4OP8A

Room temperature crystal structure of stabilized tem-1 beta-lactamase variant v.13 carrying g238s mutation
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
263
structure length
262
Chain Sequence
HPETLVKVKDAEDQLGGRVGYIELDLASGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVGELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTTPVAMATTLRKLLTGELLTAASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGASERSRGIIAALGPDGKPSRIVVIYMTGSQATMDERNRQIAEIGASLIKHW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords TEM-94 ES-beta-lactamase
publication title Negative Epistasis and Evolvability in TEM-1 beta-Lactamase--The Thin Line between an Enzyme's Conformational Freedom and Disorder.
pubmed doi rcsb
source organism Escherichia coli
total genus 98
structure length 262
sequence length 263
ec nomenclature
pdb deposition date 2014-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4op8A00
2Y91A 1S6RA 4Y0OA 5FAPA 3MKEA 2ZC4B 3SH8A 4BL2A 4E6XA 1ES2A 3M6HA 4OOYA 3UN7A 5EOEA 2Y2QA 2DRWA 5F1GA 5FQ9A 3ZG7B 4N1XA 4RVAA 3UE3A 3QNCA 3HLWA 4JLFA 4UHUA 5DF9A 5DF7A 5U47A 1BUEA 1XGIA 4FSFA 1PI5A 1K25A 4E3KA 4RX3A 3UDXA 4KZAA 2ZC7A 3IT9A 4GOGA 4S2KA 3TOIA 3Q1FA 1SDEA 1K57A 4OPQA 3SH7A 2OLVA 1DJAA 1PWGA 3ITBA 2Y2KA 2Y2HA 5CGWA 2XFTA 3NDEA 5CHUA 3IWIA 3CMZA 5AQ7A 4MBKA 1W7FA 3IXBA 4ZJ1A 1ERQA 3ITAA 4QB8A 3PAEA 1LL5A 4OLGA 2ZQ7A 1I2WA 2C5WB 2JCHA 4UAAA 5FA7A 4KQOA 1VM1A 4KQQA 4Y0TA 4OOMA 4R3JA 3E2KA 2Y2JA 2EX6A 3Q7VB 4UA9A 1ZG6A 2Y2LA 2ZJ9A 3IXHA 4B4ZA 2HDSA 2WK0A 3RXWA 3VP3A 5F1FA 3VMAA 3VP2A 1BLCA 1K55C 3ZG9B 3BM6A 3UE1A 3A3FA 4M3KA 3G35A 3HVFA 4WZ5A 4Q8IA 1IKGA 3UDIA 5A93A 1H8YA 1QMEA 2H0YA 1MPLA 1G68A 4MEZA 2G2WA 1AXBA 1YLPA 4C3QA 3PBSA 4P0MA 2ZQDA 3HLBA 2J9PA 1ONGA 3IH8A 2RCXA 5HAPA 5JYOA 1BLPA 1HZOA 3UO9A 2EXAA 1L2SA 3BLMA 3O88A 4S2JA 3HLEA 3NC8A 3W4PA 2ZQ8A 2X02A 1YM1A 3A3EA 5AQAA 3ZNYA 1H5XA 1KVMA 3UPOA 4WMCA 3LCEA 1BULA 4HBTA 4KG5A 3QHYA 3WS0A 3C7UA 2C6WB 3QNBA 4B4XA 5GLBA 4BD0A 3IF6B 5CEDA 4WM9A 3AGFA 3OPRA 5DTKA 3N6IA 5HAIA 1JTDA 3P98A 4KZ9A 3C5AA 1K4FA 4E3OA 5GHYA 5DF8A 3N4IA 1KDWA 3A3DA 3OC2A 4X53A 5E43A 1JWZA 5M18A 5CGSA 2UWXA 3IWQA 5EE8A 4KENB 3V50A 1H8ZA 4QD4A 2Y2IA 4IBXA 5EUAA 2WGIA 2ZM2A 2EXBA 3NIAA 4KZ6A 3UDFA 2ZQCA 2WAEA 3OPPA 3Q7VA 5CEBA 4UA7A 3AGDA 1RCJA 5F83A 5CHJA 4C75A 4PM7A 3HLCA 3BYDA 3CZDA 1QMFA 2A49A 3O87A 4EWFA 1FQGA 2WZZA 1NYYA 2ZM8A 1ZC2A 1XP4A 4U3TA 5HW3A 1JTGA 3PBRA 5JYPA 1KDSA 3ZG5A 1DY6A 1YLJA 4X55A 2Y2PA 1W8QA 3GR2A 5HL1A 4K0XA 3N8RA 1GA9A 4LENA 3M2JA 3CG5A 1BLHA 4K91A 4WEJA 1VQQA 2BG1A 2HPBA 1CEGA 4ZAMA 4LV1A 3W8KA 3NDGA 3V3RA 2XR0A 1CEFA 1O07A 1XA1A 5E2FA 1KGFA 4ZBEA 1ESUA 1FOFA 4GN2A 2ZLYA 2ZQAA 4S2LA 3ZG0A 4OLDA 4NK3A 1FR1A 2P9VA 4OQIA 5EECA 3B3XA 4KZ7A 3G31A 4MBHA 3O86A 4BLMA 3LEZA 1ZG4A 2ZC5B 2ZC3B 3MZDA 3N7WA 4N9KA 3VSLA 1HD8A 4D2OA 1EI5A 1IYQA 2B5RA 1HVBA 3HUMA 3IF6A 4K0WA 5A91A 3ZG8B 1YT4A 3HBRA 3WS4A 3G34A 1L0GA 4DE0A 4OH0A 1OMEA 3IH9A 1IEMA 4LCLA 4X56A 3V3SA 1K57C 3N8LA 3WS2A 4R1GA 4BENA 1Q2QA 1J9MA 3WRTA 1WYBA 2EX9A 4QY5A 3FYZA 2HDQA 2X71A 5FQIA 2XF3A 4R4SA 5IHVA 4BL3A 1XKZA 4LV0A 1PW1A 4JF4A 5FI7A 2QZ6A 3IQAA 3A3IA 4JXWA 2H10A 4OVDA 3ZNTA 3C7VA 2OLUA 5M1AA 4P85A 3GV9A 5FQKA 1PZOA 1Z6FA 3HL9A 4R4RA 3WS5A 4PM9A 1KE4A 4PMAA 4C6YA 4NETA 5CRFA 3GMWA 3E2LA 1ERMA 1K56A 4WMCD 4F94A 1XX2A 4DE3A 4IVKA 2HP5A 4B88A 3BFCA 4WZ5C 1SHVA 3UPNA 2JBFA 2I72A 4LV2A 3UNWA 3HUNA 5E2GA 1HTZA 4GKUA 1MWUA 2Y2NA 4FH4A 1YLYA 4KZ3A 2H5SA 4FCFA 4CJNA 1E3UA 3DTMA 1FCOA 3NI9A 2Y2MA 4WYYA 4DDSA 2H0TA 2A3UA 4BQMA 1JWPA 1PW8A 3GSGA 5HFOA 5CERA 5FI2A 5BOHA 1TDGA 4QU3A 2Y4AA 4IEDA 4OOLA 3WWXA 2J9OA 2P9VB 5TR7A 1NJ4A 2Y2OA 2PU2A 5FAOA 2J8YA 3N8SA 1Y54A 1RGZA 1FSWA 4R0QA 5KMWA 3BFFA 1YLZA 1GA0A 4OPRA 4EV4A 5GHXA 3G4PA 1SDNA 3G2ZA 4ID4A 5CHMA 1K54A 1PYYA 4GD8A 2J7VA 3DW0A 1L0DA 3PBQA 5CTMA 3ZVWA 2WKHA 4U0XA 4N92A 2XD1A 2R9XA 3PBTA 4IBRA 3IHAA 1NYMA 4KZ8A 5HARA 4PM6A 4S2NA 3IF5A 3NY4A 3BFEA 1KE0A 3P09A 5DTSA 1PWDA 3ZCZA 4HBUA 1GCEA 3LY3A 5EVIA 1E4DA 5I94A 1MWRA 2IWBA 3ZDJA 1MWSA 1W8YA 3DWKA 4KG6A 2DNSA 1MWTA 4RYEA 5GL9A 3FWLA 3TSGA 3HLFA 2JC7A 1TDLA 2Q9MA 3HLDA 4HESA 3Q7ZA 1JVJA 5F82A 5A92A 3HUOA 2XQZA 3SOIA 3WRZA 4EBPA 1PI4A 4O7DA 4UA6A 4DXCA 4WELA 3O3VA 2XGNA 4X69A 4OKPA 3JYIA 1XXMA 1K4EA 1E25A 3LO7A 4YFMA 5DTTA 1MBLA 3SS4A 2X01A 4DRTA 3IXDA 3C4OA 2WAFA 1FSYA 1MKIA 2WKEA 3NCKA 4DDYA 4OPZA 1ALQA 3ISGA 4KZ4A 5G18A 2HDRA 4ZJ3A 4MNRA 2OSUA 2P74A 2IWDA 2HP6A 1L0EA 4LV3A 2ZD8A 3FV7A 1DJCA 2QMIA 1CI9A 1TEMA 3MFDA 1Q2PA 3OCNA 3G30A 3S1YA 1IYPA 4PM8A 3ZHHA 4ZJ2A 1WYCA 4R3BA 3SH9A 3OPLA 1FCNA 1SKFA 4WBGA 2XD5A 4XUZA 3UY6A 1NRFA 3IF6C 5FQQA 3ZFZA 2CC1A 1N4OA 1K38A 2E8IA 4FD8A 4FH2A 4WZ4A 2Z2LB 1MY8A 1K56D 1N9BA 2Q9NA 3OCLA 5CTNA 5FSRA 1EROA 1NZUA 3NBLA 4DE2A 5EVLA 2EX2A 4QY6A 2XLNA 2V1ZA 1SCWA 3MZEA 2EFXA 1FR6A 2OV5A 3VP1A 4JXVA 3S4XA 1C3BA 1PWCA 4QJGA 1G6AA 5CECA 3VP0A 2EX8A 4JPMA 5L2FA 1E3UD 4RA7A 3VFFA 4P87A 3PBNA 2G2UA 4GD6A 4S2IA 4EQIA 1IELA 1LLBA 1BSGA 4GZBA 5EVIB 3V5MA 4PPRA 5GLCA 3IWOA 2HP9A 2XK1A 2ZM0A 4OPYA 4Z9QA 1RP5A 5E2HA 3GRJA 1IKIA 1CI8A 1XPBA 4N1HA 5FQJA 3VOZA 3SS3A 1BTLA 3GTCA 1LI9A 1M40A 2FFFB 4P6BA 2WYXA 1FCMA 3ZVTA 1WE4A 4XUXA 2XFSA 4QHCA 1ES4A 2WGWA 3BECA 4KZBA 5FAQA 4X68A 4RX2A 1YMXA 2HDUA 1PIOA 3IXGA 4IVIA 5AQ9A 5CGXA 4E3NA 4BD1A 1NXYA 2V2FF 4JKTA 4OQ0A 5KSCA 1ES3A 4JF6A 3A3JA 5FI6A 2WUQA 3D4FA 1O7EA 2BLSA 3I7JA 4N9LA 1YMSA 3PBOA 5HAQA 5GLDA 1K55A 4HEFA 3AGEA 4MBFA 1L0FA 2WGVA 4GB7A 5EOOA 2R9WA 3VOYA 4EBNA 3PTEA 2FFYA 4JXGA 4JBFA 4Y7PA 5EVID 2EFUA 1IYOA 3GVBA 3Q81A 3ZGAB 4E6WA 4GDNA 1PZPA 1YLWA 5GLAA 1LHYA 4EUZA 1K54C 4MLLA 3VP4A 2PBYA 5FDHA 2V20A 1GHPA 3TG9A 2PU4A 1BT5A 2XEPA 2GDNA 3MBZA 3W4QA 3LY4A 3WS1A 3EQVA 5TFQA 1GHIA 1JWVA 5FASA 4DKIA 4S2NC 5J8XA 5D3OA 1U60A 3DWZA 5EPHA 5GHZA 1IYSA 3OZHA 1ESIA 2IWCA 2Z2MB 5HX9A 4LCMA 1KE3A 1KVLA 4OQHA 1W5DA 4E3JA 2ZQ9A 1ES5A 1GHMA 4OONA 4E3IA 5EVIC 2XDMA 1EWZA 2XH9A 5TGFA 4CPKA 3MZFA 1YLTA 2QPNA 3W4OA 1S0WA 1LI0A 2WZXA 3RJUA 4EBLA 2JE5A 1I5QA 2ZMAA 1K6SA 1W79A 4OQGA 1KGEA 2WGWB 3EQUA 3Q07A 4Y0UA 4DE1A 3C4PA 1ONHA 1RGYA 1TVFA 4OP5A 2Y59A 4KZ5A 5AQBA 1BLSA 1K6RA 4A5RA 4S2MA 4PM5A 3VSKA 3G32A 3SS5A 5KSHA 1YQSA 4E3LA 1BZAA 3BEBA 4R23A 3GQZA 3IHBA 3PAGA 4BJPA 4KQRA 2DCFA 4GDBA 4H8RA 3BFGA 1XA7A 3M2KA 4ZDXA 5M19A 1MXOA 1NZOA 3M6BA 3FKVA 2VGJA 2VGKA 3OPHA 1CK3A 3FZCA 4JF5A 4JXSA 4E3MA 4ZTKA 2Y55A 5E2EA 5CXWA 4L0LA 1XGJA 3MXSA 4S2PA 3HREA 4XXRA 3S22A 1NY0A 3BLSA 3CJMA 5FATA 4GNUA 3UE0A 3RXXA 1I2SA 2Y2GA 3FKWA 3V39A 2RL3A 4DXBA 2WADA 5A90A 5KZHA 1M6KA 4KG2A 1KGGA 3MXRA 2WKIA 4WEKA 1ZKJA 3G2YA 3HLGA 4OP8A 3Q82A 3MKFA 1DJBA 3BFDA 4DF6A 1LL9A 3UPPA 4X6TA 4YINA 5DVAA 4U0TA 2ZC6B 3BRMA 5FQMA 3VFHA 4S2OA
chains in the Genus database with same CATH superfamily
4IHQA 1S6RA 4Y0OA 5FAPA 2M7UA 2ZC4B 4OOYA 2KDKA 5F1GA 3QP2A 3ZG7B 4N1XA 3HLWA 1BUEA 5LBRA 1K25A 4DJ2A 3UDXA 2HJ9C 4KZAA 3IT9A 3RH8B 1PWGA 2Y2KA 4DJ3A 2XFTA 4R70A 4ZJ1A 4QB8A 3PAEA 4UAAA 1HLUP 1VM1A 4KQQA 1DP8A 1ZG6A 2Y2LA 2ZJ9A 4B4ZA 2HDSA 5F1FA 2W3EA 1BLCA 3ZG9B 3BM6A 3UE1A 3A3FA 4M3KA 4Q8IA 3HVFA 2PDRA 1QMEA 2H0YA 4D60A 3PBSA 1OTAA 3TW8A 2E8JA 4Y17A 5HAPA 5JYOA 3IX8A 3T12B 2EXAA 3O88A 1YPRA 3NC8A 4I5SA 5FEGA 4NKPA 3A3EA 1H5XA 3LCEA 4HBTA 2P08A 4ARZA 2QHKA 4UQIS 3R7WB 3N6IA 3P98A 2BTFP 3C5AA 1K4FA 2I9VA 1KDWA 3MXQA 4H6JA 5M18A 4ESPA 2UWXA 3V50A 1H8ZA 5EUAA 2ZL1A 2WGIA 3AGDA 5J7EA 5F83A 5CHJA 4C75A 3HLCA 1S67L 3CZDA 2A49A 4EWFA 1FQGA 2WZZA 1XP4A 1JTGA 1KDSA 3ZG5A 1YLJA 4Z1WA 3N8RA 3M2JA 2GJ3A 2VK3A 2DMWA 2W3GA 2XSSA 2PYRA 3B3XA 4N9KA 3IF6A 4K0WA 1YT4A 2QJ7A 3E0YA 1IEMA 4EERA 1K57C 3WS2A 1XJ2A 4BENA 1J9MA 1UGUA 2WKRA 1WYBA 1T18A 3FYZA 2X71A 4LRXC 5IHVA 4BL3A 5DJUA 4JF4A 5IU1A 1G6OA 3A3IA 4JXWA 4OVDA 2O9CA 1UWPX 2OLUA 3VE4A 3JVUA 1K0KA 3GV9A 1Z6FA 2VGLM 4R4RA 3WS5A 4PM9A 4PMAA 2KX6A 2ZOHA 5CRFA 3E2LA 1K56A 1XJ4A 5F6AA 4DE3A 2VJWA 2HP5A 4IVKA 2V1BA 4LV2A 3UNWA 1MWUA 4KZ3A 3T4LA 2H5SA 4FCFA 4CJNA 2PYPA 3DTMA 1SKOB 1PW8A 1TDGA 1PNEA 4R0QA 3BFFA 1YLZA 3CHWP 5GHXA 1SDNA 3G2ZA 5CHMA 4GD8A 2J7VA 3ZVWA 2R9XA 4IBRA 1NYMA 5HARA 5HWTA 3C8CA 2V8CA 4HJ6A 3BFEA 3DTEA 3ZCZA 5IT5A 5I94A 3DWKA 4RYEA 5F82A 2XQZA 4O7DA 4DXCA 2XGNA 1K4EA 1E25A 3SS4A 2X01A 4O01A 1FSYA 3LR3A 5G18A 2OSUA 2P74A 2IWDA 4LV3A 2ZD8A 3FV7A 1H3QA 3MFDA 3G30A 4GS9A 1IYPA 3ZHHA 1WYCA 5HPFA 4R3BA 3KSFA 2JKTI 4KUOA 3SH9A 1YAXA 2XD5A 1NRFA 4G3KA 1TD5A 4FH2A 1EROA 3NBLA 1G5UA 3MZEA 3K3CA 3VP1A 4JXVA 1E3UD 1S66L 3C38A 4P87A 5EVIB 2HP9A 2XK1A 2ZM0A 4OPYA 3GRJA 3VOZA 3SS3A 5DFYA 4MN6A 4G3VA 3ZVTA 1FCMA 1WE4A 4XUXA 2WGWA 3BECA 2YKFA 1PIOA 2IA2A 3U2AA 5EV0A 2W1TA 2V2FF 4JKTA 3D3OA 4OQ0A 4JF6A 3A3JA 2OAQ1 1H0MA 3IS2A 3MQ0A 3PBOA 1K55A 4BBTA 2AVXA 2VZWA 4CLCA 2GZAA 1L0FA 3C2WA 2FFYA 3GVBA 1YLWA 3TJZC 5HZHA 2V20A 2EA9A 3MBZA 3LY4A 5TFQA 1JWVA 3GECA 2B18A 4S2NC 5EPHA 5GHZA 4ME4A 1ESIA 2IWCA 5HX9A 1D06A 1ES5A 4E3IA 3PXPA 2Q0OA 2XH9A 5TGFA 3MZFA 1YLTA 1T1AA 1S0WA 1LI0A 1XJ3A 1I5QA 3U4LP 3EOIA 4OQGA 4QPRA 3Q07A 1MC0A 1RGYA 1TVFA 4OP5A 1K6RA 4A5RA 4E3LA 3IHBA 3PAGA 4BJPA 4KQRA 4GDBA 1MXOA 2VGKA 3OPHA 1CK3A 4JXSA 2LB5A 1XGJA 2PD7A 3HREA 1NY0A 4I38A 3V39A 2JKRI 3UE0A 3RXXA 2Y2GA 2RL3A 3KX0X 3P01A 1M6KA 1X0OA 3MXRA 2XA7M 2WKIA 5DFXA 3HLGA 1DJBA 3BFDA 1LL9A 3MJQA 4X6TA 5DVAA 2Y91A 1OPXA 3MKEA 4E6XA 4FOFA 5EOEA 2DRWA 2V8FA 3QNCA 5DF9A 5FDSA 4RX3A 4GOGA 3Q1FA 3SH7A 4OPQA 3G6OA 2Y2HA 3W2ZA 3CMZA 2PR5A 3MQOA 3ITAA 1Z09A 3QP4A 2J3WA 1LL5A 2C5WB 4KQOA 4X1MA 3E2KA 2EX6A 3Q7VB 4EXOA 3UE6A 3RXWA 3VP3A 3KYZA 4Y13A 3A0SA 3VP2A 4MDZA 4WZ5A 3UDIA 1ODVA 1MPLA 4PKYA 2QWSA 1AXBA 2L0WA 2ZQDA 4X25A 1XJ6A 1ONGA 3IH8A 4HJ4A 2ZMFA 4S2JA 5HWWA 3HLEA 2X02A 1YM1A 3H7WA 5AQAA 3ZNYA 3UPOA 1KVMA 3F1PA 4WMCA 2H28A 3C7UA 4ZRRA 3AGFA 3OPRA 4M4XA 5HAIA 1JTDA 1VETB 4LRYC 4CLCE 4AFIA 5E43A 1OT9A 3IWQA 1EW0A 4HH3A 5EE8A 4QD4A 4IBXA 4NXBA 2ZM2A 2WAEA 3OPPA 3CITA 1RCJA 4PM7A 3T4OA 2VEAA 3O87A 4HNBA 1ZC2A 4LFUA 4EESA 5HW3A 3HCYA 2Y2PA 1TS8A 4K0XA 4LENA 1BYWA 1BLHA 2A2LA 1VQQA 2BG1A 4ZAMA 3FPWA 4WLAA 4EETB 1O07A 3BWLA 1ESUA 4GN2A 1S4SA 3S7OA 4OLDA 5TJJA 1FR1A 4UQIM 2A24B 3NOTC 3CUEC 3O86A 3LEZA 3MZDA 2O9AA 3VSLA 1HD8A 1EI5A 4XT2A 1MZUA 4HIAA 4MCWA 2B5RA 1HVBA 5A91A 3F1OA 3HBRA 2PAVP 1L0GA 4DE0A 3H82B 4OH0A 3IH9A 2MJ6A 2W3HA 3KYEA 4QY5A 5FQIA 1N9NA 1XKZA 2W3DA 3CPTB 4I3AA 2HGVA 3IQAA 1P9RA 4EEUA 1FIKA 5FQKA 3HL9A 3LR4A 5HDCA 1XX2A 1FILA 2JBFA 5L8MA 3HUNA 3DBAA 4FH4A 4YOFA 2H0TA 4BQMA 5CERA 5BOHA 4OOLA 2P9VB 1NJ4A 2J8YA 3N8SA 1RGZA 3T4SA 3CAXA 4EV4A 4BBUA 1K54A 2KLIA 3IBJA 2WKHA 2XD1A 3F1NA 1LT0A 3IHAA 1OTDA 2W3FA 3IF5A 3NY4A 2JKTM 3UB6A 5DKLA 4HBUA 4CQHA 2P04A 3NHQA 3LY3A 5EVIA 3BY8A 1MWRA 3ZDJA 1MWTA 1TDLA 3HLDA 4HESA 5A92A 4GHIB 3T1SA 1VB6A 2HJEA 4UA6A 3LGOA 4X69A 4YFMA 5DTTA 2UV0E 5HD3A 1MKIA 1VEUB 4WUJA 2QKPA 4MNRA 4RQ9A 2W0NA 1DJCA 2J3TD 4NXEA 1TEMA 3S7PA 4IUKA 3C30A 4ZJ2A 3K2NA 1SKFA 3UB9A 3UY6A 2L4RA 3VE3A 3IF6C 3ZFZA 1K38A 4FD8A 1MY8A 1N9BA 3OCLA 1NZUA 1YSPA 4DE2A 5EVLA 2EX2A 2EFXA 2OV5A 1C3BA 4LRZE 2EX8A 4JPMA 2ZMVA 4GD6A 1OJGA 1IELA 1LLBA 5GLCA 2K31A 4Z9QA 4B93A 1CI8A 1XPBA 2VX8A 3TE8A 4P6BA 2WYXA 2OAP1 3PR6A 4KZBA 5FAQA 3S7NA 4E3NA 3EGXC 1YKDA 5KSCA 5FI6A 1O7EA 2LB9A 2VV8A 1YMSA 5HAQA 4HEFA 3AGEA 4GB7A 3PTEA 3LI9A 3Q81A 4E6WA 4L9FA 5GLAA 1LHYA 3KYQA 3VP4A 2PBYA 5FDHA 1GHPA 3TG9A 2GDNA 3W4QA 3BQ8A 5J3WA 3WS1A 2JKRM 5EM1A 2D01A 1TS6A 5J8XA 1U60A 1IYSA 2Y8HA 3TRCA 2GX5A 2Z2MB 1GSVA 1KE3A 1KVLA 2YKHA 4OQHA 4E3JA 2ZQ9A 1GHMA 3MQQA 2XDMA 1EWZA 4CPKA 4HJ3A 1ZHHB 3RJUA 2JE5A 1K6SA 2B95A 1KGEA 3EQUA 4DE1A 3C4PA 5AQBA 4KZ5A 1BLSA 4P6ZM 5A8BA 3VSKA 3E4PA 4I3JA 1NWZA 4KUKA 3M6BA 3FKVA 1PRQA 2VV7A 3FZCA 4JF5A 2Y55A 4L0LA 3CJMA 4GNUA 1I2SA 4DXBA 2VGLS 2G7UA 1ZKJA 3FC7A 4DF6A 2PR6A 3UB5P 4U0TA 5HDDA 3VFHA 4NXGA 1LSXA 2ZOIA 2O0YA 4BL2A 1ES2A 2VA0A 4HY8A 2J3TC 3MF0A 3T1XA 3QP6A 2QJ5A 1PI5A 3VOLA 2VKSA 2ZC7A 3TOIA 4S2KA 1SDEA 2J80A 3ITBA 5CGWA 3OOVA 5CHUA 3IWIA 5AQ7A 4FTXA 1W7FA 2NUPC 3LYXA 3IXBA 4OLGA 2ZQ7A 2JHEA 1I2WA 2JCHA 2ZL1B 4OOMA 4R3JA 5G4ZA 3IXHA 2PRFA 3RFBA 3H9WA 1K55C 3HJKA 3R4KA 4ETXA 1IKGA 1H8YA 4MEZA 2G2WA 3HLBA 2RCXA 5AJGA 2WKPA 1BLPA 1HZOA 3UO9A 1T19A 2A24A 3W4PA 2ZQ8A 3KSGA 4KG5A 4B4XA 3QNBA 5GLBA 3IF6B 5CEDA 3H82A 4KZ9A 5I5LA 5DF8A 1S4RA 5F68A 5DJTA 4EW7A 2ACGA 1D7EA 4KENB 3PYPA 3CI6A 5CEBA 3NIAA 4KZ6A 2ZQCA 1GSWA 1QMFA 1NYYA 3PBRA 4PAUA 1DY6A 3GR2A 3CWFA 1GA9A 3CG5A 4II7A 4LV1A 2BASA 4Y3IA 3ZQ5A 1XA1A 5E2FA 4ZBEA 2ZQAA 3ZG0A 1OJ5A 1N9OA 2P9VA 5EECA 3MS6A 5AVFA 3G31A 4MBHA 1ZG4A 2ZC3B 1IYQA 3ZG8B 1ACFA 3R7WA 4EUVA 2XRNA 4FUWA 4BWIA 3N8LA 4R1GA 3WRTA 2OWHA 2HDQA 4R4SA 3MMHA 1UWNX 4B9OA 2HV1A 5L10A 3C7VA 1J3WA 3HJIA 5M1AA 5FEFA 2OWJA 5CX7A 4GLQA 2FZ0A 1KE4A 4GHIA 4C6YA 4NETA 3UB7A 4F94A 3LIEA 5HWVA 4WZ5C 3LICA 1HTZA 4GKUA 1YLYA 2HZ5A 2KOIA 2V9AA 1VEUA 1E3UA 1NLYA 1FCOA 3NI9A 2Y2MA 1TS7A 1JWPA 2M7VA 4GJ4A 3WWXA 2J9OA 4LGWA 2Y2OA 2PU2A 1P97A 3NOPC 2VLGA 4GS9B 1GA0A 4OPRA 2JKGA 3G4PA 4WF0A 4ID4A 4Y5FA 4LLOB 1PYYA 2V0UA 1L0DA 4K08A 3T1RA 5CTMA 3QP8A 3DAVA 3PBTA 2HF6A 4KZ8A 1Y4OA 3D9YA 4L9GA 3BY9A 5L07A 5F5YA 1E4DA 1W8YA 4KG6A 3B47A 4MMNA 3TSGA 3HLFA 2JC7A 2Q9MA 3RTYA 1JVJA 3HUOA 4Q0IA 3SOIA 1PI4A 4F3LB 3IX4A 4WELA 2OOLA 2W1RA 4NG2A 4DRTA 2W1TB 5MC7A 1P0ZA 3IXDA 3C4OA 3NCKA 1ALQA 3ISGA 4KZ4A 4ZJ3A 4HQAA 1SKOA 3IS2B 3NOUC 1ZTUA 2QMIA 1CI9A 4ETZA 1A0KA 3OCNA 4PM8A 1FCNA 2VV6A 3OLOA 4XUZA 2E8IA 4Y2FA 3NECA 4WZ4A 1K56D 2Q9NA 3MFXA 4QY6A 3FPVA 2XLNA 3LR5A 3CUEA 3T4JA 4HH2A 1PWCA 5CECA 1G6AA 3VP0A 5L2FA 3LFVA 3VFFA 3PBNA 2G2UA 4MN7A 4EQIA 1BSGA 4EU0A 2EWWA 5E2HA 1IKIA 1SZVA 5FQJA 3T4KA 3KSHA 1LI9A 4IUHA 4UEYA 2XFSA 4GW9A 4QHCA 3ZYTA 4HOIA 4RX2A 1YMXA 5HPIA 2HDUA 3IXGA 1WA9A 4IVIA 5AQ9A 5CGXA 4BD1A 5KIZA 2WUQA 3D4FA 3DTKA 3E98A 5GLDA 1MKMA 5EOOA 2WGVA 2R9WA 4IJGA 4JXGA 4JBFA 4Y7PA 4HP4A 4R38A 1XFQA 3EEHA 1PZPA 4GDNA 1AWIA 4Y15A 5HSQA 5EM0A 5FL3A 4EUZA 2PBDP 1K54C 3L9KA 1PFLA 4O0PA 1W63Q 2Z6DA 1BT5A 3B33A 3KSIA 4YWZA 2CMNA 3EQVA 3ICYA 4YNRA 3VV4A 5FASA 4DKIA 5D3OA 3OZHA 1NRJA 3LIDA 4OONA 5EVIC 3LI8A 2M1CA 5C5KA 2P7JA 4NXFA 2QPNA 3W4OA 3MSHA 4L9EA 2JKFA 2WZXA 1IOUA 1V9YA 1W79A 4Y0UA 3L7HA 1ONHA 2W27A 2Y59A 3BJNA 4PM5A 1OTIA 1YQSA 4EQ1A 3LIFA 4R23A 2DCFA 4ZDXA 4H8RA 3BFGA 3M2KA 1NZOA 2VGJA 4E3MA 4ZTKA 5E2EA 4Q0HA 5AVEA 4I39A 4S2PA 4XXRA 5A90A 2WADA 4KG2A 1KGGA 4G3WA 1STZA 4YINA 2ZC6B 3BRMA 4S2OA 1GSXA 1G28A 2PD8A 1S1ZA 3SH8A 3M6HA 3UN7A 2Y2QA 5FQ9A 3H7WB 4JGPA 1IFQA 3F1PB 4RVAA 3UE3A 4JLFA 3NJAA 5DF7A 4UHUA 5U47A 2V1AA 1XGIA 1CF0A 4FSFA 4DMZA 4E3KA 1K57A 4CLCD 2OLVA 1DJAA 4DN0A 3NULA 3NDEA 1CJFA 4HHDA 4MBKA 1T1BA 3A0RA 1ERQA 5FA7A 3MR0A 4Y0TA 2Y2JA 5TBMB 4UA9A 3B42A 3V67A 3SZTA 2WK0A 3VMAA 2R78A 3E4QA 3EWKA 5A93A 3G35A 2B02A 1G68A 1F2KA 1YLPA 4C3QA 4P0MA 2J9PA 1NLZA 1L2SA 3BLMA 1L3LA 3QP1A 1BULA 3QHYA 3WS0A 2C6WB 4XT2B 4BD0A 3F1OB 4WM9A 5DTKA 4R6LA 5DKKA 5K5BA 4E3OA 5GHYA 1LSWA 2GNXA 3N4IA 3A3DA 3OC2A 4X53A 5F69A 1JWZA 5CGSA 3IX3A 2Y2IA 2Y79A 2EXBA 2JN7A 3UDFA 3Q7VA 4UA7A 3PHYA 3BW6A 3BYDA 2FH5A 2ZM8A 4U3TA 2Z6CA 5JYPA 1TF1A 4X55A 2EWVA 1W8QA 5HL1A 4K91A 3LEQA 3P7NA 4WEJA 4PKYG 2HPBA 1CEGA 3W8KA 3NDGA 3V3RA 2XR0A 1CEFA 1KGFA 2NUTC 3LIAA 1FOFA 2ZLYA 4S2LA 4NK3A 4I3IA 4OQIA 3EGDC 4KZ7A 4BLMA 2ZC5B 3N7WA 4D2OA 5L09A 1DP9A 5EVEA 3T50A 3HUMA 4ARZB 1LSVA 3WS4A 3A0VA 3G34A 1OMEA 1VETA 4LCLA 4X56A 3UB8A 3V3SA 1Q2QA 2EX9A 3F1NB 3T1QB 4H6JB 2XF3A 4LV0A 1PW1A 5FI7A 3KO6A 2QZ6A 1DP6A 3BQAA 4MN5A 1F9IA 2H10A 3ZNTA 2ZBBA 2PT7A 4X1LA 3OBFA 1CQAA 4P85A 3DTIA 1PZOA 3GMWA 1ERMA 4WMCD 4CLCC 1YSQA 5G4YA 4F3LA 4B88A 3BFCA 1SHVA 3UPNA 2I72A 5E2GA 2Y2NA 4HP9A 1H8MA 4WYYA 4DDSA 1XFNA 2A3UA 4P6ZS 3GSGA 5HFOA 5FI2A 4QU3A 2Y4AA 4IEDA 5J4EA 5TR7A 5FAOA 3IBRA 1Y54A 1FSWA 5KMWA 5HDSA 4NEED 3D72A 4WN5A 1T1CA 3LIBA 1Y28A 1TS0A 3DW0A 3PBQA 3S7QA 4U0XA 4N92A 4EEPA 4PM6A 4S2NA 5HL6A 3ULFA 1KE0A 1F98A 1P9WA 3CPTA 3P09A 5DTSA 1PWDA 1GCEA 4QWOA 2IWBA 1MWSA 1N9LA 5GL9A 2DNSA 3FG8A 3T4QA 3FWLA 3GDIA 1OTBA 3Q7ZA 3WRZA 4EBPA 4HI4A 3O3VA 3UMEA 4OKPA 3JYIA 1XXMA 3LO7A 1MBLA 3O5YA 2WAFA 2WKEA 4DDYA 4OPZA 2HDRA 2HP6A 1L0EA 3LUQA 4E04A 1DRMA 2V0WA 1D1JA 4GCZA 1Q2PA 3S1YA 4JGOA 4JGQA 3OPLA 4WBGA 5FQQA 2CC1A 1N4OA 1S1YA 2Z2LB 5FSRA 5CTNA 4KQDA 2V1ZA 1SCWA 1FR6A 3T4TA 3S4XA 4QJGA 4LPZA 4RA7A 4S2IA 4GZBA 3V5MA 4PPRA 3IWOA 2K7SA 1RP5A 2O99A 3K3DA 4N1HA 3SW1A 1OT6A 1BTLA 3GTCA 1M40A 2FFFB 2QYBA 1ES4A 4X68A 1OTEA 2O9BA 1NXYA 1ES3A 3CLOA 2BLSA 3I7JA 4O8GA 4N9LA 1F5MA 3UMDA 2WKQA 2XROA 4R3AA 2K2NA 3EEAA 4MBFA 4EBNA 3VOYA 1V9ZA 5EVID 2EFUA 4PHTA 1IYOA 1LL8A 3ZGAB 2PHYA 5HD5A 2INWA 4BBVA 4MLLA 2PU4A 3JPUA 2XEPA 2XA7S 1GHIA 5EFWA 3DWZA 4LCMA 3E4OA 1W5DA 4JGRA 3LR0A 4EBLA 2ZMAA 2WGWB 3JVVA 1KOUA 2D02A 1VHMA 1W63M 5IS1A 4S2MA 4WL9A 3G32A 3SS5A 5KSHA 1BZAA 1JNUA 3BEBA 3GQZA 3QP5A 1XA7A 5TBMA 5M19A 4BMWA 4Q0JA 5CXWA 2L1MA 4CLCB 3MXSA 3S22A 3BLSA 5FATA 3FKWA 5KZHA 4WEKA 3G2YA 4OP8A 3Q82A 3MKFA 3UPPA 5FQMA
chains in the Genus database with same CATH topology
2Y91A 1S6RA 4Y0OA 5FAPA 3MKEA 2ZC4B 3SH8A 4BL2A 4E6XA 1ES2A 3M6HA 4OOYA 3UN7A 5EOEA 2Y2QA 2DRWA 5F1GA 5FQ9A 3ZG7B 4N1XA 4RVAA 3UE3A 3QNCA 3HLWA 4JLFA 4UHUA 5DF9A 5DF7A 5U47A 1BUEA 1XGIA 4FSFA 1PI5A 1K25A 4E3KA 4RX3A 3UDXA 4KZAA 2ZC7A 3IT9A 4GOGA 4S2KA 3TOIA 3Q1FA 1SDEA 1K57A 4OPQA 3SH7A 2OLVA 1DJAA 1PWGA 3ITBA 2Y2KA 2Y2HA 5CGWA 2XFTA 3NDEA 5CHUA 3IWIA 3CMZA 5AQ7A 4MBKA 1W7FA 3IXBA 4ZJ1A 1ERQA 3ITAA 4QB8A 3PAEA 1LL5A 4OLGA 2ZQ7A 1I2WA 2C5WB 2JCHA 4UAAA 5FA7A 4KQOA 1VM1A 4KQQA 4Y0TA 4OOMA 4R3JA 3E2KA 2Y2JA 2EX6A 3Q7VB 4UA9A 1ZG6A 2Y2LA 2ZJ9A 3IXHA 4B4ZA 2HDSA 2WK0A 3RXWA 3VP3A 5F1FA 3VMAA 3VP2A 1BLCA 1K55C 3ZG9B 3BM6A 3UE1A 3A3FA 4M3KA 3G35A 3HVFA 4WZ5A 4Q8IA 1IKGA 3UDIA 5A93A 1H8YA 1QMEA 2H0YA 1MPLA 1G68A 4MEZA 2G2WA 1AXBA 1YLPA 4C3QA 3PBSA 4P0MA 2ZQDA 3HLBA 2J9PA 1ONGA 3IH8A 2RCXA 5HAPA 5JYOA 1BLPA 1HZOA 3UO9A 2EXAA 1L2SA 3BLMA 3O88A 4S2JA 3HLEA 3NC8A 3W4PA 2ZQ8A 2X02A 1YM1A 3A3EA 5AQAA 3ZNYA 1H5XA 1KVMA 3UPOA 4WMCA 3LCEA 1BULA 4HBTA 4KG5A 3QHYA 3WS0A 3C7UA 2C6WB 3QNBA 4B4XA 5GLBA 4BD0A 3IF6B 5CEDA 4WM9A 3AGFA 3OPRA 5DTKA 3N6IA 5HAIA 1JTDA 3P98A 4KZ9A 3C5AA 1K4FA 4E3OA 5GHYA 5DF8A 3N4IA 1KDWA 3A3DA 3OC2A 4X53A 5E43A 1JWZA 5M18A 5CGSA 2UWXA 3IWQA 5EE8A 4KENB 3V50A 1H8ZA 4QD4A 2Y2IA 4IBXA 5EUAA 2WGIA 2ZM2A 2EXBA 3NIAA 4KZ6A 3UDFA 2ZQCA 2WAEA 3OPPA 3Q7VA 5CEBA 4UA7A 3AGDA 1RCJA 5F83A 5CHJA 4C75A 4PM7A 3HLCA 3BYDA 3CZDA 1QMFA 2A49A 3O87A 4EWFA 1FQGA 2WZZA 1NYYA 2ZM8A 1ZC2A 1XP4A 4U3TA 5HW3A 1JTGA 3PBRA 5JYPA 1KDSA 3ZG5A 1DY6A 1YLJA 4X55A 2Y2PA 1W8QA 3GR2A 5HL1A 4K0XA 3N8RA 1GA9A 4LENA 3M2JA 3CG5A 1BLHA 4K91A 4WEJA 1VQQA 2BG1A 2HPBA 1CEGA 4ZAMA 4LV1A 3W8KA 3NDGA 3V3RA 2XR0A 1CEFA 1O07A 1XA1A 5E2FA 1KGFA 4ZBEA 1ESUA 1FOFA 4GN2A 2ZLYA 2ZQAA 4S2LA 3ZG0A 4OLDA 4NK3A 1FR1A 2P9VA 4OQIA 5EECA 3B3XA 4KZ7A 3G31A 4MBHA 3O86A 4BLMA 3LEZA 1ZG4A 2ZC5B 2ZC3B 3MZDA 3N7WA 4N9KA 3VSLA 1HD8A 4D2OA 1EI5A 1IYQA 2B5RA 1HVBA 3HUMA 3IF6A 4K0WA 5A91A 3ZG8B 1YT4A 3HBRA 3WS4A 3G34A 1L0GA 4DE0A 4OH0A 1OMEA 3IH9A 1IEMA 4LCLA 4X56A 3V3SA 1K57C 3N8LA 3WS2A 4R1GA 4BENA 1Q2QA 1J9MA 3WRTA 1WYBA 2EX9A 4QY5A 3FYZA 2HDQA 2X71A 5FQIA 2XF3A 4R4SA 5IHVA 4BL3A 1XKZA 4LV0A 1PW1A 4JF4A 5FI7A 2QZ6A 3IQAA 3A3IA 4JXWA 2H10A 4OVDA 3ZNTA 3C7VA 2OLUA 5M1AA 4P85A 3GV9A 5FQKA 1PZOA 1Z6FA 3HL9A 4R4RA 3WS5A 4PM9A 1KE4A 4PMAA 4C6YA 4NETA 5CRFA 3GMWA 3E2LA 1ERMA 1K56A 4WMCD 4F94A 1XX2A 4DE3A 4IVKA 2HP5A 4B88A 3BFCA 4WZ5C 1SHVA 3UPNA 2JBFA 2I72A 4LV2A 3UNWA 3HUNA 5E2GA 1HTZA 4GKUA 1MWUA 2Y2NA 4FH4A 1YLYA 4KZ3A 2H5SA 4FCFA 4CJNA 1E3UA 3DTMA 1FCOA 3NI9A 2Y2MA 4WYYA 4DDSA 2H0TA 2A3UA 4BQMA 1JWPA 1PW8A 3GSGA 5HFOA 5CERA 5FI2A 5BOHA 1TDGA 4QU3A 2Y4AA 4IEDA 4OOLA 3WWXA 2J9OA 2P9VB 5TR7A 1NJ4A 2Y2OA 2PU2A 5FAOA 2J8YA 3N8SA 1Y54A 1RGZA 1FSWA 4R0QA 5KMWA 3BFFA 1YLZA 1GA0A 4OPRA 4EV4A 5GHXA 3G4PA 1SDNA 3G2ZA 4ID4A 5CHMA 1K54A 1PYYA 4GD8A 2J7VA 3DW0A 1L0DA 3PBQA 5CTMA 3ZVWA 2WKHA 4U0XA 4N92A 2XD1A 2R9XA 3PBTA 4IBRA 3IHAA 1NYMA 4KZ8A 5HARA 4PM6A 4S2NA 3IF5A 3NY4A 3BFEA 1KE0A 3P09A 5DTSA 1PWDA 3ZCZA 4HBUA 1GCEA 3LY3A 5EVIA 1E4DA 5I94A 1MWRA 2IWBA 3ZDJA 1MWSA 1W8YA 3DWKA 4KG6A 2DNSA 1MWTA 4RYEA 5GL9A 3FWLA 3TSGA 3HLFA 2JC7A 1TDLA 2Q9MA 3HLDA 4HESA 3Q7ZA 1JVJA 5F82A 5A92A 3HUOA 2XQZA 3SOIA 3WRZA 4EBPA 1PI4A 4O7DA 4UA6A 4DXCA 4WELA 3O3VA 2XGNA 4X69A 4OKPA 3JYIA 1XXMA 1K4EA 1E25A 3LO7A 4YFMA 5DTTA 1MBLA 3SS4A 2X01A 4DRTA 3IXDA 3C4OA 2WAFA 1FSYA 1MKIA 2WKEA 3NCKA 4DDYA 4OPZA 1ALQA 3ISGA 4KZ4A 5G18A 2HDRA 4ZJ3A 4MNRA 2OSUA 2P74A 2IWDA 2HP6A 1L0EA 4LV3A 2ZD8A 3FV7A 1DJCA 2QMIA 1CI9A 1TEMA 3MFDA 1Q2PA 3OCNA 3G30A 3S1YA 1IYPA 4PM8A 3ZHHA 4ZJ2A 1WYCA 4R3BA 3SH9A 3OPLA 1FCNA 1SKFA 4WBGA 2XD5A 4XUZA 3UY6A 1NRFA 3IF6C 5FQQA 3ZFZA 2CC1A 1N4OA 1K38A 2E8IA 4FD8A 4FH2A 4WZ4A 2Z2LB 1MY8A 1K56D 1N9BA 2Q9NA 3OCLA 5CTNA 5FSRA 1EROA 1NZUA 3NBLA 4DE2A 5EVLA 2EX2A 4QY6A 2XLNA 2V1ZA 1SCWA 3MZEA 2EFXA 1FR6A 2OV5A 3VP1A 4JXVA 3S4XA 1C3BA 1PWCA 4QJGA 1G6AA 5CECA 3VP0A 2EX8A 4JPMA 5L2FA 1E3UD 4RA7A 3VFFA 4P87A 3PBNA 2G2UA 4GD6A 4S2IA 4EQIA 1IELA 1LLBA 1BSGA 4GZBA 5EVIB 3V5MA 4PPRA 5GLCA 3IWOA 2HP9A 2XK1A 2ZM0A 4OPYA 4Z9QA 1RP5A 5E2HA 3GRJA 1IKIA 1CI8A 1XPBA 4N1HA 5FQJA 3VOZA 3SS3A 1BTLA 3GTCA 1LI9A 1M40A 2FFFB 4P6BA 2WYXA 1FCMA 3ZVTA 1WE4A 4XUXA 2XFSA 4QHCA 1ES4A 2WGWA 3BECA 4KZBA 5FAQA 4X68A 4RX2A 1YMXA 2HDUA 1PIOA 3IXGA 4IVIA 5AQ9A 5CGXA 4E3NA 4BD1A 1NXYA 2V2FF 4JKTA 4OQ0A 5KSCA 1ES3A 4JF6A 3A3JA 5FI6A 2WUQA 3D4FA 1O7EA 2BLSA 3I7JA 4N9LA 1YMSA 3PBOA 5HAQA 5GLDA 1K55A 4HEFA 3AGEA 4MBFA 1L0FA 2WGVA 4GB7A 5EOOA 2R9WA 3VOYA 4EBNA 3PTEA 2FFYA 4JXGA 4JBFA 4Y7PA 5EVID 2EFUA 1IYOA 3GVBA 3Q81A 3ZGAB 4E6WA 4GDNA 1PZPA 1YLWA 5GLAA 1LHYA 4EUZA 1K54C 4MLLA 3VP4A 2PBYA 5FDHA 2V20A 1GHPA 3TG9A 2PU4A 1BT5A 2XEPA 2GDNA 3MBZA 3W4QA 3LY4A 3WS1A 3EQVA 5TFQA 1GHIA 1JWVA 5FASA 4DKIA 4S2NC 5J8XA 5D3OA 1U60A 3DWZA 5EPHA 5GHZA 1IYSA 3OZHA 1ESIA 2IWCA 2Z2MB 5HX9A 4LCMA 1KE3A 1KVLA 4OQHA 1W5DA 4E3JA 2ZQ9A 1ES5A 1GHMA 4OONA 4E3IA 5EVIC 2XDMA 1EWZA 2XH9A 5TGFA 4CPKA 3MZFA 1YLTA 2QPNA 3W4OA 1S0WA 1LI0A 2WZXA 3RJUA 4EBLA 2JE5A 1I5QA 2ZMAA 1K6SA 1W79A 4OQGA 1KGEA 2WGWB 3EQUA 3Q07A 4Y0UA 4DE1A 3C4PA 1ONHA 1RGYA 1TVFA 4OP5A 2Y59A 4KZ5A 5AQBA 1BLSA 1K6RA 4A5RA 4S2MA 4PM5A 3VSKA 3G32A 3SS5A 5KSHA 1YQSA 4E3LA 1BZAA 3BEBA 4R23A 3GQZA 3IHBA 3PAGA 4BJPA 4KQRA 2DCFA 4GDBA 4H8RA 3BFGA 1XA7A 3M2KA 4ZDXA 5M19A 1MXOA 1NZOA 3M6BA 3FKVA 2VGJA 2VGKA 3OPHA 1CK3A 3FZCA 4JF5A 4JXSA 4E3MA 4ZTKA 2Y55A 5E2EA 5CXWA 4L0LA 1XGJA 3MXSA 4S2PA 3HREA 4XXRA 3S22A 1NY0A 3BLSA 3CJMA 5FATA 4GNUA 3UE0A 3RXXA 1I2SA 2Y2GA 3FKWA 3V39A 2RL3A 4DXBA 2WADA 5A90A 5KZHA 1M6KA 4KG2A 1KGGA 3MXRA 2WKIA 4WEKA 1ZKJA 3G2YA 3HLGA 4OP8A 3Q82A 3MKFA 1DJBA 3BFDA 4DF6A 1LL9A 3UPPA 4X6TA 4YINA 5DVAA 4U0TA 2ZC6B 3BRMA 5FQMA 3VFHA 4S2OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y91 A;  1S6R A;  4Y0O A;  5FAP A;  3MKE A;  2ZC4 B;  3SH8 A;  4BL2 A;  4E6X A;  1ES2 A;  3M6H A;  4OOY A;  3UN7 A;  5EOE A;  2Y2Q A;  2DRW A;  5F1G A;  5FQ9 A;  3ZG7 B;  4N1X A;  4RVA A;  3UE3 A;  3QNC A;  3HLW A;  4JLF A;  4UHU A;  5DF9 A;  5DF7 A;  5U47 A;  1BUE A;  1XGI A;  4FSF A;  1PI5 A;  1K25 A;  4E3K A;  4RX3 A;  3UDX A;  4KZA A;  2ZC7 A;  3IT9 A;  4GOG A;  4S2K A;  3TOI A;  3Q1F A;  1SDE A;  1K57 A;  4OPQ A;  3SH7 A;  2OLV A;  1DJA A;  1PWG A;  3ITB A;  2Y2K A;  2Y2H A;  5CGW A;  2XFT A;  3NDE A;  5CHU A;  3IWI A;  3CMZ A;  5AQ7 A;  4MBK A;  1W7F A;  3IXB A;  4ZJ1 A;  1ERQ A;  3ITA A;  4QB8 A;  3PAE A;  1LL5 A;  4OLG A;  2ZQ7 A;  1I2W A;  2C5W B;  2JCH A;  4UAA A;  5FA7 A;  4KQO A;  1VM1 A;  4KQQ A;  4Y0T A;  4OOM A;  4R3J A;  3E2K A;  2Y2J A;  2EX6 A;  3Q7V B;  4UA9 A;  1ZG6 A;  2Y2L A;  2ZJ9 A;  3IXH A;  4B4Z A;  2HDS A;  2WK0 A;  3RXW A;  3VP3 A;  5F1F A;  3VMA A;  3VP2 A;  1BLC A;  1K55 C;  3ZG9 B;  3BM6 A;  3UE1 A;  3A3F A;  4M3K A;  3G35 A;  3HVF A;  4WZ5 A;  4Q8I A;  1IKG A;  3UDI A;  5A93 A;  1H8Y A;  1QME A;  2H0Y A;  1MPL A;  1G68 A;  4MEZ A;  2G2W A;  1AXB A;  1YLP A;  4C3Q A;  3PBS A;  4P0M A;  2ZQD A;  3HLB A;  2J9P A;  1ONG A;  3IH8 A;  2RCX A;  5HAP A;  5JYO A;  1BLP A;  1HZO A;  3UO9 A;  2EXA A;  1L2S A;  3BLM A;  3O88 A;  4S2J A;  3HLE A;  3NC8 A;  3W4P A;  2ZQ8 A;  2X02 A;  1YM1 A;  3A3E A;  5AQA A;  3ZNY A;  1H5X A;  1KVM A;  3UPO A;  4WMC A;  3LCE A;  1BUL A;  4HBT A;  4KG5 A;  3QHY A;  3WS0 A;  3C7U A;  2C6W B;  3QNB A;  4B4X A;  5GLB A;  4BD0 A;  3IF6 B;  5CED A;  4WM9 A;  3AGF A;  3OPR A;  5DTK A;  3N6I A;  5HAI A;  1JTD A;  3P98 A;  4KZ9 A;  3C5A A;  1K4F A;  4E3O A;  5GHY A;  5DF8 A;  3N4I A;  1KDW A;  3A3D A;  3OC2 A;  4X53 A;  5E43 A;  1JWZ A;  5M18 A;  5CGS A;  2UWX A;  3IWQ A;  5EE8 A;  4KEN B;  3V50 A;  1H8Z A;  4QD4 A;  2Y2I A;  4IBX A;  5EUA A;  2WGI A;  2ZM2 A;  2EXB A;  3NIA A;  4KZ6 A;  3UDF A;  2ZQC A;  2WAE A;  3OPP A;  3Q7V A;  5CEB A;  4UA7 A;  3AGD A;  1RCJ A;  5F83 A;  5CHJ A;  4C75 A;  4PM7 A;  3HLC A;  3BYD A;  3CZD A;  1QMF A;  2A49 A;  3O87 A;  4EWF A;  1FQG A;  2WZZ A;  1NYY A;  2ZM8 A;  1ZC2 A;  1XP4 A;  4U3T A;  5HW3 A;  1JTG A;  3PBR A;  5JYP A;  1KDS A;  3ZG5 A;  1DY6 A;  1YLJ A;  4X55 A;  2Y2P A;  1W8Q A;  3GR2 A;  5HL1 A;  4K0X A;  3N8R A;  1GA9 A;  4LEN A;  3M2J A;  3CG5 A;  1BLH A;  4K91 A;  4WEJ A;  1VQQ A;  2BG1 A;  2HPB A;  1CEG A;  4ZAM A;  4LV1 A;  3W8K A;  3NDG A;  3V3R A;  2XR0 A;  1CEF A;  1O07 A;  1XA1 A;  5E2F A;  1KGF A;  4ZBE A;  1ESU A;  1FOF A;  4GN2 A;  2ZLY A;  2ZQA A;  4S2L A;  3ZG0 A;  4OLD A;  4NK3 A;  1FR1 A;  2P9V A;  4OQI A;  5EEC A;  3B3X A;  4KZ7 A;  3G31 A;  4MBH A;  3O86 A;  4BLM A;  3LEZ A;  1ZG4 A;  2ZC5 B;  2ZC3 B;  3MZD A;  3N7W A;  4N9K A;  3VSL A;  1HD8 A;  4D2O A;  1EI5 A;  1IYQ A;  2B5R A;  1HVB A;  3HUM A;  3IF6 A;  4K0W A;  5A91 A;  3ZG8 B;  1YT4 A;  3HBR A;  3WS4 A;  3G34 A;  1L0G A;  4DE0 A;  4OH0 A;  1OME A;  3IH9 A;  1IEM A;  4LCL A;  4X56 A;  3V3S A;  1K57 C;  3N8L A;  3WS2 A;  4R1G A;  4BEN A;  1Q2Q A;  1J9M A;  3WRT A;  1WYB A;  2EX9 A;  4QY5 A;  3FYZ A;  2HDQ A;  2X71 A;  5FQI A;  2XF3 A;  4R4S A;  5IHV A;  4BL3 A;  1XKZ A;  4LV0 A;  1PW1 A;  4JF4 A;  5FI7 A;  2QZ6 A;  3IQA A;  3A3I A;  4JXW A;  2H10 A;  4OVD A;  3ZNT A;  3C7V A;  2OLU A;  5M1A A;  4P85 A;  3GV9 A;  5FQK A;  1PZO A;  1Z6F A;  3HL9 A;  4R4R A;  3WS5 A;  4PM9 A;  1KE4 A;  4PMA A;  4C6Y A;  4NET A;  5CRF A;  3GMW A;  3E2L A;  1ERM A;  1K56 A;  4WMC D;  4F94 A;  1XX2 A;  4DE3 A;  4IVK A;  2HP5 A;  4B88 A;  3BFC A;  4WZ5 C;  1SHV A;  3UPN A;  2JBF A;  2I72 A;  4LV2 A;  3UNW A;  3HUN A;  5E2G A;  1HTZ A;  4GKU A;  1MWU A;  2Y2N A;  4FH4 A;  1YLY A;  4KZ3 A;  2H5S A;  4FCF A;  4CJN A;  1E3U A;  3DTM A;  1FCO A;  3NI9 A;  2Y2M A;  4WYY A;  4DDS A;  2H0T A;  2A3U A;  4BQM A;  1JWP A;  1PW8 A;  3GSG A;  5HFO A;  5CER A;  5FI2 A;  5BOH A;  1TDG A;  4QU3 A;  2Y4A A;  4IED A;  4OOL A;  3WWX A;  2J9O A;  2P9V B;  5TR7 A;  1NJ4 A;  2Y2O A;  2PU2 A;  5FAO A;  2J8Y A;  3N8S A;  1Y54 A;  1RGZ A;  1FSW A;  4R0Q A;  5KMW A;  3BFF A;  1YLZ A;  1GA0 A;  4OPR A;  4EV4 A;  5GHX A;  3G4P A;  1SDN A;  3G2Z A;  4ID4 A;  5CHM A;  1K54 A;  1PYY A;  4GD8 A;  2J7V A;  3DW0 A;  1L0D A;  3PBQ A;  5CTM A;  3ZVW A;  2WKH A;  4U0X A;  4N92 A;  2XD1 A;  2R9X A;  3PBT A;  4IBR A;  3IHA A;  1NYM A;  4KZ8 A;  5HAR A;  4PM6 A;  4S2N A;  3IF5 A;  3NY4 A;  3BFE A;  1KE0 A;  3P09 A;  5DTS A;  1PWD A;  3ZCZ A;  4HBU A;  1GCE A;  3LY3 A;  5EVI A;  1E4D A;  5I94 A;  1MWR A;  2IWB A;  3ZDJ A;  1MWS A;  1W8Y A;  3DWK A;  4KG6 A;  2DNS A;  1MWT A;  4RYE A;  5GL9 A;  3FWL A;  3TSG A;  3HLF A;  2JC7 A;  1TDL A;  2Q9M A;  3HLD A;  4HES A;  3Q7Z A;  1JVJ A;  5F82 A;  5A92 A;  3HUO A;  2XQZ A;  3SOI A;  3WRZ A;  4EBP A;  1PI4 A;  4O7D A;  4UA6 A;  4DXC A;  4WEL A;  3O3V A;  2XGN A;  4X69 A;  4OKP A;  3JYI A;  1XXM A;  1K4E A;  1E25 A;  3LO7 A;  4YFM A;  5DTT A;  1MBL A;  3SS4 A;  2X01 A;  4DRT A;  3IXD A;  3C4O A;  2WAF A;  1FSY A;  1MKI A;  2WKE A;  3NCK A;  4DDY A;  4OPZ A;  1ALQ A;  3ISG A;  4KZ4 A;  5G18 A;  2HDR A;  4ZJ3 A;  4MNR A;  2OSU A;  2P74 A;  2IWD A;  2HP6 A;  1L0E A;  4LV3 A;  2ZD8 A;  3FV7 A;  1DJC A;  2QMI A;  1CI9 A;  1TEM A;  3MFD A;  1Q2P A;  3OCN A;  3G30 A;  3S1Y A;  1IYP A;  4PM8 A;  3ZHH A;  4ZJ2 A;  1WYC A;  4R3B A;  3SH9 A;  3OPL A;  1FCN A;  1SKF A;  4WBG A;  2XD5 A;  4XUZ A;  3UY6 A;  1NRF A;  3IF6 C;  5FQQ A;  3ZFZ A;  2CC1 A;  1N4O A;  1K38 A;  2E8I A;  4FD8 A;  4FH2 A;  4WZ4 A;  2Z2L B;  1MY8 A;  1K56 D;  1N9B A;  2Q9N A;  3OCL A;  5CTN A;  5FSR A;  1ERO A;  1NZU A;  3NBL A;  4DE2 A;  5EVL A;  2EX2 A;  4QY6 A;  2XLN A;  2V1Z A;  1SCW A;  3MZE A;  2EFX A;  1FR6 A;  2OV5 A;  3VP1 A;  4JXV A;  3S4X A;  1C3B A;  1PWC A;  4QJG A;  1G6A A;  5CEC A;  3VP0 A;  2EX8 A;  4JPM A;  5L2F A;  1E3U D;  4RA7 A;  3VFF A;  4P87 A;  3PBN A;  2G2U A;  4GD6 A;  4S2I A;  4EQI A;  1IEL A;  1LLB A;  1BSG A;  4GZB A;  5EVI B;  3V5M A;  4PPR A;  5GLC A;  3IWO A;  2HP9 A;  2XK1 A;  2ZM0 A;  4OPY A;  4Z9Q A;  1RP5 A;  5E2H A;  3GRJ A;  1IKI A;  1CI8 A;  1XPB A;  4N1H A;  5FQJ A;  3VOZ A;  3SS3 A;  1BTL A;  3GTC A;  1LI9 A;  1M40 A;  2FFF B;  4P6B A;  2WYX A;  1FCM A;  3ZVT A;  1WE4 A;  4XUX A;  2XFS A;  4QHC A;  1ES4 A;  2WGW A;  3BEC A;  4KZB A;  5FAQ A;  4X68 A;  4RX2 A;  1YMX A;  2HDU A;  1PIO A;  3IXG A;  4IVI A;  5AQ9 A;  5CGX A;  4E3N A;  4BD1 A;  1NXY A;  2V2F F;  4JKT A;  4OQ0 A;  5KSC A;  1ES3 A;  4JF6 A;  3A3J A;  5FI6 A;  2WUQ A;  3D4F A;  1O7E A;  2BLS A;  3I7J A;  4N9L A;  1YMS A;  3PBO A;  5HAQ A;  5GLD A;  1K55 A;  4HEF A;  3AGE A;  4MBF A;  1L0F A;  2WGV A;  4GB7 A;  5EOO A;  2R9W A;  3VOY A;  4EBN A;  3PTE A;  2FFY A;  4JXG A;  4JBF A;  4Y7P A;  5EVI D;  2EFU A;  1IYO A;  3GVB A;  3Q81 A;  3ZGA B;  4E6W A;  4GDN A;  1PZP A;  1YLW A;  5GLA A;  1LHY A;  4EUZ A;  1K54 C;  4MLL A;  3VP4 A;  2PBY A;  5FDH A;  2V20 A;  1GHP A;  3TG9 A;  2PU4 A;  1BT5 A;  2XEP A;  2GDN A;  3MBZ A;  3W4Q A;  3LY4 A;  3WS1 A;  3EQV A;  5TFQ A;  1GHI A;  1JWV A;  5FAS A;  4DKI A;  4S2N C;  5J8X A;  5D3O A;  1U60 A;  3DWZ A;  5EPH A;  5GHZ A;  1IYS A;  3OZH A;  1ESI A;  2IWC A;  2Z2M B;  5HX9 A;  4LCM A;  1KE3 A;  1KVL A;  4OQH A;  1W5D A;  4E3J A;  2ZQ9 A;  1ES5 A;  1GHM A;  4OON A;  4E3I A;  5EVI C;  2XDM A;  1EWZ A;  2XH9 A;  5TGF A;  4CPK A;  3MZF A;  1YLT A;  2QPN A;  3W4O A;  1S0W A;  1LI0 A;  2WZX A;  3RJU A;  4EBL A;  2JE5 A;  1I5Q A;  2ZMA A;  1K6S A;  1W79 A;  4OQG A;  1KGE A;  2WGW B;  3EQU A;  3Q07 A;  4Y0U A;  4DE1 A;  3C4P A;  1ONH A;  1RGY A;  1TVF A;  4OP5 A;  2Y59 A;  4KZ5 A;  5AQB A;  1BLS A;  1K6R A;  4A5R A;  4S2M A;  4PM5 A;  3VSK A;  3G32 A;  3SS5 A;  5KSH A;  1YQS A;  4E3L A;  1BZA A;  3BEB A;  4R23 A;  3GQZ A;  3IHB A;  3PAG A;  4BJP A;  4KQR A;  2DCF A;  4GDB A;  4H8R A;  3BFG A;  1XA7 A;  3M2K A;  4ZDX A;  5M19 A;  1MXO A;  1NZO A;  3M6B A;  3FKV A;  2VGJ A;  2VGK A;  3OPH A;  1CK3 A;  3FZC A;  4JF5 A;  4JXS A;  4E3M A;  4ZTK A;  2Y55 A;  5E2E A;  5CXW A;  4L0L A;  1XGJ A;  3MXS A;  4S2P A;  3HRE A;  4XXR A;  3S22 A;  1NY0 A;  3BLS A;  3CJM A;  5FAT A;  4GNU A;  3UE0 A;  3RXX A;  1I2S A;  2Y2G A;  3FKW A;  3V39 A;  2RL3 A;  4DXB A;  2WAD A;  5A90 A;  5KZH A;  1M6K A;  4KG2 A;  1KGG A;  3MXR A;  2WKI A;  4WEK A;  1ZKJ A;  3G2Y A;  3HLG A;  4OP8 A;  3Q82 A;  3MKF A;  1DJB A;  3BFD A;  4DF6 A;  1LL9 A;  3UPP A;  4X6T A;  4YIN A;  5DVA A;  4U0T A;  2ZC6 B;  3BRM A;  5FQM A;  3VFH A;  4S2O A; 
#chains in the Genus database with same CATH topology
 4IHQ A;  1S6R A;  4Y0O A;  5FAP A;  2M7U A;  2ZC4 B;  4OOY A;  2KDK A;  5F1G A;  3QP2 A;  3ZG7 B;  4N1X A;  3HLW A;  1BUE A;  5LBR A;  1K25 A;  4DJ2 A;  3UDX A;  2HJ9 C;  4KZA A;  3IT9 A;  3RH8 B;  1PWG A;  2Y2K A;  4DJ3 A;  2XFT A;  4R70 A;  4ZJ1 A;  4QB8 A;  3PAE A;  4UAA A;  1HLU P;  1VM1 A;  4KQQ A;  1DP8 A;  1ZG6 A;  2Y2L A;  2ZJ9 A;  4B4Z A;  2HDS A;  5F1F A;  2W3E A;  1BLC A;  3ZG9 B;  3BM6 A;  3UE1 A;  3A3F A;  4M3K A;  4Q8I A;  3HVF A;  2PDR A;  1QME A;  2H0Y A;  4D60 A;  3PBS A;  1OTA A;  3TW8 A;  2E8J A;  4Y17 A;  5HAP A;  5JYO A;  3IX8 A;  3T12 B;  2EXA A;  3O88 A;  1YPR A;  3NC8 A;  4I5S A;  5FEG A;  4NKP A;  3A3E A;  1H5X A;  3LCE A;  4HBT A;  2P08 A;  4ARZ A;  2QHK A;  4UQI S;  3R7W B;  3N6I A;  3P98 A;  2BTF P;  3C5A A;  1K4F A;  2I9V A;  1KDW A;  3MXQ A;  4H6J A;  5M18 A;  4ESP A;  2UWX A;  3V50 A;  1H8Z A;  5EUA A;  2ZL1 A;  2WGI A;  3AGD A;  5J7E A;  5F83 A;  5CHJ A;  4C75 A;  3HLC A;  1S67 L;  3CZD A;  2A49 A;  4EWF A;  1FQG A;  2WZZ A;  1XP4 A;  1JTG A;  1KDS A;  3ZG5 A;  1YLJ A;  4Z1W A;  3N8R A;  3M2J A;  2GJ3 A;  2VK3 A;  2DMW A;  2W3G A;  2XSS A;  2PYR A;  3B3X A;  4N9K A;  3IF6 A;  4K0W A;  1YT4 A;  2QJ7 A;  3E0Y A;  1IEM A;  4EER A;  1K57 C;  3WS2 A;  1XJ2 A;  4BEN A;  1J9M A;  1UGU A;  2WKR A;  1WYB A;  1T18 A;  3FYZ A;  2X71 A;  4LRX C;  5IHV A;  4BL3 A;  5DJU A;  4JF4 A;  5IU1 A;  1G6O A;  3A3I A;  4JXW A;  4OVD A;  2O9C A;  1UWP X;  2OLU A;  3VE4 A;  3JVU A;  1K0K A;  3GV9 A;  1Z6F A;  2VGL M;  4R4R A;  3WS5 A;  4PM9 A;  4PMA A;  2KX6 A;  2ZOH A;  5CRF A;  3E2L A;  1K56 A;  1XJ4 A;  5F6A A;  4DE3 A;  2VJW A;  2HP5 A;  4IVK A;  2V1B A;  4LV2 A;  3UNW A;  1MWU A;  4KZ3 A;  3T4L A;  2H5S A;  4FCF A;  4CJN A;  2PYP A;  3DTM A;  1SKO B;  1PW8 A;  1TDG A;  1PNE A;  4R0Q A;  3BFF A;  1YLZ A;  3CHW P;  5GHX A;  1SDN A;  3G2Z A;  5CHM A;  4GD8 A;  2J7V A;  3ZVW A;  2R9X A;  4IBR A;  1NYM A;  5HAR A;  5HWT A;  3C8C A;  2V8C A;  4HJ6 A;  3BFE A;  3DTE A;  3ZCZ A;  5IT5 A;  5I94 A;  3DWK A;  4RYE A;  5F82 A;  2XQZ A;  4O7D A;  4DXC A;  2XGN A;  1K4E A;  1E25 A;  3SS4 A;  2X01 A;  4O01 A;  1FSY A;  3LR3 A;  5G18 A;  2OSU A;  2P74 A;  2IWD A;  4LV3 A;  2ZD8 A;  3FV7 A;  1H3Q A;  3MFD A;  3G30 A;  4GS9 A;  1IYP A;  3ZHH A;  1WYC A;  5HPF A;  4R3B A;  3KSF A;  2JKT I;  4KUO A;  3SH9 A;  1YAX A;  2XD5 A;  1NRF A;  4G3K A;  1TD5 A;  4FH2 A;  1ERO A;  3NBL A;  1G5U A;  3MZE A;  3K3C A;  3VP1 A;  4JXV A;  1E3U D;  1S66 L;  3C38 A;  4P87 A;  5EVI B;  2HP9 A;  2XK1 A;  2ZM0 A;  4OPY A;  3GRJ A;  3VOZ A;  3SS3 A;  5DFY A;  4MN6 A;  4G3V A;  3ZVT A;  1FCM A;  1WE4 A;  4XUX A;  2WGW A;  3BEC A;  2YKF A;  1PIO A;  2IA2 A;  3U2A A;  5EV0 A;  2W1T A;  2V2F F;  4JKT A;  3D3O A;  4OQ0 A;  4JF6 A;  3A3J A;  2OAQ 1;  1H0M A;  3IS2 A;  3MQ0 A;  3PBO A;  1K55 A;  4BBT A;  2AVX A;  2VZW A;  4CLC A;  2GZA A;  1L0F A;  3C2W A;  2FFY A;  3GVB A;  1YLW A;  3TJZ C;  5HZH A;  2V20 A;  2EA9 A;  3MBZ A;  3LY4 A;  5TFQ A;  1JWV A;  3GEC A;  2B18 A;  4S2N C;  5EPH A;  5GHZ A;  4ME4 A;  1ESI A;  2IWC A;  5HX9 A;  1D06 A;  1ES5 A;  4E3I A;  3PXP A;  2Q0O A;  2XH9 A;  5TGF A;  3MZF A;  1YLT A;  1T1A A;  1S0W A;  1LI0 A;  1XJ3 A;  1I5Q A;  3U4L P;  3EOI A;  4OQG A;  4QPR A;  3Q07 A;  1MC0 A;  1RGY A;  1TVF A;  4OP5 A;  1K6R A;  4A5R A;  4E3L A;  3IHB A;  3PAG A;  4BJP A;  4KQR A;  4GDB A;  1MXO A;  2VGK A;  3OPH A;  1CK3 A;  4JXS A;  2LB5 A;  1XGJ A;  2PD7 A;  3HRE A;  1NY0 A;  4I38 A;  3V39 A;  2JKR I;  3UE0 A;  3RXX A;  2Y2G A;  2RL3 A;  3KX0 X;  3P01 A;  1M6K A;  1X0O A;  3MXR A;  2XA7 M;  2WKI A;  5DFX A;  3HLG A;  1DJB A;  3BFD A;  1LL9 A;  3MJQ A;  4X6T A;  5DVA A;  2Y91 A;  1OPX A;  3MKE A;  4E6X A;  4FOF A;  5EOE A;  2DRW A;  2V8F A;  3QNC A;  5DF9 A;  5FDS A;  4RX3 A;  4GOG A;  3Q1F A;  3SH7 A;  4OPQ A;  3G6O A;  2Y2H A;  3W2Z A;  3CMZ A;  2PR5 A;  3MQO A;  3ITA A;  1Z09 A;  3QP4 A;  2J3W A;  1LL5 A;  2C5W B;  4KQO A;  4X1M A;  3E2K A;  2EX6 A;  3Q7V B;  4EXO A;  3UE6 A;  3RXW A;  3VP3 A;  3KYZ A;  4Y13 A;  3A0S A;  3VP2 A;  4MDZ A;  4WZ5 A;  3UDI A;  1ODV A;  1MPL A;  4PKY A;  2QWS A;  1AXB A;  2L0W A;  2ZQD A;  4X25 A;  1XJ6 A;  1ONG A;  3IH8 A;  4HJ4 A;  2ZMF A;  4S2J A;  5HWW A;  3HLE A;  2X02 A;  1YM1 A;  3H7W A;  5AQA A;  3ZNY A;  3UPO A;  1KVM A;  3F1P A;  4WMC A;  2H28 A;  3C7U A;  4ZRR A;  3AGF A;  3OPR A;  4M4X A;  5HAI A;  1JTD A;  1VET B;  4LRY C;  4CLC E;  4AFI A;  5E43 A;  1OT9 A;  3IWQ A;  1EW0 A;  4HH3 A;  5EE8 A;  4QD4 A;  4IBX A;  4NXB A;  2ZM2 A;  2WAE A;  3OPP A;  3CIT A;  1RCJ A;  4PM7 A;  3T4O A;  2VEA A;  3O87 A;  4HNB A;  1ZC2 A;  4LFU A;  4EES A;  5HW3 A;  3HCY A;  2Y2P A;  1TS8 A;  4K0X A;  4LEN A;  1BYW A;  1BLH A;  2A2L A;  1VQQ A;  2BG1 A;  4ZAM A;  3FPW A;  4WLA A;  4EET B;  1O07 A;  3BWL A;  1ESU A;  4GN2 A;  1S4S A;  3S7O A;  4OLD A;  5TJJ A;  1FR1 A;  4UQI M;  2A24 B;  3NOT C;  3CUE C;  3O86 A;  3LEZ A;  3MZD A;  2O9A A;  3VSL A;  1HD8 A;  1EI5 A;  4XT2 A;  1MZU A;  4HIA A;  4MCW A;  2B5R A;  1HVB A;  5A91 A;  3F1O A;  3HBR A;  2PAV P;  1L0G A;  4DE0 A;  3H82 B;  4OH0 A;  3IH9 A;  2MJ6 A;  2W3H A;  3KYE A;  4QY5 A;  5FQI A;  1N9N A;  1XKZ A;  2W3D A;  3CPT B;  4I3A A;  2HGV A;  3IQA A;  1P9R A;  4EEU A;  1FIK A;  5FQK A;  3HL9 A;  3LR4 A;  5HDC A;  1XX2 A;  1FIL A;  2JBF A;  5L8M A;  3HUN A;  3DBA A;  4FH4 A;  4YOF A;  2H0T A;  4BQM A;  5CER A;  5BOH A;  4OOL A;  2P9V B;  1NJ4 A;  2J8Y A;  3N8S A;  1RGZ A;  3T4S A;  3CAX A;  4EV4 A;  4BBU A;  1K54 A;  2KLI A;  3IBJ A;  2WKH A;  2XD1 A;  3F1N A;  1LT0 A;  3IHA A;  1OTD A;  2W3F A;  3IF5 A;  3NY4 A;  2JKT M;  3UB6 A;  5DKL A;  4HBU A;  4CQH A;  2P04 A;  3NHQ A;  3LY3 A;  5EVI A;  3BY8 A;  1MWR A;  3ZDJ A;  1MWT A;  1TDL A;  3HLD A;  4HES A;  5A92 A;  4GHI B;  3T1S A;  1VB6 A;  2HJE A;  4UA6 A;  3LGO A;  4X69 A;  4YFM A;  5DTT A;  2UV0 E;  5HD3 A;  1MKI A;  1VEU B;  4WUJ A;  2QKP A;  4MNR A;  4RQ9 A;  2W0N A;  1DJC A;  2J3T D;  4NXE A;  1TEM A;  3S7P A;  4IUK A;  3C30 A;  4ZJ2 A;  3K2N A;  1SKF A;  3UB9 A;  3UY6 A;  2L4R A;  3VE3 A;  3IF6 C;  3ZFZ A;  1K38 A;  4FD8 A;  1MY8 A;  1N9B A;  3OCL A;  1NZU A;  1YSP A;  4DE2 A;  5EVL A;  2EX2 A;  2EFX A;  2OV5 A;  1C3B A;  4LRZ E;  2EX8 A;  4JPM A;  2ZMV A;  4GD6 A;  1OJG A;  1IEL A;  1LLB A;  5GLC A;  2K31 A;  4Z9Q A;  4B93 A;  1CI8 A;  1XPB A;  2VX8 A;  3TE8 A;  4P6B A;  2WYX A;  2OAP 1;  3PR6 A;  4KZB A;  5FAQ A;  3S7N A;  4E3N A;  3EGX C;  1YKD A;  5KSC A;  5FI6 A;  1O7E A;  2LB9 A;  2VV8 A;  1YMS A;  5HAQ A;  4HEF A;  3AGE A;  4GB7 A;  3PTE A;  3LI9 A;  3Q81 A;  4E6W A;  4L9F A;  5GLA A;  1LHY A;  3KYQ A;  3VP4 A;  2PBY A;  5FDH A;  1GHP A;  3TG9 A;  2GDN A;  3W4Q A;  3BQ8 A;  5J3W A;  3WS1 A;  2JKR M;  5EM1 A;  2D01 A;  1TS6 A;  5J8X A;  1U60 A;  1IYS A;  2Y8H A;  3TRC A;  2GX5 A;  2Z2M B;  1GSV A;  1KE3 A;  1KVL A;  2YKH A;  4OQH A;  4E3J A;  2ZQ9 A;  1GHM A;  3MQQ A;  2XDM A;  1EWZ A;  4CPK A;  4HJ3 A;  1ZHH B;  3RJU A;  2JE5 A;  1K6S A;  2B95 A;  1KGE A;  3EQU A;  4DE1 A;  3C4P A;  5AQB A;  4KZ5 A;  1BLS A;  4P6Z M;  5A8B A;  3VSK A;  3E4P A;  4I3J A;  1NWZ A;  4KUK A;  3M6B A;  3FKV A;  1PRQ A;  2VV7 A;  3FZC A;  4JF5 A;  2Y55 A;  4L0L A;  3CJM A;  4GNU A;  1I2S A;  4DXB A;  2VGL S;  2G7U A;  1ZKJ A;  3FC7 A;  4DF6 A;  2PR6 A;  3UB5 P;  4U0T A;  5HDD A;  3VFH A;  4NXG A;  1LSX A;  2ZOI A;  2O0Y A;  4BL2 A;  1ES2 A;  2VA0 A;  4HY8 A;  2J3T C;  3MF0 A;  3T1X A;  3QP6 A;  2QJ5 A;  1PI5 A;  3VOL A;  2VKS A;  2ZC7 A;  3TOI A;  4S2K A;  1SDE A;  2J80 A;  3ITB A;  5CGW A;  3OOV A;  5CHU A;  3IWI A;  5AQ7 A;  4FTX A;  1W7F A;  2NUP C;  3LYX A;  3IXB A;  4OLG A;  2ZQ7 A;  2JHE A;  1I2W A;  2JCH A;  2ZL1 B;  4OOM A;  4R3J A;  5G4Z A;  3IXH A;  2PRF A;  3RFB A;  3H9W A;  1K55 C;  3HJK A;  3R4K A;  4ETX A;  1IKG A;  1H8Y A;  4MEZ A;  2G2W A;  3HLB A;  2RCX A;  5AJG A;  2WKP A;  1BLP A;  1HZO A;  3UO9 A;  1T19 A;  2A24 A;  3W4P A;  2ZQ8 A;  3KSG A;  4KG5 A;  4B4X A;  3QNB A;  5GLB A;  3IF6 B;  5CED A;  3H82 A;  4KZ9 A;  5I5L A;  5DF8 A;  1S4R A;  5F68 A;  5DJT A;  4EW7 A;  2ACG A;  1D7E A;  4KEN B;  3PYP A;  3CI6 A;  5CEB A;  3NIA A;  4KZ6 A;  2ZQC A;  1GSW A;  1QMF A;  1NYY A;  3PBR A;  4PAU A;  1DY6 A;  3GR2 A;  3CWF A;  1GA9 A;  3CG5 A;  4II7 A;  4LV1 A;  2BAS A;  4Y3I A;  3ZQ5 A;  1XA1 A;  5E2F A;  4ZBE A;  2ZQA A;  3ZG0 A;  1OJ5 A;  1N9O A;  2P9V A;  5EEC A;  3MS6 A;  5AVF A;  3G31 A;  4MBH A;  1ZG4 A;  2ZC3 B;  1IYQ A;  3ZG8 B;  1ACF A;  3R7W A;  4EUV A;  2XRN A;  4FUW A;  4BWI A;  3N8L A;  4R1G A;  3WRT A;  2OWH A;  2HDQ A;  4R4S A;  3MMH A;  1UWN X;  4B9O A;  2HV1 A;  5L10 A;  3C7V A;  1J3W A;  3HJI A;  5M1A A;  5FEF A;  2OWJ A;  5CX7 A;  4GLQ A;  2FZ0 A;  1KE4 A;  4GHI A;  4C6Y A;  4NET A;  3UB7 A;  4F94 A;  3LIE A;  5HWV A;  4WZ5 C;  3LIC A;  1HTZ A;  4GKU A;  1YLY A;  2HZ5 A;  2KOI A;  2V9A A;  1VEU A;  1E3U A;  1NLY A;  1FCO A;  3NI9 A;  2Y2M A;  1TS7 A;  1JWP A;  2M7V A;  4GJ4 A;  3WWX A;  2J9O A;  4LGW A;  2Y2O A;  2PU2 A;  1P97 A;  3NOP C;  2VLG A;  4GS9 B;  1GA0 A;  4OPR A;  2JKG A;  3G4P A;  4WF0 A;  4ID4 A;  4Y5F A;  4LLO B;  1PYY A;  2V0U A;  1L0D A;  4K08 A;  3T1R A;  5CTM A;  3QP8 A;  3DAV A;  3PBT A;  2HF6 A;  4KZ8 A;  1Y4O A;  3D9Y A;  4L9G A;  3BY9 A;  5L07 A;  5F5Y A;  1E4D A;  1W8Y A;  4KG6 A;  3B47 A;  4MMN A;  3TSG A;  3HLF A;  2JC7 A;  2Q9M A;  3RTY A;  1JVJ A;  3HUO A;  4Q0I A;  3SOI A;  1PI4 A;  4F3L B;  3IX4 A;  4WEL A;  2OOL A;  2W1R A;  4NG2 A;  4DRT A;  2W1T B;  5MC7 A;  1P0Z A;  3IXD A;  3C4O A;  3NCK A;  1ALQ A;  3ISG A;  4KZ4 A;  4ZJ3 A;  4HQA A;  1SKO A;  3IS2 B;  3NOU C;  1ZTU A;  2QMI A;  1CI9 A;  4ETZ A;  1A0K A;  3OCN A;  4PM8 A;  1FCN A;  2VV6 A;  3OLO A;  4XUZ A;  2E8I A;  4Y2F A;  3NEC A;  4WZ4 A;  1K56 D;  2Q9N A;  3MFX A;  4QY6 A;  3FPV A;  2XLN A;  3LR5 A;  3CUE A;  3T4J A;  4HH2 A;  1PWC A;  5CEC A;  1G6A A;  3VP0 A;  5L2F A;  3LFV A;  3VFF A;  3PBN A;  2G2U A;  4MN7 A;  4EQI A;  1BSG A;  4EU0 A;  2EWW A;  5E2H A;  1IKI A;  1SZV A;  5FQJ A;  3T4K A;  3KSH A;  1LI9 A;  4IUH A;  4UEY A;  2XFS A;  4GW9 A;  4QHC A;  3ZYT A;  4HOI A;  4RX2 A;  1YMX A;  5HPI A;  2HDU A;  3IXG A;  1WA9 A;  4IVI A;  5AQ9 A;  5CGX A;  4BD1 A;  5KIZ A;  2WUQ A;  3D4F A;  3DTK A;  3E98 A;  5GLD A;  1MKM A;  5EOO A;  2WGV A;  2R9W A;  4IJG A;  4JXG A;  4JBF A;  4Y7P A;  4HP4 A;  4R38 A;  1XFQ A;  3EEH A;  1PZP A;  4GDN A;  1AWI A;  4Y15 A;  5HSQ A;  5EM0 A;  5FL3 A;  4EUZ A;  2PBD P;  1K54 C;  3L9K A;  1PFL A;  4O0P A;  1W63 Q;  2Z6D A;  1BT5 A;  3B33 A;  3KSI A;  4YWZ A;  2CMN A;  3EQV A;  3ICY A;  4YNR A;  3VV4 A;  5FAS A;  4DKI A;  5D3O A;  3OZH A;  1NRJ A;  3LID A;  4OON A;  5EVI C;  3LI8 A;  2M1C A;  5C5K A;  2P7J A;  4NXF A;  2QPN A;  3W4O A;  3MSH A;  4L9E A;  2JKF A;  2WZX A;  1IOU A;  1V9Y A;  1W79 A;  4Y0U A;  3L7H A;  1ONH A;  2W27 A;  2Y59 A;  3BJN A;  4PM5 A;  1OTI A;  1YQS A;  4EQ1 A;  3LIF A;  4R23 A;  2DCF A;  4ZDX A;  4H8R A;  3BFG A;  3M2K A;  1NZO A;  2VGJ A;  4E3M A;  4ZTK A;  5E2E A;  4Q0H A;  5AVE A;  4I39 A;  4S2P A;  4XXR A;  5A90 A;  2WAD A;  4KG2 A;  1KGG A;  4G3W A;  1STZ A;  4YIN A;  2ZC6 B;  3BRM A;  4S2O A;  1GSX A;  1G28 A;  2PD8 A;  1S1Z A;  3SH8 A;  3M6H A;  3UN7 A;  2Y2Q A;  5FQ9 A;  3H7W B;  4JGP A;  1IFQ A;  3F1P B;  4RVA A;  3UE3 A;  4JLF A;  3NJA A;  5DF7 A;  4UHU A;  5U47 A;  2V1A A;  1XGI A;  1CF0 A;  4FSF A;  4DMZ A;  4E3K A;  1K57 A;  4CLC D;  2OLV A;  1DJA A;  4DN0 A;  3NUL A;  3NDE A;  1CJF A;  4HHD A;  4MBK A;  1T1B A;  3A0R A;  1ERQ A;  5FA7 A;  3MR0 A;  4Y0T A;  2Y2J A;  5TBM B;  4UA9 A;  3B42 A;  3V67 A;  3SZT A;  2WK0 A;  3VMA A;  2R78 A;  3E4Q A;  3EWK A;  5A93 A;  3G35 A;  2B02 A;  1G68 A;  1F2K A;  1YLP A;  4C3Q A;  4P0M A;  2J9P A;  1NLZ A;  1L2S A;  3BLM A;  1L3L A;  3QP1 A;  1BUL A;  3QHY A;  3WS0 A;  2C6W B;  4XT2 B;  4BD0 A;  3F1O B;  4WM9 A;  5DTK A;  4R6L A;  5DKK A;  5K5B A;  4E3O A;  5GHY A;  1LSW A;  2GNX A;  3N4I A;  3A3D A;  3OC2 A;  4X53 A;  5F69 A;  1JWZ A;  5CGS A;  3IX3 A;  2Y2I A;  2Y79 A;  2EXB A;  2JN7 A;  3UDF A;  3Q7V A;  4UA7 A;  3PHY A;  3BW6 A;  3BYD A;  2FH5 A;  2ZM8 A;  4U3T A;  2Z6C A;  5JYP A;  1TF1 A;  4X55 A;  2EWV A;  1W8Q A;  5HL1 A;  4K91 A;  3LEQ A;  3P7N A;  4WEJ A;  4PKY G;  2HPB A;  1CEG A;  3W8K A;  3NDG A;  3V3R A;  2XR0 A;  1CEF A;  1KGF A;  2NUT C;  3LIA A;  1FOF A;  2ZLY A;  4S2L A;  4NK3 A;  4I3I A;  4OQI A;  3EGD C;  4KZ7 A;  4BLM A;  2ZC5 B;  3N7W A;  4D2O A;  5L09 A;  1DP9 A;  5EVE A;  3T50 A;  3HUM A;  4ARZ B;  1LSV A;  3WS4 A;  3A0V A;  3G34 A;  1OME A;  1VET A;  4LCL A;  4X56 A;  3UB8 A;  3V3S A;  1Q2Q A;  2EX9 A;  3F1N B;  3T1Q B;  4H6J B;  2XF3 A;  4LV0 A;  1PW1 A;  5FI7 A;  3KO6 A;  2QZ6 A;  1DP6 A;  3BQA A;  4MN5 A;  1F9I A;  2H10 A;  3ZNT A;  2ZBB A;  2PT7 A;  4X1L A;  3OBF A;  1CQA A;  4P85 A;  3DTI A;  1PZO A;  3GMW A;  1ERM A;  4WMC D;  4CLC C;  1YSQ A;  5G4Y A;  4F3L A;  4B88 A;  3BFC A;  1SHV A;  3UPN A;  2I72 A;  5E2G A;  2Y2N A;  4HP9 A;  1H8M A;  4WYY A;  4DDS A;  1XFN A;  2A3U A;  4P6Z S;  3GSG A;  5HFO A;  5FI2 A;  4QU3 A;  2Y4A A;  4IED A;  5J4E A;  5TR7 A;  5FAO A;  3IBR A;  1Y54 A;  1FSW A;  5KMW A;  5HDS A;  4NEE D;  3D72 A;  4WN5 A;  1T1C A;  3LIB A;  1Y28 A;  1TS0 A;  3DW0 A;  3PBQ A;  3S7Q A;  4U0X A;  4N92 A;  4EEP A;  4PM6 A;  4S2N A;  5HL6 A;  3ULF A;  1KE0 A;  1F98 A;  1P9W A;  3CPT A;  3P09 A;  5DTS A;  1PWD A;  1GCE A;  4QWO A;  2IWB A;  1MWS A;  1N9L A;  5GL9 A;  2DNS A;  3FG8 A;  3T4Q A;  3FWL A;  3GDI A;  1OTB A;  3Q7Z A;  3WRZ A;  4EBP A;  4HI4 A;  3O3V A;  3UME A;  4OKP A;  3JYI A;  1XXM A;  3LO7 A;  1MBL A;  3O5Y A;  2WAF A;  2WKE A;  4DDY A;  4OPZ A;  2HDR A;  2HP6 A;  1L0E A;  3LUQ A;  4E04 A;  1DRM A;  2V0W A;  1D1J A;  4GCZ A;  1Q2P A;  3S1Y A;  4JGO A;  4JGQ A;  3OPL A;  4WBG A;  5FQQ A;  2CC1 A;  1N4O A;  1S1Y A;  2Z2L B;  5FSR A;  5CTN A;  4KQD A;  2V1Z A;  1SCW A;  1FR6 A;  3T4T A;  3S4X A;  4QJG A;  4LPZ A;  4RA7 A;  4S2I A;  4GZB A;  3V5M A;  4PPR A;  3IWO A;  2K7S A;  1RP5 A;  2O99 A;  3K3D A;  4N1H A;  3SW1 A;  1OT6 A;  1BTL A;  3GTC A;  1M40 A;  2FFF B;  2QYB A;  1ES4 A;  4X68 A;  1OTE A;  2O9B A;  1NXY A;  1ES3 A;  3CLO A;  2BLS A;  3I7J A;  4O8G A;  4N9L A;  1F5M A;  3UMD A;  2WKQ A;  2XRO A;  4R3A A;  2K2N A;  3EEA A;  4MBF A;  4EBN A;  3VOY A;  1V9Z A;  5EVI D;  2EFU A;  4PHT A;  1IYO A;  1LL8 A;  3ZGA B;  2PHY A;  5HD5 A;  2INW A;  4BBV A;  4MLL A;  2PU4 A;  3JPU A;  2XEP A;  2XA7 S;  1GHI A;  5EFW A;  3DWZ A;  4LCM A;  3E4O A;  1W5D A;  4JGR A;  3LR0 A;  4EBL A;  2ZMA A;  2WGW B;  3JVV A;  1KOU A;  2D02 A;  1VHM A;  1W63 M;  5IS1 A;  4S2M A;  4WL9 A;  3G32 A;  3SS5 A;  5KSH A;  1BZA A;  1JNU A;  3BEB A;  3GQZ A;  3QP5 A;  1XA7 A;  5TBM A;  5M19 A;  4BMW A;  4Q0J A;  5CXW A;  2L1M A;  4CLC B;  3MXS A;  3S22 A;  3BLS A;  5FAT A;  3FKW A;  5KZH A;  4WEK A;  3G2Y A;  4OP8 A;  3Q82 A;  3MKF A;  3UPP A;  5FQM A; 
#chains in the Genus database with same CATH homology
 2Y91 A;  1S6R A;  4Y0O A;  5FAP A;  3MKE A;  2ZC4 B;  3SH8 A;  4BL2 A;  4E6X A;  1ES2 A;  3M6H A;  4OOY A;  3UN7 A;  5EOE A;  2Y2Q A;  2DRW A;  5F1G A;  5FQ9 A;  3ZG7 B;  4N1X A;  4RVA A;  3UE3 A;  3QNC A;  3HLW A;  4JLF A;  4UHU A;  5DF9 A;  5DF7 A;  5U47 A;  1BUE A;  1XGI A;  4FSF A;  1PI5 A;  1K25 A;  4E3K A;  4RX3 A;  3UDX A;  4KZA A;  2ZC7 A;  3IT9 A;  4GOG A;  4S2K A;  3TOI A;  3Q1F A;  1SDE A;  1K57 A;  4OPQ A;  3SH7 A;  2OLV A;  1DJA A;  1PWG A;  3ITB A;  2Y2K A;  2Y2H A;  5CGW A;  2XFT A;  3NDE A;  5CHU A;  3IWI A;  3CMZ A;  5AQ7 A;  4MBK A;  1W7F A;  3IXB A;  4ZJ1 A;  1ERQ A;  3ITA A;  4QB8 A;  3PAE A;  1LL5 A;  4OLG A;  2ZQ7 A;  1I2W A;  2C5W B;  2JCH A;  4UAA A;  5FA7 A;  4KQO A;  1VM1 A;  4KQQ A;  4Y0T A;  4OOM A;  4R3J A;  3E2K A;  2Y2J A;  2EX6 A;  3Q7V B;  4UA9 A;  1ZG6 A;  2Y2L A;  2ZJ9 A;  3IXH A;  4B4Z A;  2HDS A;  2WK0 A;  3RXW A;  3VP3 A;  5F1F A;  3VMA A;  3VP2 A;  1BLC A;  1K55 C;  3ZG9 B;  3BM6 A;  3UE1 A;  3A3F A;  4M3K A;  3G35 A;  3HVF A;  4WZ5 A;  4Q8I A;  1IKG A;  3UDI A;  5A93 A;  1H8Y A;  1QME A;  2H0Y A;  1MPL A;  1G68 A;  4MEZ A;  2G2W A;  1AXB A;  1YLP A;  4C3Q A;  3PBS A;  4P0M A;  2ZQD A;  3HLB A;  2J9P A;  1ONG A;  3IH8 A;  2RCX A;  5HAP A;  5JYO A;  1BLP A;  1HZO A;  3UO9 A;  2EXA A;  1L2S A;  3BLM A;  3O88 A;  4S2J A;  3HLE A;  3NC8 A;  3W4P A;  2ZQ8 A;  2X02 A;  1YM1 A;  3A3E A;  5AQA A;  3ZNY A;  1H5X A;  1KVM A;  3UPO A;  4WMC A;  3LCE A;  1BUL A;  4HBT A;  4KG5 A;  3QHY A;  3WS0 A;  3C7U A;  2C6W B;  3QNB A;  4B4X A;  5GLB A;  4BD0 A;  3IF6 B;  5CED A;  4WM9 A;  3AGF A;  3OPR A;  5DTK A;  3N6I A;  5HAI A;  1JTD A;  3P98 A;  4KZ9 A;  3C5A A;  1K4F A;  4E3O A;  5GHY A;  5DF8 A;  3N4I A;  1KDW A;  3A3D A;  3OC2 A;  4X53 A;  5E43 A;  1JWZ A;  5M18 A;  5CGS A;  2UWX A;  3IWQ A;  5EE8 A;  4KEN B;  3V50 A;  1H8Z A;  4QD4 A;  2Y2I A;  4IBX A;  5EUA A;  2WGI A;  2ZM2 A;  2EXB A;  3NIA A;  4KZ6 A;  3UDF A;  2ZQC A;  2WAE A;  3OPP A;  3Q7V A;  5CEB A;  4UA7 A;  3AGD A;  1RCJ A;  5F83 A;  5CHJ A;  4C75 A;  4PM7 A;  3HLC A;  3BYD A;  3CZD A;  1QMF A;  2A49 A;  3O87 A;  4EWF A;  1FQG A;  2WZZ A;  1NYY A;  2ZM8 A;  1ZC2 A;  1XP4 A;  4U3T A;  5HW3 A;  1JTG A;  3PBR A;  5JYP A;  1KDS A;  3ZG5 A;  1DY6 A;  1YLJ A;  4X55 A;  2Y2P A;  1W8Q A;  3GR2 A;  5HL1 A;  4K0X A;  3N8R A;  1GA9 A;  4LEN A;  3M2J A;  3CG5 A;  1BLH A;  4K91 A;  4WEJ A;  1VQQ A;  2BG1 A;  2HPB A;  1CEG A;  4ZAM A;  4LV1 A;  3W8K A;  3NDG A;  3V3R A;  2XR0 A;  1CEF A;  1O07 A;  1XA1 A;  5E2F A;  1KGF A;  4ZBE A;  1ESU A;  1FOF A;  4GN2 A;  2ZLY A;  2ZQA A;  4S2L A;  3ZG0 A;  4OLD A;  4NK3 A;  1FR1 A;  2P9V A;  4OQI A;  5EEC A;  3B3X A;  4KZ7 A;  3G31 A;  4MBH A;  3O86 A;  4BLM A;  3LEZ A;  1ZG4 A;  2ZC5 B;  2ZC3 B;  3MZD A;  3N7W A;  4N9K A;  3VSL A;  1HD8 A;  4D2O A;  1EI5 A;  1IYQ A;  2B5R A;  1HVB A;  3HUM A;  3IF6 A;  4K0W A;  5A91 A;  3ZG8 B;  1YT4 A;  3HBR A;  3WS4 A;  3G34 A;  1L0G A;  4DE0 A;  4OH0 A;  1OME A;  3IH9 A;  1IEM A;  4LCL A;  4X56 A;  3V3S A;  1K57 C;  3N8L A;  3WS2 A;  4R1G A;  4BEN A;  1Q2Q A;  1J9M A;  3WRT A;  1WYB A;  2EX9 A;  4QY5 A;  3FYZ A;  2HDQ A;  2X71 A;  5FQI A;  2XF3 A;  4R4S A;  5IHV A;  4BL3 A;  1XKZ A;  4LV0 A;  1PW1 A;  4JF4 A;  5FI7 A;  2QZ6 A;  3IQA A;  3A3I A;  4JXW A;  2H10 A;  4OVD A;  3ZNT A;  3C7V A;  2OLU A;  5M1A A;  4P85 A;  3GV9 A;  5FQK A;  1PZO A;  1Z6F A;  3HL9 A;  4R4R A;  3WS5 A;  4PM9 A;  1KE4 A;  4PMA A;  4C6Y A;  4NET A;  5CRF A;  3GMW A;  3E2L A;  1ERM A;  1K56 A;  4WMC D;  4F94 A;  1XX2 A;  4DE3 A;  4IVK A;  2HP5 A;  4B88 A;  3BFC A;  4WZ5 C;  1SHV A;  3UPN A;  2JBF A;  2I72 A;  4LV2 A;  3UNW A;  3HUN A;  5E2G A;  1HTZ A;  4GKU A;  1MWU A;  2Y2N A;  4FH4 A;  1YLY A;  4KZ3 A;  2H5S A;  4FCF A;  4CJN A;  1E3U A;  3DTM A;  1FCO A;  3NI9 A;  2Y2M A;  4WYY A;  4DDS A;  2H0T A;  2A3U A;  4BQM A;  1JWP A;  1PW8 A;  3GSG A;  5HFO A;  5CER A;  5FI2 A;  5BOH A;  1TDG A;  4QU3 A;  2Y4A A;  4IED A;  4OOL A;  3WWX A;  2J9O A;  2P9V B;  5TR7 A;  1NJ4 A;  2Y2O A;  2PU2 A;  5FAO A;  2J8Y A;  3N8S A;  1Y54 A;  1RGZ A;  1FSW A;  4R0Q A;  5KMW A;  3BFF A;  1YLZ A;  1GA0 A;  4OPR A;  4EV4 A;  5GHX A;  3G4P A;  1SDN A;  3G2Z A;  4ID4 A;  5CHM A;  1K54 A;  1PYY A;  4GD8 A;  2J7V A;  3DW0 A;  1L0D A;  3PBQ A;  5CTM A;  3ZVW A;  2WKH A;  4U0X A;  4N92 A;  2XD1 A;  2R9X A;  3PBT A;  4IBR A;  3IHA A;  1NYM A;  4KZ8 A;  5HAR A;  4PM6 A;  4S2N A;  3IF5 A;  3NY4 A;  3BFE A;  1KE0 A;  3P09 A;  5DTS A;  1PWD A;  3ZCZ A;  4HBU A;  1GCE A;  3LY3 A;  5EVI A;  1E4D A;  5I94 A;  1MWR A;  2IWB A;  3ZDJ A;  1MWS A;  1W8Y A;  3DWK A;  4KG6 A;  2DNS A;  1MWT A;  4RYE A;  5GL9 A;  3FWL A;  3TSG A;  3HLF A;  2JC7 A;  1TDL A;  2Q9M A;  3HLD A;  4HES A;  3Q7Z A;  1JVJ A;  5F82 A;  5A92 A;  3HUO A;  2XQZ A;  3SOI A;  3WRZ A;  4EBP A;  1PI4 A;  4O7D A;  4UA6 A;  4DXC A;  4WEL A;  3O3V A;  2XGN A;  4X69 A;  4OKP A;  3JYI A;  1XXM A;  1K4E A;  1E25 A;  3LO7 A;  4YFM A;  5DTT A;  1MBL A;  3SS4 A;  2X01 A;  4DRT A;  3IXD A;  3C4O A;  2WAF A;  1FSY A;  1MKI A;  2WKE A;  3NCK A;  4DDY A;  4OPZ A;  1ALQ A;  3ISG A;  4KZ4 A;  5G18 A;  2HDR A;  4ZJ3 A;  4MNR A;  2OSU A;  2P74 A;  2IWD A;  2HP6 A;  1L0E A;  4LV3 A;  2ZD8 A;  3FV7 A;  1DJC A;  2QMI A;  1CI9 A;  1TEM A;  3MFD A;  1Q2P A;  3OCN A;  3G30 A;  3S1Y A;  1IYP A;  4PM8 A;  3ZHH A;  4ZJ2 A;  1WYC A;  4R3B A;  3SH9 A;  3OPL A;  1FCN A;  1SKF A;  4WBG A;  2XD5 A;  4XUZ A;  3UY6 A;  1NRF A;  3IF6 C;  5FQQ A;  3ZFZ A;  2CC1 A;  1N4O A;  1K38 A;  2E8I A;  4FD8 A;  4FH2 A;  4WZ4 A;  2Z2L B;  1MY8 A;  1K56 D;  1N9B A;  2Q9N A;  3OCL A;  5CTN A;  5FSR A;  1ERO A;  1NZU A;  3NBL A;  4DE2 A;  5EVL A;  2EX2 A;  4QY6 A;  2XLN A;  2V1Z A;  1SCW A;  3MZE A;  2EFX A;  1FR6 A;  2OV5 A;  3VP1 A;  4JXV A;  3S4X A;  1C3B A;  1PWC A;  4QJG A;  1G6A A;  5CEC A;  3VP0 A;  2EX8 A;  4JPM A;  5L2F A;  1E3U D;  4RA7 A;  3VFF A;  4P87 A;  3PBN A;  2G2U A;  4GD6 A;  4S2I A;  4EQI A;  1IEL A;  1LLB A;  1BSG A;  4GZB A;  5EVI B;  3V5M A;  4PPR A;  5GLC A;  3IWO A;  2HP9 A;  2XK1 A;  2ZM0 A;  4OPY A;  4Z9Q A;  1RP5 A;  5E2H A;  3GRJ A;  1IKI A;  1CI8 A;  1XPB A;  4N1H A;  5FQJ A;  3VOZ A;  3SS3 A;  1BTL A;  3GTC A;  1LI9 A;  1M40 A;  2FFF B;  4P6B A;  2WYX A;  1FCM A;  3ZVT A;  1WE4 A;  4XUX A;  2XFS A;  4QHC A;  1ES4 A;  2WGW A;  3BEC A;  4KZB A;  5FAQ A;  4X68 A;  4RX2 A;  1YMX A;  2HDU A;  1PIO A;  3IXG A;  4IVI A;  5AQ9 A;  5CGX A;  4E3N A;  4BD1 A;  1NXY A;  2V2F F;  4JKT A;  4OQ0 A;  5KSC A;  1ES3 A;  4JF6 A;  3A3J A;  5FI6 A;  2WUQ A;  3D4F A;  1O7E A;  2BLS A;  3I7J A;  4N9L A;  1YMS A;  3PBO A;  5HAQ A;  5GLD A;  1K55 A;  4HEF A;  3AGE A;  4MBF A;  1L0F A;  2WGV A;  4GB7 A;  5EOO A;  2R9W A;  3VOY A;  4EBN A;  3PTE A;  2FFY A;  4JXG A;  4JBF A;  4Y7P A;  5EVI D;  2EFU A;  1IYO A;  3GVB A;  3Q81 A;  3ZGA B;  4E6W A;  4GDN A;  1PZP A;  1YLW A;  5GLA A;  1LHY A;  4EUZ A;  1K54 C;  4MLL A;  3VP4 A;  2PBY A;  5FDH A;  2V20 A;  1GHP A;  3TG9 A;  2PU4 A;  1BT5 A;  2XEP A;  2GDN A;  3MBZ A;  3W4Q A;  3LY4 A;  3WS1 A;  3EQV A;  5TFQ A;  1GHI A;  1JWV A;  5FAS A;  4DKI A;  4S2N C;  5J8X A;  5D3O A;  1U60 A;  3DWZ A;  5EPH A;  5GHZ A;  1IYS A;  3OZH A;  1ESI A;  2IWC A;  2Z2M B;  5HX9 A;  4LCM A;  1KE3 A;  1KVL A;  4OQH A;  1W5D A;  4E3J A;  2ZQ9 A;  1ES5 A;  1GHM A;  4OON A;  4E3I A;  5EVI C;  2XDM A;  1EWZ A;  2XH9 A;  5TGF A;  4CPK A;  3MZF A;  1YLT A;  2QPN A;  3W4O A;  1S0W A;  1LI0 A;  2WZX A;  3RJU A;  4EBL A;  2JE5 A;  1I5Q A;  2ZMA A;  1K6S A;  1W79 A;  4OQG A;  1KGE A;  2WGW B;  3EQU A;  3Q07 A;  4Y0U A;  4DE1 A;  3C4P A;  1ONH A;  1RGY A;  1TVF A;  4OP5 A;  2Y59 A;  4KZ5 A;  5AQB A;  1BLS A;  1K6R A;  4A5R A;  4S2M A;  4PM5 A;  3VSK A;  3G32 A;  3SS5 A;  5KSH A;  1YQS A;  4E3L A;  1BZA A;  3BEB A;  4R23 A;  3GQZ A;  3IHB A;  3PAG A;  4BJP A;  4KQR A;  2DCF A;  4GDB A;  4H8R A;  3BFG A;  1XA7 A;  3M2K A;  4ZDX A;  5M19 A;  1MXO A;  1NZO A;  3M6B A;  3FKV A;  2VGJ A;  2VGK A;  3OPH A;  1CK3 A;  3FZC A;  4JF5 A;  4JXS A;  4E3M A;  4ZTK A;  2Y55 A;  5E2E A;  5CXW A;  4L0L A;  1XGJ A;  3MXS A;  4S2P A;  3HRE A;  4XXR A;  3S22 A;  1NY0 A;  3BLS A;  3CJM A;  5FAT A;  4GNU A;  3UE0 A;  3RXX A;  1I2S A;  2Y2G A;  3FKW A;  3V39 A;  2RL3 A;  4DXB A;  2WAD A;  5A90 A;  5KZH A;  1M6K A;  4KG2 A;  1KGG A;  3MXR A;  2WKI A;  4WEK A;  1ZKJ A;  3G2Y A;  3HLG A;  4OP8 A;  3Q82 A;  3MKF A;  1DJB A;  3BFD A;  4DF6 A;  1LL9 A;  3UPP A;  4X6T A;  4YIN A;  5DVA A;  4U0T A;  2ZC6 B;  3BRM A;  5FQM A;  3VFH A;  4S2O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...