1RCJA

Crystal structure of e166a mutant of shv-1 beta-lactamase with the trans-enamine intermediate of tazobactam
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
265
structure length
265
Chain Sequence
SPQPLEQIKLSESQLSGRVGMIEMDLASGRTLTAWRADERFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGELCAAAITMSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWATELNEALPGDARDTTTPASMAATLRKLLTSQRLSARSQRQLLQWMVDDRVAGPLIRSVLPAGWFIADKTGAGERGARGIVALLGPNNKAERIVVIYLRDTPASMAERNQQIAGIGAALIEHWQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Beta-lactamase SHV-1
publication title Tazobactam Forms a Stoichiometric trans-Enamine Intermediate in the E166A Variant of SHV-1 beta-Lactamase: 1.63 A Crystal Structure
pubmed rcsb
source organism Klebsiella pneumoniae
total genus 98
structure length 265
sequence length 265
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2003-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1rcjA00
3NIAA 1GA9A 4N1HA 1ES4A 1ERQA 3LY3A 5GLCA 4EBPA 2EX2A 1XA7A 3IXDA 4C6YA 4OPZA 1ONHA 4WYYA 4M3KA 5FQQA 3A3JA 3FZCA 2XFSA 2J9OA 4X53A 4DKIA 1WE4A 3N8LA 4RYEA 4R4SA 2EX8A 2CC1A 4OQIA 1W8YA 3IT9A 4P85A 5FI2A 3TG9A 3UDXA 2WADA 4R0QA 2WKEA 4B4ZA 1GHMA 5HAQA 2ZM0A 4JXSA 4U0TA 1KDWA 2XEPA 4OQHA 5EVLA 3A3IA 4JF5A 3G34A 2XD1A 4EQIA 1SKFA 3P98A 4EBLA 4S2PA 3TOIA 3PBQA 3ZNYA 4S2KA 5FAPA 2Y55A 2XQZA 5FAOA 3HUOA 5EPHA 3E2LA 4FH4A 4C75A 2Y2QA 4DDYA 3QNBA 1O07A 2JC7A 4S2LA 4MLLA 5A92A 3OZHA 1K6SA 3G31A 2PU4A 3DWZA 2HDUA 2J9PA 2XH9A 3A3FA 4HEFA 4DXBA 3ZG7B 1H8YA 2ZM2A 3M6BA 3DW0A 3WS0A 1E3UD 1TDGA 5EE8A 4BENA 3AGDA 4GKUA 3HLDA 3I7JA 4PM8A 1BSGA 1GCEA 4UHUA 5F83A 2PU2A 4ZBEA 3W8KA 4N1XA 4E3LA 3CG5A 4RA7A 4Y0UA 4E6WA 4DF6A 1K54C 5EUAA 3HLFA 4Y0OA 1YQSA 4WZ4A 1L0FA 1PW8A 1DJAA 3VP3A 1XKZA 1XGIA 3G2YA 3AGFA 1LL9A 3WS5A 1MPLA 1AXBA 3HLEA 4WEJA 3MZEA 1FSWA 1K56D 1K4FA 4PM6A 3VMAA 2J8YA 1NZOA 1FSYA 2P9VB 3EQUA 5AQAA 4DXCA 1YM1A 3ZVWA 2ZC5B 4JF4A 3O87A 5DF9A 3UE3A 4OOYA 2Q9MA 1RGZA 3PBNA 3MFDA 3IWIA 1YLTA 3Q7VB 4KZ4A 1KE0A 1I2WA 4BL2A 4YINA 2WKIA 4RX3A 3SH9A 1RP5A 1W8QA 5DVAA 1PWDA 4CPKA 1DJBA 1RGYA 4P0MA 4KZ7A 2IWDA 4JLFA 2E8IA 1ALQA 1H5XA 2H10A 3IF6B 4LV1A 1MWTA 3OC2A 3QHYA 4UA9A 4GB7A 5J8XA 1ESIA 4KZ6A 3BM6A 4ZJ3A 1K57A 2WZZA 3VP2A 5E2GA 2Y2IA 1SDEA 3O86A 1GA0A 1ONGA 4DE3A 2V1ZA 5CHJA 1EI5A 1ES5A 2Y2OA 5A93A 1JWVA 1QMFA 1E4DA 3CZDA 4FH2A 5GLAA 4P87A 3ZG9B 2JE5A 4GD6A 1BUEA 2Z2MB 4ZDXA 3WS2A 1C3BA 4OVDA 4KZ8A 4KG2A 5E2EA 4DDSA 2XDMA 2EFXA 1MWUA 2ZQDA 3IHBA 3OCLA 1JTGA 3HLWA 2X71A 2EFUA 1NYMA 3HLGA 1Q2QA 5AQBA 4X56A 3G4PA 5DTSA 3HLCA 4P6BA 1XPBA 2DNSA 2Y4AA 4S2NA 2A3UA 5M1AA 5EVIA 4Q8IA 5DF8A 5FQ9A 4BD1A 2HP6A 3SS5A 3UNWA 3MKFA 1DY6A 4WBGA 3VFHA 4XXRA 3OPRA 2HP5A 2P9VA 2ZQ8A 1NZUA 1FCNA 2GDNA 1KDSA 2C5WB 2OSUA 4N9KA 4OKPA 3V3SA 5GHZA 5FASA 5HARA 3VFFA 3G32A 4JF6A 3SH7A 1OMEA 4OQ0A 3Q7VA 3HL9A 5CTMA 4U0XA 3V3RA 4OQGA 4GN2A 5FATA 4S2IA 5FQJA 2Y2JA 3IF5A 4KZBA 3ISGA 3GV9A 5KMWA 3UE1A 3ZG5A 5DTTA 1Z6FA 1ESUA 3O3VA 1K4EA 1BLCA 1NY0A 3PBTA 4OH0A 5FI6A 3IF6A 3DWKA 4GNUA 3BFGA 2ZC4B 1ES2A 1XX2A 4KZ3A 3WRZA 5KSCA 1SCWA 5GLBA 1PYYA 2EXAA 2HDSA 4R3BA 4PM7A 5I94A 4K91A 5CHMA 2QMIA 3SOIA 3WS4A 4JPMA 2ZQ7A 4ZJ1A 4LCLA 1YMSA 1TEMA 2EX6A 2JBFA 2XR0A 1CEGA 2WGWB 5FQIA 1YMXA 3UPNA 2V20A 1YLPA 3A3EA 4ZJ2A 1BLPA 4HBTA 4FCFA 4EWFA 4KQRA 3UPOA 3DTMA 2HDQA 2WZXA 3ZFZA 2WK0A 2ZQ9A 5CGSA 2JCHA 3C4PA 2IWCA 1I5QA 3NC8A 2BG1A 5U47A 5HL1A 1LHYA 3LCEA 3ZG0A 1K55A 4EV4A 3GSGA 3LO7A 1I2SA 4YFMA 1HVBA 3BLSA 1O7EA 1K6RA 3VSLA 4BQMA 3D4FA 2G2WA 3VP1A 4QY5A 5CRFA 3MXRA 5EVIB 4S2OA 4B88A 3OPHA 4KQOA 5TGFA 4C3QA 5E2HA 2ZM8A 4IEDA 5EOEA 1FOFA 4LV2A 2Y2LA 3UDFA 4BJPA 3CJMA 3G35A 4IVIA 5F82A 3TSGA 4WMCA 4X55A 1FQGA 1H8ZA 1L0GA 1J9MA 1NRFA 4S2NC 1DJCA 3ZVTA 5CEBA 4ZAMA 4E3MA 4JXWA 5DF7A 1ZG6A 5DTKA 1CI8A 1TDLA 1KGGA 4X69A 5AQ9A 1WYCA 3GTCA 5CHUA 3PAGA 1IYPA 4QU3A 4EUZA 5HW3A 3VSKA 3BFFA 5FSRA 1VQQA 2WAFA 1NYYA 2HP9A 4MBFA 4QJGA 4BD0A 3ZNTA 1MWSA 1YLYA 4MBKA 2WAEA 4OPQA 1BULA 1IEMA 3UO9A 3WS1A 3ZGAB 3W4OA 5GL9A 2XD5A 1PIOA 1S0WA 3UE0A 2EX9A 4KENB 3FKWA 3VP0A 4GDBA 4E6XA 3N8SA 4N9LA 4QY6A 1HTZA 3G2ZA 1MBLA 3ITAA 3IXBA 2WGWA 4KQQA 1NJ4A 4E3JA 3IWQA 5F1GA 1MXOA 1KE3A 3FV7A 2EXBA 2Y2NA 1JWZA 4GOGA 1KVLA 1CEFA 3BFDA 3FKVA 2H0TA 1FR6A 5GLDA 3UPPA 4X68A 4S2JA 4QD4A 3BYDA 1NXYA 4KZ9A 3BRMA 2R9WA 4NETA 4WELA 2XK1A 1YLJA 5FDHA 3NBLA 3HBRA 1IELA 4OP8A 3GVBA 3C7UA 1JWPA 1RCJA 4GDNA 1PWGA 3S1YA 5A91A 3AGEA 2WGVA 4JXVA 4D2OA 2ZC7A 3RXWA 1S6RA 2ZD8A 4JXGA 4OONA 2ZC3B 4RVAA 5E43A 3GMWA 3FYZA 3HUNA 3IXHA 4N92A 3RJUA 4ID4A 3JYIA 3IH8A 3A3DA 3IWOA 1K54A 5TR7A 3Q82A 1N4OA 1K55C 2DRWA 1XA1A 3NDGA 1XP4A 4IBRA 1EWZA 4LENA 2HDRA 1M40A 5L2FA 2Y91A 1PI5A 5HX9A 3S22A 2Y2PA 1HD8A 4PM9A 2Y2GA 1FCMA 2XLNA 2UWXA 1HZOA 3S4XA 1JTDA 5KSHA 1LI9A 2H0YA 2ZC6B 2Q9NA 1ERMA 4R1GA 3BECA 1CI9A 3BFEA 5F1FA 4EBNA 1FR1A 2FFFB 3NY4A 2DCFA 4OP5A 3HUMA 3Q07A 4F94A 4LCMA 3PTEA 5AQ7A 1PZPA 3WWXA 5TFQA 4R4RA 5GHXA 1GHIA 4WZ5A 5M19A 4O7DA 2PBYA 4PPRA 5EVID 3WRTA 4B4XA 3BFCA 2RL3A 4A5RA 3N8RA 1GHPA 2A49A 3UDIA 1E3UA 5HAIA 3VP4A 3NDEA 3MZFA 5JYOA 4KZAA 2OLUA 5FQMA 4E3IA 4JKTA 2OV5A 2Y2KA 1G6AA 4PMAA 4IBXA 2WKHA 1Y54A 1K57C 1XXMA 1W79A 1VM1A 1KVMA 2XF3A 2ZQAA 4BLMA 4MEZA 3PBOA 3Q1FA 2ZJ9A 3V5MA 1K56A 2XGNA 3M2KA 1MWRA 1LI0A 1W7FA 5FAQA 1ZKJA 1BT5A 3N7WA 1YLZA 1IYSA 2Z2LB 1BTLA 2J7VA 1JVJA 3Q7ZA 4KZ5A 3Q81A 1TVFA 4L0LA 4OLGA 3GR2A 2QZ6A 5CGWA 1BLHA 4UA6A 5EECA 5M18A 4K0WA 4XUXA 4Y7PA 3C4OA 3OPLA 2VGKA 2HPBA 3VOYA 3O88A 4WEKA 1YLWA 3FWLA 2QPNA 4K0XA 3P09A 3PAEA 1W5DA 1PZOA 1ZC2A 3M2JA 1FCOA 3LY4A 4LV3A 5E2FA 5EVIC 4KG6A 4R23A 5CERA 4OLDA 4CJNA 1PW1A 3BEBA 4U3TA 3SH8A 1YT4A 1LLBA 3RXXA 3ZG8B 1K25A 1XGJA 3UN7A 1ZG4A 2H5SA 2P74A 3IQAA 2WGIA 3MZDA 5CGXA 4JBFA 2XFTA 4E3NA 2WYXA 5A90A 1QMEA 1LL5A 4UAAA 2ZLYA 1M6KA 4S2MA 4PM5A 5EOOA 1PWCA 2C6WB 5IHVA 1BLSA 3IXGA 2Y59A 2RCXA 4GZBA 3VOZA 1MY8A 1Q2PA 3QNCA 1L0EA 1U60A 2R9XA 1E25A 4XUZA 4Y0TA 3SS4A 3B3XA 3IF6C 4MBHA 4E3OA 4WMCD 3N4IA 1N9BA 4QB8A 4WZ5C 4DE2A 5JYPA 1WYBA 2ZMAA 4H8RA 3LEZA 3BLMA 3IHAA 1IYQA 2VGJA 2X02A 3OPPA 5FA7A 3NCKA 2V2FF 1KGFA 2B5RA 3CMZA 3SS3A 1IKGA 4GD8A 3ZHHA 5CEDA 5CTNA 5KZHA 1KGEA 2OLVA 1G68A 4KG5A 4UA7A 3PBSA 4RX2A 3ZDJA 4E3KA 1K38A 3MKEA 4Z9QA 5FQKA 3V50A 3HREA 3OCNA 5G18A 5HAPA 5HFOA 2BLSA 3PBRA 4ZTKA 3NI9A 5BOHA 5CXWA 2FFYA 4X6TA 1CK3A 4WM9A 4DRTA 1MKIA 3W4PA 1SHVA 1BZAA 4OOMA 5D3OA 4IVKA 4DE0A 4R3JA 1IYOA 2IWBA 3GQZA 4NK3A 1L0DA 3ZCZA 5CECA 3UY6A 2Y2HA 1ES3A 1KE4A 3N6IA 4BL3A 1EROA 3MBZA 3C5AA 1PI4A 2I72A 3EQVA 4FD8A 4FSFA 3HVFA 3GRJA 4OOLA 3G30A 2G2UA 3M6HA 2X01A 3MXSA 3E2KA 2WUQA 3ITBA 5FI7A 5GHYA 3V39A 2Y2MA 4DE1A 4QHCA 1L2SA 1SDNA 2ZQCA 4OPRA 1IKIA 4OPYA 4HESA 4HBUA 3W4QA 4LV0A 4MNRA 3HLBA 3IH9A 3C7VA
chains in the Genus database with same CATH superfamily
3DAVA 2FH5A 5GLCA 5IT5A 4C6YA 1ONHA 4WYYA 4M3KA 3A3JA 2VX8A 2PYPA 4RYEA 2PR6A 4R4SA 3BY8A 2O99A 2JKTM 4P85A 3UDXA 1D7EA 2J3TD 2P7JA 5HAQA 4U0TA 5EVLA 4JF5A 3G34A 4EQIA 3P98A 4EBLA 4S2PA 3PBQA 4WN5A 4S2KA 2Y55A 2KX6A 3QNBA 1K6SA 4I38A 2PU4A 3DWZA 2XH9A 3PXPA 1H8YA 3L7HA 5HSQA 4CLCB 3WS0A 2UV0E 2FZ0A 3KYEA 3W8KA 2L0WA 4RA7A 4DF6A 4O01A 4WZ4A 1PW8A 4GLQA 1DJAA 1XKZA 3AGFA 3JVUA 4WEJA 5AJGA 1K56D 1K4FA 5EVEA 1NZOA 3EQUA 3TJZC 4CLCE 4HP9A 3ZVWA 3O87A 3UE3A 4JGQA 1RGZA 3PBNA 1AWIA 2H28A 1P9RA 1P0ZA 1PWDA 4CPKA 1DJBA 2QJ5A 3QP1A 4LV1A 3OC2A 2WZZA 1LT0A 2G7UA 1OT9A 3CZDA 4FH2A 3ZG9B 1TS0A 4GD6A 1BUEA 2VV6A 2Z2MB 4ZDXA 4MN6A 4DDSA 4KZ8A 2XDMA 4CLCA 1MWUA 3IHBA 2W27A 2L1MA 1NYMA 3NECA 3EOIA 3NULA 1DY6A 3VFHA 3OPRA 3UB8A 1NZUA 1CQAA 3V3SA 2VLGA 4JF6A 1OJ5A 3HL9A 1Z09A 3QP8A 3IF5A 3NOTC 1VETB 3UE1A 3ZG5A 5DTTA 4OH0A 3PBTA 1BLCA 3D72A 3NOUC 4GNUA 3LR0A 2ZC4B 5KSCA 2D01A 4MN7A 1FIKA 4PM7A 5CHMA 4GCZA 3WS4A 4JPMA 1TEMA 3LR5A 4DN0A 1YMXA 3UPNA 4HBTA 4I3JA 3DTMA 5HD3A 5HL1A 3ZG0A 4EV4A 1I2SA 1HVBA 1K6RA 3LUQA 3VP1A 5FDSA 2O9AA 1S4SA 4Q0JA 4CLCC 1OTEA 4KQOA 3ULFA 5E2HA 2VA0A 1NWZA 4GW9A 4YOFA 4M4XA 4X55A 1FQGA 1L0GA 2A24B 1KGGA 5AQ9A 3PAGA 1VETA 4ZRRA 3VSKA 5FSRA 1YKDA 3C8CA 5DJTA 3ZGAB 3W4OA 2XD5A 1S0WA 2LB9A 3LEQA 2V9AA 4HH3A 4BBUA 3N8SA 4N9LA 1HTZA 2JKFA 4GHIB 1T1CA 1MXOA 2EXBA 2Y2NA 1CEFA 3H82B 5GLDA 3UPPA 4S2JA 3BWLA 4NETA 5FDHA 2A2LA 3C7UA 1JWPA 1PWGA 5A91A 4DMZA 1P97A 4JXVA 4D2OA 2ZC7A 3LFVA 5E43A 5IS1A 3MMHA 3FYZA 3RJUA 1NLYA 3CITA 3A3DA 1K54A 3Q82A 1F9IA 3BQAA 2EWWA 5FEFA 4HY8A 1XP4A 2W3DA 2A24A 2PHYA 1PI5A 3T12B 3BW6A 3S4XA 1JTDA 5KSHA 4G3KA 2ZC6B 3JVVA 3BECA 4EBNA 4X1LA 4OP5A 3KO6A 4LCMA 2KOIA 5TFQA 4ETZA 4PPRA 1Y4OA 2RL3A 4A5RA 4GHIA 1E3UA 4LRYC 4E3IA 4JKTA 3H82A 1H0MA 1G6AA 1K57C 1VM1A 1KVMA 2XF3A 2ZQAA 3T4OA 2ZJ9A 3U2AA 2NUTC 5EM1A 1SZVA 1JVJA 3Q7ZA 3Q81A 2QZ6A 1XJ3A 4Y7PA 2Q0OA 3B47A 3O88A 1W5DA 3FPWA 5FL3A 1FCOA 3LY4A 1MC0A 4CJNA 1YT4A 2H5SA 2P74A 1CF0A 4EU0A 2WYXA 2V8FA 1LL5A 3CUEA 2VJWA 3E98A 4IUHA 3D3OA 2VGLS 3IXGA 2RCXA 1JNUA 2HGVA 4Y0TA 3B3XA 4WUJA 4MBHA 5C5KA 4WMCD 3N4IA 1STZA 1WYBA 4H8RA 3BLMA 2X02A 2V2FF 5HDCA 5G4ZA 5CTNA 2WKPA 4RX2A 3E4OA 1FILA 1N9OA 1CK3A 3TW8A 1SHVA 1BZAA 3LI9A 2IWBA 2V0WA 1L0DA 3UY6A 2Y2HA 2VV7A 1EROA 1XFQA 2I72A 4AFIA 3GECA 1V9YA 3R4KA 5FI7A 5GHYA 1L2SA 3T1XA 4OPYA 4HBUA 3W4QA 2YKFA 3HLBA 3C7VA 3LR4A 1V9ZA 4EEUA 5MC7A 3LIBA 3VE3A 4EBPA 2EX2A 1XA7A 2AVXA 3MXQA 3CUEC 2B18A 4OPZA 5FQQA 3FZCA 2XFSA 3EEHA 4I3IA 2K31A 4HJ3A 4BMWA 2EX8A 2CC1A 4OQIA 1W8YA 3IT9A 5FI2A 1IOUA 4L9FA 3MSHA 3T4TA 2ZM0A 4R70A 3TOIA 5FAOA 4HNBA 4DDYA 3T4KA 4MLLA 5A92A 2W1TB 4Y5FA 3A3FA 2ACGA 5DFXA 3M6BA 3DW0A 3VOLA 1TDGA 1T18A 4ETXA 5L07A 2V1BA 5F83A 1SKOB 2J80A 4Y0OA 4QPRA 1YQSA 3O5YA 2IA2A 3MFXA 2PD8A 3MZEA 1FSWA 2O9BA 3VMAA 3U4LP 3LIDA 2ZC5B 2Q9MA 4R38A 4KZ4A 1KE0A 4RX3A 5TJJA 3PR6A 4KZ7A 2K7SA 3OBFA 2E8IA 1ALQA 1H5XA 2H10A 3IF6B 5HDDA 3VE4A 5J8XA 1ESIA 4Q0IA 5E2GA 4DE3A 2PT7A 1EI5A 1ES5A 5A93A 2W1TA 3CPTB 4P87A 3UB5P 1L3LA 3WS2A 2ZQDA 3OCLA 1JTGA 2X71A 1UGUA 1SKOA 3SZTA 4EXOA 2KLIA 3HLCA 1XPBA 2Y4AA 5EVIA 4Q8IA 4BD1A 3UNWA 3MKFA 4WBGA 4XXRA 4F3LB 4EUVA 1VHMA 2QHKA 5GHZA 5FASA 3SH7A 2CMNA 3V3RA 4OQGA 3S7PA 4GN2A 4L9EA 3KSFA 5FATA 5FQJA 1UWNX 4KZBA 1LSWA 5KMWA 4CLCD 1GSWA 4NXEA 2XSSA 1WA9A 3ICYA 1K4EA 5FI6A 3IF6A 3DWKA 4BBTA 3BFGA 1ES2A 1XX2A 3WRZA 4Z1WA 3QP4A 1PYYA 2EXAA 4R3BA 4MCWA 5I94A 4Q0HA 4PAUA 5KIZA 1N9NA 2XR0A 5FQIA 3CPTA 4PKYA 1YLPA 3A3EA 4ZJ2A 4EWFA 3UPOA 4KQRA 5DKLA 2WZXA 2WK0A 5HDSA 3UB9A 4DJ2A 2WKQA 3NC8A 3F1PB 5U47A 3LCEA 3GSGA 2JKGA 3BLSA 3VSLA 2XA7M 5CRFA 4F3LA 3HCYA 4II7A 5TGFA 4C3QA 1W63Q 1XJ6A 5DKKA 3CJMA 5F82A 2XRNA 1NRFA 4DJ3A 2OAQ1 4JXWA 1ZG6A 5DTKA 1OTDA 3GTCA 1IYPA 4QU3A 2BTFP 5HW3A 3BFFA 1VQQA 2WAFA 4QJGA 3F1OB 1LL8A 3FKWA 3VP0A 1W63M 2INWA 3IWQA 1YSPA 4P6ZS 1S4RA 1JWZA 2H0TA 4X68A 4QD4A 4KZ9A 3BRMA 3F1PA 2XK1A 3NBLA 4UQIM 4OP8A 3MQQA 3RH8B 3S1YA 1G28A 2ZD8A 4JXGA 5J3WA 3RXWA 2ZC3B 4RVAA 5EFWA 2BASA 3JYIA 3IWOA 1N4OA 4NKPA 3D9YA 1XA1A 1EWZA 4LENA 1M40A 5L2FA 3T1RA 3S22A 2YKHA 1TS8A 1TS6A 3RFBA 1FCMA 3K2NA 2H0YA 3F1OA 1CI9A 1FR1A 4Y2FA 1XJ4A 1PZPA 4R4RA 5GHXA 1GHIA 3LICA 5M19A 5A8BA 2QYBA 4O7DA 3BFCA 1HLUP 1GHPA 2A49A 2W3EA 5HZHA 5JYOA 3T4QA 2Y2KA 2WKHA 1W79A 3F1NB 4K08A 3PBOA 3Q1FA 3V5MA 1K56A 1MWRA 5FAQA 5I5LA 3N7WA 1IYSA 2Z2LB 4KZ5A 1TVFA 1BLHA 4CQHA 4IUKA 2W3GA 3FWLA 3H9WA 1XFNA 3M2JA 3ZYTA 5CERA 3SH8A 2W3HA 1LLBA 2ZL1B 3IQAA 5CGXA 2XFTA 1F98A 1QMEA 4UAAA 2ZLYA 1M6KA 3VV4A 4Y3IA 1PWCA 5IHVA 3TE8A 3MF0A 5FEGA 3VOZA 1MY8A 3QNCA 4G3WA 1MKMA 4XUZA 2Z6CA 3R7WB 1OT6A 3MS6A 2W1RA 4FUWA 3F1NA 4KUKA 3LEZA 3K3CA 3OPPA 5CEDA 3SS3A 4GD8A 4HP4A 3ZHHA 3TRCA 1KGEA 2OLVA 1G68A 3ZDJA 4E3KA 3MKEA 4B93A 3P7NA 4LRXC 3V50A 5G18A 5HAPA 1T1BA 2BLSA 3NI9A 1A0KA 4IVKA 2HZ5A 4NK3A 3ZCZA 1DP9A 5TBMB 3N6IA 2GZAA 2ZL1A 3ZQ5A 3MBZA 3C5AA 2QKPA 1DRMA 1PI4A 3EQVA 3MQ0A 4FD8A 4OOLA 1XJ2A 3G30A 2WUQA 3V39A 4OPRA 1IKIA 4MNRA 3IH9A 3NIAA 1GA9A 5F68A 1ERQA 3R7WA 3IXDA 2OWHA 2J9OA 4O0PA 1WE4A 1YAXA 2NUPC 4R0QA 2WKEA 1GHMA 1KDWA 3DTKA 2XD1A 3UB6A 1SKFA 1H8MA 4I39A 3HUOA 4C75A 1O07A 1YSQA 3G31A 2HDUA 4E04A 3ZG7B 5TBMA 4BENA 3AGDA 4GKUA 4PM8A 1BSGA 1GCEA 4G3VA 3UB7A 4BBVA 3CG5A 4Y0UA 4E6WA 1K54C 1G6OA 2M7VA 4HOIA 2WKRA 1L0FA 3VP3A 3GDIA 3G2YA 1AXBA 5EM0A 4PM6A 3UE6A 2P9VB 1FSYA 5AQAA 4JGOA 1YM1A 3T50A 2EA9A 2OWJA 4RQ9A 4FTXA 4JF4A 5DF9A 4OOYA 4MN5A 2VKSA 3IWIA 4Y15A 1YLTA 1I2WA 4BL2A 4YINA 2WKIA 1RP5A 1RGYA 3C30A 2IWDA 5G4YA 1MWTA 3MJQA 4UA9A 4FOFA 3BM6A 4ZJ3A 3VP2A 2Y2IA 1SDEA 1ONGA 2V1ZA 4LRZE 3A0VA 1GSXA 2Y2OA 3V67A 1JWVA 1QMFA 3G6OA 1E4DA 1KOUA 2JE5A 1S1ZA 4B9OA 1C3BA 4OVDA 5E2EA 4KG2A 5HL6A 1TF1A 2EFXA 3LIAA 4PHTA 2R78A 5K5BA 1Q2QA 3QP2A 5AQBA 3G4PA 4P6BA 3H7WA 2A3UA 5M1AA 1Y28A 3SS5A 3T4LA 2HP5A 2P9VA 2ZQ8A 3T1QB 2GNXA 1OJGA 4QWOA 3B42A 2C5WB 1F5MA 2OSUA 4N9KA 4OKPA 4EEPA 3VFFA 5CTMA 4U0XA 4R6LA 4S2IA 2B02A 1Z6FA 3O3VA 4D60A 4I5SA 4KZ3A 1SCWA 5GLBA 2D02A 2HDSA 3FC7A 4ME4A 2Z6DA 3SOIA 3RTYA 4LCLA 2W0NA 2JBFA 4HIAA 4EESA 1CEGA 2WGWB 1YPRA 2JCHA 1NLZA 3C4PA 1I5QA 2W3FA 1J3WA 1LHYA 4NXBA 3A0RA 4YNRA 3E0YA 3SW1A 3D4FA 1VB6A 2OOLA 2OAP1 1T1AA 4YWZA 5EVIB 2GX5A 3OPHA 3CWFA 4EW7A 3IX4A 4BJPA 2Y2LA 3UDFA 3P01A 4IVIA 4WMCA 1H8ZA 1J9MA 5CEBA 4E3MA 5DF7A 1CI8A 2JN7A 5CHUA 4EUZA 1NYYA 2HP9A 4MBFA 3BQ8A 1MWSA 3ZNTA 1YLYA 4MBKA 3T1SA 1BULA 1IEMA 4JGPA 3WS1A 5GL9A 4PKYG 1PIOA 1OTIA 5HWTA 3CHWP 2I9VA 2LB5A 3IXBA 3ITAA 4KQQA 2WGWA 4E3JA 3BJNA 4MDZA 3FV7A 3T4JA 1KVLA 2VEAA 1BYWA 4WELA 1NXYA 2R9WA 3KYZA 1YLJA 2Y8HA 3HBRA 1IELA 1S66L 1RCJA 4GDNA 2P04A 3AGEA 1NRJA 1S6RA 4OONA 3QP6A 3E4QA 3GMWA 3HUNA 3IXHA 3NHQA 4GJ4A 3IH8A 5TR7A 4H6JB 4HH2A 3HJIA 5CX7A 2Y91A 3NJAA 4HQAA 3B33A 2Y2PA 1HD8A 4PM9A 2Y2GA 2UWXA 5F5YA 3LI8A 1LI9A 1ODVA 1ZTUA 4R1GA 3BFEA 3MQOA 3KSHA 3HUMA 4F94A 5AQ7A 3PTEA 3EGDC 3UMDA 3PHYA 2PBYA 3WRTA 4B4XA 3UDIA 5HAIA 2K2NA 3VP4A 3MZFA 2OLUA 5FQMA 4I3AA 1Y54A 1XXMA 4MEZA 2EWVA 3KX0X 2XGNA 3M2KA 1TD5A 1LI0A 5HWWA 1BT5A 4UEYA 2J7VA 3S7QA 4H6JA 1F2KA 5CGWA 5EECA 2VGKA 5HPIA 4K0XA 1PZOA 5EVIC 4OLDA 1PW1A 4U3TA 1K25A 1XGJA 4ARZB 1ZG4A 2WGIA 3FG8A 5A90A 3EWKA 2J3WA 4S2MA 2C6WB 1BLSA 2DMWA 4GZBA 1Q2PA 4X1MA 1DP8A 1L0EA 1U60A 2R9XA 1E25A 3SS4A 3IF6C 4X25A 1N9BA 3EEAA 4DE2A 4MMNA 2VGJA 5FA7A 3NCKA 2B5RA 1EW0A 1IKGA 5KZHA 4XT2B 4KG5A 4UA7A 4Z9QA 5FQKA 2O0YA 3HREA 3OCNA 5HFOA 3PBRA 4ZTKA 5BOHA 4HHDA 4X6TA 5CXWA 4HJ6A 1MKIA 3W4PA 4HI4A 4OOMA 5D3OA 4LGWA 4DE0A 4R3JA 3GQZA 5L8MA 3JPUA 3DTEA 2Y79A 1ES3A 3NOPC 1KE4A 4ARZA 4BL3A 3MR0A 4FSFA 2HV1A 3BY9A 3W2ZA 2G2UA 2X01A 5JYPA 3ITBA 4DE1A 2Y2MA 1SDNA 2PAVP 4HESA 5EOOA 3T4SA 4N1HA 1ES4A 3LY3A 4HJ4A 4X53A 4DKIA 1CJFA 3N8LA 4O8GA 3LIFA 3S7OA 1H3QA 3DBAA 3TG9A 5EV0A 2WADA 4XT2A 4B4ZA 2XA7S 4JXSA 4OQHA 2XEPA 3A3IA 5HD5A 3ZNYA 5FAPA 5HPFA 2XQZA 5EPHA 3E2LA 4FH4A 2Y2QA 3UMEA 4LFUA 1PNEA 2JC7A 4S2LA 3OZHA 1ACFA 4DXBA 2J9PA 4HEFA 2HJ9C 2ZM2A 4WF0A 1S67L 3A0SA 1E3UD 5EE8A 3HLDA 3I7JA 4UHUA 2PU2A 4ZBEA 4E3LA 4N1XA 2MJ6A 5EUAA 3HLFA 3LR3A 1XGIA 1LL9A 3WS5A 1MPLA 3OOVA 3HLEA 2PYRA 3LGOA 2J3TC 2J8YA 4NXGA 4DXCA 4EERA 1DP6A 3MFDA 1X0OA 3Q7VB 3SH9A 5DVAA 1W8QA 4UQIS 4P0MA 3E4PA 4JLFA 2PD7A 3QHYA 2VK3A 3OLOA 4GB7A 4KZ6A 1K57A 3O86A 1GA0A 1LSVA 5CHJA 2VGLM 5GLAA 1VEUB 2PR5A 3HJKA 3HLWA 2EFUA 1P9WA 3HLGA 5AVFA 4L9GA 4X56A 5DTSA 1K0KA 3S7NA 2DNSA 2B95A 4S2NA 5DF8A 5FQ9A 2HP6A 1FCNA 2GDNA 1KDSA 4EQ1A 5HARA 5L09A 3G32A 1OMEA 4OQ0A 3Q7VA 2M7UA 2Y2JA 2E8JA 2PDRA 3ISGA 3GV9A 1ESUA 1NY0A 2PRFA 4K91A 2QMIA 2ZQ7A 4ZJ1A 3C38A 1YMSA 2EX6A 2ZOIA 3KSIA 1VEUA 2QWSA 2V20A 1BLPA 4FCFA 3ZFZA 2HDQA 4ESPA 2ZQ9A 5CGSA 5DJUA 2IWCA 1D1JA 2BG1A 1K55A 3LO7A 4EETB 4YFMA 1O7EA 4BQMA 2G2WA 3FPVA 5L10A 3PYPA 2V1AA 4QY5A 2ZMVA 3H7WB 3MXRA 4S2OA 4B88A 5AVEA 3IX3A 2ZM8A 4IEDA 5EOEA 1FOFA 4LV2A 3KYQA 2HF6A 3G35A 3TSGA 4KQDA 2JKRI 1DJCA 4S2NC 3ZVTA 4ZAMA 4NXFA 1OTBA 1TDLA 2O9CA 4X69A 1WYCA 2P08A 4BD0A 2WAEA 4OPQA 3UO9A 3UE0A 2EX9A 4KENB 2HJEA 4NEED 3CLOA 4GDBA 1LSXA 4E6XA 4QY6A 4WEKA 3G2ZA 1MBLA 2V8CA 5J4EA 1NJ4A 4LPZA 5F1GA 1KE3A 4GOGA 3FKVA 3BFDA 1FR6A 3BYDA 2KDKA 3IS2B 4IJGA 4NG2A 3GVBA 1TS7A 1N9LA 1S1YA 5J7EA 5DFYA 2WGVA 2M1CA 3KSGA 4WLAA 4N92A 1ZHHB 4ID4A 1K55C 2DRWA 4LLOB 3NDGA 4IBRA 2ZBBA 1GSVA 2HDRA 5HX9A 1T19A 2V0UA 2XLNA 1HZOA 3CI6A 2GJ3A 2Q9NA 1ERMA 1G5UA 5F1FA 2FFFB 3NY4A 2DCFA 3Q07A 3WWXA 5IU1A 4WZ5A 3LYXA 5EVID 3CAXA 3N8RA 2PBDP 2QJ7A 3NDEA 4KZAA 2JHEA 2OV5A 4BWIA 4PMAA 4IBXA 3EGXC 1OTAA 1IFQA 2XROA 3QP5A 3IS2A 4IHQA 2JKTI 4BLMA 5HWVA 4GS9B 1W7FA 1ZKJA 1YLZA 2ZMFA 1BTLA 4L0LA 4OLGA 2VV8A 3GR2A 2L4RA 4UA6A 5M18A 4K0WA 4XUXA 2JKRM 3C4OA 3OPLA 2HPBA 3VOYA 4Y17A 1YLWA 1MZUA 2QPNA 3P09A 3PAEA 1D06A 1ZC2A 4LV3A 5E2FA 4KG6A 4R23A 5F6AA 3BEBA 2ZOHA 3RXXA 3ZG8B 3UN7A 3MZDA 4JBFA 4E3NA 3IX8A 4PM5A 5F69A 3L9KA 3LIEA 2Y59A 4WL9A 4E3OA 4WZ5C 4QB8A 3K3DA 2ZMAA 3IHAA 1IYQA 4GS9A 3CMZA 1KGFA 1OPXA 1PFLA 3PBSA 1K38A 4JGRA 4KUOA 4R3AA 2FFYA 4WM9A 2VZWA 4DRTA 1PRQA 3IBJA 4P6ZM 3C2WA 1IYOA 3DTIA 5LBRA 5CECA 1UWPX 3IBRA 3HVFA 3GRJA 3M6HA 3MXSA 3E2KA 4QHCA 2ZQCA 4Y13A 4LV0A
chains in the Genus database with same CATH topology
3NIAA 1GA9A 4N1HA 1ES4A 1ERQA 3LY3A 5GLCA 4EBPA 2EX2A 1XA7A 3IXDA 4C6YA 4OPZA 1ONHA 4WYYA 4M3KA 5FQQA 3A3JA 3FZCA 2XFSA 2J9OA 4X53A 4DKIA 1WE4A 3N8LA 4RYEA 4R4SA 2EX8A 2CC1A 4OQIA 1W8YA 3IT9A 4P85A 5FI2A 3TG9A 3UDXA 2WADA 4R0QA 2WKEA 4B4ZA 1GHMA 5HAQA 2ZM0A 4JXSA 4U0TA 1KDWA 2XEPA 4OQHA 5EVLA 3A3IA 4JF5A 3G34A 2XD1A 4EQIA 1SKFA 3P98A 4EBLA 4S2PA 3TOIA 3PBQA 3ZNYA 4S2KA 5FAPA 2Y55A 2XQZA 5FAOA 3HUOA 5EPHA 3E2LA 4FH4A 4C75A 2Y2QA 4DDYA 3QNBA 1O07A 2JC7A 4S2LA 4MLLA 5A92A 3OZHA 1K6SA 3G31A 2PU4A 3DWZA 2HDUA 2J9PA 2XH9A 3A3FA 4HEFA 4DXBA 3ZG7B 1H8YA 2ZM2A 3M6BA 3DW0A 3WS0A 1E3UD 1TDGA 5EE8A 4BENA 3AGDA 4GKUA 3HLDA 3I7JA 4PM8A 1BSGA 1GCEA 4UHUA 5F83A 2PU2A 4ZBEA 3W8KA 4N1XA 4E3LA 3CG5A 4RA7A 4Y0UA 4E6WA 4DF6A 1K54C 5EUAA 3HLFA 4Y0OA 1YQSA 4WZ4A 1L0FA 1PW8A 1DJAA 3VP3A 1XKZA 1XGIA 3G2YA 3AGFA 1LL9A 3WS5A 1MPLA 1AXBA 3HLEA 4WEJA 3MZEA 1FSWA 1K56D 1K4FA 4PM6A 3VMAA 2J8YA 1NZOA 1FSYA 2P9VB 3EQUA 5AQAA 4DXCA 1YM1A 3ZVWA 2ZC5B 4JF4A 3O87A 5DF9A 3UE3A 4OOYA 2Q9MA 1RGZA 3PBNA 3MFDA 3IWIA 1YLTA 3Q7VB 4KZ4A 1KE0A 1I2WA 4BL2A 4YINA 2WKIA 4RX3A 3SH9A 1RP5A 1W8QA 5DVAA 1PWDA 4CPKA 1DJBA 1RGYA 4P0MA 4KZ7A 2IWDA 4JLFA 2E8IA 1ALQA 1H5XA 2H10A 3IF6B 4LV1A 1MWTA 3OC2A 3QHYA 4UA9A 4GB7A 5J8XA 1ESIA 4KZ6A 3BM6A 4ZJ3A 1K57A 2WZZA 3VP2A 5E2GA 2Y2IA 1SDEA 3O86A 1GA0A 1ONGA 4DE3A 2V1ZA 5CHJA 1EI5A 1ES5A 2Y2OA 5A93A 1JWVA 1QMFA 1E4DA 3CZDA 4FH2A 5GLAA 4P87A 3ZG9B 2JE5A 4GD6A 1BUEA 2Z2MB 4ZDXA 3WS2A 1C3BA 4OVDA 4KZ8A 4KG2A 5E2EA 4DDSA 2XDMA 2EFXA 1MWUA 2ZQDA 3IHBA 3OCLA 1JTGA 3HLWA 2X71A 2EFUA 1NYMA 3HLGA 1Q2QA 5AQBA 4X56A 3G4PA 5DTSA 3HLCA 4P6BA 1XPBA 2DNSA 2Y4AA 4S2NA 2A3UA 5M1AA 5EVIA 4Q8IA 5DF8A 5FQ9A 4BD1A 2HP6A 3SS5A 3UNWA 3MKFA 1DY6A 4WBGA 3VFHA 4XXRA 3OPRA 2HP5A 2P9VA 2ZQ8A 1NZUA 1FCNA 2GDNA 1KDSA 2C5WB 2OSUA 4N9KA 4OKPA 3V3SA 5GHZA 5FASA 5HARA 3VFFA 3G32A 4JF6A 3SH7A 1OMEA 4OQ0A 3Q7VA 3HL9A 5CTMA 4U0XA 3V3RA 4OQGA 4GN2A 5FATA 4S2IA 5FQJA 2Y2JA 3IF5A 4KZBA 3ISGA 3GV9A 5KMWA 3UE1A 3ZG5A 5DTTA 1Z6FA 1ESUA 3O3VA 1K4EA 1BLCA 1NY0A 3PBTA 4OH0A 5FI6A 3IF6A 3DWKA 4GNUA 3BFGA 2ZC4B 1ES2A 1XX2A 4KZ3A 3WRZA 5KSCA 1SCWA 5GLBA 1PYYA 2EXAA 2HDSA 4R3BA 4PM7A 5I94A 4K91A 5CHMA 2QMIA 3SOIA 3WS4A 4JPMA 2ZQ7A 4ZJ1A 4LCLA 1YMSA 1TEMA 2EX6A 2JBFA 2XR0A 1CEGA 2WGWB 5FQIA 1YMXA 3UPNA 2V20A 1YLPA 3A3EA 4ZJ2A 1BLPA 4HBTA 4FCFA 4EWFA 4KQRA 3UPOA 3DTMA 2HDQA 2WZXA 3ZFZA 2WK0A 2ZQ9A 5CGSA 2JCHA 3C4PA 2IWCA 1I5QA 3NC8A 2BG1A 5U47A 5HL1A 1LHYA 3LCEA 3ZG0A 1K55A 4EV4A 3GSGA 3LO7A 1I2SA 4YFMA 1HVBA 3BLSA 1O7EA 1K6RA 3VSLA 4BQMA 3D4FA 2G2WA 3VP1A 4QY5A 5CRFA 3MXRA 5EVIB 4S2OA 4B88A 3OPHA 4KQOA 5TGFA 4C3QA 5E2HA 2ZM8A 4IEDA 5EOEA 1FOFA 4LV2A 2Y2LA 3UDFA 4BJPA 3CJMA 3G35A 4IVIA 5F82A 3TSGA 4WMCA 4X55A 1FQGA 1H8ZA 1L0GA 1J9MA 1NRFA 4S2NC 1DJCA 3ZVTA 5CEBA 4ZAMA 4E3MA 4JXWA 5DF7A 1ZG6A 5DTKA 1CI8A 1TDLA 1KGGA 4X69A 5AQ9A 1WYCA 3GTCA 5CHUA 3PAGA 1IYPA 4QU3A 4EUZA 5HW3A 3VSKA 3BFFA 5FSRA 1VQQA 2WAFA 1NYYA 2HP9A 4MBFA 4QJGA 4BD0A 3ZNTA 1MWSA 1YLYA 4MBKA 2WAEA 4OPQA 1BULA 1IEMA 3UO9A 3WS1A 3ZGAB 3W4OA 5GL9A 2XD5A 1PIOA 1S0WA 3UE0A 2EX9A 4KENB 3FKWA 3VP0A 4GDBA 4E6XA 3N8SA 4N9LA 4QY6A 1HTZA 3G2ZA 1MBLA 3ITAA 3IXBA 2WGWA 4KQQA 1NJ4A 4E3JA 3IWQA 5F1GA 1MXOA 1KE3A 3FV7A 2EXBA 2Y2NA 1JWZA 4GOGA 1KVLA 1CEFA 3BFDA 3FKVA 2H0TA 1FR6A 5GLDA 3UPPA 4X68A 4S2JA 4QD4A 3BYDA 1NXYA 4KZ9A 3BRMA 2R9WA 4NETA 4WELA 2XK1A 1YLJA 5FDHA 3NBLA 3HBRA 1IELA 4OP8A 3GVBA 3C7UA 1JWPA 1RCJA 4GDNA 1PWGA 3S1YA 5A91A 3AGEA 2WGVA 4JXVA 4D2OA 2ZC7A 3RXWA 1S6RA 2ZD8A 4JXGA 4OONA 2ZC3B 4RVAA 5E43A 3GMWA 3FYZA 3HUNA 3IXHA 4N92A 3RJUA 4ID4A 3JYIA 3IH8A 3A3DA 3IWOA 1K54A 5TR7A 3Q82A 1N4OA 1K55C 2DRWA 1XA1A 3NDGA 1XP4A 4IBRA 1EWZA 4LENA 2HDRA 1M40A 5L2FA 2Y91A 1PI5A 5HX9A 3S22A 2Y2PA 1HD8A 4PM9A 2Y2GA 1FCMA 2XLNA 2UWXA 1HZOA 3S4XA 1JTDA 5KSHA 1LI9A 2H0YA 2ZC6B 2Q9NA 1ERMA 4R1GA 3BECA 1CI9A 3BFEA 5F1FA 4EBNA 1FR1A 2FFFB 3NY4A 2DCFA 4OP5A 3HUMA 3Q07A 4F94A 4LCMA 3PTEA 5AQ7A 1PZPA 3WWXA 5TFQA 4R4RA 5GHXA 1GHIA 4WZ5A 5M19A 4O7DA 2PBYA 4PPRA 5EVID 3WRTA 4B4XA 3BFCA 2RL3A 4A5RA 3N8RA 1GHPA 2A49A 3UDIA 1E3UA 5HAIA 3VP4A 3NDEA 3MZFA 5JYOA 4KZAA 2OLUA 5FQMA 4E3IA 4JKTA 2OV5A 2Y2KA 1G6AA 4PMAA 4IBXA 2WKHA 1Y54A 1K57C 1XXMA 1W79A 1VM1A 1KVMA 2XF3A 2ZQAA 4BLMA 4MEZA 3PBOA 3Q1FA 2ZJ9A 3V5MA 1K56A 2XGNA 3M2KA 1MWRA 1LI0A 1W7FA 5FAQA 1ZKJA 1BT5A 3N7WA 1YLZA 1IYSA 2Z2LB 1BTLA 2J7VA 1JVJA 3Q7ZA 4KZ5A 3Q81A 1TVFA 4L0LA 4OLGA 3GR2A 2QZ6A 5CGWA 1BLHA 4UA6A 5EECA 5M18A 4K0WA 4XUXA 4Y7PA 3C4OA 3OPLA 2VGKA 2HPBA 3VOYA 3O88A 4WEKA 1YLWA 3FWLA 2QPNA 4K0XA 3P09A 3PAEA 1W5DA 1PZOA 1ZC2A 3M2JA 1FCOA 3LY4A 4LV3A 5E2FA 5EVIC 4KG6A 4R23A 5CERA 4OLDA 4CJNA 1PW1A 3BEBA 4U3TA 3SH8A 1YT4A 1LLBA 3RXXA 3ZG8B 1K25A 1XGJA 3UN7A 1ZG4A 2H5SA 2P74A 3IQAA 2WGIA 3MZDA 5CGXA 4JBFA 2XFTA 4E3NA 2WYXA 5A90A 1QMEA 1LL5A 4UAAA 2ZLYA 1M6KA 4S2MA 4PM5A 5EOOA 1PWCA 2C6WB 5IHVA 1BLSA 3IXGA 2Y59A 2RCXA 4GZBA 3VOZA 1MY8A 1Q2PA 3QNCA 1L0EA 1U60A 2R9XA 1E25A 4XUZA 4Y0TA 3SS4A 3B3XA 3IF6C 4MBHA 4E3OA 4WMCD 3N4IA 1N9BA 4QB8A 4WZ5C 4DE2A 5JYPA 1WYBA 2ZMAA 4H8RA 3LEZA 3BLMA 3IHAA 1IYQA 2VGJA 2X02A 3OPPA 5FA7A 3NCKA 2V2FF 1KGFA 2B5RA 3CMZA 3SS3A 1IKGA 4GD8A 3ZHHA 5CEDA 5CTNA 5KZHA 1KGEA 2OLVA 1G68A 4KG5A 4UA7A 3PBSA 4RX2A 3ZDJA 4E3KA 1K38A 3MKEA 4Z9QA 5FQKA 3V50A 3HREA 3OCNA 5G18A 5HAPA 5HFOA 2BLSA 3PBRA 4ZTKA 3NI9A 5BOHA 5CXWA 2FFYA 4X6TA 1CK3A 4WM9A 4DRTA 1MKIA 3W4PA 1SHVA 1BZAA 4OOMA 5D3OA 4IVKA 4DE0A 4R3JA 1IYOA 2IWBA 3GQZA 4NK3A 1L0DA 3ZCZA 5CECA 3UY6A 2Y2HA 1ES3A 1KE4A 3N6IA 4BL3A 1EROA 3MBZA 3C5AA 1PI4A 2I72A 3EQVA 4FD8A 4FSFA 3HVFA 3GRJA 4OOLA 3G30A 2G2UA 3M6HA 2X01A 3MXSA 3E2KA 2WUQA 3ITBA 5FI7A 5GHYA 3V39A 2Y2MA 4DE1A 4QHCA 1L2SA 1SDNA 2ZQCA 4OPRA 1IKIA 4OPYA 4HESA 4HBUA 3W4QA 4LV0A 4MNRA 3HLBA 3IH9A 3C7VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NIA A;  1GA9 A;  4N1H A;  1ES4 A;  1ERQ A;  3LY3 A;  5GLC A;  4EBP A;  2EX2 A;  1XA7 A;  3IXD A;  4C6Y A;  4OPZ A;  1ONH A;  4WYY A;  4M3K A;  5FQQ A;  3A3J A;  3FZC A;  2XFS A;  2J9O A;  4X53 A;  4DKI A;  1WE4 A;  3N8L A;  4RYE A;  4R4S A;  2EX8 A;  2CC1 A;  4OQI A;  1W8Y A;  3IT9 A;  4P85 A;  5FI2 A;  3TG9 A;  3UDX A;  2WAD A;  4R0Q A;  2WKE A;  4B4Z A;  1GHM A;  5HAQ A;  2ZM0 A;  4JXS A;  4U0T A;  1KDW A;  2XEP A;  4OQH A;  5EVL A;  3A3I A;  4JF5 A;  3G34 A;  2XD1 A;  4EQI A;  1SKF A;  3P98 A;  4EBL A;  4S2P A;  3TOI A;  3PBQ A;  3ZNY A;  4S2K A;  5FAP A;  2Y55 A;  2XQZ A;  5FAO A;  3HUO A;  5EPH A;  3E2L A;  4FH4 A;  4C75 A;  2Y2Q A;  4DDY A;  3QNB A;  1O07 A;  2JC7 A;  4S2L A;  4MLL A;  5A92 A;  3OZH A;  1K6S A;  3G31 A;  2PU4 A;  3DWZ A;  2HDU A;  2J9P A;  2XH9 A;  3A3F A;  4HEF A;  4DXB A;  3ZG7 B;  1H8Y A;  2ZM2 A;  3M6B A;  3DW0 A;  3WS0 A;  1E3U D;  1TDG A;  5EE8 A;  4BEN A;  3AGD A;  4GKU A;  3HLD A;  3I7J A;  4PM8 A;  1BSG A;  1GCE A;  4UHU A;  5F83 A;  2PU2 A;  4ZBE A;  3W8K A;  4N1X A;  4E3L A;  3CG5 A;  4RA7 A;  4Y0U A;  4E6W A;  4DF6 A;  1K54 C;  5EUA A;  3HLF A;  4Y0O A;  1YQS A;  4WZ4 A;  1L0F A;  1PW8 A;  1DJA A;  3VP3 A;  1XKZ A;  1XGI A;  3G2Y A;  3AGF A;  1LL9 A;  3WS5 A;  1MPL A;  1AXB A;  3HLE A;  4WEJ A;  3MZE A;  1FSW A;  1K56 D;  1K4F A;  4PM6 A;  3VMA A;  2J8Y A;  1NZO A;  1FSY A;  2P9V B;  3EQU A;  5AQA A;  4DXC A;  1YM1 A;  3ZVW A;  2ZC5 B;  4JF4 A;  3O87 A;  5DF9 A;  3UE3 A;  4OOY A;  2Q9M A;  1RGZ A;  3PBN A;  3MFD A;  3IWI A;  1YLT A;  3Q7V B;  4KZ4 A;  1KE0 A;  1I2W A;  4BL2 A;  4YIN A;  2WKI A;  4RX3 A;  3SH9 A;  1RP5 A;  1W8Q A;  5DVA A;  1PWD A;  4CPK A;  1DJB A;  1RGY A;  4P0M A;  4KZ7 A;  2IWD A;  4JLF A;  2E8I A;  1ALQ A;  1H5X A;  2H10 A;  3IF6 B;  4LV1 A;  1MWT A;  3OC2 A;  3QHY A;  4UA9 A;  4GB7 A;  5J8X A;  1ESI A;  4KZ6 A;  3BM6 A;  4ZJ3 A;  1K57 A;  2WZZ A;  3VP2 A;  5E2G A;  2Y2I A;  1SDE A;  3O86 A;  1GA0 A;  1ONG A;  4DE3 A;  2V1Z A;  5CHJ A;  1EI5 A;  1ES5 A;  2Y2O A;  5A93 A;  1JWV A;  1QMF A;  1E4D A;  3CZD A;  4FH2 A;  5GLA A;  4P87 A;  3ZG9 B;  2JE5 A;  4GD6 A;  1BUE A;  2Z2M B;  4ZDX A;  3WS2 A;  1C3B A;  4OVD A;  4KZ8 A;  4KG2 A;  5E2E A;  4DDS A;  2XDM A;  2EFX A;  1MWU A;  2ZQD A;  3IHB A;  3OCL A;  1JTG A;  3HLW A;  2X71 A;  2EFU A;  1NYM A;  3HLG A;  1Q2Q A;  5AQB A;  4X56 A;  3G4P A;  5DTS A;  3HLC A;  4P6B A;  1XPB A;  2DNS A;  2Y4A A;  4S2N A;  2A3U A;  5M1A A;  5EVI A;  4Q8I A;  5DF8 A;  5FQ9 A;  4BD1 A;  2HP6 A;  3SS5 A;  3UNW A;  3MKF A;  1DY6 A;  4WBG A;  3VFH A;  4XXR A;  3OPR A;  2HP5 A;  2P9V A;  2ZQ8 A;  1NZU A;  1FCN A;  2GDN A;  1KDS A;  2C5W B;  2OSU A;  4N9K A;  4OKP A;  3V3S A;  5GHZ A;  5FAS A;  5HAR A;  3VFF A;  3G32 A;  4JF6 A;  3SH7 A;  1OME A;  4OQ0 A;  3Q7V A;  3HL9 A;  5CTM A;  4U0X A;  3V3R A;  4OQG A;  4GN2 A;  5FAT A;  4S2I A;  5FQJ A;  2Y2J A;  3IF5 A;  4KZB A;  3ISG A;  3GV9 A;  5KMW A;  3UE1 A;  3ZG5 A;  5DTT A;  1Z6F A;  1ESU A;  3O3V A;  1K4E A;  1BLC A;  1NY0 A;  3PBT A;  4OH0 A;  5FI6 A;  3IF6 A;  3DWK A;  4GNU A;  3BFG A;  2ZC4 B;  1ES2 A;  1XX2 A;  4KZ3 A;  3WRZ A;  5KSC A;  1SCW A;  5GLB A;  1PYY A;  2EXA A;  2HDS A;  4R3B A;  4PM7 A;  5I94 A;  4K91 A;  5CHM A;  2QMI A;  3SOI A;  3WS4 A;  4JPM A;  2ZQ7 A;  4ZJ1 A;  4LCL A;  1YMS A;  1TEM A;  2EX6 A;  2JBF A;  2XR0 A;  1CEG A;  2WGW B;  5FQI A;  1YMX A;  3UPN A;  2V20 A;  1YLP A;  3A3E A;  4ZJ2 A;  1BLP A;  4HBT A;  4FCF A;  4EWF A;  4KQR A;  3UPO A;  3DTM A;  2HDQ A;  2WZX A;  3ZFZ A;  2WK0 A;  2ZQ9 A;  5CGS A;  2JCH A;  3C4P A;  2IWC A;  1I5Q A;  3NC8 A;  2BG1 A;  5U47 A;  5HL1 A;  1LHY A;  3LCE A;  3ZG0 A;  1K55 A;  4EV4 A;  3GSG A;  3LO7 A;  1I2S A;  4YFM A;  1HVB A;  3BLS A;  1O7E A;  1K6R A;  3VSL A;  4BQM A;  3D4F A;  2G2W A;  3VP1 A;  4QY5 A;  5CRF A;  3MXR A;  5EVI B;  4S2O A;  4B88 A;  3OPH A;  4KQO A;  5TGF A;  4C3Q A;  5E2H A;  2ZM8 A;  4IED A;  5EOE A;  1FOF A;  4LV2 A;  2Y2L A;  3UDF A;  4BJP A;  3CJM A;  3G35 A;  4IVI A;  5F82 A;  3TSG A;  4WMC A;  4X55 A;  1FQG A;  1H8Z A;  1L0G A;  1J9M A;  1NRF A;  4S2N C;  1DJC A;  3ZVT A;  5CEB A;  4ZAM A;  4E3M A;  4JXW A;  5DF7 A;  1ZG6 A;  5DTK A;  1CI8 A;  1TDL A;  1KGG A;  4X69 A;  5AQ9 A;  1WYC A;  3GTC A;  5CHU A;  3PAG A;  1IYP A;  4QU3 A;  4EUZ A;  5HW3 A;  3VSK A;  3BFF A;  5FSR A;  1VQQ A;  2WAF A;  1NYY A;  2HP9 A;  4MBF A;  4QJG A;  4BD0 A;  3ZNT A;  1MWS A;  1YLY A;  4MBK A;  2WAE A;  4OPQ A;  1BUL A;  1IEM A;  3UO9 A;  3WS1 A;  3ZGA B;  3W4O A;  5GL9 A;  2XD5 A;  1PIO A;  1S0W A;  3UE0 A;  2EX9 A;  4KEN B;  3FKW A;  3VP0 A;  4GDB A;  4E6X A;  3N8S A;  4N9L A;  4QY6 A;  1HTZ A;  3G2Z A;  1MBL A;  3ITA A;  3IXB A;  2WGW A;  4KQQ A;  1NJ4 A;  4E3J A;  3IWQ A;  5F1G A;  1MXO A;  1KE3 A;  3FV7 A;  2EXB A;  2Y2N A;  1JWZ A;  4GOG A;  1KVL A;  1CEF A;  3BFD A;  3FKV A;  2H0T A;  1FR6 A;  5GLD A;  3UPP A;  4X68 A;  4S2J A;  4QD4 A;  3BYD A;  1NXY A;  4KZ9 A;  3BRM A;  2R9W A;  4NET A;  4WEL A;  2XK1 A;  1YLJ A;  5FDH A;  3NBL A;  3HBR A;  1IEL A;  4OP8 A;  3GVB A;  3C7U A;  1JWP A;  1RCJ A;  4GDN A;  1PWG A;  3S1Y A;  5A91 A;  3AGE A;  2WGV A;  4JXV A;  4D2O A;  2ZC7 A;  3RXW A;  1S6R A;  2ZD8 A;  4JXG A;  4OON A;  2ZC3 B;  4RVA A;  5E43 A;  3GMW A;  3FYZ A;  3HUN A;  3IXH A;  4N92 A;  3RJU A;  4ID4 A;  3JYI A;  3IH8 A;  3A3D A;  3IWO A;  1K54 A;  5TR7 A;  3Q82 A;  1N4O A;  1K55 C;  2DRW A;  1XA1 A;  3NDG A;  1XP4 A;  4IBR A;  1EWZ A;  4LEN A;  2HDR A;  1M40 A;  5L2F A;  2Y91 A;  1PI5 A;  5HX9 A;  3S22 A;  2Y2P A;  1HD8 A;  4PM9 A;  2Y2G A;  1FCM A;  2XLN A;  2UWX A;  1HZO A;  3S4X A;  1JTD A;  5KSH A;  1LI9 A;  2H0Y A;  2ZC6 B;  2Q9N A;  1ERM A;  4R1G A;  3BEC A;  1CI9 A;  3BFE A;  5F1F A;  4EBN A;  1FR1 A;  2FFF B;  3NY4 A;  2DCF A;  4OP5 A;  3HUM A;  3Q07 A;  4F94 A;  4LCM A;  3PTE A;  5AQ7 A;  1PZP A;  3WWX A;  5TFQ A;  4R4R A;  5GHX A;  1GHI A;  4WZ5 A;  5M19 A;  4O7D A;  2PBY A;  4PPR A;  5EVI D;  3WRT A;  4B4X A;  3BFC A;  2RL3 A;  4A5R A;  3N8R A;  1GHP A;  2A49 A;  3UDI A;  1E3U A;  5HAI A;  3VP4 A;  3NDE A;  3MZF A;  5JYO A;  4KZA A;  2OLU A;  5FQM A;  4E3I A;  4JKT A;  2OV5 A;  2Y2K A;  1G6A A;  4PMA A;  4IBX A;  2WKH A;  1Y54 A;  1K57 C;  1XXM A;  1W79 A;  1VM1 A;  1KVM A;  2XF3 A;  2ZQA A;  4BLM A;  4MEZ A;  3PBO A;  3Q1F A;  2ZJ9 A;  3V5M A;  1K56 A;  2XGN A;  3M2K A;  1MWR A;  1LI0 A;  1W7F A;  5FAQ A;  1ZKJ A;  1BT5 A;  3N7W A;  1YLZ A;  1IYS A;  2Z2L B;  1BTL A;  2J7V A;  1JVJ A;  3Q7Z A;  4KZ5 A;  3Q81 A;  1TVF A;  4L0L A;  4OLG A;  3GR2 A;  2QZ6 A;  5CGW A;  1BLH A;  4UA6 A;  5EEC A;  5M18 A;  4K0W A;  4XUX A;  4Y7P A;  3C4O A;  3OPL A;  2VGK A;  2HPB A;  3VOY A;  3O88 A;  4WEK A;  1YLW A;  3FWL A;  2QPN A;  4K0X A;  3P09 A;  3PAE A;  1W5D A;  1PZO A;  1ZC2 A;  3M2J A;  1FCO A;  3LY4 A;  4LV3 A;  5E2F A;  5EVI C;  4KG6 A;  4R23 A;  5CER A;  4OLD A;  4CJN A;  1PW1 A;  3BEB A;  4U3T A;  3SH8 A;  1YT4 A;  1LLB A;  3RXX A;  3ZG8 B;  1K25 A;  1XGJ A;  3UN7 A;  1ZG4 A;  2H5S A;  2P74 A;  3IQA A;  2WGI A;  3MZD A;  5CGX A;  4JBF A;  2XFT A;  4E3N A;  2WYX A;  5A90 A;  1QME A;  1LL5 A;  4UAA A;  2ZLY A;  1M6K A;  4S2M A;  4PM5 A;  5EOO A;  1PWC A;  2C6W B;  5IHV A;  1BLS A;  3IXG A;  2Y59 A;  2RCX A;  4GZB A;  3VOZ A;  1MY8 A;  1Q2P A;  3QNC A;  1L0E A;  1U60 A;  2R9X A;  1E25 A;  4XUZ A;  4Y0T A;  3SS4 A;  3B3X A;  3IF6 C;  4MBH A;  4E3O A;  4WMC D;  3N4I A;  1N9B A;  4QB8 A;  4WZ5 C;  4DE2 A;  5JYP A;  1WYB A;  2ZMA A;  4H8R A;  3LEZ A;  3BLM A;  3IHA A;  1IYQ A;  2VGJ A;  2X02 A;  3OPP A;  5FA7 A;  3NCK A;  2V2F F;  1KGF A;  2B5R A;  3CMZ A;  3SS3 A;  1IKG A;  4GD8 A;  3ZHH A;  5CED A;  5CTN A;  5KZH A;  1KGE A;  2OLV A;  1G68 A;  4KG5 A;  4UA7 A;  3PBS A;  4RX2 A;  3ZDJ A;  4E3K A;  1K38 A;  3MKE A;  4Z9Q A;  5FQK A;  3V50 A;  3HRE A;  3OCN A;  5G18 A;  5HAP A;  5HFO A;  2BLS A;  3PBR A;  4ZTK A;  3NI9 A;  5BOH A;  5CXW A;  2FFY A;  4X6T A;  1CK3 A;  4WM9 A;  4DRT A;  1MKI A;  3W4P A;  1SHV A;  1BZA A;  4OOM A;  5D3O A;  4IVK A;  4DE0 A;  4R3J A;  1IYO A;  2IWB A;  3GQZ A;  4NK3 A;  1L0D A;  3ZCZ A;  5CEC A;  3UY6 A;  2Y2H A;  1ES3 A;  1KE4 A;  3N6I A;  4BL3 A;  1ERO A;  3MBZ A;  3C5A A;  1PI4 A;  2I72 A;  3EQV A;  4FD8 A;  4FSF A;  3HVF A;  3GRJ A;  4OOL A;  3G30 A;  2G2U A;  3M6H A;  2X01 A;  3MXS A;  3E2K A;  2WUQ A;  3ITB A;  5FI7 A;  5GHY A;  3V39 A;  2Y2M A;  4DE1 A;  4QHC A;  1L2S A;  1SDN A;  2ZQC A;  4OPR A;  1IKI A;  4OPY A;  4HES A;  4HBU A;  3W4Q A;  4LV0 A;  4MNR A;  3HLB A;  3IH9 A;  3C7V A; 
#chains in the Genus database with same CATH topology
 3DAV A;  2FH5 A;  5GLC A;  5IT5 A;  4C6Y A;  1ONH A;  4WYY A;  4M3K A;  3A3J A;  2VX8 A;  2PYP A;  4RYE A;  2PR6 A;  4R4S A;  3BY8 A;  2O99 A;  2JKT M;  4P85 A;  3UDX A;  1D7E A;  2J3T D;  2P7J A;  5HAQ A;  4U0T A;  5EVL A;  4JF5 A;  3G34 A;  4EQI A;  3P98 A;  4EBL A;  4S2P A;  3PBQ A;  4WN5 A;  4S2K A;  2Y55 A;  2KX6 A;  3QNB A;  1K6S A;  4I38 A;  2PU4 A;  3DWZ A;  2XH9 A;  3PXP A;  1H8Y A;  3L7H A;  5HSQ A;  4CLC B;  3WS0 A;  2UV0 E;  2FZ0 A;  3KYE A;  3W8K A;  2L0W A;  4RA7 A;  4DF6 A;  4O01 A;  4WZ4 A;  1PW8 A;  4GLQ A;  1DJA A;  1XKZ A;  3AGF A;  3JVU A;  4WEJ A;  5AJG A;  1K56 D;  1K4F A;  5EVE A;  1NZO A;  3EQU A;  3TJZ C;  4CLC E;  4HP9 A;  3ZVW A;  3O87 A;  3UE3 A;  4JGQ A;  1RGZ A;  3PBN A;  1AWI A;  2H28 A;  1P9R A;  1P0Z A;  1PWD A;  4CPK A;  1DJB A;  2QJ5 A;  3QP1 A;  4LV1 A;  3OC2 A;  2WZZ A;  1LT0 A;  2G7U A;  1OT9 A;  3CZD A;  4FH2 A;  3ZG9 B;  1TS0 A;  4GD6 A;  1BUE A;  2VV6 A;  2Z2M B;  4ZDX A;  4MN6 A;  4DDS A;  4KZ8 A;  2XDM A;  4CLC A;  1MWU A;  3IHB A;  2W27 A;  2L1M A;  1NYM A;  3NEC A;  3EOI A;  3NUL A;  1DY6 A;  3VFH A;  3OPR A;  3UB8 A;  1NZU A;  1CQA A;  3V3S A;  2VLG A;  4JF6 A;  1OJ5 A;  3HL9 A;  1Z09 A;  3QP8 A;  3IF5 A;  3NOT C;  1VET B;  3UE1 A;  3ZG5 A;  5DTT A;  4OH0 A;  3PBT A;  1BLC A;  3D72 A;  3NOU C;  4GNU A;  3LR0 A;  2ZC4 B;  5KSC A;  2D01 A;  4MN7 A;  1FIK A;  4PM7 A;  5CHM A;  4GCZ A;  3WS4 A;  4JPM A;  1TEM A;  3LR5 A;  4DN0 A;  1YMX A;  3UPN A;  4HBT A;  4I3J A;  3DTM A;  5HD3 A;  5HL1 A;  3ZG0 A;  4EV4 A;  1I2S A;  1HVB A;  1K6R A;  3LUQ A;  3VP1 A;  5FDS A;  2O9A A;  1S4S A;  4Q0J A;  4CLC C;  1OTE A;  4KQO A;  3ULF A;  5E2H A;  2VA0 A;  1NWZ A;  4GW9 A;  4YOF A;  4M4X A;  4X55 A;  1FQG A;  1L0G A;  2A24 B;  1KGG A;  5AQ9 A;  3PAG A;  1VET A;  4ZRR A;  3VSK A;  5FSR A;  1YKD A;  3C8C A;  5DJT A;  3ZGA B;  3W4O A;  2XD5 A;  1S0W A;  2LB9 A;  3LEQ A;  2V9A A;  4HH3 A;  4BBU A;  3N8S A;  4N9L A;  1HTZ A;  2JKF A;  4GHI B;  1T1C A;  1MXO A;  2EXB A;  2Y2N A;  1CEF A;  3H82 B;  5GLD A;  3UPP A;  4S2J A;  3BWL A;  4NET A;  5FDH A;  2A2L A;  3C7U A;  1JWP A;  1PWG A;  5A91 A;  4DMZ A;  1P97 A;  4JXV A;  4D2O A;  2ZC7 A;  3LFV A;  5E43 A;  5IS1 A;  3MMH A;  3FYZ A;  3RJU A;  1NLY A;  3CIT A;  3A3D A;  1K54 A;  3Q82 A;  1F9I A;  3BQA A;  2EWW A;  5FEF A;  4HY8 A;  1XP4 A;  2W3D A;  2A24 A;  2PHY A;  1PI5 A;  3T12 B;  3BW6 A;  3S4X A;  1JTD A;  5KSH A;  4G3K A;  2ZC6 B;  3JVV A;  3BEC A;  4EBN A;  4X1L A;  4OP5 A;  3KO6 A;  4LCM A;  2KOI A;  5TFQ A;  4ETZ A;  4PPR A;  1Y4O A;  2RL3 A;  4A5R A;  4GHI A;  1E3U A;  4LRY C;  4E3I A;  4JKT A;  3H82 A;  1H0M A;  1G6A A;  1K57 C;  1VM1 A;  1KVM A;  2XF3 A;  2ZQA A;  3T4O A;  2ZJ9 A;  3U2A A;  2NUT C;  5EM1 A;  1SZV A;  1JVJ A;  3Q7Z A;  3Q81 A;  2QZ6 A;  1XJ3 A;  4Y7P A;  2Q0O A;  3B47 A;  3O88 A;  1W5D A;  3FPW A;  5FL3 A;  1FCO A;  3LY4 A;  1MC0 A;  4CJN A;  1YT4 A;  2H5S A;  2P74 A;  1CF0 A;  4EU0 A;  2WYX A;  2V8F A;  1LL5 A;  3CUE A;  2VJW A;  3E98 A;  4IUH A;  3D3O A;  2VGL S;  3IXG A;  2RCX A;  1JNU A;  2HGV A;  4Y0T A;  3B3X A;  4WUJ A;  4MBH A;  5C5K A;  4WMC D;  3N4I A;  1STZ A;  1WYB A;  4H8R A;  3BLM A;  2X02 A;  2V2F F;  5HDC A;  5G4Z A;  5CTN A;  2WKP A;  4RX2 A;  3E4O A;  1FIL A;  1N9O A;  1CK3 A;  3TW8 A;  1SHV A;  1BZA A;  3LI9 A;  2IWB A;  2V0W A;  1L0D A;  3UY6 A;  2Y2H A;  2VV7 A;  1ERO A;  1XFQ A;  2I72 A;  4AFI A;  3GEC A;  1V9Y A;  3R4K A;  5FI7 A;  5GHY A;  1L2S A;  3T1X A;  4OPY A;  4HBU A;  3W4Q A;  2YKF A;  3HLB A;  3C7V A;  3LR4 A;  1V9Z A;  4EEU A;  5MC7 A;  3LIB A;  3VE3 A;  4EBP A;  2EX2 A;  1XA7 A;  2AVX A;  3MXQ A;  3CUE C;  2B18 A;  4OPZ A;  5FQQ A;  3FZC A;  2XFS A;  3EEH A;  4I3I A;  2K31 A;  4HJ3 A;  4BMW A;  2EX8 A;  2CC1 A;  4OQI A;  1W8Y A;  3IT9 A;  5FI2 A;  1IOU A;  4L9F A;  3MSH A;  3T4T A;  2ZM0 A;  4R70 A;  3TOI A;  5FAO A;  4HNB A;  4DDY A;  3T4K A;  4MLL A;  5A92 A;  2W1T B;  4Y5F A;  3A3F A;  2ACG A;  5DFX A;  3M6B A;  3DW0 A;  3VOL A;  1TDG A;  1T18 A;  4ETX A;  5L07 A;  2V1B A;  5F83 A;  1SKO B;  2J80 A;  4Y0O A;  4QPR A;  1YQS A;  3O5Y A;  2IA2 A;  3MFX A;  2PD8 A;  3MZE A;  1FSW A;  2O9B A;  3VMA A;  3U4L P;  3LID A;  2ZC5 B;  2Q9M A;  4R38 A;  4KZ4 A;  1KE0 A;  4RX3 A;  5TJJ A;  3PR6 A;  4KZ7 A;  2K7S A;  3OBF A;  2E8I A;  1ALQ A;  1H5X A;  2H10 A;  3IF6 B;  5HDD A;  3VE4 A;  5J8X A;  1ESI A;  4Q0I A;  5E2G A;  4DE3 A;  2PT7 A;  1EI5 A;  1ES5 A;  5A93 A;  2W1T A;  3CPT B;  4P87 A;  3UB5 P;  1L3L A;  3WS2 A;  2ZQD A;  3OCL A;  1JTG A;  2X71 A;  1UGU A;  1SKO A;  3SZT A;  4EXO A;  2KLI A;  3HLC A;  1XPB A;  2Y4A A;  5EVI A;  4Q8I A;  4BD1 A;  3UNW A;  3MKF A;  4WBG A;  4XXR A;  4F3L B;  4EUV A;  1VHM A;  2QHK A;  5GHZ A;  5FAS A;  3SH7 A;  2CMN A;  3V3R A;  4OQG A;  3S7P A;  4GN2 A;  4L9E A;  3KSF A;  5FAT A;  5FQJ A;  1UWN X;  4KZB A;  1LSW A;  5KMW A;  4CLC D;  1GSW A;  4NXE A;  2XSS A;  1WA9 A;  3ICY A;  1K4E A;  5FI6 A;  3IF6 A;  3DWK A;  4BBT A;  3BFG A;  1ES2 A;  1XX2 A;  3WRZ A;  4Z1W A;  3QP4 A;  1PYY A;  2EXA A;  4R3B A;  4MCW A;  5I94 A;  4Q0H A;  4PAU A;  5KIZ A;  1N9N A;  2XR0 A;  5FQI A;  3CPT A;  4PKY A;  1YLP A;  3A3E A;  4ZJ2 A;  4EWF A;  3UPO A;  4KQR A;  5DKL A;  2WZX A;  2WK0 A;  5HDS A;  3UB9 A;  4DJ2 A;  2WKQ A;  3NC8 A;  3F1P B;  5U47 A;  3LCE A;  3GSG A;  2JKG A;  3BLS A;  3VSL A;  2XA7 M;  5CRF A;  4F3L A;  3HCY A;  4II7 A;  5TGF A;  4C3Q A;  1W63 Q;  1XJ6 A;  5DKK A;  3CJM A;  5F82 A;  2XRN A;  1NRF A;  4DJ3 A;  2OAQ 1;  4JXW A;  1ZG6 A;  5DTK A;  1OTD A;  3GTC A;  1IYP A;  4QU3 A;  2BTF P;  5HW3 A;  3BFF A;  1VQQ A;  2WAF A;  4QJG A;  3F1O B;  1LL8 A;  3FKW A;  3VP0 A;  1W63 M;  2INW A;  3IWQ A;  1YSP A;  4P6Z S;  1S4R A;  1JWZ A;  2H0T A;  4X68 A;  4QD4 A;  4KZ9 A;  3BRM A;  3F1P A;  2XK1 A;  3NBL A;  4UQI M;  4OP8 A;  3MQQ A;  3RH8 B;  3S1Y A;  1G28 A;  2ZD8 A;  4JXG A;  5J3W A;  3RXW A;  2ZC3 B;  4RVA A;  5EFW A;  2BAS A;  3JYI A;  3IWO A;  1N4O A;  4NKP A;  3D9Y A;  1XA1 A;  1EWZ A;  4LEN A;  1M40 A;  5L2F A;  3T1R A;  3S22 A;  2YKH A;  1TS8 A;  1TS6 A;  3RFB A;  1FCM A;  3K2N A;  2H0Y A;  3F1O A;  1CI9 A;  1FR1 A;  4Y2F A;  1XJ4 A;  1PZP A;  4R4R A;  5GHX A;  1GHI A;  3LIC A;  5M19 A;  5A8B A;  2QYB A;  4O7D A;  3BFC A;  1HLU P;  1GHP A;  2A49 A;  2W3E A;  5HZH A;  5JYO A;  3T4Q A;  2Y2K A;  2WKH A;  1W79 A;  3F1N B;  4K08 A;  3PBO A;  3Q1F A;  3V5M A;  1K56 A;  1MWR A;  5FAQ A;  5I5L A;  3N7W A;  1IYS A;  2Z2L B;  4KZ5 A;  1TVF A;  1BLH A;  4CQH A;  4IUK A;  2W3G A;  3FWL A;  3H9W A;  1XFN A;  3M2J A;  3ZYT A;  5CER A;  3SH8 A;  2W3H A;  1LLB A;  2ZL1 B;  3IQA A;  5CGX A;  2XFT A;  1F98 A;  1QME A;  4UAA A;  2ZLY A;  1M6K A;  3VV4 A;  4Y3I A;  1PWC A;  5IHV A;  3TE8 A;  3MF0 A;  5FEG A;  3VOZ A;  1MY8 A;  3QNC A;  4G3W A;  1MKM A;  4XUZ A;  2Z6C A;  3R7W B;  1OT6 A;  3MS6 A;  2W1R A;  4FUW A;  3F1N A;  4KUK A;  3LEZ A;  3K3C A;  3OPP A;  5CED A;  3SS3 A;  4GD8 A;  4HP4 A;  3ZHH A;  3TRC A;  1KGE A;  2OLV A;  1G68 A;  3ZDJ A;  4E3K A;  3MKE A;  4B93 A;  3P7N A;  4LRX C;  3V50 A;  5G18 A;  5HAP A;  1T1B A;  2BLS A;  3NI9 A;  1A0K A;  4IVK A;  2HZ5 A;  4NK3 A;  3ZCZ A;  1DP9 A;  5TBM B;  3N6I A;  2GZA A;  2ZL1 A;  3ZQ5 A;  3MBZ A;  3C5A A;  2QKP A;  1DRM A;  1PI4 A;  3EQV A;  3MQ0 A;  4FD8 A;  4OOL A;  1XJ2 A;  3G30 A;  2WUQ A;  3V39 A;  4OPR A;  1IKI A;  4MNR A;  3IH9 A;  3NIA A;  1GA9 A;  5F68 A;  1ERQ A;  3R7W A;  3IXD A;  2OWH A;  2J9O A;  4O0P A;  1WE4 A;  1YAX A;  2NUP C;  4R0Q A;  2WKE A;  1GHM A;  1KDW A;  3DTK A;  2XD1 A;  3UB6 A;  1SKF A;  1H8M A;  4I39 A;  3HUO A;  4C75 A;  1O07 A;  1YSQ A;  3G31 A;  2HDU A;  4E04 A;  3ZG7 B;  5TBM A;  4BEN A;  3AGD A;  4GKU A;  4PM8 A;  1BSG A;  1GCE A;  4G3V A;  3UB7 A;  4BBV A;  3CG5 A;  4Y0U A;  4E6W A;  1K54 C;  1G6O A;  2M7V A;  4HOI A;  2WKR A;  1L0F A;  3VP3 A;  3GDI A;  3G2Y A;  1AXB A;  5EM0 A;  4PM6 A;  3UE6 A;  2P9V B;  1FSY A;  5AQA A;  4JGO A;  1YM1 A;  3T50 A;  2EA9 A;  2OWJ A;  4RQ9 A;  4FTX A;  4JF4 A;  5DF9 A;  4OOY A;  4MN5 A;  2VKS A;  3IWI A;  4Y15 A;  1YLT A;  1I2W A;  4BL2 A;  4YIN A;  2WKI A;  1RP5 A;  1RGY A;  3C30 A;  2IWD A;  5G4Y A;  1MWT A;  3MJQ A;  4UA9 A;  4FOF A;  3BM6 A;  4ZJ3 A;  3VP2 A;  2Y2I A;  1SDE A;  1ONG A;  2V1Z A;  4LRZ E;  3A0V A;  1GSX A;  2Y2O A;  3V67 A;  1JWV A;  1QMF A;  3G6O A;  1E4D A;  1KOU A;  2JE5 A;  1S1Z A;  4B9O A;  1C3B A;  4OVD A;  5E2E A;  4KG2 A;  5HL6 A;  1TF1 A;  2EFX A;  3LIA A;  4PHT A;  2R78 A;  5K5B A;  1Q2Q A;  3QP2 A;  5AQB A;  3G4P A;  4P6B A;  3H7W A;  2A3U A;  5M1A A;  1Y28 A;  3SS5 A;  3T4L A;  2HP5 A;  2P9V A;  2ZQ8 A;  3T1Q B;  2GNX A;  1OJG A;  4QWO A;  3B42 A;  2C5W B;  1F5M A;  2OSU A;  4N9K A;  4OKP A;  4EEP A;  3VFF A;  5CTM A;  4U0X A;  4R6L A;  4S2I A;  2B02 A;  1Z6F A;  3O3V A;  4D60 A;  4I5S A;  4KZ3 A;  1SCW A;  5GLB A;  2D02 A;  2HDS A;  3FC7 A;  4ME4 A;  2Z6D A;  3SOI A;  3RTY A;  4LCL A;  2W0N A;  2JBF A;  4HIA A;  4EES A;  1CEG A;  2WGW B;  1YPR A;  2JCH A;  1NLZ A;  3C4P A;  1I5Q A;  2W3F A;  1J3W A;  1LHY A;  4NXB A;  3A0R A;  4YNR A;  3E0Y A;  3SW1 A;  3D4F A;  1VB6 A;  2OOL A;  2OAP 1;  1T1A A;  4YWZ A;  5EVI B;  2GX5 A;  3OPH A;  3CWF A;  4EW7 A;  3IX4 A;  4BJP A;  2Y2L A;  3UDF A;  3P01 A;  4IVI A;  4WMC A;  1H8Z A;  1J9M A;  5CEB A;  4E3M A;  5DF7 A;  1CI8 A;  2JN7 A;  5CHU A;  4EUZ A;  1NYY A;  2HP9 A;  4MBF A;  3BQ8 A;  1MWS A;  3ZNT A;  1YLY A;  4MBK A;  3T1S A;  1BUL A;  1IEM A;  4JGP A;  3WS1 A;  5GL9 A;  4PKY G;  1PIO A;  1OTI A;  5HWT A;  3CHW P;  2I9V A;  2LB5 A;  3IXB A;  3ITA A;  4KQQ A;  2WGW A;  4E3J A;  3BJN A;  4MDZ A;  3FV7 A;  3T4J A;  1KVL A;  2VEA A;  1BYW A;  4WEL A;  1NXY A;  2R9W A;  3KYZ A;  1YLJ A;  2Y8H A;  3HBR A;  1IEL A;  1S66 L;  1RCJ A;  4GDN A;  2P04 A;  3AGE A;  1NRJ A;  1S6R A;  4OON A;  3QP6 A;  3E4Q A;  3GMW A;  3HUN A;  3IXH A;  3NHQ A;  4GJ4 A;  3IH8 A;  5TR7 A;  4H6J B;  4HH2 A;  3HJI A;  5CX7 A;  2Y91 A;  3NJA A;  4HQA A;  3B33 A;  2Y2P A;  1HD8 A;  4PM9 A;  2Y2G A;  2UWX A;  5F5Y A;  3LI8 A;  1LI9 A;  1ODV A;  1ZTU A;  4R1G A;  3BFE A;  3MQO A;  3KSH A;  3HUM A;  4F94 A;  5AQ7 A;  3PTE A;  3EGD C;  3UMD A;  3PHY A;  2PBY A;  3WRT A;  4B4X A;  3UDI A;  5HAI A;  2K2N A;  3VP4 A;  3MZF A;  2OLU A;  5FQM A;  4I3A A;  1Y54 A;  1XXM A;  4MEZ A;  2EWV A;  3KX0 X;  2XGN A;  3M2K A;  1TD5 A;  1LI0 A;  5HWW A;  1BT5 A;  4UEY A;  2J7V A;  3S7Q A;  4H6J A;  1F2K A;  5CGW A;  5EEC A;  2VGK A;  5HPI A;  4K0X A;  1PZO A;  5EVI C;  4OLD A;  1PW1 A;  4U3T A;  1K25 A;  1XGJ A;  4ARZ B;  1ZG4 A;  2WGI A;  3FG8 A;  5A90 A;  3EWK A;  2J3W A;  4S2M A;  2C6W B;  1BLS A;  2DMW A;  4GZB A;  1Q2P A;  4X1M A;  1DP8 A;  1L0E A;  1U60 A;  2R9X A;  1E25 A;  3SS4 A;  3IF6 C;  4X25 A;  1N9B A;  3EEA A;  4DE2 A;  4MMN A;  2VGJ A;  5FA7 A;  3NCK A;  2B5R A;  1EW0 A;  1IKG A;  5KZH A;  4XT2 B;  4KG5 A;  4UA7 A;  4Z9Q A;  5FQK A;  2O0Y A;  3HRE A;  3OCN A;  5HFO A;  3PBR A;  4ZTK A;  5BOH A;  4HHD A;  4X6T A;  5CXW A;  4HJ6 A;  1MKI A;  3W4P A;  4HI4 A;  4OOM A;  5D3O A;  4LGW A;  4DE0 A;  4R3J A;  3GQZ A;  5L8M A;  3JPU A;  3DTE A;  2Y79 A;  1ES3 A;  3NOP C;  1KE4 A;  4ARZ A;  4BL3 A;  3MR0 A;  4FSF A;  2HV1 A;  3BY9 A;  3W2Z A;  2G2U A;  2X01 A;  5JYP A;  3ITB A;  4DE1 A;  2Y2M A;  1SDN A;  2PAV P;  4HES A;  5EOO A;  3T4S A;  4N1H A;  1ES4 A;  3LY3 A;  4HJ4 A;  4X53 A;  4DKI A;  1CJF A;  3N8L A;  4O8G A;  3LIF A;  3S7O A;  1H3Q A;  3DBA A;  3TG9 A;  5EV0 A;  2WAD A;  4XT2 A;  4B4Z A;  2XA7 S;  4JXS A;  4OQH A;  2XEP A;  3A3I A;  5HD5 A;  3ZNY A;  5FAP A;  5HPF A;  2XQZ A;  5EPH A;  3E2L A;  4FH4 A;  2Y2Q A;  3UME A;  4LFU A;  1PNE A;  2JC7 A;  4S2L A;  3OZH A;  1ACF A;  4DXB A;  2J9P A;  4HEF A;  2HJ9 C;  2ZM2 A;  4WF0 A;  1S67 L;  3A0S A;  1E3U D;  5EE8 A;  3HLD A;  3I7J A;  4UHU A;  2PU2 A;  4ZBE A;  4E3L A;  4N1X A;  2MJ6 A;  5EUA A;  3HLF A;  3LR3 A;  1XGI A;  1LL9 A;  3WS5 A;  1MPL A;  3OOV A;  3HLE A;  2PYR A;  3LGO A;  2J3T C;  2J8Y A;  4NXG A;  4DXC A;  4EER A;  1DP6 A;  3MFD A;  1X0O A;  3Q7V B;  3SH9 A;  5DVA A;  1W8Q A;  4UQI S;  4P0M A;  3E4P A;  4JLF A;  2PD7 A;  3QHY A;  2VK3 A;  3OLO A;  4GB7 A;  4KZ6 A;  1K57 A;  3O86 A;  1GA0 A;  1LSV A;  5CHJ A;  2VGL M;  5GLA A;  1VEU B;  2PR5 A;  3HJK A;  3HLW A;  2EFU A;  1P9W A;  3HLG A;  5AVF A;  4L9G A;  4X56 A;  5DTS A;  1K0K A;  3S7N A;  2DNS A;  2B95 A;  4S2N A;  5DF8 A;  5FQ9 A;  2HP6 A;  1FCN A;  2GDN A;  1KDS A;  4EQ1 A;  5HAR A;  5L09 A;  3G32 A;  1OME A;  4OQ0 A;  3Q7V A;  2M7U A;  2Y2J A;  2E8J A;  2PDR A;  3ISG A;  3GV9 A;  1ESU A;  1NY0 A;  2PRF A;  4K91 A;  2QMI A;  2ZQ7 A;  4ZJ1 A;  3C38 A;  1YMS A;  2EX6 A;  2ZOI A;  3KSI A;  1VEU A;  2QWS A;  2V20 A;  1BLP A;  4FCF A;  3ZFZ A;  2HDQ A;  4ESP A;  2ZQ9 A;  5CGS A;  5DJU A;  2IWC A;  1D1J A;  2BG1 A;  1K55 A;  3LO7 A;  4EET B;  4YFM A;  1O7E A;  4BQM A;  2G2W A;  3FPV A;  5L10 A;  3PYP A;  2V1A A;  4QY5 A;  2ZMV A;  3H7W B;  3MXR A;  4S2O A;  4B88 A;  5AVE A;  3IX3 A;  2ZM8 A;  4IED A;  5EOE A;  1FOF A;  4LV2 A;  3KYQ A;  2HF6 A;  3G35 A;  3TSG A;  4KQD A;  2JKR I;  1DJC A;  4S2N C;  3ZVT A;  4ZAM A;  4NXF A;  1OTB A;  1TDL A;  2O9C A;  4X69 A;  1WYC A;  2P08 A;  4BD0 A;  2WAE A;  4OPQ A;  3UO9 A;  3UE0 A;  2EX9 A;  4KEN B;  2HJE A;  4NEE D;  3CLO A;  4GDB A;  1LSX A;  4E6X A;  4QY6 A;  4WEK A;  3G2Z A;  1MBL A;  2V8C A;  5J4E A;  1NJ4 A;  4LPZ A;  5F1G A;  1KE3 A;  4GOG A;  3FKV A;  3BFD A;  1FR6 A;  3BYD A;  2KDK A;  3IS2 B;  4IJG A;  4NG2 A;  3GVB A;  1TS7 A;  1N9L A;  1S1Y A;  5J7E A;  5DFY A;  2WGV A;  2M1C A;  3KSG A;  4WLA A;  4N92 A;  1ZHH B;  4ID4 A;  1K55 C;  2DRW A;  4LLO B;  3NDG A;  4IBR A;  2ZBB A;  1GSV A;  2HDR A;  5HX9 A;  1T19 A;  2V0U A;  2XLN A;  1HZO A;  3CI6 A;  2GJ3 A;  2Q9N A;  1ERM A;  1G5U A;  5F1F A;  2FFF B;  3NY4 A;  2DCF A;  3Q07 A;  3WWX A;  5IU1 A;  4WZ5 A;  3LYX A;  5EVI D;  3CAX A;  3N8R A;  2PBD P;  2QJ7 A;  3NDE A;  4KZA A;  2JHE A;  2OV5 A;  4BWI A;  4PMA A;  4IBX A;  3EGX C;  1OTA A;  1IFQ A;  2XRO A;  3QP5 A;  3IS2 A;  4IHQ A;  2JKT I;  4BLM A;  5HWV A;  4GS9 B;  1W7F A;  1ZKJ A;  1YLZ A;  2ZMF A;  1BTL A;  4L0L A;  4OLG A;  2VV8 A;  3GR2 A;  2L4R A;  4UA6 A;  5M18 A;  4K0W A;  4XUX A;  2JKR M;  3C4O A;  3OPL A;  2HPB A;  3VOY A;  4Y17 A;  1YLW A;  1MZU A;  2QPN A;  3P09 A;  3PAE A;  1D06 A;  1ZC2 A;  4LV3 A;  5E2F A;  4KG6 A;  4R23 A;  5F6A A;  3BEB A;  2ZOH A;  3RXX A;  3ZG8 B;  3UN7 A;  3MZD A;  4JBF A;  4E3N A;  3IX8 A;  4PM5 A;  5F69 A;  3L9K A;  3LIE A;  2Y59 A;  4WL9 A;  4E3O A;  4WZ5 C;  4QB8 A;  3K3D A;  2ZMA A;  3IHA A;  1IYQ A;  4GS9 A;  3CMZ A;  1KGF A;  1OPX A;  1PFL A;  3PBS A;  1K38 A;  4JGR A;  4KUO A;  4R3A A;  2FFY A;  4WM9 A;  2VZW A;  4DRT A;  1PRQ A;  3IBJ A;  4P6Z M;  3C2W A;  1IYO A;  3DTI A;  5LBR A;  5CEC A;  1UWP X;  3IBR A;  3HVF A;  3GRJ A;  3M6H A;  3MXS A;  3E2K A;  4QHC A;  2ZQC A;  4Y13 A;  4LV0 A; 
#chains in the Genus database with same CATH homology
 3NIA A;  1GA9 A;  4N1H A;  1ES4 A;  1ERQ A;  3LY3 A;  5GLC A;  4EBP A;  2EX2 A;  1XA7 A;  3IXD A;  4C6Y A;  4OPZ A;  1ONH A;  4WYY A;  4M3K A;  5FQQ A;  3A3J A;  3FZC A;  2XFS A;  2J9O A;  4X53 A;  4DKI A;  1WE4 A;  3N8L A;  4RYE A;  4R4S A;  2EX8 A;  2CC1 A;  4OQI A;  1W8Y A;  3IT9 A;  4P85 A;  5FI2 A;  3TG9 A;  3UDX A;  2WAD A;  4R0Q A;  2WKE A;  4B4Z A;  1GHM A;  5HAQ A;  2ZM0 A;  4JXS A;  4U0T A;  1KDW A;  2XEP A;  4OQH A;  5EVL A;  3A3I A;  4JF5 A;  3G34 A;  2XD1 A;  4EQI A;  1SKF A;  3P98 A;  4EBL A;  4S2P A;  3TOI A;  3PBQ A;  3ZNY A;  4S2K A;  5FAP A;  2Y55 A;  2XQZ A;  5FAO A;  3HUO A;  5EPH A;  3E2L A;  4FH4 A;  4C75 A;  2Y2Q A;  4DDY A;  3QNB A;  1O07 A;  2JC7 A;  4S2L A;  4MLL A;  5A92 A;  3OZH A;  1K6S A;  3G31 A;  2PU4 A;  3DWZ A;  2HDU A;  2J9P A;  2XH9 A;  3A3F A;  4HEF A;  4DXB A;  3ZG7 B;  1H8Y A;  2ZM2 A;  3M6B A;  3DW0 A;  3WS0 A;  1E3U D;  1TDG A;  5EE8 A;  4BEN A;  3AGD A;  4GKU A;  3HLD A;  3I7J A;  4PM8 A;  1BSG A;  1GCE A;  4UHU A;  5F83 A;  2PU2 A;  4ZBE A;  3W8K A;  4N1X A;  4E3L A;  3CG5 A;  4RA7 A;  4Y0U A;  4E6W A;  4DF6 A;  1K54 C;  5EUA A;  3HLF A;  4Y0O A;  1YQS A;  4WZ4 A;  1L0F A;  1PW8 A;  1DJA A;  3VP3 A;  1XKZ A;  1XGI A;  3G2Y A;  3AGF A;  1LL9 A;  3WS5 A;  1MPL A;  1AXB A;  3HLE A;  4WEJ A;  3MZE A;  1FSW A;  1K56 D;  1K4F A;  4PM6 A;  3VMA A;  2J8Y A;  1NZO A;  1FSY A;  2P9V B;  3EQU A;  5AQA A;  4DXC A;  1YM1 A;  3ZVW A;  2ZC5 B;  4JF4 A;  3O87 A;  5DF9 A;  3UE3 A;  4OOY A;  2Q9M A;  1RGZ A;  3PBN A;  3MFD A;  3IWI A;  1YLT A;  3Q7V B;  4KZ4 A;  1KE0 A;  1I2W A;  4BL2 A;  4YIN A;  2WKI A;  4RX3 A;  3SH9 A;  1RP5 A;  1W8Q A;  5DVA A;  1PWD A;  4CPK A;  1DJB A;  1RGY A;  4P0M A;  4KZ7 A;  2IWD A;  4JLF A;  2E8I A;  1ALQ A;  1H5X A;  2H10 A;  3IF6 B;  4LV1 A;  1MWT A;  3OC2 A;  3QHY A;  4UA9 A;  4GB7 A;  5J8X A;  1ESI A;  4KZ6 A;  3BM6 A;  4ZJ3 A;  1K57 A;  2WZZ A;  3VP2 A;  5E2G A;  2Y2I A;  1SDE A;  3O86 A;  1GA0 A;  1ONG A;  4DE3 A;  2V1Z A;  5CHJ A;  1EI5 A;  1ES5 A;  2Y2O A;  5A93 A;  1JWV A;  1QMF A;  1E4D A;  3CZD A;  4FH2 A;  5GLA A;  4P87 A;  3ZG9 B;  2JE5 A;  4GD6 A;  1BUE A;  2Z2M B;  4ZDX A;  3WS2 A;  1C3B A;  4OVD A;  4KZ8 A;  4KG2 A;  5E2E A;  4DDS A;  2XDM A;  2EFX A;  1MWU A;  2ZQD A;  3IHB A;  3OCL A;  1JTG A;  3HLW A;  2X71 A;  2EFU A;  1NYM A;  3HLG A;  1Q2Q A;  5AQB A;  4X56 A;  3G4P A;  5DTS A;  3HLC A;  4P6B A;  1XPB A;  2DNS A;  2Y4A A;  4S2N A;  2A3U A;  5M1A A;  5EVI A;  4Q8I A;  5DF8 A;  5FQ9 A;  4BD1 A;  2HP6 A;  3SS5 A;  3UNW A;  3MKF A;  1DY6 A;  4WBG A;  3VFH A;  4XXR A;  3OPR A;  2HP5 A;  2P9V A;  2ZQ8 A;  1NZU A;  1FCN A;  2GDN A;  1KDS A;  2C5W B;  2OSU A;  4N9K A;  4OKP A;  3V3S A;  5GHZ A;  5FAS A;  5HAR A;  3VFF A;  3G32 A;  4JF6 A;  3SH7 A;  1OME A;  4OQ0 A;  3Q7V A;  3HL9 A;  5CTM A;  4U0X A;  3V3R A;  4OQG A;  4GN2 A;  5FAT A;  4S2I A;  5FQJ A;  2Y2J A;  3IF5 A;  4KZB A;  3ISG A;  3GV9 A;  5KMW A;  3UE1 A;  3ZG5 A;  5DTT A;  1Z6F A;  1ESU A;  3O3V A;  1K4E A;  1BLC A;  1NY0 A;  3PBT A;  4OH0 A;  5FI6 A;  3IF6 A;  3DWK A;  4GNU A;  3BFG A;  2ZC4 B;  1ES2 A;  1XX2 A;  4KZ3 A;  3WRZ A;  5KSC A;  1SCW A;  5GLB A;  1PYY A;  2EXA A;  2HDS A;  4R3B A;  4PM7 A;  5I94 A;  4K91 A;  5CHM A;  2QMI A;  3SOI A;  3WS4 A;  4JPM A;  2ZQ7 A;  4ZJ1 A;  4LCL A;  1YMS A;  1TEM A;  2EX6 A;  2JBF A;  2XR0 A;  1CEG A;  2WGW B;  5FQI A;  1YMX A;  3UPN A;  2V20 A;  1YLP A;  3A3E A;  4ZJ2 A;  1BLP A;  4HBT A;  4FCF A;  4EWF A;  4KQR A;  3UPO A;  3DTM A;  2HDQ A;  2WZX A;  3ZFZ A;  2WK0 A;  2ZQ9 A;  5CGS A;  2JCH A;  3C4P A;  2IWC A;  1I5Q A;  3NC8 A;  2BG1 A;  5U47 A;  5HL1 A;  1LHY A;  3LCE A;  3ZG0 A;  1K55 A;  4EV4 A;  3GSG A;  3LO7 A;  1I2S A;  4YFM A;  1HVB A;  3BLS A;  1O7E A;  1K6R A;  3VSL A;  4BQM A;  3D4F A;  2G2W A;  3VP1 A;  4QY5 A;  5CRF A;  3MXR A;  5EVI B;  4S2O A;  4B88 A;  3OPH A;  4KQO A;  5TGF A;  4C3Q A;  5E2H A;  2ZM8 A;  4IED A;  5EOE A;  1FOF A;  4LV2 A;  2Y2L A;  3UDF A;  4BJP A;  3CJM A;  3G35 A;  4IVI A;  5F82 A;  3TSG A;  4WMC A;  4X55 A;  1FQG A;  1H8Z A;  1L0G A;  1J9M A;  1NRF A;  4S2N C;  1DJC A;  3ZVT A;  5CEB A;  4ZAM A;  4E3M A;  4JXW A;  5DF7 A;  1ZG6 A;  5DTK A;  1CI8 A;  1TDL A;  1KGG A;  4X69 A;  5AQ9 A;  1WYC A;  3GTC A;  5CHU A;  3PAG A;  1IYP A;  4QU3 A;  4EUZ A;  5HW3 A;  3VSK A;  3BFF A;  5FSR A;  1VQQ A;  2WAF A;  1NYY A;  2HP9 A;  4MBF A;  4QJG A;  4BD0 A;  3ZNT A;  1MWS A;  1YLY A;  4MBK A;  2WAE A;  4OPQ A;  1BUL A;  1IEM A;  3UO9 A;  3WS1 A;  3ZGA B;  3W4O A;  5GL9 A;  2XD5 A;  1PIO A;  1S0W A;  3UE0 A;  2EX9 A;  4KEN B;  3FKW A;  3VP0 A;  4GDB A;  4E6X A;  3N8S A;  4N9L A;  4QY6 A;  1HTZ A;  3G2Z A;  1MBL A;  3ITA A;  3IXB A;  2WGW A;  4KQQ A;  1NJ4 A;  4E3J A;  3IWQ A;  5F1G A;  1MXO A;  1KE3 A;  3FV7 A;  2EXB A;  2Y2N A;  1JWZ A;  4GOG A;  1KVL A;  1CEF A;  3BFD A;  3FKV A;  2H0T A;  1FR6 A;  5GLD A;  3UPP A;  4X68 A;  4S2J A;  4QD4 A;  3BYD A;  1NXY A;  4KZ9 A;  3BRM A;  2R9W A;  4NET A;  4WEL A;  2XK1 A;  1YLJ A;  5FDH A;  3NBL A;  3HBR A;  1IEL A;  4OP8 A;  3GVB A;  3C7U A;  1JWP A;  1RCJ A;  4GDN A;  1PWG A;  3S1Y A;  5A91 A;  3AGE A;  2WGV A;  4JXV A;  4D2O A;  2ZC7 A;  3RXW A;  1S6R A;  2ZD8 A;  4JXG A;  4OON A;  2ZC3 B;  4RVA A;  5E43 A;  3GMW A;  3FYZ A;  3HUN A;  3IXH A;  4N92 A;  3RJU A;  4ID4 A;  3JYI A;  3IH8 A;  3A3D A;  3IWO A;  1K54 A;  5TR7 A;  3Q82 A;  1N4O A;  1K55 C;  2DRW A;  1XA1 A;  3NDG A;  1XP4 A;  4IBR A;  1EWZ A;  4LEN A;  2HDR A;  1M40 A;  5L2F A;  2Y91 A;  1PI5 A;  5HX9 A;  3S22 A;  2Y2P A;  1HD8 A;  4PM9 A;  2Y2G A;  1FCM A;  2XLN A;  2UWX A;  1HZO A;  3S4X A;  1JTD A;  5KSH A;  1LI9 A;  2H0Y A;  2ZC6 B;  2Q9N A;  1ERM A;  4R1G A;  3BEC A;  1CI9 A;  3BFE A;  5F1F A;  4EBN A;  1FR1 A;  2FFF B;  3NY4 A;  2DCF A;  4OP5 A;  3HUM A;  3Q07 A;  4F94 A;  4LCM A;  3PTE A;  5AQ7 A;  1PZP A;  3WWX A;  5TFQ A;  4R4R A;  5GHX A;  1GHI A;  4WZ5 A;  5M19 A;  4O7D A;  2PBY A;  4PPR A;  5EVI D;  3WRT A;  4B4X A;  3BFC A;  2RL3 A;  4A5R A;  3N8R A;  1GHP A;  2A49 A;  3UDI A;  1E3U A;  5HAI A;  3VP4 A;  3NDE A;  3MZF A;  5JYO A;  4KZA A;  2OLU A;  5FQM A;  4E3I A;  4JKT A;  2OV5 A;  2Y2K A;  1G6A A;  4PMA A;  4IBX A;  2WKH A;  1Y54 A;  1K57 C;  1XXM A;  1W79 A;  1VM1 A;  1KVM A;  2XF3 A;  2ZQA A;  4BLM A;  4MEZ A;  3PBO A;  3Q1F A;  2ZJ9 A;  3V5M A;  1K56 A;  2XGN A;  3M2K A;  1MWR A;  1LI0 A;  1W7F A;  5FAQ A;  1ZKJ A;  1BT5 A;  3N7W A;  1YLZ A;  1IYS A;  2Z2L B;  1BTL A;  2J7V A;  1JVJ A;  3Q7Z A;  4KZ5 A;  3Q81 A;  1TVF A;  4L0L A;  4OLG A;  3GR2 A;  2QZ6 A;  5CGW A;  1BLH A;  4UA6 A;  5EEC A;  5M18 A;  4K0W A;  4XUX A;  4Y7P A;  3C4O A;  3OPL A;  2VGK A;  2HPB A;  3VOY A;  3O88 A;  4WEK A;  1YLW A;  3FWL A;  2QPN A;  4K0X A;  3P09 A;  3PAE A;  1W5D A;  1PZO A;  1ZC2 A;  3M2J A;  1FCO A;  3LY4 A;  4LV3 A;  5E2F A;  5EVI C;  4KG6 A;  4R23 A;  5CER A;  4OLD A;  4CJN A;  1PW1 A;  3BEB A;  4U3T A;  3SH8 A;  1YT4 A;  1LLB A;  3RXX A;  3ZG8 B;  1K25 A;  1XGJ A;  3UN7 A;  1ZG4 A;  2H5S A;  2P74 A;  3IQA A;  2WGI A;  3MZD A;  5CGX A;  4JBF A;  2XFT A;  4E3N A;  2WYX A;  5A90 A;  1QME A;  1LL5 A;  4UAA A;  2ZLY A;  1M6K A;  4S2M A;  4PM5 A;  5EOO A;  1PWC A;  2C6W B;  5IHV A;  1BLS A;  3IXG A;  2Y59 A;  2RCX A;  4GZB A;  3VOZ A;  1MY8 A;  1Q2P A;  3QNC A;  1L0E A;  1U60 A;  2R9X A;  1E25 A;  4XUZ A;  4Y0T A;  3SS4 A;  3B3X A;  3IF6 C;  4MBH A;  4E3O A;  4WMC D;  3N4I A;  1N9B A;  4QB8 A;  4WZ5 C;  4DE2 A;  5JYP A;  1WYB A;  2ZMA A;  4H8R A;  3LEZ A;  3BLM A;  3IHA A;  1IYQ A;  2VGJ A;  2X02 A;  3OPP A;  5FA7 A;  3NCK A;  2V2F F;  1KGF A;  2B5R A;  3CMZ A;  3SS3 A;  1IKG A;  4GD8 A;  3ZHH A;  5CED A;  5CTN A;  5KZH A;  1KGE A;  2OLV A;  1G68 A;  4KG5 A;  4UA7 A;  3PBS A;  4RX2 A;  3ZDJ A;  4E3K A;  1K38 A;  3MKE A;  4Z9Q A;  5FQK A;  3V50 A;  3HRE A;  3OCN A;  5G18 A;  5HAP A;  5HFO A;  2BLS A;  3PBR A;  4ZTK A;  3NI9 A;  5BOH A;  5CXW A;  2FFY A;  4X6T A;  1CK3 A;  4WM9 A;  4DRT A;  1MKI A;  3W4P A;  1SHV A;  1BZA A;  4OOM A;  5D3O A;  4IVK A;  4DE0 A;  4R3J A;  1IYO A;  2IWB A;  3GQZ A;  4NK3 A;  1L0D A;  3ZCZ A;  5CEC A;  3UY6 A;  2Y2H A;  1ES3 A;  1KE4 A;  3N6I A;  4BL3 A;  1ERO A;  3MBZ A;  3C5A A;  1PI4 A;  2I72 A;  3EQV A;  4FD8 A;  4FSF A;  3HVF A;  3GRJ A;  4OOL A;  3G30 A;  2G2U A;  3M6H A;  2X01 A;  3MXS A;  3E2K A;  2WUQ A;  3ITB A;  5FI7 A;  5GHY A;  3V39 A;  2Y2M A;  4DE1 A;  4QHC A;  1L2S A;  1SDN A;  2ZQC A;  4OPR A;  1IKI A;  4OPY A;  4HES A;  4HBU A;  3W4Q A;  4LV0 A;  4MNR A;  3HLB A;  3IH9 A;  3C7V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...