1PZPA

Tem-1 beta-lactamase in complex with a novel, core-disrupting, allosteric inhibitor
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
263
structure length
263
Chain Sequence
HPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQRDLVEYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Beta-lactamase TEM
publication title Allosteric inhibition through core disruption.
pubmed doi rcsb
source organism Escherichia coli
total genus 93
structure length 263
sequence length 263
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2003-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1pzpA00
2PU4A 3UDIA 4QJGA 2ZM2A 1ZG4A 2Z2LB 2EX8A 1PW8A 2ZJ9A 3UN7A 4P85A 2PBYA 1YQSA 4MBFA 1XKZA 5GLAA 3VP4A 5KSCA 1HD8A 3G2YA 4ZJ3A 4N1XA 4BENA 1HVBA 4RYEA 2OV5A 3VMAA 3UE0A 2WKHA 3UY6A 2XH9A 4U0TA 4YFMA 1IYPA 3M6HA 5HAQA 1XA7A 1KGEA 1BLSA 3IHBA 3HUNA 1RCJA 3P98A 3IF6C 2Y2HA 1FR1A 5AQAA 3VSKA 4OVDA 2WYXA 3HREA 3MXSA 3QNCA 1GA0A 1SCWA 2G2WA 5CGXA 4K91A 1MKIA 4U0XA 4LV0A 2R9XA 4Y7PA 5TFQA 1L0GA 1XGJA 3ZDJA 2Y4AA 4JXGA 2OSUA 4K0XA 4S2MA 4WMCD 5FQKA 5CTMA 5HX9A 1L2SA 2C6WB 4GN2A 1K57C 1W8YA 1ESIA 2HDSA 4IVIA 4KQOA 5FQIA 5FQMA 4XUZA 1ZG6A 4WEKA 1IYSA 5FQ9A 5CTNA 5KMWA 2ZQDA 3WS2A 1W5DA 1SDEA 1PYYA 3PBOA 1DJBA 3UPOA 2P74A 1IYQA 5EUAA 5FAPA 1DY6A 4JBFA 5CHMA 3SH9A 3V3RA 3ZG5A 2XEPA 4WEJA 5FQQA 3O3VA 4UA7A 1QMFA 2E8IA 2B5RA 2EFXA 2IWDA 3IXHA 5CHJA 1K56D 1FCOA 3ITBA 3NDGA 1BLCA 2OLUA 4B4XA 4E6XA 2J9PA 3N7WA 3OPHA 3UPPA 1MWUA 3IF6A 1XP4A 3EQUA 3RJUA 3G2ZA 2R9WA 1K4FA 5FATA 1K55C 1DJCA 3VP2A 1H5XA 4LCMA 3N8LA 3PBSA 1NRFA 1MWTA 3SOIA 3IF5A 2ZC4B 2P9VA 4MNRA 5D3OA 1K54A 3ZCZA 4C3QA 3IQAA 4KG5A 4EBPA 4M3KA 1IKGA 1KGGA 1KE3A 5FI6A 4LV2A 3UE3A 2H10A 4E3OA 2XDMA 3C7VA 1YLWA 3DWZA 4KQRA 5CERA 2Y2JA 3GQZA 1VM1A 2ZQ7A 1KDSA 5IHVA 1GHIA 2JC7A 3VOYA 4Y0TA 1L0DA 2XLNA 3Q7VA 5HAIA 3UO9A 1PI4A 1EROA 1DJAA 1EI5A 2JCHA 4KENB 5F1GA 5DTSA 2Y59A 3IH8A 1U60A 3UDFA 3N8RA 3WWXA 5GHXA 1ES3A 2J9OA 5CRFA 4OPYA 4RX2A 4DE2A 3A3JA 4GZBA 3GRJA 4KG6A 4N1HA 3PAGA 3BECA 4JXWA 3IXBA 5HARA 4ZJ2A 1NXYA 1I2WA 3GTCA 5DF8A 3G34A 1ZKJA 4QY6A 5FAQA 4A5RA 1IEMA 2ZC5B 5GLCA 4DXBA 2EX6A 3IXDA 1K56A 5U47A 1XGIA 4S2JA 2J8YA 1ESUA 5HL1A 4DXCA 1YLYA 5M19A 1BSGA 2X71A 4MEZA 1XPBA 1PIOA 5GL9A 2XQZA 4YINA 3D4FA 4KZ5A 2A3UA 4DE0A 4GOGA 3AGDA 3VP1A 1XXMA 5DF7A 3GV9A 3G4PA 3FV7A 1K4EA 1JWVA 3OPLA 2G2UA 2WKIA 4JLFA 2Y2OA 2V1ZA 3LY4A 1GHPA 1ES2A 4PMAA 5DVAA 1CK3A 2Q9NA 4Q8IA 2DRWA 3IWQA 3A3IA 5FSRA 3IWIA 4BL2A 2WGWA 5A93A 3G31A 5A91A 4BJPA 3S22A 3OPRA 4UA9A 1YMXA 3VFFA 3E2KA 1NYMA 3QNBA 1KVLA 4IBXA 2V20A 3CMZA 4BL3A 5KZHA 1Z6FA 1K6RA 3O88A 1PWDA 1WYCA 3LCEA 4FD8A 4OONA 4PPRA 4S2NA 1PZOA 3MZDA 1I5QA 1FSWA 4OOLA 4R23A 4BLMA 3GMWA 3S4XA 2HPBA 3NI9A 4O7DA 1TDGA 3TSGA 1NZUA 3IT9A 5E2EA 3V50A 1BZAA 5EVID 3NY4A 3WRZA 3HLGA 3BLSA 3HLEA 5HFOA 4JF5A 1HTZA 1NZOA 3ZG0A 4KZAA 2IWCA 3FKVA 1K54C 1JWZA 3O86A 4OP5A 4B88A 1GHMA 2ZQ9A 3M6BA 1JTGA 2FFFB 3GR2A 3OZHA 4PM6A 2ZD8A 3DWKA 2V2FF 3BLMA 1RGYA 5E43A 1C3BA 3BEBA 3OPPA 4JPMA 5CEBA 5TR7A 2WAFA 3FYZA 4X56A 3SS3A 1PWGA 4S2KA 3TG9A 4DF6A 1KE0A 1TDLA 1BTLA 4UAAA 5EVIC 5FDHA 2WKEA 3AGEA 3FKWA 3OCLA 3AGFA 1BULA 4X55A 4GD6A 4S2LA 3IWOA 2OLVA 3A3DA 4E3LA 5CECA 1HZOA 1GCEA 3BM6A 4RX3A 3V39A 1RP5A 5A90A 1MWRA 1KDWA 4LCLA 4DE3A 2Y2GA 1BT5A 1S0WA 4IBRA 2XD1A 3BFCA 2Y55A 2BG1A 2HDQA 4IEDA 3UPNA 4K0WA 1YM1A 3HLFA 4OPRA 3CZDA 1E3UA 3MZFA 5EE8A 2ZQAA 3MKEA 5JYOA 3HUOA 3BYDA 1MXOA 4PM8A 3HBRA 3W4OA 4E3MA 4EV4A 5M18A 3G35A 5CXWA 2BLSA 2PU2A 4E3JA 3EQVA 4H8RA 3ZNYA 5AQ9A 1L0EA 4RVAA 2XF3A 3SH7A 4XUXA 4CPKA 5EVIA 1FQGA 1K25A 1M6KA 2ZQ8A 3C4OA 4FCFA 4OOMA 2Q9MA 2HDRA 4S2IA 5I94A 2HP5A 3W8KA 4KZ9A 1MY8A 1LI9A 4OH0A 2VGKA 4P87A 1Q2QA 2JBFA 2JE5A 1ALQA 2WK0A 3GSGA 1CI8A 5CHUA 4P6BA 4E3KA 1WE4A 4JXSA 1LI0A 1NJ4A 4U3TA 3IH9A 4LV1A 5E2FA 5G18A 1XA1A 3HL9A 1ERQA 5L2FA 3IF6B 1S6RA 3FZCA 3Q82A 5E2HA 4X6TA 5BOHA 4S2PA 4R0QA 3OC2A 4S2NC 4JF6A 1W7FA 1YLJA 1LHYA 4OKPA 5F82A 1SKFA 3C5AA 3O87A 4N9LA 4Y0OA 2P9VB 4WELA 3HVFA 1YMSA 4OP8A 2H0TA 3A3EA 4R3BA 4X69A 4KZ3A 3NC8A 4GDBA 5CGSA 3ZVWA 5EVLA 5HAPA 2Y2NA 2HP9A 3C7UA 4D2OA 4HBTA 4JKTA 1IELA 5KSHA 4C6YA 3WS0A 4DKIA 3S1YA 4FH2A 3PTEA 3FWLA 3BFDA 2WZZA 3MKFA 3PBQA 3ZG9B 4E3NA 1CEGA 4KZ4A 2ZLYA 3ZGAB 1TEMA 1SDNA 3Q7VB 1SHVA 4MBHA 4OQ0A 1E25A 3MXRA 3PBNA 4RA7A 2EXAA 4E3IA 2Y2IA 1ES5A 3RXWA 1E3UD 4DRTA 2ZC6B 5CEDA 3HLCA 1ONGA 1CI9A 4OPQA 3A3FA 1OMEA 1LL9A 3BFGA 4XXRA 4WZ5C 5AQBA 1J9MA 3ZNTA 4HBUA 4EBLA 2Y2MA 3Q07A 3W4PA 4QHCA 1NYYA 2WZXA 1AXBA 1JVJA 4P0MA 2DCFA 2QMIA 1BLPA 2XFSA 5DF9A 3N6IA 4QU3A 3IHAA 3ITAA 5EECA 5FI7A 1JTDA 4EUZA 1IKIA 2Y2KA 3I7JA 1BLHA 3WRTA 2UWXA 3QHYA 1MBLA 2WUQA 4PM7A 5M1AA 3HLBA 1FCMA 1I2SA 4Z9QA 4PM5A 1K6SA 2XR0A 5TGFA 1O7EA 2X01A 2RCXA 4R1GA 3LO7A 3ZHHA 4ZJ1A 5FASA 1ES4A 4ID4A 5F83A 4QD4A 2EXBA 3M2JA 4LENA 5GHYA 4DDSA 1GA9A 3M2KA 2HP6A 3NIAA 5DTKA 4ZTKA 1KVMA 1FOFA 3Q1FA 2DNSA 4L0LA 1ERMA 1IYOA 4HEFA 1YT4A 4GB7A 1QMEA 1G6AA 2XD5A 3N8SA 2WGWB 5FA7A 3LY3A 4WZ5A 3V3SA 4OOYA 4KQQA 4DDYA 2ZC7A 4OLGA 3ZG7B 4X53A 1LL5A 1MPLA 1NY0A 5GLDA 1E4DA 4UA6A 4QB8A 3Q7ZA 2EX2A 4MBKA 5F1FA 5CGWA 1H8ZA 2HDUA 1L0FA 4WZ4A 1PWCA 3W4QA 4OQGA 4X68A 3MFDA 1FCNA 2FFYA 3WS1A 4BD0A 1KGFA 4GKUA 4GDNA 4R4SA 2EX9A 4LV3A 3MBZA 3IXGA 1EWZA 2CC1A 3V5MA 4EQIA 4GNUA 1YLTA 3BRMA 4QY5A 3LEZA 3PBTA 3VP0A 4CJNA 1M40A 3E2LA 3NCKA 1W8QA 4JXVA 2IWBA 3VSLA 1FR6A 4HESA 2Z2MB 3UNWA 2WGIA 3JYIA 1PW1A 3HLWA 5GLBA 2H0YA 3BFEA 5FAOA 4EWFA 1W79A 1Q2PA 1XX2A 2ZMAA 4OLDA 4WYYA 1FSYA 4DE1A 1K57A 4BQMA 4MLLA 4IVKA 1N9BA 3HUMA 4OQIA 3VFHA 3UDXA 1RGZA 3PBRA 4NETA 4R3JA 1N4OA 3B3XA 1KE4A 4ZBEA 4JF4A 5A92A 1LLBA 4R4RA 4B4ZA 1BUEA 2VGJA 1TVFA 3SH8A 2WADA 1MWSA 2XGNA 3BFFA 2Y2QA 2A49A 4KZ6A 3HLDA 1ONHA 4KG2A 4KZ8A 5JYPA 2I72A 3C4PA 2X02A 1JWPA 5EPHA 1YLZA 2Y2LA 3PAEA 4F94A 1CEFA 1H8YA 2WAEA 2XK1A 2ZM8A 4OQHA 4WMCA 2Y2PA 3VOZA 4OPZA 1O07A 4N9KA 4Y0UA 1G68A 4WBGA 1K38A 1PZPA 3RXXA 2Y91A 2WGVA 1K55A 3TOIA 3VP3A 5EOOA 3GVBA 1PI5A 3WS4A 5EOEA 3NDEA 3ZFZA 1VQQA 2ZC3B 3MZEA 2RL3A 4PM9A 4ZAMA 2H5SA 3DW0A 4UHUA 3ZG8B 2ZQCA 5E2GA 3CG5A 4WM9A 1ZC2A 4FSFA 2QZ6A 2EFUA 4N92A 5GHZA 1YLPA 3ISGA 4EBNA 3ZVTA 3G30A 4C75A 4GD8A 4S2OA 5AQ7A 4ZDXA 2GDNA 1Y54A 5HW3A 2J7VA 5EVIB 4FH4A 3Q81A 4BD1A 3CJMA 4E6WA 5DTTA 3OCNA 5FI2A 3G32A 4KZ7A 3P09A 3WS5A 3N4IA 3SS5A 3NBLA 1WYBA 4NK3A 2XFTA 3SS4A 5J8XA 2ZM0A 5FQJA 2C5WB 3UE1A 3DTMA 4KZBA 2QPNA
chains in the Genus database with same CATH superfamily
4ARZA 3LICA 2UV0E 2ZM2A 2Z2LB 1S4SA 3UN7A 4X1LA 1CJFA 4GS9A 4BENA 1D1JA 3UY6A 2QHKA 4YFMA 1IYPA 3CUEA 3IHBA 5TJJA 1RCJA 5L8MA 3IF6C 3CHWP 5AQAA 1NRJA 4OVDA 3MXSA 5TFQA 4Y7PA 4S2MA 3FG8A 4WMCD 5HX9A 1L2SA 1K57C 4IVIA 5FQIA 3E4QA 2PBDP 4L9GA 2WKQA 2ZQDA 3WS2A 1IFQA 5FAPA 5CHMA 1OT6A 2XEPA 4EQ1A 4UA7A 3IXHA 3ITBA 1BLCA 2OLUA 4E6XA 5HL6A 3IF6A 2ZMFA 1XP4A 4F3LB 2ZMVA 5FATA 3VE3A 1H5XA 1WA9A 2M7VA 1NRFA 1MWTA 3KSIA 2GZAA 3SOIA 2HV1A 2P9VA 4C3QA 4EBPA 2QJ7A 4LV2A 4KQDA 1YLWA 5CERA 4NKPA 1KDSA 4Y0TA 2WKPA 3UO9A 3R7WA 1EROA 3SW1A 1DRMA 2JCHA 4KENB 3JVVA 4I3AA 1IOUA 2V9AA 1VETA 3GRJA 3BECA 3HJKA 3C8CA 4X1MA 4Q0IA 4O01A 4UQIS 1NXYA 1ZTUA 3GTCA 5DF8A 3P7NA 4DXBA 5U47A 1D7EA 1XGIA 1G28A 5M19A 2X71A 1XPBA 3P01A 2XQZA 5G4ZA 4YINA 2M7UA 3D4FA 2B02A 3VP1A 3B42A 3F1OB 4EERA 3G4PA 1JNUA 3FV7A 1JWVA 2GJ3A 5HWTA 5A91A 2Y2OA 1V9ZA 3BWLA 3MSHA 3UB7A 3S22A 2VGLS 3OPRA 4UA9A 1YMXA 3VFFA 3R4KA 4H6JB 1KVLA 2V20A 4BL3A 3LUQA 3BJNA 4OONA 4BLMA 1PZOA 1TS0A 3MZDA 4R23A 3GMWA 3S4XA 4O7DA 1TDGA 3LYXA 3TSGA 5E2EA 5EVID 3NY4A 2J3TD 4E04A 3VV4A 4MN7A 4GHIA 4OP5A 1K54C 2NUTC 1GHMA 2ZQ9A 2EWVA 1DP6A 1W63M 4DJ2A 5L07A 4HJ6A 4ETZA 3H7WB 3VOLA 2WAFA 3FYZA 2PD7A 3QP4A 1P97A 3OCLA 3AGFA 4X55A 3B47A 5DKLA 4S2LA 3A3DA 1MWRA 5F69A 4K0WA 2V1AA 2XA7M 3RH8B 1DP8A 1LSVA 1E3UA 5EE8A 2JKFA 3UB6A 5JYOA 4FOFA 3T4LA 3ICYA 4EV4A 2W1TB 5M18A 3G35A 3IX3A 3EQVA 4LGWA 5AQ9A 1L0EA 4BWIA 1M6KA 3C4OA 3CITA 3W8KA 4P87A 4HH3A 2JE5A 4Y2FA 2O9AA 4P6BA 5CHUA 3JPUA 3LR0A 1S6RA 3Q82A 4G3KA 4HH2A 1G6OA 2PRFA 4S2PA 1VB6A 4R0QA 4UEYA 4JF6A 1W7FA 1SKFA 3QP8A 4K08A 5IT5A 3TW8A 3A3EA 4KZ3A 5HAPA 3ZVWA 5EVLA 4D2OA 4JKTA 5MC7A 5KSHA 3S1YA 3BFDA 4E3NA 4XT2A 4HJ3A 3ZGAB 4UQIM 1SDNA 3Q7VB 2WKRA 3PR6A 2Y2IA 2HGVA 2KLIA 4HBUA 2LB5A 4QHCA 3QP5A 3LEQA 2QMIA 2XFSA 3A0VA 5FI7A 1JTDA 4EUZA 1BLHA 3WRTA 3H82A 3QHYA 1I2SA 4Z9QA 2XR0A 2G7UA 2VGLM 1O7EA 2X01A 1S1ZA 2KX6A 5F83A 2EXBA 1GA9A 3QP6A 3NIAA 3UB5P 3N8SA 4MMNA 2XD5A 5FA7A 4JGPA 3D9YA 3V3SA 4X53A 4LRYC 1NY0A 2DMWA 3KSFA 4QB8A 2EX2A 5F1FA 4HOIA 4LLOB 4WZ4A 3W4QA 1OJ5A 1FCNA 2FFYA 2GX5A 1KGFA 2L4RA 4LV3A 1Y28A 4GLQA 4EQIA 4LPZA 4QWOA 3PBTA 1M40A 4PKYG 1LT0A 4HESA 3UNWA 4GW9A 3TE8A 4R70A 3HLWA 3T4QA 4Y13A 4EWFA 4DJ3A 1W79A 1XX2A 2HZ5A 4HQAA 3DBAA 4IVKA 1N9BA 2VV7A 4OQIA 3PBRA 4NETA 1N4OA 1D06A 1KE4A 4JF4A 1LLBA 2P08A 4B4ZA 1TVFA 2WADA 2A49A 1YLZA 4CLCE 1CEFA 1H8YA 2XK1A 4WMCA 1O07A 4N9KA 1K38A 3RXXA 3KYQA 4NXBA 2ZC3B 4PM9A 2RL3A 4O0PA 3DW0A 3NJAA 3ZG8B 3CAXA 3CG5A 4WM9A 1ZC2A 3IS2B 2QZ6A 2EFUA 3MFXA 4C75A 3G30A 5AQ7A 3BQAA 5HW3A 5EVIB 3Q81A 4BD1A 4LRXC 5DTTA 4YWZA 3G32A 3P09A 3N4IA 5TBMA 3SS5A 2V8CA 2XFTA 3SS4A 5FL3A 5J8XA 4Y17A 3ZQ5A 3UE1A 2E8JA 2O9BA 2PU4A 2VV6A 1ZG4A 2EX8A 1PW8A 1YQSA 4LRZE 3VP4A 1HD8A 3T4TA 3VMAA 5J7EA 3M6HA 1KGEA 1BLSA 3LR3A 3HUNA 3U4LP 3P98A 1GA0A 1SCWA 1G5UA 4K91A 1L0GA 1ACFA 1S67L 2KOIA 2Y4AA 5CTMA 1T18A 4GN2A 1W8YA 1BYWA 2HDSA 4KQOA 4NG2A 4WEKA 2VJWA 1N9NA 5CTNA 1W5DA 1SDEA 1PYYA 3PBOA 3UPOA 2P74A 4L9EA 4PHTA 3SZTA 1DY6A 1J3WA 2B5RA 1SKOB 2JKTI 4B4XA 2J9PA 3OPHA 3EEHA 3EEAA 4RQ9A 3UPPA 2OOLA 3EQUA 2ZOHA 3RJUA 2V0UA 1K55C 1DJCA 3VP2A 1TS7A 4LCMA 3OLOA 3IF5A 2ZC4B 1OTDA 4ME4A 4M3KA 1GSWA 3UE3A 2H10A 4E3OA 2W0NA 5DFXA 3GQZA 1VM1A 5IHVA 1GHIA 1L0DA 2XLNA 1L3LA 1DJAA 1EI5A 5F1GA 2Y59A 4JGRA 3UDFA 5GHXA 2J9OA 4OPYA 4RX2A 1T1AA 4N1HA 3PAGA 4HP4A 4II7A 3ZYTA 4JXWA 2OAP1 3LIEA 4QY6A 2ZC5B 1K56A 3GECA 3C38A 2PD8A 4AFIA 5GL9A 5EM0A 2LB9A 4KZ5A 4DE0A 3AGDA 1XXMA 3OPLA 2WKIA 4JLFA 2V1ZA 3BQ8A 3A3IA 4KUKA 3IWIA 5FSRA 1LSXA 3G31A 4PKYA 4Q0HA 1X0OA 4IBXA 3CMZA 1Z6FA 4S2NA 1FSWA 2ZOIA 1CQAA 1VEUA 4PAUA 4WUJA 3LGOA 4BBTA 3F1NA 1HTZA 3FKVA 4B88A 3M6BA 1JTGA 4MN5A 2FFFB 3GR2A 2XA7S 1Z09A 2ZD8A 5E43A 1C3BA 3BEBA 5J3WA 2GNXA 4X56A 3SS3A 2VK3A 1F5MA 1KE0A 5FDHA 2WKEA 3FKWA 1BULA 4GD6A 2OLVA 4E3LA 4HNBA 3BM6A 4GJ4A 5A90A 1S1YA 1S0WA 2XD1A 3NOPC 3BFCA 2OWHA 3CZDA 3MZFA 1YSPA 2ZQAA 4I38A 3T1SA 3MKEA 3UMEA 3BYDA 1MXOA 4PM8A 3W4OA 4EESA 2V0WA 4H8RA 2BASA 2XF3A 3SH7A 3T4SA 2ZQ8A 2Q9MA 3CPTB 2HDRA 5I94A 2FH5A 2HP5A 4KZ9A 4MDZA 1MY8A 1OTIA 2JBFA 5EV0A 1WE4A 5CX7A 4Y5FA 3IH9A 5E2FA 5G18A 3HL9A 4WN5A 1XJ6A 1N9LA 4JGQA 3O87A 4Y0OA 4WELA 1YMSA 4OP8A 3FPVA 3EGDC 4FTXA 3RTYA 3B33A 1YAXA 4C6YA 4FH2A 3PTEA 3FWLA 3PBQA 3ZG9B 1TEMA 1P0ZA 1SHVA 4Z1WA 4MBHA 1E25A 3MXRA 3PBNA 4DRTA 3K3CA 2XROA 3FPWA 1CI9A 2JKTM 3BFGA 5AQBA 4CLCD 4EBLA 2WZXA 4F3LA 1BLPA 5DF9A 5IS1A 2IA2A 2O99A 3I7JA 3BW6A 2WUQA 1F98A 4PM5A 4Y15A 2RCXA 4R1GA 2J3WA 4ZJ1A 1ES4A 3M2JA 4DDSA 3M2KA 2HP6A 4ZTKA 1KVMA 4BMWA 3Q1FA 4L0LA 1IYOA 1YT4A 1QMEA 1G6AA 2WGWB 4OOYA 2ZC7A 3ZG7B 1MPLA 1T1CA 1XJ3A 3MFDA 1OTBA 3T50A 4CQHA 4GKUA 2PHYA 3MBZA 3IXGA 2Y79A 4ESPA 4ZRRA 3BY8A 3VP0A 4CJNA 3E2LA 3PXPA 4JXVA 3VSLA 2IWBA 2WGIA 3JYIA 2Z6CA 5GLBA 3MF0A 4DE1A 4WYYA 4MLLA 3KSGA 3F1OA 3B3XA 4ZBEA 4I3JA 1BUEA 4HP9A 3HLDA 4KG2A 5DJUA 3CLOA 3C4PA 5EPHA 2QJ5A 4F94A 2Y2PA 2YKHA 4OPZA 4H6JA 1NLYA 1SZVA 1PZPA 3TOIA 3K3DA 1PI5A 3ZFZA 3IBJA 4EU0A 1VQQA 4UHUA 2D01A 5E2GA 5DJTA 1OTAA 3D3OA 4ETXA 2VA0A 1EW0A 5GHZA 4NXFA 2ZL1B 3C30A 1XJ2A 3ISGA 3NHQA 3ZVTA 4O8GA 4R38A 4KUOA 4IUKA 3CJMA 5FI2A 1S4RA 1T19A 5EFWA 2C5WB 2QPNA 2QWSA 1NWZA 3EGXC 5FDSA 4QJGA 4P85A 1CF0A 1XKZA 5GLAA 4ZJ3A 5FEFA 4B9OA 3UE0A 2WKHA 3E4OA 2XH9A 5F68A 2L0WA 4YNRA 1P9WA 1XA7A 3W2ZA 1K0KA 2Y2HA 2VV8A 3VSKA 2A2LA 2WYXA 3CI6A 2W1TA 5CGXA 2VZWA 1MKIA 4U0XA 4LV0A 2R9XA 1XGJA 4JXGA 2OSUA 2O0YA 3LI9A 2M1CA 1UGUA 1IYSA 5FQ9A 5K5BA 1IYQA 1V9YA 5TBMB 4JBFA 3SH9A 3V3RA 3ZG5A 5FQQA 2A24B 2H28A 1Y4OA 4BBUA 3UE6A 4MNRA 4M4XA 3ZCZA 3IQAA 4KG5A 5AVFA 2PAVP 4IUHA 5HDDA 3MMHA 1GSXA 2XDMA 3C7VA 4KQRA 3DWZA 5DKKA 4WF0A 4EETB 2JC7A 3IX8A 3Q7VA 4HHDA 1PI4A 1OTEA 3LIBA 5DFYA 1U60A 3N8RA 2P04A 3H9WA 3T4OA 1ODVA 3A3JA 4GZBA 2Y8HA 4P6ZS 3IXBA 3OOVA 1I2WA 3MQ0A 3G34A 1ZKJA 1IEMA 4CLCB 1NLZA 2EX6A 4S2JA 2J8YA 1ESUA 1YLYA 1BSGA 3F1PB 3VE4A 2A3UA 3GV9A 1DP9A 3LY4A 1GHPA 1CK3A 4Q8IA 3IWQA 2NUPC 4BL2A 2W1RA 4G3VA 4BJPA 3QNBA 1PWDA 1WYCA 2OWJA 2OAQ1 3NI9A 1NZUA 3IT9A 3HLGA 4EEUA 5HFOA 4JF5A 3IBRA 1NZOA 4KZAA 3O86A 1JWZA 1TD5A 4JGOA 3OZHA 4PM6A 2V2FF 3L7HA 5AVEA 2B18A 5CEBA 4S2KA 1TDLA 1BTLA 5EVIC 4ARZB 2MJ6A 2Z6DA 3AGEA 2J3TC 4NXGA 2V8FA 4GS9B 5CECA 1HZOA 3V39A 1RP5A 2HJEA 1KDWA 4LCLA 4DE3A 2Y2GA 4IBRA 3E98A 3IX4A 2HDQA 1YM1A 3HLFA 4EXOA 3HUOA 1PNEA 1KOUA 2BLSA 3F1NB 4E3JA 3IS2A 4RVAA 3HJIA 1AWIA 3U2AA 5EVIA 1FQGA 1K25A 1A0KA 4WL9A 1H3QA 4S2IA 1LI9A 2VGKA 4JXSA 3O5YA 2AVXA 1NJ4A 2D02A 1ERQA 3IF6B 3OC2A 3LR4A 4S2NC 1YLJA 3G6OA 5HPIA 4OKPA 4N9LA 2P9VB 2H0TA 2YKFA 5CGSA 2W27A 4GDBA 3UB9A 2K31A 2Y2NA 4X25A 4B93A 4L9FA 1IELA 4DKIA 3FC7A 3MKFA 2VKSA 4P6ZM 1CEGA 3A0RA 1W63Q 3R7WB 4RA7A 4Q0JA 1ES5A 3RXWA 2ZC6B 5CEDA 3A3FA 1LL9A 2JKRI 4XXRA 4WLAA 1VETB 4WZ5C 3T12B 3ZNTA 1SKOA 2PR6A 3Q07A 1ZHHB 3W4PA 1FIKA 1AXBA 4P0MA 5F5YA 2DCFA 2UWXA 1MBLA 2O9CA 1K6SA 1N9OA 5TGFA 5FASA 4ID4A 5KIZA 2HF6A 3S7OA 5DTKA 4I5SA 1ERMA 1GSVA 4HEFA 5LBRA 3EWKA 4WZ5A 2K7SA 2W3EA 4DDYA 2PR5A 5GLDA 3Q7ZA 4MBKA 5CGWA 1L0FA 1PWCA 4OQGA 4X68A 4GDNA 2EX9A 1EWZA 2XSSA 1YLTA 3LI8A 4GHIB 2Z2MB 5HPFA 3MJQA 1Q2PA 2ZMAA 1FSYA 1K57A 3S7PA 2K2NA 3VFHA 1RGZA 1TF1A 5EVEA 5A92A 5FEGA 1F9IA 2VGJA 3BFFA 4KZ6A 4KZ8A 2I72A 2X02A 1JWPA 2Y2LA 2EWWA 1G68A 4EEPA 4WBGA 2WGVA 2W3HA 3VP3A 5EOOA 3GVBA 3WS4A 5EOEA 3NDEA 3T1RA 3T1XA 4ZAMA 5HWVA 3GDIA 3D72A 4FSFA 4N92A 2ACGA 1YKDA 4EBNA 5HWWA 4GD8A 4ZDXA 2GDNA 2J7VA 4E6WA 3OCNA 4KZ7A 3MS6A 3NBLA 4NK3A 4YOFA 1YSQA 5FQJA 3S7NA 3MQQA 3UDIA 4NEED 2ZJ9A 2PBYA 4MBFA 5KSCA 2W3GA 3G2YA 4N1XA 1HVBA 4RYEA 2OV5A 4U0TA 5HAQA 1FR1A 3HREA 3QNCA 2G2WA 2QYBA 3T4KA 3ZDJA 4K0XA 3DTIA 5FQKA 4IJGA 2C6WB 4XT2B 1ESIA 5FQMA 4XUZA 1ZG6A 3CPTA 5KMWA 2JHEA 2VEAA 1DJBA 5HZHA 5HDCA 5EUAA 2HJ9C 4WEJA 3O3VA 1QMFA 2E8IA 5CHJA 2EFXA 2IWDA 2JKGA 1K56D 4DMZA 1FCOA 3NDGA 3NOUC 3N7WA 3TRCA 1MWUA 5L09A 3CWFA 3G2ZA 2R9WA 1K4FA 3H82B 3N8LA 3PBSA 4BBVA 3PYPA 3E0YA 5D3OA 1K54A 1F2KA 4HIAA 5FI6A 1IKGA 1KGGA 1KE3A 5L10A 2Y2JA 1FILA 2ZQ7A 3VOYA 5HAIA 3NULA 3UB8A 3KO6A 2JKRM 5DTSA 3IH8A 3WWXA 1ES3A 5CRFA 4DE2A 1H0MA 3S7QA 4KG6A 4QPRA 5HARA 4ZJ2A 2W3FA 3KYZA 5FAQA 4A5RA 5GLCA 1XFNA 3IXDA 4HJ4A 4D60A 5HL1A 4DXCA 4MEZA 5EM1A 1PIOA 4EW7A 2XRNA 1XFQA 4GOGA 3H7WA 5DF7A 1T1BA 1K4EA 3MXQA 2G2UA 1ES2A 1HLUP 4PMAA 5DVAA 2Q9NA 5C5KA 2DRWA 2WGWA 3NECA 5A93A 2INWA 2FZ0A 1VHMA 1NYMA 3E2KA 5KZHA 1K6RA 3O88A 4PPRA 4UA6A 3LCEA 4FD8A 4OOLA 1I5QA 2HPBA 3V50A 1BZAA 3WRZA 2ZBBA 3BLSA 3HLEA 3ZG0A 2V1BA 2IWCA 3E4PA 3QP2A 3RFBA 5A8BA 3MR0A 4HY8A 3DWKA 3BLMA 3DAVA 1OPXA 1RGYA 3OPPA 4JPMA 5TR7A 3QP1A 1PWGA 3TG9A 4DF6A 4UAAA 3IWOA 1GCEA 4RX3A 3PHYA 2JN7A 1BT5A 2P7JA 2Y55A 1STZA 2BG1A 2W3DA 4IEDA 3LR5A 3UPNA 4OPRA 5I5LA 3EOIA 3HBRA 4NXEA 4E3MA 5G4YA 5CXWA 4R6LA 2PU2A 3ZNYA 2ZL1A 3UMDA 4XUXA 4CPKA 5IU1A 1LSWA 4FCFA 2R78A 4OOMA 1H8MA 3KX0X 1XJ4A 4OH0A 1PFLA 1Q2QA 4IHQA 4DN0A 5HDSA 4MCWA 1ALQA 2WK0A 3NOTC 3GSGA 1CI8A 3ULFA 4E3KA 2J80A 1LI0A 2L1MA 4U3TA 2B95A 5L2FA 4I3IA 4LV1A 1XA1A 3FZCA 5E2HA 4X6TA 5BOHA 1LHYA 1UWNX 3JVUA 5F82A 3C5AA 3TJZC 1TS8A 3KYEA 3HVFA 4X69A 4R3BA 3NC8A 2HP9A 4Y3IA 3C7UA 4HBTA 2QKPA 3WS0A 2WZZA 4KZ4A 2ZLYA 4EUVA 2VLGA 4OQ0A 4E3IA 2EXAA 1E3UD 3HLCA 1ONGA 4OPQA 1OMEA 2A24A 1J9MA 3MQOA 4I39A 2Y2MA 2PYRA 1NYYA 3A0SA 1JVJA 1S66L 3BY9A 3V67A 3N6IA 4QU3A 1LL8A 3IHAA 3ITAA 5EECA 1IKIA 2Y2KA 3T4JA 4PM7A 5M1AA 3HLBA 1FCMA 3LO7A 4CLCC 3ZHHA 2BTFP 1YPRA 1PRQA 4QD4A 3DTKA 4LENA 5GHYA 1FOFA 2DNSA 4GB7A 1UWPX 5J4EA 3LY3A 3L9KA 2PT7A 3LIDA 4KQQA 4G3WA 4OLGA 4LFUA 3T1QB 1LL5A 1E4DA 4HI4A 1H8ZA 1P9RA 2HDUA 3WS1A 4BD0A 2CMNA 2EA9A 1VEUB 4R4SA 2CC1A 3V5MA 3LIFA 4GNUA 4QY5A 3BRMA 2KDKA 3LEZA 1OJGA 4CLCA 3NCKA 1W8QA 1FR6A 2I9VA 4FUWA 1PW1A 2H0YA 3BFEA 5FAOA 1OT9A 3F1PA 4OLDA 1MC0A 4GCZA 4BQMA 3HUMA 3OBFA 5HSQA 3UDXA 4R3JA 4R4RA 4R3AA 1TS6A 3LIAA 3SH8A 1MWSA 2XGNA 2Y2QA 1ONHA 3C2WA 5JYPA 3PAEA 3HCYA 1MKMA 2WAEA 2ZM8A 4OQHA 3VOZA 4Y0UA 2PYPA 2Y91A 1K55A 2PDRA 3DTEA 5AJGA 2Q0OA 3MZEA 3KSHA 2H5SA 2ZQCA 5HD3A 3CUEC 3K2NA 5F6AA 1MZUA 1YLPA 4MN6A 4S2OA 1Y54A 3LFVA 4FH4A 3WS5A 1WYBA 2ZM0A 5HD5A 3DTMA 4KZBA 2VX8A
chains in the Genus database with same CATH topology
2PU4A 3UDIA 4QJGA 2ZM2A 1ZG4A 2Z2LB 2EX8A 1PW8A 2ZJ9A 3UN7A 4P85A 2PBYA 1YQSA 4MBFA 1XKZA 5GLAA 3VP4A 5KSCA 1HD8A 3G2YA 4ZJ3A 4N1XA 4BENA 1HVBA 4RYEA 2OV5A 3VMAA 3UE0A 2WKHA 3UY6A 2XH9A 4U0TA 4YFMA 1IYPA 3M6HA 5HAQA 1XA7A 1KGEA 1BLSA 3IHBA 3HUNA 1RCJA 3P98A 3IF6C 2Y2HA 1FR1A 5AQAA 3VSKA 4OVDA 2WYXA 3HREA 3MXSA 3QNCA 1GA0A 1SCWA 2G2WA 5CGXA 4K91A 1MKIA 4U0XA 4LV0A 2R9XA 4Y7PA 5TFQA 1L0GA 1XGJA 3ZDJA 2Y4AA 4JXGA 2OSUA 4K0XA 4S2MA 4WMCD 5FQKA 5CTMA 5HX9A 1L2SA 2C6WB 4GN2A 1K57C 1W8YA 1ESIA 2HDSA 4IVIA 4KQOA 5FQIA 5FQMA 4XUZA 1ZG6A 4WEKA 1IYSA 5FQ9A 5CTNA 5KMWA 2ZQDA 3WS2A 1W5DA 1SDEA 1PYYA 3PBOA 1DJBA 3UPOA 2P74A 1IYQA 5EUAA 5FAPA 1DY6A 4JBFA 5CHMA 3SH9A 3V3RA 3ZG5A 2XEPA 4WEJA 5FQQA 3O3VA 4UA7A 1QMFA 2E8IA 2B5RA 2EFXA 2IWDA 3IXHA 5CHJA 1K56D 1FCOA 3ITBA 3NDGA 1BLCA 2OLUA 4B4XA 4E6XA 2J9PA 3N7WA 3OPHA 3UPPA 1MWUA 3IF6A 1XP4A 3EQUA 3RJUA 3G2ZA 2R9WA 1K4FA 5FATA 1K55C 1DJCA 3VP2A 1H5XA 4LCMA 3N8LA 3PBSA 1NRFA 1MWTA 3SOIA 3IF5A 2ZC4B 2P9VA 4MNRA 5D3OA 1K54A 3ZCZA 4C3QA 3IQAA 4KG5A 4EBPA 4M3KA 1IKGA 1KGGA 1KE3A 5FI6A 4LV2A 3UE3A 2H10A 4E3OA 2XDMA 3C7VA 1YLWA 3DWZA 4KQRA 5CERA 2Y2JA 3GQZA 1VM1A 2ZQ7A 1KDSA 5IHVA 1GHIA 2JC7A 3VOYA 4Y0TA 1L0DA 2XLNA 3Q7VA 5HAIA 3UO9A 1PI4A 1EROA 1DJAA 1EI5A 2JCHA 4KENB 5F1GA 5DTSA 2Y59A 3IH8A 1U60A 3UDFA 3N8RA 3WWXA 5GHXA 1ES3A 2J9OA 5CRFA 4OPYA 4RX2A 4DE2A 3A3JA 4GZBA 3GRJA 4KG6A 4N1HA 3PAGA 3BECA 4JXWA 3IXBA 5HARA 4ZJ2A 1NXYA 1I2WA 3GTCA 5DF8A 3G34A 1ZKJA 4QY6A 5FAQA 4A5RA 1IEMA 2ZC5B 5GLCA 4DXBA 2EX6A 3IXDA 1K56A 5U47A 1XGIA 4S2JA 2J8YA 1ESUA 5HL1A 4DXCA 1YLYA 5M19A 1BSGA 2X71A 4MEZA 1XPBA 1PIOA 5GL9A 2XQZA 4YINA 3D4FA 4KZ5A 2A3UA 4DE0A 4GOGA 3AGDA 3VP1A 1XXMA 5DF7A 3GV9A 3G4PA 3FV7A 1K4EA 1JWVA 3OPLA 2G2UA 2WKIA 4JLFA 2Y2OA 2V1ZA 3LY4A 1GHPA 1ES2A 4PMAA 5DVAA 1CK3A 2Q9NA 4Q8IA 2DRWA 3IWQA 3A3IA 5FSRA 3IWIA 4BL2A 2WGWA 5A93A 3G31A 5A91A 4BJPA 3S22A 3OPRA 4UA9A 1YMXA 3VFFA 3E2KA 1NYMA 3QNBA 1KVLA 4IBXA 2V20A 3CMZA 4BL3A 5KZHA 1Z6FA 1K6RA 3O88A 1PWDA 1WYCA 3LCEA 4FD8A 4OONA 4PPRA 4S2NA 1PZOA 3MZDA 1I5QA 1FSWA 4OOLA 4R23A 4BLMA 3GMWA 3S4XA 2HPBA 3NI9A 4O7DA 1TDGA 3TSGA 1NZUA 3IT9A 5E2EA 3V50A 1BZAA 5EVID 3NY4A 3WRZA 3HLGA 3BLSA 3HLEA 5HFOA 4JF5A 1HTZA 1NZOA 3ZG0A 4KZAA 2IWCA 3FKVA 1K54C 1JWZA 3O86A 4OP5A 4B88A 1GHMA 2ZQ9A 3M6BA 1JTGA 2FFFB 3GR2A 3OZHA 4PM6A 2ZD8A 3DWKA 2V2FF 3BLMA 1RGYA 5E43A 1C3BA 3BEBA 3OPPA 4JPMA 5CEBA 5TR7A 2WAFA 3FYZA 4X56A 3SS3A 1PWGA 4S2KA 3TG9A 4DF6A 1KE0A 1TDLA 1BTLA 4UAAA 5EVIC 5FDHA 2WKEA 3AGEA 3FKWA 3OCLA 3AGFA 1BULA 4X55A 4GD6A 4S2LA 3IWOA 2OLVA 3A3DA 4E3LA 5CECA 1HZOA 1GCEA 3BM6A 4RX3A 3V39A 1RP5A 5A90A 1MWRA 1KDWA 4LCLA 4DE3A 2Y2GA 1BT5A 1S0WA 4IBRA 2XD1A 3BFCA 2Y55A 2BG1A 2HDQA 4IEDA 3UPNA 4K0WA 1YM1A 3HLFA 4OPRA 3CZDA 1E3UA 3MZFA 5EE8A 2ZQAA 3MKEA 5JYOA 3HUOA 3BYDA 1MXOA 4PM8A 3HBRA 3W4OA 4E3MA 4EV4A 5M18A 3G35A 5CXWA 2BLSA 2PU2A 4E3JA 3EQVA 4H8RA 3ZNYA 5AQ9A 1L0EA 4RVAA 2XF3A 3SH7A 4XUXA 4CPKA 5EVIA 1FQGA 1K25A 1M6KA 2ZQ8A 3C4OA 4FCFA 4OOMA 2Q9MA 2HDRA 4S2IA 5I94A 2HP5A 3W8KA 4KZ9A 1MY8A 1LI9A 4OH0A 2VGKA 4P87A 1Q2QA 2JBFA 2JE5A 1ALQA 2WK0A 3GSGA 1CI8A 5CHUA 4P6BA 4E3KA 1WE4A 4JXSA 1LI0A 1NJ4A 4U3TA 3IH9A 4LV1A 5E2FA 5G18A 1XA1A 3HL9A 1ERQA 5L2FA 3IF6B 1S6RA 3FZCA 3Q82A 5E2HA 4X6TA 5BOHA 4S2PA 4R0QA 3OC2A 4S2NC 4JF6A 1W7FA 1YLJA 1LHYA 4OKPA 5F82A 1SKFA 3C5AA 3O87A 4N9LA 4Y0OA 2P9VB 4WELA 3HVFA 1YMSA 4OP8A 2H0TA 3A3EA 4R3BA 4X69A 4KZ3A 3NC8A 4GDBA 5CGSA 3ZVWA 5EVLA 5HAPA 2Y2NA 2HP9A 3C7UA 4D2OA 4HBTA 4JKTA 1IELA 5KSHA 4C6YA 3WS0A 4DKIA 3S1YA 4FH2A 3PTEA 3FWLA 3BFDA 2WZZA 3MKFA 3PBQA 3ZG9B 4E3NA 1CEGA 4KZ4A 2ZLYA 3ZGAB 1TEMA 1SDNA 3Q7VB 1SHVA 4MBHA 4OQ0A 1E25A 3MXRA 3PBNA 4RA7A 2EXAA 4E3IA 2Y2IA 1ES5A 3RXWA 1E3UD 4DRTA 2ZC6B 5CEDA 3HLCA 1ONGA 1CI9A 4OPQA 3A3FA 1OMEA 1LL9A 3BFGA 4XXRA 4WZ5C 5AQBA 1J9MA 3ZNTA 4HBUA 4EBLA 2Y2MA 3Q07A 3W4PA 4QHCA 1NYYA 2WZXA 1AXBA 1JVJA 4P0MA 2DCFA 2QMIA 1BLPA 2XFSA 5DF9A 3N6IA 4QU3A 3IHAA 3ITAA 5EECA 5FI7A 1JTDA 4EUZA 1IKIA 2Y2KA 3I7JA 1BLHA 3WRTA 2UWXA 3QHYA 1MBLA 2WUQA 4PM7A 5M1AA 3HLBA 1FCMA 1I2SA 4Z9QA 4PM5A 1K6SA 2XR0A 5TGFA 1O7EA 2X01A 2RCXA 4R1GA 3LO7A 3ZHHA 4ZJ1A 5FASA 1ES4A 4ID4A 5F83A 4QD4A 2EXBA 3M2JA 4LENA 5GHYA 4DDSA 1GA9A 3M2KA 2HP6A 3NIAA 5DTKA 4ZTKA 1KVMA 1FOFA 3Q1FA 2DNSA 4L0LA 1ERMA 1IYOA 4HEFA 1YT4A 4GB7A 1QMEA 1G6AA 2XD5A 3N8SA 2WGWB 5FA7A 3LY3A 4WZ5A 3V3SA 4OOYA 4KQQA 4DDYA 2ZC7A 4OLGA 3ZG7B 4X53A 1LL5A 1MPLA 1NY0A 5GLDA 1E4DA 4UA6A 4QB8A 3Q7ZA 2EX2A 4MBKA 5F1FA 5CGWA 1H8ZA 2HDUA 1L0FA 4WZ4A 1PWCA 3W4QA 4OQGA 4X68A 3MFDA 1FCNA 2FFYA 3WS1A 4BD0A 1KGFA 4GKUA 4GDNA 4R4SA 2EX9A 4LV3A 3MBZA 3IXGA 1EWZA 2CC1A 3V5MA 4EQIA 4GNUA 1YLTA 3BRMA 4QY5A 3LEZA 3PBTA 3VP0A 4CJNA 1M40A 3E2LA 3NCKA 1W8QA 4JXVA 2IWBA 3VSLA 1FR6A 4HESA 2Z2MB 3UNWA 2WGIA 3JYIA 1PW1A 3HLWA 5GLBA 2H0YA 3BFEA 5FAOA 4EWFA 1W79A 1Q2PA 1XX2A 2ZMAA 4OLDA 4WYYA 1FSYA 4DE1A 1K57A 4BQMA 4MLLA 4IVKA 1N9BA 3HUMA 4OQIA 3VFHA 3UDXA 1RGZA 3PBRA 4NETA 4R3JA 1N4OA 3B3XA 1KE4A 4ZBEA 4JF4A 5A92A 1LLBA 4R4RA 4B4ZA 1BUEA 2VGJA 1TVFA 3SH8A 2WADA 1MWSA 2XGNA 3BFFA 2Y2QA 2A49A 4KZ6A 3HLDA 1ONHA 4KG2A 4KZ8A 5JYPA 2I72A 3C4PA 2X02A 1JWPA 5EPHA 1YLZA 2Y2LA 3PAEA 4F94A 1CEFA 1H8YA 2WAEA 2XK1A 2ZM8A 4OQHA 4WMCA 2Y2PA 3VOZA 4OPZA 1O07A 4N9KA 4Y0UA 1G68A 4WBGA 1K38A 1PZPA 3RXXA 2Y91A 2WGVA 1K55A 3TOIA 3VP3A 5EOOA 3GVBA 1PI5A 3WS4A 5EOEA 3NDEA 3ZFZA 1VQQA 2ZC3B 3MZEA 2RL3A 4PM9A 4ZAMA 2H5SA 3DW0A 4UHUA 3ZG8B 2ZQCA 5E2GA 3CG5A 4WM9A 1ZC2A 4FSFA 2QZ6A 2EFUA 4N92A 5GHZA 1YLPA 3ISGA 4EBNA 3ZVTA 3G30A 4C75A 4GD8A 4S2OA 5AQ7A 4ZDXA 2GDNA 1Y54A 5HW3A 2J7VA 5EVIB 4FH4A 3Q81A 4BD1A 3CJMA 4E6WA 5DTTA 3OCNA 5FI2A 3G32A 4KZ7A 3P09A 3WS5A 3N4IA 3SS5A 3NBLA 1WYBA 4NK3A 2XFTA 3SS4A 5J8XA 2ZM0A 5FQJA 2C5WB 3UE1A 3DTMA 4KZBA 2QPNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PU4 A;  3UDI A;  4QJG A;  2ZM2 A;  1ZG4 A;  2Z2L B;  2EX8 A;  1PW8 A;  2ZJ9 A;  3UN7 A;  4P85 A;  2PBY A;  1YQS A;  4MBF A;  1XKZ A;  5GLA A;  3VP4 A;  5KSC A;  1HD8 A;  3G2Y A;  4ZJ3 A;  4N1X A;  4BEN A;  1HVB A;  4RYE A;  2OV5 A;  3VMA A;  3UE0 A;  2WKH A;  3UY6 A;  2XH9 A;  4U0T A;  4YFM A;  1IYP A;  3M6H A;  5HAQ A;  1XA7 A;  1KGE A;  1BLS A;  3IHB A;  3HUN A;  1RCJ A;  3P98 A;  3IF6 C;  2Y2H A;  1FR1 A;  5AQA A;  3VSK A;  4OVD A;  2WYX A;  3HRE A;  3MXS A;  3QNC A;  1GA0 A;  1SCW A;  2G2W A;  5CGX A;  4K91 A;  1MKI A;  4U0X A;  4LV0 A;  2R9X A;  4Y7P A;  5TFQ A;  1L0G A;  1XGJ A;  3ZDJ A;  2Y4A A;  4JXG A;  2OSU A;  4K0X A;  4S2M A;  4WMC D;  5FQK A;  5CTM A;  5HX9 A;  1L2S A;  2C6W B;  4GN2 A;  1K57 C;  1W8Y A;  1ESI A;  2HDS A;  4IVI A;  4KQO A;  5FQI A;  5FQM A;  4XUZ A;  1ZG6 A;  4WEK A;  1IYS A;  5FQ9 A;  5CTN A;  5KMW A;  2ZQD A;  3WS2 A;  1W5D A;  1SDE A;  1PYY A;  3PBO A;  1DJB A;  3UPO A;  2P74 A;  1IYQ A;  5EUA A;  5FAP A;  1DY6 A;  4JBF A;  5CHM A;  3SH9 A;  3V3R A;  3ZG5 A;  2XEP A;  4WEJ A;  5FQQ A;  3O3V A;  4UA7 A;  1QMF A;  2E8I A;  2B5R A;  2EFX A;  2IWD A;  3IXH A;  5CHJ A;  1K56 D;  1FCO A;  3ITB A;  3NDG A;  1BLC A;  2OLU A;  4B4X A;  4E6X A;  2J9P A;  3N7W A;  3OPH A;  3UPP A;  1MWU A;  3IF6 A;  1XP4 A;  3EQU A;  3RJU A;  3G2Z A;  2R9W A;  1K4F A;  5FAT A;  1K55 C;  1DJC A;  3VP2 A;  1H5X A;  4LCM A;  3N8L A;  3PBS A;  1NRF A;  1MWT A;  3SOI A;  3IF5 A;  2ZC4 B;  2P9V A;  4MNR A;  5D3O A;  1K54 A;  3ZCZ A;  4C3Q A;  3IQA A;  4KG5 A;  4EBP A;  4M3K A;  1IKG A;  1KGG A;  1KE3 A;  5FI6 A;  4LV2 A;  3UE3 A;  2H10 A;  4E3O A;  2XDM A;  3C7V A;  1YLW A;  3DWZ A;  4KQR A;  5CER A;  2Y2J A;  3GQZ A;  1VM1 A;  2ZQ7 A;  1KDS A;  5IHV A;  1GHI A;  2JC7 A;  3VOY A;  4Y0T A;  1L0D A;  2XLN A;  3Q7V A;  5HAI A;  3UO9 A;  1PI4 A;  1ERO A;  1DJA A;  1EI5 A;  2JCH A;  4KEN B;  5F1G A;  5DTS A;  2Y59 A;  3IH8 A;  1U60 A;  3UDF A;  3N8R A;  3WWX A;  5GHX A;  1ES3 A;  2J9O A;  5CRF A;  4OPY A;  4RX2 A;  4DE2 A;  3A3J A;  4GZB A;  3GRJ A;  4KG6 A;  4N1H A;  3PAG A;  3BEC A;  4JXW A;  3IXB A;  5HAR A;  4ZJ2 A;  1NXY A;  1I2W A;  3GTC A;  5DF8 A;  3G34 A;  1ZKJ A;  4QY6 A;  5FAQ A;  4A5R A;  1IEM A;  2ZC5 B;  5GLC A;  4DXB A;  2EX6 A;  3IXD A;  1K56 A;  5U47 A;  1XGI A;  4S2J A;  2J8Y A;  1ESU A;  5HL1 A;  4DXC A;  1YLY A;  5M19 A;  1BSG A;  2X71 A;  4MEZ A;  1XPB A;  1PIO A;  5GL9 A;  2XQZ A;  4YIN A;  3D4F A;  4KZ5 A;  2A3U A;  4DE0 A;  4GOG A;  3AGD A;  3VP1 A;  1XXM A;  5DF7 A;  3GV9 A;  3G4P A;  3FV7 A;  1K4E A;  1JWV A;  3OPL A;  2G2U A;  2WKI A;  4JLF A;  2Y2O A;  2V1Z A;  3LY4 A;  1GHP A;  1ES2 A;  4PMA A;  5DVA A;  1CK3 A;  2Q9N A;  4Q8I A;  2DRW A;  3IWQ A;  3A3I A;  5FSR A;  3IWI A;  4BL2 A;  2WGW A;  5A93 A;  3G31 A;  5A91 A;  4BJP A;  3S22 A;  3OPR A;  4UA9 A;  1YMX A;  3VFF A;  3E2K A;  1NYM A;  3QNB A;  1KVL A;  4IBX A;  2V20 A;  3CMZ A;  4BL3 A;  5KZH A;  1Z6F A;  1K6R A;  3O88 A;  1PWD A;  1WYC A;  3LCE A;  4FD8 A;  4OON A;  4PPR A;  4S2N A;  1PZO A;  3MZD A;  1I5Q A;  1FSW A;  4OOL A;  4R23 A;  4BLM A;  3GMW A;  3S4X A;  2HPB A;  3NI9 A;  4O7D A;  1TDG A;  3TSG A;  1NZU A;  3IT9 A;  5E2E A;  3V50 A;  1BZA A;  5EVI D;  3NY4 A;  3WRZ A;  3HLG A;  3BLS A;  3HLE A;  5HFO A;  4JF5 A;  1HTZ A;  1NZO A;  3ZG0 A;  4KZA A;  2IWC A;  3FKV A;  1K54 C;  1JWZ A;  3O86 A;  4OP5 A;  4B88 A;  1GHM A;  2ZQ9 A;  3M6B A;  1JTG A;  2FFF B;  3GR2 A;  3OZH A;  4PM6 A;  2ZD8 A;  3DWK A;  2V2F F;  3BLM A;  1RGY A;  5E43 A;  1C3B A;  3BEB A;  3OPP A;  4JPM A;  5CEB A;  5TR7 A;  2WAF A;  3FYZ A;  4X56 A;  3SS3 A;  1PWG A;  4S2K A;  3TG9 A;  4DF6 A;  1KE0 A;  1TDL A;  1BTL A;  4UAA A;  5EVI C;  5FDH A;  2WKE A;  3AGE A;  3FKW A;  3OCL A;  3AGF A;  1BUL A;  4X55 A;  4GD6 A;  4S2L A;  3IWO A;  2OLV A;  3A3D A;  4E3L A;  5CEC A;  1HZO A;  1GCE A;  3BM6 A;  4RX3 A;  3V39 A;  1RP5 A;  5A90 A;  1MWR A;  1KDW A;  4LCL A;  4DE3 A;  2Y2G A;  1BT5 A;  1S0W A;  4IBR A;  2XD1 A;  3BFC A;  2Y55 A;  2BG1 A;  2HDQ A;  4IED A;  3UPN A;  4K0W A;  1YM1 A;  3HLF A;  4OPR A;  3CZD A;  1E3U A;  3MZF A;  5EE8 A;  2ZQA A;  3MKE A;  5JYO A;  3HUO A;  3BYD A;  1MXO A;  4PM8 A;  3HBR A;  3W4O A;  4E3M A;  4EV4 A;  5M18 A;  3G35 A;  5CXW A;  2BLS A;  2PU2 A;  4E3J A;  3EQV A;  4H8R A;  3ZNY A;  5AQ9 A;  1L0E A;  4RVA A;  2XF3 A;  3SH7 A;  4XUX A;  4CPK A;  5EVI A;  1FQG A;  1K25 A;  1M6K A;  2ZQ8 A;  3C4O A;  4FCF A;  4OOM A;  2Q9M A;  2HDR A;  4S2I A;  5I94 A;  2HP5 A;  3W8K A;  4KZ9 A;  1MY8 A;  1LI9 A;  4OH0 A;  2VGK A;  4P87 A;  1Q2Q A;  2JBF A;  2JE5 A;  1ALQ A;  2WK0 A;  3GSG A;  1CI8 A;  5CHU A;  4P6B A;  4E3K A;  1WE4 A;  4JXS A;  1LI0 A;  1NJ4 A;  4U3T A;  3IH9 A;  4LV1 A;  5E2F A;  5G18 A;  1XA1 A;  3HL9 A;  1ERQ A;  5L2F A;  3IF6 B;  1S6R A;  3FZC A;  3Q82 A;  5E2H A;  4X6T A;  5BOH A;  4S2P A;  4R0Q A;  3OC2 A;  4S2N C;  4JF6 A;  1W7F A;  1YLJ A;  1LHY A;  4OKP A;  5F82 A;  1SKF A;  3C5A A;  3O87 A;  4N9L A;  4Y0O A;  2P9V B;  4WEL A;  3HVF A;  1YMS A;  4OP8 A;  2H0T A;  3A3E A;  4R3B A;  4X69 A;  4KZ3 A;  3NC8 A;  4GDB A;  5CGS A;  3ZVW A;  5EVL A;  5HAP A;  2Y2N A;  2HP9 A;  3C7U A;  4D2O A;  4HBT A;  4JKT A;  1IEL A;  5KSH A;  4C6Y A;  3WS0 A;  4DKI A;  3S1Y A;  4FH2 A;  3PTE A;  3FWL A;  3BFD A;  2WZZ A;  3MKF A;  3PBQ A;  3ZG9 B;  4E3N A;  1CEG A;  4KZ4 A;  2ZLY A;  3ZGA B;  1TEM A;  1SDN A;  3Q7V B;  1SHV A;  4MBH A;  4OQ0 A;  1E25 A;  3MXR A;  3PBN A;  4RA7 A;  2EXA A;  4E3I A;  2Y2I A;  1ES5 A;  3RXW A;  1E3U D;  4DRT A;  2ZC6 B;  5CED A;  3HLC A;  1ONG A;  1CI9 A;  4OPQ A;  3A3F A;  1OME A;  1LL9 A;  3BFG A;  4XXR A;  4WZ5 C;  5AQB A;  1J9M A;  3ZNT A;  4HBU A;  4EBL A;  2Y2M A;  3Q07 A;  3W4P A;  4QHC A;  1NYY A;  2WZX A;  1AXB A;  1JVJ A;  4P0M A;  2DCF A;  2QMI A;  1BLP A;  2XFS A;  5DF9 A;  3N6I A;  4QU3 A;  3IHA A;  3ITA A;  5EEC A;  5FI7 A;  1JTD A;  4EUZ A;  1IKI A;  2Y2K A;  3I7J A;  1BLH A;  3WRT A;  2UWX A;  3QHY A;  1MBL A;  2WUQ A;  4PM7 A;  5M1A A;  3HLB A;  1FCM A;  1I2S A;  4Z9Q A;  4PM5 A;  1K6S A;  2XR0 A;  5TGF A;  1O7E A;  2X01 A;  2RCX A;  4R1G A;  3LO7 A;  3ZHH A;  4ZJ1 A;  5FAS A;  1ES4 A;  4ID4 A;  5F83 A;  4QD4 A;  2EXB A;  3M2J A;  4LEN A;  5GHY A;  4DDS A;  1GA9 A;  3M2K A;  2HP6 A;  3NIA A;  5DTK A;  4ZTK A;  1KVM A;  1FOF A;  3Q1F A;  2DNS A;  4L0L A;  1ERM A;  1IYO A;  4HEF A;  1YT4 A;  4GB7 A;  1QME A;  1G6A A;  2XD5 A;  3N8S A;  2WGW B;  5FA7 A;  3LY3 A;  4WZ5 A;  3V3S A;  4OOY A;  4KQQ A;  4DDY A;  2ZC7 A;  4OLG A;  3ZG7 B;  4X53 A;  1LL5 A;  1MPL A;  1NY0 A;  5GLD A;  1E4D A;  4UA6 A;  4QB8 A;  3Q7Z A;  2EX2 A;  4MBK A;  5F1F A;  5CGW A;  1H8Z A;  2HDU A;  1L0F A;  4WZ4 A;  1PWC A;  3W4Q A;  4OQG A;  4X68 A;  3MFD A;  1FCN A;  2FFY A;  3WS1 A;  4BD0 A;  1KGF A;  4GKU A;  4GDN A;  4R4S A;  2EX9 A;  4LV3 A;  3MBZ A;  3IXG A;  1EWZ A;  2CC1 A;  3V5M A;  4EQI A;  4GNU A;  1YLT A;  3BRM A;  4QY5 A;  3LEZ A;  3PBT A;  3VP0 A;  4CJN A;  1M40 A;  3E2L A;  3NCK A;  1W8Q A;  4JXV A;  2IWB A;  3VSL A;  1FR6 A;  4HES A;  2Z2M B;  3UNW A;  2WGI A;  3JYI A;  1PW1 A;  3HLW A;  5GLB A;  2H0Y A;  3BFE A;  5FAO A;  4EWF A;  1W79 A;  1Q2P A;  1XX2 A;  2ZMA A;  4OLD A;  4WYY A;  1FSY A;  4DE1 A;  1K57 A;  4BQM A;  4MLL A;  4IVK A;  1N9B A;  3HUM A;  4OQI A;  3VFH A;  3UDX A;  1RGZ A;  3PBR A;  4NET A;  4R3J A;  1N4O A;  3B3X A;  1KE4 A;  4ZBE A;  4JF4 A;  5A92 A;  1LLB A;  4R4R A;  4B4Z A;  1BUE A;  2VGJ A;  1TVF A;  3SH8 A;  2WAD A;  1MWS A;  2XGN A;  3BFF A;  2Y2Q A;  2A49 A;  4KZ6 A;  3HLD A;  1ONH A;  4KG2 A;  4KZ8 A;  5JYP A;  2I72 A;  3C4P A;  2X02 A;  1JWP A;  5EPH A;  1YLZ A;  2Y2L A;  3PAE A;  4F94 A;  1CEF A;  1H8Y A;  2WAE A;  2XK1 A;  2ZM8 A;  4OQH A;  4WMC A;  2Y2P A;  3VOZ A;  4OPZ A;  1O07 A;  4N9K A;  4Y0U A;  1G68 A;  4WBG A;  1K38 A;  1PZP A;  3RXX A;  2Y91 A;  2WGV A;  1K55 A;  3TOI A;  3VP3 A;  5EOO A;  3GVB A;  1PI5 A;  3WS4 A;  5EOE A;  3NDE A;  3ZFZ A;  1VQQ A;  2ZC3 B;  3MZE A;  2RL3 A;  4PM9 A;  4ZAM A;  2H5S A;  3DW0 A;  4UHU A;  3ZG8 B;  2ZQC A;  5E2G A;  3CG5 A;  4WM9 A;  1ZC2 A;  4FSF A;  2QZ6 A;  2EFU A;  4N92 A;  5GHZ A;  1YLP A;  3ISG A;  4EBN A;  3ZVT A;  3G30 A;  4C75 A;  4GD8 A;  4S2O A;  5AQ7 A;  4ZDX A;  2GDN A;  1Y54 A;  5HW3 A;  2J7V A;  5EVI B;  4FH4 A;  3Q81 A;  4BD1 A;  3CJM A;  4E6W A;  5DTT A;  3OCN A;  5FI2 A;  3G32 A;  4KZ7 A;  3P09 A;  3WS5 A;  3N4I A;  3SS5 A;  3NBL A;  1WYB A;  4NK3 A;  2XFT A;  3SS4 A;  5J8X A;  2ZM0 A;  5FQJ A;  2C5W B;  3UE1 A;  3DTM A;  4KZB A;  2QPN A; 
#chains in the Genus database with same CATH topology
 4ARZ A;  3LIC A;  2UV0 E;  2ZM2 A;  2Z2L B;  1S4S A;  3UN7 A;  4X1L A;  1CJF A;  4GS9 A;  4BEN A;  1D1J A;  3UY6 A;  2QHK A;  4YFM A;  1IYP A;  3CUE A;  3IHB A;  5TJJ A;  1RCJ A;  5L8M A;  3IF6 C;  3CHW P;  5AQA A;  1NRJ A;  4OVD A;  3MXS A;  5TFQ A;  4Y7P A;  4S2M A;  3FG8 A;  4WMC D;  5HX9 A;  1L2S A;  1K57 C;  4IVI A;  5FQI A;  3E4Q A;  2PBD P;  4L9G A;  2WKQ A;  2ZQD A;  3WS2 A;  1IFQ A;  5FAP A;  5CHM A;  1OT6 A;  2XEP A;  4EQ1 A;  4UA7 A;  3IXH A;  3ITB A;  1BLC A;  2OLU A;  4E6X A;  5HL6 A;  3IF6 A;  2ZMF A;  1XP4 A;  4F3L B;  2ZMV A;  5FAT A;  3VE3 A;  1H5X A;  1WA9 A;  2M7V A;  1NRF A;  1MWT A;  3KSI A;  2GZA A;  3SOI A;  2HV1 A;  2P9V A;  4C3Q A;  4EBP A;  2QJ7 A;  4LV2 A;  4KQD A;  1YLW A;  5CER A;  4NKP A;  1KDS A;  4Y0T A;  2WKP A;  3UO9 A;  3R7W A;  1ERO A;  3SW1 A;  1DRM A;  2JCH A;  4KEN B;  3JVV A;  4I3A A;  1IOU A;  2V9A A;  1VET A;  3GRJ A;  3BEC A;  3HJK A;  3C8C A;  4X1M A;  4Q0I A;  4O01 A;  4UQI S;  1NXY A;  1ZTU A;  3GTC A;  5DF8 A;  3P7N A;  4DXB A;  5U47 A;  1D7E A;  1XGI A;  1G28 A;  5M19 A;  2X71 A;  1XPB A;  3P01 A;  2XQZ A;  5G4Z A;  4YIN A;  2M7U A;  3D4F A;  2B02 A;  3VP1 A;  3B42 A;  3F1O B;  4EER A;  3G4P A;  1JNU A;  3FV7 A;  1JWV A;  2GJ3 A;  5HWT A;  5A91 A;  2Y2O A;  1V9Z A;  3BWL A;  3MSH A;  3UB7 A;  3S22 A;  2VGL S;  3OPR A;  4UA9 A;  1YMX A;  3VFF A;  3R4K A;  4H6J B;  1KVL A;  2V20 A;  4BL3 A;  3LUQ A;  3BJN A;  4OON A;  4BLM A;  1PZO A;  1TS0 A;  3MZD A;  4R23 A;  3GMW A;  3S4X A;  4O7D A;  1TDG A;  3LYX A;  3TSG A;  5E2E A;  5EVI D;  3NY4 A;  2J3T D;  4E04 A;  3VV4 A;  4MN7 A;  4GHI A;  4OP5 A;  1K54 C;  2NUT C;  1GHM A;  2ZQ9 A;  2EWV A;  1DP6 A;  1W63 M;  4DJ2 A;  5L07 A;  4HJ6 A;  4ETZ A;  3H7W B;  3VOL A;  2WAF A;  3FYZ A;  2PD7 A;  3QP4 A;  1P97 A;  3OCL A;  3AGF A;  4X55 A;  3B47 A;  5DKL A;  4S2L A;  3A3D A;  1MWR A;  5F69 A;  4K0W A;  2V1A A;  2XA7 M;  3RH8 B;  1DP8 A;  1LSV A;  1E3U A;  5EE8 A;  2JKF A;  3UB6 A;  5JYO A;  4FOF A;  3T4L A;  3ICY A;  4EV4 A;  2W1T B;  5M18 A;  3G35 A;  3IX3 A;  3EQV A;  4LGW A;  5AQ9 A;  1L0E A;  4BWI A;  1M6K A;  3C4O A;  3CIT A;  3W8K A;  4P87 A;  4HH3 A;  2JE5 A;  4Y2F A;  2O9A A;  4P6B A;  5CHU A;  3JPU A;  3LR0 A;  1S6R A;  3Q82 A;  4G3K A;  4HH2 A;  1G6O A;  2PRF A;  4S2P A;  1VB6 A;  4R0Q A;  4UEY A;  4JF6 A;  1W7F A;  1SKF A;  3QP8 A;  4K08 A;  5IT5 A;  3TW8 A;  3A3E A;  4KZ3 A;  5HAP A;  3ZVW A;  5EVL A;  4D2O A;  4JKT A;  5MC7 A;  5KSH A;  3S1Y A;  3BFD A;  4E3N A;  4XT2 A;  4HJ3 A;  3ZGA B;  4UQI M;  1SDN A;  3Q7V B;  2WKR A;  3PR6 A;  2Y2I A;  2HGV A;  2KLI A;  4HBU A;  2LB5 A;  4QHC A;  3QP5 A;  3LEQ A;  2QMI A;  2XFS A;  3A0V A;  5FI7 A;  1JTD A;  4EUZ A;  1BLH A;  3WRT A;  3H82 A;  3QHY A;  1I2S A;  4Z9Q A;  2XR0 A;  2G7U A;  2VGL M;  1O7E A;  2X01 A;  1S1Z A;  2KX6 A;  5F83 A;  2EXB A;  1GA9 A;  3QP6 A;  3NIA A;  3UB5 P;  3N8S A;  4MMN A;  2XD5 A;  5FA7 A;  4JGP A;  3D9Y A;  3V3S A;  4X53 A;  4LRY C;  1NY0 A;  2DMW A;  3KSF A;  4QB8 A;  2EX2 A;  5F1F A;  4HOI A;  4LLO B;  4WZ4 A;  3W4Q A;  1OJ5 A;  1FCN A;  2FFY A;  2GX5 A;  1KGF A;  2L4R A;  4LV3 A;  1Y28 A;  4GLQ A;  4EQI A;  4LPZ A;  4QWO A;  3PBT A;  1M40 A;  4PKY G;  1LT0 A;  4HES A;  3UNW A;  4GW9 A;  3TE8 A;  4R70 A;  3HLW A;  3T4Q A;  4Y13 A;  4EWF A;  4DJ3 A;  1W79 A;  1XX2 A;  2HZ5 A;  4HQA A;  3DBA A;  4IVK A;  1N9B A;  2VV7 A;  4OQI A;  3PBR A;  4NET A;  1N4O A;  1D06 A;  1KE4 A;  4JF4 A;  1LLB A;  2P08 A;  4B4Z A;  1TVF A;  2WAD A;  2A49 A;  1YLZ A;  4CLC E;  1CEF A;  1H8Y A;  2XK1 A;  4WMC A;  1O07 A;  4N9K A;  1K38 A;  3RXX A;  3KYQ A;  4NXB A;  2ZC3 B;  4PM9 A;  2RL3 A;  4O0P A;  3DW0 A;  3NJA A;  3ZG8 B;  3CAX A;  3CG5 A;  4WM9 A;  1ZC2 A;  3IS2 B;  2QZ6 A;  2EFU A;  3MFX A;  4C75 A;  3G30 A;  5AQ7 A;  3BQA A;  5HW3 A;  5EVI B;  3Q81 A;  4BD1 A;  4LRX C;  5DTT A;  4YWZ A;  3G32 A;  3P09 A;  3N4I A;  5TBM A;  3SS5 A;  2V8C A;  2XFT A;  3SS4 A;  5FL3 A;  5J8X A;  4Y17 A;  3ZQ5 A;  3UE1 A;  2E8J A;  2O9B A;  2PU4 A;  2VV6 A;  1ZG4 A;  2EX8 A;  1PW8 A;  1YQS A;  4LRZ E;  3VP4 A;  1HD8 A;  3T4T A;  3VMA A;  5J7E A;  3M6H A;  1KGE A;  1BLS A;  3LR3 A;  3HUN A;  3U4L P;  3P98 A;  1GA0 A;  1SCW A;  1G5U A;  4K91 A;  1L0G A;  1ACF A;  1S67 L;  2KOI A;  2Y4A A;  5CTM A;  1T18 A;  4GN2 A;  1W8Y A;  1BYW A;  2HDS A;  4KQO A;  4NG2 A;  4WEK A;  2VJW A;  1N9N A;  5CTN A;  1W5D A;  1SDE A;  1PYY A;  3PBO A;  3UPO A;  2P74 A;  4L9E A;  4PHT A;  3SZT A;  1DY6 A;  1J3W A;  2B5R A;  1SKO B;  2JKT I;  4B4X A;  2J9P A;  3OPH A;  3EEH A;  3EEA A;  4RQ9 A;  3UPP A;  2OOL A;  3EQU A;  2ZOH A;  3RJU A;  2V0U A;  1K55 C;  1DJC A;  3VP2 A;  1TS7 A;  4LCM A;  3OLO A;  3IF5 A;  2ZC4 B;  1OTD A;  4ME4 A;  4M3K A;  1GSW A;  3UE3 A;  2H10 A;  4E3O A;  2W0N A;  5DFX A;  3GQZ A;  1VM1 A;  5IHV A;  1GHI A;  1L0D A;  2XLN A;  1L3L A;  1DJA A;  1EI5 A;  5F1G A;  2Y59 A;  4JGR A;  3UDF A;  5GHX A;  2J9O A;  4OPY A;  4RX2 A;  1T1A A;  4N1H A;  3PAG A;  4HP4 A;  4II7 A;  3ZYT A;  4JXW A;  2OAP 1;  3LIE A;  4QY6 A;  2ZC5 B;  1K56 A;  3GEC A;  3C38 A;  2PD8 A;  4AFI A;  5GL9 A;  5EM0 A;  2LB9 A;  4KZ5 A;  4DE0 A;  3AGD A;  1XXM A;  3OPL A;  2WKI A;  4JLF A;  2V1Z A;  3BQ8 A;  3A3I A;  4KUK A;  3IWI A;  5FSR A;  1LSX A;  3G31 A;  4PKY A;  4Q0H A;  1X0O A;  4IBX A;  3CMZ A;  1Z6F A;  4S2N A;  1FSW A;  2ZOI A;  1CQA A;  1VEU A;  4PAU A;  4WUJ A;  3LGO A;  4BBT A;  3F1N A;  1HTZ A;  3FKV A;  4B88 A;  3M6B A;  1JTG A;  4MN5 A;  2FFF B;  3GR2 A;  2XA7 S;  1Z09 A;  2ZD8 A;  5E43 A;  1C3B A;  3BEB A;  5J3W A;  2GNX A;  4X56 A;  3SS3 A;  2VK3 A;  1F5M A;  1KE0 A;  5FDH A;  2WKE A;  3FKW A;  1BUL A;  4GD6 A;  2OLV A;  4E3L A;  4HNB A;  3BM6 A;  4GJ4 A;  5A90 A;  1S1Y A;  1S0W A;  2XD1 A;  3NOP C;  3BFC A;  2OWH A;  3CZD A;  3MZF A;  1YSP A;  2ZQA A;  4I38 A;  3T1S A;  3MKE A;  3UME A;  3BYD A;  1MXO A;  4PM8 A;  3W4O A;  4EES A;  2V0W A;  4H8R A;  2BAS A;  2XF3 A;  3SH7 A;  3T4S A;  2ZQ8 A;  2Q9M A;  3CPT B;  2HDR A;  5I94 A;  2FH5 A;  2HP5 A;  4KZ9 A;  4MDZ A;  1MY8 A;  1OTI A;  2JBF A;  5EV0 A;  1WE4 A;  5CX7 A;  4Y5F A;  3IH9 A;  5E2F A;  5G18 A;  3HL9 A;  4WN5 A;  1XJ6 A;  1N9L A;  4JGQ A;  3O87 A;  4Y0O A;  4WEL A;  1YMS A;  4OP8 A;  3FPV A;  3EGD C;  4FTX A;  3RTY A;  3B33 A;  1YAX A;  4C6Y A;  4FH2 A;  3PTE A;  3FWL A;  3PBQ A;  3ZG9 B;  1TEM A;  1P0Z A;  1SHV A;  4Z1W A;  4MBH A;  1E25 A;  3MXR A;  3PBN A;  4DRT A;  3K3C A;  2XRO A;  3FPW A;  1CI9 A;  2JKT M;  3BFG A;  5AQB A;  4CLC D;  4EBL A;  2WZX A;  4F3L A;  1BLP A;  5DF9 A;  5IS1 A;  2IA2 A;  2O99 A;  3I7J A;  3BW6 A;  2WUQ A;  1F98 A;  4PM5 A;  4Y15 A;  2RCX A;  4R1G A;  2J3W A;  4ZJ1 A;  1ES4 A;  3M2J A;  4DDS A;  3M2K A;  2HP6 A;  4ZTK A;  1KVM A;  4BMW A;  3Q1F A;  4L0L A;  1IYO A;  1YT4 A;  1QME A;  1G6A A;  2WGW B;  4OOY A;  2ZC7 A;  3ZG7 B;  1MPL A;  1T1C A;  1XJ3 A;  3MFD A;  1OTB A;  3T50 A;  4CQH A;  4GKU A;  2PHY A;  3MBZ A;  3IXG A;  2Y79 A;  4ESP A;  4ZRR A;  3BY8 A;  3VP0 A;  4CJN A;  3E2L A;  3PXP A;  4JXV A;  3VSL A;  2IWB A;  2WGI A;  3JYI A;  2Z6C A;  5GLB A;  3MF0 A;  4DE1 A;  4WYY A;  4MLL A;  3KSG A;  3F1O A;  3B3X A;  4ZBE A;  4I3J A;  1BUE A;  4HP9 A;  3HLD A;  4KG2 A;  5DJU A;  3CLO A;  3C4P A;  5EPH A;  2QJ5 A;  4F94 A;  2Y2P A;  2YKH A;  4OPZ A;  4H6J A;  1NLY A;  1SZV A;  1PZP A;  3TOI A;  3K3D A;  1PI5 A;  3ZFZ A;  3IBJ A;  4EU0 A;  1VQQ A;  4UHU A;  2D01 A;  5E2G A;  5DJT A;  1OTA A;  3D3O A;  4ETX A;  2VA0 A;  1EW0 A;  5GHZ A;  4NXF A;  2ZL1 B;  3C30 A;  1XJ2 A;  3ISG A;  3NHQ A;  3ZVT A;  4O8G A;  4R38 A;  4KUO A;  4IUK A;  3CJM A;  5FI2 A;  1S4R A;  1T19 A;  5EFW A;  2C5W B;  2QPN A;  2QWS A;  1NWZ A;  3EGX C;  5FDS A;  4QJG A;  4P85 A;  1CF0 A;  1XKZ A;  5GLA A;  4ZJ3 A;  5FEF A;  4B9O A;  3UE0 A;  2WKH A;  3E4O A;  2XH9 A;  5F68 A;  2L0W A;  4YNR A;  1P9W A;  1XA7 A;  3W2Z A;  1K0K A;  2Y2H A;  2VV8 A;  3VSK A;  2A2L A;  2WYX A;  3CI6 A;  2W1T A;  5CGX A;  2VZW A;  1MKI A;  4U0X A;  4LV0 A;  2R9X A;  1XGJ A;  4JXG A;  2OSU A;  2O0Y A;  3LI9 A;  2M1C A;  1UGU A;  1IYS A;  5FQ9 A;  5K5B A;  1IYQ A;  1V9Y A;  5TBM B;  4JBF A;  3SH9 A;  3V3R A;  3ZG5 A;  5FQQ A;  2A24 B;  2H28 A;  1Y4O A;  4BBU A;  3UE6 A;  4MNR A;  4M4X A;  3ZCZ A;  3IQA A;  4KG5 A;  5AVF A;  2PAV P;  4IUH A;  5HDD A;  3MMH A;  1GSX A;  2XDM A;  3C7V A;  4KQR A;  3DWZ A;  5DKK A;  4WF0 A;  4EET B;  2JC7 A;  3IX8 A;  3Q7V A;  4HHD A;  1PI4 A;  1OTE A;  3LIB A;  5DFY A;  1U60 A;  3N8R A;  2P04 A;  3H9W A;  3T4O A;  1ODV A;  3A3J A;  4GZB A;  2Y8H A;  4P6Z S;  3IXB A;  3OOV A;  1I2W A;  3MQ0 A;  3G34 A;  1ZKJ A;  1IEM A;  4CLC B;  1NLZ A;  2EX6 A;  4S2J A;  2J8Y A;  1ESU A;  1YLY A;  1BSG A;  3F1P B;  3VE4 A;  2A3U A;  3GV9 A;  1DP9 A;  3LY4 A;  1GHP A;  1CK3 A;  4Q8I A;  3IWQ A;  2NUP C;  4BL2 A;  2W1R A;  4G3V A;  4BJP A;  3QNB A;  1PWD A;  1WYC A;  2OWJ A;  2OAQ 1;  3NI9 A;  1NZU A;  3IT9 A;  3HLG A;  4EEU A;  5HFO A;  4JF5 A;  3IBR A;  1NZO A;  4KZA A;  3O86 A;  1JWZ A;  1TD5 A;  4JGO A;  3OZH A;  4PM6 A;  2V2F F;  3L7H A;  5AVE A;  2B18 A;  5CEB A;  4S2K A;  1TDL A;  1BTL A;  5EVI C;  4ARZ B;  2MJ6 A;  2Z6D A;  3AGE A;  2J3T C;  4NXG A;  2V8F A;  4GS9 B;  5CEC A;  1HZO A;  3V39 A;  1RP5 A;  2HJE A;  1KDW A;  4LCL A;  4DE3 A;  2Y2G A;  4IBR A;  3E98 A;  3IX4 A;  2HDQ A;  1YM1 A;  3HLF A;  4EXO A;  3HUO A;  1PNE A;  1KOU A;  2BLS A;  3F1N B;  4E3J A;  3IS2 A;  4RVA A;  3HJI A;  1AWI A;  3U2A A;  5EVI A;  1FQG A;  1K25 A;  1A0K A;  4WL9 A;  1H3Q A;  4S2I A;  1LI9 A;  2VGK A;  4JXS A;  3O5Y A;  2AVX A;  1NJ4 A;  2D02 A;  1ERQ A;  3IF6 B;  3OC2 A;  3LR4 A;  4S2N C;  1YLJ A;  3G6O A;  5HPI A;  4OKP A;  4N9L A;  2P9V B;  2H0T A;  2YKF A;  5CGS A;  2W27 A;  4GDB A;  3UB9 A;  2K31 A;  2Y2N A;  4X25 A;  4B93 A;  4L9F A;  1IEL A;  4DKI A;  3FC7 A;  3MKF A;  2VKS A;  4P6Z M;  1CEG A;  3A0R A;  1W63 Q;  3R7W B;  4RA7 A;  4Q0J A;  1ES5 A;  3RXW A;  2ZC6 B;  5CED A;  3A3F A;  1LL9 A;  2JKR I;  4XXR A;  4WLA A;  1VET B;  4WZ5 C;  3T12 B;  3ZNT A;  1SKO A;  2PR6 A;  3Q07 A;  1ZHH B;  3W4P A;  1FIK A;  1AXB A;  4P0M A;  5F5Y A;  2DCF A;  2UWX A;  1MBL A;  2O9C A;  1K6S A;  1N9O A;  5TGF A;  5FAS A;  4ID4 A;  5KIZ A;  2HF6 A;  3S7O A;  5DTK A;  4I5S A;  1ERM A;  1GSV A;  4HEF A;  5LBR A;  3EWK A;  4WZ5 A;  2K7S A;  2W3E A;  4DDY A;  2PR5 A;  5GLD A;  3Q7Z A;  4MBK A;  5CGW A;  1L0F A;  1PWC A;  4OQG A;  4X68 A;  4GDN A;  2EX9 A;  1EWZ A;  2XSS A;  1YLT A;  3LI8 A;  4GHI B;  2Z2M B;  5HPF A;  3MJQ A;  1Q2P A;  2ZMA A;  1FSY A;  1K57 A;  3S7P A;  2K2N A;  3VFH A;  1RGZ A;  1TF1 A;  5EVE A;  5A92 A;  5FEG A;  1F9I A;  2VGJ A;  3BFF A;  4KZ6 A;  4KZ8 A;  2I72 A;  2X02 A;  1JWP A;  2Y2L A;  2EWW A;  1G68 A;  4EEP A;  4WBG A;  2WGV A;  2W3H A;  3VP3 A;  5EOO A;  3GVB A;  3WS4 A;  5EOE A;  3NDE A;  3T1R A;  3T1X A;  4ZAM A;  5HWV A;  3GDI A;  3D72 A;  4FSF A;  4N92 A;  2ACG A;  1YKD A;  4EBN A;  5HWW A;  4GD8 A;  4ZDX A;  2GDN A;  2J7V A;  4E6W A;  3OCN A;  4KZ7 A;  3MS6 A;  3NBL A;  4NK3 A;  4YOF A;  1YSQ A;  5FQJ A;  3S7N A;  3MQQ A;  3UDI A;  4NEE D;  2ZJ9 A;  2PBY A;  4MBF A;  5KSC A;  2W3G A;  3G2Y A;  4N1X A;  1HVB A;  4RYE A;  2OV5 A;  4U0T A;  5HAQ A;  1FR1 A;  3HRE A;  3QNC A;  2G2W A;  2QYB A;  3T4K A;  3ZDJ A;  4K0X A;  3DTI A;  5FQK A;  4IJG A;  2C6W B;  4XT2 B;  1ESI A;  5FQM A;  4XUZ A;  1ZG6 A;  3CPT A;  5KMW A;  2JHE A;  2VEA A;  1DJB A;  5HZH A;  5HDC A;  5EUA A;  2HJ9 C;  4WEJ A;  3O3V A;  1QMF A;  2E8I A;  5CHJ A;  2EFX A;  2IWD A;  2JKG A;  1K56 D;  4DMZ A;  1FCO A;  3NDG A;  3NOU C;  3N7W A;  3TRC A;  1MWU A;  5L09 A;  3CWF A;  3G2Z A;  2R9W A;  1K4F A;  3H82 B;  3N8L A;  3PBS A;  4BBV A;  3PYP A;  3E0Y A;  5D3O A;  1K54 A;  1F2K A;  4HIA A;  5FI6 A;  1IKG A;  1KGG A;  1KE3 A;  5L10 A;  2Y2J A;  1FIL A;  2ZQ7 A;  3VOY A;  5HAI A;  3NUL A;  3UB8 A;  3KO6 A;  2JKR M;  5DTS A;  3IH8 A;  3WWX A;  1ES3 A;  5CRF A;  4DE2 A;  1H0M A;  3S7Q A;  4KG6 A;  4QPR A;  5HAR A;  4ZJ2 A;  2W3F A;  3KYZ A;  5FAQ A;  4A5R A;  5GLC A;  1XFN A;  3IXD A;  4HJ4 A;  4D60 A;  5HL1 A;  4DXC A;  4MEZ A;  5EM1 A;  1PIO A;  4EW7 A;  2XRN A;  1XFQ A;  4GOG A;  3H7W A;  5DF7 A;  1T1B A;  1K4E A;  3MXQ A;  2G2U A;  1ES2 A;  1HLU P;  4PMA A;  5DVA A;  2Q9N A;  5C5K A;  2DRW A;  2WGW A;  3NEC A;  5A93 A;  2INW A;  2FZ0 A;  1VHM A;  1NYM A;  3E2K A;  5KZH A;  1K6R A;  3O88 A;  4PPR A;  4UA6 A;  3LCE A;  4FD8 A;  4OOL A;  1I5Q A;  2HPB A;  3V50 A;  1BZA A;  3WRZ A;  2ZBB A;  3BLS A;  3HLE A;  3ZG0 A;  2V1B A;  2IWC A;  3E4P A;  3QP2 A;  3RFB A;  5A8B A;  3MR0 A;  4HY8 A;  3DWK A;  3BLM A;  3DAV A;  1OPX A;  1RGY A;  3OPP A;  4JPM A;  5TR7 A;  3QP1 A;  1PWG A;  3TG9 A;  4DF6 A;  4UAA A;  3IWO A;  1GCE A;  4RX3 A;  3PHY A;  2JN7 A;  1BT5 A;  2P7J A;  2Y55 A;  1STZ A;  2BG1 A;  2W3D A;  4IED A;  3LR5 A;  3UPN A;  4OPR A;  5I5L A;  3EOI A;  3HBR A;  4NXE A;  4E3M A;  5G4Y A;  5CXW A;  4R6L A;  2PU2 A;  3ZNY A;  2ZL1 A;  3UMD A;  4XUX A;  4CPK A;  5IU1 A;  1LSW A;  4FCF A;  2R78 A;  4OOM A;  1H8M A;  3KX0 X;  1XJ4 A;  4OH0 A;  1PFL A;  1Q2Q A;  4IHQ A;  4DN0 A;  5HDS A;  4MCW A;  1ALQ A;  2WK0 A;  3NOT C;  3GSG A;  1CI8 A;  3ULF A;  4E3K A;  2J80 A;  1LI0 A;  2L1M A;  4U3T A;  2B95 A;  5L2F A;  4I3I A;  4LV1 A;  1XA1 A;  3FZC A;  5E2H A;  4X6T A;  5BOH A;  1LHY A;  1UWN X;  3JVU A;  5F82 A;  3C5A A;  3TJZ C;  1TS8 A;  3KYE A;  3HVF A;  4X69 A;  4R3B A;  3NC8 A;  2HP9 A;  4Y3I A;  3C7U A;  4HBT A;  2QKP A;  3WS0 A;  2WZZ A;  4KZ4 A;  2ZLY A;  4EUV A;  2VLG A;  4OQ0 A;  4E3I A;  2EXA A;  1E3U D;  3HLC A;  1ONG A;  4OPQ A;  1OME A;  2A24 A;  1J9M A;  3MQO A;  4I39 A;  2Y2M A;  2PYR A;  1NYY A;  3A0S A;  1JVJ A;  1S66 L;  3BY9 A;  3V67 A;  3N6I A;  4QU3 A;  1LL8 A;  3IHA A;  3ITA A;  5EEC A;  1IKI A;  2Y2K A;  3T4J A;  4PM7 A;  5M1A A;  3HLB A;  1FCM A;  3LO7 A;  4CLC C;  3ZHH A;  2BTF P;  1YPR A;  1PRQ A;  4QD4 A;  3DTK A;  4LEN A;  5GHY A;  1FOF A;  2DNS A;  4GB7 A;  1UWP X;  5J4E A;  3LY3 A;  3L9K A;  2PT7 A;  3LID A;  4KQQ A;  4G3W A;  4OLG A;  4LFU A;  3T1Q B;  1LL5 A;  1E4D A;  4HI4 A;  1H8Z A;  1P9R A;  2HDU A;  3WS1 A;  4BD0 A;  2CMN A;  2EA9 A;  1VEU B;  4R4S A;  2CC1 A;  3V5M A;  3LIF A;  4GNU A;  4QY5 A;  3BRM A;  2KDK A;  3LEZ A;  1OJG A;  4CLC A;  3NCK A;  1W8Q A;  1FR6 A;  2I9V A;  4FUW A;  1PW1 A;  2H0Y A;  3BFE A;  5FAO A;  1OT9 A;  3F1P A;  4OLD A;  1MC0 A;  4GCZ A;  4BQM A;  3HUM A;  3OBF A;  5HSQ A;  3UDX A;  4R3J A;  4R4R A;  4R3A A;  1TS6 A;  3LIA A;  3SH8 A;  1MWS A;  2XGN A;  2Y2Q A;  1ONH A;  3C2W A;  5JYP A;  3PAE A;  3HCY A;  1MKM A;  2WAE A;  2ZM8 A;  4OQH A;  3VOZ A;  4Y0U A;  2PYP A;  2Y91 A;  1K55 A;  2PDR A;  3DTE A;  5AJG A;  2Q0O A;  3MZE A;  3KSH A;  2H5S A;  2ZQC A;  5HD3 A;  3CUE C;  3K2N A;  5F6A A;  1MZU A;  1YLP A;  4MN6 A;  4S2O A;  1Y54 A;  3LFV A;  4FH4 A;  3WS5 A;  1WYB A;  2ZM0 A;  5HD5 A;  3DTM A;  4KZB A;  2VX8 A; 
#chains in the Genus database with same CATH homology
 2PU4 A;  3UDI A;  4QJG A;  2ZM2 A;  1ZG4 A;  2Z2L B;  2EX8 A;  1PW8 A;  2ZJ9 A;  3UN7 A;  4P85 A;  2PBY A;  1YQS A;  4MBF A;  1XKZ A;  5GLA A;  3VP4 A;  5KSC A;  1HD8 A;  3G2Y A;  4ZJ3 A;  4N1X A;  4BEN A;  1HVB A;  4RYE A;  2OV5 A;  3VMA A;  3UE0 A;  2WKH A;  3UY6 A;  2XH9 A;  4U0T A;  4YFM A;  1IYP A;  3M6H A;  5HAQ A;  1XA7 A;  1KGE A;  1BLS A;  3IHB A;  3HUN A;  1RCJ A;  3P98 A;  3IF6 C;  2Y2H A;  1FR1 A;  5AQA A;  3VSK A;  4OVD A;  2WYX A;  3HRE A;  3MXS A;  3QNC A;  1GA0 A;  1SCW A;  2G2W A;  5CGX A;  4K91 A;  1MKI A;  4U0X A;  4LV0 A;  2R9X A;  4Y7P A;  5TFQ A;  1L0G A;  1XGJ A;  3ZDJ A;  2Y4A A;  4JXG A;  2OSU A;  4K0X A;  4S2M A;  4WMC D;  5FQK A;  5CTM A;  5HX9 A;  1L2S A;  2C6W B;  4GN2 A;  1K57 C;  1W8Y A;  1ESI A;  2HDS A;  4IVI A;  4KQO A;  5FQI A;  5FQM A;  4XUZ A;  1ZG6 A;  4WEK A;  1IYS A;  5FQ9 A;  5CTN A;  5KMW A;  2ZQD A;  3WS2 A;  1W5D A;  1SDE A;  1PYY A;  3PBO A;  1DJB A;  3UPO A;  2P74 A;  1IYQ A;  5EUA A;  5FAP A;  1DY6 A;  4JBF A;  5CHM A;  3SH9 A;  3V3R A;  3ZG5 A;  2XEP A;  4WEJ A;  5FQQ A;  3O3V A;  4UA7 A;  1QMF A;  2E8I A;  2B5R A;  2EFX A;  2IWD A;  3IXH A;  5CHJ A;  1K56 D;  1FCO A;  3ITB A;  3NDG A;  1BLC A;  2OLU A;  4B4X A;  4E6X A;  2J9P A;  3N7W A;  3OPH A;  3UPP A;  1MWU A;  3IF6 A;  1XP4 A;  3EQU A;  3RJU A;  3G2Z A;  2R9W A;  1K4F A;  5FAT A;  1K55 C;  1DJC A;  3VP2 A;  1H5X A;  4LCM A;  3N8L A;  3PBS A;  1NRF A;  1MWT A;  3SOI A;  3IF5 A;  2ZC4 B;  2P9V A;  4MNR A;  5D3O A;  1K54 A;  3ZCZ A;  4C3Q A;  3IQA A;  4KG5 A;  4EBP A;  4M3K A;  1IKG A;  1KGG A;  1KE3 A;  5FI6 A;  4LV2 A;  3UE3 A;  2H10 A;  4E3O A;  2XDM A;  3C7V A;  1YLW A;  3DWZ A;  4KQR A;  5CER A;  2Y2J A;  3GQZ A;  1VM1 A;  2ZQ7 A;  1KDS A;  5IHV A;  1GHI A;  2JC7 A;  3VOY A;  4Y0T A;  1L0D A;  2XLN A;  3Q7V A;  5HAI A;  3UO9 A;  1PI4 A;  1ERO A;  1DJA A;  1EI5 A;  2JCH A;  4KEN B;  5F1G A;  5DTS A;  2Y59 A;  3IH8 A;  1U60 A;  3UDF A;  3N8R A;  3WWX A;  5GHX A;  1ES3 A;  2J9O A;  5CRF A;  4OPY A;  4RX2 A;  4DE2 A;  3A3J A;  4GZB A;  3GRJ A;  4KG6 A;  4N1H A;  3PAG A;  3BEC A;  4JXW A;  3IXB A;  5HAR A;  4ZJ2 A;  1NXY A;  1I2W A;  3GTC A;  5DF8 A;  3G34 A;  1ZKJ A;  4QY6 A;  5FAQ A;  4A5R A;  1IEM A;  2ZC5 B;  5GLC A;  4DXB A;  2EX6 A;  3IXD A;  1K56 A;  5U47 A;  1XGI A;  4S2J A;  2J8Y A;  1ESU A;  5HL1 A;  4DXC A;  1YLY A;  5M19 A;  1BSG A;  2X71 A;  4MEZ A;  1XPB A;  1PIO A;  5GL9 A;  2XQZ A;  4YIN A;  3D4F A;  4KZ5 A;  2A3U A;  4DE0 A;  4GOG A;  3AGD A;  3VP1 A;  1XXM A;  5DF7 A;  3GV9 A;  3G4P A;  3FV7 A;  1K4E A;  1JWV A;  3OPL A;  2G2U A;  2WKI A;  4JLF A;  2Y2O A;  2V1Z A;  3LY4 A;  1GHP A;  1ES2 A;  4PMA A;  5DVA A;  1CK3 A;  2Q9N A;  4Q8I A;  2DRW A;  3IWQ A;  3A3I A;  5FSR A;  3IWI A;  4BL2 A;  2WGW A;  5A93 A;  3G31 A;  5A91 A;  4BJP A;  3S22 A;  3OPR A;  4UA9 A;  1YMX A;  3VFF A;  3E2K A;  1NYM A;  3QNB A;  1KVL A;  4IBX A;  2V20 A;  3CMZ A;  4BL3 A;  5KZH A;  1Z6F A;  1K6R A;  3O88 A;  1PWD A;  1WYC A;  3LCE A;  4FD8 A;  4OON A;  4PPR A;  4S2N A;  1PZO A;  3MZD A;  1I5Q A;  1FSW A;  4OOL A;  4R23 A;  4BLM A;  3GMW A;  3S4X A;  2HPB A;  3NI9 A;  4O7D A;  1TDG A;  3TSG A;  1NZU A;  3IT9 A;  5E2E A;  3V50 A;  1BZA A;  5EVI D;  3NY4 A;  3WRZ A;  3HLG A;  3BLS A;  3HLE A;  5HFO A;  4JF5 A;  1HTZ A;  1NZO A;  3ZG0 A;  4KZA A;  2IWC A;  3FKV A;  1K54 C;  1JWZ A;  3O86 A;  4OP5 A;  4B88 A;  1GHM A;  2ZQ9 A;  3M6B A;  1JTG A;  2FFF B;  3GR2 A;  3OZH A;  4PM6 A;  2ZD8 A;  3DWK A;  2V2F F;  3BLM A;  1RGY A;  5E43 A;  1C3B A;  3BEB A;  3OPP A;  4JPM A;  5CEB A;  5TR7 A;  2WAF A;  3FYZ A;  4X56 A;  3SS3 A;  1PWG A;  4S2K A;  3TG9 A;  4DF6 A;  1KE0 A;  1TDL A;  1BTL A;  4UAA A;  5EVI C;  5FDH A;  2WKE A;  3AGE A;  3FKW A;  3OCL A;  3AGF A;  1BUL A;  4X55 A;  4GD6 A;  4S2L A;  3IWO A;  2OLV A;  3A3D A;  4E3L A;  5CEC A;  1HZO A;  1GCE A;  3BM6 A;  4RX3 A;  3V39 A;  1RP5 A;  5A90 A;  1MWR A;  1KDW A;  4LCL A;  4DE3 A;  2Y2G A;  1BT5 A;  1S0W A;  4IBR A;  2XD1 A;  3BFC A;  2Y55 A;  2BG1 A;  2HDQ A;  4IED A;  3UPN A;  4K0W A;  1YM1 A;  3HLF A;  4OPR A;  3CZD A;  1E3U A;  3MZF A;  5EE8 A;  2ZQA A;  3MKE A;  5JYO A;  3HUO A;  3BYD A;  1MXO A;  4PM8 A;  3HBR A;  3W4O A;  4E3M A;  4EV4 A;  5M18 A;  3G35 A;  5CXW A;  2BLS A;  2PU2 A;  4E3J A;  3EQV A;  4H8R A;  3ZNY A;  5AQ9 A;  1L0E A;  4RVA A;  2XF3 A;  3SH7 A;  4XUX A;  4CPK A;  5EVI A;  1FQG A;  1K25 A;  1M6K A;  2ZQ8 A;  3C4O A;  4FCF A;  4OOM A;  2Q9M A;  2HDR A;  4S2I A;  5I94 A;  2HP5 A;  3W8K A;  4KZ9 A;  1MY8 A;  1LI9 A;  4OH0 A;  2VGK A;  4P87 A;  1Q2Q A;  2JBF A;  2JE5 A;  1ALQ A;  2WK0 A;  3GSG A;  1CI8 A;  5CHU A;  4P6B A;  4E3K A;  1WE4 A;  4JXS A;  1LI0 A;  1NJ4 A;  4U3T A;  3IH9 A;  4LV1 A;  5E2F A;  5G18 A;  1XA1 A;  3HL9 A;  1ERQ A;  5L2F A;  3IF6 B;  1S6R A;  3FZC A;  3Q82 A;  5E2H A;  4X6T A;  5BOH A;  4S2P A;  4R0Q A;  3OC2 A;  4S2N C;  4JF6 A;  1W7F A;  1YLJ A;  1LHY A;  4OKP A;  5F82 A;  1SKF A;  3C5A A;  3O87 A;  4N9L A;  4Y0O A;  2P9V B;  4WEL A;  3HVF A;  1YMS A;  4OP8 A;  2H0T A;  3A3E A;  4R3B A;  4X69 A;  4KZ3 A;  3NC8 A;  4GDB A;  5CGS A;  3ZVW A;  5EVL A;  5HAP A;  2Y2N A;  2HP9 A;  3C7U A;  4D2O A;  4HBT A;  4JKT A;  1IEL A;  5KSH A;  4C6Y A;  3WS0 A;  4DKI A;  3S1Y A;  4FH2 A;  3PTE A;  3FWL A;  3BFD A;  2WZZ A;  3MKF A;  3PBQ A;  3ZG9 B;  4E3N A;  1CEG A;  4KZ4 A;  2ZLY A;  3ZGA B;  1TEM A;  1SDN A;  3Q7V B;  1SHV A;  4MBH A;  4OQ0 A;  1E25 A;  3MXR A;  3PBN A;  4RA7 A;  2EXA A;  4E3I A;  2Y2I A;  1ES5 A;  3RXW A;  1E3U D;  4DRT A;  2ZC6 B;  5CED A;  3HLC A;  1ONG A;  1CI9 A;  4OPQ A;  3A3F A;  1OME A;  1LL9 A;  3BFG A;  4XXR A;  4WZ5 C;  5AQB A;  1J9M A;  3ZNT A;  4HBU A;  4EBL A;  2Y2M A;  3Q07 A;  3W4P A;  4QHC A;  1NYY A;  2WZX A;  1AXB A;  1JVJ A;  4P0M A;  2DCF A;  2QMI A;  1BLP A;  2XFS A;  5DF9 A;  3N6I A;  4QU3 A;  3IHA A;  3ITA A;  5EEC A;  5FI7 A;  1JTD A;  4EUZ A;  1IKI A;  2Y2K A;  3I7J A;  1BLH A;  3WRT A;  2UWX A;  3QHY A;  1MBL A;  2WUQ A;  4PM7 A;  5M1A A;  3HLB A;  1FCM A;  1I2S A;  4Z9Q A;  4PM5 A;  1K6S A;  2XR0 A;  5TGF A;  1O7E A;  2X01 A;  2RCX A;  4R1G A;  3LO7 A;  3ZHH A;  4ZJ1 A;  5FAS A;  1ES4 A;  4ID4 A;  5F83 A;  4QD4 A;  2EXB A;  3M2J A;  4LEN A;  5GHY A;  4DDS A;  1GA9 A;  3M2K A;  2HP6 A;  3NIA A;  5DTK A;  4ZTK A;  1KVM A;  1FOF A;  3Q1F A;  2DNS A;  4L0L A;  1ERM A;  1IYO A;  4HEF A;  1YT4 A;  4GB7 A;  1QME A;  1G6A A;  2XD5 A;  3N8S A;  2WGW B;  5FA7 A;  3LY3 A;  4WZ5 A;  3V3S A;  4OOY A;  4KQQ A;  4DDY A;  2ZC7 A;  4OLG A;  3ZG7 B;  4X53 A;  1LL5 A;  1MPL A;  1NY0 A;  5GLD A;  1E4D A;  4UA6 A;  4QB8 A;  3Q7Z A;  2EX2 A;  4MBK A;  5F1F A;  5CGW A;  1H8Z A;  2HDU A;  1L0F A;  4WZ4 A;  1PWC A;  3W4Q A;  4OQG A;  4X68 A;  3MFD A;  1FCN A;  2FFY A;  3WS1 A;  4BD0 A;  1KGF A;  4GKU A;  4GDN A;  4R4S A;  2EX9 A;  4LV3 A;  3MBZ A;  3IXG A;  1EWZ A;  2CC1 A;  3V5M A;  4EQI A;  4GNU A;  1YLT A;  3BRM A;  4QY5 A;  3LEZ A;  3PBT A;  3VP0 A;  4CJN A;  1M40 A;  3E2L A;  3NCK A;  1W8Q A;  4JXV A;  2IWB A;  3VSL A;  1FR6 A;  4HES A;  2Z2M B;  3UNW A;  2WGI A;  3JYI A;  1PW1 A;  3HLW A;  5GLB A;  2H0Y A;  3BFE A;  5FAO A;  4EWF A;  1W79 A;  1Q2P A;  1XX2 A;  2ZMA A;  4OLD A;  4WYY A;  1FSY A;  4DE1 A;  1K57 A;  4BQM A;  4MLL A;  4IVK A;  1N9B A;  3HUM A;  4OQI A;  3VFH A;  3UDX A;  1RGZ A;  3PBR A;  4NET A;  4R3J A;  1N4O A;  3B3X A;  1KE4 A;  4ZBE A;  4JF4 A;  5A92 A;  1LLB A;  4R4R A;  4B4Z A;  1BUE A;  2VGJ A;  1TVF A;  3SH8 A;  2WAD A;  1MWS A;  2XGN A;  3BFF A;  2Y2Q A;  2A49 A;  4KZ6 A;  3HLD A;  1ONH A;  4KG2 A;  4KZ8 A;  5JYP A;  2I72 A;  3C4P A;  2X02 A;  1JWP A;  5EPH A;  1YLZ A;  2Y2L A;  3PAE A;  4F94 A;  1CEF A;  1H8Y A;  2WAE A;  2XK1 A;  2ZM8 A;  4OQH A;  4WMC A;  2Y2P A;  3VOZ A;  4OPZ A;  1O07 A;  4N9K A;  4Y0U A;  1G68 A;  4WBG A;  1K38 A;  1PZP A;  3RXX A;  2Y91 A;  2WGV A;  1K55 A;  3TOI A;  3VP3 A;  5EOO A;  3GVB A;  1PI5 A;  3WS4 A;  5EOE A;  3NDE A;  3ZFZ A;  1VQQ A;  2ZC3 B;  3MZE A;  2RL3 A;  4PM9 A;  4ZAM A;  2H5S A;  3DW0 A;  4UHU A;  3ZG8 B;  2ZQC A;  5E2G A;  3CG5 A;  4WM9 A;  1ZC2 A;  4FSF A;  2QZ6 A;  2EFU A;  4N92 A;  5GHZ A;  1YLP A;  3ISG A;  4EBN A;  3ZVT A;  3G30 A;  4C75 A;  4GD8 A;  4S2O A;  5AQ7 A;  4ZDX A;  2GDN A;  1Y54 A;  5HW3 A;  2J7V A;  5EVI B;  4FH4 A;  3Q81 A;  4BD1 A;  3CJM A;  4E6W A;  5DTT A;  3OCN A;  5FI2 A;  3G32 A;  4KZ7 A;  3P09 A;  3WS5 A;  3N4I A;  3SS5 A;  3NBL A;  1WYB A;  4NK3 A;  2XFT A;  3SS4 A;  5J8X A;  2ZM0 A;  5FQJ A;  2C5W B;  3UE1 A;  3DTM A;  4KZB A;  2QPN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...