5KSH A;  4ETZ A;  3B33 A;  3NHQ A;  1BYW A;  3PYP A;  4F3L A;  3NOU C;  4DMZ A;  3OOV A;  3P01 A;  5F68 A;  2V9A A;  2XA7 S;  2VLG A;  3ZQ5 A;  2VX8 A;  4HI4 A;  2L0W A;  3VE3 A;  1MC0 A;  4MDZ A;  4PHT A;  5HPF A;  1T1A A;  4LRX C;  2P08 A;  4WL9 A;  2PT7 A;  5DKK A;  4FOF A;  4BJP A;  3NJA A;  2GNX A;  4B93 A;  2FZ0 A;  3EQV A;  4BWI A;  4ME4 A;  4GHI A;  3BQA A;  4HH3 A;  4XT2 B;  3BW6 A;  1EW0 A;  4Y3I A;  4HQA A;  2QJ7 A;  3LYX A;  1OTA A;  2XRO A;  3LIF A;  4HJ6 A;  2W3E A;  2W3D A;  4UEY A;  3UMD A;  4MN7 A;  1LSX A;  2W3G A;  1N9L A;  3VOL A;  2MJ6 A;  1XJ2 A;  4JGO A;  3EQU A;  1GSX A;  4P6Z M;  1DP6 A;  3PBS A;  2YKH A;  2OWH A;  4NXB A;  5KIZ A;  1WA9 A;  3E98 A;  1OJ5 A;  5IT5 A;  1W63 Q;  3OLO A;  3F1N B;  3IS2 A;  2W27 A;  3A0V A;  4B9O A;  2O0Y A;  4UQI M;  3TJZ C;  5HPI A;  3IBJ A;  3PR6 A;  2L4R A;  2J3T C;  3U2A A;  1S4S A;  4OOM A;  2JKT I;  2K7S A;  2V1A A;  2D02 A;  2GX5 A;  3K2N A;  4WEL A;  5TJJ A;  3LIB A;  5TBM A;  4BBV A;  4UQI S;  3H82 B;  2VV8 A;  4HH2 A;  3H7W B;  3ZYT A;  1G6O A;  3CUE A;  3BWL A;  1F5M A;  3JVU A;  2J80 A;  1TS8 A;  4HJ3 A;  3UB9 A;  1NLZ A;  3EWK A;  4BBU A;  3SW1 A;  4OOL A;  5HD5 A;  2PD8 A;  1XFN A;  2PYP A;  2EWV A;  2A24 B;  5EFW A;  4EES A;  4CLC B;  1NLY A;  3KSG A;  1LT0 A;  2K31 A;  1YSP A;  2DMW A;  2O9C A;  2EWW A;  3H9W A;  5MC7 A;  4HNB A;  3LIE A;  2PR6 A;  4L9E A;  3OBF A;  1STZ A;  1V9Y A;  5HWT A;  3CLO A;  3VE4 A;  4WUJ A;  1T1C A;  1P9R A;  5LBR A;  2R78 A;  4F3L B;  5HDC A;  4LPZ A;  3GDI A;  4I3A A;  1D06 A;  2NUP C;  4PKY G;  2W1T B;  4GW9 A;  4CQH A;  4LRZ E;  5G4Y A;  1T19 A;  3MF0 A;  4BBT A;  1YSQ A;  4K08 A;  4ZRR A;  5F5Y A;  3B42 A;  4YNR A;  3OC2 A;  3KO6 A;  2M7U A;  2VGL S;  4EU0 A;  5HSQ A;  2I9V A;  1OT6 A;  1H8M A;  3PBN A;  1ZHH B;  4JGR A;  4LLO B;  2QHK A;  2XSS A;  5DJU A;  3W2Z A;  3G6O A;  3F1P B;  5IU1 A;  5DF9 A;  2XA7 M;  2BAS A;  3EGX C;  4R38 A;  3KSH A;  4R3A A;  3UB7 A;  4I39 A;  4WF0 A;  5DJT A;  2G7U A;  2W1T A;  2O99 A;  4HOI A;  1S4R A;  4Q0I A;  4QPR A;  4YOF A;  1GSW A;  2W3H A;  3PBR A;  3MFX A;  3MXQ A;  2Z6C A;  4WN5 A;  5J7E A;  4EUV A;  1VB6 A;  5L8M A;  3K3C A;  3IS2 B;  3E4Q A;  3H82 A;  2VEA A;  3H7W A;  2V1B A;  1TF1 A;  3DBA A;  2OWJ A;  5HDS A;  2K2N A;  5HL6 A;  3PBQ A;  2IA2 A;  1OTB A;  3BY9 A;  4Y2F A;  2KDK A;  2LB5 A;  5HDD A;  3F1P A;  4E04 A;  2A2L A;  4GJ4 A;  2ZBB A;  1N9O A;  3E0Y A;  2ZOI A;  4PKY A;  3LI8 A;  5IS1 A;  4P6Z S;  1XJ6 A;  2W0N A;  1XJ4 A;  3VV4 A;  3GEC A;  3LIA A;  4ARZ A;  4IUH A;  3FC7 A;  3BY8 A;  2ZOH A;  1KOU A;  4ETX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...