4OP8A

Room temperature crystal structure of stabilized tem-1 beta-lactamase variant v.13 carrying g238s mutation
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
263
structure length
262
Chain Sequence
HPETLVKVKDAEDQLGGRVGYIELDLASGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVGELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTTPVAMATTLRKLLTGELLTAASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGASERSRGIIAALGPDGKPSRIVVIYMTGSQATMDERNRQIAEIGASLIKHW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TEM-94 ES-beta-lactamase
publication title Negative Epistasis and Evolvability in TEM-1 beta-Lactamase--The Thin Line between an Enzyme's Conformational Freedom and Disorder.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 98
structure length 262
sequence length 263
ec nomenclature
pdb deposition date 2014-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4op8A00
4HESA 4GOGA 1O7EA 4N9KA 5DVAA 3PBOA 1HZOA 5CGSA 2UWXA 2ZC7A 3OCLA 1KE4A 4EWFA 4Q8IA 3Q7ZA 1KE3A 1NYMA 1Q2QA 2B5RA 2WUQA 3A3DA 3BECA 5M18A 4JLFA 4BL2A 4DF6A 1PWGA 2QZ6A 4N92A 3IXBA 4IVKA 4JKTA 1E4DA 4UA6A 4PM6A 4Y0OA 5GHZA 1ES4A 3ZHHA 5J8XA 3W4PA 4MBHA 5AQAA 3G30A 3N6IA 2P74A 4WMCD 4R1GA 2DNSA 4UA9A 5EOEA 4K0WA 4FD8A 5CTNA 3V5MA 1AXBA 2EXAA 3HREA 5FAPA 1IYOA 4EV4A 1JVJA 4OONA 1ERQA 1G68A 3V39A 3VMAA 1XX2A 4O7DA 3UY6A 1H8YA 2EX8A 4OKPA 2Y2LA 3IF6A 5FQJA 4UAAA 2Y2OA 3HLCA 2IWCA 2Y4AA 3ZDJA 2R9WA 1YLJA 3N7WA 1NJ4A 1XGJA 5F1FA 5KMWA 4P6BA 3MXSA 2JC7A 2ZC5B 5FSRA 1PZOA 3UE1A 1M6KA 2EFXA 2XD1A 4OPYA 3ZVWA 3DTMA 3NC8A 5FAOA 2WZXA 1SDEA 1DY6A 2Y2KA 4KG6A 3JYIA 2DRWA 1DJBA 2ZC6B 3OPRA 5DTKA 4LV3A 2XH9A 3PBQA 5TGFA 1QMFA 3HVFA 1JWPA 5I94A 1MBLA 2Y59A 1H8ZA 2WGIA 3SH8A 2FFYA 3VP2A 4X69A 1SKFA 2R9XA 2Y2PA 2V20A 3IF6B 3N8LA 2XFTA 4OVDA 1XP4A 3UDFA 2JE5A 2Y2NA 3ISGA 3ZG5A 4WELA 3C5AA 3IQAA 3ZVTA 5CEBA 4S2IA 3UO9A 3VSLA 1NXYA 2ZLYA 3IHAA 1E25A 4IBRA 4WZ5A 1CK3A 4DE0A 3LEZA 4ID4A 4ZAMA 3NCKA 3RJUA 1ZG4A 4BL3A 1N9BA 1KE0A 1Y54A 3HBRA 3ITAA 1JTGA 3TG9A 1FCMA 1L2SA 1O07A 3PAEA 2A49A 1TDLA 4KG5A 5D3OA 2JCHA 3BFEA 4Z9QA 1L0FA 5GLBA 1KDSA 1K4FA 3IXHA 1DJCA 3PAGA 1W5DA 3W4QA 2ZQDA 1CI8A 2Y2IA 3O87A 4DDYA 2OSUA 4PM9A 3UPPA 5CEDA 1CEFA 3S1YA 3V50A 5CERA 3BFGA 2WAFA 3GTCA 3IT9A 4KZ5A 1KGGA 4LV2A 4P87A 1NY0A 4DE3A 1G6AA 2V1ZA 3WRZA 4JXSA 1EROA 4R4SA 2IWBA 3Q07A 1HVBA 3UNWA 1CI9A 1XGIA 4OPQA 4FH4A 1W8QA 4JPMA 4S2MA 1YM1A 2EX2A 4C75A 1BTLA 2J9PA 4BENA 4OH0A 1MY8A 1BLHA 3MKFA 2Y2QA 4RVAA 3VOZA 3ZG0A 4E3MA 4E3OA 2XGNA 3AGFA 2XR0A 5EE8A 3BLSA 4KENB 3DWKA 4M3KA 1ESIA 2H5SA 1IKIA 2RL3A 2G2UA 3N8SA 5HAPA 4DKIA 5FA7A 4GZBA 5DTTA 4X55A 1IELA 3C4OA 3MZDA 1TEMA 3QNBA 3C7UA 4MNRA 5E2HA 2Y2GA 3FKWA 1ONGA 1IKGA 1PI4A 1LL9A 5A91A 4X53A 4ZJ3A 4KG2A 3S22A 4BJPA 4E3JA 5KZHA 3OZHA 3GV9A 3Q7VA 3VP4A 1BULA 1FSYA 5CTMA 1FOFA 1JTDA 2HP6A 4WM9A 1RP5A 4KQOA 4N9LA 1ES3A 5EVIC 1FCOA 4GB7A 3Q1FA 1PW1A 4NETA 1BSGA 1IEMA 5AQ7A 5JYOA 4XUXA 3LY4A 3VP3A 5KSCA 1WE4A 2XDMA 3VP1A 2PU4A 3V3RA 4QU3A 4RYEA 1Q2PA 4OQHA 5FI7A 5TR7A 1FCNA 1K57C 2HDSA 5E2EA 3OCNA 4IVIA 4KQQA 4KZ7A 2ZJ9A 2ZM0A 4OQ0A 1S6RA 1XKZA 5FAQA 3GVBA 2V2FF 2HP5A 3N8RA 4P0MA 1IYQA 3BM6A 3PBNA 3Q7VB 1LLBA 1M40A 5EOOA 3UE3A 4QJGA 2XF3A 5GLAA 3BLMA 3M2JA 4KZ3A 3FV7A 4OPZA 5FASA 3NY4A 5CHJA 1SDNA 3GQZA 3GR2A 4QHCA 1ALQA 1DJAA 1K54C 4B88A 1BT5A 3SOIA 3M6HA 3SH7A 4C6YA 3Q82A 3WS4A 4KQRA 4XXRA 2Z2LB 3O86A 5JYPA 4KZBA 1NYYA 2A3UA 5U47A 4FCFA 4OLDA 4P85A 5HARA 3SS4A 4CJNA 4Y0TA 3Q81A 2XD5A 2DCFA 1XXMA 4OOLA 3CMZA 3IXGA 3S4XA 3OPHA 4JXVA 1MXOA 1OMEA 1TDGA 5AQBA 1ES2A 4E6XA 3FKVA 2EXBA 3NIAA 3HLGA 4B4ZA 4WYYA 4KZ9A 5EUAA 4BQMA 1K55C 3HUNA 3NDEA 3O88A 1XA1A 5HX9A 3A3EA 3IH9A 5DF9A 2ZQAA 4LCLA 4GKUA 4OOMA 4BLMA 2EFUA 4RX2A 4B4XA 3D4FA 3G2YA 5EVLA 1EI5A 4LENA 4BD1A 2XLNA 2XK1A 5FQQA 2OLVA 5M1AA 4DE2A 5EPHA 3NI9A 1SCWA 2GDNA 1S0WA 4LV1A 4KZ8A 5DF7A 3IXDA 5CHUA 1VQQA 3A3IA 3VP0A 2Y2MA 4U3TA 5M19A 3SH9A 3W8KA 2WGVA 2WKIA 4GD6A 4JXWA 2I72A 1PYYA 2H0TA 3ZG7B 3UN7A 4RX3A 1JWZA 3BYDA 2PBYA 5EVIA 4ZBEA 2J8YA 1K4EA 2IWDA 5GHYA 1YLYA 2FFFB 5HL1A 4QB8A 1GCEA 3E2LA 3WS2A 4OLGA 4OOYA 5IHVA 5F1GA 1K56A 1BZAA 3A3FA 3UE0A 1HD8A 3HUOA 3BRMA 2Y55A 5EVID 4PM7A 3WWXA 1YLZA 1K57A 2VGKA 2WK0A 4HBUA 5GLDA 3IF5A 3ZFZA 2Y2HA 5CGXA 1K56D 1W8YA 1I5QA 2WKEA 4U0XA 2ZQ9A 4UA7A 3SS5A 5AQ9A 2Z2MB 4Y0UA 4JBFA 4Y7PA 3N4IA 3ZG8B 5HAQA 3C4PA 4X6TA 4D2OA 3NDGA 3HUMA 2X01A 1YLWA 2XEPA 3W4OA 5CXWA 5CECA 2VGJA 2WYXA 1H5XA 1BLPA 3DWZA 3ITBA 4R0QA 5GL9A 2HDRA 1Z6FA 4CPKA 1MWRA 1K54A 2J9OA 3HLFA 4EQIA 2ZQ7A 3UDIA 1TVFA 4OP8A 2WADA 1ONHA 4K91A 1KDWA 3O3VA 1PWDA 1I2SA 1XPBA 1BLCA 3G31A 1CEGA 2OLUA 3FWLA 2P9VA 2ZM2A 3GMWA 4PM8A 2WKHA 4E3KA 1MWUA 2C6WB 4GDBA 2X71A 4EBNA 4E3LA 4S2JA 4S2NC 3RXWA 4E3NA 2WAEA 1L0EA 4HBTA 3IWIA 1KVMA 2WZZA 3CJMA 3FYZA 1YMXA 5FI6A 4A5RA 1FR6A 4QD4A 4R4RA 1ERMA 1K25A 2ZC4B 1K55A 1YMSA 4YFMA 3UDXA 2HP9A 4E6WA 4C3QA 3G32A 2XQZA 5L2FA 3OC2A 2ZQCA 4WMCA 4MEZA 1ES5A 2C5WB 1RGZA 5DTSA 3WS5A 2PU2A 1N4OA 2ZC3B 3VFFA 4GDNA 2H0YA 3QHYA 3ZNTA 2P9VB 1C3BA 1BLSA 5FI2A 3TSGA 1MKIA 1ZG6A 1KGEA 4DE1A 1I2WA 3C7VA 4IEDA 1PW8A 1LI9A 3G2ZA 1KGFA 1LL5A 1YQSA 1PI5A 2H10A 1ZKJA 4N1HA 4ZJ1A 4DXCA 4OPRA 4KZ4A 4KZAA 3IWOA 1NZUA 3ZGAB 2Y91A 3E2KA 5TFQA 1FR1A 2ZD8A 4MBFA 3HLBA 3I7JA 3QNCA 3VSKA 4OQIA 2J7VA 1MPLA 1PWCA 2CC1A 4R3BA 4X56A 5EECA 1MWTA 4S2PA 1ZC2A 3EQUA 3CG5A 3M6BA 4E3IA 3PBSA 2OV5A 1L0DA 4KZ6A 4S2OA 3UPOA 4ZDXA 4F94A 3PBTA 1L0GA 1LI0A 5HFOA 1ESUA 4PMAA 1VM1A 4OP5A 1GA0A 1FQGA 3MXRA 4QY5A 1GHMA 2QMIA 4K0XA 3MZEA 5E43A 3UPNA 4PPRA 5CGWA 5CHMA 2JBFA 4XUZA 1IYSA 1JWVA 3GRJA 3PBRA 1RGYA 5F83A 3VFHA 4DDSA 5FQIA 4EUZA 5A92A 3G4PA 5A93A 4IBXA 1RCJA 3HLWA 4GD8A 3IHBA 3G35A 2XFSA 1YLTA 2EX9A 4EBLA 3MZFA 1SHVA 3TOIA 3WS1A 3BFCA 4R23A 5E2GA 3BFFA 4R3JA 4RA7A 4ZJ2A 2QPNA 4GNUA 1GHIA 5CRFA 4FSFA 2HPBA 3HLEA 4QY6A 1W79A 2BG1A 3ZG9B 5GHXA 4WZ4A 1PIOA 4WEKA 2E8IA 2ZQ8A 1LHYA 4LV0A 3WRTA 4L0LA 2EX6A 3MFDA 3IF6C 3OPPA 4S2NA 5A90A 1WYBA 1IYPA 4BD0A 1HTZA 2HDQA 4GN2A 5HW3A 1K6RA 4S2LA 3CZDA 4JF6A 2HDUA 4HEFA 4WBGA 4H8RA 1GHPA 3A3JA 3LCEA 4YINA 3MKEA 1YLPA 5FQ9A 2Q9MA 1K38A 4MLLA 2BLSA 5G18A 1WYCA 2X02A 1EWZA 4EBPA 3WS0A 2ZM8A 3V3SA 2G2WA 1W7FA 2Y2JA 3NBLA 3HL9A 1E3UA 5FDHA 4JXGA 1GA9A 2WGWA 1BUEA 1U60A 2Q9NA 5GLCA 2ZMAA 3P98A 5EVIB 4ZTKA 3OPLA 3SS3A 4NK3A 1YT4A 3ZNYA 3FZCA 5E2FA 3ZCZA 1QMEA 1KVLA 1E3UD 1K6SA 1XA7A 4JF4A 3LY3A 5FQMA 5BOHA 1MWSA 4DRTA 4DXBA 4N1XA 4U0TA 1NRFA 3GSGA 5FQKA 3EQVA 2RCXA 1NZOA 4WEJA 3HLDA 3M2KA 4OQGA 5HAIA 3LO7A 3MBZA 4WZ5C 3B3XA 3PTEA 3VOYA 3AGEA 4FH2A 3DW0A 5DF8A 4JF5A 3IWQA 3P09A 1J9MA 3BFDA 5FATA 3RXXA 5F82A 4PM5A 1PZPA 3IH8A 3AGDA 3G34A 4MBKA 2WGWB 3BEBA 4S2KA 4LCMA 4X68A 5KSHA 4UHUA 1FSWA
chains in the Genus database with same CATH superfamily
2NUTC 4GOGA 4UQIS 3T4SA 1O7EA 4N9KA 5CGSA 4XT2A 2ZC7A 3OCLA 4HNBA 4BBUA 2KDKA 1D1JA 2WUQA 3BECA 1S4RA 2J3TC 4JKTA 4IVKA 1E4DA 3R7WA 4D60A 4R1GA 2DNSA 5EOEA 3UB7A 5CTNA 3T4TA 4Y3IA 1JVJA 5L07A 1XX2A 3UY6A 2EX8A 5FQJA 2Y4AA 2ZC5B 5FSRA 2EFXA 3ZVWA 3BY9A 1DY6A 4KG6A 1T19A 4EEPA 3T1XA 1G6OA 3JYIA 1OJGA 5J3WA 5DTKA 4B9OA 2JKTI 5TGFA 1QMFA 1JWPA 3DBAA 1H8ZA 2WGIA 3KO6A 4KUOA 2W0NA 3IQAA 4S2IA 1NXYA 4IBRA 4WUJA 4WZ5A 3LEZA 4ZAMA 4HI4A 1Y54A 1JTGA 1FCMA 4KG5A 3S7QA 3BFEA 3KYQA 3BWLA 2W3EA 5J4EA 1DJCA 4CLCE 3V50A 2YKFA 2WAFA 4PKYG 4NG2A 5AVEA 1KGGA 4P87A 1NY0A 2ZOIA 4JXSA 1EROA 4R4SA 3UNWA 1CI9A 4OPQA 1YM1A 2J3TD 3TW8A 4OH0A 1BLHA 4RVAA 1S4SA 2W1TA 3LR0A 4KENB 2Z6DA 1IKIA 2G2UA 5TBMB 3C30A 4GZBA 4DN0A 3L7HA 4YNRA 3C7UA 2P08A 1IKGA 4X53A 4L9EA 4ZJ3A 4BJPA 5KZHA 1LT0A 4WM9A 4KQOA 2IA2A 2W1TB 3UB6A 2PYPA 1FCOA 1IEMA 3LIDA 2O9AA 3V3RA 5IU1A 3OCNA 3ULFA 4OQ0A 4GJ4A 3N8RA 4P0MA 4AFIA 3KSIA 4EEUA 2W1RA 4Q0JA 3UE3A 4QJGA 2XF3A 5FASA 1EW0A 1SDNA 3GR2A 1LSWA 3M6HA 2B02A 5LBRA 2L1MA 4KZBA 1NYYA 3LIBA 4CJNA 3Q81A 1XXMA 2QJ7A 4OOLA 3CMZA 3OPHA 1MXOA 5AQBA 2OWHA 1T18A 3NJAA 1XA1A 2ZQAA 4GKUA 1V9YA 4Y13A 3EEAA 3G2YA 3VOLA 4DE2A 3NI9A 2JKTM 2XA7M 1N9OA 2A2LA 2E8JA 2QWSA 4HJ6A 5HDSA 4GD6A 4JGRA 2PDRA 2VZWA 3UN7A 3ZG7B 2LB5A 5EVIA 4ETXA 5HL1A 2FFFB 4QB8A 1ZTUA 1GCEA 3E2LA 3WS2A 4OLGA 5HD3A 5F1GA 1FILA 1HLUP 3HUOA 4EQ1A 2WK0A 5CGXA 1K56D 4U0XA 4UA7A 3MQQA 2ZBBA 4X6TA 3ZYTA 2X01A 1YLWA 2XEPA 5CECA 2WYXA 1BLPA 1H5XA 3DWZA 5GL9A 1Z6FA 2PAVP 1MWRA 1K54A 3HLFA 3UDIA 1OTIA 4HOIA 3O3VA 3FWLA 4CLCC 2P9VA 1S67L 1MWUA 2C6WB 4X1MA 1F5MA 4I5SA 1KVMA 3CJMA 4A5RA 2YKHA 1YMSA 3UDXA 2VEAA 2HP9A 3LR3A 3S7NA 5L2FA 3VE3A 2ZQCA 1RGZA 2JKFA 3IBRA 3WS5A 3JVUA 2O9CA 2P9VB 1OTAA 3F1PB 1C3BA 4Y2FA 5FI2A 3TSGA 1MKIA 1KGEA 4GLQA 3LGOA 1AWIA 1Y4OA 4IHQA 1NZUA 2Y91A 3QNCA 5EECA 3TJZC 2AVXA 4Y5FA 4HP9A 4S2PA 3EQUA 2J3WA 3H82B 4E3IA 4KZ6A 3UPOA 3PBTA 1LI0A 1ESUA 4PMAA 4OP5A 1FQGA 2V1BA 2VGLM 2QMIA 3CWFA 3MZEA 5CGWA 3VFHA 4QPRA 4DDSA 2GZAA 4WN5A 2XFSA 1YLTA 3MZFA 3CITA 3MR0A 3B42A 1OJ5A 5F6AA 2L4RA 2BG1A 5GHXA 2ZQ8A 1LHYA 4LV0A 5A90A 3OPPA 2PD8A 4GN2A 2VV6A 4CLCD 1K6RA 4S2LA 3MSHA 4HEFA 3LCEA 2X02A 3FPWA 1EWZA 3V3SA 2Y2JA 4BWIA 5TJJA 4BMWA 4IUHA 4GW9A 1GA9A 1P97A 2WGWA 1BUEA 2KOIA 5GLCA 2ZMAA 3SS3A 3FZCA 2L0WA 5E2FA 1SKOA 1XA7A 5G4ZA 4DRTA 4N1XA 4ESPA 3RH8B 5FQKA 4GS9A 3EQVA 1NZOA 3M2KA 4BBTA 3VOYA 3TRCA 3DW0A 2WGWB 4LCMA 3B33A 4PAUA 4UHUA 3PYPA 4HESA 4LRXC 1SKOB 2UWXA 3LFVA 3JPUA 1WA9A 1NYMA 3FG8A 4GS9B 3A3DA 5M18A 4DF6A 4UA6A 2QZ6A 3IXBA 3ZHHA 5GHZA 4PM6A 5J8XA 3P7NA 1ES4A 5AQAA 3N6IA 4ARZA 4WMCD 3T4QA 4GCZA 2B18A 1IYOA 1OTDA 3EGDC 4OONA 1G68A 3DTEA 4O7DA 3IF6A 2Y2OA 2IWCA 3ZDJA 1YLJA 3F1NA 1S1ZA 2XD1A 2V1AA 2DRWA 4I3IA 5K5BA 3MJQA 4LV3A 2XH9A 3PBQA 5HZHA 1MBLA 3SH8A 2FFYA 4X69A 2J80A 3IF6B 4OVDA 1XP4A 3UDFA 2JE5A 3F1NB 3ISGA 5CEBA 3UO9A 3T1QB 2ZLYA 3FC7A 1E25A 3IHAA 1T1AA 1CK3A 1KE0A 4QWOA 3KX0X 1L2SA 2JCHA 5GLBA 3RTYA 3T1RA 1K4FA 3IXHA 3PAGA 1W5DA 2Y79A 2HZ5A 2ZQDA 1CI8A 3O87A 4DDYA 2OSUA 3S1YA 3BFGA 3IT9A 4Z1WA 4KZ5A 4LV2A 1G6AA 4Y15A 4G3KA 3LI9A 4FH4A 3DAVA 4JGQA 4HIAA 2J9PA 4BENA 4ETZA 2XGNA 5EE8A 3BLSA 1ESIA 2RL3A 4X55A 5FDSA 4MNRA 3MZDA 4K08A 1OT6A 1TD5A 5E2HA 4LFUA 5DFXA 4WLAA 4E3JA 4FOFA 3GV9A 3Q7VA 1BULA 1T1CA 3JVVA 4N9LA 3NHQA 4GB7A 1PW1A 4XUXA 5KSCA 1WE4A 1X0OA 2NUPC 2XDMA 3VP1A 4UQIM 4QU3A 3UMDA 4OQHA 5FI7A 5TR7A 1FCNA 5E2EA 2HDSA 4KZ7A 2HV1A 1S6RA 2V2FF 2HP5A 1YSQA 4XT2B 3BM6A 3PBNA 3Q7VB 1MC0A 2A24A 3BLMA 3CAXA 3EOIA 4I38A 3M2JA 3FV7A 3LEQA 3D3OA 3LR4A 3NY4A 5CHJA 3GQZA 2WKPA 3R7WB 1ALQA 5EFWA 3CHWP 3SOIA 3UE6A 2P04A 3Q82A 3K3DA 5JYPA 1A0KA 5U47A 4FCFA 2FZ0A 5HPFA 3SS4A 3PXPA 2DCFA 1OMEA 4E6XA 3CPTA 4KZ9A 5EUAA 3S7PA 1K55C 3A3EA 3IH9A 4RX2A 4R70A 1P0ZA 2Y8HA 1EI5A 4LENA 1L3LA 2V0WA 2O0YA 2OLVA 2GDNA 4LV1A 4KZ8A 5DF7A 5F68A 3A0RA 3A3IA 3LYXA 4NXFA 3S7OA 2WGVA 2WKIA 1XFNA 2H0TA 4RX3A 4ZBEA 1K4EA 4RQ9A 2DMWA 1XJ3A 3K3CA 4OOYA 1ZHHB 1HD8A 3WWXA 4HY8A 1YLZA 1K57A 2D02A 2V0UA 2WKQA 3IF5A 2WKEA 1I5QA 2P7JA 5AQ9A 1GSWA 3HJIA 3HUMA 3W4OA 2VGJA 4CPKA 2XSSA 3CUEA 4EQIA 2ZQ7A 3B47A 4OP8A 2WADA 1KDWA 5L8MA 1I2SA 1XPBA 1BLCA 2W3FA 3G31A 2OLUA 1BYWA 2WKHA 2X71A 4S2JA 4S2NC 1YAXA 2WZZA 1TS7A 1YMXA 1FR6A 4QD4A 2ZC4B 4E6WA 3LIEA 3C38A 4WMCA 5F5YA 5DTSA 2C5WB 2PU2A 2VV8A 3EGXC 2H0YA 3QHYA 3ZNTA 5HWTA 1LL5A 1YQSA 4ZJ1A 2GJ3A 1ZKJA 4N1HA 4DXCA 5HWVA 4KZ4A 3D9YA 4HJ3A 4O0PA 1PFLA 3I7JA 1T1BA 1MPLA 4X56A 3R4KA 3CG5A 3M6BA 3PBSA 4S2OA 4ZDXA 4MN6A 1L0GA 1VM1A 1GA0A 4QY5A 2QKPA 4K0XA 4PPRA 3WRTA 4XUZA 3PBRA 3GRJA 3MQ0A 1IFQA 2HF6A 1DP9A 5A93A 4R3AA 2EX9A 3TOIA 2JN7A 3BFFA 4RA7A 2HPBA 2CMNA 4QY6A 1CF0A 4WZ4A 1OT9A 2E8IA 4L0LA 2EX6A 1WYBA 1IYPA 2HDQA 5HW3A 4G3VA 4JF6A 2HDUA 4R38A 4ZRRA 5EV0A 4HH2A 3SZTA 3A3JA 3T12B 5C5KA 4MLLA 2BLSA 5G18A 2PT7A 5A8BA 2ZM8A 2G2WA 1P9RA 4JXGA 1U60A 2Q9NA 5EVIB 4NK3A 2JKGA 1E3UD 1K6SA 4JF4A 3LY3A 1MWSA 3KYZA 3GSGA 4WEJA 1DRMA 4OQGA 5HAIA 4WZ5C 1JNUA 1N9LA 2HJEA 3AGEA 5DF8A 3KYEA 4PM5A 3IWQA 1J9MA 3BFDA 3RXXA 4DJ3A 3U2AA 5DJTA 3G34A 4MBKA 3A0SA 4S2KA 1FSWA 2MJ6A 3PBOA 2PR6A 2B5RA 4JLFA 1H3QA 1PWGA 3OLOA 4Y0OA 4MBHA 3E4PA 4UA9A 2XRNA 3ZQ5A 3V5MA 3F1OA 1AXBA 3HREA 1J3WA 3IS2A 3V39A 3VMAA 3QP4A 4OKPA 2Y2LA 3T4JA 4UAAA 2K31A 2R9WA 3N7WA 1NJ4A 1ACFA 1PZOA 2ZMFA 3UE1A 4OPYA 2WZXA 1SDEA 2WKRA 3OPRA 3F1OB 3HVFA 5FEFA 3IS2B 2Y59A 3MFXA 5I94A 2O99A 4P6ZS 2VK3A 3VP2A 1SKFA 4NKPA 2R9XA 2XFTA 1XFQA 3C5AA 3E98A 3EWKA 4DE0A 3RJUA 5HWWA 1ZG4A 3ITAA 1O07A 4NEED 5D3OA 3T4OA 4Z9QA 1L0FA 1KDSA 2OAQ1 3W4QA 3UB9A 4PM9A 3NECA 1CEFA 1S1YA 1STZA 3GTCA 4DE3A 3WRZA 5AVFA 1VHMA 1XGIA 4PHTA 4JPMA 4S2MA 2JHEA 1YSPA 2EX2A 3QP8A 1MY8A 3MKFA 4LGWA 3VOZA 4E3MA 3AGFA 3E4OA 3DWKA 4M3KA 2QHKA 3N8SA 5HAPA 5HSQA 4DKIA 1IELA 3C4OA 1TEMA 1W63Q 3QNBA 2Y2GA 3RFBA 3FKWA 1ONGA 1PI4A 3E0YA 5MC7A 4KG2A 3S22A 3OZHA 3P01A 1FSYA 5CTMA 3IBJA 1JTDA 2HP6A 1RP5A 3MF0A 3IX8A 5EVIC 1K0KA 1P9WA 5JYOA 5AQ7A 3MQOA 4JGPA 3VP3A 1TS0A 4RYEA 1SZVA 2ZJ9A 5FAQA 1XKZA 2GNXA 2OAP1 4Q0IA 1IYQA 5EOOA 1XJ6A 4MN5A 1MZUA 4QHCA 1K54C 4ARZB 4B88A 3SH7A 4C6YA 4LRZE 3WS4A 4KQRA 5HDCA 3O86A 2I9VA 1NLZA 2A3UA 4Y0TA 5HL6A 3IXGA 3LIFA 3GECA 4EXOA 2LB9A 1TDGA 3BQ8A 3KSFA 2EXBA 3NIAA 3HLGA 5HPIA 4WYYA 2V8CA 2HGVA 3O88A 3BW6A 4LCLA 4B4XA 2JKRI 2XLNA 5M1AA 1SCWA 1G28A 2ZMVA 1VQQA 1DP6A 4U3TA 5M19A 1TF1A 3SH9A 2QYBA 3W8KA 4JXWA 1PYYA 3PR6A 2QJ5A 1JWZA 3BYDA 2PBYA 2IWDA 3W2ZA 4I3AA 1IOUA 5KIZA 1K56A 3UE0A 1XJ2A 3BRMA 2Y55A 5EVID 4HBUA 3PHYA 5GLDA 3ZFZA 5AJGA 3T1SA 1NWZA 3ZG8B 3N4IA 3L9KA 4BBVA 4D2OA 1D7EA 1GSXA 5CX7A 3MXQA 3UB8A 4EERA 1TVFA 4K91A 1ONHA 4O8GA 1CEGA 3GMWA 4PM8A 4E3KA 3LIAA 4EBNA 4E3LA 3RXWA 3SW1A 4Q0HA 1L0EA 3IWIA 1F9IA 3FYZA 4G3WA 4R4RA 1ERMA 1K25A 4IJGA 3TE8A 4C3QA 2XQZA 3C2WA 3OC2A 5IS1A 1DP8A 1N4OA 4GDNA 5DKLA 2M7UA 1BLSA 1ZG6A 4DE1A 4IEDA 1PW8A 1LI9A 4EETB 4HHDA 4KZAA 3IWOA 3ZGAB 3E2KA 5TFQA 2ZD8A 4MBFA 3KSHA 3VSKA 4OQIA 2CC1A 1MWTA 1ZC2A 2A24B 2OV5A 4F94A 5HFOA 1NRJA 3MXRA 5G4YA 1GHMA 3HCYA 5E43A 3UPNA 5F83A 1IYSA 1JWVA 1RGYA 3H7WA 5FQIA 3G4PA 4IBXA 3HLWA 4GD8A 3G35A 4EU0A 4EBLA 1SHVA 3BJNA 3BFCA 5E2GA 4HQAA 4R3JA 4B93A 2QPNA 1GHIA 4WF0A 4FSFA 5DJUA 3BQAA 1W79A 4CLCA 3ZG9B 1PIOA 3CPTB 3IF6C 3NOUC 4BD0A 1HTZA 3H7WB 2JKRM 3CZDA 4ME4A 3T4KA 2VLGA 3D72A 4YINA 3MKEA 1MKMA 1YLPA 1K38A 1WYCA 5TBMA 3WS0A 3NBLA 3HL9A 5FDHA 4GHIA 3U4LP 4CLCB 4ZTKA 3OPLA 3ZNYA 1YT4A 2VX8A 3G6OA 1QMEA 5DFYA 3MS6A 1VEUA 5I5LA 1NRFA 2W27A 4KUKA 3HLDA 4X1LA 1OPXA 3PTEA 4FH2A 5HD5A 4JF5A 3NOTC 1PZPA 1LL8A 4GHIB 3BEBA 4X68A 5DVAA 2M7VA 1HZOA 1KE4A 4EWFA 4Q8IA 3Q7ZA 1VEUB 1KE3A 1Q2QA 1Y28A 3CLOA 4BL2A 4N92A 3W4PA 4F3LA 3G30A 2P74A 5EVEA 1PRQA 4K0WA 4FD8A 2EXAA 5FAPA 4EV4A 1ERQA 2VA0A 1H8YA 2G7UA 3HLCA 5KMWA 1XGJA 3IX3A 5F1FA 4P6BA 3MXSA 2JC7A 2R78A 2BASA 4LLOB 1M6KA 3DTMA 3NC8A 4EESA 5FAOA 2Y2KA 2BTFP 4F3LB 4JGOA 1DJBA 3ICYA 1UGUA 2ZC6B 2H28A 2B95A 1ODVA 2Y2PA 2V20A 3N8LA 3T50A 2XA7S 2Y2NA 3V67A 3VV4A 3ZG5A 4WELA 3KSGA 3ZVTA 3VSLA 2KLIA 3IX4A 4BL3A 4ID4A 3NCKA 5HDDA 1F98A 1N9BA 3HBRA 3TG9A 3PAEA 2A49A 1TDLA 3A0VA 4KQDA 4MN7A 2Y2IA 3UPPA 5CEDA 4MMNA 4M4XA 5CERA 2V1ZA 2IWBA 3Q07A 2GX5A 1HVBA 2KX6A 3EEHA 1W8QA 4LRYC 2EWVA 4C75A 3QP5A 1BTLA 4Y17A 2Y2QA 3ZG0A 2K2NA 4E3OA 2XR0A 1VETA 3MMHA 2H5SA 4DMZA 5FA7A 5DTTA 1W63M 3O5YA 4DJ2A 1VB6A 2OWJA 5A91A 1LL9A 3LUQA 1LSXA 3VP4A 1FOFA 3F1PA 4LPZA 1ES3A 1VETB 3Q1FA 4NETA 1BSGA 3CI6A 3LY4A 3GDIA 2XROA 2PU4A 1Q2PA 3FPVA 1K57C 4IVIA 4KQQA 1YPRA 4O01A 1GSVA 2ZM0A 3GVBA 1D06A 1PNEA 2PHYA 1LLBA 1M40A 3H82A 3OOVA 5GLAA 4KZ3A 4OPZA 3QP6A 3CUEC 1DJAA 2OOLA 3UMEA 3QP2A 1BT5A 2M1CA 2VGLS 4XXRA 2Z2LB 2W3GA 5EM0A 5F69A 4OLDA 4P85A 5HARA 2D01A 2XD5A 4HP4A 1TS8A 2VJWA 3S4XA 4JXVA 5IT5A 4HJ4A 1ES2A 3FKVA 4B4ZA 4BQMA 2EWWA 3HUNA 3NDEA 5HX9A 5DF9A 4OOMA 2W3DA 4BLMA 2EFUA 3VE4A 4P6ZM 3D4FA 5EVLA 4BD1A 4L9FA 2XK1A 5FQQA 5EPHA 4NXBA 3H9WA 1S0WA 1UWPX 3UB5P 2INWA 3IXDA 4WL9A 5CHUA 3VP0A 2Y2MA 4L9GA 4NXGA 3NOPC 1S66L 2I72A 2VV7A 1N9NA 2ZOHA 2J8YA 5GHYA 1OTEA 1YLYA 1OTBA 5IHVA 2ZL1A 1BZAA 1XJ4A 3A3FA 1FIKA 4PM7A 4NXEA 2VGKA 5DKKA 2Y2HA 1W8YA 3SS5A 2ZQ9A 4EW7A 2Q0OA 2Z2MB 4Y0UA 4JBFA 4Y7PA 3NULA 5HAQA 3C4PA 3NDGA 5CXWA 3ITBA 4R0QA 2HDRA 4FTXA 2Z6CA 4II7A 2J9OA 2ZL1B 1NLYA 3DTKA 3LI8A 5FL3A 1PWDA 5L09A 1H0MA 2ZM2A 2PD7A 4GDBA 4E3NA 2WAEA 4HBTA 1V9ZA 2V8FA 5FI6A 3C8CA 1K55A 1H8MA 2PR5A 4YFMA 4H6JA 3G32A 4R6LA 4MDZA 4MEZA 1ES5A 2ZC3B 3VFFA 4PKYA 1KOUA 1Z09A 1I2WA 3C7VA 3E4QA 3G2ZA 1KGFA 2H10A 1PI5A 2ACGA 4OPRA 4UEYA 1CJFA 4H6JB 1FR1A 2PYRA 3HLBA 2J7VA 1PWCA 4R3BA 5EM1A 1TS6A 1L0DA 4YOFA 3K2NA 1G5UA 5CHMA 2JBFA 4FUWA 5L10A 4EUZA 5A92A 1RCJA 3IHBA 3WS1A 4R23A 4ZJ2A 1YKDA 2W3HA 4GNUA 5CRFA 2HJ9C 3HLEA 5J7EA 4YWZA 4WEKA 1LSVA 3HJKA 2O9BA 3MFDA 4S2NA 4CQHA 4X25A 3LR5A 4I39A 3LICA 4WBGA 4H8RA 1GHPA 2V9AA 1CQAA 2K7SA 3BY8A 3OBFA 5FQ9A 2Q9MA 1F2KA 2PRFA 4EBPA 1W7FA 2FH5A 1E3UA 3T4LA 2UV0E 2VKSA 3P98A 1UWNX 2PBDP 4I3JA 3QP1A 2EA9A 3ZCZA 5FQMA 1KVLA 5BOHA 4DXBA 4EUVA 4HH3A 4U0TA 2RCXA 3LO7A 3DTIA 3MBZA 3B3XA 4MCWA 3P09A 5FATA 4E04A 4IUKA 5F82A 5FEGA 3IH8A 3AGDA 5KSHA
chains in the Genus database with same CATH topology
4HESA 4GOGA 1O7EA 4N9KA 5DVAA 3PBOA 1HZOA 5CGSA 2UWXA 2ZC7A 3OCLA 1KE4A 4EWFA 4Q8IA 3Q7ZA 1KE3A 1NYMA 1Q2QA 2B5RA 2WUQA 3A3DA 3BECA 5M18A 4JLFA 4BL2A 4DF6A 1PWGA 2QZ6A 4N92A 3IXBA 4IVKA 4JKTA 1E4DA 4UA6A 4PM6A 4Y0OA 5GHZA 1ES4A 3ZHHA 5J8XA 3W4PA 4MBHA 5AQAA 3G30A 3N6IA 2P74A 4WMCD 4R1GA 2DNSA 4UA9A 5EOEA 4K0WA 4FD8A 5CTNA 3V5MA 1AXBA 2EXAA 3HREA 5FAPA 1IYOA 4EV4A 1JVJA 4OONA 1ERQA 1G68A 3V39A 3VMAA 1XX2A 4O7DA 3UY6A 1H8YA 2EX8A 4OKPA 2Y2LA 3IF6A 5FQJA 4UAAA 2Y2OA 3HLCA 2IWCA 2Y4AA 3ZDJA 2R9WA 1YLJA 3N7WA 1NJ4A 1XGJA 5F1FA 5KMWA 4P6BA 3MXSA 2JC7A 2ZC5B 5FSRA 1PZOA 3UE1A 1M6KA 2EFXA 2XD1A 4OPYA 3ZVWA 3DTMA 3NC8A 5FAOA 2WZXA 1SDEA 1DY6A 2Y2KA 4KG6A 3JYIA 2DRWA 1DJBA 2ZC6B 3OPRA 5DTKA 4LV3A 2XH9A 3PBQA 5TGFA 1QMFA 3HVFA 1JWPA 5I94A 1MBLA 2Y59A 1H8ZA 2WGIA 3SH8A 2FFYA 3VP2A 4X69A 1SKFA 2R9XA 2Y2PA 2V20A 3IF6B 3N8LA 2XFTA 4OVDA 1XP4A 3UDFA 2JE5A 2Y2NA 3ISGA 3ZG5A 4WELA 3C5AA 3IQAA 3ZVTA 5CEBA 4S2IA 3UO9A 3VSLA 1NXYA 2ZLYA 3IHAA 1E25A 4IBRA 4WZ5A 1CK3A 4DE0A 3LEZA 4ID4A 4ZAMA 3NCKA 3RJUA 1ZG4A 4BL3A 1N9BA 1KE0A 1Y54A 3HBRA 3ITAA 1JTGA 3TG9A 1FCMA 1L2SA 1O07A 3PAEA 2A49A 1TDLA 4KG5A 5D3OA 2JCHA 3BFEA 4Z9QA 1L0FA 5GLBA 1KDSA 1K4FA 3IXHA 1DJCA 3PAGA 1W5DA 3W4QA 2ZQDA 1CI8A 2Y2IA 3O87A 4DDYA 2OSUA 4PM9A 3UPPA 5CEDA 1CEFA 3S1YA 3V50A 5CERA 3BFGA 2WAFA 3GTCA 3IT9A 4KZ5A 1KGGA 4LV2A 4P87A 1NY0A 4DE3A 1G6AA 2V1ZA 3WRZA 4JXSA 1EROA 4R4SA 2IWBA 3Q07A 1HVBA 3UNWA 1CI9A 1XGIA 4OPQA 4FH4A 1W8QA 4JPMA 4S2MA 1YM1A 2EX2A 4C75A 1BTLA 2J9PA 4BENA 4OH0A 1MY8A 1BLHA 3MKFA 2Y2QA 4RVAA 3VOZA 3ZG0A 4E3MA 4E3OA 2XGNA 3AGFA 2XR0A 5EE8A 3BLSA 4KENB 3DWKA 4M3KA 1ESIA 2H5SA 1IKIA 2RL3A 2G2UA 3N8SA 5HAPA 4DKIA 5FA7A 4GZBA 5DTTA 4X55A 1IELA 3C4OA 3MZDA 1TEMA 3QNBA 3C7UA 4MNRA 5E2HA 2Y2GA 3FKWA 1ONGA 1IKGA 1PI4A 1LL9A 5A91A 4X53A 4ZJ3A 4KG2A 3S22A 4BJPA 4E3JA 5KZHA 3OZHA 3GV9A 3Q7VA 3VP4A 1BULA 1FSYA 5CTMA 1FOFA 1JTDA 2HP6A 4WM9A 1RP5A 4KQOA 4N9LA 1ES3A 5EVIC 1FCOA 4GB7A 3Q1FA 1PW1A 4NETA 1BSGA 1IEMA 5AQ7A 5JYOA 4XUXA 3LY4A 3VP3A 5KSCA 1WE4A 2XDMA 3VP1A 2PU4A 3V3RA 4QU3A 4RYEA 1Q2PA 4OQHA 5FI7A 5TR7A 1FCNA 1K57C 2HDSA 5E2EA 3OCNA 4IVIA 4KQQA 4KZ7A 2ZJ9A 2ZM0A 4OQ0A 1S6RA 1XKZA 5FAQA 3GVBA 2V2FF 2HP5A 3N8RA 4P0MA 1IYQA 3BM6A 3PBNA 3Q7VB 1LLBA 1M40A 5EOOA 3UE3A 4QJGA 2XF3A 5GLAA 3BLMA 3M2JA 4KZ3A 3FV7A 4OPZA 5FASA 3NY4A 5CHJA 1SDNA 3GQZA 3GR2A 4QHCA 1ALQA 1DJAA 1K54C 4B88A 1BT5A 3SOIA 3M6HA 3SH7A 4C6YA 3Q82A 3WS4A 4KQRA 4XXRA 2Z2LB 3O86A 5JYPA 4KZBA 1NYYA 2A3UA 5U47A 4FCFA 4OLDA 4P85A 5HARA 3SS4A 4CJNA 4Y0TA 3Q81A 2XD5A 2DCFA 1XXMA 4OOLA 3CMZA 3IXGA 3S4XA 3OPHA 4JXVA 1MXOA 1OMEA 1TDGA 5AQBA 1ES2A 4E6XA 3FKVA 2EXBA 3NIAA 3HLGA 4B4ZA 4WYYA 4KZ9A 5EUAA 4BQMA 1K55C 3HUNA 3NDEA 3O88A 1XA1A 5HX9A 3A3EA 3IH9A 5DF9A 2ZQAA 4LCLA 4GKUA 4OOMA 4BLMA 2EFUA 4RX2A 4B4XA 3D4FA 3G2YA 5EVLA 1EI5A 4LENA 4BD1A 2XLNA 2XK1A 5FQQA 2OLVA 5M1AA 4DE2A 5EPHA 3NI9A 1SCWA 2GDNA 1S0WA 4LV1A 4KZ8A 5DF7A 3IXDA 5CHUA 1VQQA 3A3IA 3VP0A 2Y2MA 4U3TA 5M19A 3SH9A 3W8KA 2WGVA 2WKIA 4GD6A 4JXWA 2I72A 1PYYA 2H0TA 3ZG7B 3UN7A 4RX3A 1JWZA 3BYDA 2PBYA 5EVIA 4ZBEA 2J8YA 1K4EA 2IWDA 5GHYA 1YLYA 2FFFB 5HL1A 4QB8A 1GCEA 3E2LA 3WS2A 4OLGA 4OOYA 5IHVA 5F1GA 1K56A 1BZAA 3A3FA 3UE0A 1HD8A 3HUOA 3BRMA 2Y55A 5EVID 4PM7A 3WWXA 1YLZA 1K57A 2VGKA 2WK0A 4HBUA 5GLDA 3IF5A 3ZFZA 2Y2HA 5CGXA 1K56D 1W8YA 1I5QA 2WKEA 4U0XA 2ZQ9A 4UA7A 3SS5A 5AQ9A 2Z2MB 4Y0UA 4JBFA 4Y7PA 3N4IA 3ZG8B 5HAQA 3C4PA 4X6TA 4D2OA 3NDGA 3HUMA 2X01A 1YLWA 2XEPA 3W4OA 5CXWA 5CECA 2VGJA 2WYXA 1H5XA 1BLPA 3DWZA 3ITBA 4R0QA 5GL9A 2HDRA 1Z6FA 4CPKA 1MWRA 1K54A 2J9OA 3HLFA 4EQIA 2ZQ7A 3UDIA 1TVFA 4OP8A 2WADA 1ONHA 4K91A 1KDWA 3O3VA 1PWDA 1I2SA 1XPBA 1BLCA 3G31A 1CEGA 2OLUA 3FWLA 2P9VA 2ZM2A 3GMWA 4PM8A 2WKHA 4E3KA 1MWUA 2C6WB 4GDBA 2X71A 4EBNA 4E3LA 4S2JA 4S2NC 3RXWA 4E3NA 2WAEA 1L0EA 4HBTA 3IWIA 1KVMA 2WZZA 3CJMA 3FYZA 1YMXA 5FI6A 4A5RA 1FR6A 4QD4A 4R4RA 1ERMA 1K25A 2ZC4B 1K55A 1YMSA 4YFMA 3UDXA 2HP9A 4E6WA 4C3QA 3G32A 2XQZA 5L2FA 3OC2A 2ZQCA 4WMCA 4MEZA 1ES5A 2C5WB 1RGZA 5DTSA 3WS5A 2PU2A 1N4OA 2ZC3B 3VFFA 4GDNA 2H0YA 3QHYA 3ZNTA 2P9VB 1C3BA 1BLSA 5FI2A 3TSGA 1MKIA 1ZG6A 1KGEA 4DE1A 1I2WA 3C7VA 4IEDA 1PW8A 1LI9A 3G2ZA 1KGFA 1LL5A 1YQSA 1PI5A 2H10A 1ZKJA 4N1HA 4ZJ1A 4DXCA 4OPRA 4KZ4A 4KZAA 3IWOA 1NZUA 3ZGAB 2Y91A 3E2KA 5TFQA 1FR1A 2ZD8A 4MBFA 3HLBA 3I7JA 3QNCA 3VSKA 4OQIA 2J7VA 1MPLA 1PWCA 2CC1A 4R3BA 4X56A 5EECA 1MWTA 4S2PA 1ZC2A 3EQUA 3CG5A 3M6BA 4E3IA 3PBSA 2OV5A 1L0DA 4KZ6A 4S2OA 3UPOA 4ZDXA 4F94A 3PBTA 1L0GA 1LI0A 5HFOA 1ESUA 4PMAA 1VM1A 4OP5A 1GA0A 1FQGA 3MXRA 4QY5A 1GHMA 2QMIA 4K0XA 3MZEA 5E43A 3UPNA 4PPRA 5CGWA 5CHMA 2JBFA 4XUZA 1IYSA 1JWVA 3GRJA 3PBRA 1RGYA 5F83A 3VFHA 4DDSA 5FQIA 4EUZA 5A92A 3G4PA 5A93A 4IBXA 1RCJA 3HLWA 4GD8A 3IHBA 3G35A 2XFSA 1YLTA 2EX9A 4EBLA 3MZFA 1SHVA 3TOIA 3WS1A 3BFCA 4R23A 5E2GA 3BFFA 4R3JA 4RA7A 4ZJ2A 2QPNA 4GNUA 1GHIA 5CRFA 4FSFA 2HPBA 3HLEA 4QY6A 1W79A 2BG1A 3ZG9B 5GHXA 4WZ4A 1PIOA 4WEKA 2E8IA 2ZQ8A 1LHYA 4LV0A 3WRTA 4L0LA 2EX6A 3MFDA 3IF6C 3OPPA 4S2NA 5A90A 1WYBA 1IYPA 4BD0A 1HTZA 2HDQA 4GN2A 5HW3A 1K6RA 4S2LA 3CZDA 4JF6A 2HDUA 4HEFA 4WBGA 4H8RA 1GHPA 3A3JA 3LCEA 4YINA 3MKEA 1YLPA 5FQ9A 2Q9MA 1K38A 4MLLA 2BLSA 5G18A 1WYCA 2X02A 1EWZA 4EBPA 3WS0A 2ZM8A 3V3SA 2G2WA 1W7FA 2Y2JA 3NBLA 3HL9A 1E3UA 5FDHA 4JXGA 1GA9A 2WGWA 1BUEA 1U60A 2Q9NA 5GLCA 2ZMAA 3P98A 5EVIB 4ZTKA 3OPLA 3SS3A 4NK3A 1YT4A 3ZNYA 3FZCA 5E2FA 3ZCZA 1QMEA 1KVLA 1E3UD 1K6SA 1XA7A 4JF4A 3LY3A 5FQMA 5BOHA 1MWSA 4DRTA 4DXBA 4N1XA 4U0TA 1NRFA 3GSGA 5FQKA 3EQVA 2RCXA 1NZOA 4WEJA 3HLDA 3M2KA 4OQGA 5HAIA 3LO7A 3MBZA 4WZ5C 3B3XA 3PTEA 3VOYA 3AGEA 4FH2A 3DW0A 5DF8A 4JF5A 3IWQA 3P09A 1J9MA 3BFDA 5FATA 3RXXA 5F82A 4PM5A 1PZPA 3IH8A 3AGDA 3G34A 4MBKA 2WGWB 3BEBA 4S2KA 4LCMA 4X68A 5KSHA 4UHUA 1FSWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HES A;  4GOG A;  1O7E A;  4N9K A;  5DVA A;  3PBO A;  1HZO A;  5CGS A;  2UWX A;  2ZC7 A;  3OCL A;  1KE4 A;  4EWF A;  4Q8I A;  3Q7Z A;  1KE3 A;  1NYM A;  1Q2Q A;  2B5R A;  2WUQ A;  3A3D A;  3BEC A;  5M18 A;  4JLF A;  4BL2 A;  4DF6 A;  1PWG A;  2QZ6 A;  4N92 A;  3IXB A;  4IVK A;  4JKT A;  1E4D A;  4UA6 A;  4PM6 A;  4Y0O A;  5GHZ A;  1ES4 A;  3ZHH A;  5J8X A;  3W4P A;  4MBH A;  5AQA A;  3G30 A;  3N6I A;  2P74 A;  4WMC D;  4R1G A;  2DNS A;  4UA9 A;  5EOE A;  4K0W A;  4FD8 A;  5CTN A;  3V5M A;  1AXB A;  2EXA A;  3HRE A;  5FAP A;  1IYO A;  4EV4 A;  1JVJ A;  4OON A;  1ERQ A;  1G68 A;  3V39 A;  3VMA A;  1XX2 A;  4O7D A;  3UY6 A;  1H8Y A;  2EX8 A;  4OKP A;  2Y2L A;  3IF6 A;  5FQJ A;  4UAA A;  2Y2O A;  3HLC A;  2IWC A;  2Y4A A;  3ZDJ A;  2R9W A;  1YLJ A;  3N7W A;  1NJ4 A;  1XGJ A;  5F1F A;  5KMW A;  4P6B A;  3MXS A;  2JC7 A;  2ZC5 B;  5FSR A;  1PZO A;  3UE1 A;  1M6K A;  2EFX A;  2XD1 A;  4OPY A;  3ZVW A;  3DTM A;  3NC8 A;  5FAO A;  2WZX A;  1SDE A;  1DY6 A;  2Y2K A;  4KG6 A;  3JYI A;  2DRW A;  1DJB A;  2ZC6 B;  3OPR A;  5DTK A;  4LV3 A;  2XH9 A;  3PBQ A;  5TGF A;  1QMF A;  3HVF A;  1JWP A;  5I94 A;  1MBL A;  2Y59 A;  1H8Z A;  2WGI A;  3SH8 A;  2FFY A;  3VP2 A;  4X69 A;  1SKF A;  2R9X A;  2Y2P A;  2V20 A;  3IF6 B;  3N8L A;  2XFT A;  4OVD A;  1XP4 A;  3UDF A;  2JE5 A;  2Y2N A;  3ISG A;  3ZG5 A;  4WEL A;  3C5A A;  3IQA A;  3ZVT A;  5CEB A;  4S2I A;  3UO9 A;  3VSL A;  1NXY A;  2ZLY A;  3IHA A;  1E25 A;  4IBR A;  4WZ5 A;  1CK3 A;  4DE0 A;  3LEZ A;  4ID4 A;  4ZAM A;  3NCK A;  3RJU A;  1ZG4 A;  4BL3 A;  1N9B A;  1KE0 A;  1Y54 A;  3HBR A;  3ITA A;  1JTG A;  3TG9 A;  1FCM A;  1L2S A;  1O07 A;  3PAE A;  2A49 A;  1TDL A;  4KG5 A;  5D3O A;  2JCH A;  3BFE A;  4Z9Q A;  1L0F A;  5GLB A;  1KDS A;  1K4F A;  3IXH A;  1DJC A;  3PAG A;  1W5D A;  3W4Q A;  2ZQD A;  1CI8 A;  2Y2I A;  3O87 A;  4DDY A;  2OSU A;  4PM9 A;  3UPP A;  5CED A;  1CEF A;  3S1Y A;  3V50 A;  5CER A;  3BFG A;  2WAF A;  3GTC A;  3IT9 A;  4KZ5 A;  1KGG A;  4LV2 A;  4P87 A;  1NY0 A;  4DE3 A;  1G6A A;  2V1Z A;  3WRZ A;  4JXS A;  1ERO A;  4R4S A;  2IWB A;  3Q07 A;  1HVB A;  3UNW A;  1CI9 A;  1XGI A;  4OPQ A;  4FH4 A;  1W8Q A;  4JPM A;  4S2M A;  1YM1 A;  2EX2 A;  4C75 A;  1BTL A;  2J9P A;  4BEN A;  4OH0 A;  1MY8 A;  1BLH A;  3MKF A;  2Y2Q A;  4RVA A;  3VOZ A;  3ZG0 A;  4E3M A;  4E3O A;  2XGN A;  3AGF A;  2XR0 A;  5EE8 A;  3BLS A;  4KEN B;  3DWK A;  4M3K A;  1ESI A;  2H5S A;  1IKI A;  2RL3 A;  2G2U A;  3N8S A;  5HAP A;  4DKI A;  5FA7 A;  4GZB A;  5DTT A;  4X55 A;  1IEL A;  3C4O A;  3MZD A;  1TEM A;  3QNB A;  3C7U A;  4MNR A;  5E2H A;  2Y2G A;  3FKW A;  1ONG A;  1IKG A;  1PI4 A;  1LL9 A;  5A91 A;  4X53 A;  4ZJ3 A;  4KG2 A;  3S22 A;  4BJP A;  4E3J A;  5KZH A;  3OZH A;  3GV9 A;  3Q7V A;  3VP4 A;  1BUL A;  1FSY A;  5CTM A;  1FOF A;  1JTD A;  2HP6 A;  4WM9 A;  1RP5 A;  4KQO A;  4N9L A;  1ES3 A;  5EVI C;  1FCO A;  4GB7 A;  3Q1F A;  1PW1 A;  4NET A;  1BSG A;  1IEM A;  5AQ7 A;  5JYO A;  4XUX A;  3LY4 A;  3VP3 A;  5KSC A;  1WE4 A;  2XDM A;  3VP1 A;  2PU4 A;  3V3R A;  4QU3 A;  4RYE A;  1Q2P A;  4OQH A;  5FI7 A;  5TR7 A;  1FCN A;  1K57 C;  2HDS A;  5E2E A;  3OCN A;  4IVI A;  4KQQ A;  4KZ7 A;  2ZJ9 A;  2ZM0 A;  4OQ0 A;  1S6R A;  1XKZ A;  5FAQ A;  3GVB A;  2V2F F;  2HP5 A;  3N8R A;  4P0M A;  1IYQ A;  3BM6 A;  3PBN A;  3Q7V B;  1LLB A;  1M40 A;  5EOO A;  3UE3 A;  4QJG A;  2XF3 A;  5GLA A;  3BLM A;  3M2J A;  4KZ3 A;  3FV7 A;  4OPZ A;  5FAS A;  3NY4 A;  5CHJ A;  1SDN A;  3GQZ A;  3GR2 A;  4QHC A;  1ALQ A;  1DJA A;  1K54 C;  4B88 A;  1BT5 A;  3SOI A;  3M6H A;  3SH7 A;  4C6Y A;  3Q82 A;  3WS4 A;  4KQR A;  4XXR A;  2Z2L B;  3O86 A;  5JYP A;  4KZB A;  1NYY A;  2A3U A;  5U47 A;  4FCF A;  4OLD A;  4P85 A;  5HAR A;  3SS4 A;  4CJN A;  4Y0T A;  3Q81 A;  2XD5 A;  2DCF A;  1XXM A;  4OOL A;  3CMZ A;  3IXG A;  3S4X A;  3OPH A;  4JXV A;  1MXO A;  1OME A;  1TDG A;  5AQB A;  1ES2 A;  4E6X A;  3FKV A;  2EXB A;  3NIA A;  3HLG A;  4B4Z A;  4WYY A;  4KZ9 A;  5EUA A;  4BQM A;  1K55 C;  3HUN A;  3NDE A;  3O88 A;  1XA1 A;  5HX9 A;  3A3E A;  3IH9 A;  5DF9 A;  2ZQA A;  4LCL A;  4GKU A;  4OOM A;  4BLM A;  2EFU A;  4RX2 A;  4B4X A;  3D4F A;  3G2Y A;  5EVL A;  1EI5 A;  4LEN A;  4BD1 A;  2XLN A;  2XK1 A;  5FQQ A;  2OLV A;  5M1A A;  4DE2 A;  5EPH A;  3NI9 A;  1SCW A;  2GDN A;  1S0W A;  4LV1 A;  4KZ8 A;  5DF7 A;  3IXD A;  5CHU A;  1VQQ A;  3A3I A;  3VP0 A;  2Y2M A;  4U3T A;  5M19 A;  3SH9 A;  3W8K A;  2WGV A;  2WKI A;  4GD6 A;  4JXW A;  2I72 A;  1PYY A;  2H0T A;  3ZG7 B;  3UN7 A;  4RX3 A;  1JWZ A;  3BYD A;  2PBY A;  5EVI A;  4ZBE A;  2J8Y A;  1K4E A;  2IWD A;  5GHY A;  1YLY A;  2FFF B;  5HL1 A;  4QB8 A;  1GCE A;  3E2L A;  3WS2 A;  4OLG A;  4OOY A;  5IHV A;  5F1G A;  1K56 A;  1BZA A;  3A3F A;  3UE0 A;  1HD8 A;  3HUO A;  3BRM A;  2Y55 A;  5EVI D;  4PM7 A;  3WWX A;  1YLZ A;  1K57 A;  2VGK A;  2WK0 A;  4HBU A;  5GLD A;  3IF5 A;  3ZFZ A;  2Y2H A;  5CGX A;  1K56 D;  1W8Y A;  1I5Q A;  2WKE A;  4U0X A;  2ZQ9 A;  4UA7 A;  3SS5 A;  5AQ9 A;  2Z2M B;  4Y0U A;  4JBF A;  4Y7P A;  3N4I A;  3ZG8 B;  5HAQ A;  3C4P A;  4X6T A;  4D2O A;  3NDG A;  3HUM A;  2X01 A;  1YLW A;  2XEP A;  3W4O A;  5CXW A;  5CEC A;  2VGJ A;  2WYX A;  1H5X A;  1BLP A;  3DWZ A;  3ITB A;  4R0Q A;  5GL9 A;  2HDR A;  1Z6F A;  4CPK A;  1MWR A;  1K54 A;  2J9O A;  3HLF A;  4EQI A;  2ZQ7 A;  3UDI A;  1TVF A;  4OP8 A;  2WAD A;  1ONH A;  4K91 A;  1KDW A;  3O3V A;  1PWD A;  1I2S A;  1XPB A;  1BLC A;  3G31 A;  1CEG A;  2OLU A;  3FWL A;  2P9V A;  2ZM2 A;  3GMW A;  4PM8 A;  2WKH A;  4E3K A;  1MWU A;  2C6W B;  4GDB A;  2X71 A;  4EBN A;  4E3L A;  4S2J A;  4S2N C;  3RXW A;  4E3N A;  2WAE A;  1L0E A;  4HBT A;  3IWI A;  1KVM A;  2WZZ A;  3CJM A;  3FYZ A;  1YMX A;  5FI6 A;  4A5R A;  1FR6 A;  4QD4 A;  4R4R A;  1ERM A;  1K25 A;  2ZC4 B;  1K55 A;  1YMS A;  4YFM A;  3UDX A;  2HP9 A;  4E6W A;  4C3Q A;  3G32 A;  2XQZ A;  5L2F A;  3OC2 A;  2ZQC A;  4WMC A;  4MEZ A;  1ES5 A;  2C5W B;  1RGZ A;  5DTS A;  3WS5 A;  2PU2 A;  1N4O A;  2ZC3 B;  3VFF A;  4GDN A;  2H0Y A;  3QHY A;  3ZNT A;  2P9V B;  1C3B A;  1BLS A;  5FI2 A;  3TSG A;  1MKI A;  1ZG6 A;  1KGE A;  4DE1 A;  1I2W A;  3C7V A;  4IED A;  1PW8 A;  1LI9 A;  3G2Z A;  1KGF A;  1LL5 A;  1YQS A;  1PI5 A;  2H10 A;  1ZKJ A;  4N1H A;  4ZJ1 A;  4DXC A;  4OPR A;  4KZ4 A;  4KZA A;  3IWO A;  1NZU A;  3ZGA B;  2Y91 A;  3E2K A;  5TFQ A;  1FR1 A;  2ZD8 A;  4MBF A;  3HLB A;  3I7J A;  3QNC A;  3VSK A;  4OQI A;  2J7V A;  1MPL A;  1PWC A;  2CC1 A;  4R3B A;  4X56 A;  5EEC A;  1MWT A;  4S2P A;  1ZC2 A;  3EQU A;  3CG5 A;  3M6B A;  4E3I A;  3PBS A;  2OV5 A;  1L0D A;  4KZ6 A;  4S2O A;  3UPO A;  4ZDX A;  4F94 A;  3PBT A;  1L0G A;  1LI0 A;  5HFO A;  1ESU A;  4PMA A;  1VM1 A;  4OP5 A;  1GA0 A;  1FQG A;  3MXR A;  4QY5 A;  1GHM A;  2QMI A;  4K0X A;  3MZE A;  5E43 A;  3UPN A;  4PPR A;  5CGW A;  5CHM A;  2JBF A;  4XUZ A;  1IYS A;  1JWV A;  3GRJ A;  3PBR A;  1RGY A;  5F83 A;  3VFH A;  4DDS A;  5FQI A;  4EUZ A;  5A92 A;  3G4P A;  5A93 A;  4IBX A;  1RCJ A;  3HLW A;  4GD8 A;  3IHB A;  3G35 A;  2XFS A;  1YLT A;  2EX9 A;  4EBL A;  3MZF A;  1SHV A;  3TOI A;  3WS1 A;  3BFC A;  4R23 A;  5E2G A;  3BFF A;  4R3J A;  4RA7 A;  4ZJ2 A;  2QPN A;  4GNU A;  1GHI A;  5CRF A;  4FSF A;  2HPB A;  3HLE A;  4QY6 A;  1W79 A;  2BG1 A;  3ZG9 B;  5GHX A;  4WZ4 A;  1PIO A;  4WEK A;  2E8I A;  2ZQ8 A;  1LHY A;  4LV0 A;  3WRT A;  4L0L A;  2EX6 A;  3MFD A;  3IF6 C;  3OPP A;  4S2N A;  5A90 A;  1WYB A;  1IYP A;  4BD0 A;  1HTZ A;  2HDQ A;  4GN2 A;  5HW3 A;  1K6R A;  4S2L A;  3CZD A;  4JF6 A;  2HDU A;  4HEF A;  4WBG A;  4H8R A;  1GHP A;  3A3J A;  3LCE A;  4YIN A;  3MKE A;  1YLP A;  5FQ9 A;  2Q9M A;  1K38 A;  4MLL A;  2BLS A;  5G18 A;  1WYC A;  2X02 A;  1EWZ A;  4EBP A;  3WS0 A;  2ZM8 A;  3V3S A;  2G2W A;  1W7F A;  2Y2J A;  3NBL A;  3HL9 A;  1E3U A;  5FDH A;  4JXG A;  1GA9 A;  2WGW A;  1BUE A;  1U60 A;  2Q9N A;  5GLC A;  2ZMA A;  3P98 A;  5EVI B;  4ZTK A;  3OPL A;  3SS3 A;  4NK3 A;  1YT4 A;  3ZNY A;  3FZC A;  5E2F A;  3ZCZ A;  1QME A;  1KVL A;  1E3U D;  1K6S A;  1XA7 A;  4JF4 A;  3LY3 A;  5FQM A;  5BOH A;  1MWS A;  4DRT A;  4DXB A;  4N1X A;  4U0T A;  1NRF A;  3GSG A;  5FQK A;  3EQV A;  2RCX A;  1NZO A;  4WEJ A;  3HLD A;  3M2K A;  4OQG A;  5HAI A;  3LO7 A;  3MBZ A;  4WZ5 C;  3B3X A;  3PTE A;  3VOY A;  3AGE A;  4FH2 A;  3DW0 A;  5DF8 A;  4JF5 A;  3IWQ A;  3P09 A;  1J9M A;  3BFD A;  5FAT A;  3RXX A;  5F82 A;  4PM5 A;  1PZP A;  3IH8 A;  3AGD A;  3G34 A;  4MBK A;  2WGW B;  3BEB A;  4S2K A;  4LCM A;  4X68 A;  5KSH A;  4UHU A;  1FSW A; 
#chains in the Genus database with same CATH topology
 2NUT C;  4GOG A;  4UQI S;  3T4S A;  1O7E A;  4N9K A;  5CGS A;  4XT2 A;  2ZC7 A;  3OCL A;  4HNB A;  4BBU A;  2KDK A;  1D1J A;  2WUQ A;  3BEC A;  1S4R A;  2J3T C;  4JKT A;  4IVK A;  1E4D A;  3R7W A;  4D60 A;  4R1G A;  2DNS A;  5EOE A;  3UB7 A;  5CTN A;  3T4T A;  4Y3I A;  1JVJ A;  5L07 A;  1XX2 A;  3UY6 A;  2EX8 A;  5FQJ A;  2Y4A A;  2ZC5 B;  5FSR A;  2EFX A;  3ZVW A;  3BY9 A;  1DY6 A;  4KG6 A;  1T19 A;  4EEP A;  3T1X A;  1G6O A;  3JYI A;  1OJG A;  5J3W A;  5DTK A;  4B9O A;  2JKT I;  5TGF A;  1QMF A;  1JWP A;  3DBA A;  1H8Z A;  2WGI A;  3KO6 A;  4KUO A;  2W0N A;  3IQA A;  4S2I A;  1NXY A;  4IBR A;  4WUJ A;  4WZ5 A;  3LEZ A;  4ZAM A;  4HI4 A;  1Y54 A;  1JTG A;  1FCM A;  4KG5 A;  3S7Q A;  3BFE A;  3KYQ A;  3BWL A;  2W3E A;  5J4E A;  1DJC A;  4CLC E;  3V50 A;  2YKF A;  2WAF A;  4PKY G;  4NG2 A;  5AVE A;  1KGG A;  4P87 A;  1NY0 A;  2ZOI A;  4JXS A;  1ERO A;  4R4S A;  3UNW A;  1CI9 A;  4OPQ A;  1YM1 A;  2J3T D;  3TW8 A;  4OH0 A;  1BLH A;  4RVA A;  1S4S A;  2W1T A;  3LR0 A;  4KEN B;  2Z6D A;  1IKI A;  2G2U A;  5TBM B;  3C30 A;  4GZB A;  4DN0 A;  3L7H A;  4YNR A;  3C7U A;  2P08 A;  1IKG A;  4X53 A;  4L9E A;  4ZJ3 A;  4BJP A;  5KZH A;  1LT0 A;  4WM9 A;  4KQO A;  2IA2 A;  2W1T B;  3UB6 A;  2PYP A;  1FCO A;  1IEM A;  3LID A;  2O9A A;  3V3R A;  5IU1 A;  3OCN A;  3ULF A;  4OQ0 A;  4GJ4 A;  3N8R A;  4P0M A;  4AFI A;  3KSI A;  4EEU A;  2W1R A;  4Q0J A;  3UE3 A;  4QJG A;  2XF3 A;  5FAS A;  1EW0 A;  1SDN A;  3GR2 A;  1LSW A;  3M6H A;  2B02 A;  5LBR A;  2L1M A;  4KZB A;  1NYY A;  3LIB A;  4CJN A;  3Q81 A;  1XXM A;  2QJ7 A;  4OOL A;  3CMZ A;  3OPH A;  1MXO A;  5AQB A;  2OWH A;  1T18 A;  3NJA A;  1XA1 A;  2ZQA A;  4GKU A;  1V9Y A;  4Y13 A;  3EEA A;  3G2Y A;  3VOL A;  4DE2 A;  3NI9 A;  2JKT M;  2XA7 M;  1N9O A;  2A2L A;  2E8J A;  2QWS A;  4HJ6 A;  5HDS A;  4GD6 A;  4JGR A;  2PDR A;  2VZW A;  3UN7 A;  3ZG7 B;  2LB5 A;  5EVI A;  4ETX A;  5HL1 A;  2FFF B;  4QB8 A;  1ZTU A;  1GCE A;  3E2L A;  3WS2 A;  4OLG A;  5HD3 A;  5F1G A;  1FIL A;  1HLU P;  3HUO A;  4EQ1 A;  2WK0 A;  5CGX A;  1K56 D;  4U0X A;  4UA7 A;  3MQQ A;  2ZBB A;  4X6T A;  3ZYT A;  2X01 A;  1YLW A;  2XEP A;  5CEC A;  2WYX A;  1BLP A;  1H5X A;  3DWZ A;  5GL9 A;  1Z6F A;  2PAV P;  1MWR A;  1K54 A;  3HLF A;  3UDI A;  1OTI A;  4HOI A;  3O3V A;  3FWL A;  4CLC C;  2P9V A;  1S67 L;  1MWU A;  2C6W B;  4X1M A;  1F5M A;  4I5S A;  1KVM A;  3CJM A;  4A5R A;  2YKH A;  1YMS A;  3UDX A;  2VEA A;  2HP9 A;  3LR3 A;  3S7N A;  5L2F A;  3VE3 A;  2ZQC A;  1RGZ A;  2JKF A;  3IBR A;  3WS5 A;  3JVU A;  2O9C A;  2P9V B;  1OTA A;  3F1P B;  1C3B A;  4Y2F A;  5FI2 A;  3TSG A;  1MKI A;  1KGE A;  4GLQ A;  3LGO A;  1AWI A;  1Y4O A;  4IHQ A;  1NZU A;  2Y91 A;  3QNC A;  5EEC A;  3TJZ C;  2AVX A;  4Y5F A;  4HP9 A;  4S2P A;  3EQU A;  2J3W A;  3H82 B;  4E3I A;  4KZ6 A;  3UPO A;  3PBT A;  1LI0 A;  1ESU A;  4PMA A;  4OP5 A;  1FQG A;  2V1B A;  2VGL M;  2QMI A;  3CWF A;  3MZE A;  5CGW A;  3VFH A;  4QPR A;  4DDS A;  2GZA A;  4WN5 A;  2XFS A;  1YLT A;  3MZF A;  3CIT A;  3MR0 A;  3B42 A;  1OJ5 A;  5F6A A;  2L4R A;  2BG1 A;  5GHX A;  2ZQ8 A;  1LHY A;  4LV0 A;  5A90 A;  3OPP A;  2PD8 A;  4GN2 A;  2VV6 A;  4CLC D;  1K6R A;  4S2L A;  3MSH A;  4HEF A;  3LCE A;  2X02 A;  3FPW A;  1EWZ A;  3V3S A;  2Y2J A;  4BWI A;  5TJJ A;  4BMW A;  4IUH A;  4GW9 A;  1GA9 A;  1P97 A;  2WGW A;  1BUE A;  2KOI A;  5GLC A;  2ZMA A;  3SS3 A;  3FZC A;  2L0W A;  5E2F A;  1SKO A;  1XA7 A;  5G4Z A;  4DRT A;  4N1X A;  4ESP A;  3RH8 B;  5FQK A;  4GS9 A;  3EQV A;  1NZO A;  3M2K A;  4BBT A;  3VOY A;  3TRC A;  3DW0 A;  2WGW B;  4LCM A;  3B33 A;  4PAU A;  4UHU A;  3PYP A;  4HES A;  4LRX C;  1SKO B;  2UWX A;  3LFV A;  3JPU A;  1WA9 A;  1NYM A;  3FG8 A;  4GS9 B;  3A3D A;  5M18 A;  4DF6 A;  4UA6 A;  2QZ6 A;  3IXB A;  3ZHH A;  5GHZ A;  4PM6 A;  5J8X A;  3P7N A;  1ES4 A;  5AQA A;  3N6I A;  4ARZ A;  4WMC D;  3T4Q A;  4GCZ A;  2B18 A;  1IYO A;  1OTD A;  3EGD C;  4OON A;  1G68 A;  3DTE A;  4O7D A;  3IF6 A;  2Y2O A;  2IWC A;  3ZDJ A;  1YLJ A;  3F1N A;  1S1Z A;  2XD1 A;  2V1A A;  2DRW A;  4I3I A;  5K5B A;  3MJQ A;  4LV3 A;  2XH9 A;  3PBQ A;  5HZH A;  1MBL A;  3SH8 A;  2FFY A;  4X69 A;  2J80 A;  3IF6 B;  4OVD A;  1XP4 A;  3UDF A;  2JE5 A;  3F1N B;  3ISG A;  5CEB A;  3UO9 A;  3T1Q B;  2ZLY A;  3FC7 A;  1E25 A;  3IHA A;  1T1A A;  1CK3 A;  1KE0 A;  4QWO A;  3KX0 X;  1L2S A;  2JCH A;  5GLB A;  3RTY A;  3T1R A;  1K4F A;  3IXH A;  3PAG A;  1W5D A;  2Y79 A;  2HZ5 A;  2ZQD A;  1CI8 A;  3O87 A;  4DDY A;  2OSU A;  3S1Y A;  3BFG A;  3IT9 A;  4Z1W A;  4KZ5 A;  4LV2 A;  1G6A A;  4Y15 A;  4G3K A;  3LI9 A;  4FH4 A;  3DAV A;  4JGQ A;  4HIA A;  2J9P A;  4BEN A;  4ETZ A;  2XGN A;  5EE8 A;  3BLS A;  1ESI A;  2RL3 A;  4X55 A;  5FDS A;  4MNR A;  3MZD A;  4K08 A;  1OT6 A;  1TD5 A;  5E2H A;  4LFU A;  5DFX A;  4WLA A;  4E3J A;  4FOF A;  3GV9 A;  3Q7V A;  1BUL A;  1T1C A;  3JVV A;  4N9L A;  3NHQ A;  4GB7 A;  1PW1 A;  4XUX A;  5KSC A;  1WE4 A;  1X0O A;  2NUP C;  2XDM A;  3VP1 A;  4UQI M;  4QU3 A;  3UMD A;  4OQH A;  5FI7 A;  5TR7 A;  1FCN A;  5E2E A;  2HDS A;  4KZ7 A;  2HV1 A;  1S6R A;  2V2F F;  2HP5 A;  1YSQ A;  4XT2 B;  3BM6 A;  3PBN A;  3Q7V B;  1MC0 A;  2A24 A;  3BLM A;  3CAX A;  3EOI A;  4I38 A;  3M2J A;  3FV7 A;  3LEQ A;  3D3O A;  3LR4 A;  3NY4 A;  5CHJ A;  3GQZ A;  2WKP A;  3R7W B;  1ALQ A;  5EFW A;  3CHW P;  3SOI A;  3UE6 A;  2P04 A;  3Q82 A;  3K3D A;  5JYP A;  1A0K A;  5U47 A;  4FCF A;  2FZ0 A;  5HPF A;  3SS4 A;  3PXP A;  2DCF A;  1OME A;  4E6X A;  3CPT A;  4KZ9 A;  5EUA A;  3S7P A;  1K55 C;  3A3E A;  3IH9 A;  4RX2 A;  4R70 A;  1P0Z A;  2Y8H A;  1EI5 A;  4LEN A;  1L3L A;  2V0W A;  2O0Y A;  2OLV A;  2GDN A;  4LV1 A;  4KZ8 A;  5DF7 A;  5F68 A;  3A0R A;  3A3I A;  3LYX A;  4NXF A;  3S7O A;  2WGV A;  2WKI A;  1XFN A;  2H0T A;  4RX3 A;  4ZBE A;  1K4E A;  4RQ9 A;  2DMW A;  1XJ3 A;  3K3C A;  4OOY A;  1ZHH B;  1HD8 A;  3WWX A;  4HY8 A;  1YLZ A;  1K57 A;  2D02 A;  2V0U A;  2WKQ A;  3IF5 A;  2WKE A;  1I5Q A;  2P7J A;  5AQ9 A;  1GSW A;  3HJI A;  3HUM A;  3W4O A;  2VGJ A;  4CPK A;  2XSS A;  3CUE A;  4EQI A;  2ZQ7 A;  3B47 A;  4OP8 A;  2WAD A;  1KDW A;  5L8M A;  1I2S A;  1XPB A;  1BLC A;  2W3F A;  3G31 A;  2OLU A;  1BYW A;  2WKH A;  2X71 A;  4S2J A;  4S2N C;  1YAX A;  2WZZ A;  1TS7 A;  1YMX A;  1FR6 A;  4QD4 A;  2ZC4 B;  4E6W A;  3LIE A;  3C38 A;  4WMC A;  5F5Y A;  5DTS A;  2C5W B;  2PU2 A;  2VV8 A;  3EGX C;  2H0Y A;  3QHY A;  3ZNT A;  5HWT A;  1LL5 A;  1YQS A;  4ZJ1 A;  2GJ3 A;  1ZKJ A;  4N1H A;  4DXC A;  5HWV A;  4KZ4 A;  3D9Y A;  4HJ3 A;  4O0P A;  1PFL A;  3I7J A;  1T1B A;  1MPL A;  4X56 A;  3R4K A;  3CG5 A;  3M6B A;  3PBS A;  4S2O A;  4ZDX A;  4MN6 A;  1L0G A;  1VM1 A;  1GA0 A;  4QY5 A;  2QKP A;  4K0X A;  4PPR A;  3WRT A;  4XUZ A;  3PBR A;  3GRJ A;  3MQ0 A;  1IFQ A;  2HF6 A;  1DP9 A;  5A93 A;  4R3A A;  2EX9 A;  3TOI A;  2JN7 A;  3BFF A;  4RA7 A;  2HPB A;  2CMN A;  4QY6 A;  1CF0 A;  4WZ4 A;  1OT9 A;  2E8I A;  4L0L A;  2EX6 A;  1WYB A;  1IYP A;  2HDQ A;  5HW3 A;  4G3V A;  4JF6 A;  2HDU A;  4R38 A;  4ZRR A;  5EV0 A;  4HH2 A;  3SZT A;  3A3J A;  3T12 B;  5C5K A;  4MLL A;  2BLS A;  5G18 A;  2PT7 A;  5A8B A;  2ZM8 A;  2G2W A;  1P9R A;  4JXG A;  1U60 A;  2Q9N A;  5EVI B;  4NK3 A;  2JKG A;  1E3U D;  1K6S A;  4JF4 A;  3LY3 A;  1MWS A;  3KYZ A;  3GSG A;  4WEJ A;  1DRM A;  4OQG A;  5HAI A;  4WZ5 C;  1JNU A;  1N9L A;  2HJE A;  3AGE A;  5DF8 A;  3KYE A;  4PM5 A;  3IWQ A;  1J9M A;  3BFD A;  3RXX A;  4DJ3 A;  3U2A A;  5DJT A;  3G34 A;  4MBK A;  3A0S A;  4S2K A;  1FSW A;  2MJ6 A;  3PBO A;  2PR6 A;  2B5R A;  4JLF A;  1H3Q A;  1PWG A;  3OLO A;  4Y0O A;  4MBH A;  3E4P A;  4UA9 A;  2XRN A;  3ZQ5 A;  3V5M A;  3F1O A;  1AXB A;  3HRE A;  1J3W A;  3IS2 A;  3V39 A;  3VMA A;  3QP4 A;  4OKP A;  2Y2L A;  3T4J A;  4UAA A;  2K31 A;  2R9W A;  3N7W A;  1NJ4 A;  1ACF A;  1PZO A;  2ZMF A;  3UE1 A;  4OPY A;  2WZX A;  1SDE A;  2WKR A;  3OPR A;  3F1O B;  3HVF A;  5FEF A;  3IS2 B;  2Y59 A;  3MFX A;  5I94 A;  2O99 A;  4P6Z S;  2VK3 A;  3VP2 A;  1SKF A;  4NKP A;  2R9X A;  2XFT A;  1XFQ A;  3C5A A;  3E98 A;  3EWK A;  4DE0 A;  3RJU A;  5HWW A;  1ZG4 A;  3ITA A;  1O07 A;  4NEE D;  5D3O A;  3T4O A;  4Z9Q A;  1L0F A;  1KDS A;  2OAQ 1;  3W4Q A;  3UB9 A;  4PM9 A;  3NEC A;  1CEF A;  1S1Y A;  1STZ A;  3GTC A;  4DE3 A;  3WRZ A;  5AVF A;  1VHM A;  1XGI A;  4PHT A;  4JPM A;  4S2M A;  2JHE A;  1YSP A;  2EX2 A;  3QP8 A;  1MY8 A;  3MKF A;  4LGW A;  3VOZ A;  4E3M A;  3AGF A;  3E4O A;  3DWK A;  4M3K A;  2QHK A;  3N8S A;  5HAP A;  5HSQ A;  4DKI A;  1IEL A;  3C4O A;  1TEM A;  1W63 Q;  3QNB A;  2Y2G A;  3RFB A;  3FKW A;  1ONG A;  1PI4 A;  3E0Y A;  5MC7 A;  4KG2 A;  3S22 A;  3OZH A;  3P01 A;  1FSY A;  5CTM A;  3IBJ A;  1JTD A;  2HP6 A;  1RP5 A;  3MF0 A;  3IX8 A;  5EVI C;  1K0K A;  1P9W A;  5JYO A;  5AQ7 A;  3MQO A;  4JGP A;  3VP3 A;  1TS0 A;  4RYE A;  1SZV A;  2ZJ9 A;  5FAQ A;  1XKZ A;  2GNX A;  2OAP 1;  4Q0I A;  1IYQ A;  5EOO A;  1XJ6 A;  4MN5 A;  1MZU A;  4QHC A;  1K54 C;  4ARZ B;  4B88 A;  3SH7 A;  4C6Y A;  4LRZ E;  3WS4 A;  4KQR A;  5HDC A;  3O86 A;  2I9V A;  1NLZ A;  2A3U A;  4Y0T A;  5HL6 A;  3IXG A;  3LIF A;  3GEC A;  4EXO A;  2LB9 A;  1TDG A;  3BQ8 A;  3KSF A;  2EXB A;  3NIA A;  3HLG A;  5HPI A;  4WYY A;  2V8C A;  2HGV A;  3O88 A;  3BW6 A;  4LCL A;  4B4X A;  2JKR I;  2XLN A;  5M1A A;  1SCW A;  1G28 A;  2ZMV A;  1VQQ A;  1DP6 A;  4U3T A;  5M19 A;  1TF1 A;  3SH9 A;  2QYB A;  3W8K A;  4JXW A;  1PYY A;  3PR6 A;  2QJ5 A;  1JWZ A;  3BYD A;  2PBY A;  2IWD A;  3W2Z A;  4I3A A;  1IOU A;  5KIZ A;  1K56 A;  3UE0 A;  1XJ2 A;  3BRM A;  2Y55 A;  5EVI D;  4HBU A;  3PHY A;  5GLD A;  3ZFZ A;  5AJG A;  3T1S A;  1NWZ A;  3ZG8 B;  3N4I A;  3L9K A;  4BBV A;  4D2O A;  1D7E A;  1GSX A;  5CX7 A;  3MXQ A;  3UB8 A;  4EER A;  1TVF A;  4K91 A;  1ONH A;  4O8G A;  1CEG A;  3GMW A;  4PM8 A;  4E3K A;  3LIA A;  4EBN A;  4E3L A;  3RXW A;  3SW1 A;  4Q0H A;  1L0E A;  3IWI A;  1F9I A;  3FYZ A;  4G3W A;  4R4R A;  1ERM A;  1K25 A;  4IJG A;  3TE8 A;  4C3Q A;  2XQZ A;  3C2W A;  3OC2 A;  5IS1 A;  1DP8 A;  1N4O A;  4GDN A;  5DKL A;  2M7U A;  1BLS A;  1ZG6 A;  4DE1 A;  4IED A;  1PW8 A;  1LI9 A;  4EET B;  4HHD A;  4KZA A;  3IWO A;  3ZGA B;  3E2K A;  5TFQ A;  2ZD8 A;  4MBF A;  3KSH A;  3VSK A;  4OQI A;  2CC1 A;  1MWT A;  1ZC2 A;  2A24 B;  2OV5 A;  4F94 A;  5HFO A;  1NRJ A;  3MXR A;  5G4Y A;  1GHM A;  3HCY A;  5E43 A;  3UPN A;  5F83 A;  1IYS A;  1JWV A;  1RGY A;  3H7W A;  5FQI A;  3G4P A;  4IBX A;  3HLW A;  4GD8 A;  3G35 A;  4EU0 A;  4EBL A;  1SHV A;  3BJN A;  3BFC A;  5E2G A;  4HQA A;  4R3J A;  4B93 A;  2QPN A;  1GHI A;  4WF0 A;  4FSF A;  5DJU A;  3BQA A;  1W79 A;  4CLC A;  3ZG9 B;  1PIO A;  3CPT B;  3IF6 C;  3NOU C;  4BD0 A;  1HTZ A;  3H7W B;  2JKR M;  3CZD A;  4ME4 A;  3T4K A;  2VLG A;  3D72 A;  4YIN A;  3MKE A;  1MKM A;  1YLP A;  1K38 A;  1WYC A;  5TBM A;  3WS0 A;  3NBL A;  3HL9 A;  5FDH A;  4GHI A;  3U4L P;  4CLC B;  4ZTK A;  3OPL A;  3ZNY A;  1YT4 A;  2VX8 A;  3G6O A;  1QME A;  5DFY A;  3MS6 A;  1VEU A;  5I5L A;  1NRF A;  2W27 A;  4KUK A;  3HLD A;  4X1L A;  1OPX A;  3PTE A;  4FH2 A;  5HD5 A;  4JF5 A;  3NOT C;  1PZP A;  1LL8 A;  4GHI B;  3BEB A;  4X68 A;  5DVA A;  2M7V A;  1HZO A;  1KE4 A;  4EWF A;  4Q8I A;  3Q7Z A;  1VEU B;  1KE3 A;  1Q2Q A;  1Y28 A;  3CLO A;  4BL2 A;  4N92 A;  3W4P A;  4F3L A;  3G30 A;  2P74 A;  5EVE A;  1PRQ A;  4K0W A;  4FD8 A;  2EXA A;  5FAP A;  4EV4 A;  1ERQ A;  2VA0 A;  1H8Y A;  2G7U A;  3HLC A;  5KMW A;  1XGJ A;  3IX3 A;  5F1F A;  4P6B A;  3MXS A;  2JC7 A;  2R78 A;  2BAS A;  4LLO B;  1M6K A;  3DTM A;  3NC8 A;  4EES A;  5FAO A;  2Y2K A;  2BTF P;  4F3L B;  4JGO A;  1DJB A;  3ICY A;  1UGU A;  2ZC6 B;  2H28 A;  2B95 A;  1ODV A;  2Y2P A;  2V20 A;  3N8L A;  3T50 A;  2XA7 S;  2Y2N A;  3V67 A;  3VV4 A;  3ZG5 A;  4WEL A;  3KSG A;  3ZVT A;  3VSL A;  2KLI A;  3IX4 A;  4BL3 A;  4ID4 A;  3NCK A;  5HDD A;  1F98 A;  1N9B A;  3HBR A;  3TG9 A;  3PAE A;  2A49 A;  1TDL A;  3A0V A;  4KQD A;  4MN7 A;  2Y2I A;  3UPP A;  5CED A;  4MMN A;  4M4X A;  5CER A;  2V1Z A;  2IWB A;  3Q07 A;  2GX5 A;  1HVB A;  2KX6 A;  3EEH A;  1W8Q A;  4LRY C;  2EWV A;  4C75 A;  3QP5 A;  1BTL A;  4Y17 A;  2Y2Q A;  3ZG0 A;  2K2N A;  4E3O A;  2XR0 A;  1VET A;  3MMH A;  2H5S A;  4DMZ A;  5FA7 A;  5DTT A;  1W63 M;  3O5Y A;  4DJ2 A;  1VB6 A;  2OWJ A;  5A91 A;  1LL9 A;  3LUQ A;  1LSX A;  3VP4 A;  1FOF A;  3F1P A;  4LPZ A;  1ES3 A;  1VET B;  3Q1F A;  4NET A;  1BSG A;  3CI6 A;  3LY4 A;  3GDI A;  2XRO A;  2PU4 A;  1Q2P A;  3FPV A;  1K57 C;  4IVI A;  4KQQ A;  1YPR A;  4O01 A;  1GSV A;  2ZM0 A;  3GVB A;  1D06 A;  1PNE A;  2PHY A;  1LLB A;  1M40 A;  3H82 A;  3OOV A;  5GLA A;  4KZ3 A;  4OPZ A;  3QP6 A;  3CUE C;  1DJA A;  2OOL A;  3UME A;  3QP2 A;  1BT5 A;  2M1C A;  2VGL S;  4XXR A;  2Z2L B;  2W3G A;  5EM0 A;  5F69 A;  4OLD A;  4P85 A;  5HAR A;  2D01 A;  2XD5 A;  4HP4 A;  1TS8 A;  2VJW A;  3S4X A;  4JXV A;  5IT5 A;  4HJ4 A;  1ES2 A;  3FKV A;  4B4Z A;  4BQM A;  2EWW A;  3HUN A;  3NDE A;  5HX9 A;  5DF9 A;  4OOM A;  2W3D A;  4BLM A;  2EFU A;  3VE4 A;  4P6Z M;  3D4F A;  5EVL A;  4BD1 A;  4L9F A;  2XK1 A;  5FQQ A;  5EPH A;  4NXB A;  3H9W A;  1S0W A;  1UWP X;  3UB5 P;  2INW A;  3IXD A;  4WL9 A;  5CHU A;  3VP0 A;  2Y2M A;  4L9G A;  4NXG A;  3NOP C;  1S66 L;  2I72 A;  2VV7 A;  1N9N A;  2ZOH A;  2J8Y A;  5GHY A;  1OTE A;  1YLY A;  1OTB A;  5IHV A;  2ZL1 A;  1BZA A;  1XJ4 A;  3A3F A;  1FIK A;  4PM7 A;  4NXE A;  2VGK A;  5DKK A;  2Y2H A;  1W8Y A;  3SS5 A;  2ZQ9 A;  4EW7 A;  2Q0O A;  2Z2M B;  4Y0U A;  4JBF A;  4Y7P A;  3NUL A;  5HAQ A;  3C4P A;  3NDG A;  5CXW A;  3ITB A;  4R0Q A;  2HDR A;  4FTX A;  2Z6C A;  4II7 A;  2J9O A;  2ZL1 B;  1NLY A;  3DTK A;  3LI8 A;  5FL3 A;  1PWD A;  5L09 A;  1H0M A;  2ZM2 A;  2PD7 A;  4GDB A;  4E3N A;  2WAE A;  4HBT A;  1V9Z A;  2V8F A;  5FI6 A;  3C8C A;  1K55 A;  1H8M A;  2PR5 A;  4YFM A;  4H6J A;  3G32 A;  4R6L A;  4MDZ A;  4MEZ A;  1ES5 A;  2ZC3 B;  3VFF A;  4PKY A;  1KOU A;  1Z09 A;  1I2W A;  3C7V A;  3E4Q A;  3G2Z A;  1KGF A;  2H10 A;  1PI5 A;  2ACG A;  4OPR A;  4UEY A;  1CJF A;  4H6J B;  1FR1 A;  2PYR A;  3HLB A;  2J7V A;  1PWC A;  4R3B A;  5EM1 A;  1TS6 A;  1L0D A;  4YOF A;  3K2N A;  1G5U A;  5CHM A;  2JBF A;  4FUW A;  5L10 A;  4EUZ A;  5A92 A;  1RCJ A;  3IHB A;  3WS1 A;  4R23 A;  4ZJ2 A;  1YKD A;  2W3H A;  4GNU A;  5CRF A;  2HJ9 C;  3HLE A;  5J7E A;  4YWZ A;  4WEK A;  1LSV A;  3HJK A;  2O9B A;  3MFD A;  4S2N A;  4CQH A;  4X25 A;  3LR5 A;  4I39 A;  3LIC A;  4WBG A;  4H8R A;  1GHP A;  2V9A A;  1CQA A;  2K7S A;  3BY8 A;  3OBF A;  5FQ9 A;  2Q9M A;  1F2K A;  2PRF A;  4EBP A;  1W7F A;  2FH5 A;  1E3U A;  3T4L A;  2UV0 E;  2VKS A;  3P98 A;  1UWN X;  2PBD P;  4I3J A;  3QP1 A;  2EA9 A;  3ZCZ A;  5FQM A;  1KVL A;  5BOH A;  4DXB A;  4EUV A;  4HH3 A;  4U0T A;  2RCX A;  3LO7 A;  3DTI A;  3MBZ A;  3B3X A;  4MCW A;  3P09 A;  5FAT A;  4E04 A;  4IUK A;  5F82 A;  5FEG A;  3IH8 A;  3AGD A;  5KSH A; 
#chains in the Genus database with same CATH homology
 4HES A;  4GOG A;  1O7E A;  4N9K A;  5DVA A;  3PBO A;  1HZO A;  5CGS A;  2UWX A;  2ZC7 A;  3OCL A;  1KE4 A;  4EWF A;  4Q8I A;  3Q7Z A;  1KE3 A;  1NYM A;  1Q2Q A;  2B5R A;  2WUQ A;  3A3D A;  3BEC A;  5M18 A;  4JLF A;  4BL2 A;  4DF6 A;  1PWG A;  2QZ6 A;  4N92 A;  3IXB A;  4IVK A;  4JKT A;  1E4D A;  4UA6 A;  4PM6 A;  4Y0O A;  5GHZ A;  1ES4 A;  3ZHH A;  5J8X A;  3W4P A;  4MBH A;  5AQA A;  3G30 A;  3N6I A;  2P74 A;  4WMC D;  4R1G A;  2DNS A;  4UA9 A;  5EOE A;  4K0W A;  4FD8 A;  5CTN A;  3V5M A;  1AXB A;  2EXA A;  3HRE A;  5FAP A;  1IYO A;  4EV4 A;  1JVJ A;  4OON A;  1ERQ A;  1G68 A;  3V39 A;  3VMA A;  1XX2 A;  4O7D A;  3UY6 A;  1H8Y A;  2EX8 A;  4OKP A;  2Y2L A;  3IF6 A;  5FQJ A;  4UAA A;  2Y2O A;  3HLC A;  2IWC A;  2Y4A A;  3ZDJ A;  2R9W A;  1YLJ A;  3N7W A;  1NJ4 A;  1XGJ A;  5F1F A;  5KMW A;  4P6B A;  3MXS A;  2JC7 A;  2ZC5 B;  5FSR A;  1PZO A;  3UE1 A;  1M6K A;  2EFX A;  2XD1 A;  4OPY A;  3ZVW A;  3DTM A;  3NC8 A;  5FAO A;  2WZX A;  1SDE A;  1DY6 A;  2Y2K A;  4KG6 A;  3JYI A;  2DRW A;  1DJB A;  2ZC6 B;  3OPR A;  5DTK A;  4LV3 A;  2XH9 A;  3PBQ A;  5TGF A;  1QMF A;  3HVF A;  1JWP A;  5I94 A;  1MBL A;  2Y59 A;  1H8Z A;  2WGI A;  3SH8 A;  2FFY A;  3VP2 A;  4X69 A;  1SKF A;  2R9X A;  2Y2P A;  2V20 A;  3IF6 B;  3N8L A;  2XFT A;  4OVD A;  1XP4 A;  3UDF A;  2JE5 A;  2Y2N A;  3ISG A;  3ZG5 A;  4WEL A;  3C5A A;  3IQA A;  3ZVT A;  5CEB A;  4S2I A;  3UO9 A;  3VSL A;  1NXY A;  2ZLY A;  3IHA A;  1E25 A;  4IBR A;  4WZ5 A;  1CK3 A;  4DE0 A;  3LEZ A;  4ID4 A;  4ZAM A;  3NCK A;  3RJU A;  1ZG4 A;  4BL3 A;  1N9B A;  1KE0 A;  1Y54 A;  3HBR A;  3ITA A;  1JTG A;  3TG9 A;  1FCM A;  1L2S A;  1O07 A;  3PAE A;  2A49 A;  1TDL A;  4KG5 A;  5D3O A;  2JCH A;  3BFE A;  4Z9Q A;  1L0F A;  5GLB A;  1KDS A;  1K4F A;  3IXH A;  1DJC A;  3PAG A;  1W5D A;  3W4Q A;  2ZQD A;  1CI8 A;  2Y2I A;  3O87 A;  4DDY A;  2OSU A;  4PM9 A;  3UPP A;  5CED A;  1CEF A;  3S1Y A;  3V50 A;  5CER A;  3BFG A;  2WAF A;  3GTC A;  3IT9 A;  4KZ5 A;  1KGG A;  4LV2 A;  4P87 A;  1NY0 A;  4DE3 A;  1G6A A;  2V1Z A;  3WRZ A;  4JXS A;  1ERO A;  4R4S A;  2IWB A;  3Q07 A;  1HVB A;  3UNW A;  1CI9 A;  1XGI A;  4OPQ A;  4FH4 A;  1W8Q A;  4JPM A;  4S2M A;  1YM1 A;  2EX2 A;  4C75 A;  1BTL A;  2J9P A;  4BEN A;  4OH0 A;  1MY8 A;  1BLH A;  3MKF A;  2Y2Q A;  4RVA A;  3VOZ A;  3ZG0 A;  4E3M A;  4E3O A;  2XGN A;  3AGF A;  2XR0 A;  5EE8 A;  3BLS A;  4KEN B;  3DWK A;  4M3K A;  1ESI A;  2H5S A;  1IKI A;  2RL3 A;  2G2U A;  3N8S A;  5HAP A;  4DKI A;  5FA7 A;  4GZB A;  5DTT A;  4X55 A;  1IEL A;  3C4O A;  3MZD A;  1TEM A;  3QNB A;  3C7U A;  4MNR A;  5E2H A;  2Y2G A;  3FKW A;  1ONG A;  1IKG A;  1PI4 A;  1LL9 A;  5A91 A;  4X53 A;  4ZJ3 A;  4KG2 A;  3S22 A;  4BJP A;  4E3J A;  5KZH A;  3OZH A;  3GV9 A;  3Q7V A;  3VP4 A;  1BUL A;  1FSY A;  5CTM A;  1FOF A;  1JTD A;  2HP6 A;  4WM9 A;  1RP5 A;  4KQO A;  4N9L A;  1ES3 A;  5EVI C;  1FCO A;  4GB7 A;  3Q1F A;  1PW1 A;  4NET A;  1BSG A;  1IEM A;  5AQ7 A;  5JYO A;  4XUX A;  3LY4 A;  3VP3 A;  5KSC A;  1WE4 A;  2XDM A;  3VP1 A;  2PU4 A;  3V3R A;  4QU3 A;  4RYE A;  1Q2P A;  4OQH A;  5FI7 A;  5TR7 A;  1FCN A;  1K57 C;  2HDS A;  5E2E A;  3OCN A;  4IVI A;  4KQQ A;  4KZ7 A;  2ZJ9 A;  2ZM0 A;  4OQ0 A;  1S6R A;  1XKZ A;  5FAQ A;  3GVB A;  2V2F F;  2HP5 A;  3N8R A;  4P0M A;  1IYQ A;  3BM6 A;  3PBN A;  3Q7V B;  1LLB A;  1M40 A;  5EOO A;  3UE3 A;  4QJG A;  2XF3 A;  5GLA A;  3BLM A;  3M2J A;  4KZ3 A;  3FV7 A;  4OPZ A;  5FAS A;  3NY4 A;  5CHJ A;  1SDN A;  3GQZ A;  3GR2 A;  4QHC A;  1ALQ A;  1DJA A;  1K54 C;  4B88 A;  1BT5 A;  3SOI A;  3M6H A;  3SH7 A;  4C6Y A;  3Q82 A;  3WS4 A;  4KQR A;  4XXR A;  2Z2L B;  3O86 A;  5JYP A;  4KZB A;  1NYY A;  2A3U A;  5U47 A;  4FCF A;  4OLD A;  4P85 A;  5HAR A;  3SS4 A;  4CJN A;  4Y0T A;  3Q81 A;  2XD5 A;  2DCF A;  1XXM A;  4OOL A;  3CMZ A;  3IXG A;  3S4X A;  3OPH A;  4JXV A;  1MXO A;  1OME A;  1TDG A;  5AQB A;  1ES2 A;  4E6X A;  3FKV A;  2EXB A;  3NIA A;  3HLG A;  4B4Z A;  4WYY A;  4KZ9 A;  5EUA A;  4BQM A;  1K55 C;  3HUN A;  3NDE A;  3O88 A;  1XA1 A;  5HX9 A;  3A3E A;  3IH9 A;  5DF9 A;  2ZQA A;  4LCL A;  4GKU A;  4OOM A;  4BLM A;  2EFU A;  4RX2 A;  4B4X A;  3D4F A;  3G2Y A;  5EVL A;  1EI5 A;  4LEN A;  4BD1 A;  2XLN A;  2XK1 A;  5FQQ A;  2OLV A;  5M1A A;  4DE2 A;  5EPH A;  3NI9 A;  1SCW A;  2GDN A;  1S0W A;  4LV1 A;  4KZ8 A;  5DF7 A;  3IXD A;  5CHU A;  1VQQ A;  3A3I A;  3VP0 A;  2Y2M A;  4U3T A;  5M19 A;  3SH9 A;  3W8K A;  2WGV A;  2WKI A;  4GD6 A;  4JXW A;  2I72 A;  1PYY A;  2H0T A;  3ZG7 B;  3UN7 A;  4RX3 A;  1JWZ A;  3BYD A;  2PBY A;  5EVI A;  4ZBE A;  2J8Y A;  1K4E A;  2IWD A;  5GHY A;  1YLY A;  2FFF B;  5HL1 A;  4QB8 A;  1GCE A;  3E2L A;  3WS2 A;  4OLG A;  4OOY A;  5IHV A;  5F1G A;  1K56 A;  1BZA A;  3A3F A;  3UE0 A;  1HD8 A;  3HUO A;  3BRM A;  2Y55 A;  5EVI D;  4PM7 A;  3WWX A;  1YLZ A;  1K57 A;  2VGK A;  2WK0 A;  4HBU A;  5GLD A;  3IF5 A;  3ZFZ A;  2Y2H A;  5CGX A;  1K56 D;  1W8Y A;  1I5Q A;  2WKE A;  4U0X A;  2ZQ9 A;  4UA7 A;  3SS5 A;  5AQ9 A;  2Z2M B;  4Y0U A;  4JBF A;  4Y7P A;  3N4I A;  3ZG8 B;  5HAQ A;  3C4P A;  4X6T A;  4D2O A;  3NDG A;  3HUM A;  2X01 A;  1YLW A;  2XEP A;  3W4O A;  5CXW A;  5CEC A;  2VGJ A;  2WYX A;  1H5X A;  1BLP A;  3DWZ A;  3ITB A;  4R0Q A;  5GL9 A;  2HDR A;  1Z6F A;  4CPK A;  1MWR A;  1K54 A;  2J9O A;  3HLF A;  4EQI A;  2ZQ7 A;  3UDI A;  1TVF A;  4OP8 A;  2WAD A;  1ONH A;  4K91 A;  1KDW A;  3O3V A;  1PWD A;  1I2S A;  1XPB A;  1BLC A;  3G31 A;  1CEG A;  2OLU A;  3FWL A;  2P9V A;  2ZM2 A;  3GMW A;  4PM8 A;  2WKH A;  4E3K A;  1MWU A;  2C6W B;  4GDB A;  2X71 A;  4EBN A;  4E3L A;  4S2J A;  4S2N C;  3RXW A;  4E3N A;  2WAE A;  1L0E A;  4HBT A;  3IWI A;  1KVM A;  2WZZ A;  3CJM A;  3FYZ A;  1YMX A;  5FI6 A;  4A5R A;  1FR6 A;  4QD4 A;  4R4R A;  1ERM A;  1K25 A;  2ZC4 B;  1K55 A;  1YMS A;  4YFM A;  3UDX A;  2HP9 A;  4E6W A;  4C3Q A;  3G32 A;  2XQZ A;  5L2F A;  3OC2 A;  2ZQC A;  4WMC A;  4MEZ A;  1ES5 A;  2C5W B;  1RGZ A;  5DTS A;  3WS5 A;  2PU2 A;  1N4O A;  2ZC3 B;  3VFF A;  4GDN A;  2H0Y A;  3QHY A;  3ZNT A;  2P9V B;  1C3B A;  1BLS A;  5FI2 A;  3TSG A;  1MKI A;  1ZG6 A;  1KGE A;  4DE1 A;  1I2W A;  3C7V A;  4IED A;  1PW8 A;  1LI9 A;  3G2Z A;  1KGF A;  1LL5 A;  1YQS A;  1PI5 A;  2H10 A;  1ZKJ A;  4N1H A;  4ZJ1 A;  4DXC A;  4OPR A;  4KZ4 A;  4KZA A;  3IWO A;  1NZU A;  3ZGA B;  2Y91 A;  3E2K A;  5TFQ A;  1FR1 A;  2ZD8 A;  4MBF A;  3HLB A;  3I7J A;  3QNC A;  3VSK A;  4OQI A;  2J7V A;  1MPL A;  1PWC A;  2CC1 A;  4R3B A;  4X56 A;  5EEC A;  1MWT A;  4S2P A;  1ZC2 A;  3EQU A;  3CG5 A;  3M6B A;  4E3I A;  3PBS A;  2OV5 A;  1L0D A;  4KZ6 A;  4S2O A;  3UPO A;  4ZDX A;  4F94 A;  3PBT A;  1L0G A;  1LI0 A;  5HFO A;  1ESU A;  4PMA A;  1VM1 A;  4OP5 A;  1GA0 A;  1FQG A;  3MXR A;  4QY5 A;  1GHM A;  2QMI A;  4K0X A;  3MZE A;  5E43 A;  3UPN A;  4PPR A;  5CGW A;  5CHM A;  2JBF A;  4XUZ A;  1IYS A;  1JWV A;  3GRJ A;  3PBR A;  1RGY A;  5F83 A;  3VFH A;  4DDS A;  5FQI A;  4EUZ A;  5A92 A;  3G4P A;  5A93 A;  4IBX A;  1RCJ A;  3HLW A;  4GD8 A;  3IHB A;  3G35 A;  2XFS A;  1YLT A;  2EX9 A;  4EBL A;  3MZF A;  1SHV A;  3TOI A;  3WS1 A;  3BFC A;  4R23 A;  5E2G A;  3BFF A;  4R3J A;  4RA7 A;  4ZJ2 A;  2QPN A;  4GNU A;  1GHI A;  5CRF A;  4FSF A;  2HPB A;  3HLE A;  4QY6 A;  1W79 A;  2BG1 A;  3ZG9 B;  5GHX A;  4WZ4 A;  1PIO A;  4WEK A;  2E8I A;  2ZQ8 A;  1LHY A;  4LV0 A;  3WRT A;  4L0L A;  2EX6 A;  3MFD A;  3IF6 C;  3OPP A;  4S2N A;  5A90 A;  1WYB A;  1IYP A;  4BD0 A;  1HTZ A;  2HDQ A;  4GN2 A;  5HW3 A;  1K6R A;  4S2L A;  3CZD A;  4JF6 A;  2HDU A;  4HEF A;  4WBG A;  4H8R A;  1GHP A;  3A3J A;  3LCE A;  4YIN A;  3MKE A;  1YLP A;  5FQ9 A;  2Q9M A;  1K38 A;  4MLL A;  2BLS A;  5G18 A;  1WYC A;  2X02 A;  1EWZ A;  4EBP A;  3WS0 A;  2ZM8 A;  3V3S A;  2G2W A;  1W7F A;  2Y2J A;  3NBL A;  3HL9 A;  1E3U A;  5FDH A;  4JXG A;  1GA9 A;  2WGW A;  1BUE A;  1U60 A;  2Q9N A;  5GLC A;  2ZMA A;  3P98 A;  5EVI B;  4ZTK A;  3OPL A;  3SS3 A;  4NK3 A;  1YT4 A;  3ZNY A;  3FZC A;  5E2F A;  3ZCZ A;  1QME A;  1KVL A;  1E3U D;  1K6S A;  1XA7 A;  4JF4 A;  3LY3 A;  5FQM A;  5BOH A;  1MWS A;  4DRT A;  4DXB A;  4N1X A;  4U0T A;  1NRF A;  3GSG A;  5FQK A;  3EQV A;  2RCX A;  1NZO A;  4WEJ A;  3HLD A;  3M2K A;  4OQG A;  5HAI A;  3LO7 A;  3MBZ A;  4WZ5 C;  3B3X A;  3PTE A;  3VOY A;  3AGE A;  4FH2 A;  3DW0 A;  5DF8 A;  4JF5 A;  3IWQ A;  3P09 A;  1J9M A;  3BFD A;  5FAT A;  3RXX A;  5F82 A;  4PM5 A;  1PZP A;  3IH8 A;  3AGD A;  3G34 A;  4MBK A;  2WGW B;  3BEB A;  4S2K A;  4LCM A;  4X68 A;  5KSH A;  4UHU A;  1FSW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...