4OP8A

Room temperature crystal structure of stabilized tem-1 beta-lactamase variant v.13 carrying g238s mutation
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
263
structure length
262
Chain Sequence
HPETLVKVKDAEDQLGGRVGYIELDLASGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVGELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTTPVAMATTLRKLLTGELLTAASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGASERSRGIIAALGPDGKPSRIVVIYMTGSQATMDERNRQIAEIGASLIKHW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TEM-94 ES-beta-lactamase
publication title Negative Epistasis and Evolvability in TEM-1 beta-Lactamase--The Thin Line between an Enzyme's Conformational Freedom and Disorder.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 98
structure length 262
sequence length 263
ec nomenclature
pdb deposition date 2014-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4op8A00
5AQ9A 4LV1A 1BZAA 3PTEA 1FCOA 3TSGA 1K4EA 4ZTKA 1AXBA 1DY6A 3IT9A 4DDYA 4RVAA 3Q7VB 5DTKA 5GLBA 2WAFA 3S1YA 4OVDA 5AQAA 4RX2A 5HARA 2EFXA 3W4PA 4BD1A 3GTCA 4DE3A 2VGJA 3MZFA 1PZPA 5FQQA 3UPNA 3VP1A 3FKWA 4OQHA 3ZDJA 4S2NA 4E3MA 4PM9A 4QY6A 1JTGA 2I72A 5FI7A 3C7VA 4WEJA 4WZ5A 1LL5A 1Q2QA 2Y2LA 2XFTA 2HP5A 3HUNA 3ZHHA 3VFFA 3P09A 3BFDA 4OPQA 3UDIA 2HPBA 4X55A 1PI4A 4ID4A 1BTLA 5CTNA 4GKUA 2ZC6B 4E3IA 3IH8A 5FSRA 2ZC7A 2J9OA 4OPYA 1YLTA 1KDSA 4GNUA 5TR7A 2Z2LB 3BEBA 5IHVA 4UA9A 2WGWA 3OPLA 3UO9A 5KZHA 5TGFA 3FZCA 1XXMA 4B4ZA 4HESA 2PBYA 2OLUA 3NBLA 3O86A 1H5XA 3HLBA 5CXWA 1I5QA 1ZG6A 2H0YA 1DJCA 2XQZA 1GA9A 1HD8A 3QNCA 4BENA 4WELA 4C3QA 4A5RA 2Y91A 3MXSA 4HEFA 2WKHA 3HUMA 4GDBA 2DNSA 4WEKA 3B3XA 1FR1A 2ZQ9A 1BLHA 1LI9A 1KVMA 1JTDA 1YLZA 1QMFA 2XLNA 4IBXA 4N9LA 2XD5A 5EVIB 2WADA 3ZGAB 3M2KA 3ISGA 1NYMA 2Y2MA 4ZAMA 3IWQA 3OPRA 3P98A 5EVIC 1NJ4A 5EPHA 2WAEA 4K0WA 4EWFA 2Q9MA 2XK1A 4N92A 2JBFA 2Y2KA 3HUOA 2OSUA 3I7JA 3A3IA 4DE1A 3SOIA 1J9MA 5DF8A 5FQ9A 3IF5A 4Y7PA 3IXBA 2BLSA 1I2WA 4LV3A 4ZJ3A 1KGGA 2HDQA 3TOIA 4IEDA 4R23A 4KZ9A 4B4XA 2WKIA 3E2LA 2WUQA 4DRTA 1ZKJA 4KENB 2PU2A 2XEPA 2QZ6A 4MBFA 3AGDA 1FOFA 1ZG4A 1SHVA 2WKEA 1K6SA 1HZOA 3IF6C 1ES4A 1G68A 3MFDA 1XA7A 3Q07A 3G2ZA 5M1AA 1ZC2A 3VP0A 2XD1A 5FAQA 2Y55A 1E4DA 4IVIA 3DWZA 1K57A 4KZ7A 2P9VA 4B88A 3NI9A 3GVBA 3ZG7B 4KQRA 3WS2A 5D3OA 1CEGA 4FSFA 4P6BA 3A3JA 3DTMA 3GR2A 3ZG0A 1DJAA 3WWXA 1IYSA 4FCFA 3M6HA 3MZEA 3BLMA 3LEZA 1YMXA 1N4OA 4KZ3A 3SS3A 3G34A 4UA7A 3SS4A 1K4FA 1E25A 3G32A 5FATA 4KZ4A 3C5AA 1YQSA 3HLGA 5F1FA 4WM9A 1L0EA 3WRZA 3VP2A 3UN7A 5HAIA 4E6XA 2ZM0A 3BFFA 1E3UA 3FWLA 1NZUA 3BM6A 2X71A 4JBFA 1NY0A 3HREA 3UPPA 3V3SA 4U3TA 4OOLA 1MWTA 2V1ZA 4GDNA 2ZC3B 4K0XA 4OH0A 1YLWA 4DKIA 5EECA 3IXDA 5HAQA 3G35A 3BYDA 4LCMA 1SCWA 1XGJA 4QJGA 3NCKA 2UWXA 5FI2A 1GA0A 4R3BA 1BT5A 3A3FA 2C6WB 3V3RA 4C6YA 4NETA 1K54A 1K54C 1OMEA 4S2NC 1L0GA 4WYYA 4OP5A 4WZ5C 5KSHA 2ZMAA 1S6RA 2RL3A 3VP3A 3IH9A 3HLDA 1K6RA 1GHIA 3Q82A 4MBHA 1IKIA 5AQ7A 3SH8A 1ES2A 3Q1FA 1GCEA 1PIOA 2WYXA 4JPMA 3OCNA 4S2PA 1XX2A 3ZFZA 3RXXA 1NRFA 5FQJA 1MPLA 4P87A 4Y0UA 5EOOA 1BULA 3DWKA 4DDSA 4BD0A 5CEDA 1PWGA 2HDRA 1CK3A 3IHBA 3MKEA 3GV9A 5GL9A 3BLSA 5U47A 4UA6A 3N4IA 3G31A 4OOMA 4WBGA 1NZOA 3OZHA 1K55A 2ZC4B 4C75A 5FQMA 2J8YA 3ZNYA 4CJNA 5J8XA 3M2JA 3N8LA 5FQKA 4E6WA 3WS5A 2ZQCA 2WZZA 3AGEA 5I94A 2OLVA 1FCMA 1O07A 4RX3A 2WGIA 1KDWA 1IYQA 4N9KA 2FFYA 4RA7A 1O7EA 5CRFA 4X69A 3C4OA 1BUEA 2GDNA 3HLWA 1CI8A 4PM7A 1IEMA 4JXGA 2JE5A 1DJBA 3LY3A 2IWCA 4L0LA 4HBTA 1PW1A 4JF5A 1QMEA 4LV0A 4ZBEA 1FSYA 3QHYA 2G2UA 1TDLA 4N1HA 5EE8A 3V50A 3NC8A 4M3KA 3ZCZA 1ONHA 4O7DA 2CC1A 3C7UA 4EBLA 4S2OA 1KGFA 5DF7A 1WE4A 4DXCA 5GLDA 3PBTA 1LHYA 1K25A 4YFMA 1ESUA 4JF4A 4E3JA 1NYYA 5FAPA 5EUAA 1YLPA 4R1GA 5CHUA 4U0XA 5CGWA 1XGIA 1FQGA 4QU3A 5CTMA 5DTTA 5JYOA 4KQQA 3MXRA 1E3UD 1RGZA 1TVFA 1C3BA 4GD8A 4KZ6A 2Y2HA 1ES5A 4P85A 5CHJA 4UAAA 2G2WA 3PBOA 1XP4A 1PWCA 3IF6B 3JYIA 4R4RA 3RXWA 4JF6A 5F83A 4RYEA 3WRTA 3W4OA 1SKFA 4EUZA 5GLCA 1EWZA 4FD8A 5HL1A 3HVFA 3O87A 4X53A 2B5RA 3LY4A 3UNWA 1ESIA 3N8SA 1IKGA 4H8RA 4NK3A 2X01A 1KE0A 4OPRA 1PI5A 1MY8A 1W7FA 4ZJ2A 1K57C 1MWSA 3UDXA 3MKFA 2WZXA 4KQOA 1K56A 2EX2A 5E2FA 1KE4A 2HDUA 4GOGA 1YLYA 2EX9A 3OC2A 4OQIA 4OOYA 3GMWA 5CGXA 1ALQA 3NDGA 2DRWA 4MLLA 4Z9QA 1WYBA 2ZM2A 4S2LA 1Y54A 4JLFA 3Q7ZA 1K38A 1GHMA 5FAOA 3SS5A 5M18A 4DE2A 2E8IA 1JWZA 1RGYA 1CI9A 2HDSA 3CMZA 4BQMA 4F94A 5L2FA 2H0TA 4QHCA 5DVAA 3O88A 2ZC5B 5FQIA 5GHZA 5A90A 1SDNA 4XUZA 3IHAA 4HBUA 3W8KA 4QB8A 2XDMA 2Q9NA 2ZQ8A 3WS1A 4JXVA 2H5SA 4OONA 3BFGA 3VMAA 5F1GA 4BLMA 1MWRA 1KGEA 3N7WA 4WZ4A 4XXRA 3ZG8B 5DF9A 1L0DA 3A3EA 3PBRA 4K91A 2EX8A 4FH4A 3W4QA 1W5DA 4EV4A 2A49A 2XGNA 5DTSA 5E2HA 3S4XA 5GLAA 1PZOA 4ZDXA 3N6IA 5FDHA 1YMSA 4JXSA 4UHUA 5JYPA 1YM1A 1WYCA 5CHMA 3NY4A 4IVKA 1BSGA 1YLJA 4KG6A 3O3VA 4LV2A 4X6TA 5A91A 2R9XA 5CGSA 5HFOA 4X56A 1JWPA 2XF3A 4PMAA 4KZ5A 5KMWA 5A92A 3IXHA 3VSKA 4CPKA 3V5MA 1HTZA 4JXWA 1FSWA 1RP5A 4XUXA 2FFFB 3VP4A 4P0MA 4R4SA 3C4PA 4QD4A 4S2IA 1I2SA 3WS4A 1RCJA 5CEBA 3OPPA 2HP6A 3OCLA 5KSCA 4KZAA 3OPHA 3V39A 3VSLA 2R9WA 5HW3A 3A3DA 5FI6A 3Q7VA 1M6KA 2WGWB 3EQUA 1S0WA 4PM8A 4MNRA 4OKPA 3UDFA 4KZ8A 2VGKA 3PAEA 3D4FA 1L0FA 2ZQ7A 5EVID 3ZVTA 4E3OA 4LCLA 2OV5A 3ITBA 1W8QA 3BFEA 5A93A 2P74A 4KG2A 1MBLA 1K55C 3UE0A 3ZVWA 5M19A 4E3KA 5CECA 2IWDA 1N9BA 1XKZA 1IELA 2EX6A 4OQ0A 4S2KA 2IWBA 2ZM8A 4DF6A 3Q81A 5F82A 2EXAA 3CJMA 5TFQA 4R0QA 5EVLA 5FA7A 4FH2A 2ZLYA 2ZQAA 1SDEA 4JKTA 3FV7A 1K56D 1YT4A 3TG9A 4EBNA 3EQVA 5E2GA 3SH7A 3IWOA 1MWUA 1G6AA 4PM6A 1M40A 2Y2PA 1LLBA 5AQBA 4N1XA 4D2OA 2Y2OA 2V2FF 5CERA 1GHPA 1PWDA 3HL9A 3NIAA 5E2EA 3GRJA 2Y2NA 4E3LA 1CEFA 3HLFA 2V20A 1KVLA 3LCEA 3IWIA 3N8RA 4S2MA 1MKIA 5G18A 1LL9A 4WMCD 4EQIA 4EBPA 2ZJ9A 5GHYA 3QNBA 2C5WB 4LENA 1EROA 1ES3A 4GB7A 4PPRA 4OP8A 4X68A 3UE3A 3BFCA 3E2KA 2Y59A 5FASA 4DE0A 1FR6A 1HVBA 3HBRA 4IBRA 2WK0A 4MEZA 5EVIA 3SH9A 3PBNA 5HX9A 3WS0A 4BL3A 3ZG9B 4BJPA 3FYZA 1W79A 4Q8IA 4KG5A 3IQAA 2Y2IA 1H8ZA 2XH9A 2P9VB 3MBZA 4QY5A 4PM5A 2PU4A 5HAPA 3UY6A 3BECA 3ZNTA 1W8YA 4OPZA 2QPNA 1PW8A 1XPBA 4U0TA 3AGFA 1TEMA 3CG5A 1ERQA 3MZDA 1IYOA 2ZD8A 4GZBA 2X02A 3IF6A 1U60A 4OLDA 1PYYA 3DW0A 2H10A 1VM1A 4OQGA 1IYPA 2XR0A 2RCXA 3HLCA 3S22A 1JWVA 3IXGA 4GN2A 2DCFA 5BOHA 3ITAA 1VQQA 3G4PA 1L2SA 2EFUA 3HLEA 4MBKA 1MXOA 4WMCA 1BLSA 4BL2A 2QMIA 4DXBA 3BRMA 1ERMA 2XFSA 3VOZA 1Z6FA 3PBQA 4ZJ1A 2A3UA 1JVJA 3GQZA 2Z2MB 4OLGA 4YINA 3VOYA 1KE3A 3CZDA 4KZBA 1FCNA 3UE1A 5GHXA 1ONGA 3GSGA 2Y2JA 2Y2QA 2BG1A 1Q2PA 5E43A 2Y2GA 3LO7A 2JC7A 3M6BA 3ZG5A 3RJUA 4Y0TA 1BLCA 3NDEA 3PBSA 3PAGA 2HP9A 2ZQDA 1BLPA 2WGVA 1H8YA 1NXYA 2JCHA 4S2JA 4Y0OA 3VFHA 3G2YA 2EXBA 3G30A 2J9PA 2Y4AA 4R3JA 4E3NA 3UPOA 4GD6A 1XA1A 1EI5A 1LI0A 2J7VA 3FKVA 1TDGA 5EOEA
chains in the Genus database with same CATH superfamily
4I39A 4LV1A 3TSGA 1K4EA 1AXBA 3IT9A 4RVAA 5FEFA 4Q0HA 3MXQA 5HARA 5DJUA 3GTCA 4DE3A 5FQQA 3VP1A 4PM9A 3CLOA 2I72A 2PAVP 5FI7A 3C7VA 4WEJA 4WZ5A 5HD5A 2K7SA 3BFDA 4EW7A 3UDIA 3U4LP 4GKUA 4E3IA 4OPYA 1YLTA 2PRFA 2VGLM 4ZRRA 2OWHA 5IHVA 5TGFA 3FZCA 3T1QB 1TF1A 2JHEA 4YNRA 1HD8A 4EERA 4C3QA 2Y91A 4GDBA 4H6JB 4R3AA 4UQIM 3S7QA 1FR1A 2ZQ9A 3B47A 1KVMA 1YLZA 2XLNA 1NYMA 5C5KA 2A24B 2O9BA 3P98A 5EVIC 4K08A 3OLOA 5EPHA 2XK1A 4N92A 3NHQA 4EUVA 3I7JA 4DE1A 5FQ9A 4QPRA 4D60A 1GSXA 1I2WA 4LV3A 4PKYG 1KGGA 3TOIA 4HP9A 2WKIA 1NWZA 3EGDC 4DRTA 1VEUB 4KENB 2PU2A 4MBFA 2PR5A 1OTEA 1ODVA 4ARZB 1G68A 3Q07A 3G2ZA 4NXBA 1E4DA 4Z1WA 4X1MA 4KZ7A 2XA7M 3L7HA 3QP5A 3NI9A 3GVBA 5MC7A 3A3JA 4ETZA 3GR2A 3OOVA 3EOIA 3LEZA 1N4OA 4XT2A 3SS3A 2VZWA 5FATA 3UE6A 1YQSA 1L0EA 2W3HA 3UN7A 5HAIA 5F69A 2OAP1 3TRCA 1NY0A 4OOLA 4GDNA 4K0XA 1YLWA 3IXDA 3BYDA 4QJGA 1XGJA 5HWTA 1GA0A 3A3FA 2BTFP 1OJ5A 3DTEA 4S2NC 2JKGA 5HWVA 2A2LA 2Y79A 3HCYA 1S6RA 3VP3A 3IH9A 3SH8A 4CLCE 1PIOA 2WYXA 3ZFZA 3OCNA 4LGWA 2QJ5A 2B95A 4DDSA 5CEDA 3MKEA 5GL9A 4OOMA 1K55A 3DAVA 4CJNA 3N8LA 5EM1A 4E6WA 5I94A 1ZHHB 1FCMA 3QP8A 4N9KA 2JKRI 4X69A 4PM7A 1IEMA 2IWCA 5TJJA 4HBTA 4LV0A 1P9RA 3ZCZA 4O7DA 3P01A 4EBLA 2V9AA 4S2OA 1KGFA 4DXCA 2HGVA 5FEGA 4JF4A 1NYYA 4X25A 3JPUA 4LPZA 5DTTA 3D72A 4KZ6A 1RGZA 1C3BA 2W3GA 1XFNA 3UB5P 4RYEA 4II7A 4KQDA 3N8SA 1IKGA 2W27A 2WZXA 4KQOA 2EX2A 4Y3IA 4FTXA 4XT2B 1KE4A 2HDUA 4GOGA 1YLYA 3OC2A 3IX8A 4Z9QA 3Q7ZA 1K38A 5FAOA 3UMEA 4HI4A 4BQMA 3UMDA 4R6LA 5DVAA 5GHZA 2VV6A 1SDNA 3IHAA 3W8KA 2Q9NA 2ZQ8A 3BFGA 4BLMA 3IBJA 1L0DA 5E2HA 3S4XA 3H7WA 1H0MA 5JYPA 1YM1A 3PXPA 1YLJA 5CGSA 4X56A 4R70A 1MC0A 1GSWA 1ZTUA 3V5MA 2MJ6A 1S4RA 2FFFB 3FPVA 4P0MA 4S2IA 3WS4A 5KSCA 3TW8A 3ULFA 3VSLA 3IS2A 1S66L 4IUKA 1OJGA 5FI6A 4PM8A 1PRQA 3UDFA 4HH2A 3D4FA 4E3OA 2OV5A 3NULA 4E3KA 4S2KA 4OQ0A 2IWBA 4DF6A 3CJMA 1K56D 4EBNA 3SH7A 3KSIA 1M40A 2Y2PA 5AQBA 4N1XA 3HLFA 1VHMA 3LYXA 3LIAA 1EROA 2O0YA 3KX0X 3UE3A 3BFCA 3E2KA 4O01A 4DE0A 1FR6A 2GZAA 5EVIA 2EWVA 4BL3A 4BJPA 3FYZA 1TS7A 1H8ZA 2O9AA 4PKYA 4HP4A 2L1MA 2R78A 2O9CA 4BBVA 3LI8A 3IBRA 1ERQA 3MR0A 4HOIA 2CMNA 3BQAA 5AVFA 1PYYA 2H10A 1VM1A 4OQGA 3T12B 1JWVA 3ITAA 4MBKA 4BL2A 1JNUA 4WF0A 3BRMA 2XFSA 3PBQA 4MDZA 2W1TA 4YINA 2V8CA 3VOLA 3H82A 5IU1A 1LSVA 3K3DA 3GSGA 3H7WB 2Y2QA 1Q2PA 2Y2GA 3M6BA 3PBSA 3PAGA 2ZQDA 3ZQ5A 2WGVA 3R4KA 2EXBA 4HH3A 2J9PA 2Y4AA 3PHYA 1XJ6A 1EI5A 3E0YA 2V1BA 3T1SA 4ZTKA 3IS2B 4LRZE 3UB9A 4OVDA 5AQAA 4RX2A 3LUQA 3VE3A 2EFXA 1PZPA 4WUJA 2GX5A 3FKWA 4S2NA 3LIBA 2Y2LA 3HUNA 1TS8A 3P09A 5DJTA 4X55A 4IJGA 1L3LA 4UEYA 2ZC7A 5F6AA 3T4QA 2YKHA 5IS1A 3W2ZA 4GNUA 4Y5FA 4UA9A 3OPLA 3UO9A 1XXMA 5HDCA 4HESA 3BY9A 1I5QA 1ZG6A 1DJCA 1GA9A 3KYZA 3QNCA 2QHKA 4WELA 3MXSA 4Q0IA 3HUMA 2DNSA 3B3XA 1JTDA 4N9LA 4DJ2A 1D1JA 5EVIB 2WADA 3M2KA 2ZOIA 3IWQA 4ESPA 2Q9MA 2JBFA 2Y2KA 3A3IA 3SOIA 3IXBA 2YKFA 1FILA 2HDQA 4IEDA 3AGDA 1SHVA 3IF6C 4L9EA 5M1AA 5FAQA 4IVIA 3DWZA 1N9NA 4P6ZM 3ZG7B 4FSFA 3ZG0A 1N9LA 3WWXA 4NXEA 3M6HA 3BLMA 3G34A 3SS4A 2D02A 1K4FA 1E25A 3BW6A 4GS9A 3C5AA 4WM9A 4E6XA 2V1ZA 3LGOA 4DKIA 1S4SA 1SCWA 3T4TA 1GSVA 4R3BA 3DBAA 1VETA 1K54A 1L0GA 2ZMAA 2RL3A 1OTIA 1XJ2A 1PNEA 2XSSA 5L10A 1ES2A 1GCEA 4JPMA 4P87A 2JN7A 2HF6A 2OAQ1 4BD0A 1PWGA 3LIDA 4UA6A 3N4IA 4WBGA 4C75A 5J8XA 3WS5A 3VV4A 2ZQCA 3AGEA 2OLVA 1KOUA 4RX3A 2VGLS 1IYQA 1OTBA 5CRFA 1BUEA 2GDNA 3HLWA 4LFUA 1CI8A 2V8FA 1S67L 3ICYA 1PW1A 1QMEA 1FSYA 3MQOA 2G2UA 4B9OA 1TDLA 4N1HA 3C7UA 3LR4A 3G6OA 1LHYA 4CLCB 1CJFA 1ESUA 4UQIS 4U0XA 4BMWA 3MXRA 1TVFA 3JVVA 3EWKA 4HHDA 4UAAA 2G2WA 5CHJA 3CHWP 3RXWA 4JF6A 4EUZA 1F2KA 4B93A 5GLCA 4FD8A 2VV8A 4H8RA 3KSFA 3H9WA 4OPRA 4ZJ2A 3ZYTA 1IOUA 1K56A 1P9WA 3KYQA 3NDGA 2DRWA 4ME4A 4GS9B 2ZM2A 4JGOA 1Y54A 4JLFA 4DE2A 3MFXA 1JWZA 4QHCA 2XA7S 3LFVA 1MZUA 2XDMA 3LR0A 3PR6A 3WS1A 1YAXA 2H5SA 5DF9A 3LEQA 3PBRA 4NXGA 2EX8A 4FH4A 3W4QA 4EV4A 1PZOA 4ZDXA 2P7JA 3FC7A 4R38A 4IVKA 4KG6A 3O3VA 2R9XA 2B18A 3CITA 5A92A 4L9FA 1WA9A 2JKTM 4JXWA 2M7UA 3VP4A 4R4SA 1DP6A 4QD4A 5CEBA 3OPPA 4KZAA 2W0NA 2R9WA 5HW3A 2ACGA 3Q7VA 3EQUA 5J3WA 1DP8A 3FPWA 1N9OA 4LCLA 3ITBA 3BFEA 2P74A 3BQ8A 3ZVWA 3UE0A 2NUTC 2IWDA 1XKZA 2EX6A 2AVXA 3Q81A 1T1AA 2M1CA 5TFQA 1YPRA 4HQAA 3KSGA 4FH2A 2ZQAA 3UB6A 1SDEA 2BASA 3L9KA 1YT4A 5E2GA 1MWUA 4PM6A 2PYPA 2WKQA 1LLBA 2V2FF 3QP4A 1GHPA 3GRJA 4DMZA 1KVLA 3LCEA 4LLOB 5G18A 4WMCD 5GHYA 4OP8A 2Y59A 3QP6A 5EVEA 3SH9A 5HX9A 5L07A 2M7VA 1YKDA 2Y2IA 2XH9A 2PD7A 4QY5A 5HAPA 5LBRA 2W3EA 3BECA 3ZNTA 1T18A 1W8YA 4OPZA 1YSPA 1XPBA 1OTAA 1TEMA 3D3OA 3CG5A 3MZDA 1IYOA 2ZD8A 3K3CA 1DRMA 3IF6A 1U60A 3LIFA 3S22A 5FL3A 4GN2A 1VQQA 1L2SA 1MXOA 1BLSA 1NLYA 2QMIA 4DXBA 1ERMA 3UB8A 4ZJ1A 1JVJA 3GQZA 2Z2MB 4KZBA 5HL6A 2W3DA 5GHXA 4JGQA 3KYEA 3C2WA 4EEPA 4O0PA 4EXOA 2J3TD 2JC7A 3RJUA 4Y0TA 2HP9A 4S2JA 1NXYA 2JCHA 4Y0OA 4BBUA 4HJ4A 3UPOA 3MQ0A 3TJZC 3CI6A 5AQ9A 1BZAA 1FCOA 3Q7VB 5DTKA 4IUHA 3S1YA 3PYPA 2GNXA 5EM0A 2J3WA 3MZFA 3ZDJA 4E3MA 4QY6A 1LL5A 2XFTA 5DKKA 2HP5A 2QJ7A 2IA2A 3SZTA 2D01A 3B42A 2J3TC 3IH8A 5FSRA 2J9OA 5DFXA 4NXFA 3BEBA 3A0RA 2WGWA 2P04A 2PBYA 3TE8A 2OLUA 3NBLA 3O86A 3HLBA 2H0YA 1LL8A 2VA0A 4A5RA 4HEFA 2WKHA 1S1ZA 1BLHA 1LI9A 1QMFA 4IBXA 3KSHA 3MJQA 2Y2MA 5HPFA 1NJ4A 4EWFA 5J7EA 1J9MA 3C38A 4Y7PA 2BLSA 4R23A 3E2LA 5HZHA 2WUQA 1ZKJA 1MKMA 4GLQA 4NG2A 4X1LA 1K6SA 1HZOA 3MFDA 1ES4A 3CUEC 3VP0A 2HV1A 1LT0A 2XD1A 5I5LA 2P9VA 1HLUP 3DTMA 4L9GA 1DJAA 4FCFA 2JKRM 3LR5A 2LB5A 1YMXA 2XRNA 3MZEA 3BWLA 3A0SA 4UA7A 2EWWA 2UV0E 1F5MA 2E8JA 2QWSA 5F1FA 2ZM0A 2X71A 4JBFA 4Y17A 4OH0A 4HJ3A 4FOFA 5HAQA 3G35A 5HDDA 4LCMA 5HDSA 5FI2A 1BT5A 1T19A 3E4QA 2C6WB 2V0WA 4C6YA 3IX3A 1OMEA 2LB9A 4WYYA 5KSHA 1K6RA 1GHIA 2PD8A 1IKIA 5AQ7A 3Q1FA 5FDSA 5J4EA 1XX2A 3NECA 4NEED 3C30A 1BULA 3DWKA 2HDRA 3IHBA 1CK3A 2OOLA 3GV9A 3OZHA 3ZNYA 3M2JA 1NLZA 1LSXA 2WGIA 1KDWA 2QKPA 4M4XA 2QYBA 3C4OA 2J80A 2KX6A 3LY3A 4EESA 3LR3A 4L0LA 4ZBEA 2VLGA 3V50A 3NC8A 2CC1A 1F98A 5GLDA 5F5YA 3PBTA 4R1GA 5CGWA 5JYOA 1XGIA 1FQGA 4QU3A 4YWZA 4KQQA 1E3UD 2PYRA 4WL9A 3T4JA 3MSHA 1ES5A 4P85A 3PBOA 4R4RA 1XP4A 2I9VA 5TBMA 5AVEA 1EWZA 5HL1A 2B5RA 2VKSA 5EV0A 3UNWA 1ESIA 4NK3A 2X01A 1KE0A 4LRXC 1W7FA 1K57C 2WKRA 1MWSA 3UDXA 2JKTI 2W1TB 3FG8A 5G4YA 3H82B 5E2FA 1OT9A 4OQIA 4OOYA 2EX9A 5CGXA 3GMWA 1WYBA 1GHMA 3SS5A 2E8IA 2HDSA 5L2FA 2H0TA 2ZC5B 5FQIA 1EW0A 3NOTC 4JXVA 4OONA 4BBTA 1MWRA 1KGEA 3N7WA 4WZ4A 4XXRA 3ZG8B 2V1AA 4FUWA 1W5DA 2XGNA 3N6IA 5FDHA 4JXSA 4UHUA 3DTKA 4HY8A 4Q0JA 2DMWA 1WYCA 3CPTA 5CHMA 3NY4A 4LV2A 4PAUA 1JWPA 4KZ5A 2K31A 3VSKA 4CPKA 4HNBA 2JKFA 3U2AA 1RP5A 4XUXA 1I2SA 3KO6A 3OPHA 3V39A 3K2NA 1S0WA 4HJ6A 4MNRA 2VV7A 5HWWA 2VGKA 4O8GA 3PAEA 1J3WA 2ZBBA 5EVID 3ZVTA 1SZVA 1W8QA 1MBLA 5M19A 5CECA 1N9BA 2HJ9C 2ZM8A 5F82A 3MQQA 2ZLYA 4I5SA 3T4SA 2OWJA 3A0VA 3D9YA 1G6AA 4AFIA 3NOUC 4D2OA 2Y2OA 3LI9A 1PWDA 3HL9A 4E3LA 1STZA 2Y2NA 2V20A 3N8RA 4S2MA 4I3JA 1LL9A 4EQIA 3QNBA 1TD5A 4GB7A 4PPRA 3NOPC 5TBMB 5L8MA 4IHQA 3HBRA 4IBRA 2WK0A 4MEZA 3PBNA 3WS0A 3ZG9B 4Q8IA 2G7UA 1ACFA 3P7NA 2VK3A 1K0KA 3MBZA 4PM5A 1BYWA 3QP2A 2GJ3A 2K2NA 2FH5A 3UY6A 1G28A 3V67A 4U0TA 5KIZA 2ZMVA 3T50A 4GZBA 2X02A 3CUEA 4YOFA 4KUOA 1OPXA 4OLDA 4I3IA 1IYPA 1G6OA 2RCXA 5DFYA 2DCFA 3HLEA 3R7WA 3VOZA 1IFQA 2VJWA 2A3UA 4OLGA 3CZDA 1FCNA 3UE1A 2Y8HA 2Y2JA 2L4RA 2BG1A 5E43A 3CPTB 1BLCA 3GDIA 1VETB 3HJIA 1H8YA 2FZ0A 3VFHA 3G2YA 1XJ3A 3G30A 1OTDA 4QWOA 4R3JA 2VX8A 3B33A 4Y13A 1VB6A 5EOEA 3PTEA 1DY6A 1FIKA 1UWNX 4DDYA 5GLBA 2WAFA 5HPIA 3W4PA 4BD1A 2VGJA 3UPNA 4OQHA 1OT6A 1SKOA 1JTGA 5G4ZA 1Q2QA 3F1PA 3ZHHA 3VFFA 1CF0A 4OPQA 2HPBA 1PI4A 1A0KA 3CWFA 4ID4A 4GHIA 1BTLA 5CTNA 3RTYA 4PHTA 2ZC6B 2EA9A 4RQ9A 1KDSA 1S1YA 5TR7A 4CLCD 2Z2LB 4G3KA 5KZHA 3DTIA 4B4ZA 3OBFA 1P0ZA 1H5XA 1T1CA 5CXWA 2XQZA 3T4LA 4BENA 4WEKA 3RFBA 1D7EA 3CAXA 4DJ3A 2XD5A 3ZGAB 3ISGA 2V0UA 4ZAMA 3OPRA 4F3LA 2WAEA 3RH8B 4K0WA 5HD3A 1UWPX 1TS0A 4MN7A 1DP9A 3HUOA 2OSUA 5DF8A 2PR6A 1Z09A 3IF5A 1UGUA 4MN6A 4ZJ3A 4CLCC 3S7PA 4KZ9A 4B4XA 4MMNA 2Z6DA 2QZ6A 2XEPA 1FOFA 1ZG4A 3T1RA 2WKEA 3BJNA 1XA7A 4GCZA 1ZC2A 3VE4A 2Y55A 1T1BA 4HIAA 3R7WB 1K57A 4B88A 4KQRA 3WS2A 5D3OA 5K5BA 1CEGA 4P6BA 2PT7A 1IYSA 4KZ3A 4JGPA 3G32A 3MMHA 4I38A 4KZ4A 1H8MA 3HLGA 3WRZA 3VP2A 2KLIA 3BFFA 1E3UA 3FWLA 1NZUA 3BM6A 3HREA 3UPPA 3V3SA 4U3TA 1MWTA 2ZC3B 5EECA 3UB7A 3NCKA 2UWXA 4EQ1A 1SKOB 3V3RA 4NETA 1K54C 3F1PB 4OP5A 4WZ5C 2W1RA 3HLDA 4GHIB 3Q82A 4MBHA 2Z6CA 5F68A 3LIEA 4S2PA 3RXXA 1NRFA 5FQJA 1MPLA 4WN5A 4Y0UA 4CQHA 2NUPC 5EOOA 3MS6A 5L09A 3BLSA 5U47A 1TS6A 3G31A 4I3AA 1NZOA 2ZC4B 5FQMA 2PBDP 2Q0OA 2J8YA 5FQKA 2WZZA 1O07A 2FFYA 4RA7A 1O7EA 3HJKA 2KOIA 4EETB 4JXGA 2JE5A 1DJBA 4Y15A 3F1OA 4F3LB 3QP1A 2HJEA 4JF5A 3QHYA 5EE8A 4M3KA 1ONHA 5DF7A 1WE4A 5AJGA 4NKPA 1K25A 2H28A 4YFMA 4E3JA 5FAPA 2WKPA 5EUAA 3O5YA 3T4OA 1YLPA 5CHUA 5CTMA 4GD8A 4BWIA 1Y4OA 2Y2HA 3NJAA 4WLAA 4GJ4A 3IF6B 1PWCA 3JYIA 5F83A 3WRTA 3W4OA 1SKFA 3HVFA 3O87A 4X53A 3LY4A 3GECA 1PI5A 1MY8A 4LRYC 4Y2FA 5CX7A 1YSQA 3MKFA 1AWIA 3EEHA 5DKLA 2W3FA 1ALQA 4MLLA 2ZL1A 4S2LA 5M18A 3CMZA 1RGYA 1CI9A 4F94A 3O88A 5A90A 3E98A 4XUZA 4HBUA 4QB8A 3VMAA 2L0WA 5F1GA 4G3VA 3A3EA 2ZOHA 4K91A 3T4KA 5HSQA 3SW1A 2A49A 4EEUA 5DTSA 5GLAA 1CQAA 1YMSA 4X6TA 1BSGA 5A91A 5HFOA 4PMAA 2XF3A 5KMWA 2O99A 3IXHA 2B02A 1HTZA 1FSWA 3LICA 4KUKA 3F1NA 3C4PA 1RCJA 2HP6A 3OCLA 4E04A 1P97A 2PDRA 3A3DA 1M6KA 2WGWB 1XJ4A 2HZ5A 1D06A 4OKPA 3T1XA 4KZ8A 1L0FA 2ZQ7A 2P08A 5A93A 4EU0A 4KG2A 1K55C 1IELA 1NRJA 3IX4A 2EXAA 1F9IA 1G5UA 4R0QA 5EVLA 5FA7A 3S7NA 5IT5A 3F1OB 4JKTA 3FV7A 2INWA 3TG9A 4DN0A 3EQVA 3IWOA 4JGRA 2XROA 2VEAA 5CERA 3NIAA 5E2EA 3EGXC 1CEFA 3IWIA 3C8CA 1MKIA 4EBPA 2ZJ9A 1LSWA 2C5WB 4LENA 4H6JA 1ES3A 4X68A 5FASA 1HVBA 1V9YA 2A24A 1W79A 4KG5A 3IQAA 1V9ZA 2P9VB 1Y28A 2PU4A 4MCWA 3S7OA 4CLCA 4ETXA 2QPNA 2PHYA 1PW8A 1X0OA 2ZMFA 3AGFA 1W63M 2ZL1B 1PFLA 1VEUA 3JVUA 4MN5A 3DW0A 4ARZA 2XR0A 3HLCA 3IXGA 5BOHA 3G4PA 2EFUA 4WMCA 4P6ZS 1H3QA 3EEAA 4G3WA 1Z6FA 3VOYA 1KE3A 2KDKA 5EFWA 4GW9A 1ONGA 3BY8A 3LO7A 3ZG5A 3NDEA 1BLPA 3MF0A 5A8BA 3E4PA 4E3NA 4GD6A 1W63Q 1XFQA 1XA1A 1LI0A 2J7VA 3F1NB 3E4OA 3FKVA 1TDGA
chains in the Genus database with same CATH topology
5AQ9A 4LV1A 1BZAA 3PTEA 1FCOA 3TSGA 1K4EA 4ZTKA 1AXBA 1DY6A 3IT9A 4DDYA 4RVAA 3Q7VB 5DTKA 5GLBA 2WAFA 3S1YA 4OVDA 5AQAA 4RX2A 5HARA 2EFXA 3W4PA 4BD1A 3GTCA 4DE3A 2VGJA 3MZFA 1PZPA 5FQQA 3UPNA 3VP1A 3FKWA 4OQHA 3ZDJA 4S2NA 4E3MA 4PM9A 4QY6A 1JTGA 2I72A 5FI7A 3C7VA 4WEJA 4WZ5A 1LL5A 1Q2QA 2Y2LA 2XFTA 2HP5A 3HUNA 3ZHHA 3VFFA 3P09A 3BFDA 4OPQA 3UDIA 2HPBA 4X55A 1PI4A 4ID4A 1BTLA 5CTNA 4GKUA 2ZC6B 4E3IA 3IH8A 5FSRA 2ZC7A 2J9OA 4OPYA 1YLTA 1KDSA 4GNUA 5TR7A 2Z2LB 3BEBA 5IHVA 4UA9A 2WGWA 3OPLA 3UO9A 5KZHA 5TGFA 3FZCA 1XXMA 4B4ZA 4HESA 2PBYA 2OLUA 3NBLA 3O86A 1H5XA 3HLBA 5CXWA 1I5QA 1ZG6A 2H0YA 1DJCA 2XQZA 1GA9A 1HD8A 3QNCA 4BENA 4WELA 4C3QA 4A5RA 2Y91A 3MXSA 4HEFA 2WKHA 3HUMA 4GDBA 2DNSA 4WEKA 3B3XA 1FR1A 2ZQ9A 1BLHA 1LI9A 1KVMA 1JTDA 1YLZA 1QMFA 2XLNA 4IBXA 4N9LA 2XD5A 5EVIB 2WADA 3ZGAB 3M2KA 3ISGA 1NYMA 2Y2MA 4ZAMA 3IWQA 3OPRA 3P98A 5EVIC 1NJ4A 5EPHA 2WAEA 4K0WA 4EWFA 2Q9MA 2XK1A 4N92A 2JBFA 2Y2KA 3HUOA 2OSUA 3I7JA 3A3IA 4DE1A 3SOIA 1J9MA 5DF8A 5FQ9A 3IF5A 4Y7PA 3IXBA 2BLSA 1I2WA 4LV3A 4ZJ3A 1KGGA 2HDQA 3TOIA 4IEDA 4R23A 4KZ9A 4B4XA 2WKIA 3E2LA 2WUQA 4DRTA 1ZKJA 4KENB 2PU2A 2XEPA 2QZ6A 4MBFA 3AGDA 1FOFA 1ZG4A 1SHVA 2WKEA 1K6SA 1HZOA 3IF6C 1ES4A 1G68A 3MFDA 1XA7A 3Q07A 3G2ZA 5M1AA 1ZC2A 3VP0A 2XD1A 5FAQA 2Y55A 1E4DA 4IVIA 3DWZA 1K57A 4KZ7A 2P9VA 4B88A 3NI9A 3GVBA 3ZG7B 4KQRA 3WS2A 5D3OA 1CEGA 4FSFA 4P6BA 3A3JA 3DTMA 3GR2A 3ZG0A 1DJAA 3WWXA 1IYSA 4FCFA 3M6HA 3MZEA 3BLMA 3LEZA 1YMXA 1N4OA 4KZ3A 3SS3A 3G34A 4UA7A 3SS4A 1K4FA 1E25A 3G32A 5FATA 4KZ4A 3C5AA 1YQSA 3HLGA 5F1FA 4WM9A 1L0EA 3WRZA 3VP2A 3UN7A 5HAIA 4E6XA 2ZM0A 3BFFA 1E3UA 3FWLA 1NZUA 3BM6A 2X71A 4JBFA 1NY0A 3HREA 3UPPA 3V3SA 4U3TA 4OOLA 1MWTA 2V1ZA 4GDNA 2ZC3B 4K0XA 4OH0A 1YLWA 4DKIA 5EECA 3IXDA 5HAQA 3G35A 3BYDA 4LCMA 1SCWA 1XGJA 4QJGA 3NCKA 2UWXA 5FI2A 1GA0A 4R3BA 1BT5A 3A3FA 2C6WB 3V3RA 4C6YA 4NETA 1K54A 1K54C 1OMEA 4S2NC 1L0GA 4WYYA 4OP5A 4WZ5C 5KSHA 2ZMAA 1S6RA 2RL3A 3VP3A 3IH9A 3HLDA 1K6RA 1GHIA 3Q82A 4MBHA 1IKIA 5AQ7A 3SH8A 1ES2A 3Q1FA 1GCEA 1PIOA 2WYXA 4JPMA 3OCNA 4S2PA 1XX2A 3ZFZA 3RXXA 1NRFA 5FQJA 1MPLA 4P87A 4Y0UA 5EOOA 1BULA 3DWKA 4DDSA 4BD0A 5CEDA 1PWGA 2HDRA 1CK3A 3IHBA 3MKEA 3GV9A 5GL9A 3BLSA 5U47A 4UA6A 3N4IA 3G31A 4OOMA 4WBGA 1NZOA 3OZHA 1K55A 2ZC4B 4C75A 5FQMA 2J8YA 3ZNYA 4CJNA 5J8XA 3M2JA 3N8LA 5FQKA 4E6WA 3WS5A 2ZQCA 2WZZA 3AGEA 5I94A 2OLVA 1FCMA 1O07A 4RX3A 2WGIA 1KDWA 1IYQA 4N9KA 2FFYA 4RA7A 1O7EA 5CRFA 4X69A 3C4OA 1BUEA 2GDNA 3HLWA 1CI8A 4PM7A 1IEMA 4JXGA 2JE5A 1DJBA 3LY3A 2IWCA 4L0LA 4HBTA 1PW1A 4JF5A 1QMEA 4LV0A 4ZBEA 1FSYA 3QHYA 2G2UA 1TDLA 4N1HA 5EE8A 3V50A 3NC8A 4M3KA 3ZCZA 1ONHA 4O7DA 2CC1A 3C7UA 4EBLA 4S2OA 1KGFA 5DF7A 1WE4A 4DXCA 5GLDA 3PBTA 1LHYA 1K25A 4YFMA 1ESUA 4JF4A 4E3JA 1NYYA 5FAPA 5EUAA 1YLPA 4R1GA 5CHUA 4U0XA 5CGWA 1XGIA 1FQGA 4QU3A 5CTMA 5DTTA 5JYOA 4KQQA 3MXRA 1E3UD 1RGZA 1TVFA 1C3BA 4GD8A 4KZ6A 2Y2HA 1ES5A 4P85A 5CHJA 4UAAA 2G2WA 3PBOA 1XP4A 1PWCA 3IF6B 3JYIA 4R4RA 3RXWA 4JF6A 5F83A 4RYEA 3WRTA 3W4OA 1SKFA 4EUZA 5GLCA 1EWZA 4FD8A 5HL1A 3HVFA 3O87A 4X53A 2B5RA 3LY4A 3UNWA 1ESIA 3N8SA 1IKGA 4H8RA 4NK3A 2X01A 1KE0A 4OPRA 1PI5A 1MY8A 1W7FA 4ZJ2A 1K57C 1MWSA 3UDXA 3MKFA 2WZXA 4KQOA 1K56A 2EX2A 5E2FA 1KE4A 2HDUA 4GOGA 1YLYA 2EX9A 3OC2A 4OQIA 4OOYA 3GMWA 5CGXA 1ALQA 3NDGA 2DRWA 4MLLA 4Z9QA 1WYBA 2ZM2A 4S2LA 1Y54A 4JLFA 3Q7ZA 1K38A 1GHMA 5FAOA 3SS5A 5M18A 4DE2A 2E8IA 1JWZA 1RGYA 1CI9A 2HDSA 3CMZA 4BQMA 4F94A 5L2FA 2H0TA 4QHCA 5DVAA 3O88A 2ZC5B 5FQIA 5GHZA 5A90A 1SDNA 4XUZA 3IHAA 4HBUA 3W8KA 4QB8A 2XDMA 2Q9NA 2ZQ8A 3WS1A 4JXVA 2H5SA 4OONA 3BFGA 3VMAA 5F1GA 4BLMA 1MWRA 1KGEA 3N7WA 4WZ4A 4XXRA 3ZG8B 5DF9A 1L0DA 3A3EA 3PBRA 4K91A 2EX8A 4FH4A 3W4QA 1W5DA 4EV4A 2A49A 2XGNA 5DTSA 5E2HA 3S4XA 5GLAA 1PZOA 4ZDXA 3N6IA 5FDHA 1YMSA 4JXSA 4UHUA 5JYPA 1YM1A 1WYCA 5CHMA 3NY4A 4IVKA 1BSGA 1YLJA 4KG6A 3O3VA 4LV2A 4X6TA 5A91A 2R9XA 5CGSA 5HFOA 4X56A 1JWPA 2XF3A 4PMAA 4KZ5A 5KMWA 5A92A 3IXHA 3VSKA 4CPKA 3V5MA 1HTZA 4JXWA 1FSWA 1RP5A 4XUXA 2FFFB 3VP4A 4P0MA 4R4SA 3C4PA 4QD4A 4S2IA 1I2SA 3WS4A 1RCJA 5CEBA 3OPPA 2HP6A 3OCLA 5KSCA 4KZAA 3OPHA 3V39A 3VSLA 2R9WA 5HW3A 3A3DA 5FI6A 3Q7VA 1M6KA 2WGWB 3EQUA 1S0WA 4PM8A 4MNRA 4OKPA 3UDFA 4KZ8A 2VGKA 3PAEA 3D4FA 1L0FA 2ZQ7A 5EVID 3ZVTA 4E3OA 4LCLA 2OV5A 3ITBA 1W8QA 3BFEA 5A93A 2P74A 4KG2A 1MBLA 1K55C 3UE0A 3ZVWA 5M19A 4E3KA 5CECA 2IWDA 1N9BA 1XKZA 1IELA 2EX6A 4OQ0A 4S2KA 2IWBA 2ZM8A 4DF6A 3Q81A 5F82A 2EXAA 3CJMA 5TFQA 4R0QA 5EVLA 5FA7A 4FH2A 2ZLYA 2ZQAA 1SDEA 4JKTA 3FV7A 1K56D 1YT4A 3TG9A 4EBNA 3EQVA 5E2GA 3SH7A 3IWOA 1MWUA 1G6AA 4PM6A 1M40A 2Y2PA 1LLBA 5AQBA 4N1XA 4D2OA 2Y2OA 2V2FF 5CERA 1GHPA 1PWDA 3HL9A 3NIAA 5E2EA 3GRJA 2Y2NA 4E3LA 1CEFA 3HLFA 2V20A 1KVLA 3LCEA 3IWIA 3N8RA 4S2MA 1MKIA 5G18A 1LL9A 4WMCD 4EQIA 4EBPA 2ZJ9A 5GHYA 3QNBA 2C5WB 4LENA 1EROA 1ES3A 4GB7A 4PPRA 4OP8A 4X68A 3UE3A 3BFCA 3E2KA 2Y59A 5FASA 4DE0A 1FR6A 1HVBA 3HBRA 4IBRA 2WK0A 4MEZA 5EVIA 3SH9A 3PBNA 5HX9A 3WS0A 4BL3A 3ZG9B 4BJPA 3FYZA 1W79A 4Q8IA 4KG5A 3IQAA 2Y2IA 1H8ZA 2XH9A 2P9VB 3MBZA 4QY5A 4PM5A 2PU4A 5HAPA 3UY6A 3BECA 3ZNTA 1W8YA 4OPZA 2QPNA 1PW8A 1XPBA 4U0TA 3AGFA 1TEMA 3CG5A 1ERQA 3MZDA 1IYOA 2ZD8A 4GZBA 2X02A 3IF6A 1U60A 4OLDA 1PYYA 3DW0A 2H10A 1VM1A 4OQGA 1IYPA 2XR0A 2RCXA 3HLCA 3S22A 1JWVA 3IXGA 4GN2A 2DCFA 5BOHA 3ITAA 1VQQA 3G4PA 1L2SA 2EFUA 3HLEA 4MBKA 1MXOA 4WMCA 1BLSA 4BL2A 2QMIA 4DXBA 3BRMA 1ERMA 2XFSA 3VOZA 1Z6FA 3PBQA 4ZJ1A 2A3UA 1JVJA 3GQZA 2Z2MB 4OLGA 4YINA 3VOYA 1KE3A 3CZDA 4KZBA 1FCNA 3UE1A 5GHXA 1ONGA 3GSGA 2Y2JA 2Y2QA 2BG1A 1Q2PA 5E43A 2Y2GA 3LO7A 2JC7A 3M6BA 3ZG5A 3RJUA 4Y0TA 1BLCA 3NDEA 3PBSA 3PAGA 2HP9A 2ZQDA 1BLPA 2WGVA 1H8YA 1NXYA 2JCHA 4S2JA 4Y0OA 3VFHA 3G2YA 2EXBA 3G30A 2J9PA 2Y4AA 4R3JA 4E3NA 3UPOA 4GD6A 1XA1A 1EI5A 1LI0A 2J7VA 3FKVA 1TDGA 5EOEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AQ9 A;  4LV1 A;  1BZA A;  3PTE A;  1FCO A;  3TSG A;  1K4E A;  4ZTK A;  1AXB A;  1DY6 A;  3IT9 A;  4DDY A;  4RVA A;  3Q7V B;  5DTK A;  5GLB A;  2WAF A;  3S1Y A;  4OVD A;  5AQA A;  4RX2 A;  5HAR A;  2EFX A;  3W4P A;  4BD1 A;  3GTC A;  4DE3 A;  2VGJ A;  3MZF A;  1PZP A;  5FQQ A;  3UPN A;  3VP1 A;  3FKW A;  4OQH A;  3ZDJ A;  4S2N A;  4E3M A;  4PM9 A;  4QY6 A;  1JTG A;  2I72 A;  5FI7 A;  3C7V A;  4WEJ A;  4WZ5 A;  1LL5 A;  1Q2Q A;  2Y2L A;  2XFT A;  2HP5 A;  3HUN A;  3ZHH A;  3VFF A;  3P09 A;  3BFD A;  4OPQ A;  3UDI A;  2HPB A;  4X55 A;  1PI4 A;  4ID4 A;  1BTL A;  5CTN A;  4GKU A;  2ZC6 B;  4E3I A;  3IH8 A;  5FSR A;  2ZC7 A;  2J9O A;  4OPY A;  1YLT A;  1KDS A;  4GNU A;  5TR7 A;  2Z2L B;  3BEB A;  5IHV A;  4UA9 A;  2WGW A;  3OPL A;  3UO9 A;  5KZH A;  5TGF A;  3FZC A;  1XXM A;  4B4Z A;  4HES A;  2PBY A;  2OLU A;  3NBL A;  3O86 A;  1H5X A;  3HLB A;  5CXW A;  1I5Q A;  1ZG6 A;  2H0Y A;  1DJC A;  2XQZ A;  1GA9 A;  1HD8 A;  3QNC A;  4BEN A;  4WEL A;  4C3Q A;  4A5R A;  2Y91 A;  3MXS A;  4HEF A;  2WKH A;  3HUM A;  4GDB A;  2DNS A;  4WEK A;  3B3X A;  1FR1 A;  2ZQ9 A;  1BLH A;  1LI9 A;  1KVM A;  1JTD A;  1YLZ A;  1QMF A;  2XLN A;  4IBX A;  4N9L A;  2XD5 A;  5EVI B;  2WAD A;  3ZGA B;  3M2K A;  3ISG A;  1NYM A;  2Y2M A;  4ZAM A;  3IWQ A;  3OPR A;  3P98 A;  5EVI C;  1NJ4 A;  5EPH A;  2WAE A;  4K0W A;  4EWF A;  2Q9M A;  2XK1 A;  4N92 A;  2JBF A;  2Y2K A;  3HUO A;  2OSU A;  3I7J A;  3A3I A;  4DE1 A;  3SOI A;  1J9M A;  5DF8 A;  5FQ9 A;  3IF5 A;  4Y7P A;  3IXB A;  2BLS A;  1I2W A;  4LV3 A;  4ZJ3 A;  1KGG A;  2HDQ A;  3TOI A;  4IED A;  4R23 A;  4KZ9 A;  4B4X A;  2WKI A;  3E2L A;  2WUQ A;  4DRT A;  1ZKJ A;  4KEN B;  2PU2 A;  2XEP A;  2QZ6 A;  4MBF A;  3AGD A;  1FOF A;  1ZG4 A;  1SHV A;  2WKE A;  1K6S A;  1HZO A;  3IF6 C;  1ES4 A;  1G68 A;  3MFD A;  1XA7 A;  3Q07 A;  3G2Z A;  5M1A A;  1ZC2 A;  3VP0 A;  2XD1 A;  5FAQ A;  2Y55 A;  1E4D A;  4IVI A;  3DWZ A;  1K57 A;  4KZ7 A;  2P9V A;  4B88 A;  3NI9 A;  3GVB A;  3ZG7 B;  4KQR A;  3WS2 A;  5D3O A;  1CEG A;  4FSF A;  4P6B A;  3A3J A;  3DTM A;  3GR2 A;  3ZG0 A;  1DJA A;  3WWX A;  1IYS A;  4FCF A;  3M6H A;  3MZE A;  3BLM A;  3LEZ A;  1YMX A;  1N4O A;  4KZ3 A;  3SS3 A;  3G34 A;  4UA7 A;  3SS4 A;  1K4F A;  1E25 A;  3G32 A;  5FAT A;  4KZ4 A;  3C5A A;  1YQS A;  3HLG A;  5F1F A;  4WM9 A;  1L0E A;  3WRZ A;  3VP2 A;  3UN7 A;  5HAI A;  4E6X A;  2ZM0 A;  3BFF A;  1E3U A;  3FWL A;  1NZU A;  3BM6 A;  2X71 A;  4JBF A;  1NY0 A;  3HRE A;  3UPP A;  3V3S A;  4U3T A;  4OOL A;  1MWT A;  2V1Z A;  4GDN A;  2ZC3 B;  4K0X A;  4OH0 A;  1YLW A;  4DKI A;  5EEC A;  3IXD A;  5HAQ A;  3G35 A;  3BYD A;  4LCM A;  1SCW A;  1XGJ A;  4QJG A;  3NCK A;  2UWX A;  5FI2 A;  1GA0 A;  4R3B A;  1BT5 A;  3A3F A;  2C6W B;  3V3R A;  4C6Y A;  4NET A;  1K54 A;  1K54 C;  1OME A;  4S2N C;  1L0G A;  4WYY A;  4OP5 A;  4WZ5 C;  5KSH A;  2ZMA A;  1S6R A;  2RL3 A;  3VP3 A;  3IH9 A;  3HLD A;  1K6R A;  1GHI A;  3Q82 A;  4MBH A;  1IKI A;  5AQ7 A;  3SH8 A;  1ES2 A;  3Q1F A;  1GCE A;  1PIO A;  2WYX A;  4JPM A;  3OCN A;  4S2P A;  1XX2 A;  3ZFZ A;  3RXX A;  1NRF A;  5FQJ A;  1MPL A;  4P87 A;  4Y0U A;  5EOO A;  1BUL A;  3DWK A;  4DDS A;  4BD0 A;  5CED A;  1PWG A;  2HDR A;  1CK3 A;  3IHB A;  3MKE A;  3GV9 A;  5GL9 A;  3BLS A;  5U47 A;  4UA6 A;  3N4I A;  3G31 A;  4OOM A;  4WBG A;  1NZO A;  3OZH A;  1K55 A;  2ZC4 B;  4C75 A;  5FQM A;  2J8Y A;  3ZNY A;  4CJN A;  5J8X A;  3M2J A;  3N8L A;  5FQK A;  4E6W A;  3WS5 A;  2ZQC A;  2WZZ A;  3AGE A;  5I94 A;  2OLV A;  1FCM A;  1O07 A;  4RX3 A;  2WGI A;  1KDW A;  1IYQ A;  4N9K A;  2FFY A;  4RA7 A;  1O7E A;  5CRF A;  4X69 A;  3C4O A;  1BUE A;  2GDN A;  3HLW A;  1CI8 A;  4PM7 A;  1IEM A;  4JXG A;  2JE5 A;  1DJB A;  3LY3 A;  2IWC A;  4L0L A;  4HBT A;  1PW1 A;  4JF5 A;  1QME A;  4LV0 A;  4ZBE A;  1FSY A;  3QHY A;  2G2U A;  1TDL A;  4N1H A;  5EE8 A;  3V50 A;  3NC8 A;  4M3K A;  3ZCZ A;  1ONH A;  4O7D A;  2CC1 A;  3C7U A;  4EBL A;  4S2O A;  1KGF A;  5DF7 A;  1WE4 A;  4DXC A;  5GLD A;  3PBT A;  1LHY A;  1K25 A;  4YFM A;  1ESU A;  4JF4 A;  4E3J A;  1NYY A;  5FAP A;  5EUA A;  1YLP A;  4R1G A;  5CHU A;  4U0X A;  5CGW A;  1XGI A;  1FQG A;  4QU3 A;  5CTM A;  5DTT A;  5JYO A;  4KQQ A;  3MXR A;  1E3U D;  1RGZ A;  1TVF A;  1C3B A;  4GD8 A;  4KZ6 A;  2Y2H A;  1ES5 A;  4P85 A;  5CHJ A;  4UAA A;  2G2W A;  3PBO A;  1XP4 A;  1PWC A;  3IF6 B;  3JYI A;  4R4R A;  3RXW A;  4JF6 A;  5F83 A;  4RYE A;  3WRT A;  3W4O A;  1SKF A;  4EUZ A;  5GLC A;  1EWZ A;  4FD8 A;  5HL1 A;  3HVF A;  3O87 A;  4X53 A;  2B5R A;  3LY4 A;  3UNW A;  1ESI A;  3N8S A;  1IKG A;  4H8R A;  4NK3 A;  2X01 A;  1KE0 A;  4OPR A;  1PI5 A;  1MY8 A;  1W7F A;  4ZJ2 A;  1K57 C;  1MWS A;  3UDX A;  3MKF A;  2WZX A;  4KQO A;  1K56 A;  2EX2 A;  5E2F A;  1KE4 A;  2HDU A;  4GOG A;  1YLY A;  2EX9 A;  3OC2 A;  4OQI A;  4OOY A;  3GMW A;  5CGX A;  1ALQ A;  3NDG A;  2DRW A;  4MLL A;  4Z9Q A;  1WYB A;  2ZM2 A;  4S2L A;  1Y54 A;  4JLF A;  3Q7Z A;  1K38 A;  1GHM A;  5FAO A;  3SS5 A;  5M18 A;  4DE2 A;  2E8I A;  1JWZ A;  1RGY A;  1CI9 A;  2HDS A;  3CMZ A;  4BQM A;  4F94 A;  5L2F A;  2H0T A;  4QHC A;  5DVA A;  3O88 A;  2ZC5 B;  5FQI A;  5GHZ A;  5A90 A;  1SDN A;  4XUZ A;  3IHA A;  4HBU A;  3W8K A;  4QB8 A;  2XDM A;  2Q9N A;  2ZQ8 A;  3WS1 A;  4JXV A;  2H5S A;  4OON A;  3BFG A;  3VMA A;  5F1G A;  4BLM A;  1MWR A;  1KGE A;  3N7W A;  4WZ4 A;  4XXR A;  3ZG8 B;  5DF9 A;  1L0D A;  3A3E A;  3PBR A;  4K91 A;  2EX8 A;  4FH4 A;  3W4Q A;  1W5D A;  4EV4 A;  2A49 A;  2XGN A;  5DTS A;  5E2H A;  3S4X A;  5GLA A;  1PZO A;  4ZDX A;  3N6I A;  5FDH A;  1YMS A;  4JXS A;  4UHU A;  5JYP A;  1YM1 A;  1WYC A;  5CHM A;  3NY4 A;  4IVK A;  1BSG A;  1YLJ A;  4KG6 A;  3O3V A;  4LV2 A;  4X6T A;  5A91 A;  2R9X A;  5CGS A;  5HFO A;  4X56 A;  1JWP A;  2XF3 A;  4PMA A;  4KZ5 A;  5KMW A;  5A92 A;  3IXH A;  3VSK A;  4CPK A;  3V5M A;  1HTZ A;  4JXW A;  1FSW A;  1RP5 A;  4XUX A;  2FFF B;  3VP4 A;  4P0M A;  4R4S A;  3C4P A;  4QD4 A;  4S2I A;  1I2S A;  3WS4 A;  1RCJ A;  5CEB A;  3OPP A;  2HP6 A;  3OCL A;  5KSC A;  4KZA A;  3OPH A;  3V39 A;  3VSL A;  2R9W A;  5HW3 A;  3A3D A;  5FI6 A;  3Q7V A;  1M6K A;  2WGW B;  3EQU A;  1S0W A;  4PM8 A;  4MNR A;  4OKP A;  3UDF A;  4KZ8 A;  2VGK A;  3PAE A;  3D4F A;  1L0F A;  2ZQ7 A;  5EVI D;  3ZVT A;  4E3O A;  4LCL A;  2OV5 A;  3ITB A;  1W8Q A;  3BFE A;  5A93 A;  2P74 A;  4KG2 A;  1MBL A;  1K55 C;  3UE0 A;  3ZVW A;  5M19 A;  4E3K A;  5CEC A;  2IWD A;  1N9B A;  1XKZ A;  1IEL A;  2EX6 A;  4OQ0 A;  4S2K A;  2IWB A;  2ZM8 A;  4DF6 A;  3Q81 A;  5F82 A;  2EXA A;  3CJM A;  5TFQ A;  4R0Q A;  5EVL A;  5FA7 A;  4FH2 A;  2ZLY A;  2ZQA A;  1SDE A;  4JKT A;  3FV7 A;  1K56 D;  1YT4 A;  3TG9 A;  4EBN A;  3EQV A;  5E2G A;  3SH7 A;  3IWO A;  1MWU A;  1G6A A;  4PM6 A;  1M40 A;  2Y2P A;  1LLB A;  5AQB A;  4N1X A;  4D2O A;  2Y2O A;  2V2F F;  5CER A;  1GHP A;  1PWD A;  3HL9 A;  3NIA A;  5E2E A;  3GRJ A;  2Y2N A;  4E3L A;  1CEF A;  3HLF A;  2V20 A;  1KVL A;  3LCE A;  3IWI A;  3N8R A;  4S2M A;  1MKI A;  5G18 A;  1LL9 A;  4WMC D;  4EQI A;  4EBP A;  2ZJ9 A;  5GHY A;  3QNB A;  2C5W B;  4LEN A;  1ERO A;  1ES3 A;  4GB7 A;  4PPR A;  4OP8 A;  4X68 A;  3UE3 A;  3BFC A;  3E2K A;  2Y59 A;  5FAS A;  4DE0 A;  1FR6 A;  1HVB A;  3HBR A;  4IBR A;  2WK0 A;  4MEZ A;  5EVI A;  3SH9 A;  3PBN A;  5HX9 A;  3WS0 A;  4BL3 A;  3ZG9 B;  4BJP A;  3FYZ A;  1W79 A;  4Q8I A;  4KG5 A;  3IQA A;  2Y2I A;  1H8Z A;  2XH9 A;  2P9V B;  3MBZ A;  4QY5 A;  4PM5 A;  2PU4 A;  5HAP A;  3UY6 A;  3BEC A;  3ZNT A;  1W8Y A;  4OPZ A;  2QPN A;  1PW8 A;  1XPB A;  4U0T A;  3AGF A;  1TEM A;  3CG5 A;  1ERQ A;  3MZD A;  1IYO A;  2ZD8 A;  4GZB A;  2X02 A;  3IF6 A;  1U60 A;  4OLD A;  1PYY A;  3DW0 A;  2H10 A;  1VM1 A;  4OQG A;  1IYP A;  2XR0 A;  2RCX A;  3HLC A;  3S22 A;  1JWV A;  3IXG A;  4GN2 A;  2DCF A;  5BOH A;  3ITA A;  1VQQ A;  3G4P A;  1L2S A;  2EFU A;  3HLE A;  4MBK A;  1MXO A;  4WMC A;  1BLS A;  4BL2 A;  2QMI A;  4DXB A;  3BRM A;  1ERM A;  2XFS A;  3VOZ A;  1Z6F A;  3PBQ A;  4ZJ1 A;  2A3U A;  1JVJ A;  3GQZ A;  2Z2M B;  4OLG A;  4YIN A;  3VOY A;  1KE3 A;  3CZD A;  4KZB A;  1FCN A;  3UE1 A;  5GHX A;  1ONG A;  3GSG A;  2Y2J A;  2Y2Q A;  2BG1 A;  1Q2P A;  5E43 A;  2Y2G A;  3LO7 A;  2JC7 A;  3M6B A;  3ZG5 A;  3RJU A;  4Y0T A;  1BLC A;  3NDE A;  3PBS A;  3PAG A;  2HP9 A;  2ZQD A;  1BLP A;  2WGV A;  1H8Y A;  1NXY A;  2JCH A;  4S2J A;  4Y0O A;  3VFH A;  3G2Y A;  2EXB A;  3G30 A;  2J9P A;  2Y4A A;  4R3J A;  4E3N A;  3UPO A;  4GD6 A;  1XA1 A;  1EI5 A;  1LI0 A;  2J7V A;  3FKV A;  1TDG A;  5EOE A; 
#chains in the Genus database with same CATH topology
 4I39 A;  4LV1 A;  3TSG A;  1K4E A;  1AXB A;  3IT9 A;  4RVA A;  5FEF A;  4Q0H A;  3MXQ A;  5HAR A;  5DJU A;  3GTC A;  4DE3 A;  5FQQ A;  3VP1 A;  4PM9 A;  3CLO A;  2I72 A;  2PAV P;  5FI7 A;  3C7V A;  4WEJ A;  4WZ5 A;  5HD5 A;  2K7S A;  3BFD A;  4EW7 A;  3UDI A;  3U4L P;  4GKU A;  4E3I A;  4OPY A;  1YLT A;  2PRF A;  2VGL M;  4ZRR A;  2OWH A;  5IHV A;  5TGF A;  3FZC A;  3T1Q B;  1TF1 A;  2JHE A;  4YNR A;  1HD8 A;  4EER A;  4C3Q A;  2Y91 A;  4GDB A;  4H6J B;  4R3A A;  4UQI M;  3S7Q A;  1FR1 A;  2ZQ9 A;  3B47 A;  1KVM A;  1YLZ A;  2XLN A;  1NYM A;  5C5K A;  2A24 B;  2O9B A;  3P98 A;  5EVI C;  4K08 A;  3OLO A;  5EPH A;  2XK1 A;  4N92 A;  3NHQ A;  4EUV A;  3I7J A;  4DE1 A;  5FQ9 A;  4QPR A;  4D60 A;  1GSX A;  1I2W A;  4LV3 A;  4PKY G;  1KGG A;  3TOI A;  4HP9 A;  2WKI A;  1NWZ A;  3EGD C;  4DRT A;  1VEU B;  4KEN B;  2PU2 A;  4MBF A;  2PR5 A;  1OTE A;  1ODV A;  4ARZ B;  1G68 A;  3Q07 A;  3G2Z A;  4NXB A;  1E4D A;  4Z1W A;  4X1M A;  4KZ7 A;  2XA7 M;  3L7H A;  3QP5 A;  3NI9 A;  3GVB A;  5MC7 A;  3A3J A;  4ETZ A;  3GR2 A;  3OOV A;  3EOI A;  3LEZ A;  1N4O A;  4XT2 A;  3SS3 A;  2VZW A;  5FAT A;  3UE6 A;  1YQS A;  1L0E A;  2W3H A;  3UN7 A;  5HAI A;  5F69 A;  2OAP 1;  3TRC A;  1NY0 A;  4OOL A;  4GDN A;  4K0X A;  1YLW A;  3IXD A;  3BYD A;  4QJG A;  1XGJ A;  5HWT A;  1GA0 A;  3A3F A;  2BTF P;  1OJ5 A;  3DTE A;  4S2N C;  2JKG A;  5HWV A;  2A2L A;  2Y79 A;  3HCY A;  1S6R A;  3VP3 A;  3IH9 A;  3SH8 A;  4CLC E;  1PIO A;  2WYX A;  3ZFZ A;  3OCN A;  4LGW A;  2QJ5 A;  2B95 A;  4DDS A;  5CED A;  3MKE A;  5GL9 A;  4OOM A;  1K55 A;  3DAV A;  4CJN A;  3N8L A;  5EM1 A;  4E6W A;  5I94 A;  1ZHH B;  1FCM A;  3QP8 A;  4N9K A;  2JKR I;  4X69 A;  4PM7 A;  1IEM A;  2IWC A;  5TJJ A;  4HBT A;  4LV0 A;  1P9R A;  3ZCZ A;  4O7D A;  3P01 A;  4EBL A;  2V9A A;  4S2O A;  1KGF A;  4DXC A;  2HGV A;  5FEG A;  4JF4 A;  1NYY A;  4X25 A;  3JPU A;  4LPZ A;  5DTT A;  3D72 A;  4KZ6 A;  1RGZ A;  1C3B A;  2W3G A;  1XFN A;  3UB5 P;  4RYE A;  4II7 A;  4KQD A;  3N8S A;  1IKG A;  2W27 A;  2WZX A;  4KQO A;  2EX2 A;  4Y3I A;  4FTX A;  4XT2 B;  1KE4 A;  2HDU A;  4GOG A;  1YLY A;  3OC2 A;  3IX8 A;  4Z9Q A;  3Q7Z A;  1K38 A;  5FAO A;  3UME A;  4HI4 A;  4BQM A;  3UMD A;  4R6L A;  5DVA A;  5GHZ A;  2VV6 A;  1SDN A;  3IHA A;  3W8K A;  2Q9N A;  2ZQ8 A;  3BFG A;  4BLM A;  3IBJ A;  1L0D A;  5E2H A;  3S4X A;  3H7W A;  1H0M A;  5JYP A;  1YM1 A;  3PXP A;  1YLJ A;  5CGS A;  4X56 A;  4R70 A;  1MC0 A;  1GSW A;  1ZTU A;  3V5M A;  2MJ6 A;  1S4R A;  2FFF B;  3FPV A;  4P0M A;  4S2I A;  3WS4 A;  5KSC A;  3TW8 A;  3ULF A;  3VSL A;  3IS2 A;  1S66 L;  4IUK A;  1OJG A;  5FI6 A;  4PM8 A;  1PRQ A;  3UDF A;  4HH2 A;  3D4F A;  4E3O A;  2OV5 A;  3NUL A;  4E3K A;  4S2K A;  4OQ0 A;  2IWB A;  4DF6 A;  3CJM A;  1K56 D;  4EBN A;  3SH7 A;  3KSI A;  1M40 A;  2Y2P A;  5AQB A;  4N1X A;  3HLF A;  1VHM A;  3LYX A;  3LIA A;  1ERO A;  2O0Y A;  3KX0 X;  3UE3 A;  3BFC A;  3E2K A;  4O01 A;  4DE0 A;  1FR6 A;  2GZA A;  5EVI A;  2EWV A;  4BL3 A;  4BJP A;  3FYZ A;  1TS7 A;  1H8Z A;  2O9A A;  4PKY A;  4HP4 A;  2L1M A;  2R78 A;  2O9C A;  4BBV A;  3LI8 A;  3IBR A;  1ERQ A;  3MR0 A;  4HOI A;  2CMN A;  3BQA A;  5AVF A;  1PYY A;  2H10 A;  1VM1 A;  4OQG A;  3T12 B;  1JWV A;  3ITA A;  4MBK A;  4BL2 A;  1JNU A;  4WF0 A;  3BRM A;  2XFS A;  3PBQ A;  4MDZ A;  2W1T A;  4YIN A;  2V8C A;  3VOL A;  3H82 A;  5IU1 A;  1LSV A;  3K3D A;  3GSG A;  3H7W B;  2Y2Q A;  1Q2P A;  2Y2G A;  3M6B A;  3PBS A;  3PAG A;  2ZQD A;  3ZQ5 A;  2WGV A;  3R4K A;  2EXB A;  4HH3 A;  2J9P A;  2Y4A A;  3PHY A;  1XJ6 A;  1EI5 A;  3E0Y A;  2V1B A;  3T1S A;  4ZTK A;  3IS2 B;  4LRZ E;  3UB9 A;  4OVD A;  5AQA A;  4RX2 A;  3LUQ A;  3VE3 A;  2EFX A;  1PZP A;  4WUJ A;  2GX5 A;  3FKW A;  4S2N A;  3LIB A;  2Y2L A;  3HUN A;  1TS8 A;  3P09 A;  5DJT A;  4X55 A;  4IJG A;  1L3L A;  4UEY A;  2ZC7 A;  5F6A A;  3T4Q A;  2YKH A;  5IS1 A;  3W2Z A;  4GNU A;  4Y5F A;  4UA9 A;  3OPL A;  3UO9 A;  1XXM A;  5HDC A;  4HES A;  3BY9 A;  1I5Q A;  1ZG6 A;  1DJC A;  1GA9 A;  3KYZ A;  3QNC A;  2QHK A;  4WEL A;  3MXS A;  4Q0I A;  3HUM A;  2DNS A;  3B3X A;  1JTD A;  4N9L A;  4DJ2 A;  1D1J A;  5EVI B;  2WAD A;  3M2K A;  2ZOI A;  3IWQ A;  4ESP A;  2Q9M A;  2JBF A;  2Y2K A;  3A3I A;  3SOI A;  3IXB A;  2YKF A;  1FIL A;  2HDQ A;  4IED A;  3AGD A;  1SHV A;  3IF6 C;  4L9E A;  5M1A A;  5FAQ A;  4IVI A;  3DWZ A;  1N9N A;  4P6Z M;  3ZG7 B;  4FSF A;  3ZG0 A;  1N9L A;  3WWX A;  4NXE A;  3M6H A;  3BLM A;  3G34 A;  3SS4 A;  2D02 A;  1K4F A;  1E25 A;  3BW6 A;  4GS9 A;  3C5A A;  4WM9 A;  4E6X A;  2V1Z A;  3LGO A;  4DKI A;  1S4S A;  1SCW A;  3T4T A;  1GSV A;  4R3B A;  3DBA A;  1VET A;  1K54 A;  1L0G A;  2ZMA A;  2RL3 A;  1OTI A;  1XJ2 A;  1PNE A;  2XSS A;  5L10 A;  1ES2 A;  1GCE A;  4JPM A;  4P87 A;  2JN7 A;  2HF6 A;  2OAQ 1;  4BD0 A;  1PWG A;  3LID A;  4UA6 A;  3N4I A;  4WBG A;  4C75 A;  5J8X A;  3WS5 A;  3VV4 A;  2ZQC A;  3AGE A;  2OLV A;  1KOU A;  4RX3 A;  2VGL S;  1IYQ A;  1OTB A;  5CRF A;  1BUE A;  2GDN A;  3HLW A;  4LFU A;  1CI8 A;  2V8F A;  1S67 L;  3ICY A;  1PW1 A;  1QME A;  1FSY A;  3MQO A;  2G2U A;  4B9O A;  1TDL A;  4N1H A;  3C7U A;  3LR4 A;  3G6O A;  1LHY A;  4CLC B;  1CJF A;  1ESU A;  4UQI S;  4U0X A;  4BMW A;  3MXR A;  1TVF A;  3JVV A;  3EWK A;  4HHD A;  4UAA A;  2G2W A;  5CHJ A;  3CHW P;  3RXW A;  4JF6 A;  4EUZ A;  1F2K A;  4B93 A;  5GLC A;  4FD8 A;  2VV8 A;  4H8R A;  3KSF A;  3H9W A;  4OPR A;  4ZJ2 A;  3ZYT A;  1IOU A;  1K56 A;  1P9W A;  3KYQ A;  3NDG A;  2DRW A;  4ME4 A;  4GS9 B;  2ZM2 A;  4JGO A;  1Y54 A;  4JLF A;  4DE2 A;  3MFX A;  1JWZ A;  4QHC A;  2XA7 S;  3LFV A;  1MZU A;  2XDM A;  3LR0 A;  3PR6 A;  3WS1 A;  1YAX A;  2H5S A;  5DF9 A;  3LEQ A;  3PBR A;  4NXG A;  2EX8 A;  4FH4 A;  3W4Q A;  4EV4 A;  1PZO A;  4ZDX A;  2P7J A;  3FC7 A;  4R38 A;  4IVK A;  4KG6 A;  3O3V A;  2R9X A;  2B18 A;  3CIT A;  5A92 A;  4L9F A;  1WA9 A;  2JKT M;  4JXW A;  2M7U A;  3VP4 A;  4R4S A;  1DP6 A;  4QD4 A;  5CEB A;  3OPP A;  4KZA A;  2W0N A;  2R9W A;  5HW3 A;  2ACG A;  3Q7V A;  3EQU A;  5J3W A;  1DP8 A;  3FPW A;  1N9O A;  4LCL A;  3ITB A;  3BFE A;  2P74 A;  3BQ8 A;  3ZVW A;  3UE0 A;  2NUT C;  2IWD A;  1XKZ A;  2EX6 A;  2AVX A;  3Q81 A;  1T1A A;  2M1C A;  5TFQ A;  1YPR A;  4HQA A;  3KSG A;  4FH2 A;  2ZQA A;  3UB6 A;  1SDE A;  2BAS A;  3L9K A;  1YT4 A;  5E2G A;  1MWU A;  4PM6 A;  2PYP A;  2WKQ A;  1LLB A;  2V2F F;  3QP4 A;  1GHP A;  3GRJ A;  4DMZ A;  1KVL A;  3LCE A;  4LLO B;  5G18 A;  4WMC D;  5GHY A;  4OP8 A;  2Y59 A;  3QP6 A;  5EVE A;  3SH9 A;  5HX9 A;  5L07 A;  2M7V A;  1YKD A;  2Y2I A;  2XH9 A;  2PD7 A;  4QY5 A;  5HAP A;  5LBR A;  2W3E A;  3BEC A;  3ZNT A;  1T18 A;  1W8Y A;  4OPZ A;  1YSP A;  1XPB A;  1OTA A;  1TEM A;  3D3O A;  3CG5 A;  3MZD A;  1IYO A;  2ZD8 A;  3K3C A;  1DRM A;  3IF6 A;  1U60 A;  3LIF A;  3S22 A;  5FL3 A;  4GN2 A;  1VQQ A;  1L2S A;  1MXO A;  1BLS A;  1NLY A;  2QMI A;  4DXB A;  1ERM A;  3UB8 A;  4ZJ1 A;  1JVJ A;  3GQZ A;  2Z2M B;  4KZB A;  5HL6 A;  2W3D A;  5GHX A;  4JGQ A;  3KYE A;  3C2W A;  4EEP A;  4O0P A;  4EXO A;  2J3T D;  2JC7 A;  3RJU A;  4Y0T A;  2HP9 A;  4S2J A;  1NXY A;  2JCH A;  4Y0O A;  4BBU A;  4HJ4 A;  3UPO A;  3MQ0 A;  3TJZ C;  3CI6 A;  5AQ9 A;  1BZA A;  1FCO A;  3Q7V B;  5DTK A;  4IUH A;  3S1Y A;  3PYP A;  2GNX A;  5EM0 A;  2J3W A;  3MZF A;  3ZDJ A;  4E3M A;  4QY6 A;  1LL5 A;  2XFT A;  5DKK A;  2HP5 A;  2QJ7 A;  2IA2 A;  3SZT A;  2D01 A;  3B42 A;  2J3T C;  3IH8 A;  5FSR A;  2J9O A;  5DFX A;  4NXF A;  3BEB A;  3A0R A;  2WGW A;  2P04 A;  2PBY A;  3TE8 A;  2OLU A;  3NBL A;  3O86 A;  3HLB A;  2H0Y A;  1LL8 A;  2VA0 A;  4A5R A;  4HEF A;  2WKH A;  1S1Z A;  1BLH A;  1LI9 A;  1QMF A;  4IBX A;  3KSH A;  3MJQ A;  2Y2M A;  5HPF A;  1NJ4 A;  4EWF A;  5J7E A;  1J9M A;  3C38 A;  4Y7P A;  2BLS A;  4R23 A;  3E2L A;  5HZH A;  2WUQ A;  1ZKJ A;  1MKM A;  4GLQ A;  4NG2 A;  4X1L A;  1K6S A;  1HZO A;  3MFD A;  1ES4 A;  3CUE C;  3VP0 A;  2HV1 A;  1LT0 A;  2XD1 A;  5I5L A;  2P9V A;  1HLU P;  3DTM A;  4L9G A;  1DJA A;  4FCF A;  2JKR M;  3LR5 A;  2LB5 A;  1YMX A;  2XRN A;  3MZE A;  3BWL A;  3A0S A;  4UA7 A;  2EWW A;  2UV0 E;  1F5M A;  2E8J A;  2QWS A;  5F1F A;  2ZM0 A;  2X71 A;  4JBF A;  4Y17 A;  4OH0 A;  4HJ3 A;  4FOF A;  5HAQ A;  3G35 A;  5HDD A;  4LCM A;  5HDS A;  5FI2 A;  1BT5 A;  1T19 A;  3E4Q A;  2C6W B;  2V0W A;  4C6Y A;  3IX3 A;  1OME A;  2LB9 A;  4WYY A;  5KSH A;  1K6R A;  1GHI A;  2PD8 A;  1IKI A;  5AQ7 A;  3Q1F A;  5FDS A;  5J4E A;  1XX2 A;  3NEC A;  4NEE D;  3C30 A;  1BUL A;  3DWK A;  2HDR A;  3IHB A;  1CK3 A;  2OOL A;  3GV9 A;  3OZH A;  3ZNY A;  3M2J A;  1NLZ A;  1LSX A;  2WGI A;  1KDW A;  2QKP A;  4M4X A;  2QYB A;  3C4O A;  2J80 A;  2KX6 A;  3LY3 A;  4EES A;  3LR3 A;  4L0L A;  4ZBE A;  2VLG A;  3V50 A;  3NC8 A;  2CC1 A;  1F98 A;  5GLD A;  5F5Y A;  3PBT A;  4R1G A;  5CGW A;  5JYO A;  1XGI A;  1FQG A;  4QU3 A;  4YWZ A;  4KQQ A;  1E3U D;  2PYR A;  4WL9 A;  3T4J A;  3MSH A;  1ES5 A;  4P85 A;  3PBO A;  4R4R A;  1XP4 A;  2I9V A;  5TBM A;  5AVE A;  1EWZ A;  5HL1 A;  2B5R A;  2VKS A;  5EV0 A;  3UNW A;  1ESI A;  4NK3 A;  2X01 A;  1KE0 A;  4LRX C;  1W7F A;  1K57 C;  2WKR A;  1MWS A;  3UDX A;  2JKT I;  2W1T B;  3FG8 A;  5G4Y A;  3H82 B;  5E2F A;  1OT9 A;  4OQI A;  4OOY A;  2EX9 A;  5CGX A;  3GMW A;  1WYB A;  1GHM A;  3SS5 A;  2E8I A;  2HDS A;  5L2F A;  2H0T A;  2ZC5 B;  5FQI A;  1EW0 A;  3NOT C;  4JXV A;  4OON A;  4BBT A;  1MWR A;  1KGE A;  3N7W A;  4WZ4 A;  4XXR A;  3ZG8 B;  2V1A A;  4FUW A;  1W5D A;  2XGN A;  3N6I A;  5FDH A;  4JXS A;  4UHU A;  3DTK A;  4HY8 A;  4Q0J A;  2DMW A;  1WYC A;  3CPT A;  5CHM A;  3NY4 A;  4LV2 A;  4PAU A;  1JWP A;  4KZ5 A;  2K31 A;  3VSK A;  4CPK A;  4HNB A;  2JKF A;  3U2A A;  1RP5 A;  4XUX A;  1I2S A;  3KO6 A;  3OPH A;  3V39 A;  3K2N A;  1S0W A;  4HJ6 A;  4MNR A;  2VV7 A;  5HWW A;  2VGK A;  4O8G A;  3PAE A;  1J3W A;  2ZBB A;  5EVI D;  3ZVT A;  1SZV A;  1W8Q A;  1MBL A;  5M19 A;  5CEC A;  1N9B A;  2HJ9 C;  2ZM8 A;  5F82 A;  3MQQ A;  2ZLY A;  4I5S A;  3T4S A;  2OWJ A;  3A0V A;  3D9Y A;  1G6A A;  4AFI A;  3NOU C;  4D2O A;  2Y2O A;  3LI9 A;  1PWD A;  3HL9 A;  4E3L A;  1STZ A;  2Y2N A;  2V20 A;  3N8R A;  4S2M A;  4I3J A;  1LL9 A;  4EQI A;  3QNB A;  1TD5 A;  4GB7 A;  4PPR A;  3NOP C;  5TBM B;  5L8M A;  4IHQ A;  3HBR A;  4IBR A;  2WK0 A;  4MEZ A;  3PBN A;  3WS0 A;  3ZG9 B;  4Q8I A;  2G7U A;  1ACF A;  3P7N A;  2VK3 A;  1K0K A;  3MBZ A;  4PM5 A;  1BYW A;  3QP2 A;  2GJ3 A;  2K2N A;  2FH5 A;  3UY6 A;  1G28 A;  3V67 A;  4U0T A;  5KIZ A;  2ZMV A;  3T50 A;  4GZB A;  2X02 A;  3CUE A;  4YOF A;  4KUO A;  1OPX A;  4OLD A;  4I3I A;  1IYP A;  1G6O A;  2RCX A;  5DFY A;  2DCF A;  3HLE A;  3R7W A;  3VOZ A;  1IFQ A;  2VJW A;  2A3U A;  4OLG A;  3CZD A;  1FCN A;  3UE1 A;  2Y8H A;  2Y2J A;  2L4R A;  2BG1 A;  5E43 A;  3CPT B;  1BLC A;  3GDI A;  1VET B;  3HJI A;  1H8Y A;  2FZ0 A;  3VFH A;  3G2Y A;  1XJ3 A;  3G30 A;  1OTD A;  4QWO A;  4R3J A;  2VX8 A;  3B33 A;  4Y13 A;  1VB6 A;  5EOE A;  3PTE A;  1DY6 A;  1FIK A;  1UWN X;  4DDY A;  5GLB A;  2WAF A;  5HPI A;  3W4P A;  4BD1 A;  2VGJ A;  3UPN A;  4OQH A;  1OT6 A;  1SKO A;  1JTG A;  5G4Z A;  1Q2Q A;  3F1P A;  3ZHH A;  3VFF A;  1CF0 A;  4OPQ A;  2HPB A;  1PI4 A;  1A0K A;  3CWF A;  4ID4 A;  4GHI A;  1BTL A;  5CTN A;  3RTY A;  4PHT A;  2ZC6 B;  2EA9 A;  4RQ9 A;  1KDS A;  1S1Y A;  5TR7 A;  4CLC D;  2Z2L B;  4G3K A;  5KZH A;  3DTI A;  4B4Z A;  3OBF A;  1P0Z A;  1H5X A;  1T1C A;  5CXW A;  2XQZ A;  3T4L A;  4BEN A;  4WEK A;  3RFB A;  1D7E A;  3CAX A;  4DJ3 A;  2XD5 A;  3ZGA B;  3ISG A;  2V0U A;  4ZAM A;  3OPR A;  4F3L A;  2WAE A;  3RH8 B;  4K0W A;  5HD3 A;  1UWP X;  1TS0 A;  4MN7 A;  1DP9 A;  3HUO A;  2OSU A;  5DF8 A;  2PR6 A;  1Z09 A;  3IF5 A;  1UGU A;  4MN6 A;  4ZJ3 A;  4CLC C;  3S7P A;  4KZ9 A;  4B4X A;  4MMN A;  2Z6D A;  2QZ6 A;  2XEP A;  1FOF A;  1ZG4 A;  3T1R A;  2WKE A;  3BJN A;  1XA7 A;  4GCZ A;  1ZC2 A;  3VE4 A;  2Y55 A;  1T1B A;  4HIA A;  3R7W B;  1K57 A;  4B88 A;  4KQR A;  3WS2 A;  5D3O A;  5K5B A;  1CEG A;  4P6B A;  2PT7 A;  1IYS A;  4KZ3 A;  4JGP A;  3G32 A;  3MMH A;  4I38 A;  4KZ4 A;  1H8M A;  3HLG A;  3WRZ A;  3VP2 A;  2KLI A;  3BFF A;  1E3U A;  3FWL A;  1NZU A;  3BM6 A;  3HRE A;  3UPP A;  3V3S A;  4U3T A;  1MWT A;  2ZC3 B;  5EEC A;  3UB7 A;  3NCK A;  2UWX A;  4EQ1 A;  1SKO B;  3V3R A;  4NET A;  1K54 C;  3F1P B;  4OP5 A;  4WZ5 C;  2W1R A;  3HLD A;  4GHI B;  3Q82 A;  4MBH A;  2Z6C A;  5F68 A;  3LIE A;  4S2P A;  3RXX A;  1NRF A;  5FQJ A;  1MPL A;  4WN5 A;  4Y0U A;  4CQH A;  2NUP C;  5EOO A;  3MS6 A;  5L09 A;  3BLS A;  5U47 A;  1TS6 A;  3G31 A;  4I3A A;  1NZO A;  2ZC4 B;  5FQM A;  2PBD P;  2Q0O A;  2J8Y A;  5FQK A;  2WZZ A;  1O07 A;  2FFY A;  4RA7 A;  1O7E A;  3HJK A;  2KOI A;  4EET B;  4JXG A;  2JE5 A;  1DJB A;  4Y15 A;  3F1O A;  4F3L B;  3QP1 A;  2HJE A;  4JF5 A;  3QHY A;  5EE8 A;  4M3K A;  1ONH A;  5DF7 A;  1WE4 A;  5AJG A;  4NKP A;  1K25 A;  2H28 A;  4YFM A;  4E3J A;  5FAP A;  2WKP A;  5EUA A;  3O5Y A;  3T4O A;  1YLP A;  5CHU A;  5CTM A;  4GD8 A;  4BWI A;  1Y4O A;  2Y2H A;  3NJA A;  4WLA A;  4GJ4 A;  3IF6 B;  1PWC A;  3JYI A;  5F83 A;  3WRT A;  3W4O A;  1SKF A;  3HVF A;  3O87 A;  4X53 A;  3LY4 A;  3GEC A;  1PI5 A;  1MY8 A;  4LRY C;  4Y2F A;  5CX7 A;  1YSQ A;  3MKF A;  1AWI A;  3EEH A;  5DKL A;  2W3F A;  1ALQ A;  4MLL A;  2ZL1 A;  4S2L A;  5M18 A;  3CMZ A;  1RGY A;  1CI9 A;  4F94 A;  3O88 A;  5A90 A;  3E98 A;  4XUZ A;  4HBU A;  4QB8 A;  3VMA A;  2L0W A;  5F1G A;  4G3V A;  3A3E A;  2ZOH A;  4K91 A;  3T4K A;  5HSQ A;  3SW1 A;  2A49 A;  4EEU A;  5DTS A;  5GLA A;  1CQA A;  1YMS A;  4X6T A;  1BSG A;  5A91 A;  5HFO A;  4PMA A;  2XF3 A;  5KMW A;  2O99 A;  3IXH A;  2B02 A;  1HTZ A;  1FSW A;  3LIC A;  4KUK A;  3F1N A;  3C4P A;  1RCJ A;  2HP6 A;  3OCL A;  4E04 A;  1P97 A;  2PDR A;  3A3D A;  1M6K A;  2WGW B;  1XJ4 A;  2HZ5 A;  1D06 A;  4OKP A;  3T1X A;  4KZ8 A;  1L0F A;  2ZQ7 A;  2P08 A;  5A93 A;  4EU0 A;  4KG2 A;  1K55 C;  1IEL A;  1NRJ A;  3IX4 A;  2EXA A;  1F9I A;  1G5U A;  4R0Q A;  5EVL A;  5FA7 A;  3S7N A;  5IT5 A;  3F1O B;  4JKT A;  3FV7 A;  2INW A;  3TG9 A;  4DN0 A;  3EQV A;  3IWO A;  4JGR A;  2XRO A;  2VEA A;  5CER A;  3NIA A;  5E2E A;  3EGX C;  1CEF A;  3IWI A;  3C8C A;  1MKI A;  4EBP A;  2ZJ9 A;  1LSW A;  2C5W B;  4LEN A;  4H6J A;  1ES3 A;  4X68 A;  5FAS A;  1HVB A;  1V9Y A;  2A24 A;  1W79 A;  4KG5 A;  3IQA A;  1V9Z A;  2P9V B;  1Y28 A;  2PU4 A;  4MCW A;  3S7O A;  4CLC A;  4ETX A;  2QPN A;  2PHY A;  1PW8 A;  1X0O A;  2ZMF A;  3AGF A;  1W63 M;  2ZL1 B;  1PFL A;  1VEU A;  3JVU A;  4MN5 A;  3DW0 A;  4ARZ A;  2XR0 A;  3HLC A;  3IXG A;  5BOH A;  3G4P A;  2EFU A;  4WMC A;  4P6Z S;  1H3Q A;  3EEA A;  4G3W A;  1Z6F A;  3VOY A;  1KE3 A;  2KDK A;  5EFW A;  4GW9 A;  1ONG A;  3BY8 A;  3LO7 A;  3ZG5 A;  3NDE A;  1BLP A;  3MF0 A;  5A8B A;  3E4P A;  4E3N A;  4GD6 A;  1W63 Q;  1XFQ A;  1XA1 A;  1LI0 A;  2J7V A;  3F1N B;  3E4O A;  3FKV A;  1TDG A; 
#chains in the Genus database with same CATH homology
 5AQ9 A;  4LV1 A;  1BZA A;  3PTE A;  1FCO A;  3TSG A;  1K4E A;  4ZTK A;  1AXB A;  1DY6 A;  3IT9 A;  4DDY A;  4RVA A;  3Q7V B;  5DTK A;  5GLB A;  2WAF A;  3S1Y A;  4OVD A;  5AQA A;  4RX2 A;  5HAR A;  2EFX A;  3W4P A;  4BD1 A;  3GTC A;  4DE3 A;  2VGJ A;  3MZF A;  1PZP A;  5FQQ A;  3UPN A;  3VP1 A;  3FKW A;  4OQH A;  3ZDJ A;  4S2N A;  4E3M A;  4PM9 A;  4QY6 A;  1JTG A;  2I72 A;  5FI7 A;  3C7V A;  4WEJ A;  4WZ5 A;  1LL5 A;  1Q2Q A;  2Y2L A;  2XFT A;  2HP5 A;  3HUN A;  3ZHH A;  3VFF A;  3P09 A;  3BFD A;  4OPQ A;  3UDI A;  2HPB A;  4X55 A;  1PI4 A;  4ID4 A;  1BTL A;  5CTN A;  4GKU A;  2ZC6 B;  4E3I A;  3IH8 A;  5FSR A;  2ZC7 A;  2J9O A;  4OPY A;  1YLT A;  1KDS A;  4GNU A;  5TR7 A;  2Z2L B;  3BEB A;  5IHV A;  4UA9 A;  2WGW A;  3OPL A;  3UO9 A;  5KZH A;  5TGF A;  3FZC A;  1XXM A;  4B4Z A;  4HES A;  2PBY A;  2OLU A;  3NBL A;  3O86 A;  1H5X A;  3HLB A;  5CXW A;  1I5Q A;  1ZG6 A;  2H0Y A;  1DJC A;  2XQZ A;  1GA9 A;  1HD8 A;  3QNC A;  4BEN A;  4WEL A;  4C3Q A;  4A5R A;  2Y91 A;  3MXS A;  4HEF A;  2WKH A;  3HUM A;  4GDB A;  2DNS A;  4WEK A;  3B3X A;  1FR1 A;  2ZQ9 A;  1BLH A;  1LI9 A;  1KVM A;  1JTD A;  1YLZ A;  1QMF A;  2XLN A;  4IBX A;  4N9L A;  2XD5 A;  5EVI B;  2WAD A;  3ZGA B;  3M2K A;  3ISG A;  1NYM A;  2Y2M A;  4ZAM A;  3IWQ A;  3OPR A;  3P98 A;  5EVI C;  1NJ4 A;  5EPH A;  2WAE A;  4K0W A;  4EWF A;  2Q9M A;  2XK1 A;  4N92 A;  2JBF A;  2Y2K A;  3HUO A;  2OSU A;  3I7J A;  3A3I A;  4DE1 A;  3SOI A;  1J9M A;  5DF8 A;  5FQ9 A;  3IF5 A;  4Y7P A;  3IXB A;  2BLS A;  1I2W A;  4LV3 A;  4ZJ3 A;  1KGG A;  2HDQ A;  3TOI A;  4IED A;  4R23 A;  4KZ9 A;  4B4X A;  2WKI A;  3E2L A;  2WUQ A;  4DRT A;  1ZKJ A;  4KEN B;  2PU2 A;  2XEP A;  2QZ6 A;  4MBF A;  3AGD A;  1FOF A;  1ZG4 A;  1SHV A;  2WKE A;  1K6S A;  1HZO A;  3IF6 C;  1ES4 A;  1G68 A;  3MFD A;  1XA7 A;  3Q07 A;  3G2Z A;  5M1A A;  1ZC2 A;  3VP0 A;  2XD1 A;  5FAQ A;  2Y55 A;  1E4D A;  4IVI A;  3DWZ A;  1K57 A;  4KZ7 A;  2P9V A;  4B88 A;  3NI9 A;  3GVB A;  3ZG7 B;  4KQR A;  3WS2 A;  5D3O A;  1CEG A;  4FSF A;  4P6B A;  3A3J A;  3DTM A;  3GR2 A;  3ZG0 A;  1DJA A;  3WWX A;  1IYS A;  4FCF A;  3M6H A;  3MZE A;  3BLM A;  3LEZ A;  1YMX A;  1N4O A;  4KZ3 A;  3SS3 A;  3G34 A;  4UA7 A;  3SS4 A;  1K4F A;  1E25 A;  3G32 A;  5FAT A;  4KZ4 A;  3C5A A;  1YQS A;  3HLG A;  5F1F A;  4WM9 A;  1L0E A;  3WRZ A;  3VP2 A;  3UN7 A;  5HAI A;  4E6X A;  2ZM0 A;  3BFF A;  1E3U A;  3FWL A;  1NZU A;  3BM6 A;  2X71 A;  4JBF A;  1NY0 A;  3HRE A;  3UPP A;  3V3S A;  4U3T A;  4OOL A;  1MWT A;  2V1Z A;  4GDN A;  2ZC3 B;  4K0X A;  4OH0 A;  1YLW A;  4DKI A;  5EEC A;  3IXD A;  5HAQ A;  3G35 A;  3BYD A;  4LCM A;  1SCW A;  1XGJ A;  4QJG A;  3NCK A;  2UWX A;  5FI2 A;  1GA0 A;  4R3B A;  1BT5 A;  3A3F A;  2C6W B;  3V3R A;  4C6Y A;  4NET A;  1K54 A;  1K54 C;  1OME A;  4S2N C;  1L0G A;  4WYY A;  4OP5 A;  4WZ5 C;  5KSH A;  2ZMA A;  1S6R A;  2RL3 A;  3VP3 A;  3IH9 A;  3HLD A;  1K6R A;  1GHI A;  3Q82 A;  4MBH A;  1IKI A;  5AQ7 A;  3SH8 A;  1ES2 A;  3Q1F A;  1GCE A;  1PIO A;  2WYX A;  4JPM A;  3OCN A;  4S2P A;  1XX2 A;  3ZFZ A;  3RXX A;  1NRF A;  5FQJ A;  1MPL A;  4P87 A;  4Y0U A;  5EOO A;  1BUL A;  3DWK A;  4DDS A;  4BD0 A;  5CED A;  1PWG A;  2HDR A;  1CK3 A;  3IHB A;  3MKE A;  3GV9 A;  5GL9 A;  3BLS A;  5U47 A;  4UA6 A;  3N4I A;  3G31 A;  4OOM A;  4WBG A;  1NZO A;  3OZH A;  1K55 A;  2ZC4 B;  4C75 A;  5FQM A;  2J8Y A;  3ZNY A;  4CJN A;  5J8X A;  3M2J A;  3N8L A;  5FQK A;  4E6W A;  3WS5 A;  2ZQC A;  2WZZ A;  3AGE A;  5I94 A;  2OLV A;  1FCM A;  1O07 A;  4RX3 A;  2WGI A;  1KDW A;  1IYQ A;  4N9K A;  2FFY A;  4RA7 A;  1O7E A;  5CRF A;  4X69 A;  3C4O A;  1BUE A;  2GDN A;  3HLW A;  1CI8 A;  4PM7 A;  1IEM A;  4JXG A;  2JE5 A;  1DJB A;  3LY3 A;  2IWC A;  4L0L A;  4HBT A;  1PW1 A;  4JF5 A;  1QME A;  4LV0 A;  4ZBE A;  1FSY A;  3QHY A;  2G2U A;  1TDL A;  4N1H A;  5EE8 A;  3V50 A;  3NC8 A;  4M3K A;  3ZCZ A;  1ONH A;  4O7D A;  2CC1 A;  3C7U A;  4EBL A;  4S2O A;  1KGF A;  5DF7 A;  1WE4 A;  4DXC A;  5GLD A;  3PBT A;  1LHY A;  1K25 A;  4YFM A;  1ESU A;  4JF4 A;  4E3J A;  1NYY A;  5FAP A;  5EUA A;  1YLP A;  4R1G A;  5CHU A;  4U0X A;  5CGW A;  1XGI A;  1FQG A;  4QU3 A;  5CTM A;  5DTT A;  5JYO A;  4KQQ A;  3MXR A;  1E3U D;  1RGZ A;  1TVF A;  1C3B A;  4GD8 A;  4KZ6 A;  2Y2H A;  1ES5 A;  4P85 A;  5CHJ A;  4UAA A;  2G2W A;  3PBO A;  1XP4 A;  1PWC A;  3IF6 B;  3JYI A;  4R4R A;  3RXW A;  4JF6 A;  5F83 A;  4RYE A;  3WRT A;  3W4O A;  1SKF A;  4EUZ A;  5GLC A;  1EWZ A;  4FD8 A;  5HL1 A;  3HVF A;  3O87 A;  4X53 A;  2B5R A;  3LY4 A;  3UNW A;  1ESI A;  3N8S A;  1IKG A;  4H8R A;  4NK3 A;  2X01 A;  1KE0 A;  4OPR A;  1PI5 A;  1MY8 A;  1W7F A;  4ZJ2 A;  1K57 C;  1MWS A;  3UDX A;  3MKF A;  2WZX A;  4KQO A;  1K56 A;  2EX2 A;  5E2F A;  1KE4 A;  2HDU A;  4GOG A;  1YLY A;  2EX9 A;  3OC2 A;  4OQI A;  4OOY A;  3GMW A;  5CGX A;  1ALQ A;  3NDG A;  2DRW A;  4MLL A;  4Z9Q A;  1WYB A;  2ZM2 A;  4S2L A;  1Y54 A;  4JLF A;  3Q7Z A;  1K38 A;  1GHM A;  5FAO A;  3SS5 A;  5M18 A;  4DE2 A;  2E8I A;  1JWZ A;  1RGY A;  1CI9 A;  2HDS A;  3CMZ A;  4BQM A;  4F94 A;  5L2F A;  2H0T A;  4QHC A;  5DVA A;  3O88 A;  2ZC5 B;  5FQI A;  5GHZ A;  5A90 A;  1SDN A;  4XUZ A;  3IHA A;  4HBU A;  3W8K A;  4QB8 A;  2XDM A;  2Q9N A;  2ZQ8 A;  3WS1 A;  4JXV A;  2H5S A;  4OON A;  3BFG A;  3VMA A;  5F1G A;  4BLM A;  1MWR A;  1KGE A;  3N7W A;  4WZ4 A;  4XXR A;  3ZG8 B;  5DF9 A;  1L0D A;  3A3E A;  3PBR A;  4K91 A;  2EX8 A;  4FH4 A;  3W4Q A;  1W5D A;  4EV4 A;  2A49 A;  2XGN A;  5DTS A;  5E2H A;  3S4X A;  5GLA A;  1PZO A;  4ZDX A;  3N6I A;  5FDH A;  1YMS A;  4JXS A;  4UHU A;  5JYP A;  1YM1 A;  1WYC A;  5CHM A;  3NY4 A;  4IVK A;  1BSG A;  1YLJ A;  4KG6 A;  3O3V A;  4LV2 A;  4X6T A;  5A91 A;  2R9X A;  5CGS A;  5HFO A;  4X56 A;  1JWP A;  2XF3 A;  4PMA A;  4KZ5 A;  5KMW A;  5A92 A;  3IXH A;  3VSK A;  4CPK A;  3V5M A;  1HTZ A;  4JXW A;  1FSW A;  1RP5 A;  4XUX A;  2FFF B;  3VP4 A;  4P0M A;  4R4S A;  3C4P A;  4QD4 A;  4S2I A;  1I2S A;  3WS4 A;  1RCJ A;  5CEB A;  3OPP A;  2HP6 A;  3OCL A;  5KSC A;  4KZA A;  3OPH A;  3V39 A;  3VSL A;  2R9W A;  5HW3 A;  3A3D A;  5FI6 A;  3Q7V A;  1M6K A;  2WGW B;  3EQU A;  1S0W A;  4PM8 A;  4MNR A;  4OKP A;  3UDF A;  4KZ8 A;  2VGK A;  3PAE A;  3D4F A;  1L0F A;  2ZQ7 A;  5EVI D;  3ZVT A;  4E3O A;  4LCL A;  2OV5 A;  3ITB A;  1W8Q A;  3BFE A;  5A93 A;  2P74 A;  4KG2 A;  1MBL A;  1K55 C;  3UE0 A;  3ZVW A;  5M19 A;  4E3K A;  5CEC A;  2IWD A;  1N9B A;  1XKZ A;  1IEL A;  2EX6 A;  4OQ0 A;  4S2K A;  2IWB A;  2ZM8 A;  4DF6 A;  3Q81 A;  5F82 A;  2EXA A;  3CJM A;  5TFQ A;  4R0Q A;  5EVL A;  5FA7 A;  4FH2 A;  2ZLY A;  2ZQA A;  1SDE A;  4JKT A;  3FV7 A;  1K56 D;  1YT4 A;  3TG9 A;  4EBN A;  3EQV A;  5E2G A;  3SH7 A;  3IWO A;  1MWU A;  1G6A A;  4PM6 A;  1M40 A;  2Y2P A;  1LLB A;  5AQB A;  4N1X A;  4D2O A;  2Y2O A;  2V2F F;  5CER A;  1GHP A;  1PWD A;  3HL9 A;  3NIA A;  5E2E A;  3GRJ A;  2Y2N A;  4E3L A;  1CEF A;  3HLF A;  2V20 A;  1KVL A;  3LCE A;  3IWI A;  3N8R A;  4S2M A;  1MKI A;  5G18 A;  1LL9 A;  4WMC D;  4EQI A;  4EBP A;  2ZJ9 A;  5GHY A;  3QNB A;  2C5W B;  4LEN A;  1ERO A;  1ES3 A;  4GB7 A;  4PPR A;  4OP8 A;  4X68 A;  3UE3 A;  3BFC A;  3E2K A;  2Y59 A;  5FAS A;  4DE0 A;  1FR6 A;  1HVB A;  3HBR A;  4IBR A;  2WK0 A;  4MEZ A;  5EVI A;  3SH9 A;  3PBN A;  5HX9 A;  3WS0 A;  4BL3 A;  3ZG9 B;  4BJP A;  3FYZ A;  1W79 A;  4Q8I A;  4KG5 A;  3IQA A;  2Y2I A;  1H8Z A;  2XH9 A;  2P9V B;  3MBZ A;  4QY5 A;  4PM5 A;  2PU4 A;  5HAP A;  3UY6 A;  3BEC A;  3ZNT A;  1W8Y A;  4OPZ A;  2QPN A;  1PW8 A;  1XPB A;  4U0T A;  3AGF A;  1TEM A;  3CG5 A;  1ERQ A;  3MZD A;  1IYO A;  2ZD8 A;  4GZB A;  2X02 A;  3IF6 A;  1U60 A;  4OLD A;  1PYY A;  3DW0 A;  2H10 A;  1VM1 A;  4OQG A;  1IYP A;  2XR0 A;  2RCX A;  3HLC A;  3S22 A;  1JWV A;  3IXG A;  4GN2 A;  2DCF A;  5BOH A;  3ITA A;  1VQQ A;  3G4P A;  1L2S A;  2EFU A;  3HLE A;  4MBK A;  1MXO A;  4WMC A;  1BLS A;  4BL2 A;  2QMI A;  4DXB A;  3BRM A;  1ERM A;  2XFS A;  3VOZ A;  1Z6F A;  3PBQ A;  4ZJ1 A;  2A3U A;  1JVJ A;  3GQZ A;  2Z2M B;  4OLG A;  4YIN A;  3VOY A;  1KE3 A;  3CZD A;  4KZB A;  1FCN A;  3UE1 A;  5GHX A;  1ONG A;  3GSG A;  2Y2J A;  2Y2Q A;  2BG1 A;  1Q2P A;  5E43 A;  2Y2G A;  3LO7 A;  2JC7 A;  3M6B A;  3ZG5 A;  3RJU A;  4Y0T A;  1BLC A;  3NDE A;  3PBS A;  3PAG A;  2HP9 A;  2ZQD A;  1BLP A;  2WGV A;  1H8Y A;  1NXY A;  2JCH A;  4S2J A;  4Y0O A;  3VFH A;  3G2Y A;  2EXB A;  3G30 A;  2J9P A;  2Y4A A;  4R3J A;  4E3N A;  3UPO A;  4GD6 A;  1XA1 A;  1EI5 A;  1LI0 A;  2J7V A;  3FKV A;  1TDG A;  5EOE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...