1PZPA

Tem-1 beta-lactamase in complex with a novel, core-disrupting, allosteric inhibitor
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
263
structure length
263
Chain Sequence
HPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQRDLVEYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Allosteric inhibition through core disruption.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords Beta-lactamase TEM
total genus 93
structure length 263
sequence length 263
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2003-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1pzpA00
1NXYA 1ES3A 2Z2MB 1LLBA 4P6BA 3A3DA 3WRZA 4R4RA 4DE3A 5FAPA 4F94A 3HLDA 3MZEA 4S2NC 5FAQA 3C4OA 2ZQ9A 2Y59A 4ZJ3A 1KE0A 4Z9QA 1LL5A 1RCJA 4JKTA 5DF7A 3N6IA 1ONGA 2H5SA 4WEKA 3V3SA 1E4DA 2EX2A 4JPMA 2IWBA 3BFGA 4WBGA 2H0YA 4KZAA 3GQZA 2V1ZA 1IKIA 2A3UA 1MBLA 4D2OA 2J8YA 1BLCA 2Y2KA 3GR2A 5A92A 4HBUA 2X02A 5DTKA 4O7DA 1L0GA 3ZNYA 4KZ7A 1IEMA 5FQMA 1HD8A 1MWTA 3VP4A 2JC7A 3BLSA 4H8RA 3SH7A 5CHJA 1KVMA 4X69A 4KZ4A 4MEZA 1PZPA 4OOMA 4X55A 3UDFA 3WWXA 3MZFA 3MKFA 4E6XA 4KQQA 2PBYA 1SKFA 3BRMA 3OCNA 2ZC7A 3VP1A 3HLGA 3P09A 5KMWA 1K4FA 3IXHA 4X6TA 5GLAA 3V39A 2B5RA 1FCNA 2HP5A 2A49A 1QMEA 3PAEA 2V2FF 4WZ5C 5AQ7A 5KZHA 1PW1A 4P87A 5GLCA 4MBFA 4S2IA 1EWZA 3IF6A 4RX3A 5CHUA 5HARA 3IXBA 5D3OA 1ZKJA 5HAIA 3NI9A 3BEBA 1E3UD 3A3JA 2WUQA 4XUZA 1JVJA 1N9BA 3N7WA 3W4OA 2ZC3B 4QY5A 4KG2A 1NYMA 2XLNA 1ES2A 1BUEA 2QPNA 4S2LA 5FATA 4OQ0A 4E3LA 2ZM8A 1BLPA 1K56D 3PBTA 3UE1A 1CEFA 4WEJA 5AQAA 1L0FA 2EFXA 4OOLA 4KQOA 3BFFA 3PTEA 1JWVA 1YLWA 4XUXA 2ZC4B 4S2NA 1FCMA 3CJMA 1YLTA 1JWPA 1NZUA 4YINA 1Y54A 5FI6A 4EUZA 4MBKA 4EWFA 1ESIA 4ZJ2A 3ZG5A 3W4QA 1L0EA 1L2SA 4M3KA 4ID4A 4N9KA 4IBRA 3BFCA 3ISGA 3HUOA 4JXVA 2H10A 3LY3A 3FKVA 4WYYA 5EOOA 4DDSA 1GHPA 3ZGAB 1NY0A 3OPLA 4FCFA 3RXWA 4B4ZA 3SS4A 4K91A 2Y2GA 1CEGA 4JF4A 1XGJA 4IEDA 1G6AA 3G32A 3ZHHA 4IVKA 3ZVWA 3IWIA 5HX9A 3EQUA 2ZC5B 3IT9A 4KG6A 4DXCA 1C3BA 4DF6A 1KDWA 3IH9A 3SH8A 3TOIA 3UE0A 2ZM0A 5E2EA 5E43A 2XFTA 3G4PA 2JCHA 4N1HA 5TR7A 3CG5A 3QNCA 3LCEA 2HPBA 2WGWA 2Z2LB 1K38A 2OLUA 3BM6A 3IXGA 5FQ9A 1OMEA 4MNRA 1DJAA 3Q7ZA 1PI4A 2XDMA 1KGFA 4PM8A 1O7EA 1M6KA 4Y0UA 1H5XA 5M19A 4GD8A 4A5RA 1SCWA 5EECA 2WYXA 4GB7A 5BOHA 4GNUA 5KSHA 1TDGA 3P98A 1W79A 1K54A 4BJPA 3DWKA 1K6RA 3GRJA 3FWLA 2P9VA 2H0TA 1ALQA 2WGIA 1SDNA 2XD5A 5U47A 5L2FA 2WZZA 4N92A 3V50A 1K57A 2OV5A 4LV0A 3UDIA 1I5QA 2Y2JA 2ZQDA 2G2UA 4MLLA 2ZMAA 2GDNA 1ESUA 2EFUA 2XH9A 4UA6A 3HUMA 3UNWA 4KZ6A 4GZBA 4QB8A 3LEZA 4RVAA 4IBXA 3LO7A 5FSRA 3HBRA 3ZNTA 4OKPA 3GSGA 3UPOA 3WS2A 5GHYA 4KZ5A 3BFDA 4KQRA 2XK1A 4EBPA 4GDBA 2EXAA 3UPPA 3O86A 3OC2A 4U0XA 1I2SA 1PWCA 1YLPA 2WAEA 2UWXA 5FQJA 5CGXA 4HESA 2Y2IA 5CGSA 1Z6FA 2P74A 2Q9MA 1JTDA 2BG1A 4QY6A 3FKWA 4R4SA 4U3TA 4X68A 4EQIA 1K55C 5EVIA 3B3XA 5I94A 1TVFA 3AGDA 2PU2A 4DE1A 1TEMA 1GHMA 4GN2A 4L0LA 3BYDA 2FFFB 1FOFA 3NDGA 1GA9A 3NIAA 4Y7PA 5DVAA 4OQHA 4ZJ1A 1YLZA 3N8RA 4X53A 2HDSA 1ONHA 1RGZA 3ITBA 4BLMA 4OP5A 3MXRA 1YMXA 3TG9A 5GHXA 4WMCA 2C6WB 4BD0A 3G30A 5AQ9A 2XQZA 3OPPA 1NYYA 1IYSA 4WMCD 3WS5A 5HAPA 1SDEA 1MWUA 1FSWA 4LV3A 2WGVA 4JLFA 3E2LA 4KZBA 3Q7VA 3ZFZA 3ZG7B 1S0WA 2WKIA 3FZCA 3PBNA 3DW0A 2Y2HA 4HBTA 2DRWA 3IWOA 1VQQA 2HDRA 4JF6A 3VSKA 1CI8A 5DF9A 3VOYA 5F82A 1XXMA 3UDXA 4QJGA 1BTLA 2HP9A 5HFOA 4S2MA 2ZD8A 4WZ5A 4UHUA 4GOGA 4FH2A 2Y2LA 4KZ9A 2P9VB 5EUAA 5KSCA 1ES4A 1HTZA 1NRFA 4OONA 4DRTA 4KENB 5CERA 3W8KA 2HP6A 2I72A 3G2YA 2Y2NA 5FA7A 4DE2A 4PM5A 3HLCA 5HW3A 3WS1A 4Y0OA 5JYOA 3VSLA 2WADA 1YLYA 3Q07A 1PIOA 1MWRA 5CGWA 1IKGA 3SS3A 1W8YA 4EBLA 1W5DA 2WKEA 2ZQAA 5IHVA 5CTNA 1KE3A 3NBLA 1S6RA 3DWZA 1K55A 5EVIC 4S2PA 3W4PA 1K6SA 2QZ6A 4RYEA 4Y0TA 5GL9A 3BECA 2Y91A 3HL9A 4S2OA 1WYBA 2OLVA 1FR1A 2WZXA 4E3OA 3HVFA 5GLDA 5DTTA 4WZ4A 5A91A 1LI0A 3WRTA 4Q8IA 1W7FA 4CPKA 4OPYA 5EVID 3JYIA 3GMWA 4X56A 1E25A 1K56A 4PMAA 3A3EA 4E3NA 1DJBA 3IF5A 1NZOA 2DNSA 4OLGA 1I2WA 4BL2A 5JYPA 4C75A 4E6WA 4PM7A 4WM9A 3D4FA 4E3MA 1PWGA 1KDSA 2Y2OA 3VFHA 1N4OA 5TFQA 5A90A 1NJ4A 4LCMA 4S2KA 3MZDA 3SOIA 3ZDJA 4JF5A 1HZOA 3ZG0A 1JWZA 2RL3A 3G2ZA 1Q2PA 3IWQA 5FASA 1BLHA 3O87A 5FDHA 5M1AA 3VP3A 4DE0A 2HDUA 1ZG4A 3QHYA 4QHCA 3Q7VB 3MKEA 4UAAA 1J9MA 4R3BA 4KZ3A 1MWSA 3O3VA 3G34A 5FQIA 3PBQA 3QNBA 4LV2A 2Y2PA 1KVLA 4OQGA 2BLSA 3C7UA 4JBFA 3M6BA 3RXXA 5FI7A 3TSGA 2J9OA 4R3JA 5J8XA 4K0XA 2J7VA 1AXBA 4P0MA 1MPLA 3IQAA 3M6HA 1PYYA 4ZDXA 4OOYA 2WGWB 1RP5A 5FAOA 3WS0A 5DTSA 3NCKA 1MKIA 2X01A 2E8IA 1XGIA 3C4PA 3PBSA 5CEBA 2XEPA 2XD1A 3S4XA 4JXWA 2DCFA 1W8QA 3N8LA 3A3FA 1SHVA 2Y2QA 3Q1FA 4NK3A 3AGEA 2WKHA 4C6YA 3ZCZA 3IHBA 1QMFA 4UA7A 5CECA 3I7JA 3ITAA 4OQIA 3BFEA 1MY8A 2IWCA 1BLSA 2R9WA 2RCXA 4NETA 3OPHA 3OPRA 1K57C 3SH9A 5EVIB 2R9XA 3PBRA 3M2JA 2J9PA 4LV1A 4YFMA 4C3QA 4OP8A 4CJNA 1LHYA 1ZG6A 3HLFA 3A3IA 5HL1A 3MXSA 1PZOA 1BSGA 5M18A 2G2WA 3IHAA 1YQSA 3EQVA 1GA0A 1HVBA 1ERQA 2Y55A 3NC8A 4RX2A 1ES5A 3S22A 1G68A 1U60A 3OZHA 4LCLA 3GVBA 1FQGA 4B4XA 4R1GA 2ZJ9A 5CHMA 2VGJA 4FH4A 2PU4A 3VP2A 3IXDA 1IELA 4IVIA 1WE4A 3IF6C 2ZM2A 4KG5A 2ZLYA 3Q81A 4QU3A 3GTCA 3WS4A 1IYOA 2ZQCA 3FV7A 4U0TA 3UN7A 1YMSA 3G35A 3UY6A 3V5MA 1YM1A 5FQQA 4E3IA 3UPNA 3PAGA 1H8ZA 4ZAMA 2QMIA 2EX8A 1L0DA 4GD6A 2EXBA 3HLEA 2WAFA 3Q82A 1Q2QA 4KZ8A 5GLBA 3ZG8B 4BENA 2WK0A 4BD1A 3N4IA 4WELA 3G31A 3GV9A 2OSUA 5G18A 1EI5A 3IF6B 4DDYA 1VM1A 1YLJA 2ZQ7A 3VP0A 1JTGA 1XX2A 1GHIA 1XA1A 2CC1A 3O88A 4R23A 4UA9A 1FR6A 5F1FA 1TDLA 1CI9A 4GDNA 5EOEA 3N8SA 5EPHA 2XGNA 3NY4A 4XXRA 4PPRA 1KGEA 2X71A 3VOZA 4EBNA 1PI5A 1XPBA 4EV4A 2JBFA 1BZAA 2JE5A 3V3RA 3E2KA 4PM9A 1PWDA 1PW8A 3HLWA 4OPQA 5CRFA 3HREA 5A93A 4ZTKA 5AQBA 5EE8A 5F83A 4B88A 5FQKA 3UE3A 1ERMA 4JXGA 4HEFA 5GHZA 1K4EA 3C7VA 1EROA 2XFSA 4BQMA 4P85A 3AGFA 2Y2MA 5HAQA 1FSYA 1MXOA 1YT4A 4FD8A 1WYCA 4QD4A 4DXBA 4OLDA 4MBHA 4BL3A 1FCOA 3DTMA 3NDEA 4GKUA 3MBZA 3IH8A 4N9LA 3BLMA 3HLBA 3PBOA 2C5WB 5F1GA 2Y4AA 5TGFA 3CMZA 3M2KA 2ZQ8A 3MFDA 1GCEA 4ZBEA 1CK3A 4DKIA 3HUNA 4E3JA 1ZC2A 5CXWA 1IYQA 1K25A 4N1XA 5E2GA 3ZVTA 1XKZA 2VGKA 5E2HA 2IWDA 2XF3A 1M40A 4K0WA 1BT5A 1LL9A 3VFFA 1K54C 4FSFA 1E3UA 2XR0A 2V20A 2EX9A 4OPRA 1LI9A 3RJUA 4E3KA 3ZG9B 2EX6A 3FYZA 5EVLA 3SS5A 1RGYA 3LY4A 3OCLA 3UO9A 4JXSA 5CEDA 3VMAA 4OH0A 4RA7A 2FFYA 1KE4A 4PM6A 3S1YA 4OVDA 1XP4A 2Q9NA 3CZDA 1DJCA 1BULA 1DY6A 1KGGA 2HDQA 4LENA 4OPZA 5DF8A 4R0QA 5CTMA 1XA7A 4S2JA 5E2FA 2ZC6B 1O07A 3C5AA 1IYPA 5FI2A 1H8YA
chains in the Genus database with same CATH superfamily
4R4RA 4R38A 4NG2A 2M7VA 4ZJ3A 4Z9QA 1LL5A 1RCJA 3N6IA 2D02A 3V3SA 1OTIA 2EX2A 1T1AA 4O01A 2V8FA 5HDDA 2H0YA 3GQZA 4XT2B 2J8YA 3NJAA 5A92A 1L0GA 2Q0OA 5FQMA 2V8CA 3BLSA 3KSIA 4KZ4A 4MEZA 1PZPA 4HOIA 2V1BA 4KQQA 2OOLA 3OCNA 2ZC7A 1OJ5A 2W3EA 3V39A 2B5RA 2OWJA 1QMEA 3PAEA 1DRMA 4KQDA 1Y28A 5D3OA 4LLOB 3R7WB 4LRXC 2JKTI 2L0WA 1JVJA 3W4OA 3N7WA 2ZC3B 4KG2A 5FATA 2ZM8A 1K56D 2QYBA 5HWVA 2EFXA 4JGQA 3PTEA 1JWVA 4XUXA 4CLCE 4IJGA 1Y54A 4EWFA 1L2SA 4M3KA 5DKKA 4DMZA 1VETA 3ZYTA 4LRZE 1GHPA 3OPLA 4FCFA 4B4ZA 1XFQA 3SS4A 2HF6A 1XGJA 2IA2A 4XT2A 3K3CA 4GS9B 3EQUA 1C3BA 3SH8A 1FIKA 2ZM0A 2XFTA 3G4PA 2JCHA 3SW1A 4G3WA 3DAVA 3DBAA 1PI4A 3KSHA 3CAXA 3B42A 4GD8A 5BOHA 4GNUA 1OTEA 1W79A 1N9LA 3A0VA 1K6RA 2Y79A 2EWWA 5HSQA 2JKFA 2WZZA 2Y2JA 2G2UA 5F5YA 2ZMAA 2GDNA 5DJUA 4KZ6A 4NXGA 2W1TA 3H7WA 4IBXA 3HBRA 4OKPA 3KX0X 5GHYA 3BFDA 4EBPA 2EXAA 3UPPA 2XA7M 4U0XA 1I2SA 2UWXA 1EW0A 1Z6FA 1JTDA 4X68A 1SKOA 2P04A 1K55C 3LIAA 3MJQA 5I94A 1TS6A 2PU2A 4DE1A 4GN2A 1GHMA 4L0LA 3BYDA 3BW6A 4G3VA 4Y7PA 4OQHA 1YLZA 3N8RA 1ONHA 4BWIA 4BD0A 4WLAA 3OPPA 1IYSA 2GZAA 3UB6A 3E2LA 2GNXA 2Z6CA 1NRJA 3UMEA 4EXOA 3UE6A 2WKIA 3DW0A 2P08A 4Z1WA 2PBDP 5F82A 1XXMA 1MZUA 2ZD8A 3PXPA 1ZHHB 2Y2LA 4JGOA 2O99A 4DRTA 4KENB 3IX4A 1LSWA 4DE2A 3HLCA 3WS1A 3Q07A 1PIOA 4Q0JA 5CGWA 4BBUA 3C8CA 3OOVA 2ZQAA 1STZA 3W4PA 3HL9A 2OLVA 1N9NA 3HVFA 5GLDA 5A91A 1LI0A 3WRTA 4Q8IA 1W7FA 3T4OA 4CPKA 1IOUA 4OPYA 3GMWA 1E25A 3A3EA 4Y13A 2DNSA 4BL2A 5JYPA 3MXQA 4E3MA 3S7QA 2Y2OA 4RQ9A 5A90A 1NJ4A 1KOUA 3SOIA 4S2KA 3T4LA 5G4ZA 3ZG0A 3RTYA 5HWTA 5FASA 1CJFA 1P97A 3MKEA 3LR5A 4R3BA 1MWSA 3O3VA 3PBQA 2VGLM 4JBFA 4DJ3A 4AFIA 3M6BA 3M6HA 2HZ5A 4ZDXA 2WGWB 3S7OA 4UQIS 2X01A 1XGIA 3PBSA 4YWZA 2XEPA 3SZTA 2DCFA 3Q1FA 4C6YA 3ZCZA 1QMFA 5CECA 3ITAA 4GW9A 2R9WA 2RCXA 3SH9A 2R9XA 3PBRA 1VB6A 1OT9A 4YOFA 3H82A 5HL1A 3MXSA 1LT0A 5TBMB 2P7JA 4MN7A 2PT7A 1YQSA 2PDRA 4RX2A 1YSPA 3H82B 3DTKA 3IXDA 4IVIA 4WN5A 1S1ZA 2JHEA 3B33A 4P6ZM 3GTCA 1TD5A 5L10A 2D01A 5EVEA 1YMSA 1YM1A 4E3IA 4ZAMA 3Q82A 2WAFA 4KZ8A 4BD1A 3G31A 3QP8A 2OSUA 5G18A 1EI5A 4DDYA 2YKFA 1VM1A 2ZMFA 1JTGA 3T4QA 2PYRA 3F1OB 4R23A 3W2ZA 4XXRA 2X71A 4ETZA 1XPBA 3T4SA 4EV4A 2JE5A 4M4XA 4PM9A 1PW8A 2Z6DA 5F83A 4B88A 3UE3A 1ERMA 4JXGA 1K4EA 5J4EA 1EROA 4BQMA 5HAQA 1FSYA 4QD4A 3T4KA 4DXBA 2BASA 1BYWA 5HPFA 1UWPX 4HJ4A 3MQOA 4N9LA 5F1GA 5TGFA 3BLMA 2C5WB 3PBOA 2Y4AA 4L9GA 4D60A 3NULA 3HCYA 2JKGA 4HH2A 5E2GA 2JKRM 1BT5A 1LL9A 3VFFA 1K54C 4NXFA 2R78A 3FYZA 3SS5A 4JGRA 2J3TC 3VMAA 4RA7A 4PM6A 4OVDA 4LENA 4Y17A 1DJCA 1BULA 1XJ4A 5E2FA 3VOLA 2KX6A 3E0YA 3C5AA 3MMHA 1H0MA 2Z2MB 3IX3A 1LLBA 3A3DA 1T18A 4HP4A 3MZEA 4S2NC 3C4OA 5DF7A 1ONGA 3T12B 1E4DA 2IWBA 3C38A 3K2NA 4WBGA 3EWKA 5G4YA 1G28A 1MBLA 4D2OA 2Y2KA 1BLCA 4L9FA 2X02A 4KZ7A 5AVEA 2JC7A 4H8RA 5MC7A 1GSXA 2J3TD 4OOMA 2V9AA 3BRMA 3VP1A 1K4FA 3FG8A 2W3FA 5L09A 4Y15A 2HP5A 3V67A 1T1CA 2V2FF 5AQ7A 4KUOA 4LFUA 4P87A 4MBFA 4S2IA 4RX3A 5HARA 1ZKJA 3A0RA 3NI9A 1E3UD 2WUQA 3E98A 4OQ0A 4E3LA 1BLPA 3UE1A 3F1NB 4KQOA 2ZC4B 3CJMA 4ARZB 1JWPA 2E8JA 4EEPA 3W4QA 1L0EA 3VE3A 4N9KA 2VZWA 4JXVA 4MDZA 2H10A 3LY3A 2FH5A 3ZGAB 4PKYG 3RXWA 1OTDA 2Y2GA 3QP2A 1S4RA 4O0PA 3ZHHA 4IVKA 3ZVWA 3IWIA 1J3WA 2ZC5B 4KG6A 4DXCA 2V0UA 5E2EA 2ZBBA 5E43A 3LCEA 1UWNX 3BM6A 2VJWA 1OMEA 5AJGA 4KUKA 5M19A 1OTAA 1M6KA 1H5XA 4A5RA 2WYXA 4GB7A 3QP1A 2ZMVA 5KSHA 4YNRA 3P98A 2W0NA 1K54A 4LPZA 3PHYA 1ALQA 2WGIA 5U47A 4I3IA 2QJ7A 5LBRA 2OV5A 4LV0A 3UDIA 1I5QA 2ZQDA 3CLOA 4MLLA 2XH9A 4F3LA 1OJGA 4RVAA 4QB8A 3BJNA 3H9WA 3WS2A 2HJEA 4EESA 3O5YA 4GDBA 1NLZA 3OC2A 1YLPA 1PWCA 4HESA 2K2NA 2Y2IA 4U3TA 4R4SA 3FKWA 2L4RA 3FPWA 5EVIA 3B3XA 2VV7A 2FFFB 3NIAA 3CHWP 2A24A 5DVAA 4ZJ1A 2QHKA 1RGZA 3ITBA 4BLMA 4OP5A 3MXRA 2L1MA 3G30A 2XQZA 3WS5A 1FSWA 4JLFA 3Q7VA 1S0WA 3FZCA 2Y2HA 4HBTA 1VQQA 4R6LA 5IS1A 2HDRA 3UB5P 2PD7A 2QKPA 2CMNA 3RFBA 3UDXA 1BTLA 3EGDC 4FH2A 5EUAA 1PNEA 1NRFA 4GCZA 4EQ1A 3W8KA 4BMWA 2I72A 3T4JA 4Y0OA 5JYOA 2WADA 4GHIA 3LIFA 1W5DA 3NBLA 4MCWA 1K55A 4Y0TA 4S2PA 4RYEA 5GL9A 2XSSA 2Y91A 1TF1A 4S2OA 1FR1A 2QWSA 2WZXA 1P9RA 5EVID 4H6JB 3G6OA 3LFVA 4E3NA 3KSFA 1I2WA 3JPUA 4E6WA 2MJ6A 4PM7A 1PWGA 3LIEA 1T1BA 5EV0A 4LCMA 1OT6A 4JF5A 3G2ZA 2XROA 3IWQA 4Q0HA 5FDHA 3VP3A 4DE0A 2HDUA 1J9MA 4KZ3A 1S67L 3QNBA 4NXEA 1KVLA 4OQGA 2M7UA 3TSGA 4R3JA 1DP9A 4K0XA 3KYEA 5J8XA 1MPLA 4UQIM 4ESPA 4EETB 4IUKA 3MSHA 2XD1A 3S4XA 5FEFA 3A3FA 2Y2QA 4ZRRA 4OQIA 5J7EA 5EVIB 3E4OA 4YFMA 3HLFA 3A3IA 3U4LP 4ARZA 1T19A 4EU0A 1G68A 2O9BA 2AVXA 3BQ8A 3VP2A 1WE4A 2INWA 3F1OA 3IF6C 5L8MA 2ZLYA 4QU3A 3WS4A 3PR6A 1IYOA 3UN7A 2QJ5A 3UY6A 3V5MA 3A0SA 3UPNA 3PAGA 2QMIA 1L0DA 3ZG8B 3HLEA 1Q2QA 1HLUP 3MQQA 3F1PA 4I39A 1IFQA 1W63Q 1YLJA 4P6ZS 1GHIA 4MN5A 2CC1A 4UA9A 1FR6A 3K3DA 5IT5A 1TDLA 4R70A 2XGNA 3NY4A 1KGEA 3T4TA 3BY9A 3VOZA 4EBNA 3V3RA 4Y5FA 5DFYA 3E2KA 1PWDA 4ZTKA 5AQBA 2WKQA 1F98A 2EWVA 5HWWA 4P85A 1MXOA 5TJJA 4NKPA 4MBHA 4BL3A 1FCOA 4HHDA 3NDEA 4GKUA 3MBZA 3MFXA 3HLBA 3CUEA 3CMZA 1CK3A 4E3JA 5FEGA 5CXWA 1K25A 4N1XA 2G7UA 1V9YA 3KYZA 2XF3A 1UGUA 2ZOHA 4K0WA 4PAUA 2XR0A 2EX9A 3RJUA 4E3KA 4CLCB 1F9IA 2WKPA 5EVLA 1RGYA 3LY4A 3OCLA 1W63M 3T1QB 4OH0A 3TJZC 2Q9NA 1KGGA 4OPZA 3OBFA 1P0ZA 4R3AA 5CTMA 2HV1A 1O07A 1IYPA 4EUZA 1NXYA 3LI9A 4EERA 2FZ0A 4DE3A 1PRQA 5FAPA 4FUWA 5FAQA 5DKLA 2GJ3A 1KE0A 4II7A 4WEKA 3BFGA 4MN6A 4KZAA 3ULFA 1AWIA 3GR2A 3IS2B 3ZNYA 1S1YA 1HD8A 1MWTA 3VP4A 4HP9A 2B95A 1KVMA 4X69A 4X55A 2VLGA 3UDFA 1PFLA 3MZFA 3MKFA 5HL6A 1SKFA 4HI4A 5KMWA 3HLGA 4X6TA 5GLAA 2Y8HA 2JN7A 1GSVA 3E4PA 4FTXA 4WZ5C 5KZHA 1PW1A 3CPTB 1EWZA 3IF6A 3MR0A 5CHUA 3IXBA 1S66L 2O9CA 2OAP1 4Y3IA 4XUZA 1N9BA 1ES2A 3MQ0A 2QPNA 4S2LA 3PBTA 1CEFA 4WEJA 5AQAA 4B9OA 2WKRA 3BFFA 4S2NA 1FCMA 1XJ2A 5FI6A 1XFNA 4ZJ2A 4IBRA 3R7WA 4HQAA 3FKVA 4WYYA 5EOOA 4DJ2A 4H6JA 5IU1A 4K91A 4BBVA 4JF4A 4IEDA 5DJTA 3KYQA 3FPVA 5F6AA 1ODVA 5F69A 4DF6A 1KDWA 3UE0A 3P7NA 1VEUB 4N1HA 1TS7A 2HPBA 3IXGA 1K38A 2W1TB 3H7WB 4MNRA 4Y0UA 1KGFA 1VHMA 4PM8A 5EECA 1X0OA 3HJIA 1TDGA 3FWLA 2H0TA 1K0KA 4QPRA 1SDNA 2XD5A 4ETXA 5L2FA 4N92A 2W1RA 3V50A 1K57A 2BTFP 1ESUA 4E04A 3UNWA 1LSVA 3ZNTA 3UPOA 3GSGA 5I5LA 4KQRA 2XK1A 3UB8A 5FQJA 3TRCA 2Q9MA 2BG1A 4QY6A 3LEQA 2H28A 2J80A 3MS6A 4FOFA 3LYXA 1TVFA 1TEMA 1FOFA 2B18A 1GA9A 3NDGA 3NOPC 1D1JA 3IX8A 3TG9A 5GHXA 4WMCA 2VEAA 5EM1A 5AQ9A 4B93A 2OAQ1 5FL3A 1NYYA 2DMWA 3S7NA 5HAPA 1SDEA 1MWUA 3ZFZA 3ZG7B 3NOTC 2VV8A 3IWOA 4JF6A 2VK3A 4NEED 5DF9A 4QJGA 2OWHA 4S2MA 4WZ5A 4UHUA 3L7HA 3QP5A 4KZ9A 5KSCA 1ES4A 1HTZA 5HD5A 1YSQA 2HP6A 3G2YA 2PRFA 5FA7A 3VSLA 1ACFA 2PR5A 1YLYA 1MWRA 1IKGA 3SS3A 4EBLA 5IHVA 3BWLA 5CTNA 1S6RA 5EVIC 2I9VA 1K6SA 2QZ6A 3LR3A 3BECA 1WYBA 5HDCA 4GHIB 4GS9A 1YKDA 4E3OA 5KIZA 3UB9A 3JYIA 4X56A 4PMAA 1DJBA 3IF5A 4OLGA 4GJ4A 5F68A 1G6OA 3D4FA 4WM9A 3VFHA 1N4OA 2W27A 3MZDA 3ZDJA 3UMDA 1BLHA 3O87A 5M1AA 1ZG4A 3QHYA 4QHCA 3Q7VB 4UAAA 2YKHA 3G34A 4LV2A 3KO6A 2BLSA 3C7UA 3RXXA 2V0WA 3FC7A 2J7VA 4P0MA 2JKTM 1PYYA 1RP5A 1SZVA 2ZL1B 5DTSA 1MKIA 2E8IA 1SKOB 3C4PA 2PYPA 3N8LA 1W8QA 4NK3A 3LR4A 2UV0E 3AGEA 3LUQA 4UA7A 2W3HA 3I7JA 1H8MA 1MY8A 3OPHA 1ZTUA 3OPRA 1K57C 3M2JA 3R4KA 4OP8A 1LHYA 1ZG6A 3D72A 4HNBA 2O0YA 1BSGA 3S7PA 4MMNA 3MF0A 3IHAA 2ZOIA 1GA0A 3RH8B 2LB9A 3S22A 1ES5A 1U60A 4LCLA 4R1GA 2ZJ9A 2VGJA 1XJ3A 2PU4A 4WUJA 5HD3A 4KG5A 3P01A 5FQQA 1P9WA 2EXBA 3TE8A 4BENA 3NECA 2NUPC 4I3AA 2ZQ7A 4PKYA 1H3QA 3O88A 3QP6A 5AVFA 1VEUA 5EPHA 5EOEA 3N8SA 4I5SA 4PPRA 1WA9A 1BZAA 4JGPA 3EEHA 3HLWA 3HREA 5A93A 5EE8A 3AGFA 3C2WA 4EEUA 1WYCA 4UEYA 4OLDA 3IH8A 2ZQ8A 3MFDA 4ZBEA 4DKIA 1ZC2A 3ZVTA 2VGKA 2PD8A 3CPTA 2VGLS 1M40A 4FSFA 4Q0IA 4HJ6A 1E3UA 5HZHA 2V20A 1YAXA 3TW8A 1LI9A 1D7EA 1KE4A 1YPRA 5DF8A 1XA7A 4S2JA 2ZC6B 3PYPA 1CI8A 1ES3A 4P6BA 3WRZA 4F94A 3HLDA 4LGWA 2HGVA 3U2AA 2ZQ9A 2Y59A 4JKTA 4O8GA 2H5SA 4I38A 4JPMA 4PHTA 1DP6A 2V1ZA 1IKIA 5HPIA 2A3UA 4HBUA 5DTKA 4O7DA 1IEMA 3SH7A 4GLQA 1Z09A 5CHJA 3WWXA 3LR0A 3T1SA 4E6XA 2PBYA 3P09A 3IXHA 1FCNA 2A49A 3D3OA 5GLCA 3NHQA 4I3JA 5HAIA 3BEBA 3A3JA 1Y4OA 3UB7A 4K08A 4QY5A 3ZQ5A 1NYMA 2XLNA 1BUEA 1F5MA 1D06A 1L0FA 4OOLA 1S4SA 2PR6A 1YLWA 4YINA 1YLTA 1NZUA 4MBKA 1ESIA 2XRNA 3ZG5A 4ID4A 3BFCA 3ISGA 3HUOA 4Y2FA 4DDSA 1DP8A 1NY0A 1LL8A 1CEGA 3NOUC 1G6AA 3G32A 5FDSA 3T1XA 5HX9A 4HH3A 3IT9A 3IH9A 3TOIA 5TR7A 3CG5A 3QNCA 2WGWA 2Z2LB 2OLUA 5FQ9A 3KSGA 3VV4A 1DJAA 3Q7ZA 2XDMA 1O7EA 1L3LA 4CLCA 5EFWA 1SCWA 3IBJA 4L9EA 4EUVA 4BJPA 3DWKA 3GRJA 2P9VA 2VX8A 4HY8A 3LIDA 5EM0A 2EFUA 4WL9A 4UA6A 3HUMA 1XJ6A 4GZBA 3LEZA 2W3GA 3LO7A 5FSRA 4KZ5A 1F2KA 3O86A 3T1RA 4HJ3A 2WAEA 5L07A 5CGXA 5CGSA 2P74A 4EQIA 2GX5A 4DN0A 2ZL1A 3AGDA 4BBTA 3CWFA 4X53A 3E4QA 1OTBA 1VETB 2HDSA 1OPXA 1YMXA 4LRYC 2V1AA 2C6WB 1A0KA 4WMCD 4LV3A 2WGVA 2XA7S 4KZBA 3PBNA 5C5KA 2DRWA 4NXBA 3VSKA 3VOYA 2KOIA 5J3WA 2JKRI 2HJ9C 2HP9A 5HFOA 1CQAA 3F1NA 3JVVA 4GOGA 1GSWA 2P9VB 5A8BA 4OONA 3F1PB 4ME4A 5CERA 3EGXC 2Y2NA 4PM5A 5HW3A 3EEAA 3T50A 1W8YA 2WKEA 1KE3A 3B47A 3DWZA 3C30A 3IS2A 2NUTC 3LICA 4X25A 2KDKA 5DTTA 4WZ4A 2M1CA 3OLOA 4CLCD 5TBMA 1K56A 1NZOA 4C75A 1JNUA 1KDSA 5TFQA 2VV6A 1HZOA 1JWZA 2RL3A 2W3DA 1Q2PA 3HJKA 2VKSA 2ACGA 1CF0A 5FQIA 2Y2PA 2VA0A 3BY8A 2J3WA 5FI7A 4IHQA 2J9OA 1AXBA 2PHYA 3IQAA 3GDIA 1N9OA 3LGOA 4OOYA 5FAOA 3WS0A 1TS0A 3NCKA 3CI6A 4CLCC 5CEBA 3GECA 3EOIA 4JXWA 1SHVA 2WKHA 3IHBA 1FILA 2KLIA 3BFEA 5K5BA 2IWCA 1BLSA 4NETA 2PAVP 1NLYA 2J9PA 4LV1A 4C3QA 4CJNA 1PZOA 2K7SA 5M18A 2G2WA 1V9ZA 3EQVA 1HVBA 2LB5A 3VE4A 1ERQA 2Y55A 3NC8A 3OZHA 4B4XA 3GVBA 1FQGA 5CHMA 4FH4A 4WF0A 3DTEA 1TS8A 1IELA 2B02A 5CX7A 2ZM2A 3Q81A 4IUHA 2ZQCA 3FV7A 4U0TA 3G35A 1H8ZA 2EX8A 4GD6A 4X1LA 1LSXA 5GLBA 2WK0A 3N4IA 3CUEC 4WELA 1NWZA 3GV9A 3IF6B 3IBRA 3VP0A 1XX2A 1XA1A 5F1FA 1CI9A 3ICYA 4GDNA 1PI5A 3LI8A 3QP4A 2JBFA 5HDSA 4HIAA 4OPQA 2K31A 5CRFA 5FQKA 1G5UA 4HEFA 5GHZA 3C7VA 4G3KA 2XFSA 3JVUA 2Y2MA 1YT4A 4FD8A 3CITA 4CQHA 3DTMA 3BQAA 3DTIA 4X1MA 1MC0A 4EW7A 3M2KA 1GCEA 4F3LB 3HUNA 1IYQA 1XKZA 5E2HA 2A24B 2IWDA 2A2LA 4OPRA 1MKMA 3ZG9B 2EA9A 2EX6A 5DFXA 3UO9A 4JXSA 3LIBA 3L9KA 5CEDA 2FFYA 3D9YA 3S1YA 1XP4A 2O9AA 3CZDA 1DY6A 2HDQA 4R0QA 5FI2A 4QWOA 1H8YA
chains in the Genus database with same CATH topology
1NXYA 1ES3A 2Z2MB 1LLBA 4P6BA 3A3DA 3WRZA 4R4RA 4DE3A 5FAPA 4F94A 3HLDA 3MZEA 4S2NC 5FAQA 3C4OA 2ZQ9A 2Y59A 4ZJ3A 1KE0A 4Z9QA 1LL5A 1RCJA 4JKTA 5DF7A 3N6IA 1ONGA 2H5SA 4WEKA 3V3SA 1E4DA 2EX2A 4JPMA 2IWBA 3BFGA 4WBGA 2H0YA 4KZAA 3GQZA 2V1ZA 1IKIA 2A3UA 1MBLA 4D2OA 2J8YA 1BLCA 2Y2KA 3GR2A 5A92A 4HBUA 2X02A 5DTKA 4O7DA 1L0GA 3ZNYA 4KZ7A 1IEMA 5FQMA 1HD8A 1MWTA 3VP4A 2JC7A 3BLSA 4H8RA 3SH7A 5CHJA 1KVMA 4X69A 4KZ4A 4MEZA 1PZPA 4OOMA 4X55A 3UDFA 3WWXA 3MZFA 3MKFA 4E6XA 4KQQA 2PBYA 1SKFA 3BRMA 3OCNA 2ZC7A 3VP1A 3HLGA 3P09A 5KMWA 1K4FA 3IXHA 4X6TA 5GLAA 3V39A 2B5RA 1FCNA 2HP5A 2A49A 1QMEA 3PAEA 2V2FF 4WZ5C 5AQ7A 5KZHA 1PW1A 4P87A 5GLCA 4MBFA 4S2IA 1EWZA 3IF6A 4RX3A 5CHUA 5HARA 3IXBA 5D3OA 1ZKJA 5HAIA 3NI9A 3BEBA 1E3UD 3A3JA 2WUQA 4XUZA 1JVJA 1N9BA 3N7WA 3W4OA 2ZC3B 4QY5A 4KG2A 1NYMA 2XLNA 1ES2A 1BUEA 2QPNA 4S2LA 5FATA 4OQ0A 4E3LA 2ZM8A 1BLPA 1K56D 3PBTA 3UE1A 1CEFA 4WEJA 5AQAA 1L0FA 2EFXA 4OOLA 4KQOA 3BFFA 3PTEA 1JWVA 1YLWA 4XUXA 2ZC4B 4S2NA 1FCMA 3CJMA 1YLTA 1JWPA 1NZUA 4YINA 1Y54A 5FI6A 4EUZA 4MBKA 4EWFA 1ESIA 4ZJ2A 3ZG5A 3W4QA 1L0EA 1L2SA 4M3KA 4ID4A 4N9KA 4IBRA 3BFCA 3ISGA 3HUOA 4JXVA 2H10A 3LY3A 3FKVA 4WYYA 5EOOA 4DDSA 1GHPA 3ZGAB 1NY0A 3OPLA 4FCFA 3RXWA 4B4ZA 3SS4A 4K91A 2Y2GA 1CEGA 4JF4A 1XGJA 4IEDA 1G6AA 3G32A 3ZHHA 4IVKA 3ZVWA 3IWIA 5HX9A 3EQUA 2ZC5B 3IT9A 4KG6A 4DXCA 1C3BA 4DF6A 1KDWA 3IH9A 3SH8A 3TOIA 3UE0A 2ZM0A 5E2EA 5E43A 2XFTA 3G4PA 2JCHA 4N1HA 5TR7A 3CG5A 3QNCA 3LCEA 2HPBA 2WGWA 2Z2LB 1K38A 2OLUA 3BM6A 3IXGA 5FQ9A 1OMEA 4MNRA 1DJAA 3Q7ZA 1PI4A 2XDMA 1KGFA 4PM8A 1O7EA 1M6KA 4Y0UA 1H5XA 5M19A 4GD8A 4A5RA 1SCWA 5EECA 2WYXA 4GB7A 5BOHA 4GNUA 5KSHA 1TDGA 3P98A 1W79A 1K54A 4BJPA 3DWKA 1K6RA 3GRJA 3FWLA 2P9VA 2H0TA 1ALQA 2WGIA 1SDNA 2XD5A 5U47A 5L2FA 2WZZA 4N92A 3V50A 1K57A 2OV5A 4LV0A 3UDIA 1I5QA 2Y2JA 2ZQDA 2G2UA 4MLLA 2ZMAA 2GDNA 1ESUA 2EFUA 2XH9A 4UA6A 3HUMA 3UNWA 4KZ6A 4GZBA 4QB8A 3LEZA 4RVAA 4IBXA 3LO7A 5FSRA 3HBRA 3ZNTA 4OKPA 3GSGA 3UPOA 3WS2A 5GHYA 4KZ5A 3BFDA 4KQRA 2XK1A 4EBPA 4GDBA 2EXAA 3UPPA 3O86A 3OC2A 4U0XA 1I2SA 1PWCA 1YLPA 2WAEA 2UWXA 5FQJA 5CGXA 4HESA 2Y2IA 5CGSA 1Z6FA 2P74A 2Q9MA 1JTDA 2BG1A 4QY6A 3FKWA 4R4SA 4U3TA 4X68A 4EQIA 1K55C 5EVIA 3B3XA 5I94A 1TVFA 3AGDA 2PU2A 4DE1A 1TEMA 1GHMA 4GN2A 4L0LA 3BYDA 2FFFB 1FOFA 3NDGA 1GA9A 3NIAA 4Y7PA 5DVAA 4OQHA 4ZJ1A 1YLZA 3N8RA 4X53A 2HDSA 1ONHA 1RGZA 3ITBA 4BLMA 4OP5A 3MXRA 1YMXA 3TG9A 5GHXA 4WMCA 2C6WB 4BD0A 3G30A 5AQ9A 2XQZA 3OPPA 1NYYA 1IYSA 4WMCD 3WS5A 5HAPA 1SDEA 1MWUA 1FSWA 4LV3A 2WGVA 4JLFA 3E2LA 4KZBA 3Q7VA 3ZFZA 3ZG7B 1S0WA 2WKIA 3FZCA 3PBNA 3DW0A 2Y2HA 4HBTA 2DRWA 3IWOA 1VQQA 2HDRA 4JF6A 3VSKA 1CI8A 5DF9A 3VOYA 5F82A 1XXMA 3UDXA 4QJGA 1BTLA 2HP9A 5HFOA 4S2MA 2ZD8A 4WZ5A 4UHUA 4GOGA 4FH2A 2Y2LA 4KZ9A 2P9VB 5EUAA 5KSCA 1ES4A 1HTZA 1NRFA 4OONA 4DRTA 4KENB 5CERA 3W8KA 2HP6A 2I72A 3G2YA 2Y2NA 5FA7A 4DE2A 4PM5A 3HLCA 5HW3A 3WS1A 4Y0OA 5JYOA 3VSLA 2WADA 1YLYA 3Q07A 1PIOA 1MWRA 5CGWA 1IKGA 3SS3A 1W8YA 4EBLA 1W5DA 2WKEA 2ZQAA 5IHVA 5CTNA 1KE3A 3NBLA 1S6RA 3DWZA 1K55A 5EVIC 4S2PA 3W4PA 1K6SA 2QZ6A 4RYEA 4Y0TA 5GL9A 3BECA 2Y91A 3HL9A 4S2OA 1WYBA 2OLVA 1FR1A 2WZXA 4E3OA 3HVFA 5GLDA 5DTTA 4WZ4A 5A91A 1LI0A 3WRTA 4Q8IA 1W7FA 4CPKA 4OPYA 5EVID 3JYIA 3GMWA 4X56A 1E25A 1K56A 4PMAA 3A3EA 4E3NA 1DJBA 3IF5A 1NZOA 2DNSA 4OLGA 1I2WA 4BL2A 5JYPA 4C75A 4E6WA 4PM7A 4WM9A 3D4FA 4E3MA 1PWGA 1KDSA 2Y2OA 3VFHA 1N4OA 5TFQA 5A90A 1NJ4A 4LCMA 4S2KA 3MZDA 3SOIA 3ZDJA 4JF5A 1HZOA 3ZG0A 1JWZA 2RL3A 3G2ZA 1Q2PA 3IWQA 5FASA 1BLHA 3O87A 5FDHA 5M1AA 3VP3A 4DE0A 2HDUA 1ZG4A 3QHYA 4QHCA 3Q7VB 3MKEA 4UAAA 1J9MA 4R3BA 4KZ3A 1MWSA 3O3VA 3G34A 5FQIA 3PBQA 3QNBA 4LV2A 2Y2PA 1KVLA 4OQGA 2BLSA 3C7UA 4JBFA 3M6BA 3RXXA 5FI7A 3TSGA 2J9OA 4R3JA 5J8XA 4K0XA 2J7VA 1AXBA 4P0MA 1MPLA 3IQAA 3M6HA 1PYYA 4ZDXA 4OOYA 2WGWB 1RP5A 5FAOA 3WS0A 5DTSA 3NCKA 1MKIA 2X01A 2E8IA 1XGIA 3C4PA 3PBSA 5CEBA 2XEPA 2XD1A 3S4XA 4JXWA 2DCFA 1W8QA 3N8LA 3A3FA 1SHVA 2Y2QA 3Q1FA 4NK3A 3AGEA 2WKHA 4C6YA 3ZCZA 3IHBA 1QMFA 4UA7A 5CECA 3I7JA 3ITAA 4OQIA 3BFEA 1MY8A 2IWCA 1BLSA 2R9WA 2RCXA 4NETA 3OPHA 3OPRA 1K57C 3SH9A 5EVIB 2R9XA 3PBRA 3M2JA 2J9PA 4LV1A 4YFMA 4C3QA 4OP8A 4CJNA 1LHYA 1ZG6A 3HLFA 3A3IA 5HL1A 3MXSA 1PZOA 1BSGA 5M18A 2G2WA 3IHAA 1YQSA 3EQVA 1GA0A 1HVBA 1ERQA 2Y55A 3NC8A 4RX2A 1ES5A 3S22A 1G68A 1U60A 3OZHA 4LCLA 3GVBA 1FQGA 4B4XA 4R1GA 2ZJ9A 5CHMA 2VGJA 4FH4A 2PU4A 3VP2A 3IXDA 1IELA 4IVIA 1WE4A 3IF6C 2ZM2A 4KG5A 2ZLYA 3Q81A 4QU3A 3GTCA 3WS4A 1IYOA 2ZQCA 3FV7A 4U0TA 3UN7A 1YMSA 3G35A 3UY6A 3V5MA 1YM1A 5FQQA 4E3IA 3UPNA 3PAGA 1H8ZA 4ZAMA 2QMIA 2EX8A 1L0DA 4GD6A 2EXBA 3HLEA 2WAFA 3Q82A 1Q2QA 4KZ8A 5GLBA 3ZG8B 4BENA 2WK0A 4BD1A 3N4IA 4WELA 3G31A 3GV9A 2OSUA 5G18A 1EI5A 3IF6B 4DDYA 1VM1A 1YLJA 2ZQ7A 3VP0A 1JTGA 1XX2A 1GHIA 1XA1A 2CC1A 3O88A 4R23A 4UA9A 1FR6A 5F1FA 1TDLA 1CI9A 4GDNA 5EOEA 3N8SA 5EPHA 2XGNA 3NY4A 4XXRA 4PPRA 1KGEA 2X71A 3VOZA 4EBNA 1PI5A 1XPBA 4EV4A 2JBFA 1BZAA 2JE5A 3V3RA 3E2KA 4PM9A 1PWDA 1PW8A 3HLWA 4OPQA 5CRFA 3HREA 5A93A 4ZTKA 5AQBA 5EE8A 5F83A 4B88A 5FQKA 3UE3A 1ERMA 4JXGA 4HEFA 5GHZA 1K4EA 3C7VA 1EROA 2XFSA 4BQMA 4P85A 3AGFA 2Y2MA 5HAQA 1FSYA 1MXOA 1YT4A 4FD8A 1WYCA 4QD4A 4DXBA 4OLDA 4MBHA 4BL3A 1FCOA 3DTMA 3NDEA 4GKUA 3MBZA 3IH8A 4N9LA 3BLMA 3HLBA 3PBOA 2C5WB 5F1GA 2Y4AA 5TGFA 3CMZA 3M2KA 2ZQ8A 3MFDA 1GCEA 4ZBEA 1CK3A 4DKIA 3HUNA 4E3JA 1ZC2A 5CXWA 1IYQA 1K25A 4N1XA 5E2GA 3ZVTA 1XKZA 2VGKA 5E2HA 2IWDA 2XF3A 1M40A 4K0WA 1BT5A 1LL9A 3VFFA 1K54C 4FSFA 1E3UA 2XR0A 2V20A 2EX9A 4OPRA 1LI9A 3RJUA 4E3KA 3ZG9B 2EX6A 3FYZA 5EVLA 3SS5A 1RGYA 3LY4A 3OCLA 3UO9A 4JXSA 5CEDA 3VMAA 4OH0A 4RA7A 2FFYA 1KE4A 4PM6A 3S1YA 4OVDA 1XP4A 2Q9NA 3CZDA 1DJCA 1BULA 1DY6A 1KGGA 2HDQA 4LENA 4OPZA 5DF8A 4R0QA 5CTMA 1XA7A 4S2JA 5E2FA 2ZC6B 1O07A 3C5AA 1IYPA 5FI2A 1H8YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NXY A;  1ES3 A;  2Z2M B;  1LLB A;  4P6B A;  3A3D A;  3WRZ A;  4R4R A;  4DE3 A;  5FAP A;  4F94 A;  3HLD A;  3MZE A;  4S2N C;  5FAQ A;  3C4O A;  2ZQ9 A;  2Y59 A;  4ZJ3 A;  1KE0 A;  4Z9Q A;  1LL5 A;  1RCJ A;  4JKT A;  5DF7 A;  3N6I A;  1ONG A;  2H5S A;  4WEK A;  3V3S A;  1E4D A;  2EX2 A;  4JPM A;  2IWB A;  3BFG A;  4WBG A;  2H0Y A;  4KZA A;  3GQZ A;  2V1Z A;  1IKI A;  2A3U A;  1MBL A;  4D2O A;  2J8Y A;  1BLC A;  2Y2K A;  3GR2 A;  5A92 A;  4HBU A;  2X02 A;  5DTK A;  4O7D A;  1L0G A;  3ZNY A;  4KZ7 A;  1IEM A;  5FQM A;  1HD8 A;  1MWT A;  3VP4 A;  2JC7 A;  3BLS A;  4H8R A;  3SH7 A;  5CHJ A;  1KVM A;  4X69 A;  4KZ4 A;  4MEZ A;  1PZP A;  4OOM A;  4X55 A;  3UDF A;  3WWX A;  3MZF A;  3MKF A;  4E6X A;  4KQQ A;  2PBY A;  1SKF A;  3BRM A;  3OCN A;  2ZC7 A;  3VP1 A;  3HLG A;  3P09 A;  5KMW A;  1K4F A;  3IXH A;  4X6T A;  5GLA A;  3V39 A;  2B5R A;  1FCN A;  2HP5 A;  2A49 A;  1QME A;  3PAE A;  2V2F F;  4WZ5 C;  5AQ7 A;  5KZH A;  1PW1 A;  4P87 A;  5GLC A;  4MBF A;  4S2I A;  1EWZ A;  3IF6 A;  4RX3 A;  5CHU A;  5HAR A;  3IXB A;  5D3O A;  1ZKJ A;  5HAI A;  3NI9 A;  3BEB A;  1E3U D;  3A3J A;  2WUQ A;  4XUZ A;  1JVJ A;  1N9B A;  3N7W A;  3W4O A;  2ZC3 B;  4QY5 A;  4KG2 A;  1NYM A;  2XLN A;  1ES2 A;  1BUE A;  2QPN A;  4S2L A;  5FAT A;  4OQ0 A;  4E3L A;  2ZM8 A;  1BLP A;  1K56 D;  3PBT A;  3UE1 A;  1CEF A;  4WEJ A;  5AQA A;  1L0F A;  2EFX A;  4OOL A;  4KQO A;  3BFF A;  3PTE A;  1JWV A;  1YLW A;  4XUX A;  2ZC4 B;  4S2N A;  1FCM A;  3CJM A;  1YLT A;  1JWP A;  1NZU A;  4YIN A;  1Y54 A;  5FI6 A;  4EUZ A;  4MBK A;  4EWF A;  1ESI A;  4ZJ2 A;  3ZG5 A;  3W4Q A;  1L0E A;  1L2S A;  4M3K A;  4ID4 A;  4N9K A;  4IBR A;  3BFC A;  3ISG A;  3HUO A;  4JXV A;  2H10 A;  3LY3 A;  3FKV A;  4WYY A;  5EOO A;  4DDS A;  1GHP A;  3ZGA B;  1NY0 A;  3OPL A;  4FCF A;  3RXW A;  4B4Z A;  3SS4 A;  4K91 A;  2Y2G A;  1CEG A;  4JF4 A;  1XGJ A;  4IED A;  1G6A A;  3G32 A;  3ZHH A;  4IVK A;  3ZVW A;  3IWI A;  5HX9 A;  3EQU A;  2ZC5 B;  3IT9 A;  4KG6 A;  4DXC A;  1C3B A;  4DF6 A;  1KDW A;  3IH9 A;  3SH8 A;  3TOI A;  3UE0 A;  2ZM0 A;  5E2E A;  5E43 A;  2XFT A;  3G4P A;  2JCH A;  4N1H A;  5TR7 A;  3CG5 A;  3QNC A;  3LCE A;  2HPB A;  2WGW A;  2Z2L B;  1K38 A;  2OLU A;  3BM6 A;  3IXG A;  5FQ9 A;  1OME A;  4MNR A;  1DJA A;  3Q7Z A;  1PI4 A;  2XDM A;  1KGF A;  4PM8 A;  1O7E A;  1M6K A;  4Y0U A;  1H5X A;  5M19 A;  4GD8 A;  4A5R A;  1SCW A;  5EEC A;  2WYX A;  4GB7 A;  5BOH A;  4GNU A;  5KSH A;  1TDG A;  3P98 A;  1W79 A;  1K54 A;  4BJP A;  3DWK A;  1K6R A;  3GRJ A;  3FWL A;  2P9V A;  2H0T A;  1ALQ A;  2WGI A;  1SDN A;  2XD5 A;  5U47 A;  5L2F A;  2WZZ A;  4N92 A;  3V50 A;  1K57 A;  2OV5 A;  4LV0 A;  3UDI A;  1I5Q A;  2Y2J A;  2ZQD A;  2G2U A;  4MLL A;  2ZMA A;  2GDN A;  1ESU A;  2EFU A;  2XH9 A;  4UA6 A;  3HUM A;  3UNW A;  4KZ6 A;  4GZB A;  4QB8 A;  3LEZ A;  4RVA A;  4IBX A;  3LO7 A;  5FSR A;  3HBR A;  3ZNT A;  4OKP A;  3GSG A;  3UPO A;  3WS2 A;  5GHY A;  4KZ5 A;  3BFD A;  4KQR A;  2XK1 A;  4EBP A;  4GDB A;  2EXA A;  3UPP A;  3O86 A;  3OC2 A;  4U0X A;  1I2S A;  1PWC A;  1YLP A;  2WAE A;  2UWX A;  5FQJ A;  5CGX A;  4HES A;  2Y2I A;  5CGS A;  1Z6F A;  2P74 A;  2Q9M A;  1JTD A;  2BG1 A;  4QY6 A;  3FKW A;  4R4S A;  4U3T A;  4X68 A;  4EQI A;  1K55 C;  5EVI A;  3B3X A;  5I94 A;  1TVF A;  3AGD A;  2PU2 A;  4DE1 A;  1TEM A;  1GHM A;  4GN2 A;  4L0L A;  3BYD A;  2FFF B;  1FOF A;  3NDG A;  1GA9 A;  3NIA A;  4Y7P A;  5DVA A;  4OQH A;  4ZJ1 A;  1YLZ A;  3N8R A;  4X53 A;  2HDS A;  1ONH A;  1RGZ A;  3ITB A;  4BLM A;  4OP5 A;  3MXR A;  1YMX A;  3TG9 A;  5GHX A;  4WMC A;  2C6W B;  4BD0 A;  3G30 A;  5AQ9 A;  2XQZ A;  3OPP A;  1NYY A;  1IYS A;  4WMC D;  3WS5 A;  5HAP A;  1SDE A;  1MWU A;  1FSW A;  4LV3 A;  2WGV A;  4JLF A;  3E2L A;  4KZB A;  3Q7V A;  3ZFZ A;  3ZG7 B;  1S0W A;  2WKI A;  3FZC A;  3PBN A;  3DW0 A;  2Y2H A;  4HBT A;  2DRW A;  3IWO A;  1VQQ A;  2HDR A;  4JF6 A;  3VSK A;  1CI8 A;  5DF9 A;  3VOY A;  5F82 A;  1XXM A;  3UDX A;  4QJG A;  1BTL A;  2HP9 A;  5HFO A;  4S2M A;  2ZD8 A;  4WZ5 A;  4UHU A;  4GOG A;  4FH2 A;  2Y2L A;  4KZ9 A;  2P9V B;  5EUA A;  5KSC A;  1ES4 A;  1HTZ A;  1NRF A;  4OON A;  4DRT A;  4KEN B;  5CER A;  3W8K A;  2HP6 A;  2I72 A;  3G2Y A;  2Y2N A;  5FA7 A;  4DE2 A;  4PM5 A;  3HLC A;  5HW3 A;  3WS1 A;  4Y0O A;  5JYO A;  3VSL A;  2WAD A;  1YLY A;  3Q07 A;  1PIO A;  1MWR A;  5CGW A;  1IKG A;  3SS3 A;  1W8Y A;  4EBL A;  1W5D A;  2WKE A;  2ZQA A;  5IHV A;  5CTN A;  1KE3 A;  3NBL A;  1S6R A;  3DWZ A;  1K55 A;  5EVI C;  4S2P A;  3W4P A;  1K6S A;  2QZ6 A;  4RYE A;  4Y0T A;  5GL9 A;  3BEC A;  2Y91 A;  3HL9 A;  4S2O A;  1WYB A;  2OLV A;  1FR1 A;  2WZX A;  4E3O A;  3HVF A;  5GLD A;  5DTT A;  4WZ4 A;  5A91 A;  1LI0 A;  3WRT A;  4Q8I A;  1W7F A;  4CPK A;  4OPY A;  5EVI D;  3JYI A;  3GMW A;  4X56 A;  1E25 A;  1K56 A;  4PMA A;  3A3E A;  4E3N A;  1DJB A;  3IF5 A;  1NZO A;  2DNS A;  4OLG A;  1I2W A;  4BL2 A;  5JYP A;  4C75 A;  4E6W A;  4PM7 A;  4WM9 A;  3D4F A;  4E3M A;  1PWG A;  1KDS A;  2Y2O A;  3VFH A;  1N4O A;  5TFQ A;  5A90 A;  1NJ4 A;  4LCM A;  4S2K A;  3MZD A;  3SOI A;  3ZDJ A;  4JF5 A;  1HZO A;  3ZG0 A;  1JWZ A;  2RL3 A;  3G2Z A;  1Q2P A;  3IWQ A;  5FAS A;  1BLH A;  3O87 A;  5FDH A;  5M1A A;  3VP3 A;  4DE0 A;  2HDU A;  1ZG4 A;  3QHY A;  4QHC A;  3Q7V B;  3MKE A;  4UAA A;  1J9M A;  4R3B A;  4KZ3 A;  1MWS A;  3O3V A;  3G34 A;  5FQI A;  3PBQ A;  3QNB A;  4LV2 A;  2Y2P A;  1KVL A;  4OQG A;  2BLS A;  3C7U A;  4JBF A;  3M6B A;  3RXX A;  5FI7 A;  3TSG A;  2J9O A;  4R3J A;  5J8X A;  4K0X A;  2J7V A;  1AXB A;  4P0M A;  1MPL A;  3IQA A;  3M6H A;  1PYY A;  4ZDX A;  4OOY A;  2WGW B;  1RP5 A;  5FAO A;  3WS0 A;  5DTS A;  3NCK A;  1MKI A;  2X01 A;  2E8I A;  1XGI A;  3C4P A;  3PBS A;  5CEB A;  2XEP A;  2XD1 A;  3S4X A;  4JXW A;  2DCF A;  1W8Q A;  3N8L A;  3A3F A;  1SHV A;  2Y2Q A;  3Q1F A;  4NK3 A;  3AGE A;  2WKH A;  4C6Y A;  3ZCZ A;  3IHB A;  1QMF A;  4UA7 A;  5CEC A;  3I7J A;  3ITA A;  4OQI A;  3BFE A;  1MY8 A;  2IWC A;  1BLS A;  2R9W A;  2RCX A;  4NET A;  3OPH A;  3OPR A;  1K57 C;  3SH9 A;  5EVI B;  2R9X A;  3PBR A;  3M2J A;  2J9P A;  4LV1 A;  4YFM A;  4C3Q A;  4OP8 A;  4CJN A;  1LHY A;  1ZG6 A;  3HLF A;  3A3I A;  5HL1 A;  3MXS A;  1PZO A;  1BSG A;  5M18 A;  2G2W A;  3IHA A;  1YQS A;  3EQV A;  1GA0 A;  1HVB A;  1ERQ A;  2Y55 A;  3NC8 A;  4RX2 A;  1ES5 A;  3S22 A;  1G68 A;  1U60 A;  3OZH A;  4LCL A;  3GVB A;  1FQG A;  4B4X A;  4R1G A;  2ZJ9 A;  5CHM A;  2VGJ A;  4FH4 A;  2PU4 A;  3VP2 A;  3IXD A;  1IEL A;  4IVI A;  1WE4 A;  3IF6 C;  2ZM2 A;  4KG5 A;  2ZLY A;  3Q81 A;  4QU3 A;  3GTC A;  3WS4 A;  1IYO A;  2ZQC A;  3FV7 A;  4U0T A;  3UN7 A;  1YMS A;  3G35 A;  3UY6 A;  3V5M A;  1YM1 A;  5FQQ A;  4E3I A;  3UPN A;  3PAG A;  1H8Z A;  4ZAM A;  2QMI A;  2EX8 A;  1L0D A;  4GD6 A;  2EXB A;  3HLE A;  2WAF A;  3Q82 A;  1Q2Q A;  4KZ8 A;  5GLB A;  3ZG8 B;  4BEN A;  2WK0 A;  4BD1 A;  3N4I A;  4WEL A;  3G31 A;  3GV9 A;  2OSU A;  5G18 A;  1EI5 A;  3IF6 B;  4DDY A;  1VM1 A;  1YLJ A;  2ZQ7 A;  3VP0 A;  1JTG A;  1XX2 A;  1GHI A;  1XA1 A;  2CC1 A;  3O88 A;  4R23 A;  4UA9 A;  1FR6 A;  5F1F A;  1TDL A;  1CI9 A;  4GDN A;  5EOE A;  3N8S A;  5EPH A;  2XGN A;  3NY4 A;  4XXR A;  4PPR A;  1KGE A;  2X71 A;  3VOZ A;  4EBN A;  1PI5 A;  1XPB A;  4EV4 A;  2JBF A;  1BZA A;  2JE5 A;  3V3R A;  3E2K A;  4PM9 A;  1PWD A;  1PW8 A;  3HLW A;  4OPQ A;  5CRF A;  3HRE A;  5A93 A;  4ZTK A;  5AQB A;  5EE8 A;  5F83 A;  4B88 A;  5FQK A;  3UE3 A;  1ERM A;  4JXG A;  4HEF A;  5GHZ A;  1K4E A;  3C7V A;  1ERO A;  2XFS A;  4BQM A;  4P85 A;  3AGF A;  2Y2M A;  5HAQ A;  1FSY A;  1MXO A;  1YT4 A;  4FD8 A;  1WYC A;  4QD4 A;  4DXB A;  4OLD A;  4MBH A;  4BL3 A;  1FCO A;  3DTM A;  3NDE A;  4GKU A;  3MBZ A;  3IH8 A;  4N9L A;  3BLM A;  3HLB A;  3PBO A;  2C5W B;  5F1G A;  2Y4A A;  5TGF A;  3CMZ A;  3M2K A;  2ZQ8 A;  3MFD A;  1GCE A;  4ZBE A;  1CK3 A;  4DKI A;  3HUN A;  4E3J A;  1ZC2 A;  5CXW A;  1IYQ A;  1K25 A;  4N1X A;  5E2G A;  3ZVT A;  1XKZ A;  2VGK A;  5E2H A;  2IWD A;  2XF3 A;  1M40 A;  4K0W A;  1BT5 A;  1LL9 A;  3VFF A;  1K54 C;  4FSF A;  1E3U A;  2XR0 A;  2V20 A;  2EX9 A;  4OPR A;  1LI9 A;  3RJU A;  4E3K A;  3ZG9 B;  2EX6 A;  3FYZ A;  5EVL A;  3SS5 A;  1RGY A;  3LY4 A;  3OCL A;  3UO9 A;  4JXS A;  5CED A;  3VMA A;  4OH0 A;  4RA7 A;  2FFY A;  1KE4 A;  4PM6 A;  3S1Y A;  4OVD A;  1XP4 A;  2Q9N A;  3CZD A;  1DJC A;  1BUL A;  1DY6 A;  1KGG A;  2HDQ A;  4LEN A;  4OPZ A;  5DF8 A;  4R0Q A;  5CTM A;  1XA7 A;  4S2J A;  5E2F A;  2ZC6 B;  1O07 A;  3C5A A;  1IYP A;  5FI2 A;  1H8Y A; 
#chains in the Genus database with same CATH topology
 4R4R A;  4R38 A;  4NG2 A;  2M7V A;  4ZJ3 A;  4Z9Q A;  1LL5 A;  1RCJ A;  3N6I A;  2D02 A;  3V3S A;  1OTI A;  2EX2 A;  1T1A A;  4O01 A;  2V8F A;  5HDD A;  2H0Y A;  3GQZ A;  4XT2 B;  2J8Y A;  3NJA A;  5A92 A;  1L0G A;  2Q0O A;  5FQM A;  2V8C A;  3BLS A;  3KSI A;  4KZ4 A;  4MEZ A;  1PZP A;  4HOI A;  2V1B A;  4KQQ A;  2OOL A;  3OCN A;  2ZC7 A;  1OJ5 A;  2W3E A;  3V39 A;  2B5R A;  2OWJ A;  1QME A;  3PAE A;  1DRM A;  4KQD A;  1Y28 A;  5D3O A;  4LLO B;  3R7W B;  4LRX C;  2JKT I;  2L0W A;  1JVJ A;  3W4O A;  3N7W A;  2ZC3 B;  4KG2 A;  5FAT A;  2ZM8 A;  1K56 D;  2QYB A;  5HWV A;  2EFX A;  4JGQ A;  3PTE A;  1JWV A;  4XUX A;  4CLC E;  4IJG A;  1Y54 A;  4EWF A;  1L2S A;  4M3K A;  5DKK A;  4DMZ A;  1VET A;  3ZYT A;  4LRZ E;  1GHP A;  3OPL A;  4FCF A;  4B4Z A;  1XFQ A;  3SS4 A;  2HF6 A;  1XGJ A;  2IA2 A;  4XT2 A;  3K3C A;  4GS9 B;  3EQU A;  1C3B A;  3SH8 A;  1FIK A;  2ZM0 A;  2XFT A;  3G4P A;  2JCH A;  3SW1 A;  4G3W A;  3DAV A;  3DBA A;  1PI4 A;  3KSH A;  3CAX A;  3B42 A;  4GD8 A;  5BOH A;  4GNU A;  1OTE A;  1W79 A;  1N9L A;  3A0V A;  1K6R A;  2Y79 A;  2EWW A;  5HSQ A;  2JKF A;  2WZZ A;  2Y2J A;  2G2U A;  5F5Y A;  2ZMA A;  2GDN A;  5DJU A;  4KZ6 A;  4NXG A;  2W1T A;  3H7W A;  4IBX A;  3HBR A;  4OKP A;  3KX0 X;  5GHY A;  3BFD A;  4EBP A;  2EXA A;  3UPP A;  2XA7 M;  4U0X A;  1I2S A;  2UWX A;  1EW0 A;  1Z6F A;  1JTD A;  4X68 A;  1SKO A;  2P04 A;  1K55 C;  3LIA A;  3MJQ A;  5I94 A;  1TS6 A;  2PU2 A;  4DE1 A;  4GN2 A;  1GHM A;  4L0L A;  3BYD A;  3BW6 A;  4G3V A;  4Y7P A;  4OQH A;  1YLZ A;  3N8R A;  1ONH A;  4BWI A;  4BD0 A;  4WLA A;  3OPP A;  1IYS A;  2GZA A;  3UB6 A;  3E2L A;  2GNX A;  2Z6C A;  1NRJ A;  3UME A;  4EXO A;  3UE6 A;  2WKI A;  3DW0 A;  2P08 A;  4Z1W A;  2PBD P;  5F82 A;  1XXM A;  1MZU A;  2ZD8 A;  3PXP A;  1ZHH B;  2Y2L A;  4JGO A;  2O99 A;  4DRT A;  4KEN B;  3IX4 A;  1LSW A;  4DE2 A;  3HLC A;  3WS1 A;  3Q07 A;  1PIO A;  4Q0J A;  5CGW A;  4BBU A;  3C8C A;  3OOV A;  2ZQA A;  1STZ A;  3W4P A;  3HL9 A;  2OLV A;  1N9N A;  3HVF A;  5GLD A;  5A91 A;  1LI0 A;  3WRT A;  4Q8I A;  1W7F A;  3T4O A;  4CPK A;  1IOU A;  4OPY A;  3GMW A;  1E25 A;  3A3E A;  4Y13 A;  2DNS A;  4BL2 A;  5JYP A;  3MXQ A;  4E3M A;  3S7Q A;  2Y2O A;  4RQ9 A;  5A90 A;  1NJ4 A;  1KOU A;  3SOI A;  4S2K A;  3T4L A;  5G4Z A;  3ZG0 A;  3RTY A;  5HWT A;  5FAS A;  1CJF A;  1P97 A;  3MKE A;  3LR5 A;  4R3B A;  1MWS A;  3O3V A;  3PBQ A;  2VGL M;  4JBF A;  4DJ3 A;  4AFI A;  3M6B A;  3M6H A;  2HZ5 A;  4ZDX A;  2WGW B;  3S7O A;  4UQI S;  2X01 A;  1XGI A;  3PBS A;  4YWZ A;  2XEP A;  3SZT A;  2DCF A;  3Q1F A;  4C6Y A;  3ZCZ A;  1QMF A;  5CEC A;  3ITA A;  4GW9 A;  2R9W A;  2RCX A;  3SH9 A;  2R9X A;  3PBR A;  1VB6 A;  1OT9 A;  4YOF A;  3H82 A;  5HL1 A;  3MXS A;  1LT0 A;  5TBM B;  2P7J A;  4MN7 A;  2PT7 A;  1YQS A;  2PDR A;  4RX2 A;  1YSP A;  3H82 B;  3DTK A;  3IXD A;  4IVI A;  4WN5 A;  1S1Z A;  2JHE A;  3B33 A;  4P6Z M;  3GTC A;  1TD5 A;  5L10 A;  2D01 A;  5EVE A;  1YMS A;  1YM1 A;  4E3I A;  4ZAM A;  3Q82 A;  2WAF A;  4KZ8 A;  4BD1 A;  3G31 A;  3QP8 A;  2OSU A;  5G18 A;  1EI5 A;  4DDY A;  2YKF A;  1VM1 A;  2ZMF A;  1JTG A;  3T4Q A;  2PYR A;  3F1O B;  4R23 A;  3W2Z A;  4XXR A;  2X71 A;  4ETZ A;  1XPB A;  3T4S A;  4EV4 A;  2JE5 A;  4M4X A;  4PM9 A;  1PW8 A;  2Z6D A;  5F83 A;  4B88 A;  3UE3 A;  1ERM A;  4JXG A;  1K4E A;  5J4E A;  1ERO A;  4BQM A;  5HAQ A;  1FSY A;  4QD4 A;  3T4K A;  4DXB A;  2BAS A;  1BYW A;  5HPF A;  1UWP X;  4HJ4 A;  3MQO A;  4N9L A;  5F1G A;  5TGF A;  3BLM A;  2C5W B;  3PBO A;  2Y4A A;  4L9G A;  4D60 A;  3NUL A;  3HCY A;  2JKG A;  4HH2 A;  5E2G A;  2JKR M;  1BT5 A;  1LL9 A;  3VFF A;  1K54 C;  4NXF A;  2R78 A;  3FYZ A;  3SS5 A;  4JGR A;  2J3T C;  3VMA A;  4RA7 A;  4PM6 A;  4OVD A;  4LEN A;  4Y17 A;  1DJC A;  1BUL A;  1XJ4 A;  5E2F A;  3VOL A;  2KX6 A;  3E0Y A;  3C5A A;  3MMH A;  1H0M A;  2Z2M B;  3IX3 A;  1LLB A;  3A3D A;  1T18 A;  4HP4 A;  3MZE A;  4S2N C;  3C4O A;  5DF7 A;  1ONG A;  3T12 B;  1E4D A;  2IWB A;  3C38 A;  3K2N A;  4WBG A;  3EWK A;  5G4Y A;  1G28 A;  1MBL A;  4D2O A;  2Y2K A;  1BLC A;  4L9F A;  2X02 A;  4KZ7 A;  5AVE A;  2JC7 A;  4H8R A;  5MC7 A;  1GSX A;  2J3T D;  4OOM A;  2V9A A;  3BRM A;  3VP1 A;  1K4F A;  3FG8 A;  2W3F A;  5L09 A;  4Y15 A;  2HP5 A;  3V67 A;  1T1C A;  2V2F F;  5AQ7 A;  4KUO A;  4LFU A;  4P87 A;  4MBF A;  4S2I A;  4RX3 A;  5HAR A;  1ZKJ A;  3A0R A;  3NI9 A;  1E3U D;  2WUQ A;  3E98 A;  4OQ0 A;  4E3L A;  1BLP A;  3UE1 A;  3F1N B;  4KQO A;  2ZC4 B;  3CJM A;  4ARZ B;  1JWP A;  2E8J A;  4EEP A;  3W4Q A;  1L0E A;  3VE3 A;  4N9K A;  2VZW A;  4JXV A;  4MDZ A;  2H10 A;  3LY3 A;  2FH5 A;  3ZGA B;  4PKY G;  3RXW A;  1OTD A;  2Y2G A;  3QP2 A;  1S4R A;  4O0P A;  3ZHH A;  4IVK A;  3ZVW A;  3IWI A;  1J3W A;  2ZC5 B;  4KG6 A;  4DXC A;  2V0U A;  5E2E A;  2ZBB A;  5E43 A;  3LCE A;  1UWN X;  3BM6 A;  2VJW A;  1OME A;  5AJG A;  4KUK A;  5M19 A;  1OTA A;  1M6K A;  1H5X A;  4A5R A;  2WYX A;  4GB7 A;  3QP1 A;  2ZMV A;  5KSH A;  4YNR A;  3P98 A;  2W0N A;  1K54 A;  4LPZ A;  3PHY A;  1ALQ A;  2WGI A;  5U47 A;  4I3I A;  2QJ7 A;  5LBR A;  2OV5 A;  4LV0 A;  3UDI A;  1I5Q A;  2ZQD A;  3CLO A;  4MLL A;  2XH9 A;  4F3L A;  1OJG A;  4RVA A;  4QB8 A;  3BJN A;  3H9W A;  3WS2 A;  2HJE A;  4EES A;  3O5Y A;  4GDB A;  1NLZ A;  3OC2 A;  1YLP A;  1PWC A;  4HES A;  2K2N A;  2Y2I A;  4U3T A;  4R4S A;  3FKW A;  2L4R A;  3FPW A;  5EVI A;  3B3X A;  2VV7 A;  2FFF B;  3NIA A;  3CHW P;  2A24 A;  5DVA A;  4ZJ1 A;  2QHK A;  1RGZ A;  3ITB A;  4BLM A;  4OP5 A;  3MXR A;  2L1M A;  3G30 A;  2XQZ A;  3WS5 A;  1FSW A;  4JLF A;  3Q7V A;  1S0W A;  3FZC A;  2Y2H A;  4HBT A;  1VQQ A;  4R6L A;  5IS1 A;  2HDR A;  3UB5 P;  2PD7 A;  2QKP A;  2CMN A;  3RFB A;  3UDX A;  1BTL A;  3EGD C;  4FH2 A;  5EUA A;  1PNE A;  1NRF A;  4GCZ A;  4EQ1 A;  3W8K A;  4BMW A;  2I72 A;  3T4J A;  4Y0O A;  5JYO A;  2WAD A;  4GHI A;  3LIF A;  1W5D A;  3NBL A;  4MCW A;  1K55 A;  4Y0T A;  4S2P A;  4RYE A;  5GL9 A;  2XSS A;  2Y91 A;  1TF1 A;  4S2O A;  1FR1 A;  2QWS A;  2WZX A;  1P9R A;  5EVI D;  4H6J B;  3G6O A;  3LFV A;  4E3N A;  3KSF A;  1I2W A;  3JPU A;  4E6W A;  2MJ6 A;  4PM7 A;  1PWG A;  3LIE A;  1T1B A;  5EV0 A;  4LCM A;  1OT6 A;  4JF5 A;  3G2Z A;  2XRO A;  3IWQ A;  4Q0H A;  5FDH A;  3VP3 A;  4DE0 A;  2HDU A;  1J9M A;  4KZ3 A;  1S67 L;  3QNB A;  4NXE A;  1KVL A;  4OQG A;  2M7U A;  3TSG A;  4R3J A;  1DP9 A;  4K0X A;  3KYE A;  5J8X A;  1MPL A;  4UQI M;  4ESP A;  4EET B;  4IUK A;  3MSH A;  2XD1 A;  3S4X A;  5FEF A;  3A3F A;  2Y2Q A;  4ZRR A;  4OQI A;  5J7E A;  5EVI B;  3E4O A;  4YFM A;  3HLF A;  3A3I A;  3U4L P;  4ARZ A;  1T19 A;  4EU0 A;  1G68 A;  2O9B A;  2AVX A;  3BQ8 A;  3VP2 A;  1WE4 A;  2INW A;  3F1O A;  3IF6 C;  5L8M A;  2ZLY A;  4QU3 A;  3WS4 A;  3PR6 A;  1IYO A;  3UN7 A;  2QJ5 A;  3UY6 A;  3V5M A;  3A0S A;  3UPN A;  3PAG A;  2QMI A;  1L0D A;  3ZG8 B;  3HLE A;  1Q2Q A;  1HLU P;  3MQQ A;  3F1P A;  4I39 A;  1IFQ A;  1W63 Q;  1YLJ A;  4P6Z S;  1GHI A;  4MN5 A;  2CC1 A;  4UA9 A;  1FR6 A;  3K3D A;  5IT5 A;  1TDL A;  4R70 A;  2XGN A;  3NY4 A;  1KGE A;  3T4T A;  3BY9 A;  3VOZ A;  4EBN A;  3V3R A;  4Y5F A;  5DFY A;  3E2K A;  1PWD A;  4ZTK A;  5AQB A;  2WKQ A;  1F98 A;  2EWV A;  5HWW A;  4P85 A;  1MXO A;  5TJJ A;  4NKP A;  4MBH A;  4BL3 A;  1FCO A;  4HHD A;  3NDE A;  4GKU A;  3MBZ A;  3MFX A;  3HLB A;  3CUE A;  3CMZ A;  1CK3 A;  4E3J A;  5FEG A;  5CXW A;  1K25 A;  4N1X A;  2G7U A;  1V9Y A;  3KYZ A;  2XF3 A;  1UGU A;  2ZOH A;  4K0W A;  4PAU A;  2XR0 A;  2EX9 A;  3RJU A;  4E3K A;  4CLC B;  1F9I A;  2WKP A;  5EVL A;  1RGY A;  3LY4 A;  3OCL A;  1W63 M;  3T1Q B;  4OH0 A;  3TJZ C;  2Q9N A;  1KGG A;  4OPZ A;  3OBF A;  1P0Z A;  4R3A A;  5CTM A;  2HV1 A;  1O07 A;  1IYP A;  4EUZ A;  1NXY A;  3LI9 A;  4EER A;  2FZ0 A;  4DE3 A;  1PRQ A;  5FAP A;  4FUW A;  5FAQ A;  5DKL A;  2GJ3 A;  1KE0 A;  4II7 A;  4WEK A;  3BFG A;  4MN6 A;  4KZA A;  3ULF A;  1AWI A;  3GR2 A;  3IS2 B;  3ZNY A;  1S1Y A;  1HD8 A;  1MWT A;  3VP4 A;  4HP9 A;  2B95 A;  1KVM A;  4X69 A;  4X55 A;  2VLG A;  3UDF A;  1PFL A;  3MZF A;  3MKF A;  5HL6 A;  1SKF A;  4HI4 A;  5KMW A;  3HLG A;  4X6T A;  5GLA A;  2Y8H A;  2JN7 A;  1GSV A;  3E4P A;  4FTX A;  4WZ5 C;  5KZH A;  1PW1 A;  3CPT B;  1EWZ A;  3IF6 A;  3MR0 A;  5CHU A;  3IXB A;  1S66 L;  2O9C A;  2OAP 1;  4Y3I A;  4XUZ A;  1N9B A;  1ES2 A;  3MQ0 A;  2QPN A;  4S2L A;  3PBT A;  1CEF A;  4WEJ A;  5AQA A;  4B9O A;  2WKR A;  3BFF A;  4S2N A;  1FCM A;  1XJ2 A;  5FI6 A;  1XFN A;  4ZJ2 A;  4IBR A;  3R7W A;  4HQA A;  3FKV A;  4WYY A;  5EOO A;  4DJ2 A;  4H6J A;  5IU1 A;  4K91 A;  4BBV A;  4JF4 A;  4IED A;  5DJT A;  3KYQ A;  3FPV A;  5F6A A;  1ODV A;  5F69 A;  4DF6 A;  1KDW A;  3UE0 A;  3P7N A;  1VEU B;  4N1H A;  1TS7 A;  2HPB A;  3IXG A;  1K38 A;  2W1T B;  3H7W B;  4MNR A;  4Y0U A;  1KGF A;  1VHM A;  4PM8 A;  5EEC A;  1X0O A;  3HJI A;  1TDG A;  3FWL A;  2H0T A;  1K0K A;  4QPR A;  1SDN A;  2XD5 A;  4ETX A;  5L2F A;  4N92 A;  2W1R A;  3V50 A;  1K57 A;  2BTF P;  1ESU A;  4E04 A;  3UNW A;  1LSV A;  3ZNT A;  3UPO A;  3GSG A;  5I5L A;  4KQR A;  2XK1 A;  3UB8 A;  5FQJ A;  3TRC A;  2Q9M A;  2BG1 A;  4QY6 A;  3LEQ A;  2H28 A;  2J80 A;  3MS6 A;  4FOF A;  3LYX A;  1TVF A;  1TEM A;  1FOF A;  2B18 A;  1GA9 A;  3NDG A;  3NOP C;  1D1J A;  3IX8 A;  3TG9 A;  5GHX A;  4WMC A;  2VEA A;  5EM1 A;  5AQ9 A;  4B93 A;  2OAQ 1;  5FL3 A;  1NYY A;  2DMW A;  3S7N A;  5HAP A;  1SDE A;  1MWU A;  3ZFZ A;  3ZG7 B;  3NOT C;  2VV8 A;  3IWO A;  4JF6 A;  2VK3 A;  4NEE D;  5DF9 A;  4QJG A;  2OWH A;  4S2M A;  4WZ5 A;  4UHU A;  3L7H A;  3QP5 A;  4KZ9 A;  5KSC A;  1ES4 A;  1HTZ A;  5HD5 A;  1YSQ A;  2HP6 A;  3G2Y A;  2PRF A;  5FA7 A;  3VSL A;  1ACF A;  2PR5 A;  1YLY A;  1MWR A;  1IKG A;  3SS3 A;  4EBL A;  5IHV A;  3BWL A;  5CTN A;  1S6R A;  5EVI C;  2I9V A;  1K6S A;  2QZ6 A;  3LR3 A;  3BEC A;  1WYB A;  5HDC A;  4GHI B;  4GS9 A;  1YKD A;  4E3O A;  5KIZ A;  3UB9 A;  3JYI A;  4X56 A;  4PMA A;  1DJB A;  3IF5 A;  4OLG A;  4GJ4 A;  5F68 A;  1G6O A;  3D4F A;  4WM9 A;  3VFH A;  1N4O A;  2W27 A;  3MZD A;  3ZDJ A;  3UMD A;  1BLH A;  3O87 A;  5M1A A;  1ZG4 A;  3QHY A;  4QHC A;  3Q7V B;  4UAA A;  2YKH A;  3G34 A;  4LV2 A;  3KO6 A;  2BLS A;  3C7U A;  3RXX A;  2V0W A;  3FC7 A;  2J7V A;  4P0M A;  2JKT M;  1PYY A;  1RP5 A;  1SZV A;  2ZL1 B;  5DTS A;  1MKI A;  2E8I A;  1SKO B;  3C4P A;  2PYP A;  3N8L A;  1W8Q A;  4NK3 A;  3LR4 A;  2UV0 E;  3AGE A;  3LUQ A;  4UA7 A;  2W3H A;  3I7J A;  1H8M A;  1MY8 A;  3OPH A;  1ZTU A;  3OPR A;  1K57 C;  3M2J A;  3R4K A;  4OP8 A;  1LHY A;  1ZG6 A;  3D72 A;  4HNB A;  2O0Y A;  1BSG A;  3S7P A;  4MMN A;  3MF0 A;  3IHA A;  2ZOI A;  1GA0 A;  3RH8 B;  2LB9 A;  3S22 A;  1ES5 A;  1U60 A;  4LCL A;  4R1G A;  2ZJ9 A;  2VGJ A;  1XJ3 A;  2PU4 A;  4WUJ A;  5HD3 A;  4KG5 A;  3P01 A;  5FQQ A;  1P9W A;  2EXB A;  3TE8 A;  4BEN A;  3NEC A;  2NUP C;  4I3A A;  2ZQ7 A;  4PKY A;  1H3Q A;  3O88 A;  3QP6 A;  5AVF A;  1VEU A;  5EPH A;  5EOE A;  3N8S A;  4I5S A;  4PPR A;  1WA9 A;  1BZA A;  4JGP A;  3EEH A;  3HLW A;  3HRE A;  5A93 A;  5EE8 A;  3AGF A;  3C2W A;  4EEU A;  1WYC A;  4UEY A;  4OLD A;  3IH8 A;  2ZQ8 A;  3MFD A;  4ZBE A;  4DKI A;  1ZC2 A;  3ZVT A;  2VGK A;  2PD8 A;  3CPT A;  2VGL S;  1M40 A;  4FSF A;  4Q0I A;  4HJ6 A;  1E3U A;  5HZH A;  2V20 A;  1YAX A;  3TW8 A;  1LI9 A;  1D7E A;  1KE4 A;  1YPR A;  5DF8 A;  1XA7 A;  4S2J A;  2ZC6 B;  3PYP A;  1CI8 A;  1ES3 A;  4P6B A;  3WRZ A;  4F94 A;  3HLD A;  4LGW A;  2HGV A;  3U2A A;  2ZQ9 A;  2Y59 A;  4JKT A;  4O8G A;  2H5S A;  4I38 A;  4JPM A;  4PHT A;  1DP6 A;  2V1Z A;  1IKI A;  5HPI A;  2A3U A;  4HBU A;  5DTK A;  4O7D A;  1IEM A;  3SH7 A;  4GLQ A;  1Z09 A;  5CHJ A;  3WWX A;  3LR0 A;  3T1S A;  4E6X A;  2PBY A;  3P09 A;  3IXH A;  1FCN A;  2A49 A;  3D3O A;  5GLC A;  3NHQ A;  4I3J A;  5HAI A;  3BEB A;  3A3J A;  1Y4O A;  3UB7 A;  4K08 A;  4QY5 A;  3ZQ5 A;  1NYM A;  2XLN A;  1BUE A;  1F5M A;  1D06 A;  1L0F A;  4OOL A;  1S4S A;  2PR6 A;  1YLW A;  4YIN A;  1YLT A;  1NZU A;  4MBK A;  1ESI A;  2XRN A;  3ZG5 A;  4ID4 A;  3BFC A;  3ISG A;  3HUO A;  4Y2F A;  4DDS A;  1DP8 A;  1NY0 A;  1LL8 A;  1CEG A;  3NOU C;  1G6A A;  3G32 A;  5FDS A;  3T1X A;  5HX9 A;  4HH3 A;  3IT9 A;  3IH9 A;  3TOI A;  5TR7 A;  3CG5 A;  3QNC A;  2WGW A;  2Z2L B;  2OLU A;  5FQ9 A;  3KSG A;  3VV4 A;  1DJA A;  3Q7Z A;  2XDM A;  1O7E A;  1L3L A;  4CLC A;  5EFW A;  1SCW A;  3IBJ A;  4L9E A;  4EUV A;  4BJP A;  3DWK A;  3GRJ A;  2P9V A;  2VX8 A;  4HY8 A;  3LID A;  5EM0 A;  2EFU A;  4WL9 A;  4UA6 A;  3HUM A;  1XJ6 A;  4GZB A;  3LEZ A;  2W3G A;  3LO7 A;  5FSR A;  4KZ5 A;  1F2K A;  3O86 A;  3T1R A;  4HJ3 A;  2WAE A;  5L07 A;  5CGX A;  5CGS A;  2P74 A;  4EQI A;  2GX5 A;  4DN0 A;  2ZL1 A;  3AGD A;  4BBT A;  3CWF A;  4X53 A;  3E4Q A;  1OTB A;  1VET B;  2HDS A;  1OPX A;  1YMX A;  4LRY C;  2V1A A;  2C6W B;  1A0K A;  4WMC D;  4LV3 A;  2WGV A;  2XA7 S;  4KZB A;  3PBN A;  5C5K A;  2DRW A;  4NXB A;  3VSK A;  3VOY A;  2KOI A;  5J3W A;  2JKR I;  2HJ9 C;  2HP9 A;  5HFO A;  1CQA A;  3F1N A;  3JVV A;  4GOG A;  1GSW A;  2P9V B;  5A8B A;  4OON A;  3F1P B;  4ME4 A;  5CER A;  3EGX C;  2Y2N A;  4PM5 A;  5HW3 A;  3EEA A;  3T50 A;  1W8Y A;  2WKE A;  1KE3 A;  3B47 A;  3DWZ A;  3C30 A;  3IS2 A;  2NUT C;  3LIC A;  4X25 A;  2KDK A;  5DTT A;  4WZ4 A;  2M1C A;  3OLO A;  4CLC D;  5TBM A;  1K56 A;  1NZO A;  4C75 A;  1JNU A;  1KDS A;  5TFQ A;  2VV6 A;  1HZO A;  1JWZ A;  2RL3 A;  2W3D A;  1Q2P A;  3HJK A;  2VKS A;  2ACG A;  1CF0 A;  5FQI A;  2Y2P A;  2VA0 A;  3BY8 A;  2J3W A;  5FI7 A;  4IHQ A;  2J9O A;  1AXB A;  2PHY A;  3IQA A;  3GDI A;  1N9O A;  3LGO A;  4OOY A;  5FAO A;  3WS0 A;  1TS0 A;  3NCK A;  3CI6 A;  4CLC C;  5CEB A;  3GEC A;  3EOI A;  4JXW A;  1SHV A;  2WKH A;  3IHB A;  1FIL A;  2KLI A;  3BFE A;  5K5B A;  2IWC A;  1BLS A;  4NET A;  2PAV P;  1NLY A;  2J9P A;  4LV1 A;  4C3Q A;  4CJN A;  1PZO A;  2K7S A;  5M18 A;  2G2W A;  1V9Z A;  3EQV A;  1HVB A;  2LB5 A;  3VE4 A;  1ERQ A;  2Y55 A;  3NC8 A;  3OZH A;  4B4X A;  3GVB A;  1FQG A;  5CHM A;  4FH4 A;  4WF0 A;  3DTE A;  1TS8 A;  1IEL A;  2B02 A;  5CX7 A;  2ZM2 A;  3Q81 A;  4IUH A;  2ZQC A;  3FV7 A;  4U0T A;  3G35 A;  1H8Z A;  2EX8 A;  4GD6 A;  4X1L A;  1LSX A;  5GLB A;  2WK0 A;  3N4I A;  3CUE C;  4WEL A;  1NWZ A;  3GV9 A;  3IF6 B;  3IBR A;  3VP0 A;  1XX2 A;  1XA1 A;  5F1F A;  1CI9 A;  3ICY A;  4GDN A;  1PI5 A;  3LI8 A;  3QP4 A;  2JBF A;  5HDS A;  4HIA A;  4OPQ A;  2K31 A;  5CRF A;  5FQK A;  1G5U A;  4HEF A;  5GHZ A;  3C7V A;  4G3K A;  2XFS A;  3JVU A;  2Y2M A;  1YT4 A;  4FD8 A;  3CIT A;  4CQH A;  3DTM A;  3BQA A;  3DTI A;  4X1M A;  1MC0 A;  4EW7 A;  3M2K A;  1GCE A;  4F3L B;  3HUN A;  1IYQ A;  1XKZ A;  5E2H A;  2A24 B;  2IWD A;  2A2L A;  4OPR A;  1MKM A;  3ZG9 B;  2EA9 A;  2EX6 A;  5DFX A;  3UO9 A;  4JXS A;  3LIB A;  3L9K A;  5CED A;  2FFY A;  3D9Y A;  3S1Y A;  1XP4 A;  2O9A A;  3CZD A;  1DY6 A;  2HDQ A;  4R0Q A;  5FI2 A;  4QWO A;  1H8Y A; 
#chains in the Genus database with same CATH homology
 1NXY A;  1ES3 A;  2Z2M B;  1LLB A;  4P6B A;  3A3D A;  3WRZ A;  4R4R A;  4DE3 A;  5FAP A;  4F94 A;  3HLD A;  3MZE A;  4S2N C;  5FAQ A;  3C4O A;  2ZQ9 A;  2Y59 A;  4ZJ3 A;  1KE0 A;  4Z9Q A;  1LL5 A;  1RCJ A;  4JKT A;  5DF7 A;  3N6I A;  1ONG A;  2H5S A;  4WEK A;  3V3S A;  1E4D A;  2EX2 A;  4JPM A;  2IWB A;  3BFG A;  4WBG A;  2H0Y A;  4KZA A;  3GQZ A;  2V1Z A;  1IKI A;  2A3U A;  1MBL A;  4D2O A;  2J8Y A;  1BLC A;  2Y2K A;  3GR2 A;  5A92 A;  4HBU A;  2X02 A;  5DTK A;  4O7D A;  1L0G A;  3ZNY A;  4KZ7 A;  1IEM A;  5FQM A;  1HD8 A;  1MWT A;  3VP4 A;  2JC7 A;  3BLS A;  4H8R A;  3SH7 A;  5CHJ A;  1KVM A;  4X69 A;  4KZ4 A;  4MEZ A;  1PZP A;  4OOM A;  4X55 A;  3UDF A;  3WWX A;  3MZF A;  3MKF A;  4E6X A;  4KQQ A;  2PBY A;  1SKF A;  3BRM A;  3OCN A;  2ZC7 A;  3VP1 A;  3HLG A;  3P09 A;  5KMW A;  1K4F A;  3IXH A;  4X6T A;  5GLA A;  3V39 A;  2B5R A;  1FCN A;  2HP5 A;  2A49 A;  1QME A;  3PAE A;  2V2F F;  4WZ5 C;  5AQ7 A;  5KZH A;  1PW1 A;  4P87 A;  5GLC A;  4MBF A;  4S2I A;  1EWZ A;  3IF6 A;  4RX3 A;  5CHU A;  5HAR A;  3IXB A;  5D3O A;  1ZKJ A;  5HAI A;  3NI9 A;  3BEB A;  1E3U D;  3A3J A;  2WUQ A;  4XUZ A;  1JVJ A;  1N9B A;  3N7W A;  3W4O A;  2ZC3 B;  4QY5 A;  4KG2 A;  1NYM A;  2XLN A;  1ES2 A;  1BUE A;  2QPN A;  4S2L A;  5FAT A;  4OQ0 A;  4E3L A;  2ZM8 A;  1BLP A;  1K56 D;  3PBT A;  3UE1 A;  1CEF A;  4WEJ A;  5AQA A;  1L0F A;  2EFX A;  4OOL A;  4KQO A;  3BFF A;  3PTE A;  1JWV A;  1YLW A;  4XUX A;  2ZC4 B;  4S2N A;  1FCM A;  3CJM A;  1YLT A;  1JWP A;  1NZU A;  4YIN A;  1Y54 A;  5FI6 A;  4EUZ A;  4MBK A;  4EWF A;  1ESI A;  4ZJ2 A;  3ZG5 A;  3W4Q A;  1L0E A;  1L2S A;  4M3K A;  4ID4 A;  4N9K A;  4IBR A;  3BFC A;  3ISG A;  3HUO A;  4JXV A;  2H10 A;  3LY3 A;  3FKV A;  4WYY A;  5EOO A;  4DDS A;  1GHP A;  3ZGA B;  1NY0 A;  3OPL A;  4FCF A;  3RXW A;  4B4Z A;  3SS4 A;  4K91 A;  2Y2G A;  1CEG A;  4JF4 A;  1XGJ A;  4IED A;  1G6A A;  3G32 A;  3ZHH A;  4IVK A;  3ZVW A;  3IWI A;  5HX9 A;  3EQU A;  2ZC5 B;  3IT9 A;  4KG6 A;  4DXC A;  1C3B A;  4DF6 A;  1KDW A;  3IH9 A;  3SH8 A;  3TOI A;  3UE0 A;  2ZM0 A;  5E2E A;  5E43 A;  2XFT A;  3G4P A;  2JCH A;  4N1H A;  5TR7 A;  3CG5 A;  3QNC A;  3LCE A;  2HPB A;  2WGW A;  2Z2L B;  1K38 A;  2OLU A;  3BM6 A;  3IXG A;  5FQ9 A;  1OME A;  4MNR A;  1DJA A;  3Q7Z A;  1PI4 A;  2XDM A;  1KGF A;  4PM8 A;  1O7E A;  1M6K A;  4Y0U A;  1H5X A;  5M19 A;  4GD8 A;  4A5R A;  1SCW A;  5EEC A;  2WYX A;  4GB7 A;  5BOH A;  4GNU A;  5KSH A;  1TDG A;  3P98 A;  1W79 A;  1K54 A;  4BJP A;  3DWK A;  1K6R A;  3GRJ A;  3FWL A;  2P9V A;  2H0T A;  1ALQ A;  2WGI A;  1SDN A;  2XD5 A;  5U47 A;  5L2F A;  2WZZ A;  4N92 A;  3V50 A;  1K57 A;  2OV5 A;  4LV0 A;  3UDI A;  1I5Q A;  2Y2J A;  2ZQD A;  2G2U A;  4MLL A;  2ZMA A;  2GDN A;  1ESU A;  2EFU A;  2XH9 A;  4UA6 A;  3HUM A;  3UNW A;  4KZ6 A;  4GZB A;  4QB8 A;  3LEZ A;  4RVA A;  4IBX A;  3LO7 A;  5FSR A;  3HBR A;  3ZNT A;  4OKP A;  3GSG A;  3UPO A;  3WS2 A;  5GHY A;  4KZ5 A;  3BFD A;  4KQR A;  2XK1 A;  4EBP A;  4GDB A;  2EXA A;  3UPP A;  3O86 A;  3OC2 A;  4U0X A;  1I2S A;  1PWC A;  1YLP A;  2WAE A;  2UWX A;  5FQJ A;  5CGX A;  4HES A;  2Y2I A;  5CGS A;  1Z6F A;  2P74 A;  2Q9M A;  1JTD A;  2BG1 A;  4QY6 A;  3FKW A;  4R4S A;  4U3T A;  4X68 A;  4EQI A;  1K55 C;  5EVI A;  3B3X A;  5I94 A;  1TVF A;  3AGD A;  2PU2 A;  4DE1 A;  1TEM A;  1GHM A;  4GN2 A;  4L0L A;  3BYD A;  2FFF B;  1FOF A;  3NDG A;  1GA9 A;  3NIA A;  4Y7P A;  5DVA A;  4OQH A;  4ZJ1 A;  1YLZ A;  3N8R A;  4X53 A;  2HDS A;  1ONH A;  1RGZ A;  3ITB A;  4BLM A;  4OP5 A;  3MXR A;  1YMX A;  3TG9 A;  5GHX A;  4WMC A;  2C6W B;  4BD0 A;  3G30 A;  5AQ9 A;  2XQZ A;  3OPP A;  1NYY A;  1IYS A;  4WMC D;  3WS5 A;  5HAP A;  1SDE A;  1MWU A;  1FSW A;  4LV3 A;  2WGV A;  4JLF A;  3E2L A;  4KZB A;  3Q7V A;  3ZFZ A;  3ZG7 B;  1S0W A;  2WKI A;  3FZC A;  3PBN A;  3DW0 A;  2Y2H A;  4HBT A;  2DRW A;  3IWO A;  1VQQ A;  2HDR A;  4JF6 A;  3VSK A;  1CI8 A;  5DF9 A;  3VOY A;  5F82 A;  1XXM A;  3UDX A;  4QJG A;  1BTL A;  2HP9 A;  5HFO A;  4S2M A;  2ZD8 A;  4WZ5 A;  4UHU A;  4GOG A;  4FH2 A;  2Y2L A;  4KZ9 A;  2P9V B;  5EUA A;  5KSC A;  1ES4 A;  1HTZ A;  1NRF A;  4OON A;  4DRT A;  4KEN B;  5CER A;  3W8K A;  2HP6 A;  2I72 A;  3G2Y A;  2Y2N A;  5FA7 A;  4DE2 A;  4PM5 A;  3HLC A;  5HW3 A;  3WS1 A;  4Y0O A;  5JYO A;  3VSL A;  2WAD A;  1YLY A;  3Q07 A;  1PIO A;  1MWR A;  5CGW A;  1IKG A;  3SS3 A;  1W8Y A;  4EBL A;  1W5D A;  2WKE A;  2ZQA A;  5IHV A;  5CTN A;  1KE3 A;  3NBL A;  1S6R A;  3DWZ A;  1K55 A;  5EVI C;  4S2P A;  3W4P A;  1K6S A;  2QZ6 A;  4RYE A;  4Y0T A;  5GL9 A;  3BEC A;  2Y91 A;  3HL9 A;  4S2O A;  1WYB A;  2OLV A;  1FR1 A;  2WZX A;  4E3O A;  3HVF A;  5GLD A;  5DTT A;  4WZ4 A;  5A91 A;  1LI0 A;  3WRT A;  4Q8I A;  1W7F A;  4CPK A;  4OPY A;  5EVI D;  3JYI A;  3GMW A;  4X56 A;  1E25 A;  1K56 A;  4PMA A;  3A3E A;  4E3N A;  1DJB A;  3IF5 A;  1NZO A;  2DNS A;  4OLG A;  1I2W A;  4BL2 A;  5JYP A;  4C75 A;  4E6W A;  4PM7 A;  4WM9 A;  3D4F A;  4E3M A;  1PWG A;  1KDS A;  2Y2O A;  3VFH A;  1N4O A;  5TFQ A;  5A90 A;  1NJ4 A;  4LCM A;  4S2K A;  3MZD A;  3SOI A;  3ZDJ A;  4JF5 A;  1HZO A;  3ZG0 A;  1JWZ A;  2RL3 A;  3G2Z A;  1Q2P A;  3IWQ A;  5FAS A;  1BLH A;  3O87 A;  5FDH A;  5M1A A;  3VP3 A;  4DE0 A;  2HDU A;  1ZG4 A;  3QHY A;  4QHC A;  3Q7V B;  3MKE A;  4UAA A;  1J9M A;  4R3B A;  4KZ3 A;  1MWS A;  3O3V A;  3G34 A;  5FQI A;  3PBQ A;  3QNB A;  4LV2 A;  2Y2P A;  1KVL A;  4OQG A;  2BLS A;  3C7U A;  4JBF A;  3M6B A;  3RXX A;  5FI7 A;  3TSG A;  2J9O A;  4R3J A;  5J8X A;  4K0X A;  2J7V A;  1AXB A;  4P0M A;  1MPL A;  3IQA A;  3M6H A;  1PYY A;  4ZDX A;  4OOY A;  2WGW B;  1RP5 A;  5FAO A;  3WS0 A;  5DTS A;  3NCK A;  1MKI A;  2X01 A;  2E8I A;  1XGI A;  3C4P A;  3PBS A;  5CEB A;  2XEP A;  2XD1 A;  3S4X A;  4JXW A;  2DCF A;  1W8Q A;  3N8L A;  3A3F A;  1SHV A;  2Y2Q A;  3Q1F A;  4NK3 A;  3AGE A;  2WKH A;  4C6Y A;  3ZCZ A;  3IHB A;  1QMF A;  4UA7 A;  5CEC A;  3I7J A;  3ITA A;  4OQI A;  3BFE A;  1MY8 A;  2IWC A;  1BLS A;  2R9W A;  2RCX A;  4NET A;  3OPH A;  3OPR A;  1K57 C;  3SH9 A;  5EVI B;  2R9X A;  3PBR A;  3M2J A;  2J9P A;  4LV1 A;  4YFM A;  4C3Q A;  4OP8 A;  4CJN A;  1LHY A;  1ZG6 A;  3HLF A;  3A3I A;  5HL1 A;  3MXS A;  1PZO A;  1BSG A;  5M18 A;  2G2W A;  3IHA A;  1YQS A;  3EQV A;  1GA0 A;  1HVB A;  1ERQ A;  2Y55 A;  3NC8 A;  4RX2 A;  1ES5 A;  3S22 A;  1G68 A;  1U60 A;  3OZH A;  4LCL A;  3GVB A;  1FQG A;  4B4X A;  4R1G A;  2ZJ9 A;  5CHM A;  2VGJ A;  4FH4 A;  2PU4 A;  3VP2 A;  3IXD A;  1IEL A;  4IVI A;  1WE4 A;  3IF6 C;  2ZM2 A;  4KG5 A;  2ZLY A;  3Q81 A;  4QU3 A;  3GTC A;  3WS4 A;  1IYO A;  2ZQC A;  3FV7 A;  4U0T A;  3UN7 A;  1YMS A;  3G35 A;  3UY6 A;  3V5M A;  1YM1 A;  5FQQ A;  4E3I A;  3UPN A;  3PAG A;  1H8Z A;  4ZAM A;  2QMI A;  2EX8 A;  1L0D A;  4GD6 A;  2EXB A;  3HLE A;  2WAF A;  3Q82 A;  1Q2Q A;  4KZ8 A;  5GLB A;  3ZG8 B;  4BEN A;  2WK0 A;  4BD1 A;  3N4I A;  4WEL A;  3G31 A;  3GV9 A;  2OSU A;  5G18 A;  1EI5 A;  3IF6 B;  4DDY A;  1VM1 A;  1YLJ A;  2ZQ7 A;  3VP0 A;  1JTG A;  1XX2 A;  1GHI A;  1XA1 A;  2CC1 A;  3O88 A;  4R23 A;  4UA9 A;  1FR6 A;  5F1F A;  1TDL A;  1CI9 A;  4GDN A;  5EOE A;  3N8S A;  5EPH A;  2XGN A;  3NY4 A;  4XXR A;  4PPR A;  1KGE A;  2X71 A;  3VOZ A;  4EBN A;  1PI5 A;  1XPB A;  4EV4 A;  2JBF A;  1BZA A;  2JE5 A;  3V3R A;  3E2K A;  4PM9 A;  1PWD A;  1PW8 A;  3HLW A;  4OPQ A;  5CRF A;  3HRE A;  5A93 A;  4ZTK A;  5AQB A;  5EE8 A;  5F83 A;  4B88 A;  5FQK A;  3UE3 A;  1ERM A;  4JXG A;  4HEF A;  5GHZ A;  1K4E A;  3C7V A;  1ERO A;  2XFS A;  4BQM A;  4P85 A;  3AGF A;  2Y2M A;  5HAQ A;  1FSY A;  1MXO A;  1YT4 A;  4FD8 A;  1WYC A;  4QD4 A;  4DXB A;  4OLD A;  4MBH A;  4BL3 A;  1FCO A;  3DTM A;  3NDE A;  4GKU A;  3MBZ A;  3IH8 A;  4N9L A;  3BLM A;  3HLB A;  3PBO A;  2C5W B;  5F1G A;  2Y4A A;  5TGF A;  3CMZ A;  3M2K A;  2ZQ8 A;  3MFD A;  1GCE A;  4ZBE A;  1CK3 A;  4DKI A;  3HUN A;  4E3J A;  1ZC2 A;  5CXW A;  1IYQ A;  1K25 A;  4N1X A;  5E2G A;  3ZVT A;  1XKZ A;  2VGK A;  5E2H A;  2IWD A;  2XF3 A;  1M40 A;  4K0W A;  1BT5 A;  1LL9 A;  3VFF A;  1K54 C;  4FSF A;  1E3U A;  2XR0 A;  2V20 A;  2EX9 A;  4OPR A;  1LI9 A;  3RJU A;  4E3K A;  3ZG9 B;  2EX6 A;  3FYZ A;  5EVL A;  3SS5 A;  1RGY A;  3LY4 A;  3OCL A;  3UO9 A;  4JXS A;  5CED A;  3VMA A;  4OH0 A;  4RA7 A;  2FFY A;  1KE4 A;  4PM6 A;  3S1Y A;  4OVD A;  1XP4 A;  2Q9N A;  3CZD A;  1DJC A;  1BUL A;  1DY6 A;  1KGG A;  2HDQ A;  4LEN A;  4OPZ A;  5DF8 A;  4R0Q A;  5CTM A;  1XA7 A;  4S2J A;  5E2F A;  2ZC6 B;  1O07 A;  3C5A A;  1IYP A;  5FI2 A;  1H8Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...