1PZPA

Tem-1 beta-lactamase in complex with a novel, core-disrupting, allosteric inhibitor
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
263
structure length
263
Chain Sequence
b'HPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQRDLVEYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase TEM
publication title Allosteric inhibition through core disruption.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 93
structure length 263
sequence length 263
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2003-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1pzpA00
1YQSA 2XR0A 3NDEA 1L0DA 2HDUA 3ISGA 3PBTA 3SH8A 3OC2A 2ZC3B 4KQQA 1PW8A 4HBUA 5F82A 2ZMAA 1WYCA 4EV4A 3FYZA 4Y0TA 2ZC7A 4KZAA 4ZAMA 3UDFA 3IXHA 2Y59A 4DE1A 4WM9A 3WS1A 4N9LA 1KGEA 3Q82A 1Q2QA 3LEZA 3FV7A 1GA9A 5E2HA 5FASA 2QPNA 3ITAA 3VSKA 2WGWB 4ID4A 5CECA 4E3KA 3B3XA 2E8IA 3PBOA 4C6YA 3SOIA 1HTZA 4LV0A 3WS4A 1SDNA 2Y2QA 1MPLA 3LY4A 3V50A 2ZC6B 2ZQCA 4GDBA 2IWBA 2WKEA 4S2PA 3O87A 4IVIA 3BECA 3LY3A 1E3UD 4ZJ3A 3V39A 2XF3A 1MWUA 3O88A 3GQZA 3OPPA 5DF9A 3MZFA 5DTSA 3BFGA 4JF6A 2Y2IA 3ZFZA 1G68A 4A5RA 3MKFA 3A3EA 4MLLA 1GHIA 3WRTA 3N8SA 4KZ3A 3CMZA 2H0YA 3SS4A 5GHYA 3UE1A 5FA7A 5KSCA 3OPHA 1W8QA 4DE2A 3W4PA 2A49A 4S2NA 5EPHA 1H5XA 1J9MA 2XD5A 2ZM2A 4B88A 3VP3A 1YM1A 1BLHA 1YLPA 4FH2A 5E43A 5FQ9A 2OV5A 2CC1A 3A3IA 3GTCA 1E25A 1XGJA 5CHUA 5CEDA 3JYIA 4GD6A 1KVLA 1BLCA 1K55C 3HUOA 3N7WA 2XGNA 5CTMA 4QD4A 2OLUA 3ZVWA 4QY5A 4BENA 2Z2MB 1E3UA 5GLCA 4PM5A 5F1FA 3UE0A 3MXSA 2ZC5B 1K57C 3UDXA 3SH7A 1PWGA 2Q9NA 3NIAA 5A92A 4WYYA 3MBZA 3IHBA 4GOGA 2DCFA 3QNCA 5M1AA 4Y0OA 2HDQA 1ESIA 1ONHA 3RXXA 3HLDA 1MWTA 1LHYA 3HUNA 4JF4A 5HFOA 4WBGA 1N4OA 2Y91A 1XA7A 4K0XA 1FCNA 5AQ7A 1L0EA 2J7VA 1YT4A 5M18A 1PI5A 1MY8A 5F83A 4BD1A 3FZCA 1LI0A 1IYSA 1Z6FA 1K4FA 2VGJA 4DXCA 5FAOA 5GLDA 5EVLA 3DTMA 2HDRA 4R1GA 3I7JA 1ALQA 3NC8A 3GVBA 5E2EA 3Q07A 2Y2OA 3BFCA 4OQHA 3WWXA 3M6HA 2BG1A 2Y55A 4OONA 2C5WB 5E2GA 5I94A 4QU3A 2X02A 5CRFA 3MFDA 3MZEA 4P6BA 4OOYA 1KDSA 4RVAA 2G2UA 1CEGA 3A3DA 3V5MA 4R4SA 1VQQA 1K25A 5EUAA 3DW0A 3HVFA 4R4RA 4C3QA 1CK3A 3VMAA 4K0WA 4OLGA 4OQ0A 3HLWA 4DF6A 2HP5A 3A3FA 4Q8IA 2V2FF 4PMAA 1NYMA 4R0QA 4MBFA 2JCHA 3PAEA 1TDLA 4S2IA 3BEBA 1PZOA 1NZUA 1CEFA 4KZ4A 3ZCZA 2Y2PA 2ZLYA 1YLTA 5GL9A 2PU4A 3ZG0A 5FSRA 3N8LA 1DY6A 4R3BA 4U3TA 4OOMA 3PAGA 3NI9A 3UY6A 1JWZA 1ONGA 4KENB 4N9KA 1JTDA 3UPOA 2Y2MA 4PM9A 3IQAA 1Q2PA 3N4IA 2P9VA 1BT5A 1MKIA 1XGIA 4WZ4A 2RCXA 2XDMA 1YLYA 3GMWA 2V20A 3P09A 4DDYA 5A90A 2FFYA 2XFSA 2Z2LB 5A91A 2XEPA 5HARA 1HD8A 5JYPA 3HREA 4OVDA 4X56A 1L0GA 1HZOA 4BL3A 1W79A 1L0FA 1TVFA 2EX9A 4PM7A 5GHZA 3VSLA 1YMSA 2A3UA 2EX2A 1YLWA 1KE0A 3C5AA 3AGEA 3E2KA 3MKEA 1XPBA 4EUZA 2HPBA 4LV2A 3GSGA 4KZ8A 4CJNA 1IKIA 3G30A 1XXMA 3OCLA 4IVKA 2Y2GA 1I5QA 3BLMA 4LCLA 4OKPA 5FAPA 4OP5A 4WELA 3SS5A 1S6RA 1SDEA 2XQZA 4UA9A 4KG6A 3VOYA 3PBRA 5CERA 2ZM8A 4B4ZA 3VP1A 4X68A 5FQMA 1I2SA 2HP9A 1XP4A 3S1YA 2FFFB 4GN2A 1W5DA 5IHVA 1XX2A 2ZQ8A 3S4XA 5EVID 4KG5A 4OP8A 4RA7A 5FAQA 3TG9A 3ZG5A 5L2FA 4KZBA 3HLEA 4B4XA 1FCOA 3CZDA 2ZQ9A 1MWSA 3WS5A 3TOIA 1S0WA 4MNRA 1PI4A 1BLSA 4XUXA 5HAIA 1DJBA 1JWVA 2WYXA 5HAPA 3DWKA 3O86A 1RGZA 5DTKA 1AXBA 1QMFA 1KE4A 4M3KA 3BYDA 5FQJA 1ES2A 4UHUA 3V3SA 2EXAA 4YINA 3FKVA 5EECA 5TGFA 4S2NC 4N92A 4KZ5A 2I72A 1H8ZA 3RXWA 4KG2A 4X55A 4BLMA 3RJUA 5EVIA 3Q81A 1E4DA 1JWPA 4S2LA 1JVJA 2WAEA 3BFFA 4P85A 4DXBA 1BUEA 1FSYA 3WS0A 5FQKA 2XFTA 4HESA 1KGGA 5FQIA 3GV9A 3G32A 3ZGAB 4MBKA 4OOLA 2Y2KA 1HVBA 3QNBA 3W8KA 3ZDJA 2X01A 2JC7A 2H0TA 4ZTKA 1NZOA 2J9PA 1LLBA 1NXYA 3NY4A 1RCJA 2P74A 3N6IA 3CJMA 3PBSA 4OH0A 4PM8A 1BZAA 1W7FA 2WK0A 4IBXA 4P87A 2H5SA 2WADA 4S2OA 4O7DA 4N1XA 5CGXA 1KGFA 4S2MA 3AGDA 2WKIA 4JKTA 2ZD8A 5FDHA 3GR2A 2XD1A 3Q7VA 1K54A 1OMEA 2EX6A 4FD8A 3O3VA 5J8XA 4WZ5A 4PM6A 5CTNA 4P0MA 1BLPA 5GHXA 5TFQA 3NCKA 4CPKA 1RGYA 2IWDA 5F1GA 3IF6B 1I2WA 3G31A 5GLBA 2R9XA 2Y2LA 3G4PA 4WEJA 4E6XA 5BOHA 4UA6A 4GD8A 4HBTA 1SCWA 2VGKA 2WUQA 4U0XA 1SKFA 2ZQDA 1BULA 3IF6C 4UAAA 5TR7A 1FQGA 3VOZA 3IXBA 4QHCA 3ZHHA 4EQIA 2XLNA 5M19A 2QMIA 2WZZA 4EWFA 3HLBA 2Y4AA 3M2KA 1PIOA 3IWOA 4JXWA 5AQBA 3W4OA 3HL9A 4ZJ1A 5U47A 3FWLA 1VM1A 4F94A 3AGFA 5GLAA 1O07A 1LL5A 1YLZA 3VP4A 4OQIA 3VFHA 3WS2A 1O7EA 4OQGA 1GCEA 2DNSA 1ES5A 4JXVA 4OLDA 5FI6A 3S22A 1MBLA 3IH8A 4FH4A 5D3OA 1FOFA 1IYOA 4IEDA 2RL3A 4D2OA 3C4PA 4DDSA 1NY0A 1ZG4A 4RX2A 4YFMA 2GDNA 4KQOA 5HAQA 2PBYA 3ZG8B 4H8RA 5DTTA 1FR6A 4OPYA 4Z9QA 5CHJA 3MXRA 4MEZA 3UPPA 1CI8A 3BLSA 1EROA 1NJ4A 4ZJ2A 4C75A 1U60A 5CEBA 3VP2A 3GRJA 3HLFA 3LCEA 3VP0A 3HLGA 4X53A 4BL2A 2WGIA 1ES4A 3BFEA 3C7VA 3PBQA 4RX3A 3IHAA 2P9VB 3ZG9B 5AQ9A 2J9OA 1PW1A 4N1HA 5FQQA 2HDSA 1GA0A 4Y7PA 4EBNA 2WGWA 1GHMA 2PU2A 3PTEA 1SHVA 3ZNTA 4FCFA 5DF8A 4ZBEA 2HP6A 1G6AA 4GDNA 1K6SA 1L2SA 1YLJA 1BSGA 1IEMA 5FI7A 3IH9A 4QB8A 5KSHA 4HEFA 4BD0A 4KZ9A 2BLSA 1LL9A 3IT9A 3UNWA 1ZKJA 2EFXA 3HUMA 3G35A 3PBNA 4LENA 4E3OA 3G34A 3ZNYA 1XA1A 1EWZA 4BQMA 3IXGA 3P98A 2XK1A 5JYOA 4FSFA 1DJAA 2UWXA 4WMCD 1TEMA 4OPRA 1W8YA 4BJPA 4E3NA 3IWIA 2J8YA 1K55A 1FSWA 1GHPA 4K91A 3UE3A 2ZC4B 4E3LA 1M40A 4X69A 2WGVA 3FKWA 1ESUA 3C4OA 3UDIA 1K57A 1IYPA 3ZVTA 2B5RA 3NDGA 4JXGA 3V3RA 3G2ZA 4RYEA 2DRWA 4UA7A 1PWDA 3W4QA 2EFUA 2OLVA 1QMEA 2ZM0A 3M6BA 4OPZA 2R9WA 4EBLA 3SS3A 4Y0UA 1N9BA 4JF5A 3UPNA 3WRZA 4E3MA 3E2LA 5FI2A 1CI9A 1LI9A 1ZC2A 3OPRA 3D4FA 1EI5A 4WMCA 4PPRA 1PWCA 4DE0A 2Y2HA 2ZQAA 1ERQA 1K56D 1IYQA 3M2JA 4QJGA 5EOEA 5KZHA 1FR1A 1H8YA 1WE4A 3IWQA 4EBPA 1K38A 3DWZA 2QZ6A 5EVIB 3UO9A 3EQUA 5HW3A 5AQAA 4JXSA 3ZG7B 3BM6A 4GZBA 5EVIC 1JTGA 1PYYA 5G18A 1KDWA 3Q7ZA 1WYBA 2Y2NA 5A93A 5HL1A 5EOOA 4IBRA 1YMXA 2OSUA 2X71A 1PZPA 3NBLA 4OPQA 4E3JA 4GB7A 4DKIA 2Q9MA 2WKHA 3OCNA 4KZ6A 1K56A 2EXBA 2H10A 2EX8A 3IXDA 3IF6A 3Q7VB 1MXOA 5CXWA 4S2JA 3MZDA 1FCMA 4XXRA 3OPLA 1K4EA 2IWCA 2Y2JA 1IELA 3BRMA 3HLCA 1M6KA 3QHYA 1K54C 2JE5A 4NK3A 4LCMA 4WZ5C 4ZDXA 3G2YA 1XKZA 3UN7A 3N8RA 3C7UA 1NYYA 2WZXA 3EQVA 2XH9A 4KQRA 4U0TA 4X6TA 1ZG6A 3HBRA 5HX9A 5DF7A 1RP5A 5FATA 4MBHA 4XUZA 5E2FA 1C3BA 4DRTA 1DJCA 2C6WB 5KMWA 5EE8A 5CGWA 1NRFA 2V1ZA 5CHMA 3OZHA 3CG5A 1ERMA 4LV1A 3A3JA 1MWRA 2G2WA 4DE3A 4GKUA 4WEKA 5DVAA 1ES3A 4KZ7A 1Y54A 2WAFA 4JPMA 5CGSA 4JLFA 4E6WA 3IF5A 4NETA 1KE3A 4E3IA 1K6RA 4GNUA 2JBFA 3TSGA 1IKGA 3SH9A 3Q1FA 1KVMA 4JBFA 2ZQ7A 4LV3A 3VFFA 3BFDA 4R23A 1BTLA 2ZJ9A 4S2KA 3ITBA 1TDGA 4QY6A 4L0LA 3LO7A 4R3JA
chains in the Genus database with same CATH superfamily
2HDUA 3ISGA 1LSXA 3E98A 3OC2A 4KQQA 1PW8A 5F82A 3L9KA 4KZAA 3UDFA 4EESA 1CQAA 2O9BA 4NG2A 4N9LA 3WS1A 3LEZA 2Y79A 2WGWB 3A0SA 5DJTA 3H9WA 2E8IA 4S2PA 2PR5A 1H3QA 2HGVA 2PR6A 4EETB 1ACFA 4X1LA 2KOIA 4L9FA 2XF3A 3O88A 5DF9A 3MZFA 3NULA 3ZFZA 4NXEA 3UE1A 3CMZA 2H0YA 1N9OA 3IX3A 5FA7A 3T4OA 3W4PA 4KQDA 4FH2A 2OV5A 1XGJA 3MSHA 2PRFA 4QY5A 1WA9A 5L07A 2HJEA 3UE0A 4JGPA 1PWGA 5M1AA 4UQIS 1ONHA 3LFVA 3HLDA 1MWTA 1LHYA 3HUNA 4GS9A 3H82B 2NUPC 1XA7A 4K0XA 5AQ7A 2J7VA 3W2ZA 2PT7A 1MY8A 3FZCA 1IYSA 3LIAA 1Y4OA 2MJ6A 2DMWA 5GLDA 2HDRA 4GHIB 2QWSA 3MQ0A 2Y2OA 4OQHA 2BG1A 5DFXA 1YSQA 3EEHA 4P6ZS 4OOYA 4RQ9A 3T4LA 1CEGA 3V5MA 1VQQA 3UMDA 1YPRA 3EGXC 1OTAA 3P7NA 3BY8A 2V2FF 4PMAA 1NYMA 4R0QA 4MBFA 3PAEA 3BEBA 1NZUA 4KZ4A 3IS2B 3ZCZA 2V8CA 3ZG0A 5A8BA 1G6OA 3T1SA 2BTFP 4KENB 3UPOA 2XROA 4PM9A 1Q2PA 3N4IA 2P9VA 4WZ4A 2XDMA 1L0GA 2WKQA 3LR0A 3IBJA 1W79A 4JGQA 1OTDA 1TVFA 4PM7A 4LPZA 3RTYA 4WUJA 1F98A 3MKEA 4LV2A 3QP1A 3G30A 2JHEA 3BLMA 4OKPA 4PAUA 5FAPA 4OP5A 2XQZA 4ARZA 2XA7S 1XP4A 3S1YA 1XX2A 4OP8A 2PD7A 2VGLS 3MS6A 1FCOA 4HP4A 3WS5A 3FG8A 2W3GA 4Q0HA 1BLSA 4HOIA 5HAIA 2WYXA 3DWKA 1RGZA 2OWJA 3LUQA 2EXAA 2GX5A 5TJJA 3S7QA 4S2NC 3R4KA 1NLZA 4KG2A 4BLMA 3Q81A 4FTXA 2WAEA 2QKPA 3QP6A 3G32A 2Y2KA 3IX4A 3W8KA 2X01A 1NZOA 4II7A 2J9PA 4QHCA 1NXYA 4OH0A 4PM8A 1W7FA 2WK0A 4S2OA 3CHWP 1KGFA 3AGDA 1Y28A 2EX6A 1T1CA 4NEED 4WZ5A 5GHXA 2IWDA 5F1GA 2VJWA 3IF6B 1I2WA 1NLYA 3EGDC 4UA6A 2VGKA 5TR7A 1BULA 1VEUA 2VV6A 4JXWA 5AQBA 3H7WA 4ZJ1A 3R7WA 1P9WA 4ETXA 5HDDA 3S22A 3C2WA 1MBLA 2HF6A 3IH8A 5D3OA 1FOFA 4IEDA 3BQ8A 4GJ4A 4YFMA 2GDNA 3ZG8B 3SW1A 3GDIA 3TE8A 2O9AA 3GRJA 3HLFA 1F2KA 3HLGA 3VP0A 3BFEA 1ES4A 3BY9A 4G3VA 3PBQA 2P9VB 2J9OA 4N1HA 1GA0A 4Y7PA 3ZNTA 1G6AA 1YLJA 3LIFA 2Q0OA 5KSHA 4HEFA 2BLSA 1LL9A 3A0VA 3HUMA 3PBNA 3JVVA 3ZNYA 4BQMA 3IXGA 3P98A 5JYOA 4FSFA 1A0KA 2UWXA 3T4JA 3VOLA 4ARZB 4K91A 3LIDA 1M40A 2WGVA 1K57A 3NDGA 4JXGA 2VLGA 1PWDA 2OLVA 2ZM0A 2R9WA 4JF5A 1DRMA 3WRZA 3DTKA 1EI5A 2A24A 3MJQA 4MDZA 1WE4A 4EBPA 1K38A 3EQUA 5J3WA 3LIBA 4HH3A 5DKLA 1JTGA 1STZA 1KDWA 5A93A 1P0ZA 5HL1A 3LR5A 1LSWA 5EOOA 1TS8A 1N9NA 1YMXA 5C5KA 2X71A 1PZPA 3NBLA 3OCNA 2H10A 2VA0A 5HWWA 3FPVA 3BRMA 1K54C 4K08A 2XRNA 4UQIM 2KDKA 2WZXA 4NXFA 5DF7A 3MF0A 5FATA 3F1OA 4DRTA 1VEUB 5EE8A 1TF1A 2V1ZA 1ERMA 3R7WB 4ZRRA 1MWRA 2G2WA 2ZL1A 4GKUA 1ES3A 4KZ7A 4E6WA 2JBFA 4P6ZM 4GW9A 1KVMA 2ZQ7A 3CUEC 1TS0A 4R23A 2ZJ9A 4L0LA 3LO7A 1YQSA 3NDEA 4DN0A 4I3IA 3PBTA 2ZC3B 3FC7A 3MR0A 4HBUA 3FYZA 5KIZA 2ZC7A 4ZAMA 2Y59A 4DE1A 4WM9A 1KGEA 1ZTUA 3Q82A 5L09A 1GA9A 2QPNA 3ITAA 5CX7A 5CECA 2OAP1 4E3KA 3SOIA 1HTZA 4LV0A 3WS4A 2Y2QA 2I9VA 2IWBA 3O87A 3LIEA 5J4EA 3BECA 3LY3A 1V9ZA 1MWUA 5DTSA 3BFGA 4JF6A 2Y2IA 3DBAA 4MLLA 1GSWA 3N8SA 3SS4A 4I38A 3OPHA 3MQQA 3VE4A 2A49A 5EPHA 2ZM2A 4B88A 3VP3A 1YM1A 5E43A 5FQ9A 1S67L 1VHMA 5CEDA 4LRZE 1KVLA 4IUHA 2XGNA 5CTMA 4IHQA 1E3UA 5GLCA 3MXSA 3NOUC 3SH7A 2P08A 5A92A 4WYYA 3MBZA 2DCFA 3QNCA 5K5BA 2JKTM 1XJ3A 2XA7M 5HFOA 4WBGA 1N4OA 1AWIA 2YKHA 2VGLM 1OJ5A 1S1ZA 5F83A 3DAVA 4I5SA 1TD5A 5EVLA 3I7JA 3GVBA 3KO6A 3MQOA 3M6HA 2W3FA 2C5WB 5EFWA 4P6BA 1KDSA 4GCZA 5IU1A 4BBVA 4EQ1A 3HVFA 4LFUA 4C3QA 3VMAA 4K0WA 1LL8A 3LICA 3HLWA 2HP5A 3A3FA 3EWKA 1VB6A 2JCHA 2O0YA 1TDLA 3F1OB 3FPWA 2PDRA 2Y2PA 2ZLYA 5MC7A 3CUEA 3N8LA 1CF0A 1DY6A 3PAGA 3NI9A 3UY6A 4EUVA 5HZHA 1JWZA 2ZL1B 3IQAA 1BT5A 4WLAA 2V20A 2XFSA 1SKOA 5A91A 2OAQ1 1HD8A 3HREA 2OOLA 1EW0A 3BWLA 1YLWA 1KE0A 3E2KA 4MN5A 2HPBA 3C30A 1XJ2A 2LB9A 3OCLA 1I5QA 2JKFA 4F3LA 1W63M 4WELA 1S6RA 5CERA 3UMEA 3VP1A 2HP9A 3KYQA 1W5DA 2ZQ8A 3PXPA 4RA7A 5FAQA 3TG9A 3HLEA 4B4XA 3CZDA 3TOIA 5FEGA 1PI4A 2Z6DA 1JWVA 5HAPA 1AXBA 5F69A 1KE4A 4M3KA 2V8FA 3BYDA 4YINA 4X55A 5EVIA 3F1PA 3CWFA 1FSYA 2M7UA 3WS0A 2XFTA 4HESA 3GV9A 3ZDJA 3KSHA 1GSXA 4XT2A 2JC7A 4ZTKA 4BBTA 1LLBA 2P74A 3N6IA 2INWA 3T1QB 4CLCA 1BZAA 3T1XA 4IBXA 4N1XA 4S2MA 2VK3A 2WKIA 1CJFA 4LRYC 3GR2A 2XD1A 1OTBA 5HL6A 5L10A 5GLBA 2R9XA 4E6XA 4HBTA 2WUQA 2EWVA 3BW6A 2K2NA 1YAXA 2PYRA 3VOZA 3IXBA 4QWOA 4Q0IA 2WZZA 3M2KA 2L0WA 4ESPA 3HL9A 3OOVA 3FWLA 1VM1A 5G4YA 3AGFA 1O07A 1LL5A 4L9GA 3KX0X 1GCEA 3LI9A 4OLDA 5FI6A 4D2OA 4RX2A 4Y3IA 4KQOA 1FR6A 1BYWA 3MXRA 3UPPA 2P04A 3ZQ5A 1NJ4A 1U60A 3VP2A 3LCEA 4BL2A 3MMHA 1OJGA 5FDSA 2HDSA 1SKOB 3BJNA 1GHMA 1SHVA 4FCFA 5DF8A 4ZBEA 4B93A 2M1CA 1K6SA 4HHDA 1BSGA 3IH9A 2ZMVA 4QB8A 4BD0A 2B95A 3IT9A 2EFXA 4G3KA 4E3OA 3G34A 2ACGA 1UWPX 3A0RA 3UB9A 2L1MA 1W8YA 3ICYA 2CMNA 3UDIA 4WL9A 4UA7A 5DFYA 3T12B 4DJ2A 2EFUA 3SS3A 4Y0UA 1N9BA 3UPNA 4MMNA 1LI9A 3D4FA 4PPRA 1FILA 2ZQAA 1ERQA 4NXBA 5EOEA 5KZHA 3CI6A 2QZ6A 5EVIB 4GS9B 3F1PB 2ZOHA 1YKDA 4XT2B 4GLQA 2OSUA 2W3EA 3PYPA 4CLCB 5EM0A 2ZMFA 3E0YA 2R78A 4DJ3A 2IWCA 2HZ5A 3HLCA 2JE5A 4LCMA 4ZDXA 3G2YA 1XKZA 5FEFA 3D3OA 1NYYA 2XH9A 3MXQA 5LBRA 3F1NA 5HDCA 1H8MA 1C3BA 1DJCA 3QP5A 2GZAA 5KMWA 3ULFA 5CHMA 3CG5A 4G3WA 4LV1A 3A3JA 4DE3A 2HV1A 1DP8A 5DVAA 2WAFA 4NETA 1KE3A 4GNUA 5IS1A 3VFFA 1MZUA 5IT5A 2WKPA 1GSVA 4S2KA 3OPRA 1L0DA 2VX8A 3SH8A 4EV4A 2ZBBA 3IXHA 5AVEA 3VSKA 5EVEA 4ID4A 3UB7A 3JPUA 3B3XA 3PBOA 2EWWA 3LY4A 3V50A 2ZC6B 4MN7A 2WKEA 5G4ZA 4IJGA 1PRQA 1E3UD 4Y2FA 4ZJ3A 4Q0JA 3TRCA 3GQZA 2PHYA 1G68A 4I3AA 3MKFA 3A3EA 1GHIA 3WRTA 1NWZA 5GHYA 1W8QA 4S2NA 1H5XA 1J9MA 1YLPA 1DP9A 2V0WA 2ZOIA 2CC1A 4WF0A 3GTCA 1E25A 3JVUA 3JYIA 5DJUA 1K55C 3HUOA 3N7WA 4QD4A 4R70A 3ZVWA 4BENA 4PM5A 5F1FA 2K7SA 4GOGA 2HDQA 1ESIA 3RXXA 4HJ6A 4Y13A 4JF4A 1L0EA 5M18A 4EEPA 1T1BA 4BD1A 1LI0A 1K4FA 2VGJA 4D60A 4R1GA 4Y15A 2Z6CA 3NC8A 3Q07A 4H6JA 3BQAA 2GNXA 3VE3A 4OONA 5E2GA 5I94A 4QU3A 1HLUP 5CRFA 3LEQA 4X25A 4NXGA 4RVAA 3A3DA 4R4SA 1CK3A 4OLGA 4OQ0A 4Q8IA 3H7WB 3VV4A 3F1NB 4S2IA 3IBRA 2D02A 5GL9A 5FSRA 4R3BA 2J3TD 1ONGA 4N9KA 2Y2MA 1MKIA 3C8CA 3GMWA 4LGWA 2FFYA 1LT0A 2Z2LB 2XEPA 1IFQA 5HARA 5JYPA 4L9EA 1T1AA 1S1YA 1K0KA 3KYEA 5GHZA 1YMSA 2A3UA 2W3DA 3CAXA 1XPBA 1XXMA 2Y2GA 1OPXA 4LCLA 2J80A 2XSSA 4UA9A 3VOYA 2ZM8A 4X68A 5FQMA 2FZ0A 4GN2A 5EVID 4KG5A 4YNRA 4M4XA 4MNRA 2Y8HA 3O86A 1QMFA 3U2AA 2AVXA 1G5UA 5FQJA 1ES2A 4CLCD 4EEUA 4LLOB 4LRXC 5EECA 4JGRA 4N92A 4KZ5A 1H8ZA 2A24B 2NUTC 3SZTA 4S2LA 1E4DA 1JWPA 3P01A 5EM1A 1JVJA 3O5YA 3BFFA 4MCWA 4DXBA 5FQKA 5FQIA 1KGGA 4EW7A 2QHKA 3ZGAB 4MBKA 2E8JA 3NY4A 2H5SA 5CGXA 5FDHA 5HWVA 4HQAA 4JKTA 1NRJA 2ZD8A 3T4SA 3E4PA 3E4QA 3Q7VA 1K54A 3O3VA 4Y17A 4AFIA 4P0MA 5TFQA 3G31A 3G4PA 4H6JB 5BOHA 1P9RA 4BWIA 4GD8A 1SKFA 2ZQDA 3IF6C 3QP4A 4UAAA 1FQGA 2BASA 2VEAA 1S4RA 2WKRA 4EQIA 2QMIA 4EWFA 1T19A 4R6LA 1PIOA 3IWOA 5U47A 4CLCE 5GLAA 1YLZA 3C38A 4OQIA 3K3DA 3VFHA 3WS2A 3T1RA 1O7EA 1T18A 4OQGA 4PKYG 3IS2A 1ES5A 1UWNX 2W0NA 1PFLA 4FH4A 1IYOA 1OTIA 1P97A 4DDSA 1NY0A 4MN6A 4X1MA 3OLOA 3S7NA 5HPIA 5HAQA 2PBYA 4FUWA 3S7OA 4OPYA 3K2NA 4Z9QA 5CHJA 1CI8A 1EROA 4C75A 4ZJ2A 5CEBA 4X53A 2WGIA 3C7VA 4EU0A 5FQQA 4E04A 2A2LA 2HP6A 3DTIA 3NECA 1H0MA 4ME4A 1L2SA 4HP9A 1ZKJA 3G35A 4LENA 4BMWA 1EWZA 3D72A 2V1AA 3UB6A 2XK1A 2V9AA 4O8GA 3LYXA 1PNEA 1GHPA 2ZC4B 5L8MA 3FKWA 4HY8A 3C4OA 2B5RA 1JNUA 2DRWA 4RYEA 3B33A 1QMEA 4KUKA 4UEYA 4E3MA 1CI9A 1ZC2A 4WMCA 4CQHA 4DE0A 3S7PA 4WN5A 3M2JA 3NOTC 4QJGA 1IOUA 1H8YA 5DKKA 3DWZA 1OTEA 3UO9A 5AQAA 4JXSA 3ZG7B 3TW8A 1PYYA 2JKRI 1WYBA 1DP6A 2Y2NA 4IBRA 1TS6A 4O01A 2QJ5A 2H28A 1OT6A 4GB7A 4DKIA 2Q9MA 4KZ6A 1K56A 3KSIA 3IF6A 3Q7VB 1S4SA 1MXOA 3HJIA 4S2JA 4R3AA 3MZDA 4XXRA 1K4EA 1IELA 1M6KA 4WZ5C 3UN7A 3C7UA 3EQVA 2V0UA 4U0TA 4X6TA 5HSQA 2PD8A 3HBRA 5HX9A 1RP5A 4MBHA 2PYPA 3D9YA 3T4QA 2C6WB 1J3WA 5CGWA 1NRFA 4EERA 2LB5A 4HIAA 2OWHA 4WEKA 1Y54A 4JPMA 5CGSA 4E3IA 1K6RA 5J7EA 3SH9A 3Q1FA 4JBFA 3PHYA 4LV3A 4HH2A 1BTLA 2K31A 3ITBA 4QY6A 4HJ3A 2XR0A 2G7UA 4Z1WA 1D06A 5HDSA 5HPFA 4Y0TA 2ZMAA 1WYCA 4HNBA 1Q2QA 3FV7A 2VV7A 5E2HA 5FASA 3T50A 4Y5FA 4C6YA 3B42A 1SDNA 4F3LB 1MPLA 2W1TA 2ZQCA 4GDBA 4IVIA 5TBMA 1Z09A 3V39A 3OPPA 4A5RA 4KZ3A 5KSCA 4DE2A 1MKMA 2XD5A 1BLHA 5HD3A 3A3IA 5CHUA 1N9LA 4GD6A 2GJ3A 1BLCA 1VETA 1XJ4A 2JKGA 2OLUA 2Z2MB 2JN7A 2ZC5B 1K57C 3UDXA 3NOPC 2Q9NA 3CPTA 3NIAA 3IHBA 4Y0OA 3UB8A 2Y91A 3EEAA 1FCNA 3DTEA 1YT4A 1PI5A 1Z6FA 4DXCA 1S66L 5FAOA 3DTMA 1ALQA 5E2EA 3BFCA 3WWXA 2Y55A 4O0PA 2JKRM 3HCYA 1XFQA 2X02A 3LI8A 4HI4A 3MFXA 3MFDA 3MZEA 2W3HA 4NKPA 2G2UA 1ODVA 1K25A 4JGOA 5EUAA 3DW0A 4R4RA 3NHQA 3RFBA 1TS7A 4DF6A 3LR4A 3IX8A 1PZOA 1CEFA 1YLTA 2PU4A 2O99A 4U3TA 4OOMA 2P7JA 1JTDA 1XGIA 2RCXA 1YLYA 5A90A 3P09A 4DDYA 2D01A 4FOFA 4PKYA 1W63Q 4OVDA 4X56A 1HZOA 2W27A 4BL3A 3G6OA 1L0FA 2EX9A 3VSLA 4QPRA 2EX2A 3UE6A 3C5AA 3AGEA 1XFNA 4EUZA 3GSGA 4KZ8A 4CJNA 3L7HA 1IKIA 3OBFA 3TJZC 4IVKA 3KYZA 3SS5A 1SDEA 4KG6A 3PBRA 4B4ZA 5F6AA 4BBUA 1YSPA 1I2SA 2FFFB 5IHVA 3S4XA 2W1TB 3ZG5A 5L2FA 4KZBA 5TBMB 2ZQ9A 1MWSA 4KUOA 5FL3A 1S0WA 3KSFA 4XUXA 1DJBA 1XJ6A 2VV8A 1G28A 5DTKA 3PR6A 3V3SA 4UHUA 1V9YA 4YWZA 3FKVA 2J3WA 5TGFA 2JKTI 3RXWA 2I72A 1VETB 3RJUA 4P85A 1BUEA 2QJ7A 1F5MA 4OOLA 1HVBA 3CPTB 3QNBA 4ETZA 2H0TA 3PBSA 1RCJA 3CJMA 4P87A 2IA2A 2WADA 4O7DA 2PBDP 3QP8A 1OMEA 4FD8A 5J8XA 2KLIA 4YOFA 4PM6A 5CTNA 1BLPA 3NCKA 4CPKA 1RGYA 2Y2LA 2O9CA 4WEJA 2FH5A 1SCWA 4U0XA 1UGUA 3U4LP 3ZHHA 2W1RA 3T4KA 2XLNA 1KOUA 5M19A 1L3LA 3HLBA 2Y4AA 3QP2A 3W4OA 4F94A 3VP4A 1X0OA 1D7EA 2YKFA 2DNSA 4JXVA 5HD5A 2RL3A 3C4PA 1ZG4A 2VZWA 4H8RA 5DTTA 4MEZA 2KX6A 3BLSA 2B18A 3LGOA 4R38A 2HJ9C 4RX3A 2B02A 3IHAA 3ZG9B 5AQ9A 1PW1A 3B47A 2V1BA 4EBNA 2WGWA 2PU2A 3PTEA 3EOIA 4GDNA 1D1JA 1OT9A 1IEMA 5FI7A 4KZ9A 3UNWA 1XA1A 3UB5P 1MC0A 2J3TC 1DJAA 3NJAA 4WMCD 2M7VA 1TEMA 4OPRA 4BJPA 4E3NA 3IWIA 2J8YA 1K55A 1FSWA 3UE3A 3RH8B 4E3LA 3CLOA 4X69A 5AJGA 1ESUA 3E4OA 1IYPA 3ZVTA 3V3RA 3G2ZA 3W4QA 3M6BA 4OPZA 4EBLA 3CITA 5HWTA 5AVFA 3E2LA 1F9IA 3GECA 5FI2A 1PWCA 3H82A 2Y2HA 1K56D 1IYQA 1FR1A 3IWQA 4DMZA 1LSVA 5HW3A 5F5YA 4IUKA 2UV0E 3BM6A 4GHIA 4GZBA 5EVIC 5G18A 2VKSA 3Q7ZA 3K3CA 5F68A 4OPQA 4E3JA 2WKHA 2EXBA 2EX8A 3KSGA 3IXDA 4CLCC 5CXWA 1FCMA 3OPLA 2Y2JA 3QHYA 4NK3A 4I3JA 4PHTA 5I5LA 1SZVA 3N8RA 3HJKA 4HJ4A 4KQRA 1ZG6A 2L4RA 4XUZA 5E2FA 4EXOA 2PAVP 4I39A 3V67A 3OZHA 2QYBA 1ZHHB 3LR3A 3IF5A 4JLFA 3T4TA 3TSGA 1IKGA 3BFDA 5EV0A 4B9OA 1FIKA 2EA9A 1TDGA 3ZYTA 4R3JA
chains in the Genus database with same CATH topology
1YQSA 2XR0A 3NDEA 1L0DA 2HDUA 3ISGA 3PBTA 3SH8A 3OC2A 2ZC3B 4KQQA 1PW8A 4HBUA 5F82A 2ZMAA 1WYCA 4EV4A 3FYZA 4Y0TA 2ZC7A 4KZAA 4ZAMA 3UDFA 3IXHA 2Y59A 4DE1A 4WM9A 3WS1A 4N9LA 1KGEA 3Q82A 1Q2QA 3LEZA 3FV7A 1GA9A 5E2HA 5FASA 2QPNA 3ITAA 3VSKA 2WGWB 4ID4A 5CECA 4E3KA 3B3XA 2E8IA 3PBOA 4C6YA 3SOIA 1HTZA 4LV0A 3WS4A 1SDNA 2Y2QA 1MPLA 3LY4A 3V50A 2ZC6B 2ZQCA 4GDBA 2IWBA 2WKEA 4S2PA 3O87A 4IVIA 3BECA 3LY3A 1E3UD 4ZJ3A 3V39A 2XF3A 1MWUA 3O88A 3GQZA 3OPPA 5DF9A 3MZFA 5DTSA 3BFGA 4JF6A 2Y2IA 3ZFZA 1G68A 4A5RA 3MKFA 3A3EA 4MLLA 1GHIA 3WRTA 3N8SA 4KZ3A 3CMZA 2H0YA 3SS4A 5GHYA 3UE1A 5FA7A 5KSCA 3OPHA 1W8QA 4DE2A 3W4PA 2A49A 4S2NA 5EPHA 1H5XA 1J9MA 2XD5A 2ZM2A 4B88A 3VP3A 1YM1A 1BLHA 1YLPA 4FH2A 5E43A 5FQ9A 2OV5A 2CC1A 3A3IA 3GTCA 1E25A 1XGJA 5CHUA 5CEDA 3JYIA 4GD6A 1KVLA 1BLCA 1K55C 3HUOA 3N7WA 2XGNA 5CTMA 4QD4A 2OLUA 3ZVWA 4QY5A 4BENA 2Z2MB 1E3UA 5GLCA 4PM5A 5F1FA 3UE0A 3MXSA 2ZC5B 1K57C 3UDXA 3SH7A 1PWGA 2Q9NA 3NIAA 5A92A 4WYYA 3MBZA 3IHBA 4GOGA 2DCFA 3QNCA 5M1AA 4Y0OA 2HDQA 1ESIA 1ONHA 3RXXA 3HLDA 1MWTA 1LHYA 3HUNA 4JF4A 5HFOA 4WBGA 1N4OA 2Y91A 1XA7A 4K0XA 1FCNA 5AQ7A 1L0EA 2J7VA 1YT4A 5M18A 1PI5A 1MY8A 5F83A 4BD1A 3FZCA 1LI0A 1IYSA 1Z6FA 1K4FA 2VGJA 4DXCA 5FAOA 5GLDA 5EVLA 3DTMA 2HDRA 4R1GA 3I7JA 1ALQA 3NC8A 3GVBA 5E2EA 3Q07A 2Y2OA 3BFCA 4OQHA 3WWXA 3M6HA 2BG1A 2Y55A 4OONA 2C5WB 5E2GA 5I94A 4QU3A 2X02A 5CRFA 3MFDA 3MZEA 4P6BA 4OOYA 1KDSA 4RVAA 2G2UA 1CEGA 3A3DA 3V5MA 4R4SA 1VQQA 1K25A 5EUAA 3DW0A 3HVFA 4R4RA 4C3QA 1CK3A 3VMAA 4K0WA 4OLGA 4OQ0A 3HLWA 4DF6A 2HP5A 3A3FA 4Q8IA 2V2FF 4PMAA 1NYMA 4R0QA 4MBFA 2JCHA 3PAEA 1TDLA 4S2IA 3BEBA 1PZOA 1NZUA 1CEFA 4KZ4A 3ZCZA 2Y2PA 2ZLYA 1YLTA 5GL9A 2PU4A 3ZG0A 5FSRA 3N8LA 1DY6A 4R3BA 4U3TA 4OOMA 3PAGA 3NI9A 3UY6A 1JWZA 1ONGA 4KENB 4N9KA 1JTDA 3UPOA 2Y2MA 4PM9A 3IQAA 1Q2PA 3N4IA 2P9VA 1BT5A 1MKIA 1XGIA 4WZ4A 2RCXA 2XDMA 1YLYA 3GMWA 2V20A 3P09A 4DDYA 5A90A 2FFYA 2XFSA 2Z2LB 5A91A 2XEPA 5HARA 1HD8A 5JYPA 3HREA 4OVDA 4X56A 1L0GA 1HZOA 4BL3A 1W79A 1L0FA 1TVFA 2EX9A 4PM7A 5GHZA 3VSLA 1YMSA 2A3UA 2EX2A 1YLWA 1KE0A 3C5AA 3AGEA 3E2KA 3MKEA 1XPBA 4EUZA 2HPBA 4LV2A 3GSGA 4KZ8A 4CJNA 1IKIA 3G30A 1XXMA 3OCLA 4IVKA 2Y2GA 1I5QA 3BLMA 4LCLA 4OKPA 5FAPA 4OP5A 4WELA 3SS5A 1S6RA 1SDEA 2XQZA 4UA9A 4KG6A 3VOYA 3PBRA 5CERA 2ZM8A 4B4ZA 3VP1A 4X68A 5FQMA 1I2SA 2HP9A 1XP4A 3S1YA 2FFFB 4GN2A 1W5DA 5IHVA 1XX2A 2ZQ8A 3S4XA 5EVID 4KG5A 4OP8A 4RA7A 5FAQA 3TG9A 3ZG5A 5L2FA 4KZBA 3HLEA 4B4XA 1FCOA 3CZDA 2ZQ9A 1MWSA 3WS5A 3TOIA 1S0WA 4MNRA 1PI4A 1BLSA 4XUXA 5HAIA 1DJBA 1JWVA 2WYXA 5HAPA 3DWKA 3O86A 1RGZA 5DTKA 1AXBA 1QMFA 1KE4A 4M3KA 3BYDA 5FQJA 1ES2A 4UHUA 3V3SA 2EXAA 4YINA 3FKVA 5EECA 5TGFA 4S2NC 4N92A 4KZ5A 2I72A 1H8ZA 3RXWA 4KG2A 4X55A 4BLMA 3RJUA 5EVIA 3Q81A 1E4DA 1JWPA 4S2LA 1JVJA 2WAEA 3BFFA 4P85A 4DXBA 1BUEA 1FSYA 3WS0A 5FQKA 2XFTA 4HESA 1KGGA 5FQIA 3GV9A 3G32A 3ZGAB 4MBKA 4OOLA 2Y2KA 1HVBA 3QNBA 3W8KA 3ZDJA 2X01A 2JC7A 2H0TA 4ZTKA 1NZOA 2J9PA 1LLBA 1NXYA 3NY4A 1RCJA 2P74A 3N6IA 3CJMA 3PBSA 4OH0A 4PM8A 1BZAA 1W7FA 2WK0A 4IBXA 4P87A 2H5SA 2WADA 4S2OA 4O7DA 4N1XA 5CGXA 1KGFA 4S2MA 3AGDA 2WKIA 4JKTA 2ZD8A 5FDHA 3GR2A 2XD1A 3Q7VA 1K54A 1OMEA 2EX6A 4FD8A 3O3VA 5J8XA 4WZ5A 4PM6A 5CTNA 4P0MA 1BLPA 5GHXA 5TFQA 3NCKA 4CPKA 1RGYA 2IWDA 5F1GA 3IF6B 1I2WA 3G31A 5GLBA 2R9XA 2Y2LA 3G4PA 4WEJA 4E6XA 5BOHA 4UA6A 4GD8A 4HBTA 1SCWA 2VGKA 2WUQA 4U0XA 1SKFA 2ZQDA 1BULA 3IF6C 4UAAA 5TR7A 1FQGA 3VOZA 3IXBA 4QHCA 3ZHHA 4EQIA 2XLNA 5M19A 2QMIA 2WZZA 4EWFA 3HLBA 2Y4AA 3M2KA 1PIOA 3IWOA 4JXWA 5AQBA 3W4OA 3HL9A 4ZJ1A 5U47A 3FWLA 1VM1A 4F94A 3AGFA 5GLAA 1O07A 1LL5A 1YLZA 3VP4A 4OQIA 3VFHA 3WS2A 1O7EA 4OQGA 1GCEA 2DNSA 1ES5A 4JXVA 4OLDA 5FI6A 3S22A 1MBLA 3IH8A 4FH4A 5D3OA 1FOFA 1IYOA 4IEDA 2RL3A 4D2OA 3C4PA 4DDSA 1NY0A 1ZG4A 4RX2A 4YFMA 2GDNA 4KQOA 5HAQA 2PBYA 3ZG8B 4H8RA 5DTTA 1FR6A 4OPYA 4Z9QA 5CHJA 3MXRA 4MEZA 3UPPA 1CI8A 3BLSA 1EROA 1NJ4A 4ZJ2A 4C75A 1U60A 5CEBA 3VP2A 3GRJA 3HLFA 3LCEA 3VP0A 3HLGA 4X53A 4BL2A 2WGIA 1ES4A 3BFEA 3C7VA 3PBQA 4RX3A 3IHAA 2P9VB 3ZG9B 5AQ9A 2J9OA 1PW1A 4N1HA 5FQQA 2HDSA 1GA0A 4Y7PA 4EBNA 2WGWA 1GHMA 2PU2A 3PTEA 1SHVA 3ZNTA 4FCFA 5DF8A 4ZBEA 2HP6A 1G6AA 4GDNA 1K6SA 1L2SA 1YLJA 1BSGA 1IEMA 5FI7A 3IH9A 4QB8A 5KSHA 4HEFA 4BD0A 4KZ9A 2BLSA 1LL9A 3IT9A 3UNWA 1ZKJA 2EFXA 3HUMA 3G35A 3PBNA 4LENA 4E3OA 3G34A 3ZNYA 1XA1A 1EWZA 4BQMA 3IXGA 3P98A 2XK1A 5JYOA 4FSFA 1DJAA 2UWXA 4WMCD 1TEMA 4OPRA 1W8YA 4BJPA 4E3NA 3IWIA 2J8YA 1K55A 1FSWA 1GHPA 4K91A 3UE3A 2ZC4B 4E3LA 1M40A 4X69A 2WGVA 3FKWA 1ESUA 3C4OA 3UDIA 1K57A 1IYPA 3ZVTA 2B5RA 3NDGA 4JXGA 3V3RA 3G2ZA 4RYEA 2DRWA 4UA7A 1PWDA 3W4QA 2EFUA 2OLVA 1QMEA 2ZM0A 3M6BA 4OPZA 2R9WA 4EBLA 3SS3A 4Y0UA 1N9BA 4JF5A 3UPNA 3WRZA 4E3MA 3E2LA 5FI2A 1CI9A 1LI9A 1ZC2A 3OPRA 3D4FA 1EI5A 4WMCA 4PPRA 1PWCA 4DE0A 2Y2HA 2ZQAA 1ERQA 1K56D 1IYQA 3M2JA 4QJGA 5EOEA 5KZHA 1FR1A 1H8YA 1WE4A 3IWQA 4EBPA 1K38A 3DWZA 2QZ6A 5EVIB 3UO9A 3EQUA 5HW3A 5AQAA 4JXSA 3ZG7B 3BM6A 4GZBA 5EVIC 1JTGA 1PYYA 5G18A 1KDWA 3Q7ZA 1WYBA 2Y2NA 5A93A 5HL1A 5EOOA 4IBRA 1YMXA 2OSUA 2X71A 1PZPA 3NBLA 4OPQA 4E3JA 4GB7A 4DKIA 2Q9MA 2WKHA 3OCNA 4KZ6A 1K56A 2EXBA 2H10A 2EX8A 3IXDA 3IF6A 3Q7VB 1MXOA 5CXWA 4S2JA 3MZDA 1FCMA 4XXRA 3OPLA 1K4EA 2IWCA 2Y2JA 1IELA 3BRMA 3HLCA 1M6KA 3QHYA 1K54C 2JE5A 4NK3A 4LCMA 4WZ5C 4ZDXA 3G2YA 1XKZA 3UN7A 3N8RA 3C7UA 1NYYA 2WZXA 3EQVA 2XH9A 4KQRA 4U0TA 4X6TA 1ZG6A 3HBRA 5HX9A 5DF7A 1RP5A 5FATA 4MBHA 4XUZA 5E2FA 1C3BA 4DRTA 1DJCA 2C6WB 5KMWA 5EE8A 5CGWA 1NRFA 2V1ZA 5CHMA 3OZHA 3CG5A 1ERMA 4LV1A 3A3JA 1MWRA 2G2WA 4DE3A 4GKUA 4WEKA 5DVAA 1ES3A 4KZ7A 1Y54A 2WAFA 4JPMA 5CGSA 4JLFA 4E6WA 3IF5A 4NETA 1KE3A 4E3IA 1K6RA 4GNUA 2JBFA 3TSGA 1IKGA 3SH9A 3Q1FA 1KVMA 4JBFA 2ZQ7A 4LV3A 3VFFA 3BFDA 4R23A 1BTLA 2ZJ9A 4S2KA 3ITBA 1TDGA 4QY6A 4L0LA 3LO7A 4R3JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YQS A;  2XR0 A;  3NDE A;  1L0D A;  2HDU A;  3ISG A;  3PBT A;  3SH8 A;  3OC2 A;  2ZC3 B;  4KQQ A;  1PW8 A;  4HBU A;  5F82 A;  2ZMA A;  1WYC A;  4EV4 A;  3FYZ A;  4Y0T A;  2ZC7 A;  4KZA A;  4ZAM A;  3UDF A;  3IXH A;  2Y59 A;  4DE1 A;  4WM9 A;  3WS1 A;  4N9L A;  1KGE A;  3Q82 A;  1Q2Q A;  3LEZ A;  3FV7 A;  1GA9 A;  5E2H A;  5FAS A;  2QPN A;  3ITA A;  3VSK A;  2WGW B;  4ID4 A;  5CEC A;  4E3K A;  3B3X A;  2E8I A;  3PBO A;  4C6Y A;  3SOI A;  1HTZ A;  4LV0 A;  3WS4 A;  1SDN A;  2Y2Q A;  1MPL A;  3LY4 A;  3V50 A;  2ZC6 B;  2ZQC A;  4GDB A;  2IWB A;  2WKE A;  4S2P A;  3O87 A;  4IVI A;  3BEC A;  3LY3 A;  1E3U D;  4ZJ3 A;  3V39 A;  2XF3 A;  1MWU A;  3O88 A;  3GQZ A;  3OPP A;  5DF9 A;  3MZF A;  5DTS A;  3BFG A;  4JF6 A;  2Y2I A;  3ZFZ A;  1G68 A;  4A5R A;  3MKF A;  3A3E A;  4MLL A;  1GHI A;  3WRT A;  3N8S A;  4KZ3 A;  3CMZ A;  2H0Y A;  3SS4 A;  5GHY A;  3UE1 A;  5FA7 A;  5KSC A;  3OPH A;  1W8Q A;  4DE2 A;  3W4P A;  2A49 A;  4S2N A;  5EPH A;  1H5X A;  1J9M A;  2XD5 A;  2ZM2 A;  4B88 A;  3VP3 A;  1YM1 A;  1BLH A;  1YLP A;  4FH2 A;  5E43 A;  5FQ9 A;  2OV5 A;  2CC1 A;  3A3I A;  3GTC A;  1E25 A;  1XGJ A;  5CHU A;  5CED A;  3JYI A;  4GD6 A;  1KVL A;  1BLC A;  1K55 C;  3HUO A;  3N7W A;  2XGN A;  5CTM A;  4QD4 A;  2OLU A;  3ZVW A;  4QY5 A;  4BEN A;  2Z2M B;  1E3U A;  5GLC A;  4PM5 A;  5F1F A;  3UE0 A;  3MXS A;  2ZC5 B;  1K57 C;  3UDX A;  3SH7 A;  1PWG A;  2Q9N A;  3NIA A;  5A92 A;  4WYY A;  3MBZ A;  3IHB A;  4GOG A;  2DCF A;  3QNC A;  5M1A A;  4Y0O A;  2HDQ A;  1ESI A;  1ONH A;  3RXX A;  3HLD A;  1MWT A;  1LHY A;  3HUN A;  4JF4 A;  5HFO A;  4WBG A;  1N4O A;  2Y91 A;  1XA7 A;  4K0X A;  1FCN A;  5AQ7 A;  1L0E A;  2J7V A;  1YT4 A;  5M18 A;  1PI5 A;  1MY8 A;  5F83 A;  4BD1 A;  3FZC A;  1LI0 A;  1IYS A;  1Z6F A;  1K4F A;  2VGJ A;  4DXC A;  5FAO A;  5GLD A;  5EVL A;  3DTM A;  2HDR A;  4R1G A;  3I7J A;  1ALQ A;  3NC8 A;  3GVB A;  5E2E A;  3Q07 A;  2Y2O A;  3BFC A;  4OQH A;  3WWX A;  3M6H A;  2BG1 A;  2Y55 A;  4OON A;  2C5W B;  5E2G A;  5I94 A;  4QU3 A;  2X02 A;  5CRF A;  3MFD A;  3MZE A;  4P6B A;  4OOY A;  1KDS A;  4RVA A;  2G2U A;  1CEG A;  3A3D A;  3V5M A;  4R4S A;  1VQQ A;  1K25 A;  5EUA A;  3DW0 A;  3HVF A;  4R4R A;  4C3Q A;  1CK3 A;  3VMA A;  4K0W A;  4OLG A;  4OQ0 A;  3HLW A;  4DF6 A;  2HP5 A;  3A3F A;  4Q8I A;  2V2F F;  4PMA A;  1NYM A;  4R0Q A;  4MBF A;  2JCH A;  3PAE A;  1TDL A;  4S2I A;  3BEB A;  1PZO A;  1NZU A;  1CEF A;  4KZ4 A;  3ZCZ A;  2Y2P A;  2ZLY A;  1YLT A;  5GL9 A;  2PU4 A;  3ZG0 A;  5FSR A;  3N8L A;  1DY6 A;  4R3B A;  4U3T A;  4OOM A;  3PAG A;  3NI9 A;  3UY6 A;  1JWZ A;  1ONG A;  4KEN B;  4N9K A;  1JTD A;  3UPO A;  2Y2M A;  4PM9 A;  3IQA A;  1Q2P A;  3N4I A;  2P9V A;  1BT5 A;  1MKI A;  1XGI A;  4WZ4 A;  2RCX A;  2XDM A;  1YLY A;  3GMW A;  2V20 A;  3P09 A;  4DDY A;  5A90 A;  2FFY A;  2XFS A;  2Z2L B;  5A91 A;  2XEP A;  5HAR A;  1HD8 A;  5JYP A;  3HRE A;  4OVD A;  4X56 A;  1L0G A;  1HZO A;  4BL3 A;  1W79 A;  1L0F A;  1TVF A;  2EX9 A;  4PM7 A;  5GHZ A;  3VSL A;  1YMS A;  2A3U A;  2EX2 A;  1YLW A;  1KE0 A;  3C5A A;  3AGE A;  3E2K A;  3MKE A;  1XPB A;  4EUZ A;  2HPB A;  4LV2 A;  3GSG A;  4KZ8 A;  4CJN A;  1IKI A;  3G30 A;  1XXM A;  3OCL A;  4IVK A;  2Y2G A;  1I5Q A;  3BLM A;  4LCL A;  4OKP A;  5FAP A;  4OP5 A;  4WEL A;  3SS5 A;  1S6R A;  1SDE A;  2XQZ A;  4UA9 A;  4KG6 A;  3VOY A;  3PBR A;  5CER A;  2ZM8 A;  4B4Z A;  3VP1 A;  4X68 A;  5FQM A;  1I2S A;  2HP9 A;  1XP4 A;  3S1Y A;  2FFF B;  4GN2 A;  1W5D A;  5IHV A;  1XX2 A;  2ZQ8 A;  3S4X A;  5EVI D;  4KG5 A;  4OP8 A;  4RA7 A;  5FAQ A;  3TG9 A;  3ZG5 A;  5L2F A;  4KZB A;  3HLE A;  4B4X A;  1FCO A;  3CZD A;  2ZQ9 A;  1MWS A;  3WS5 A;  3TOI A;  1S0W A;  4MNR A;  1PI4 A;  1BLS A;  4XUX A;  5HAI A;  1DJB A;  1JWV A;  2WYX A;  5HAP A;  3DWK A;  3O86 A;  1RGZ A;  5DTK A;  1AXB A;  1QMF A;  1KE4 A;  4M3K A;  3BYD A;  5FQJ A;  1ES2 A;  4UHU A;  3V3S A;  2EXA A;  4YIN A;  3FKV A;  5EEC A;  5TGF A;  4S2N C;  4N92 A;  4KZ5 A;  2I72 A;  1H8Z A;  3RXW A;  4KG2 A;  4X55 A;  4BLM A;  3RJU A;  5EVI A;  3Q81 A;  1E4D A;  1JWP A;  4S2L A;  1JVJ A;  2WAE A;  3BFF A;  4P85 A;  4DXB A;  1BUE A;  1FSY A;  3WS0 A;  5FQK A;  2XFT A;  4HES A;  1KGG A;  5FQI A;  3GV9 A;  3G32 A;  3ZGA B;  4MBK A;  4OOL A;  2Y2K A;  1HVB A;  3QNB A;  3W8K A;  3ZDJ A;  2X01 A;  2JC7 A;  2H0T A;  4ZTK A;  1NZO A;  2J9P A;  1LLB A;  1NXY A;  3NY4 A;  1RCJ A;  2P74 A;  3N6I A;  3CJM A;  3PBS A;  4OH0 A;  4PM8 A;  1BZA A;  1W7F A;  2WK0 A;  4IBX A;  4P87 A;  2H5S A;  2WAD A;  4S2O A;  4O7D A;  4N1X A;  5CGX A;  1KGF A;  4S2M A;  3AGD A;  2WKI A;  4JKT A;  2ZD8 A;  5FDH A;  3GR2 A;  2XD1 A;  3Q7V A;  1K54 A;  1OME A;  2EX6 A;  4FD8 A;  3O3V A;  5J8X A;  4WZ5 A;  4PM6 A;  5CTN A;  4P0M A;  1BLP A;  5GHX A;  5TFQ A;  3NCK A;  4CPK A;  1RGY A;  2IWD A;  5F1G A;  3IF6 B;  1I2W A;  3G31 A;  5GLB A;  2R9X A;  2Y2L A;  3G4P A;  4WEJ A;  4E6X A;  5BOH A;  4UA6 A;  4GD8 A;  4HBT A;  1SCW A;  2VGK A;  2WUQ A;  4U0X A;  1SKF A;  2ZQD A;  1BUL A;  3IF6 C;  4UAA A;  5TR7 A;  1FQG A;  3VOZ A;  3IXB A;  4QHC A;  3ZHH A;  4EQI A;  2XLN A;  5M19 A;  2QMI A;  2WZZ A;  4EWF A;  3HLB A;  2Y4A A;  3M2K A;  1PIO A;  3IWO A;  4JXW A;  5AQB A;  3W4O A;  3HL9 A;  4ZJ1 A;  5U47 A;  3FWL A;  1VM1 A;  4F94 A;  3AGF A;  5GLA A;  1O07 A;  1LL5 A;  1YLZ A;  3VP4 A;  4OQI A;  3VFH A;  3WS2 A;  1O7E A;  4OQG A;  1GCE A;  2DNS A;  1ES5 A;  4JXV A;  4OLD A;  5FI6 A;  3S22 A;  1MBL A;  3IH8 A;  4FH4 A;  5D3O A;  1FOF A;  1IYO A;  4IED A;  2RL3 A;  4D2O A;  3C4P A;  4DDS A;  1NY0 A;  1ZG4 A;  4RX2 A;  4YFM A;  2GDN A;  4KQO A;  5HAQ A;  2PBY A;  3ZG8 B;  4H8R A;  5DTT A;  1FR6 A;  4OPY A;  4Z9Q A;  5CHJ A;  3MXR A;  4MEZ A;  3UPP A;  1CI8 A;  3BLS A;  1ERO A;  1NJ4 A;  4ZJ2 A;  4C75 A;  1U60 A;  5CEB A;  3VP2 A;  3GRJ A;  3HLF A;  3LCE A;  3VP0 A;  3HLG A;  4X53 A;  4BL2 A;  2WGI A;  1ES4 A;  3BFE A;  3C7V A;  3PBQ A;  4RX3 A;  3IHA A;  2P9V B;  3ZG9 B;  5AQ9 A;  2J9O A;  1PW1 A;  4N1H A;  5FQQ A;  2HDS A;  1GA0 A;  4Y7P A;  4EBN A;  2WGW A;  1GHM A;  2PU2 A;  3PTE A;  1SHV A;  3ZNT A;  4FCF A;  5DF8 A;  4ZBE A;  2HP6 A;  1G6A A;  4GDN A;  1K6S A;  1L2S A;  1YLJ A;  1BSG A;  1IEM A;  5FI7 A;  3IH9 A;  4QB8 A;  5KSH A;  4HEF A;  4BD0 A;  4KZ9 A;  2BLS A;  1LL9 A;  3IT9 A;  3UNW A;  1ZKJ A;  2EFX A;  3HUM A;  3G35 A;  3PBN A;  4LEN A;  4E3O A;  3G34 A;  3ZNY A;  1XA1 A;  1EWZ A;  4BQM A;  3IXG A;  3P98 A;  2XK1 A;  5JYO A;  4FSF A;  1DJA A;  2UWX A;  4WMC D;  1TEM A;  4OPR A;  1W8Y A;  4BJP A;  4E3N A;  3IWI A;  2J8Y A;  1K55 A;  1FSW A;  1GHP A;  4K91 A;  3UE3 A;  2ZC4 B;  4E3L A;  1M40 A;  4X69 A;  2WGV A;  3FKW A;  1ESU A;  3C4O A;  3UDI A;  1K57 A;  1IYP A;  3ZVT A;  2B5R A;  3NDG A;  4JXG A;  3V3R A;  3G2Z A;  4RYE A;  2DRW A;  4UA7 A;  1PWD A;  3W4Q A;  2EFU A;  2OLV A;  1QME A;  2ZM0 A;  3M6B A;  4OPZ A;  2R9W A;  4EBL A;  3SS3 A;  4Y0U A;  1N9B A;  4JF5 A;  3UPN A;  3WRZ A;  4E3M A;  3E2L A;  5FI2 A;  1CI9 A;  1LI9 A;  1ZC2 A;  3OPR A;  3D4F A;  1EI5 A;  4WMC A;  4PPR A;  1PWC A;  4DE0 A;  2Y2H A;  2ZQA A;  1ERQ A;  1K56 D;  1IYQ A;  3M2J A;  4QJG A;  5EOE A;  5KZH A;  1FR1 A;  1H8Y A;  1WE4 A;  3IWQ A;  4EBP A;  1K38 A;  3DWZ A;  2QZ6 A;  5EVI B;  3UO9 A;  3EQU A;  5HW3 A;  5AQA A;  4JXS A;  3ZG7 B;  3BM6 A;  4GZB A;  5EVI C;  1JTG A;  1PYY A;  5G18 A;  1KDW A;  3Q7Z A;  1WYB A;  2Y2N A;  5A93 A;  5HL1 A;  5EOO A;  4IBR A;  1YMX A;  2OSU A;  2X71 A;  1PZP A;  3NBL A;  4OPQ A;  4E3J A;  4GB7 A;  4DKI A;  2Q9M A;  2WKH A;  3OCN A;  4KZ6 A;  1K56 A;  2EXB A;  2H10 A;  2EX8 A;  3IXD A;  3IF6 A;  3Q7V B;  1MXO A;  5CXW A;  4S2J A;  3MZD A;  1FCM A;  4XXR A;  3OPL A;  1K4E A;  2IWC A;  2Y2J A;  1IEL A;  3BRM A;  3HLC A;  1M6K A;  3QHY A;  1K54 C;  2JE5 A;  4NK3 A;  4LCM A;  4WZ5 C;  4ZDX A;  3G2Y A;  1XKZ A;  3UN7 A;  3N8R A;  3C7U A;  1NYY A;  2WZX A;  3EQV A;  2XH9 A;  4KQR A;  4U0T A;  4X6T A;  1ZG6 A;  3HBR A;  5HX9 A;  5DF7 A;  1RP5 A;  5FAT A;  4MBH A;  4XUZ A;  5E2F A;  1C3B A;  4DRT A;  1DJC A;  2C6W B;  5KMW A;  5EE8 A;  5CGW A;  1NRF A;  2V1Z A;  5CHM A;  3OZH A;  3CG5 A;  1ERM A;  4LV1 A;  3A3J A;  1MWR A;  2G2W A;  4DE3 A;  4GKU A;  4WEK A;  5DVA A;  1ES3 A;  4KZ7 A;  1Y54 A;  2WAF A;  4JPM A;  5CGS A;  4JLF A;  4E6W A;  3IF5 A;  4NET A;  1KE3 A;  4E3I A;  1K6R A;  4GNU A;  2JBF A;  3TSG A;  1IKG A;  3SH9 A;  3Q1F A;  1KVM A;  4JBF A;  2ZQ7 A;  4LV3 A;  3VFF A;  3BFD A;  4R23 A;  1BTL A;  2ZJ9 A;  4S2K A;  3ITB A;  1TDG A;  4QY6 A;  4L0L A;  3LO7 A;  4R3J A; 
#chains in the Genus database with same CATH topology
 2HDU A;  3ISG A;  1LSX A;  3E98 A;  3OC2 A;  4KQQ A;  1PW8 A;  5F82 A;  3L9K A;  4KZA A;  3UDF A;  4EES A;  1CQA A;  2O9B A;  4NG2 A;  4N9L A;  3WS1 A;  3LEZ A;  2Y79 A;  2WGW B;  3A0S A;  5DJT A;  3H9W A;  2E8I A;  4S2P A;  2PR5 A;  1H3Q A;  2HGV A;  2PR6 A;  4EET B;  1ACF A;  4X1L A;  2KOI A;  4L9F A;  2XF3 A;  3O88 A;  5DF9 A;  3MZF A;  3NUL A;  3ZFZ A;  4NXE A;  3UE1 A;  3CMZ A;  2H0Y A;  1N9O A;  3IX3 A;  5FA7 A;  3T4O A;  3W4P A;  4KQD A;  4FH2 A;  2OV5 A;  1XGJ A;  3MSH A;  2PRF A;  4QY5 A;  1WA9 A;  5L07 A;  2HJE A;  3UE0 A;  4JGP A;  1PWG A;  5M1A A;  4UQI S;  1ONH A;  3LFV A;  3HLD A;  1MWT A;  1LHY A;  3HUN A;  4GS9 A;  3H82 B;  2NUP C;  1XA7 A;  4K0X A;  5AQ7 A;  2J7V A;  3W2Z A;  2PT7 A;  1MY8 A;  3FZC A;  1IYS A;  3LIA A;  1Y4O A;  2MJ6 A;  2DMW A;  5GLD A;  2HDR A;  4GHI B;  2QWS A;  3MQ0 A;  2Y2O A;  4OQH A;  2BG1 A;  5DFX A;  1YSQ A;  3EEH A;  4P6Z S;  4OOY A;  4RQ9 A;  3T4L A;  1CEG A;  3V5M A;  1VQQ A;  3UMD A;  1YPR A;  3EGX C;  1OTA A;  3P7N A;  3BY8 A;  2V2F F;  4PMA A;  1NYM A;  4R0Q A;  4MBF A;  3PAE A;  3BEB A;  1NZU A;  4KZ4 A;  3IS2 B;  3ZCZ A;  2V8C A;  3ZG0 A;  5A8B A;  1G6O A;  3T1S A;  2BTF P;  4KEN B;  3UPO A;  2XRO A;  4PM9 A;  1Q2P A;  3N4I A;  2P9V A;  4WZ4 A;  2XDM A;  1L0G A;  2WKQ A;  3LR0 A;  3IBJ A;  1W79 A;  4JGQ A;  1OTD A;  1TVF A;  4PM7 A;  4LPZ A;  3RTY A;  4WUJ A;  1F98 A;  3MKE A;  4LV2 A;  3QP1 A;  3G30 A;  2JHE A;  3BLM A;  4OKP A;  4PAU A;  5FAP A;  4OP5 A;  2XQZ A;  4ARZ A;  2XA7 S;  1XP4 A;  3S1Y A;  1XX2 A;  4OP8 A;  2PD7 A;  2VGL S;  3MS6 A;  1FCO A;  4HP4 A;  3WS5 A;  3FG8 A;  2W3G A;  4Q0H A;  1BLS A;  4HOI A;  5HAI A;  2WYX A;  3DWK A;  1RGZ A;  2OWJ A;  3LUQ A;  2EXA A;  2GX5 A;  5TJJ A;  3S7Q A;  4S2N C;  3R4K A;  1NLZ A;  4KG2 A;  4BLM A;  3Q81 A;  4FTX A;  2WAE A;  2QKP A;  3QP6 A;  3G32 A;  2Y2K A;  3IX4 A;  3W8K A;  2X01 A;  1NZO A;  4II7 A;  2J9P A;  4QHC A;  1NXY A;  4OH0 A;  4PM8 A;  1W7F A;  2WK0 A;  4S2O A;  3CHW P;  1KGF A;  3AGD A;  1Y28 A;  2EX6 A;  1T1C A;  4NEE D;  4WZ5 A;  5GHX A;  2IWD A;  5F1G A;  2VJW A;  3IF6 B;  1I2W A;  1NLY A;  3EGD C;  4UA6 A;  2VGK A;  5TR7 A;  1BUL A;  1VEU A;  2VV6 A;  4JXW A;  5AQB A;  3H7W A;  4ZJ1 A;  3R7W A;  1P9W A;  4ETX A;  5HDD A;  3S22 A;  3C2W A;  1MBL A;  2HF6 A;  3IH8 A;  5D3O A;  1FOF A;  4IED A;  3BQ8 A;  4GJ4 A;  4YFM A;  2GDN A;  3ZG8 B;  3SW1 A;  3GDI A;  3TE8 A;  2O9A A;  3GRJ A;  3HLF A;  1F2K A;  3HLG A;  3VP0 A;  3BFE A;  1ES4 A;  3BY9 A;  4G3V A;  3PBQ A;  2P9V B;  2J9O A;  4N1H A;  1GA0 A;  4Y7P A;  3ZNT A;  1G6A A;  1YLJ A;  3LIF A;  2Q0O A;  5KSH A;  4HEF A;  2BLS A;  1LL9 A;  3A0V A;  3HUM A;  3PBN A;  3JVV A;  3ZNY A;  4BQM A;  3IXG A;  3P98 A;  5JYO A;  4FSF A;  1A0K A;  2UWX A;  3T4J A;  3VOL A;  4ARZ B;  4K91 A;  3LID A;  1M40 A;  2WGV A;  1K57 A;  3NDG A;  4JXG A;  2VLG A;  1PWD A;  2OLV A;  2ZM0 A;  2R9W A;  4JF5 A;  1DRM A;  3WRZ A;  3DTK A;  1EI5 A;  2A24 A;  3MJQ A;  4MDZ A;  1WE4 A;  4EBP A;  1K38 A;  3EQU A;  5J3W A;  3LIB A;  4HH3 A;  5DKL A;  1JTG A;  1STZ A;  1KDW A;  5A93 A;  1P0Z A;  5HL1 A;  3LR5 A;  1LSW A;  5EOO A;  1TS8 A;  1N9N A;  1YMX A;  5C5K A;  2X71 A;  1PZP A;  3NBL A;  3OCN A;  2H10 A;  2VA0 A;  5HWW A;  3FPV A;  3BRM A;  1K54 C;  4K08 A;  2XRN A;  4UQI M;  2KDK A;  2WZX A;  4NXF A;  5DF7 A;  3MF0 A;  5FAT A;  3F1O A;  4DRT A;  1VEU B;  5EE8 A;  1TF1 A;  2V1Z A;  1ERM A;  3R7W B;  4ZRR A;  1MWR A;  2G2W A;  2ZL1 A;  4GKU A;  1ES3 A;  4KZ7 A;  4E6W A;  2JBF A;  4P6Z M;  4GW9 A;  1KVM A;  2ZQ7 A;  3CUE C;  1TS0 A;  4R23 A;  2ZJ9 A;  4L0L A;  3LO7 A;  1YQS A;  3NDE A;  4DN0 A;  4I3I A;  3PBT A;  2ZC3 B;  3FC7 A;  3MR0 A;  4HBU A;  3FYZ A;  5KIZ A;  2ZC7 A;  4ZAM A;  2Y59 A;  4DE1 A;  4WM9 A;  1KGE A;  1ZTU A;  3Q82 A;  5L09 A;  1GA9 A;  2QPN A;  3ITA A;  5CX7 A;  5CEC A;  2OAP 1;  4E3K A;  3SOI A;  1HTZ A;  4LV0 A;  3WS4 A;  2Y2Q A;  2I9V A;  2IWB A;  3O87 A;  3LIE A;  5J4E A;  3BEC A;  3LY3 A;  1V9Z A;  1MWU A;  5DTS A;  3BFG A;  4JF6 A;  2Y2I A;  3DBA A;  4MLL A;  1GSW A;  3N8S A;  3SS4 A;  4I38 A;  3OPH A;  3MQQ A;  3VE4 A;  2A49 A;  5EPH A;  2ZM2 A;  4B88 A;  3VP3 A;  1YM1 A;  5E43 A;  5FQ9 A;  1S67 L;  1VHM A;  5CED A;  4LRZ E;  1KVL A;  4IUH A;  2XGN A;  5CTM A;  4IHQ A;  1E3U A;  5GLC A;  3MXS A;  3NOU C;  3SH7 A;  2P08 A;  5A92 A;  4WYY A;  3MBZ A;  2DCF A;  3QNC A;  5K5B A;  2JKT M;  1XJ3 A;  2XA7 M;  5HFO A;  4WBG A;  1N4O A;  1AWI A;  2YKH A;  2VGL M;  1OJ5 A;  1S1Z A;  5F83 A;  3DAV A;  4I5S A;  1TD5 A;  5EVL A;  3I7J A;  3GVB A;  3KO6 A;  3MQO A;  3M6H A;  2W3F A;  2C5W B;  5EFW A;  4P6B A;  1KDS A;  4GCZ A;  5IU1 A;  4BBV A;  4EQ1 A;  3HVF A;  4LFU A;  4C3Q A;  3VMA A;  4K0W A;  1LL8 A;  3LIC A;  3HLW A;  2HP5 A;  3A3F A;  3EWK A;  1VB6 A;  2JCH A;  2O0Y A;  1TDL A;  3F1O B;  3FPW A;  2PDR A;  2Y2P A;  2ZLY A;  5MC7 A;  3CUE A;  3N8L A;  1CF0 A;  1DY6 A;  3PAG A;  3NI9 A;  3UY6 A;  4EUV A;  5HZH A;  1JWZ A;  2ZL1 B;  3IQA A;  1BT5 A;  4WLA A;  2V20 A;  2XFS A;  1SKO A;  5A91 A;  2OAQ 1;  1HD8 A;  3HRE A;  2OOL A;  1EW0 A;  3BWL A;  1YLW A;  1KE0 A;  3E2K A;  4MN5 A;  2HPB A;  3C30 A;  1XJ2 A;  2LB9 A;  3OCL A;  1I5Q A;  2JKF A;  4F3L A;  1W63 M;  4WEL A;  1S6R A;  5CER A;  3UME A;  3VP1 A;  2HP9 A;  3KYQ A;  1W5D A;  2ZQ8 A;  3PXP A;  4RA7 A;  5FAQ A;  3TG9 A;  3HLE A;  4B4X A;  3CZD A;  3TOI A;  5FEG A;  1PI4 A;  2Z6D A;  1JWV A;  5HAP A;  1AXB A;  5F69 A;  1KE4 A;  4M3K A;  2V8F A;  3BYD A;  4YIN A;  4X55 A;  5EVI A;  3F1P A;  3CWF A;  1FSY A;  2M7U A;  3WS0 A;  2XFT A;  4HES A;  3GV9 A;  3ZDJ A;  3KSH A;  1GSX A;  4XT2 A;  2JC7 A;  4ZTK A;  4BBT A;  1LLB A;  2P74 A;  3N6I A;  2INW A;  3T1Q B;  4CLC A;  1BZA A;  3T1X A;  4IBX A;  4N1X A;  4S2M A;  2VK3 A;  2WKI A;  1CJF A;  4LRY C;  3GR2 A;  2XD1 A;  1OTB A;  5HL6 A;  5L10 A;  5GLB A;  2R9X A;  4E6X A;  4HBT A;  2WUQ A;  2EWV A;  3BW6 A;  2K2N A;  1YAX A;  2PYR A;  3VOZ A;  3IXB A;  4QWO A;  4Q0I A;  2WZZ A;  3M2K A;  2L0W A;  4ESP A;  3HL9 A;  3OOV A;  3FWL A;  1VM1 A;  5G4Y A;  3AGF A;  1O07 A;  1LL5 A;  4L9G A;  3KX0 X;  1GCE A;  3LI9 A;  4OLD A;  5FI6 A;  4D2O A;  4RX2 A;  4Y3I A;  4KQO A;  1FR6 A;  1BYW A;  3MXR A;  3UPP A;  2P04 A;  3ZQ5 A;  1NJ4 A;  1U60 A;  3VP2 A;  3LCE A;  4BL2 A;  3MMH A;  1OJG A;  5FDS A;  2HDS A;  1SKO B;  3BJN A;  1GHM A;  1SHV A;  4FCF A;  5DF8 A;  4ZBE A;  4B93 A;  2M1C A;  1K6S A;  4HHD A;  1BSG A;  3IH9 A;  2ZMV A;  4QB8 A;  4BD0 A;  2B95 A;  3IT9 A;  2EFX A;  4G3K A;  4E3O A;  3G34 A;  2ACG A;  1UWP X;  3A0R A;  3UB9 A;  2L1M A;  1W8Y A;  3ICY A;  2CMN A;  3UDI A;  4WL9 A;  4UA7 A;  5DFY A;  3T12 B;  4DJ2 A;  2EFU A;  3SS3 A;  4Y0U A;  1N9B A;  3UPN A;  4MMN A;  1LI9 A;  3D4F A;  4PPR A;  1FIL A;  2ZQA A;  1ERQ A;  4NXB A;  5EOE A;  5KZH A;  3CI6 A;  2QZ6 A;  5EVI B;  4GS9 B;  3F1P B;  2ZOH A;  1YKD A;  4XT2 B;  4GLQ A;  2OSU A;  2W3E A;  3PYP A;  4CLC B;  5EM0 A;  2ZMF A;  3E0Y A;  2R78 A;  4DJ3 A;  2IWC A;  2HZ5 A;  3HLC A;  2JE5 A;  4LCM A;  4ZDX A;  3G2Y A;  1XKZ A;  5FEF A;  3D3O A;  1NYY A;  2XH9 A;  3MXQ A;  5LBR A;  3F1N A;  5HDC A;  1H8M A;  1C3B A;  1DJC A;  3QP5 A;  2GZA A;  5KMW A;  3ULF A;  5CHM A;  3CG5 A;  4G3W A;  4LV1 A;  3A3J A;  4DE3 A;  2HV1 A;  1DP8 A;  5DVA A;  2WAF A;  4NET A;  1KE3 A;  4GNU A;  5IS1 A;  3VFF A;  1MZU A;  5IT5 A;  2WKP A;  1GSV A;  4S2K A;  3OPR A;  1L0D A;  2VX8 A;  3SH8 A;  4EV4 A;  2ZBB A;  3IXH A;  5AVE A;  3VSK A;  5EVE A;  4ID4 A;  3UB7 A;  3JPU A;  3B3X A;  3PBO A;  2EWW A;  3LY4 A;  3V50 A;  2ZC6 B;  4MN7 A;  2WKE A;  5G4Z A;  4IJG A;  1PRQ A;  1E3U D;  4Y2F A;  4ZJ3 A;  4Q0J A;  3TRC A;  3GQZ A;  2PHY A;  1G68 A;  4I3A A;  3MKF A;  3A3E A;  1GHI A;  3WRT A;  1NWZ A;  5GHY A;  1W8Q A;  4S2N A;  1H5X A;  1J9M A;  1YLP A;  1DP9 A;  2V0W A;  2ZOI A;  2CC1 A;  4WF0 A;  3GTC A;  1E25 A;  3JVU A;  3JYI A;  5DJU A;  1K55 C;  3HUO A;  3N7W A;  4QD4 A;  4R70 A;  3ZVW A;  4BEN A;  4PM5 A;  5F1F A;  2K7S A;  4GOG A;  2HDQ A;  1ESI A;  3RXX A;  4HJ6 A;  4Y13 A;  4JF4 A;  1L0E A;  5M18 A;  4EEP A;  1T1B A;  4BD1 A;  1LI0 A;  1K4F A;  2VGJ A;  4D60 A;  4R1G A;  4Y15 A;  2Z6C A;  3NC8 A;  3Q07 A;  4H6J A;  3BQA A;  2GNX A;  3VE3 A;  4OON A;  5E2G A;  5I94 A;  4QU3 A;  1HLU P;  5CRF A;  3LEQ A;  4X25 A;  4NXG A;  4RVA A;  3A3D A;  4R4S A;  1CK3 A;  4OLG A;  4OQ0 A;  4Q8I A;  3H7W B;  3VV4 A;  3F1N B;  4S2I A;  3IBR A;  2D02 A;  5GL9 A;  5FSR A;  4R3B A;  2J3T D;  1ONG A;  4N9K A;  2Y2M A;  1MKI A;  3C8C A;  3GMW A;  4LGW A;  2FFY A;  1LT0 A;  2Z2L B;  2XEP A;  1IFQ A;  5HAR A;  5JYP A;  4L9E A;  1T1A A;  1S1Y A;  1K0K A;  3KYE A;  5GHZ A;  1YMS A;  2A3U A;  2W3D A;  3CAX A;  1XPB A;  1XXM A;  2Y2G A;  1OPX A;  4LCL A;  2J80 A;  2XSS A;  4UA9 A;  3VOY A;  2ZM8 A;  4X68 A;  5FQM A;  2FZ0 A;  4GN2 A;  5EVI D;  4KG5 A;  4YNR A;  4M4X A;  4MNR A;  2Y8H A;  3O86 A;  1QMF A;  3U2A A;  2AVX A;  1G5U A;  5FQJ A;  1ES2 A;  4CLC D;  4EEU A;  4LLO B;  4LRX C;  5EEC A;  4JGR A;  4N92 A;  4KZ5 A;  1H8Z A;  2A24 B;  2NUT C;  3SZT A;  4S2L A;  1E4D A;  1JWP A;  3P01 A;  5EM1 A;  1JVJ A;  3O5Y A;  3BFF A;  4MCW A;  4DXB A;  5FQK A;  5FQI A;  1KGG A;  4EW7 A;  2QHK A;  3ZGA B;  4MBK A;  2E8J A;  3NY4 A;  2H5S A;  5CGX A;  5FDH A;  5HWV A;  4HQA A;  4JKT A;  1NRJ A;  2ZD8 A;  3T4S A;  3E4P A;  3E4Q A;  3Q7V A;  1K54 A;  3O3V A;  4Y17 A;  4AFI A;  4P0M A;  5TFQ A;  3G31 A;  3G4P A;  4H6J B;  5BOH A;  1P9R A;  4BWI A;  4GD8 A;  1SKF A;  2ZQD A;  3IF6 C;  3QP4 A;  4UAA A;  1FQG A;  2BAS A;  2VEA A;  1S4R A;  2WKR A;  4EQI A;  2QMI A;  4EWF A;  1T19 A;  4R6L A;  1PIO A;  3IWO A;  5U47 A;  4CLC E;  5GLA A;  1YLZ A;  3C38 A;  4OQI A;  3K3D A;  3VFH A;  3WS2 A;  3T1R A;  1O7E A;  1T18 A;  4OQG A;  4PKY G;  3IS2 A;  1ES5 A;  1UWN X;  2W0N A;  1PFL A;  4FH4 A;  1IYO A;  1OTI A;  1P97 A;  4DDS A;  1NY0 A;  4MN6 A;  4X1M A;  3OLO A;  3S7N A;  5HPI A;  5HAQ A;  2PBY A;  4FUW A;  3S7O A;  4OPY A;  3K2N A;  4Z9Q A;  5CHJ A;  1CI8 A;  1ERO A;  4C75 A;  4ZJ2 A;  5CEB A;  4X53 A;  2WGI A;  3C7V A;  4EU0 A;  5FQQ A;  4E04 A;  2A2L A;  2HP6 A;  3DTI A;  3NEC A;  1H0M A;  4ME4 A;  1L2S A;  4HP9 A;  1ZKJ A;  3G35 A;  4LEN A;  4BMW A;  1EWZ A;  3D72 A;  2V1A A;  3UB6 A;  2XK1 A;  2V9A A;  4O8G A;  3LYX A;  1PNE A;  1GHP A;  2ZC4 B;  5L8M A;  3FKW A;  4HY8 A;  3C4O A;  2B5R A;  1JNU A;  2DRW A;  4RYE A;  3B33 A;  1QME A;  4KUK A;  4UEY A;  4E3M A;  1CI9 A;  1ZC2 A;  4WMC A;  4CQH A;  4DE0 A;  3S7P A;  4WN5 A;  3M2J A;  3NOT C;  4QJG A;  1IOU A;  1H8Y A;  5DKK A;  3DWZ A;  1OTE A;  3UO9 A;  5AQA A;  4JXS A;  3ZG7 B;  3TW8 A;  1PYY A;  2JKR I;  1WYB A;  1DP6 A;  2Y2N A;  4IBR A;  1TS6 A;  4O01 A;  2QJ5 A;  2H28 A;  1OT6 A;  4GB7 A;  4DKI A;  2Q9M A;  4KZ6 A;  1K56 A;  3KSI A;  3IF6 A;  3Q7V B;  1S4S A;  1MXO A;  3HJI A;  4S2J A;  4R3A A;  3MZD A;  4XXR A;  1K4E A;  1IEL A;  1M6K A;  4WZ5 C;  3UN7 A;  3C7U A;  3EQV A;  2V0U A;  4U0T A;  4X6T A;  5HSQ A;  2PD8 A;  3HBR A;  5HX9 A;  1RP5 A;  4MBH A;  2PYP A;  3D9Y A;  3T4Q A;  2C6W B;  1J3W A;  5CGW A;  1NRF A;  4EER A;  2LB5 A;  4HIA A;  2OWH A;  4WEK A;  1Y54 A;  4JPM A;  5CGS A;  4E3I A;  1K6R A;  5J7E A;  3SH9 A;  3Q1F A;  4JBF A;  3PHY A;  4LV3 A;  4HH2 A;  1BTL A;  2K31 A;  3ITB A;  4QY6 A;  4HJ3 A;  2XR0 A;  2G7U A;  4Z1W A;  1D06 A;  5HDS A;  5HPF A;  4Y0T A;  2ZMA A;  1WYC A;  4HNB A;  1Q2Q A;  3FV7 A;  2VV7 A;  5E2H A;  5FAS A;  3T50 A;  4Y5F A;  4C6Y A;  3B42 A;  1SDN A;  4F3L B;  1MPL A;  2W1T A;  2ZQC A;  4GDB A;  4IVI A;  5TBM A;  1Z09 A;  3V39 A;  3OPP A;  4A5R A;  4KZ3 A;  5KSC A;  4DE2 A;  1MKM A;  2XD5 A;  1BLH A;  5HD3 A;  3A3I A;  5CHU A;  1N9L A;  4GD6 A;  2GJ3 A;  1BLC A;  1VET A;  1XJ4 A;  2JKG A;  2OLU A;  2Z2M B;  2JN7 A;  2ZC5 B;  1K57 C;  3UDX A;  3NOP C;  2Q9N A;  3CPT A;  3NIA A;  3IHB A;  4Y0O A;  3UB8 A;  2Y91 A;  3EEA A;  1FCN A;  3DTE A;  1YT4 A;  1PI5 A;  1Z6F A;  4DXC A;  1S66 L;  5FAO A;  3DTM A;  1ALQ A;  5E2E A;  3BFC A;  3WWX A;  2Y55 A;  4O0P A;  2JKR M;  3HCY A;  1XFQ A;  2X02 A;  3LI8 A;  4HI4 A;  3MFX A;  3MFD A;  3MZE A;  2W3H A;  4NKP A;  2G2U A;  1ODV A;  1K25 A;  4JGO A;  5EUA A;  3DW0 A;  4R4R A;  3NHQ A;  3RFB A;  1TS7 A;  4DF6 A;  3LR4 A;  3IX8 A;  1PZO A;  1CEF A;  1YLT A;  2PU4 A;  2O99 A;  4U3T A;  4OOM A;  2P7J A;  1JTD A;  1XGI A;  2RCX A;  1YLY A;  5A90 A;  3P09 A;  4DDY A;  2D01 A;  4FOF A;  4PKY A;  1W63 Q;  4OVD A;  4X56 A;  1HZO A;  2W27 A;  4BL3 A;  3G6O A;  1L0F A;  2EX9 A;  3VSL A;  4QPR A;  2EX2 A;  3UE6 A;  3C5A A;  3AGE A;  1XFN A;  4EUZ A;  3GSG A;  4KZ8 A;  4CJN A;  3L7H A;  1IKI A;  3OBF A;  3TJZ C;  4IVK A;  3KYZ A;  3SS5 A;  1SDE A;  4KG6 A;  3PBR A;  4B4Z A;  5F6A A;  4BBU A;  1YSP A;  1I2S A;  2FFF B;  5IHV A;  3S4X A;  2W1T B;  3ZG5 A;  5L2F A;  4KZB A;  5TBM B;  2ZQ9 A;  1MWS A;  4KUO A;  5FL3 A;  1S0W A;  3KSF A;  4XUX A;  1DJB A;  1XJ6 A;  2VV8 A;  1G28 A;  5DTK A;  3PR6 A;  3V3S A;  4UHU A;  1V9Y A;  4YWZ A;  3FKV A;  2J3W A;  5TGF A;  2JKT I;  3RXW A;  2I72 A;  1VET B;  3RJU A;  4P85 A;  1BUE A;  2QJ7 A;  1F5M A;  4OOL A;  1HVB A;  3CPT B;  3QNB A;  4ETZ A;  2H0T A;  3PBS A;  1RCJ A;  3CJM A;  4P87 A;  2IA2 A;  2WAD A;  4O7D A;  2PBD P;  3QP8 A;  1OME A;  4FD8 A;  5J8X A;  2KLI A;  4YOF A;  4PM6 A;  5CTN A;  1BLP A;  3NCK A;  4CPK A;  1RGY A;  2Y2L A;  2O9C A;  4WEJ A;  2FH5 A;  1SCW A;  4U0X A;  1UGU A;  3U4L P;  3ZHH A;  2W1R A;  3T4K A;  2XLN A;  1KOU A;  5M19 A;  1L3L A;  3HLB A;  2Y4A A;  3QP2 A;  3W4O A;  4F94 A;  3VP4 A;  1X0O A;  1D7E A;  2YKF A;  2DNS A;  4JXV A;  5HD5 A;  2RL3 A;  3C4P A;  1ZG4 A;  2VZW A;  4H8R A;  5DTT A;  4MEZ A;  2KX6 A;  3BLS A;  2B18 A;  3LGO A;  4R38 A;  2HJ9 C;  4RX3 A;  2B02 A;  3IHA A;  3ZG9 B;  5AQ9 A;  1PW1 A;  3B47 A;  2V1B A;  4EBN A;  2WGW A;  2PU2 A;  3PTE A;  3EOI A;  4GDN A;  1D1J A;  1OT9 A;  1IEM A;  5FI7 A;  4KZ9 A;  3UNW A;  1XA1 A;  3UB5 P;  1MC0 A;  2J3T C;  1DJA A;  3NJA A;  4WMC D;  2M7V A;  1TEM A;  4OPR A;  4BJP A;  4E3N A;  3IWI A;  2J8Y A;  1K55 A;  1FSW A;  3UE3 A;  3RH8 B;  4E3L A;  3CLO A;  4X69 A;  5AJG A;  1ESU A;  3E4O A;  1IYP A;  3ZVT A;  3V3R A;  3G2Z A;  3W4Q A;  3M6B A;  4OPZ A;  4EBL A;  3CIT A;  5HWT A;  5AVF A;  3E2L A;  1F9I A;  3GEC A;  5FI2 A;  1PWC A;  3H82 A;  2Y2H A;  1K56 D;  1IYQ A;  1FR1 A;  3IWQ A;  4DMZ A;  1LSV A;  5HW3 A;  5F5Y A;  4IUK A;  2UV0 E;  3BM6 A;  4GHI A;  4GZB A;  5EVI C;  5G18 A;  2VKS A;  3Q7Z A;  3K3C A;  5F68 A;  4OPQ A;  4E3J A;  2WKH A;  2EXB A;  2EX8 A;  3KSG A;  3IXD A;  4CLC C;  5CXW A;  1FCM A;  3OPL A;  2Y2J A;  3QHY A;  4NK3 A;  4I3J A;  4PHT A;  5I5L A;  1SZV A;  3N8R A;  3HJK A;  4HJ4 A;  4KQR A;  1ZG6 A;  2L4R A;  4XUZ A;  5E2F A;  4EXO A;  2PAV P;  4I39 A;  3V67 A;  3OZH A;  2QYB A;  1ZHH B;  3LR3 A;  3IF5 A;  4JLF A;  3T4T A;  3TSG A;  1IKG A;  3BFD A;  5EV0 A;  4B9O A;  1FIK A;  2EA9 A;  1TDG A;  3ZYT A;  4R3J A; 
#chains in the Genus database with same CATH homology
 1YQS A;  2XR0 A;  3NDE A;  1L0D A;  2HDU A;  3ISG A;  3PBT A;  3SH8 A;  3OC2 A;  2ZC3 B;  4KQQ A;  1PW8 A;  4HBU A;  5F82 A;  2ZMA A;  1WYC A;  4EV4 A;  3FYZ A;  4Y0T A;  2ZC7 A;  4KZA A;  4ZAM A;  3UDF A;  3IXH A;  2Y59 A;  4DE1 A;  4WM9 A;  3WS1 A;  4N9L A;  1KGE A;  3Q82 A;  1Q2Q A;  3LEZ A;  3FV7 A;  1GA9 A;  5E2H A;  5FAS A;  2QPN A;  3ITA A;  3VSK A;  2WGW B;  4ID4 A;  5CEC A;  4E3K A;  3B3X A;  2E8I A;  3PBO A;  4C6Y A;  3SOI A;  1HTZ A;  4LV0 A;  3WS4 A;  1SDN A;  2Y2Q A;  1MPL A;  3LY4 A;  3V50 A;  2ZC6 B;  2ZQC A;  4GDB A;  2IWB A;  2WKE A;  4S2P A;  3O87 A;  4IVI A;  3BEC A;  3LY3 A;  1E3U D;  4ZJ3 A;  3V39 A;  2XF3 A;  1MWU A;  3O88 A;  3GQZ A;  3OPP A;  5DF9 A;  3MZF A;  5DTS A;  3BFG A;  4JF6 A;  2Y2I A;  3ZFZ A;  1G68 A;  4A5R A;  3MKF A;  3A3E A;  4MLL A;  1GHI A;  3WRT A;  3N8S A;  4KZ3 A;  3CMZ A;  2H0Y A;  3SS4 A;  5GHY A;  3UE1 A;  5FA7 A;  5KSC A;  3OPH A;  1W8Q A;  4DE2 A;  3W4P A;  2A49 A;  4S2N A;  5EPH A;  1H5X A;  1J9M A;  2XD5 A;  2ZM2 A;  4B88 A;  3VP3 A;  1YM1 A;  1BLH A;  1YLP A;  4FH2 A;  5E43 A;  5FQ9 A;  2OV5 A;  2CC1 A;  3A3I A;  3GTC A;  1E25 A;  1XGJ A;  5CHU A;  5CED A;  3JYI A;  4GD6 A;  1KVL A;  1BLC A;  1K55 C;  3HUO A;  3N7W A;  2XGN A;  5CTM A;  4QD4 A;  2OLU A;  3ZVW A;  4QY5 A;  4BEN A;  2Z2M B;  1E3U A;  5GLC A;  4PM5 A;  5F1F A;  3UE0 A;  3MXS A;  2ZC5 B;  1K57 C;  3UDX A;  3SH7 A;  1PWG A;  2Q9N A;  3NIA A;  5A92 A;  4WYY A;  3MBZ A;  3IHB A;  4GOG A;  2DCF A;  3QNC A;  5M1A A;  4Y0O A;  2HDQ A;  1ESI A;  1ONH A;  3RXX A;  3HLD A;  1MWT A;  1LHY A;  3HUN A;  4JF4 A;  5HFO A;  4WBG A;  1N4O A;  2Y91 A;  1XA7 A;  4K0X A;  1FCN A;  5AQ7 A;  1L0E A;  2J7V A;  1YT4 A;  5M18 A;  1PI5 A;  1MY8 A;  5F83 A;  4BD1 A;  3FZC A;  1LI0 A;  1IYS A;  1Z6F A;  1K4F A;  2VGJ A;  4DXC A;  5FAO A;  5GLD A;  5EVL A;  3DTM A;  2HDR A;  4R1G A;  3I7J A;  1ALQ A;  3NC8 A;  3GVB A;  5E2E A;  3Q07 A;  2Y2O A;  3BFC A;  4OQH A;  3WWX A;  3M6H A;  2BG1 A;  2Y55 A;  4OON A;  2C5W B;  5E2G A;  5I94 A;  4QU3 A;  2X02 A;  5CRF A;  3MFD A;  3MZE A;  4P6B A;  4OOY A;  1KDS A;  4RVA A;  2G2U A;  1CEG A;  3A3D A;  3V5M A;  4R4S A;  1VQQ A;  1K25 A;  5EUA A;  3DW0 A;  3HVF A;  4R4R A;  4C3Q A;  1CK3 A;  3VMA A;  4K0W A;  4OLG A;  4OQ0 A;  3HLW A;  4DF6 A;  2HP5 A;  3A3F A;  4Q8I A;  2V2F F;  4PMA A;  1NYM A;  4R0Q A;  4MBF A;  2JCH A;  3PAE A;  1TDL A;  4S2I A;  3BEB A;  1PZO A;  1NZU A;  1CEF A;  4KZ4 A;  3ZCZ A;  2Y2P A;  2ZLY A;  1YLT A;  5GL9 A;  2PU4 A;  3ZG0 A;  5FSR A;  3N8L A;  1DY6 A;  4R3B A;  4U3T A;  4OOM A;  3PAG A;  3NI9 A;  3UY6 A;  1JWZ A;  1ONG A;  4KEN B;  4N9K A;  1JTD A;  3UPO A;  2Y2M A;  4PM9 A;  3IQA A;  1Q2P A;  3N4I A;  2P9V A;  1BT5 A;  1MKI A;  1XGI A;  4WZ4 A;  2RCX A;  2XDM A;  1YLY A;  3GMW A;  2V20 A;  3P09 A;  4DDY A;  5A90 A;  2FFY A;  2XFS A;  2Z2L B;  5A91 A;  2XEP A;  5HAR A;  1HD8 A;  5JYP A;  3HRE A;  4OVD A;  4X56 A;  1L0G A;  1HZO A;  4BL3 A;  1W79 A;  1L0F A;  1TVF A;  2EX9 A;  4PM7 A;  5GHZ A;  3VSL A;  1YMS A;  2A3U A;  2EX2 A;  1YLW A;  1KE0 A;  3C5A A;  3AGE A;  3E2K A;  3MKE A;  1XPB A;  4EUZ A;  2HPB A;  4LV2 A;  3GSG A;  4KZ8 A;  4CJN A;  1IKI A;  3G30 A;  1XXM A;  3OCL A;  4IVK A;  2Y2G A;  1I5Q A;  3BLM A;  4LCL A;  4OKP A;  5FAP A;  4OP5 A;  4WEL A;  3SS5 A;  1S6R A;  1SDE A;  2XQZ A;  4UA9 A;  4KG6 A;  3VOY A;  3PBR A;  5CER A;  2ZM8 A;  4B4Z A;  3VP1 A;  4X68 A;  5FQM A;  1I2S A;  2HP9 A;  1XP4 A;  3S1Y A;  2FFF B;  4GN2 A;  1W5D A;  5IHV A;  1XX2 A;  2ZQ8 A;  3S4X A;  5EVI D;  4KG5 A;  4OP8 A;  4RA7 A;  5FAQ A;  3TG9 A;  3ZG5 A;  5L2F A;  4KZB A;  3HLE A;  4B4X A;  1FCO A;  3CZD A;  2ZQ9 A;  1MWS A;  3WS5 A;  3TOI A;  1S0W A;  4MNR A;  1PI4 A;  1BLS A;  4XUX A;  5HAI A;  1DJB A;  1JWV A;  2WYX A;  5HAP A;  3DWK A;  3O86 A;  1RGZ A;  5DTK A;  1AXB A;  1QMF A;  1KE4 A;  4M3K A;  3BYD A;  5FQJ A;  1ES2 A;  4UHU A;  3V3S A;  2EXA A;  4YIN A;  3FKV A;  5EEC A;  5TGF A;  4S2N C;  4N92 A;  4KZ5 A;  2I72 A;  1H8Z A;  3RXW A;  4KG2 A;  4X55 A;  4BLM A;  3RJU A;  5EVI A;  3Q81 A;  1E4D A;  1JWP A;  4S2L A;  1JVJ A;  2WAE A;  3BFF A;  4P85 A;  4DXB A;  1BUE A;  1FSY A;  3WS0 A;  5FQK A;  2XFT A;  4HES A;  1KGG A;  5FQI A;  3GV9 A;  3G32 A;  3ZGA B;  4MBK A;  4OOL A;  2Y2K A;  1HVB A;  3QNB A;  3W8K A;  3ZDJ A;  2X01 A;  2JC7 A;  2H0T A;  4ZTK A;  1NZO A;  2J9P A;  1LLB A;  1NXY A;  3NY4 A;  1RCJ A;  2P74 A;  3N6I A;  3CJM A;  3PBS A;  4OH0 A;  4PM8 A;  1BZA A;  1W7F A;  2WK0 A;  4IBX A;  4P87 A;  2H5S A;  2WAD A;  4S2O A;  4O7D A;  4N1X A;  5CGX A;  1KGF A;  4S2M A;  3AGD A;  2WKI A;  4JKT A;  2ZD8 A;  5FDH A;  3GR2 A;  2XD1 A;  3Q7V A;  1K54 A;  1OME A;  2EX6 A;  4FD8 A;  3O3V A;  5J8X A;  4WZ5 A;  4PM6 A;  5CTN A;  4P0M A;  1BLP A;  5GHX A;  5TFQ A;  3NCK A;  4CPK A;  1RGY A;  2IWD A;  5F1G A;  3IF6 B;  1I2W A;  3G31 A;  5GLB A;  2R9X A;  2Y2L A;  3G4P A;  4WEJ A;  4E6X A;  5BOH A;  4UA6 A;  4GD8 A;  4HBT A;  1SCW A;  2VGK A;  2WUQ A;  4U0X A;  1SKF A;  2ZQD A;  1BUL A;  3IF6 C;  4UAA A;  5TR7 A;  1FQG A;  3VOZ A;  3IXB A;  4QHC A;  3ZHH A;  4EQI A;  2XLN A;  5M19 A;  2QMI A;  2WZZ A;  4EWF A;  3HLB A;  2Y4A A;  3M2K A;  1PIO A;  3IWO A;  4JXW A;  5AQB A;  3W4O A;  3HL9 A;  4ZJ1 A;  5U47 A;  3FWL A;  1VM1 A;  4F94 A;  3AGF A;  5GLA A;  1O07 A;  1LL5 A;  1YLZ A;  3VP4 A;  4OQI A;  3VFH A;  3WS2 A;  1O7E A;  4OQG A;  1GCE A;  2DNS A;  1ES5 A;  4JXV A;  4OLD A;  5FI6 A;  3S22 A;  1MBL A;  3IH8 A;  4FH4 A;  5D3O A;  1FOF A;  1IYO A;  4IED A;  2RL3 A;  4D2O A;  3C4P A;  4DDS A;  1NY0 A;  1ZG4 A;  4RX2 A;  4YFM A;  2GDN A;  4KQO A;  5HAQ A;  2PBY A;  3ZG8 B;  4H8R A;  5DTT A;  1FR6 A;  4OPY A;  4Z9Q A;  5CHJ A;  3MXR A;  4MEZ A;  3UPP A;  1CI8 A;  3BLS A;  1ERO A;  1NJ4 A;  4ZJ2 A;  4C75 A;  1U60 A;  5CEB A;  3VP2 A;  3GRJ A;  3HLF A;  3LCE A;  3VP0 A;  3HLG A;  4X53 A;  4BL2 A;  2WGI A;  1ES4 A;  3BFE A;  3C7V A;  3PBQ A;  4RX3 A;  3IHA A;  2P9V B;  3ZG9 B;  5AQ9 A;  2J9O A;  1PW1 A;  4N1H A;  5FQQ A;  2HDS A;  1GA0 A;  4Y7P A;  4EBN A;  2WGW A;  1GHM A;  2PU2 A;  3PTE A;  1SHV A;  3ZNT A;  4FCF A;  5DF8 A;  4ZBE A;  2HP6 A;  1G6A A;  4GDN A;  1K6S A;  1L2S A;  1YLJ A;  1BSG A;  1IEM A;  5FI7 A;  3IH9 A;  4QB8 A;  5KSH A;  4HEF A;  4BD0 A;  4KZ9 A;  2BLS A;  1LL9 A;  3IT9 A;  3UNW A;  1ZKJ A;  2EFX A;  3HUM A;  3G35 A;  3PBN A;  4LEN A;  4E3O A;  3G34 A;  3ZNY A;  1XA1 A;  1EWZ A;  4BQM A;  3IXG A;  3P98 A;  2XK1 A;  5JYO A;  4FSF A;  1DJA A;  2UWX A;  4WMC D;  1TEM A;  4OPR A;  1W8Y A;  4BJP A;  4E3N A;  3IWI A;  2J8Y A;  1K55 A;  1FSW A;  1GHP A;  4K91 A;  3UE3 A;  2ZC4 B;  4E3L A;  1M40 A;  4X69 A;  2WGV A;  3FKW A;  1ESU A;  3C4O A;  3UDI A;  1K57 A;  1IYP A;  3ZVT A;  2B5R A;  3NDG A;  4JXG A;  3V3R A;  3G2Z A;  4RYE A;  2DRW A;  4UA7 A;  1PWD A;  3W4Q A;  2EFU A;  2OLV A;  1QME A;  2ZM0 A;  3M6B A;  4OPZ A;  2R9W A;  4EBL A;  3SS3 A;  4Y0U A;  1N9B A;  4JF5 A;  3UPN A;  3WRZ A;  4E3M A;  3E2L A;  5FI2 A;  1CI9 A;  1LI9 A;  1ZC2 A;  3OPR A;  3D4F A;  1EI5 A;  4WMC A;  4PPR A;  1PWC A;  4DE0 A;  2Y2H A;  2ZQA A;  1ERQ A;  1K56 D;  1IYQ A;  3M2J A;  4QJG A;  5EOE A;  5KZH A;  1FR1 A;  1H8Y A;  1WE4 A;  3IWQ A;  4EBP A;  1K38 A;  3DWZ A;  2QZ6 A;  5EVI B;  3UO9 A;  3EQU A;  5HW3 A;  5AQA A;  4JXS A;  3ZG7 B;  3BM6 A;  4GZB A;  5EVI C;  1JTG A;  1PYY A;  5G18 A;  1KDW A;  3Q7Z A;  1WYB A;  2Y2N A;  5A93 A;  5HL1 A;  5EOO A;  4IBR A;  1YMX A;  2OSU A;  2X71 A;  1PZP A;  3NBL A;  4OPQ A;  4E3J A;  4GB7 A;  4DKI A;  2Q9M A;  2WKH A;  3OCN A;  4KZ6 A;  1K56 A;  2EXB A;  2H10 A;  2EX8 A;  3IXD A;  3IF6 A;  3Q7V B;  1MXO A;  5CXW A;  4S2J A;  3MZD A;  1FCM A;  4XXR A;  3OPL A;  1K4E A;  2IWC A;  2Y2J A;  1IEL A;  3BRM A;  3HLC A;  1M6K A;  3QHY A;  1K54 C;  2JE5 A;  4NK3 A;  4LCM A;  4WZ5 C;  4ZDX A;  3G2Y A;  1XKZ A;  3UN7 A;  3N8R A;  3C7U A;  1NYY A;  2WZX A;  3EQV A;  2XH9 A;  4KQR A;  4U0T A;  4X6T A;  1ZG6 A;  3HBR A;  5HX9 A;  5DF7 A;  1RP5 A;  5FAT A;  4MBH A;  4XUZ A;  5E2F A;  1C3B A;  4DRT A;  1DJC A;  2C6W B;  5KMW A;  5EE8 A;  5CGW A;  1NRF A;  2V1Z A;  5CHM A;  3OZH A;  3CG5 A;  1ERM A;  4LV1 A;  3A3J A;  1MWR A;  2G2W A;  4DE3 A;  4GKU A;  4WEK A;  5DVA A;  1ES3 A;  4KZ7 A;  1Y54 A;  2WAF A;  4JPM A;  5CGS A;  4JLF A;  4E6W A;  3IF5 A;  4NET A;  1KE3 A;  4E3I A;  1K6R A;  4GNU A;  2JBF A;  3TSG A;  1IKG A;  3SH9 A;  3Q1F A;  1KVM A;  4JBF A;  2ZQ7 A;  4LV3 A;  3VFF A;  3BFD A;  4R23 A;  1BTL A;  2ZJ9 A;  4S2K A;  3ITB A;  1TDG A;  4QY6 A;  4L0L A;  3LO7 A;  4R3J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...