1PZPA

Tem-1 beta-lactamase in complex with a novel, core-disrupting, allosteric inhibitor
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
263
structure length
263
Chain Sequence
b'HPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQRDLVEYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase TEM
molecule tags Hydrolase
source organism Escherichia coli
publication title Allosteric inhibition through core disruption.
pubmed doi rcsb
total genus 93
structure length 263
sequence length 263
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2003-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1pzpA00
4OP5A 3RJUA 3BM6A 5FAOA 4LV0A 3GV9A 1N4OA 2JBFA 1CEFA 2J9PA 1L0EA 1W8QA 2A3UA 3CZDA 1LL9A 1Y54A 4RX3A 1L0FA 2V2FF 3TSGA 1HTZA 2QMIA 4WZ5A 4JF6A 2ZC5B 1O07A 3LCEA 1LLBA 3OC2A 4HESA 1XX2A 3WRZA 4KZ3A 3WS4A 3UN7A 4A5RA 1YLZA 1FQGA 2ZD8A 2Q9NA 3GVBA 4RVAA 1NZOA 4X56A 4IBRA 1KGEA 4P6BA 1PIOA 3SH9A 2XD1A 1BLPA 4U0TA 3HUNA 3VP4A 4NETA 1RCJA 2WGWB 2JE5A 1Q2PA 1CI9A 5D3OA 4EQIA 5G18A 2IWCA 2OV5A 4E3KA 2V1ZA 1LL5A 3S1YA 4JLFA 3UDXA 3ITAA 1L0GA 1MWSA 3IWOA 3G4PA 3E2KA 1E25A 1G68A 5FAPA 3VP2A 1NRFA 1PI5A 3VFFA 4BL3A 3WWXA 3VP1A 1CEGA 2C6WB 2DCFA 3HLCA 3BYDA 3W4PA 5CEDA 4GD8A 1BUEA 4WEJA 3WS1A 4KQQA 1RGYA 3FWLA 3UE0A 3OPPA 3HUOA 4DE0A 5CXWA 5GLCA 2XD5A 3CMZA 4KZBA 2ZM2A 3OZHA 4U0XA 5F82A 3W4OA 5EVIB 2Y55A 4GB7A 4R4SA 3NDGA 5EUAA 2WAFA 2XFSA 4R4RA 3S22A 5HW3A 4OOMA 2XGNA 1XP4A 4KG6A 5M1AA 5DVAA 3UO9A 1XGJA 1DJBA 4IVKA 1IKIA 2WZZA 1FSWA 4S2IA 4BJPA 4DE3A 2WGIA 5TGFA 4N9LA 3FZCA 2ZC6B 5DTSA 2EXAA 3TOIA 5M19A 1W8YA 2BG1A 2J7VA 4X55A 4OP8A 4QJGA 3HUMA 3IF6A 3Q1FA 5E2HA 4E3NA 1KE3A 4KENB 4U3TA 4M3KA 5CGSA 1CI8A 5CERA 3M6HA 4GDNA 3PBNA 1HZOA 1XKZA 1ERMA 1K56D 2ZC3B 1BT5A 2ZQAA 3G35A 1KGGA 2R9XA 3EQUA 2ZQ8A 5A91A 4EBPA 1BTLA 1IKGA 2I72A 1NXYA 4P85A 3WS2A 1EI5A 1WYCA 1H5XA 2C5WB 5FQKA 1JTGA 3ZFZA 3G32A 1FOFA 1HVBA 2Z2MB 3DWKA 5HARA 4ZTKA 3Q7ZA 4S2LA 4Q8IA 4GNUA 1SCWA 1YLPA 1AXBA 3NIAA 2HDUA 1ZC2A 2B5RA 1TEMA 5AQ7A 5AQ9A 4LCMA 3IF6C 5HAQA 4JF5A 1KVMA 2Y2KA 5DTTA 2EX8A 2XR0A 3ZG5A 4ZAMA 5F83A 3UY6A 5DTKA 4GKUA 2Y4AA 1IYQA 3IXGA 4Y0UA 4QHCA 1MKIA 3HLDA 5FQIA 2OLUA 2WZXA 1MBLA 4LV1A 4O7DA 2Y2HA 3VOZA 4JBFA 3HLGA 1K6SA 5E43A 2WUQA 2HP5A 4S2KA 3Q7VA 4X53A 5EOEA 5FI2A 1SKFA 1FSYA 4JF4A 5KMWA 1GA9A 1K55C 1ZKJA 5KSHA 1L2SA 1S0WA 4OQIA 2Y2IA 3HLEA 5J8XA 1OMEA 1J9MA 1SDEA 2P74A 3NI9A 3G30A 1NY0A 1KDSA 5HAPA 3V39A 1ONGA 2IWDA 4E6XA 1KVLA 3OCLA 4QY5A 3UE1A 5CEBA 1K54C 5CGWA 1WE4A 3N7WA 4BENA 3UDIA 4C75A 3PTEA 3ZG9B 3PBTA 2Y59A 3LO7A 4UHUA 1PYYA 3IT9A 4KZ4A 3O3VA 2JCHA 3ZDJA 2WYXA 4S2NA 4B4XA 4OQ0A 2FFFB 4OQHA 1WYBA 1IYSA 2ZQCA 3SOIA 3IXHA 3Q07A 2H0YA 4DE2A 2P9VB 1IELA 2RL3A 2H10A 1L0DA 5F1FA 4Z9QA 3FV7A 4DKIA 3ISGA 4PM7A 3PBOA 4D2OA 4P0MA 3O88A 1ES2A 3N8RA 5FA7A 4BQMA 4KZAA 1TVFA 1QMEA 2HDQA 5E2GA 4UAAA 1YQSA 3Q81A 3VP0A 3AGDA 2QPNA 3WS5A 5EE8A 3IWIA 2WGVA 4KZ6A 2XH9A 4GDBA 1YMSA 1K57C 3DWZA 5IHVA 1GA0A 2EXBA 2OSUA 3MZFA 3ZGAB 4BD1A 4BL2A 3HLWA 1G6AA 1PW1A 4JXVA 4DE1A 3PAEA 2EFUA 3HVFA 2Y91A 5HL1A 5HAIA 3OPRA 5FQJA 5CHUA 1HD8A 5E2FA 3GMWA 5CTNA 4GN2A 5DF7A 3ZCZA 4DF6A 1N9BA 1K38A 1E3UD 2ZC4B 3AGFA 5FDHA 3B3XA 4WYYA 3TG9A 3BFFA 4GOGA 4FH2A 3MKFA 3IH8A 3A3IA 3GTCA 3UPPA 3VSKA 3ZNTA 4IEDA 4H8RA 2H5SA 5EVIA 2XLNA 5FI6A 3C4OA 3A3EA 3EQVA 4LENA 1K55A 2ZJ9A 1FCOA 2P9VA 3ZHHA 1I5QA 2X02A 3O86A 2XQZA 4S2JA 1XXMA 3RXWA 4K0XA 4ZBEA 3A3DA 1BLHA 4N1HA 5GLDA 3UPOA 4OH0A 1H8ZA 5FQMA 1SHVA 1TDLA 4K91A 4EV4A 4R3JA 4MNRA 2A49A 3IF5A 5CECA 2H0TA 3DW0A 3MFDA 3NY4A 3O87A 4IBXA 4S2NC 4IVIA 4X69A 3HBRA 2X01A 4BD0A 2Z2LB 2Y2QA 5CHJA 1KGFA 1LI9A 1XGIA 3M2JA 4S2OA 2BLSA 1K4FA 1VQQA 1E4DA 3NBLA 4EWFA 1FR1A 1M6KA 3GQZA 4WMCA 3PBQA 3MBZA 3M2KA 3BLMA 3NCKA 3SS4A 4WBGA 4DXBA 4MBHA 1GCEA 3AGEA 1NYYA 5FQQA 5GLAA 4KQRA 3WRTA 1JWPA 4FCFA 2ZM8A 4KQOA 3G2YA 5AQBA 1K4EA 5EPHA 3SS5A 4EBLA 4LCLA 5EVID 1ERQA 3PBRA 3C7UA 4S2MA 4E6WA 1TDGA 4FH4A 5L2FA 3N8SA 4WZ4A 1EROA 3HLBA 1MXOA 5E2EA 5FATA 4R3BA 1ESUA 3BECA 4OVDA 3SH8A 5CTMA 3ZG8B 5F1GA 3S4XA 4ZJ3A 5EVIC 1JVJA 1W5DA 5FAQA 1LHYA 1JTDA 3N4IA 1K56A 4B4ZA 1XA1A 4PPRA 4QB8A 1RGZA 4OONA 1YLWA 5EECA 3RXXA 3E2LA 4ZJ2A 1I2SA 4KZ5A 1PWDA 3VMAA 4X68A 1MPLA 2DRWA 2PU2A 1ZG4A 4ID4A 1PWGA 2HDSA 2HP9A 3BFDA 2XFTA 3BFEA 4XUZA 4DXCA 1JWZA 2Y2JA 1O7EA 1IYPA 4Y0TA 4B88A 4YFMA 4WMCD 4K0WA 1MY8A 4PM8A 4UA9A 4PM5A 1KDWA 1YLJA 4BLMA 4KG5A 3QNCA 4Y7PA 5CHMA 1IYOA 3BRMA 3GRJA 2ZC7A 3V50A 3CG5A 4NK3A 2OLVA 3IQAA 5CGXA 4OOYA 3MXRA 1W7FA 4MBFA 1BSGA 2WKIA 2ZQ7A 2R9WA 4RX2A 3ZG0A 4QD4A 4E3LA 3SH7A 3LY3A 4LV3A 4XXRA 3IH9A 3A3JA 1ONHA 2HP6A 1NZUA 4R0QA 1NJ4A 2WKEA 4QY6A 1YLYA 1ES3A 3OPLA 3OPHA 1ES4A 5I94A 3MZDA 5JYOA 3GSGA 4EBNA 1GHIA 1YLTA 1Z6FA 3MZEA 4JXGA 5HX9A 4P87A 4F94A 5FQ9A 1E3UA 2EX9A 3IXBA 4KZ8A 2G2WA 4EUZA 5A90A 4KG2A 3M6BA 1DY6A 2PU4A 3W8KA 2DNSA 3MKEA 1W79A 3V3SA 2Q9MA 2VGJA 3N8LA 1CK3A 1M40A 3NDEA 2XEPA 1ES5A 1Q2QA 4X6TA 1H8YA 4JPMA 2VGKA 3QNBA 3HLFA 3OCNA 2Y2OA 5GHYA 4OQGA 3G34A 2ZM0A 3ZNYA 5TR7A 4E3MA 2HDRA 3SS3A 1ZG6A 3PAGA 1SDNA 3P09A 3QHYA 5U47A 3UDFA 3ZVWA 2CC1A 4YINA 3V5MA 3BFCA 3MXSA 4UA7A 5DF8A 1FCNA 3G31A 5BOHA 3IXDA 3ZG7B 4KZ9A 5FASA 3PBSA 1MWTA 4GD6A 1FR6A 4GZBA 3UPNA 3C5AA 3ZVTA 3LEZA 3IHAA 1QMFA 2WGWA 1IEMA 4R23A 2ZQDA 1YMXA 3Q82A 1XPBA 4FD8A 3IF6B 3FYZA 1PZOA 3FKWA 4WM9A 4HBTA 5AQAA 1JWVA 1U60A 5DF9A 1DJCA 4ZDXA 5EOOA 2EX2A 4N92A 2J9OA 1S6RA 4JXSA 5A93A 4N1XA 4PM6A 4C3QA 1BLSA 3DTMA 5KSCA 3IWQA 2Y2PA 3D4FA 4PM9A 3NC8A 1RP5A 4KZ7A 3UE3A 3VP3A 1GHPA 1I2WA 1FCMA 2Y2LA 2WADA 4R1GA 4OPQA 2GDNA 5GHZA 4QU3A 5TFQA 1K57A 2Y2NA 1NYMA 4MLLA 3VSLA 3WS0A 3ITBA 2Y2GA 4JKTA 2EX6A 1BLCA 1ESIA 4CJNA 4LV2A 1DJAA 3CJMA 4RYEA 1XA7A 3N6IA 5CRFA 5GLBA 2PBYA 4OLGA 4OOLA 1YT4A 2XF3A 3HREA 5JYPA 1K25A 2RCXA 4N9KA 4E3IA 2WK0A 5GHXA 2V20A 1PWCA 3BEBA 3C7VA 3LY4A 3V3RA 1KE4A 1PZPA 2WKHA 3BLSA 4L0LA 1MWRA 3GR2A 2FFYA 3VFHA 1PW8A 2ZMAA 3I7JA 1GHMA 3JYIA 4WELA 2XK1A 4FSFA 4OKPA 4JXWA 5EVLA 3C4PA 3G2ZA 3BFGA 2UWXA 3FKVA 4ZJ1A 4XUXA 2WAEA 4OPYA 3UNWA 4CPKA 3P98A 4UA6A 4E3OA 2XDMA 1KE0A 2JC7A 2IWBA 1BULA 3IHBA 1K54A 4WZ5C 1BZAA 2J8YA 2Y2MA 4MBKA 5FSRA 3VOYA 1MWUA 4HEFA 4E3JA 1LI0A 5FI7A 4S2PA 4PMAA 2EFXA 3Q7VB 5M18A 2E8IA 2ZQ9A 1YM1A 4OPRA 3W4QA 5A92A 4C6YA 4OPZA 3A3FA 4DDSA 4DDYA 2X71A 1VM1A 2ZLYA 4HBUA 2G2UA 5HFOA 3HL9A 1ALQA 4WEKA 4MEZA 4DRTA 2HPBA 2QZ6A 5KZHA 4RA7A 1C3BA 1EWZA 4Y0OA 1PI4A 5GL9A 1K6RA 4OLDA
chains in the Genus database with same CATH superfamily
4OP5A 4NXGA 3RJUA 2J9PA 4NKPA 1T1CA 3CZDA 4E04A 1Y54A 3TSGA 3IS2A 2VV6A 3T1QB 4KZ3A 4MMNA 1TS0A 1FQGA 3GVBA 3IBJA 3F1NA 1IOUA 4LRXC 3LIFA 3CPTB 1HLUP 4EQIA 2IWCA 1L0GA 1MWSA 4F3LB 3G4PA 1G68A 2W3FA 4Y2FA 3VFFA 4O0PA 3F1OA 2PR6A 2HJEA 4YOFA 3UE0A 3QP8A 4EUVA 5GLCA 2XD5A 3CMZA 4EEPA 4L9GA 2Y55A 3CI6A 5EUAA 1N9OA 1XP4A 4KG6A 5IT5A 1A0KA 2WZZA 4BJPA 3UB9A 5DTSA 2O99A 1S4RA 1V9YA 4ARZA 4QJGA 4KENB 3VE3A 5CERA 3M6HA 3T4KA 1XKZA 2ZC3B 3UB7A 4GS9B 3T4JA 4CLCC 5AJGA 3WS2A 2L0WA 1H5XA 2C5WB 3T1RA 3G32A 2Z2MB 2ZL1A 4ZTKA 3QP5A 2HDUA 5HAQA 2Y2KA 5DTTA 3P7NA 3KSIA 2W0NA 4BWIA 1OT6A 2HP5A 1G5UA 1FSYA 1ZKJA 4OQIA 1XJ6A 3HLEA 1KDSA 2IWDA 3T12B 4E6XA 3OCLA 4QY5A 1K54C 2D01A 3C38A 4BENA 4C75A 3PBTA 2Y59A 4FTXA 1NWZA 4H6JA 2JCHA 3LFVA 4OQHA 1IYSA 2EWVA 4X1MA 5DKLA 2H0YA 1OJ5A 4IJGA 1G6OA 2RL3A 4HJ6A 2H10A 4EW7A 3D9YA 4D2OA 1H3QA 3KYEA 1YQSA 3AGDA 1S66L 4IUKA 3DTKA 4GDBA 1K57C 3DWZA 1GA0A 3ZGAB 2OSUA 4DJ3A 5CHUA 3GMWA 5CTNA 4GN2A 1DRMA 4UQIS 1N9BA 3AGFA 3B3XA 2JN7A 4FH2A 1OT9A 3A3IA 3GTCA 3UPPA 2PT7A 2XLNA 2V1BA 3C4OA 3QP2A 1I5QA 4S2JA 2XQZA 3DTEA 3RXWA 3JPUA 3A3DA 4N1HA 1OPXA 1SHVA 3MFDA 3NY4A 3O87A 2VA0A 3HJIA 1TS7A 1N9NA 3LYXA 4L9EA 3PBQA 2ZOHA 3SS4A 1T19A 4LRZE 4MBHA 5L10A 4KQRA 1JWPA 4KQOA 3SS5A 1OTEA 2ACGA 5IU1A 3T4SA 4E6WA 1LSWA 2MJ6A 3D3OA 3HLBA 1MXOA 5F1GA 4ZJ3A 1JVJA 5FEGA 1SKOB 1JTDA 1OTAA 4B93A 1VEUB 1XA1A 4QB8A 1YLWA 1PRQA 2JKFA 4Y15A 1BYWA 2HP9A 4XUZA 2P08A 2XFTA 3BFEA 5HDSA 5HD3A 1IYOA 3BRMA 5CGXA 3LI9A 4I39A 2JKGA 2ZQ7A 4I3JA 4XXRA 3IH9A 3A3JA 1NJ4A 3OPHA 5JYOA 4HHDA 2GZAA 4R38A 1E3UA 5K5BA 1P0ZA 4EUZA 1DY6A 3W8KA 2DNSA 4Y3IA 3MKEA 3V3SA 2PD7A 2VGKA 3QNBA 2Y2OA 4YNRA 1OJGA 2W3GA 1ZG6A 3R7WB 2KLIA 3QHYA 3UDFA 4HH2A 2CC1A 4YINA 3BWLA 2Z6CA 3G31A 4HQAA 4KZ9A 3A0VA 1YPRA 1MWTA 4DMZA 4GD6A 4GZBA 2OAP1 3ZVTA 2QYBA 1QMFA 1IEMA 4R23A 1YMXA 3QP6A 5DFYA 4FD8A 5AQAA 1DJCA 4ZDXA 1TS8A 4JXSA 2PBDP 3PYPA 5KSCA 3O5YA 3NC8A 1RP5A 4X1LA 2DMWA 2Y2LA 4R1GA 4OPQA 3E4PA 1NYMA 3MJQA 1ESIA 4LV2A 4RYEA 1XA7A 3N6IA 3RFBA 2V8FA 5GLBA 5HZHA 2PBYA 4OOLA 1YT4A 2W27A 2JKTI 2V20A 3BEBA 2YKFA 3LY4A 4DN0A 3BLSA 3MFXA 1PW8A 4LGWA 2ZMAA 1GHMA 3JYIA 3FKVA 4OPYA 2XDMA 1BULA 1XFNA 2J8YA 2PYRA 5TJJA 2FH5A 5DFXA 2EFXA 3Q7VB 2CMNA 2E8IA 2JKTM 4OPRA 3T1SA 4NXBA 5J7EA 4MEZA 4DRTA 1C3BA 1EWZA 1PI4A 1WA9A 3BM6A 1S1ZA 3GV9A 1N4OA 1CEFA 1OTBA 3P01A 1T18A 1W8QA 2M7VA 3VOLA 1L0FA 2V2FF 4P6ZM 4WZ5A 3SW1A 3LCEA 4HESA 4CLCE 3UN7A 2ZD8A 2Q9NA 4X56A 4P6BA 4LRYC 3KYQA 4U0TA 1RCJA 2WGWB 2JE5A 1Q2PA 1CI9A 4K08A 5G18A 5J3WA 4E3KA 2V1ZA 1LL5A 3S1YA 2VX8A 3ITAA 3IWOA 4CLCD 3E2KA 3VP2A 1PI5A 3WWXA 2C6WB 2L4RA 4WEJA 3WS1A 4KQQA 3FWLA 3HUOA 4DE0A 2G7UA 4GB7A 3NDGA 2XFSA 5DVAA 1DJBA 4IVKA 4N9LA 4D60A 3W2ZA 1W8YA 2ZOIA 4X55A 3OOVA 4OP8A 3Q1FA 1XJ4A 1KE3A 5CGSA 1CI8A 2JKRM 1P9RA 3PBNA 1K56D 3LR5A 1GSXA 3G35A 1S1YA 1BTLA 1G28A 1NXYA 1UGUA 3IBRA 1JTGA 3ZFZA 1HVBA 1SZVA 2VK3A 3DWKA 3Q7ZA 4S2LA 3T50A 4Q8IA 1SCWA 1AXBA 3CAXA 5AQ7A 1TEMA 2B5RA 5AQ9A 2EX8A 2XR0A 3ZG5A 4GKUA 3H9WA 2W1TA 4RQ9A 1OTDA 3HLDA 2OLUA 4LV1A 4O7DA 2GX5A 4WN5A 2V0UA 5DJTA 3LR0A 4HJ4A 1OMEA 1SDEA 3IX8A 1ONGA 5CEBA 2KDKA 3N7WA 3LR4A 3PTEA 3LO7A 4LLOB 1PYYA 3IT9A 3O3VA 4OQ0A 1WYBA 3IXHA 3Q07A 2P9VB 4ARZB 1IELA 1L0DA 3F1OB 4P0MA 1DP8A 4BQMA 2K7SA 4XT2A 4MCWA 2HDQA 4UAAA 3Q81A 2XH9A 3E4OA 1YMSA 5IHVA 4HP9A 3QP4A 5DJUA 3ZCZA 5HDCA 3ZYTA 3LICA 5C5KA 3L9KA 3TG9A 3BFFA 2QHKA 3VSKA 5EVIA 5FI6A 3EQVA 2P9VA 1FCOA 3ZHHA 3LI8A 3KSHA 1XXMA 4B9OA 4K0XA 3C30A 1KOUA 5GLDA 2YKHA 1X0OA 5FQMA 2PD8A 4MNRA 3IF5A 2Y8HA 4IVIA 4X69A 1XGIA 3TJZC 1PNEA 1K4FA 3NBLA 4Q0JA 4EWFA 1FR1A 4F3LA 3GQZA 3M2KA 3BLMA 3NCKA 4ETZA 1W63Q 3FG8A 3EEHA 3R7WA 4ETXA 5EPHA 4EBLA 4LCLA 1ERQA 3N8SA 1EW0A 1ESUA 4R3AA 5HWVA 1XJ2A 1K56A 1VETA 1PWDA 3NULA 1NRJA 3VMAA 4MN7A 4X68A 1ZG4A 3BFDA 1JWZA 2J3TC 4K0WA 4PM8A 3C2WA 3BY8A 4KG5A 5CHMA 2ZC7A 4IHQA 3DAVA 3CG5A 4NK3A 1W7FA 4RX2A 2R9WA 4E3LA 5AVEA 2HP6A 4UEYA 3OPLA 2LB9A 5I94A 3MZDA 3GSGA 4EBNA 1GHIA 1Z6FA 4GJ4A 3EGXC 1VETB 4F94A 5HWWA 3M6BA 2PU4A 2QWSA 1W79A 2VGJA 3FPWA 3MF0A 2XEPA 1ES5A 1H8YA 3HLFA 2A24B 3QP1A 4GHIA 5TR7A 2HDRA 2Y79A 1SDNA 3P09A 5BOHA 1FCNA 3BW6A 5FASA 3UPNA 3C5AA 4Y13A 1T1AA 3MMHA 4QWOA 1XPBA 4I38A 2W1RA 4HBTA 1U60A 5DF9A 5EOOA 2EX2A 4GCZA 1S67L 2OAQ1 4CQHA 5A93A 4C3QA 1BLSA 3DTMA 2Y2PA 4PM9A 1N9LA 4KZ7A 3VP3A 2V0WA 1NLZA 2WADA 1D7EA 3TW8A 4PKYG 4R70A 1K57A 2Y2NA 3CUEA 4MLLA 3LEQA 3VSLA 3ITBA 2Y2GA 4JKTA 3ZQ5A 3GDIA 1DJAA 5CRFA 2XF3A 3HREA 2RCXA 4E3IA 4HJ3A 1PWCA 2QJ7A 4L0LA 3VFHA 4PHTA 4WUJA 2XK1A 2K31A 4FSFA 4JXWA 3G2ZA 4ZJ1A 1TF1A 4Q0HA 3UNWA 3P98A 4UA6A 3BJNA 3IHBA 1JNUA 1K54A 1BZAA 4MN6A 2QJ5A 5FSRA 3VOYA 4HEFA 3CITA 5HPFA 2ZQ9A 1YM1A 5A92A 4MDZA 3D72A 4OPZA 4DDSA 4DDYA 2X71A 2B95A 4WEKA 3LGOA 2HPBA 5GL9A 3IF6A 4OLDA 4LV0A 2NUPC 2JBFA 4EU0A 1L0EA 4FOFA 2A3UA 1LL9A 1Y4OA 3E4QA 5G4ZA 4RX3A 3B33A 3NJAA 2QMIA 2ZC5B 1O07A 1IFQA 3LIDA 1YLZA 1NZOA 1KGEA 2LB5A 3SH9A 3HUNA 3VP4A 4CLCA 2VV8A 5D3OA 2OV5A 3UDXA 5TBMB 5FAPA 3S7PA 2DCFA 3HLCA 3W4PA 1S4SA 3JVUA 3CUEC 1RGYA 3OPPA 1GSVA 5CXWA 4KZBA 3OZHA 4BBVA 3W4OA 2ZL1B 4R4SA 3B42A 2WAFA 4R4RA 4WF0A 4OOMA 2XGNA 3LUQA 5M1AA 1UWPX 3UO9A 3EWKA 1IKIA 4S2IA 2VKSA 5TGFA 3FZCA 2ZC6B 4WL9A 3TE8A 4O01A 1YKDA 3HUMA 4U3TA 4M3KA 4GDNA 1F9IA 1NLYA 3EQUA 5A91A 4P85A 1WYCA 1FOFA 1OTIA 5HARA 4GNUA 1YLPA 3F1NB 1ZC2A 4LCMA 1KVMA 2BTFP 5F83A 3UY6A 1IYQA 4YWZA 4I3AA 3IXGA 4Y17A 2E8JA 2EA9A 1MKIA 5FQIA 3OLOA 2WZXA 2Y2HA 3VOZA 2WUQA 4S2KA 4X53A 5EOEA 1SKFA 5EVEA 4JF4A 5KMWA 1GA9A 5FEFA 2GNXA 2Y2IA 1H8MA 4G3KA 3NI9A 3G30A 5FL3A 2P7JA 1KVLA 3UE1A 1H0MA 3MQ0A 5CGWA 2PHYA 3ZG9B 2NUTC 3E0YA 4UHUA 4EEUA 2WYXA 3RH8B 4B4XA 2ZQCA 2FZ0A 3NECA 5F1FA 4DKIA 3ISGA 4PM7A 1ES2A 4Y5FA 2W3EA 2KX6A 1TVFA 3PXPA 3L7HA 2QPNA 3WS5A 5EE8A 2HJ9C 3IWIA 4KZ6A 3RTYA 4BD1A 3HLWA 1G6AA 1PW1A 3UB5P 4DE1A 2Y91A 3UB6A 4L9FA 5HL1A 5HAIA 5FQJA 4EETB 1HD8A 3HJKA 5DF7A 1CQAA 1K38A 1E3UD 5FDHA 2PYPA 4HOIA 3MKFA 2PR5A 3IH8A 4HNBA 1D1JA 3ZNTA 4H8RA 2H5SA 1PFLA 3A3EA 4LENA 1K55A 5G4YA 2GJ3A 4ZBEA 3UPOA 3CWFA 1P9WA 2VJWA 4OH0A 1H8ZA 4BBUA 4R3JA 5CECA 2H0TA 5F6AA 4IBXA 2M7UA 3HBRA 2X01A 4BD0A 2Y2QA 5CHJA 2V9AA 4S2OA 3LIBA 1E4DA 4EERA 1YSQA 4WMCA 2QKPA 4WBGA 4DXBA 1GCEA 3AGEA 1NYYA 5FQQA 1XFQA 4IUHA 2ZM8A 2J80A 3PBRA 5L2FA 1TDGA 1F5MA 4WZ4A 1EROA 5E2EA 3SH8A 5CTMA 3ZG8B 3OBFA 1FILA 3S4XA 1W5DA 5FAQA 1LHYA 1DP6A 1RGZA 4OONA 5EECA 5HL6A 2J3WA 4ME4A 1MPLA 2PAVP 2PU2A 4ID4A 4DXCA 3BY9A 3T4QA 1IYPA 4B88A 4YFMA 3R4KA 1MY8A 3F1PB 1YLJA 2WKQA 4MN5A 4Y7PA 3GRJA 3H82B 3K3CA 5HDDA 4OOYA 3MXRA 1BSGA 2WKIA 3ZG0A 1ZTUA 4QD4A 5J4EA 3UE6A 4R0QA 1NZUA 2WKEA 1YLYA 1ES3A 3MQOA 4P6ZS 3B47A 3CHWP 1YLTA 3A0RA 4JXGA 4P87A 4EESA 1K0KA 5A90A 4KZ8A 2G2WA 2B02A 1Y28A 3NDEA 4O8GA 3PHYA 3OCNA 3ZNYA 3G34A 4E3MA 1CJFA 3SS3A 3PAGA 3ZVWA 5U47A 3MSHA 3BFCA 2O9CA 3MXSA 4UA7A 2IA2A 3IXDA 1SKOA 1LSVA 2HGVA 4JGRA 3LEZA 4HH3A 3IF6B 3FYZA 1PZOA 3FKWA 4WM9A 3VE4A 3KSGA 1VHMA 4FUWA 3C8CA 4N1XA 3IWQA 3D4FA 4EQ1A 3UE3A 1I2WA 1FCMA 3IX3A 3MR0A 2GDNA 2KOIA 4QU3A 5TFQA 2INWA 3EOIA 3CLOA 1YAXA 3WS0A 2EX6A 5EM0A 4GLQA 4JGOA 3JVVA 3K3DA 5L07A 2VEAA 2H28A 5JYPA 3V3RA 4KUOA 3KO6A 1MWRA 4I5SA 3I7JA 4WELA 4OKPA 3S7OA 3C4PA 4II7A 2BASA 3BFGA 4CPKA 2UV0E 4E3OA 1KE0A 2JKRI 4GHIB 4WZ5C 4AFIA 4MBKA 1MWUA 1DP9A 4E3JA 5FI7A 4S2PA 4PMAA 2XA7M 4KUKA 3A3FA 3V67A 1VM1A 2ZLYA 1MC0A 4HBUA 2G2UA 1ALQA 3U4LP 4RA7A 2K2NA 3NHQA 4Y0OA 3UB8A 1K6RA 1L3LA 5FAOA 2Z6DA 5F68A 1FIKA 2VZWA 1T1BA 4EXOA 3T1XA 1HTZA 4JF6A 3OC2A 1LLBA 3WRZA 1XX2A 3WS4A 4A5RA 4RVAA 5L09A 4IBRA 3KYZA 1PIOA 2J3TD 3UMEA 2VGLM 2XD1A 1BLPA 2ZMVA 4NETA 2XA7S 4JLFA 1E25A 2WKRA 2A2LA 2O9AA 1NRFA 4BL3A 3VP1A 1CEGA 3K2NA 3BYDA 5CEDA 4GD8A 1BUEA 1STZA 3T4OA 4U0XA 2ZM2A 5F82A 2Q0OA 5EVIB 3S7NA 5HW3A 2D02A 3S22A 4PAUA 4LPZA 1XGJA 4DE3A 1FSWA 3SZTA 4H6JB 2WGIA 4JGQA 2EXAA 3TOIA 5M19A 2BG1A 2J7VA 5FDSA 5E2HA 4E3NA 5EM1A 3KX0X 1HZOA 1ERMA 2OWHA 3DBAA 1BT5A 1W63M 2ZQAA 2O9BA 2PRFA 1KGGA 2R9XA 2ZQ8A 1TS6A 4EBPA 1IKGA 2I72A 1EI5A 5A8BA 5FQKA 3MS6A 5MC7A 3IS2B 3NIAA 1MZUA 5IS1A 1CF0A 3IF6C 4JF5A 4BBTA 4ZAMA 5DTKA 2Y4AA 4Y0UA 4QHCA 1MBLA 3BQAA 4JBFA 3HLGA 1K6SA 5E43A 3Q7VA 4NXEA 5FI2A 2ZBBA 3E98A 1K55C 5KSHA 1L2SA 1S0WA 5KIZA 5J8XA 1J9MA 2P74A 2VV7A 2JHEA 1NY0A 5HAPA 4Q0IA 2M1CA 3V39A 3H7WA 1WE4A 3UDIA 4KZ4A 3ZDJA 4S2NA 3PR6A 2FFFB 2W3DA 3SOIA 2XRNA 3H82A 4DE2A 4Z9QA 3FV7A 3PBOA 4WLAA 2R78A 2W1TB 3O88A 3N8RA 5FA7A 1P97A 4KZAA 1QMEA 5E2GA 3IX4A 3VP0A 4G3WA 2WGVA 5L8MA 3FPVA 2EXBA 3MZFA 5I5LA 4BL2A 4JXVA 3PAEA 2EFUA 3HVFA 1YSPA 3OPRA 5E2FA 4DF6A 2ZC4B 4WYYA 4GOGA 4ZRRA 3LIEA 5HD5A 4IEDA 2ZMFA 2V8CA 2ZJ9A 1ZHHB 2X02A 3O86A 4PKYA 1AWIA 1BLHA 5EFWA 3DTIA 2B18A 1TDLA 4K91A 4EV4A 2A49A 3DW0A 3CPTA 4HP4A 4S2NC 4CLCB 2Z2LB 3EGDC 5HWTA 1KGFA 1LI9A 3M2JA 2BLSA 2PDRA 4M4XA 3H7WB 1VQQA 5TBMA 1M6KA 3MBZA 5CX7A 2WKPA 1F98A 4HI4A 5GLAA 3WRTA 4FCFA 4I3IA 3MXQA 3G2YA 5AQBA 1K4EA 5EVID 5AVFA 1XJ3A 3C7UA 4S2MA 4FH4A 5FATA 2VGLS 4R3BA 3BECA 4OVDA 4NXFA 5EVIC 3N4IA 4B4ZA 4PPRA 3T4LA 3RXXA 3E2LA 4ZJ2A 2HV1A 1I2SA 4KZ5A 3BQ8A 5EV0A 2DRWA 4NEED 4DJ2A 1PWGA 2HDSA 2Y2JA 3GECA 1O7EA 4Y0TA 4G3VA 1MKMA 4WMCD 4UA9A 4X25A 4PM5A 1KDWA 4BLMA 3QNCA 3U2AA 4GS9A 4HY8A 3V50A 2OLVA 3IQAA 3KSFA 1F2KA 3G6OA 4MBFA 3SH7A 1ACFA 3LY3A 4LV3A 4BMWA 1ONHA 4QY6A 1ES4A 3MZEA 5HX9A 3LR3A 5F5YA 4JGPA 5FQ9A 3IXBA 2EX9A 4KG2A 1J3WA 2Q9MA 2L1MA 3N8LA 4Z1WA 1CK3A 1M40A 1UWNX 5HSQA 1Q2QA 4X6TA 1V9ZA 4JPMA 5GHYA 2O0YA 4OQGA 2ZM0A 4KQDA 1LL8A 2P04A 3LIAA 1VB6A 3V5MA 2OOLA 5DF8A 1VEUA 3ZG7B 1LT0A 3PBSA 3T4TA 1TD5A 1FR6A 3NOPC 3IHAA 5F69A 2W3HA 2WGWA 4LFUA 2ZQDA 3Q82A 4ESPA 4UQIM 3ULFA 1JWVA 3F1PA 4N92A 2J9OA 1S6RA 3EEAA 1GSWA 4PM6A 1GHPA 2A24A 2OWJA 3A0SA 5GHZA 2HZ5A 3ICYA 2XROA 3FC7A 1Z09A 1BLCA 3VV4A 4CJNA 4GW9A 3CJMA 1ODVA 1D06A 4OLGA 1K25A 4N9KA 2WK0A 5GHXA 3C7VA 1KE4A 3S7QA 1PZPA 2WKHA 2XSSA 3GR2A 2FFYA 5EVLA 2EWWA 2HF6A 3TRCA 3MQQA 2I9VA 2UWXA 4R6LA 4XUXA 2WAEA 1LSXA 4NG2A 4QPRA 2JC7A 2IWBA 2V1AA 3HCYA 4HIAA 2Y2MA 5HPIA 1LI0A 3NOTC 3NOUC 3UMDA 5M18A 4XT2B 3W4QA 4C6YA 5DKKA 5HFOA 3HL9A 2VLGA 2QZ6A 5KZHA 5LBRA 2AVXA
chains in the Genus database with same CATH topology
4OP5A 3RJUA 3BM6A 5FAOA 4LV0A 3GV9A 1N4OA 2JBFA 1CEFA 2J9PA 1L0EA 1W8QA 2A3UA 3CZDA 1LL9A 1Y54A 4RX3A 1L0FA 2V2FF 3TSGA 1HTZA 2QMIA 4WZ5A 4JF6A 2ZC5B 1O07A 3LCEA 1LLBA 3OC2A 4HESA 1XX2A 3WRZA 4KZ3A 3WS4A 3UN7A 4A5RA 1YLZA 1FQGA 2ZD8A 2Q9NA 3GVBA 4RVAA 1NZOA 4X56A 4IBRA 1KGEA 4P6BA 1PIOA 3SH9A 2XD1A 1BLPA 4U0TA 3HUNA 3VP4A 4NETA 1RCJA 2WGWB 2JE5A 1Q2PA 1CI9A 5D3OA 4EQIA 5G18A 2IWCA 2OV5A 4E3KA 2V1ZA 1LL5A 3S1YA 4JLFA 3UDXA 3ITAA 1L0GA 1MWSA 3IWOA 3G4PA 3E2KA 1E25A 1G68A 5FAPA 3VP2A 1NRFA 1PI5A 3VFFA 4BL3A 3WWXA 3VP1A 1CEGA 2C6WB 2DCFA 3HLCA 3BYDA 3W4PA 5CEDA 4GD8A 1BUEA 4WEJA 3WS1A 4KQQA 1RGYA 3FWLA 3UE0A 3OPPA 3HUOA 4DE0A 5CXWA 5GLCA 2XD5A 3CMZA 4KZBA 2ZM2A 3OZHA 4U0XA 5F82A 3W4OA 5EVIB 2Y55A 4GB7A 4R4SA 3NDGA 5EUAA 2WAFA 2XFSA 4R4RA 3S22A 5HW3A 4OOMA 2XGNA 1XP4A 4KG6A 5M1AA 5DVAA 3UO9A 1XGJA 1DJBA 4IVKA 1IKIA 2WZZA 1FSWA 4S2IA 4BJPA 4DE3A 2WGIA 5TGFA 4N9LA 3FZCA 2ZC6B 5DTSA 2EXAA 3TOIA 5M19A 1W8YA 2BG1A 2J7VA 4X55A 4OP8A 4QJGA 3HUMA 3IF6A 3Q1FA 5E2HA 4E3NA 1KE3A 4KENB 4U3TA 4M3KA 5CGSA 1CI8A 5CERA 3M6HA 4GDNA 3PBNA 1HZOA 1XKZA 1ERMA 1K56D 2ZC3B 1BT5A 2ZQAA 3G35A 1KGGA 2R9XA 3EQUA 2ZQ8A 5A91A 4EBPA 1BTLA 1IKGA 2I72A 1NXYA 4P85A 3WS2A 1EI5A 1WYCA 1H5XA 2C5WB 5FQKA 1JTGA 3ZFZA 3G32A 1FOFA 1HVBA 2Z2MB 3DWKA 5HARA 4ZTKA 3Q7ZA 4S2LA 4Q8IA 4GNUA 1SCWA 1YLPA 1AXBA 3NIAA 2HDUA 1ZC2A 2B5RA 1TEMA 5AQ7A 5AQ9A 4LCMA 3IF6C 5HAQA 4JF5A 1KVMA 2Y2KA 5DTTA 2EX8A 2XR0A 3ZG5A 4ZAMA 5F83A 3UY6A 5DTKA 4GKUA 2Y4AA 1IYQA 3IXGA 4Y0UA 4QHCA 1MKIA 3HLDA 5FQIA 2OLUA 2WZXA 1MBLA 4LV1A 4O7DA 2Y2HA 3VOZA 4JBFA 3HLGA 1K6SA 5E43A 2WUQA 2HP5A 4S2KA 3Q7VA 4X53A 5EOEA 5FI2A 1SKFA 1FSYA 4JF4A 5KMWA 1GA9A 1K55C 1ZKJA 5KSHA 1L2SA 1S0WA 4OQIA 2Y2IA 3HLEA 5J8XA 1OMEA 1J9MA 1SDEA 2P74A 3NI9A 3G30A 1NY0A 1KDSA 5HAPA 3V39A 1ONGA 2IWDA 4E6XA 1KVLA 3OCLA 4QY5A 3UE1A 5CEBA 1K54C 5CGWA 1WE4A 3N7WA 4BENA 3UDIA 4C75A 3PTEA 3ZG9B 3PBTA 2Y59A 3LO7A 4UHUA 1PYYA 3IT9A 4KZ4A 3O3VA 2JCHA 3ZDJA 2WYXA 4S2NA 4B4XA 4OQ0A 2FFFB 4OQHA 1WYBA 1IYSA 2ZQCA 3SOIA 3IXHA 3Q07A 2H0YA 4DE2A 2P9VB 1IELA 2RL3A 2H10A 1L0DA 5F1FA 4Z9QA 3FV7A 4DKIA 3ISGA 4PM7A 3PBOA 4D2OA 4P0MA 3O88A 1ES2A 3N8RA 5FA7A 4BQMA 4KZAA 1TVFA 1QMEA 2HDQA 5E2GA 4UAAA 1YQSA 3Q81A 3VP0A 3AGDA 2QPNA 3WS5A 5EE8A 3IWIA 2WGVA 4KZ6A 2XH9A 4GDBA 1YMSA 1K57C 3DWZA 5IHVA 1GA0A 2EXBA 2OSUA 3MZFA 3ZGAB 4BD1A 4BL2A 3HLWA 1G6AA 1PW1A 4JXVA 4DE1A 3PAEA 2EFUA 3HVFA 2Y91A 5HL1A 5HAIA 3OPRA 5FQJA 5CHUA 1HD8A 5E2FA 3GMWA 5CTNA 4GN2A 5DF7A 3ZCZA 4DF6A 1N9BA 1K38A 1E3UD 2ZC4B 3AGFA 5FDHA 3B3XA 4WYYA 3TG9A 3BFFA 4GOGA 4FH2A 3MKFA 3IH8A 3A3IA 3GTCA 3UPPA 3VSKA 3ZNTA 4IEDA 4H8RA 2H5SA 5EVIA 2XLNA 5FI6A 3C4OA 3A3EA 3EQVA 4LENA 1K55A 2ZJ9A 1FCOA 2P9VA 3ZHHA 1I5QA 2X02A 3O86A 2XQZA 4S2JA 1XXMA 3RXWA 4K0XA 4ZBEA 3A3DA 1BLHA 4N1HA 5GLDA 3UPOA 4OH0A 1H8ZA 5FQMA 1SHVA 1TDLA 4K91A 4EV4A 4R3JA 4MNRA 2A49A 3IF5A 5CECA 2H0TA 3DW0A 3MFDA 3NY4A 3O87A 4IBXA 4S2NC 4IVIA 4X69A 3HBRA 2X01A 4BD0A 2Z2LB 2Y2QA 5CHJA 1KGFA 1LI9A 1XGIA 3M2JA 4S2OA 2BLSA 1K4FA 1VQQA 1E4DA 3NBLA 4EWFA 1FR1A 1M6KA 3GQZA 4WMCA 3PBQA 3MBZA 3M2KA 3BLMA 3NCKA 3SS4A 4WBGA 4DXBA 4MBHA 1GCEA 3AGEA 1NYYA 5FQQA 5GLAA 4KQRA 3WRTA 1JWPA 4FCFA 2ZM8A 4KQOA 3G2YA 5AQBA 1K4EA 5EPHA 3SS5A 4EBLA 4LCLA 5EVID 1ERQA 3PBRA 3C7UA 4S2MA 4E6WA 1TDGA 4FH4A 5L2FA 3N8SA 4WZ4A 1EROA 3HLBA 1MXOA 5E2EA 5FATA 4R3BA 1ESUA 3BECA 4OVDA 3SH8A 5CTMA 3ZG8B 5F1GA 3S4XA 4ZJ3A 5EVIC 1JVJA 1W5DA 5FAQA 1LHYA 1JTDA 3N4IA 1K56A 4B4ZA 1XA1A 4PPRA 4QB8A 1RGZA 4OONA 1YLWA 5EECA 3RXXA 3E2LA 4ZJ2A 1I2SA 4KZ5A 1PWDA 3VMAA 4X68A 1MPLA 2DRWA 2PU2A 1ZG4A 4ID4A 1PWGA 2HDSA 2HP9A 3BFDA 2XFTA 3BFEA 4XUZA 4DXCA 1JWZA 2Y2JA 1O7EA 1IYPA 4Y0TA 4B88A 4YFMA 4WMCD 4K0WA 1MY8A 4PM8A 4UA9A 4PM5A 1KDWA 1YLJA 4BLMA 4KG5A 3QNCA 4Y7PA 5CHMA 1IYOA 3BRMA 3GRJA 2ZC7A 3V50A 3CG5A 4NK3A 2OLVA 3IQAA 5CGXA 4OOYA 3MXRA 1W7FA 4MBFA 1BSGA 2WKIA 2ZQ7A 2R9WA 4RX2A 3ZG0A 4QD4A 4E3LA 3SH7A 3LY3A 4LV3A 4XXRA 3IH9A 3A3JA 1ONHA 2HP6A 1NZUA 4R0QA 1NJ4A 2WKEA 4QY6A 1YLYA 1ES3A 3OPLA 3OPHA 1ES4A 5I94A 3MZDA 5JYOA 3GSGA 4EBNA 1GHIA 1YLTA 1Z6FA 3MZEA 4JXGA 5HX9A 4P87A 4F94A 5FQ9A 1E3UA 2EX9A 3IXBA 4KZ8A 2G2WA 4EUZA 5A90A 4KG2A 3M6BA 1DY6A 2PU4A 3W8KA 2DNSA 3MKEA 1W79A 3V3SA 2Q9MA 2VGJA 3N8LA 1CK3A 1M40A 3NDEA 2XEPA 1ES5A 1Q2QA 4X6TA 1H8YA 4JPMA 2VGKA 3QNBA 3HLFA 3OCNA 2Y2OA 5GHYA 4OQGA 3G34A 2ZM0A 3ZNYA 5TR7A 4E3MA 2HDRA 3SS3A 1ZG6A 3PAGA 1SDNA 3P09A 3QHYA 5U47A 3UDFA 3ZVWA 2CC1A 4YINA 3V5MA 3BFCA 3MXSA 4UA7A 5DF8A 1FCNA 3G31A 5BOHA 3IXDA 3ZG7B 4KZ9A 5FASA 3PBSA 1MWTA 4GD6A 1FR6A 4GZBA 3UPNA 3C5AA 3ZVTA 3LEZA 3IHAA 1QMFA 2WGWA 1IEMA 4R23A 2ZQDA 1YMXA 3Q82A 1XPBA 4FD8A 3IF6B 3FYZA 1PZOA 3FKWA 4WM9A 4HBTA 5AQAA 1JWVA 1U60A 5DF9A 1DJCA 4ZDXA 5EOOA 2EX2A 4N92A 2J9OA 1S6RA 4JXSA 5A93A 4N1XA 4PM6A 4C3QA 1BLSA 3DTMA 5KSCA 3IWQA 2Y2PA 3D4FA 4PM9A 3NC8A 1RP5A 4KZ7A 3UE3A 3VP3A 1GHPA 1I2WA 1FCMA 2Y2LA 2WADA 4R1GA 4OPQA 2GDNA 5GHZA 4QU3A 5TFQA 1K57A 2Y2NA 1NYMA 4MLLA 3VSLA 3WS0A 3ITBA 2Y2GA 4JKTA 2EX6A 1BLCA 1ESIA 4CJNA 4LV2A 1DJAA 3CJMA 4RYEA 1XA7A 3N6IA 5CRFA 5GLBA 2PBYA 4OLGA 4OOLA 1YT4A 2XF3A 3HREA 5JYPA 1K25A 2RCXA 4N9KA 4E3IA 2WK0A 5GHXA 2V20A 1PWCA 3BEBA 3C7VA 3LY4A 3V3RA 1KE4A 1PZPA 2WKHA 3BLSA 4L0LA 1MWRA 3GR2A 2FFYA 3VFHA 1PW8A 2ZMAA 3I7JA 1GHMA 3JYIA 4WELA 2XK1A 4FSFA 4OKPA 4JXWA 5EVLA 3C4PA 3G2ZA 3BFGA 2UWXA 3FKVA 4ZJ1A 4XUXA 2WAEA 4OPYA 3UNWA 4CPKA 3P98A 4UA6A 4E3OA 2XDMA 1KE0A 2JC7A 2IWBA 1BULA 3IHBA 1K54A 4WZ5C 1BZAA 2J8YA 2Y2MA 4MBKA 5FSRA 3VOYA 1MWUA 4HEFA 4E3JA 1LI0A 5FI7A 4S2PA 4PMAA 2EFXA 3Q7VB 5M18A 2E8IA 2ZQ9A 1YM1A 4OPRA 3W4QA 5A92A 4C6YA 4OPZA 3A3FA 4DDSA 4DDYA 2X71A 1VM1A 2ZLYA 4HBUA 2G2UA 5HFOA 3HL9A 1ALQA 4WEKA 4MEZA 4DRTA 2HPBA 2QZ6A 5KZHA 4RA7A 1C3BA 1EWZA 4Y0OA 1PI4A 5GL9A 1K6RA 4OLDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OP5 A;  3RJU A;  3BM6 A;  5FAO A;  4LV0 A;  3GV9 A;  1N4O A;  2JBF A;  1CEF A;  2J9P A;  1L0E A;  1W8Q A;  2A3U A;  3CZD A;  1LL9 A;  1Y54 A;  4RX3 A;  1L0F A;  2V2F F;  3TSG A;  1HTZ A;  2QMI A;  4WZ5 A;  4JF6 A;  2ZC5 B;  1O07 A;  3LCE A;  1LLB A;  3OC2 A;  4HES A;  1XX2 A;  3WRZ A;  4KZ3 A;  3WS4 A;  3UN7 A;  4A5R A;  1YLZ A;  1FQG A;  2ZD8 A;  2Q9N A;  3GVB A;  4RVA A;  1NZO A;  4X56 A;  4IBR A;  1KGE A;  4P6B A;  1PIO A;  3SH9 A;  2XD1 A;  1BLP A;  4U0T A;  3HUN A;  3VP4 A;  4NET A;  1RCJ A;  2WGW B;  2JE5 A;  1Q2P A;  1CI9 A;  5D3O A;  4EQI A;  5G18 A;  2IWC A;  2OV5 A;  4E3K A;  2V1Z A;  1LL5 A;  3S1Y A;  4JLF A;  3UDX A;  3ITA A;  1L0G A;  1MWS A;  3IWO A;  3G4P A;  3E2K A;  1E25 A;  1G68 A;  5FAP A;  3VP2 A;  1NRF A;  1PI5 A;  3VFF A;  4BL3 A;  3WWX A;  3VP1 A;  1CEG A;  2C6W B;  2DCF A;  3HLC A;  3BYD A;  3W4P A;  5CED A;  4GD8 A;  1BUE A;  4WEJ A;  3WS1 A;  4KQQ A;  1RGY A;  3FWL A;  3UE0 A;  3OPP A;  3HUO A;  4DE0 A;  5CXW A;  5GLC A;  2XD5 A;  3CMZ A;  4KZB A;  2ZM2 A;  3OZH A;  4U0X A;  5F82 A;  3W4O A;  5EVI B;  2Y55 A;  4GB7 A;  4R4S A;  3NDG A;  5EUA A;  2WAF A;  2XFS A;  4R4R A;  3S22 A;  5HW3 A;  4OOM A;  2XGN A;  1XP4 A;  4KG6 A;  5M1A A;  5DVA A;  3UO9 A;  1XGJ A;  1DJB A;  4IVK A;  1IKI A;  2WZZ A;  1FSW A;  4S2I A;  4BJP A;  4DE3 A;  2WGI A;  5TGF A;  4N9L A;  3FZC A;  2ZC6 B;  5DTS A;  2EXA A;  3TOI A;  5M19 A;  1W8Y A;  2BG1 A;  2J7V A;  4X55 A;  4OP8 A;  4QJG A;  3HUM A;  3IF6 A;  3Q1F A;  5E2H A;  4E3N A;  1KE3 A;  4KEN B;  4U3T A;  4M3K A;  5CGS A;  1CI8 A;  5CER A;  3M6H A;  4GDN A;  3PBN A;  1HZO A;  1XKZ A;  1ERM A;  1K56 D;  2ZC3 B;  1BT5 A;  2ZQA A;  3G35 A;  1KGG A;  2R9X A;  3EQU A;  2ZQ8 A;  5A91 A;  4EBP A;  1BTL A;  1IKG A;  2I72 A;  1NXY A;  4P85 A;  3WS2 A;  1EI5 A;  1WYC A;  1H5X A;  2C5W B;  5FQK A;  1JTG A;  3ZFZ A;  3G32 A;  1FOF A;  1HVB A;  2Z2M B;  3DWK A;  5HAR A;  4ZTK A;  3Q7Z A;  4S2L A;  4Q8I A;  4GNU A;  1SCW A;  1YLP A;  1AXB A;  3NIA A;  2HDU A;  1ZC2 A;  2B5R A;  1TEM A;  5AQ7 A;  5AQ9 A;  4LCM A;  3IF6 C;  5HAQ A;  4JF5 A;  1KVM A;  2Y2K A;  5DTT A;  2EX8 A;  2XR0 A;  3ZG5 A;  4ZAM A;  5F83 A;  3UY6 A;  5DTK A;  4GKU A;  2Y4A A;  1IYQ A;  3IXG A;  4Y0U A;  4QHC A;  1MKI A;  3HLD A;  5FQI A;  2OLU A;  2WZX A;  1MBL A;  4LV1 A;  4O7D A;  2Y2H A;  3VOZ A;  4JBF A;  3HLG A;  1K6S A;  5E43 A;  2WUQ A;  2HP5 A;  4S2K A;  3Q7V A;  4X53 A;  5EOE A;  5FI2 A;  1SKF A;  1FSY A;  4JF4 A;  5KMW A;  1GA9 A;  1K55 C;  1ZKJ A;  5KSH A;  1L2S A;  1S0W A;  4OQI A;  2Y2I A;  3HLE A;  5J8X A;  1OME A;  1J9M A;  1SDE A;  2P74 A;  3NI9 A;  3G30 A;  1NY0 A;  1KDS A;  5HAP A;  3V39 A;  1ONG A;  2IWD A;  4E6X A;  1KVL A;  3OCL A;  4QY5 A;  3UE1 A;  5CEB A;  1K54 C;  5CGW A;  1WE4 A;  3N7W A;  4BEN A;  3UDI A;  4C75 A;  3PTE A;  3ZG9 B;  3PBT A;  2Y59 A;  3LO7 A;  4UHU A;  1PYY A;  3IT9 A;  4KZ4 A;  3O3V A;  2JCH A;  3ZDJ A;  2WYX A;  4S2N A;  4B4X A;  4OQ0 A;  2FFF B;  4OQH A;  1WYB A;  1IYS A;  2ZQC A;  3SOI A;  3IXH A;  3Q07 A;  2H0Y A;  4DE2 A;  2P9V B;  1IEL A;  2RL3 A;  2H10 A;  1L0D A;  5F1F A;  4Z9Q A;  3FV7 A;  4DKI A;  3ISG A;  4PM7 A;  3PBO A;  4D2O A;  4P0M A;  3O88 A;  1ES2 A;  3N8R A;  5FA7 A;  4BQM A;  4KZA A;  1TVF A;  1QME A;  2HDQ A;  5E2G A;  4UAA A;  1YQS A;  3Q81 A;  3VP0 A;  3AGD A;  2QPN A;  3WS5 A;  5EE8 A;  3IWI A;  2WGV A;  4KZ6 A;  2XH9 A;  4GDB A;  1YMS A;  1K57 C;  3DWZ A;  5IHV A;  1GA0 A;  2EXB A;  2OSU A;  3MZF A;  3ZGA B;  4BD1 A;  4BL2 A;  3HLW A;  1G6A A;  1PW1 A;  4JXV A;  4DE1 A;  3PAE A;  2EFU A;  3HVF A;  2Y91 A;  5HL1 A;  5HAI A;  3OPR A;  5FQJ A;  5CHU A;  1HD8 A;  5E2F A;  3GMW A;  5CTN A;  4GN2 A;  5DF7 A;  3ZCZ A;  4DF6 A;  1N9B A;  1K38 A;  1E3U D;  2ZC4 B;  3AGF A;  5FDH A;  3B3X A;  4WYY A;  3TG9 A;  3BFF A;  4GOG A;  4FH2 A;  3MKF A;  3IH8 A;  3A3I A;  3GTC A;  3UPP A;  3VSK A;  3ZNT A;  4IED A;  4H8R A;  2H5S A;  5EVI A;  2XLN A;  5FI6 A;  3C4O A;  3A3E A;  3EQV A;  4LEN A;  1K55 A;  2ZJ9 A;  1FCO A;  2P9V A;  3ZHH A;  1I5Q A;  2X02 A;  3O86 A;  2XQZ A;  4S2J A;  1XXM A;  3RXW A;  4K0X A;  4ZBE A;  3A3D A;  1BLH A;  4N1H A;  5GLD A;  3UPO A;  4OH0 A;  1H8Z A;  5FQM A;  1SHV A;  1TDL A;  4K91 A;  4EV4 A;  4R3J A;  4MNR A;  2A49 A;  3IF5 A;  5CEC A;  2H0T A;  3DW0 A;  3MFD A;  3NY4 A;  3O87 A;  4IBX A;  4S2N C;  4IVI A;  4X69 A;  3HBR A;  2X01 A;  4BD0 A;  2Z2L B;  2Y2Q A;  5CHJ A;  1KGF A;  1LI9 A;  1XGI A;  3M2J A;  4S2O A;  2BLS A;  1K4F A;  1VQQ A;  1E4D A;  3NBL A;  4EWF A;  1FR1 A;  1M6K A;  3GQZ A;  4WMC A;  3PBQ A;  3MBZ A;  3M2K A;  3BLM A;  3NCK A;  3SS4 A;  4WBG A;  4DXB A;  4MBH A;  1GCE A;  3AGE A;  1NYY A;  5FQQ A;  5GLA A;  4KQR A;  3WRT A;  1JWP A;  4FCF A;  2ZM8 A;  4KQO A;  3G2Y A;  5AQB A;  1K4E A;  5EPH A;  3SS5 A;  4EBL A;  4LCL A;  5EVI D;  1ERQ A;  3PBR A;  3C7U A;  4S2M A;  4E6W A;  1TDG A;  4FH4 A;  5L2F A;  3N8S A;  4WZ4 A;  1ERO A;  3HLB A;  1MXO A;  5E2E A;  5FAT A;  4R3B A;  1ESU A;  3BEC A;  4OVD A;  3SH8 A;  5CTM A;  3ZG8 B;  5F1G A;  3S4X A;  4ZJ3 A;  5EVI C;  1JVJ A;  1W5D A;  5FAQ A;  1LHY A;  1JTD A;  3N4I A;  1K56 A;  4B4Z A;  1XA1 A;  4PPR A;  4QB8 A;  1RGZ A;  4OON A;  1YLW A;  5EEC A;  3RXX A;  3E2L A;  4ZJ2 A;  1I2S A;  4KZ5 A;  1PWD A;  3VMA A;  4X68 A;  1MPL A;  2DRW A;  2PU2 A;  1ZG4 A;  4ID4 A;  1PWG A;  2HDS A;  2HP9 A;  3BFD A;  2XFT A;  3BFE A;  4XUZ A;  4DXC A;  1JWZ A;  2Y2J A;  1O7E A;  1IYP A;  4Y0T A;  4B88 A;  4YFM A;  4WMC D;  4K0W A;  1MY8 A;  4PM8 A;  4UA9 A;  4PM5 A;  1KDW A;  1YLJ A;  4BLM A;  4KG5 A;  3QNC A;  4Y7P A;  5CHM A;  1IYO A;  3BRM A;  3GRJ A;  2ZC7 A;  3V50 A;  3CG5 A;  4NK3 A;  2OLV A;  3IQA A;  5CGX A;  4OOY A;  3MXR A;  1W7F A;  4MBF A;  1BSG A;  2WKI A;  2ZQ7 A;  2R9W A;  4RX2 A;  3ZG0 A;  4QD4 A;  4E3L A;  3SH7 A;  3LY3 A;  4LV3 A;  4XXR A;  3IH9 A;  3A3J A;  1ONH A;  2HP6 A;  1NZU A;  4R0Q A;  1NJ4 A;  2WKE A;  4QY6 A;  1YLY A;  1ES3 A;  3OPL A;  3OPH A;  1ES4 A;  5I94 A;  3MZD A;  5JYO A;  3GSG A;  4EBN A;  1GHI A;  1YLT A;  1Z6F A;  3MZE A;  4JXG A;  5HX9 A;  4P87 A;  4F94 A;  5FQ9 A;  1E3U A;  2EX9 A;  3IXB A;  4KZ8 A;  2G2W A;  4EUZ A;  5A90 A;  4KG2 A;  3M6B A;  1DY6 A;  2PU4 A;  3W8K A;  2DNS A;  3MKE A;  1W79 A;  3V3S A;  2Q9M A;  2VGJ A;  3N8L A;  1CK3 A;  1M40 A;  3NDE A;  2XEP A;  1ES5 A;  1Q2Q A;  4X6T A;  1H8Y A;  4JPM A;  2VGK A;  3QNB A;  3HLF A;  3OCN A;  2Y2O A;  5GHY A;  4OQG A;  3G34 A;  2ZM0 A;  3ZNY A;  5TR7 A;  4E3M A;  2HDR A;  3SS3 A;  1ZG6 A;  3PAG A;  1SDN A;  3P09 A;  3QHY A;  5U47 A;  3UDF A;  3ZVW A;  2CC1 A;  4YIN A;  3V5M A;  3BFC A;  3MXS A;  4UA7 A;  5DF8 A;  1FCN A;  3G31 A;  5BOH A;  3IXD A;  3ZG7 B;  4KZ9 A;  5FAS A;  3PBS A;  1MWT A;  4GD6 A;  1FR6 A;  4GZB A;  3UPN A;  3C5A A;  3ZVT A;  3LEZ A;  3IHA A;  1QMF A;  2WGW A;  1IEM A;  4R23 A;  2ZQD A;  1YMX A;  3Q82 A;  1XPB A;  4FD8 A;  3IF6 B;  3FYZ A;  1PZO A;  3FKW A;  4WM9 A;  4HBT A;  5AQA A;  1JWV A;  1U60 A;  5DF9 A;  1DJC A;  4ZDX A;  5EOO A;  2EX2 A;  4N92 A;  2J9O A;  1S6R A;  4JXS A;  5A93 A;  4N1X A;  4PM6 A;  4C3Q A;  1BLS A;  3DTM A;  5KSC A;  3IWQ A;  2Y2P A;  3D4F A;  4PM9 A;  3NC8 A;  1RP5 A;  4KZ7 A;  3UE3 A;  3VP3 A;  1GHP A;  1I2W A;  1FCM A;  2Y2L A;  2WAD A;  4R1G A;  4OPQ A;  2GDN A;  5GHZ A;  4QU3 A;  5TFQ A;  1K57 A;  2Y2N A;  1NYM A;  4MLL A;  3VSL A;  3WS0 A;  3ITB A;  2Y2G A;  4JKT A;  2EX6 A;  1BLC A;  1ESI A;  4CJN A;  4LV2 A;  1DJA A;  3CJM A;  4RYE A;  1XA7 A;  3N6I A;  5CRF A;  5GLB A;  2PBY A;  4OLG A;  4OOL A;  1YT4 A;  2XF3 A;  3HRE A;  5JYP A;  1K25 A;  2RCX A;  4N9K A;  4E3I A;  2WK0 A;  5GHX A;  2V20 A;  1PWC A;  3BEB A;  3C7V A;  3LY4 A;  3V3R A;  1KE4 A;  1PZP A;  2WKH A;  3BLS A;  4L0L A;  1MWR A;  3GR2 A;  2FFY A;  3VFH A;  1PW8 A;  2ZMA A;  3I7J A;  1GHM A;  3JYI A;  4WEL A;  2XK1 A;  4FSF A;  4OKP A;  4JXW A;  5EVL A;  3C4P A;  3G2Z A;  3BFG A;  2UWX A;  3FKV A;  4ZJ1 A;  4XUX A;  2WAE A;  4OPY A;  3UNW A;  4CPK A;  3P98 A;  4UA6 A;  4E3O A;  2XDM A;  1KE0 A;  2JC7 A;  2IWB A;  1BUL A;  3IHB A;  1K54 A;  4WZ5 C;  1BZA A;  2J8Y A;  2Y2M A;  4MBK A;  5FSR A;  3VOY A;  1MWU A;  4HEF A;  4E3J A;  1LI0 A;  5FI7 A;  4S2P A;  4PMA A;  2EFX A;  3Q7V B;  5M18 A;  2E8I A;  2ZQ9 A;  1YM1 A;  4OPR A;  3W4Q A;  5A92 A;  4C6Y A;  4OPZ A;  3A3F A;  4DDS A;  4DDY A;  2X71 A;  1VM1 A;  2ZLY A;  4HBU A;  2G2U A;  5HFO A;  3HL9 A;  1ALQ A;  4WEK A;  4MEZ A;  4DRT A;  2HPB A;  2QZ6 A;  5KZH A;  4RA7 A;  1C3B A;  1EWZ A;  4Y0O A;  1PI4 A;  5GL9 A;  1K6R A;  4OLD A; 
#chains in the Genus database with same CATH topology
 4OP5 A;  4NXG A;  3RJU A;  2J9P A;  4NKP A;  1T1C A;  3CZD A;  4E04 A;  1Y54 A;  3TSG A;  3IS2 A;  2VV6 A;  3T1Q B;  4KZ3 A;  4MMN A;  1TS0 A;  1FQG A;  3GVB A;  3IBJ A;  3F1N A;  1IOU A;  4LRX C;  3LIF A;  3CPT B;  1HLU P;  4EQI A;  2IWC A;  1L0G A;  1MWS A;  4F3L B;  3G4P A;  1G68 A;  2W3F A;  4Y2F A;  3VFF A;  4O0P A;  3F1O A;  2PR6 A;  2HJE A;  4YOF A;  3UE0 A;  3QP8 A;  4EUV A;  5GLC A;  2XD5 A;  3CMZ A;  4EEP A;  4L9G A;  2Y55 A;  3CI6 A;  5EUA A;  1N9O A;  1XP4 A;  4KG6 A;  5IT5 A;  1A0K A;  2WZZ A;  4BJP A;  3UB9 A;  5DTS A;  2O99 A;  1S4R A;  1V9Y A;  4ARZ A;  4QJG A;  4KEN B;  3VE3 A;  5CER A;  3M6H A;  3T4K A;  1XKZ A;  2ZC3 B;  3UB7 A;  4GS9 B;  3T4J A;  4CLC C;  5AJG A;  3WS2 A;  2L0W A;  1H5X A;  2C5W B;  3T1R A;  3G32 A;  2Z2M B;  2ZL1 A;  4ZTK A;  3QP5 A;  2HDU A;  5HAQ A;  2Y2K A;  5DTT A;  3P7N A;  3KSI A;  2W0N A;  4BWI A;  1OT6 A;  2HP5 A;  1G5U A;  1FSY A;  1ZKJ A;  4OQI A;  1XJ6 A;  3HLE A;  1KDS A;  2IWD A;  3T12 B;  4E6X A;  3OCL A;  4QY5 A;  1K54 C;  2D01 A;  3C38 A;  4BEN A;  4C75 A;  3PBT A;  2Y59 A;  4FTX A;  1NWZ A;  4H6J A;  2JCH A;  3LFV A;  4OQH A;  1IYS A;  2EWV A;  4X1M A;  5DKL A;  2H0Y A;  1OJ5 A;  4IJG A;  1G6O A;  2RL3 A;  4HJ6 A;  2H10 A;  4EW7 A;  3D9Y A;  4D2O A;  1H3Q A;  3KYE A;  1YQS A;  3AGD A;  1S66 L;  4IUK A;  3DTK A;  4GDB A;  1K57 C;  3DWZ A;  1GA0 A;  3ZGA B;  2OSU A;  4DJ3 A;  5CHU A;  3GMW A;  5CTN A;  4GN2 A;  1DRM A;  4UQI S;  1N9B A;  3AGF A;  3B3X A;  2JN7 A;  4FH2 A;  1OT9 A;  3A3I A;  3GTC A;  3UPP A;  2PT7 A;  2XLN A;  2V1B A;  3C4O A;  3QP2 A;  1I5Q A;  4S2J A;  2XQZ A;  3DTE A;  3RXW A;  3JPU A;  3A3D A;  4N1H A;  1OPX A;  1SHV A;  3MFD A;  3NY4 A;  3O87 A;  2VA0 A;  3HJI A;  1TS7 A;  1N9N A;  3LYX A;  4L9E A;  3PBQ A;  2ZOH A;  3SS4 A;  1T19 A;  4LRZ E;  4MBH A;  5L10 A;  4KQR A;  1JWP A;  4KQO A;  3SS5 A;  1OTE A;  2ACG A;  5IU1 A;  3T4S A;  4E6W A;  1LSW A;  2MJ6 A;  3D3O A;  3HLB A;  1MXO A;  5F1G A;  4ZJ3 A;  1JVJ A;  5FEG A;  1SKO B;  1JTD A;  1OTA A;  4B93 A;  1VEU B;  1XA1 A;  4QB8 A;  1YLW A;  1PRQ A;  2JKF A;  4Y15 A;  1BYW A;  2HP9 A;  4XUZ A;  2P08 A;  2XFT A;  3BFE A;  5HDS A;  5HD3 A;  1IYO A;  3BRM A;  5CGX A;  3LI9 A;  4I39 A;  2JKG A;  2ZQ7 A;  4I3J A;  4XXR A;  3IH9 A;  3A3J A;  1NJ4 A;  3OPH A;  5JYO A;  4HHD A;  2GZA A;  4R38 A;  1E3U A;  5K5B A;  1P0Z A;  4EUZ A;  1DY6 A;  3W8K A;  2DNS A;  4Y3I A;  3MKE A;  3V3S A;  2PD7 A;  2VGK A;  3QNB A;  2Y2O A;  4YNR A;  1OJG A;  2W3G A;  1ZG6 A;  3R7W B;  2KLI A;  3QHY A;  3UDF A;  4HH2 A;  2CC1 A;  4YIN A;  3BWL A;  2Z6C A;  3G31 A;  4HQA A;  4KZ9 A;  3A0V A;  1YPR A;  1MWT A;  4DMZ A;  4GD6 A;  4GZB A;  2OAP 1;  3ZVT A;  2QYB A;  1QMF A;  1IEM A;  4R23 A;  1YMX A;  3QP6 A;  5DFY A;  4FD8 A;  5AQA A;  1DJC A;  4ZDX A;  1TS8 A;  4JXS A;  2PBD P;  3PYP A;  5KSC A;  3O5Y A;  3NC8 A;  1RP5 A;  4X1L A;  2DMW A;  2Y2L A;  4R1G A;  4OPQ A;  3E4P A;  1NYM A;  3MJQ A;  1ESI A;  4LV2 A;  4RYE A;  1XA7 A;  3N6I A;  3RFB A;  2V8F A;  5GLB A;  5HZH A;  2PBY A;  4OOL A;  1YT4 A;  2W27 A;  2JKT I;  2V20 A;  3BEB A;  2YKF A;  3LY4 A;  4DN0 A;  3BLS A;  3MFX A;  1PW8 A;  4LGW A;  2ZMA A;  1GHM A;  3JYI A;  3FKV A;  4OPY A;  2XDM A;  1BUL A;  1XFN A;  2J8Y A;  2PYR A;  5TJJ A;  2FH5 A;  5DFX A;  2EFX A;  3Q7V B;  2CMN A;  2E8I A;  2JKT M;  4OPR A;  3T1S A;  4NXB A;  5J7E A;  4MEZ A;  4DRT A;  1C3B A;  1EWZ A;  1PI4 A;  1WA9 A;  3BM6 A;  1S1Z A;  3GV9 A;  1N4O A;  1CEF A;  1OTB A;  3P01 A;  1T18 A;  1W8Q A;  2M7V A;  3VOL A;  1L0F A;  2V2F F;  4P6Z M;  4WZ5 A;  3SW1 A;  3LCE A;  4HES A;  4CLC E;  3UN7 A;  2ZD8 A;  2Q9N A;  4X56 A;  4P6B A;  4LRY C;  3KYQ A;  4U0T A;  1RCJ A;  2WGW B;  2JE5 A;  1Q2P A;  1CI9 A;  4K08 A;  5G18 A;  5J3W A;  4E3K A;  2V1Z A;  1LL5 A;  3S1Y A;  2VX8 A;  3ITA A;  3IWO A;  4CLC D;  3E2K A;  3VP2 A;  1PI5 A;  3WWX A;  2C6W B;  2L4R A;  4WEJ A;  3WS1 A;  4KQQ A;  3FWL A;  3HUO A;  4DE0 A;  2G7U A;  4GB7 A;  3NDG A;  2XFS A;  5DVA A;  1DJB A;  4IVK A;  4N9L A;  4D60 A;  3W2Z A;  1W8Y A;  2ZOI A;  4X55 A;  3OOV A;  4OP8 A;  3Q1F A;  1XJ4 A;  1KE3 A;  5CGS A;  1CI8 A;  2JKR M;  1P9R A;  3PBN A;  1K56 D;  3LR5 A;  1GSX A;  3G35 A;  1S1Y A;  1BTL A;  1G28 A;  1NXY A;  1UGU A;  3IBR A;  1JTG A;  3ZFZ A;  1HVB A;  1SZV A;  2VK3 A;  3DWK A;  3Q7Z A;  4S2L A;  3T50 A;  4Q8I A;  1SCW A;  1AXB A;  3CAX A;  5AQ7 A;  1TEM A;  2B5R A;  5AQ9 A;  2EX8 A;  2XR0 A;  3ZG5 A;  4GKU A;  3H9W A;  2W1T A;  4RQ9 A;  1OTD A;  3HLD A;  2OLU A;  4LV1 A;  4O7D A;  2GX5 A;  4WN5 A;  2V0U A;  5DJT A;  3LR0 A;  4HJ4 A;  1OME A;  1SDE A;  3IX8 A;  1ONG A;  5CEB A;  2KDK A;  3N7W A;  3LR4 A;  3PTE A;  3LO7 A;  4LLO B;  1PYY A;  3IT9 A;  3O3V A;  4OQ0 A;  1WYB A;  3IXH A;  3Q07 A;  2P9V B;  4ARZ B;  1IEL A;  1L0D A;  3F1O B;  4P0M A;  1DP8 A;  4BQM A;  2K7S A;  4XT2 A;  4MCW A;  2HDQ A;  4UAA A;  3Q81 A;  2XH9 A;  3E4O A;  1YMS A;  5IHV A;  4HP9 A;  3QP4 A;  5DJU A;  3ZCZ A;  5HDC A;  3ZYT A;  3LIC A;  5C5K A;  3L9K A;  3TG9 A;  3BFF A;  2QHK A;  3VSK A;  5EVI A;  5FI6 A;  3EQV A;  2P9V A;  1FCO A;  3ZHH A;  3LI8 A;  3KSH A;  1XXM A;  4B9O A;  4K0X A;  3C30 A;  1KOU A;  5GLD A;  2YKH A;  1X0O A;  5FQM A;  2PD8 A;  4MNR A;  3IF5 A;  2Y8H A;  4IVI A;  4X69 A;  1XGI A;  3TJZ C;  1PNE A;  1K4F A;  3NBL A;  4Q0J A;  4EWF A;  1FR1 A;  4F3L A;  3GQZ A;  3M2K A;  3BLM A;  3NCK A;  4ETZ A;  1W63 Q;  3FG8 A;  3EEH A;  3R7W A;  4ETX A;  5EPH A;  4EBL A;  4LCL A;  1ERQ A;  3N8S A;  1EW0 A;  1ESU A;  4R3A A;  5HWV A;  1XJ2 A;  1K56 A;  1VET A;  1PWD A;  3NUL A;  1NRJ A;  3VMA A;  4MN7 A;  4X68 A;  1ZG4 A;  3BFD A;  1JWZ A;  2J3T C;  4K0W A;  4PM8 A;  3C2W A;  3BY8 A;  4KG5 A;  5CHM A;  2ZC7 A;  4IHQ A;  3DAV A;  3CG5 A;  4NK3 A;  1W7F A;  4RX2 A;  2R9W A;  4E3L A;  5AVE A;  2HP6 A;  4UEY A;  3OPL A;  2LB9 A;  5I94 A;  3MZD A;  3GSG A;  4EBN A;  1GHI A;  1Z6F A;  4GJ4 A;  3EGX C;  1VET B;  4F94 A;  5HWW A;  3M6B A;  2PU4 A;  2QWS A;  1W79 A;  2VGJ A;  3FPW A;  3MF0 A;  2XEP A;  1ES5 A;  1H8Y A;  3HLF A;  2A24 B;  3QP1 A;  4GHI A;  5TR7 A;  2HDR A;  2Y79 A;  1SDN A;  3P09 A;  5BOH A;  1FCN A;  3BW6 A;  5FAS A;  3UPN A;  3C5A A;  4Y13 A;  1T1A A;  3MMH A;  4QWO A;  1XPB A;  4I38 A;  2W1R A;  4HBT A;  1U60 A;  5DF9 A;  5EOO A;  2EX2 A;  4GCZ A;  1S67 L;  2OAQ 1;  4CQH A;  5A93 A;  4C3Q A;  1BLS A;  3DTM A;  2Y2P A;  4PM9 A;  1N9L A;  4KZ7 A;  3VP3 A;  2V0W A;  1NLZ A;  2WAD A;  1D7E A;  3TW8 A;  4PKY G;  4R70 A;  1K57 A;  2Y2N A;  3CUE A;  4MLL A;  3LEQ A;  3VSL A;  3ITB A;  2Y2G A;  4JKT A;  3ZQ5 A;  3GDI A;  1DJA A;  5CRF A;  2XF3 A;  3HRE A;  2RCX A;  4E3I A;  4HJ3 A;  1PWC A;  2QJ7 A;  4L0L A;  3VFH A;  4PHT A;  4WUJ A;  2XK1 A;  2K31 A;  4FSF A;  4JXW A;  3G2Z A;  4ZJ1 A;  1TF1 A;  4Q0H A;  3UNW A;  3P98 A;  4UA6 A;  3BJN A;  3IHB A;  1JNU A;  1K54 A;  1BZA A;  4MN6 A;  2QJ5 A;  5FSR A;  3VOY A;  4HEF A;  3CIT A;  5HPF A;  2ZQ9 A;  1YM1 A;  5A92 A;  4MDZ A;  3D72 A;  4OPZ A;  4DDS A;  4DDY A;  2X71 A;  2B95 A;  4WEK A;  3LGO A;  2HPB A;  5GL9 A;  3IF6 A;  4OLD A;  4LV0 A;  2NUP C;  2JBF A;  4EU0 A;  1L0E A;  4FOF A;  2A3U A;  1LL9 A;  1Y4O A;  3E4Q A;  5G4Z A;  4RX3 A;  3B33 A;  3NJA A;  2QMI A;  2ZC5 B;  1O07 A;  1IFQ A;  3LID A;  1YLZ A;  1NZO A;  1KGE A;  2LB5 A;  3SH9 A;  3HUN A;  3VP4 A;  4CLC A;  2VV8 A;  5D3O A;  2OV5 A;  3UDX A;  5TBM B;  5FAP A;  3S7P A;  2DCF A;  3HLC A;  3W4P A;  1S4S A;  3JVU A;  3CUE C;  1RGY A;  3OPP A;  1GSV A;  5CXW A;  4KZB A;  3OZH A;  4BBV A;  3W4O A;  2ZL1 B;  4R4S A;  3B42 A;  2WAF A;  4R4R A;  4WF0 A;  4OOM A;  2XGN A;  3LUQ A;  5M1A A;  1UWP X;  3UO9 A;  3EWK A;  1IKI A;  4S2I A;  2VKS A;  5TGF A;  3FZC A;  2ZC6 B;  4WL9 A;  3TE8 A;  4O01 A;  1YKD A;  3HUM A;  4U3T A;  4M3K A;  4GDN A;  1F9I A;  1NLY A;  3EQU A;  5A91 A;  4P85 A;  1WYC A;  1FOF A;  1OTI A;  5HAR A;  4GNU A;  1YLP A;  3F1N B;  1ZC2 A;  4LCM A;  1KVM A;  2BTF P;  5F83 A;  3UY6 A;  1IYQ A;  4YWZ A;  4I3A A;  3IXG A;  4Y17 A;  2E8J A;  2EA9 A;  1MKI A;  5FQI A;  3OLO A;  2WZX A;  2Y2H A;  3VOZ A;  2WUQ A;  4S2K A;  4X53 A;  5EOE A;  1SKF A;  5EVE A;  4JF4 A;  5KMW A;  1GA9 A;  5FEF A;  2GNX A;  2Y2I A;  1H8M A;  4G3K A;  3NI9 A;  3G30 A;  5FL3 A;  2P7J A;  1KVL A;  3UE1 A;  1H0M A;  3MQ0 A;  5CGW A;  2PHY A;  3ZG9 B;  2NUT C;  3E0Y A;  4UHU A;  4EEU A;  2WYX A;  3RH8 B;  4B4X A;  2ZQC A;  2FZ0 A;  3NEC A;  5F1F A;  4DKI A;  3ISG A;  4PM7 A;  1ES2 A;  4Y5F A;  2W3E A;  2KX6 A;  1TVF A;  3PXP A;  3L7H A;  2QPN A;  3WS5 A;  5EE8 A;  2HJ9 C;  3IWI A;  4KZ6 A;  3RTY A;  4BD1 A;  3HLW A;  1G6A A;  1PW1 A;  3UB5 P;  4DE1 A;  2Y91 A;  3UB6 A;  4L9F A;  5HL1 A;  5HAI A;  5FQJ A;  4EET B;  1HD8 A;  3HJK A;  5DF7 A;  1CQA A;  1K38 A;  1E3U D;  5FDH A;  2PYP A;  4HOI A;  3MKF A;  2PR5 A;  3IH8 A;  4HNB A;  1D1J A;  3ZNT A;  4H8R A;  2H5S A;  1PFL A;  3A3E A;  4LEN A;  1K55 A;  5G4Y A;  2GJ3 A;  4ZBE A;  3UPO A;  3CWF A;  1P9W A;  2VJW A;  4OH0 A;  1H8Z A;  4BBU A;  4R3J A;  5CEC A;  2H0T A;  5F6A A;  4IBX A;  2M7U A;  3HBR A;  2X01 A;  4BD0 A;  2Y2Q A;  5CHJ A;  2V9A A;  4S2O A;  3LIB A;  1E4D A;  4EER A;  1YSQ A;  4WMC A;  2QKP A;  4WBG A;  4DXB A;  1GCE A;  3AGE A;  1NYY A;  5FQQ A;  1XFQ A;  4IUH A;  2ZM8 A;  2J80 A;  3PBR A;  5L2F A;  1TDG A;  1F5M A;  4WZ4 A;  1ERO A;  5E2E A;  3SH8 A;  5CTM A;  3ZG8 B;  3OBF A;  1FIL A;  3S4X A;  1W5D A;  5FAQ A;  1LHY A;  1DP6 A;  1RGZ A;  4OON A;  5EEC A;  5HL6 A;  2J3W A;  4ME4 A;  1MPL A;  2PAV P;  2PU2 A;  4ID4 A;  4DXC A;  3BY9 A;  3T4Q A;  1IYP A;  4B88 A;  4YFM A;  3R4K A;  1MY8 A;  3F1P B;  1YLJ A;  2WKQ A;  4MN5 A;  4Y7P A;  3GRJ A;  3H82 B;  3K3C A;  5HDD A;  4OOY A;  3MXR A;  1BSG A;  2WKI A;  3ZG0 A;  1ZTU A;  4QD4 A;  5J4E A;  3UE6 A;  4R0Q A;  1NZU A;  2WKE A;  1YLY A;  1ES3 A;  3MQO A;  4P6Z S;  3B47 A;  3CHW P;  1YLT A;  3A0R A;  4JXG A;  4P87 A;  4EES A;  1K0K A;  5A90 A;  4KZ8 A;  2G2W A;  2B02 A;  1Y28 A;  3NDE A;  4O8G A;  3PHY A;  3OCN A;  3ZNY A;  3G34 A;  4E3M A;  1CJF A;  3SS3 A;  3PAG A;  3ZVW A;  5U47 A;  3MSH A;  3BFC A;  2O9C A;  3MXS A;  4UA7 A;  2IA2 A;  3IXD A;  1SKO A;  1LSV A;  2HGV A;  4JGR A;  3LEZ A;  4HH3 A;  3IF6 B;  3FYZ A;  1PZO A;  3FKW A;  4WM9 A;  3VE4 A;  3KSG A;  1VHM A;  4FUW A;  3C8C A;  4N1X A;  3IWQ A;  3D4F A;  4EQ1 A;  3UE3 A;  1I2W A;  1FCM A;  3IX3 A;  3MR0 A;  2GDN A;  2KOI A;  4QU3 A;  5TFQ A;  2INW A;  3EOI A;  3CLO A;  1YAX A;  3WS0 A;  2EX6 A;  5EM0 A;  4GLQ A;  4JGO A;  3JVV A;  3K3D A;  5L07 A;  2VEA A;  2H28 A;  5JYP A;  3V3R A;  4KUO A;  3KO6 A;  1MWR A;  4I5S A;  3I7J A;  4WEL A;  4OKP A;  3S7O A;  3C4P A;  4II7 A;  2BAS A;  3BFG A;  4CPK A;  2UV0 E;  4E3O A;  1KE0 A;  2JKR I;  4GHI B;  4WZ5 C;  4AFI A;  4MBK A;  1MWU A;  1DP9 A;  4E3J A;  5FI7 A;  4S2P A;  4PMA A;  2XA7 M;  4KUK A;  3A3F A;  3V67 A;  1VM1 A;  2ZLY A;  1MC0 A;  4HBU A;  2G2U A;  1ALQ A;  3U4L P;  4RA7 A;  2K2N A;  3NHQ A;  4Y0O A;  3UB8 A;  1K6R A;  1L3L A;  5FAO A;  2Z6D A;  5F68 A;  1FIK A;  2VZW A;  1T1B A;  4EXO A;  3T1X A;  1HTZ A;  4JF6 A;  3OC2 A;  1LLB A;  3WRZ A;  1XX2 A;  3WS4 A;  4A5R A;  4RVA A;  5L09 A;  4IBR A;  3KYZ A;  1PIO A;  2J3T D;  3UME A;  2VGL M;  2XD1 A;  1BLP A;  2ZMV A;  4NET A;  2XA7 S;  4JLF A;  1E25 A;  2WKR A;  2A2L A;  2O9A A;  1NRF A;  4BL3 A;  3VP1 A;  1CEG A;  3K2N A;  3BYD A;  5CED A;  4GD8 A;  1BUE A;  1STZ A;  3T4O A;  4U0X A;  2ZM2 A;  5F82 A;  2Q0O A;  5EVI B;  3S7N A;  5HW3 A;  2D02 A;  3S22 A;  4PAU A;  4LPZ A;  1XGJ A;  4DE3 A;  1FSW A;  3SZT A;  4H6J B;  2WGI A;  4JGQ A;  2EXA A;  3TOI A;  5M19 A;  2BG1 A;  2J7V A;  5FDS A;  5E2H A;  4E3N A;  5EM1 A;  3KX0 X;  1HZO A;  1ERM A;  2OWH A;  3DBA A;  1BT5 A;  1W63 M;  2ZQA A;  2O9B A;  2PRF A;  1KGG A;  2R9X A;  2ZQ8 A;  1TS6 A;  4EBP A;  1IKG A;  2I72 A;  1EI5 A;  5A8B A;  5FQK A;  3MS6 A;  5MC7 A;  3IS2 B;  3NIA A;  1MZU A;  5IS1 A;  1CF0 A;  3IF6 C;  4JF5 A;  4BBT A;  4ZAM A;  5DTK A;  2Y4A A;  4Y0U A;  4QHC A;  1MBL A;  3BQA A;  4JBF A;  3HLG A;  1K6S A;  5E43 A;  3Q7V A;  4NXE A;  5FI2 A;  2ZBB A;  3E98 A;  1K55 C;  5KSH A;  1L2S A;  1S0W A;  5KIZ A;  5J8X A;  1J9M A;  2P74 A;  2VV7 A;  2JHE A;  1NY0 A;  5HAP A;  4Q0I A;  2M1C A;  3V39 A;  3H7W A;  1WE4 A;  3UDI A;  4KZ4 A;  3ZDJ A;  4S2N A;  3PR6 A;  2FFF B;  2W3D A;  3SOI A;  2XRN A;  3H82 A;  4DE2 A;  4Z9Q A;  3FV7 A;  3PBO A;  4WLA A;  2R78 A;  2W1T B;  3O88 A;  3N8R A;  5FA7 A;  1P97 A;  4KZA A;  1QME A;  5E2G A;  3IX4 A;  3VP0 A;  4G3W A;  2WGV A;  5L8M A;  3FPV A;  2EXB A;  3MZF A;  5I5L A;  4BL2 A;  4JXV A;  3PAE A;  2EFU A;  3HVF A;  1YSP A;  3OPR A;  5E2F A;  4DF6 A;  2ZC4 B;  4WYY A;  4GOG A;  4ZRR A;  3LIE A;  5HD5 A;  4IED A;  2ZMF A;  2V8C A;  2ZJ9 A;  1ZHH B;  2X02 A;  3O86 A;  4PKY A;  1AWI A;  1BLH A;  5EFW A;  3DTI A;  2B18 A;  1TDL A;  4K91 A;  4EV4 A;  2A49 A;  3DW0 A;  3CPT A;  4HP4 A;  4S2N C;  4CLC B;  2Z2L B;  3EGD C;  5HWT A;  1KGF A;  1LI9 A;  3M2J A;  2BLS A;  2PDR A;  4M4X A;  3H7W B;  1VQQ A;  5TBM A;  1M6K A;  3MBZ A;  5CX7 A;  2WKP A;  1F98 A;  4HI4 A;  5GLA A;  3WRT A;  4FCF A;  4I3I A;  3MXQ A;  3G2Y A;  5AQB A;  1K4E A;  5EVI D;  5AVF A;  1XJ3 A;  3C7U A;  4S2M A;  4FH4 A;  5FAT A;  2VGL S;  4R3B A;  3BEC A;  4OVD A;  4NXF A;  5EVI C;  3N4I A;  4B4Z A;  4PPR A;  3T4L A;  3RXX A;  3E2L A;  4ZJ2 A;  2HV1 A;  1I2S A;  4KZ5 A;  3BQ8 A;  5EV0 A;  2DRW A;  4NEE D;  4DJ2 A;  1PWG A;  2HDS A;  2Y2J A;  3GEC A;  1O7E A;  4Y0T A;  4G3V A;  1MKM A;  4WMC D;  4UA9 A;  4X25 A;  4PM5 A;  1KDW A;  4BLM A;  3QNC A;  3U2A A;  4GS9 A;  4HY8 A;  3V50 A;  2OLV A;  3IQA A;  3KSF A;  1F2K A;  3G6O A;  4MBF A;  3SH7 A;  1ACF A;  3LY3 A;  4LV3 A;  4BMW A;  1ONH A;  4QY6 A;  1ES4 A;  3MZE A;  5HX9 A;  3LR3 A;  5F5Y A;  4JGP A;  5FQ9 A;  3IXB A;  2EX9 A;  4KG2 A;  1J3W A;  2Q9M A;  2L1M A;  3N8L A;  4Z1W A;  1CK3 A;  1M40 A;  1UWN X;  5HSQ A;  1Q2Q A;  4X6T A;  1V9Z A;  4JPM A;  5GHY A;  2O0Y A;  4OQG A;  2ZM0 A;  4KQD A;  1LL8 A;  2P04 A;  3LIA A;  1VB6 A;  3V5M A;  2OOL A;  5DF8 A;  1VEU A;  3ZG7 B;  1LT0 A;  3PBS A;  3T4T A;  1TD5 A;  1FR6 A;  3NOP C;  3IHA A;  5F69 A;  2W3H A;  2WGW A;  4LFU A;  2ZQD A;  3Q82 A;  4ESP A;  4UQI M;  3ULF A;  1JWV A;  3F1P A;  4N92 A;  2J9O A;  1S6R A;  3EEA A;  1GSW A;  4PM6 A;  1GHP A;  2A24 A;  2OWJ A;  3A0S A;  5GHZ A;  2HZ5 A;  3ICY A;  2XRO A;  3FC7 A;  1Z09 A;  1BLC A;  3VV4 A;  4CJN A;  4GW9 A;  3CJM A;  1ODV A;  1D06 A;  4OLG A;  1K25 A;  4N9K A;  2WK0 A;  5GHX A;  3C7V A;  1KE4 A;  3S7Q A;  1PZP A;  2WKH A;  2XSS A;  3GR2 A;  2FFY A;  5EVL A;  2EWW A;  2HF6 A;  3TRC A;  3MQQ A;  2I9V A;  2UWX A;  4R6L A;  4XUX A;  2WAE A;  1LSX A;  4NG2 A;  4QPR A;  2JC7 A;  2IWB A;  2V1A A;  3HCY A;  4HIA A;  2Y2M A;  5HPI A;  1LI0 A;  3NOT C;  3NOU C;  3UMD A;  5M18 A;  4XT2 B;  3W4Q A;  4C6Y A;  5DKK A;  5HFO A;  3HL9 A;  2VLG A;  2QZ6 A;  5KZH A;  5LBR A;  2AVX A; 
#chains in the Genus database with same CATH homology
 4OP5 A;  3RJU A;  3BM6 A;  5FAO A;  4LV0 A;  3GV9 A;  1N4O A;  2JBF A;  1CEF A;  2J9P A;  1L0E A;  1W8Q A;  2A3U A;  3CZD A;  1LL9 A;  1Y54 A;  4RX3 A;  1L0F A;  2V2F F;  3TSG A;  1HTZ A;  2QMI A;  4WZ5 A;  4JF6 A;  2ZC5 B;  1O07 A;  3LCE A;  1LLB A;  3OC2 A;  4HES A;  1XX2 A;  3WRZ A;  4KZ3 A;  3WS4 A;  3UN7 A;  4A5R A;  1YLZ A;  1FQG A;  2ZD8 A;  2Q9N A;  3GVB A;  4RVA A;  1NZO A;  4X56 A;  4IBR A;  1KGE A;  4P6B A;  1PIO A;  3SH9 A;  2XD1 A;  1BLP A;  4U0T A;  3HUN A;  3VP4 A;  4NET A;  1RCJ A;  2WGW B;  2JE5 A;  1Q2P A;  1CI9 A;  5D3O A;  4EQI A;  5G18 A;  2IWC A;  2OV5 A;  4E3K A;  2V1Z A;  1LL5 A;  3S1Y A;  4JLF A;  3UDX A;  3ITA A;  1L0G A;  1MWS A;  3IWO A;  3G4P A;  3E2K A;  1E25 A;  1G68 A;  5FAP A;  3VP2 A;  1NRF A;  1PI5 A;  3VFF A;  4BL3 A;  3WWX A;  3VP1 A;  1CEG A;  2C6W B;  2DCF A;  3HLC A;  3BYD A;  3W4P A;  5CED A;  4GD8 A;  1BUE A;  4WEJ A;  3WS1 A;  4KQQ A;  1RGY A;  3FWL A;  3UE0 A;  3OPP A;  3HUO A;  4DE0 A;  5CXW A;  5GLC A;  2XD5 A;  3CMZ A;  4KZB A;  2ZM2 A;  3OZH A;  4U0X A;  5F82 A;  3W4O A;  5EVI B;  2Y55 A;  4GB7 A;  4R4S A;  3NDG A;  5EUA A;  2WAF A;  2XFS A;  4R4R A;  3S22 A;  5HW3 A;  4OOM A;  2XGN A;  1XP4 A;  4KG6 A;  5M1A A;  5DVA A;  3UO9 A;  1XGJ A;  1DJB A;  4IVK A;  1IKI A;  2WZZ A;  1FSW A;  4S2I A;  4BJP A;  4DE3 A;  2WGI A;  5TGF A;  4N9L A;  3FZC A;  2ZC6 B;  5DTS A;  2EXA A;  3TOI A;  5M19 A;  1W8Y A;  2BG1 A;  2J7V A;  4X55 A;  4OP8 A;  4QJG A;  3HUM A;  3IF6 A;  3Q1F A;  5E2H A;  4E3N A;  1KE3 A;  4KEN B;  4U3T A;  4M3K A;  5CGS A;  1CI8 A;  5CER A;  3M6H A;  4GDN A;  3PBN A;  1HZO A;  1XKZ A;  1ERM A;  1K56 D;  2ZC3 B;  1BT5 A;  2ZQA A;  3G35 A;  1KGG A;  2R9X A;  3EQU A;  2ZQ8 A;  5A91 A;  4EBP A;  1BTL A;  1IKG A;  2I72 A;  1NXY A;  4P85 A;  3WS2 A;  1EI5 A;  1WYC A;  1H5X A;  2C5W B;  5FQK A;  1JTG A;  3ZFZ A;  3G32 A;  1FOF A;  1HVB A;  2Z2M B;  3DWK A;  5HAR A;  4ZTK A;  3Q7Z A;  4S2L A;  4Q8I A;  4GNU A;  1SCW A;  1YLP A;  1AXB A;  3NIA A;  2HDU A;  1ZC2 A;  2B5R A;  1TEM A;  5AQ7 A;  5AQ9 A;  4LCM A;  3IF6 C;  5HAQ A;  4JF5 A;  1KVM A;  2Y2K A;  5DTT A;  2EX8 A;  2XR0 A;  3ZG5 A;  4ZAM A;  5F83 A;  3UY6 A;  5DTK A;  4GKU A;  2Y4A A;  1IYQ A;  3IXG A;  4Y0U A;  4QHC A;  1MKI A;  3HLD A;  5FQI A;  2OLU A;  2WZX A;  1MBL A;  4LV1 A;  4O7D A;  2Y2H A;  3VOZ A;  4JBF A;  3HLG A;  1K6S A;  5E43 A;  2WUQ A;  2HP5 A;  4S2K A;  3Q7V A;  4X53 A;  5EOE A;  5FI2 A;  1SKF A;  1FSY A;  4JF4 A;  5KMW A;  1GA9 A;  1K55 C;  1ZKJ A;  5KSH A;  1L2S A;  1S0W A;  4OQI A;  2Y2I A;  3HLE A;  5J8X A;  1OME A;  1J9M A;  1SDE A;  2P74 A;  3NI9 A;  3G30 A;  1NY0 A;  1KDS A;  5HAP A;  3V39 A;  1ONG A;  2IWD A;  4E6X A;  1KVL A;  3OCL A;  4QY5 A;  3UE1 A;  5CEB A;  1K54 C;  5CGW A;  1WE4 A;  3N7W A;  4BEN A;  3UDI A;  4C75 A;  3PTE A;  3ZG9 B;  3PBT A;  2Y59 A;  3LO7 A;  4UHU A;  1PYY A;  3IT9 A;  4KZ4 A;  3O3V A;  2JCH A;  3ZDJ A;  2WYX A;  4S2N A;  4B4X A;  4OQ0 A;  2FFF B;  4OQH A;  1WYB A;  1IYS A;  2ZQC A;  3SOI A;  3IXH A;  3Q07 A;  2H0Y A;  4DE2 A;  2P9V B;  1IEL A;  2RL3 A;  2H10 A;  1L0D A;  5F1F A;  4Z9Q A;  3FV7 A;  4DKI A;  3ISG A;  4PM7 A;  3PBO A;  4D2O A;  4P0M A;  3O88 A;  1ES2 A;  3N8R A;  5FA7 A;  4BQM A;  4KZA A;  1TVF A;  1QME A;  2HDQ A;  5E2G A;  4UAA A;  1YQS A;  3Q81 A;  3VP0 A;  3AGD A;  2QPN A;  3WS5 A;  5EE8 A;  3IWI A;  2WGV A;  4KZ6 A;  2XH9 A;  4GDB A;  1YMS A;  1K57 C;  3DWZ A;  5IHV A;  1GA0 A;  2EXB A;  2OSU A;  3MZF A;  3ZGA B;  4BD1 A;  4BL2 A;  3HLW A;  1G6A A;  1PW1 A;  4JXV A;  4DE1 A;  3PAE A;  2EFU A;  3HVF A;  2Y91 A;  5HL1 A;  5HAI A;  3OPR A;  5FQJ A;  5CHU A;  1HD8 A;  5E2F A;  3GMW A;  5CTN A;  4GN2 A;  5DF7 A;  3ZCZ A;  4DF6 A;  1N9B A;  1K38 A;  1E3U D;  2ZC4 B;  3AGF A;  5FDH A;  3B3X A;  4WYY A;  3TG9 A;  3BFF A;  4GOG A;  4FH2 A;  3MKF A;  3IH8 A;  3A3I A;  3GTC A;  3UPP A;  3VSK A;  3ZNT A;  4IED A;  4H8R A;  2H5S A;  5EVI A;  2XLN A;  5FI6 A;  3C4O A;  3A3E A;  3EQV A;  4LEN A;  1K55 A;  2ZJ9 A;  1FCO A;  2P9V A;  3ZHH A;  1I5Q A;  2X02 A;  3O86 A;  2XQZ A;  4S2J A;  1XXM A;  3RXW A;  4K0X A;  4ZBE A;  3A3D A;  1BLH A;  4N1H A;  5GLD A;  3UPO A;  4OH0 A;  1H8Z A;  5FQM A;  1SHV A;  1TDL A;  4K91 A;  4EV4 A;  4R3J A;  4MNR A;  2A49 A;  3IF5 A;  5CEC A;  2H0T A;  3DW0 A;  3MFD A;  3NY4 A;  3O87 A;  4IBX A;  4S2N C;  4IVI A;  4X69 A;  3HBR A;  2X01 A;  4BD0 A;  2Z2L B;  2Y2Q A;  5CHJ A;  1KGF A;  1LI9 A;  1XGI A;  3M2J A;  4S2O A;  2BLS A;  1K4F A;  1VQQ A;  1E4D A;  3NBL A;  4EWF A;  1FR1 A;  1M6K A;  3GQZ A;  4WMC A;  3PBQ A;  3MBZ A;  3M2K A;  3BLM A;  3NCK A;  3SS4 A;  4WBG A;  4DXB A;  4MBH A;  1GCE A;  3AGE A;  1NYY A;  5FQQ A;  5GLA A;  4KQR A;  3WRT A;  1JWP A;  4FCF A;  2ZM8 A;  4KQO A;  3G2Y A;  5AQB A;  1K4E A;  5EPH A;  3SS5 A;  4EBL A;  4LCL A;  5EVI D;  1ERQ A;  3PBR A;  3C7U A;  4S2M A;  4E6W A;  1TDG A;  4FH4 A;  5L2F A;  3N8S A;  4WZ4 A;  1ERO A;  3HLB A;  1MXO A;  5E2E A;  5FAT A;  4R3B A;  1ESU A;  3BEC A;  4OVD A;  3SH8 A;  5CTM A;  3ZG8 B;  5F1G A;  3S4X A;  4ZJ3 A;  5EVI C;  1JVJ A;  1W5D A;  5FAQ A;  1LHY A;  1JTD A;  3N4I A;  1K56 A;  4B4Z A;  1XA1 A;  4PPR A;  4QB8 A;  1RGZ A;  4OON A;  1YLW A;  5EEC A;  3RXX A;  3E2L A;  4ZJ2 A;  1I2S A;  4KZ5 A;  1PWD A;  3VMA A;  4X68 A;  1MPL A;  2DRW A;  2PU2 A;  1ZG4 A;  4ID4 A;  1PWG A;  2HDS A;  2HP9 A;  3BFD A;  2XFT A;  3BFE A;  4XUZ A;  4DXC A;  1JWZ A;  2Y2J A;  1O7E A;  1IYP A;  4Y0T A;  4B88 A;  4YFM A;  4WMC D;  4K0W A;  1MY8 A;  4PM8 A;  4UA9 A;  4PM5 A;  1KDW A;  1YLJ A;  4BLM A;  4KG5 A;  3QNC A;  4Y7P A;  5CHM A;  1IYO A;  3BRM A;  3GRJ A;  2ZC7 A;  3V50 A;  3CG5 A;  4NK3 A;  2OLV A;  3IQA A;  5CGX A;  4OOY A;  3MXR A;  1W7F A;  4MBF A;  1BSG A;  2WKI A;  2ZQ7 A;  2R9W A;  4RX2 A;  3ZG0 A;  4QD4 A;  4E3L A;  3SH7 A;  3LY3 A;  4LV3 A;  4XXR A;  3IH9 A;  3A3J A;  1ONH A;  2HP6 A;  1NZU A;  4R0Q A;  1NJ4 A;  2WKE A;  4QY6 A;  1YLY A;  1ES3 A;  3OPL A;  3OPH A;  1ES4 A;  5I94 A;  3MZD A;  5JYO A;  3GSG A;  4EBN A;  1GHI A;  1YLT A;  1Z6F A;  3MZE A;  4JXG A;  5HX9 A;  4P87 A;  4F94 A;  5FQ9 A;  1E3U A;  2EX9 A;  3IXB A;  4KZ8 A;  2G2W A;  4EUZ A;  5A90 A;  4KG2 A;  3M6B A;  1DY6 A;  2PU4 A;  3W8K A;  2DNS A;  3MKE A;  1W79 A;  3V3S A;  2Q9M A;  2VGJ A;  3N8L A;  1CK3 A;  1M40 A;  3NDE A;  2XEP A;  1ES5 A;  1Q2Q A;  4X6T A;  1H8Y A;  4JPM A;  2VGK A;  3QNB A;  3HLF A;  3OCN A;  2Y2O A;  5GHY A;  4OQG A;  3G34 A;  2ZM0 A;  3ZNY A;  5TR7 A;  4E3M A;  2HDR A;  3SS3 A;  1ZG6 A;  3PAG A;  1SDN A;  3P09 A;  3QHY A;  5U47 A;  3UDF A;  3ZVW A;  2CC1 A;  4YIN A;  3V5M A;  3BFC A;  3MXS A;  4UA7 A;  5DF8 A;  1FCN A;  3G31 A;  5BOH A;  3IXD A;  3ZG7 B;  4KZ9 A;  5FAS A;  3PBS A;  1MWT A;  4GD6 A;  1FR6 A;  4GZB A;  3UPN A;  3C5A A;  3ZVT A;  3LEZ A;  3IHA A;  1QMF A;  2WGW A;  1IEM A;  4R23 A;  2ZQD A;  1YMX A;  3Q82 A;  1XPB A;  4FD8 A;  3IF6 B;  3FYZ A;  1PZO A;  3FKW A;  4WM9 A;  4HBT A;  5AQA A;  1JWV A;  1U60 A;  5DF9 A;  1DJC A;  4ZDX A;  5EOO A;  2EX2 A;  4N92 A;  2J9O A;  1S6R A;  4JXS A;  5A93 A;  4N1X A;  4PM6 A;  4C3Q A;  1BLS A;  3DTM A;  5KSC A;  3IWQ A;  2Y2P A;  3D4F A;  4PM9 A;  3NC8 A;  1RP5 A;  4KZ7 A;  3UE3 A;  3VP3 A;  1GHP A;  1I2W A;  1FCM A;  2Y2L A;  2WAD A;  4R1G A;  4OPQ A;  2GDN A;  5GHZ A;  4QU3 A;  5TFQ A;  1K57 A;  2Y2N A;  1NYM A;  4MLL A;  3VSL A;  3WS0 A;  3ITB A;  2Y2G A;  4JKT A;  2EX6 A;  1BLC A;  1ESI A;  4CJN A;  4LV2 A;  1DJA A;  3CJM A;  4RYE A;  1XA7 A;  3N6I A;  5CRF A;  5GLB A;  2PBY A;  4OLG A;  4OOL A;  1YT4 A;  2XF3 A;  3HRE A;  5JYP A;  1K25 A;  2RCX A;  4N9K A;  4E3I A;  2WK0 A;  5GHX A;  2V20 A;  1PWC A;  3BEB A;  3C7V A;  3LY4 A;  3V3R A;  1KE4 A;  1PZP A;  2WKH A;  3BLS A;  4L0L A;  1MWR A;  3GR2 A;  2FFY A;  3VFH A;  1PW8 A;  2ZMA A;  3I7J A;  1GHM A;  3JYI A;  4WEL A;  2XK1 A;  4FSF A;  4OKP A;  4JXW A;  5EVL A;  3C4P A;  3G2Z A;  3BFG A;  2UWX A;  3FKV A;  4ZJ1 A;  4XUX A;  2WAE A;  4OPY A;  3UNW A;  4CPK A;  3P98 A;  4UA6 A;  4E3O A;  2XDM A;  1KE0 A;  2JC7 A;  2IWB A;  1BUL A;  3IHB A;  1K54 A;  4WZ5 C;  1BZA A;  2J8Y A;  2Y2M A;  4MBK A;  5FSR A;  3VOY A;  1MWU A;  4HEF A;  4E3J A;  1LI0 A;  5FI7 A;  4S2P A;  4PMA A;  2EFX A;  3Q7V B;  5M18 A;  2E8I A;  2ZQ9 A;  1YM1 A;  4OPR A;  3W4Q A;  5A92 A;  4C6Y A;  4OPZ A;  3A3F A;  4DDS A;  4DDY A;  2X71 A;  1VM1 A;  2ZLY A;  4HBU A;  2G2U A;  5HFO A;  3HL9 A;  1ALQ A;  4WEK A;  4MEZ A;  4DRT A;  2HPB A;  2QZ6 A;  5KZH A;  4RA7 A;  1C3B A;  1EWZ A;  4Y0O A;  1PI4 A;  5GL9 A;  1K6R A;  4OLD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...