1RCJA

Crystal structure of e166a mutant of shv-1 beta-lactamase with the trans-enamine intermediate of tazobactam
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
265
structure length
265
Chain Sequence
SPQPLEQIKLSESQLSGRVGMIEMDLASGRTLTAWRADERFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGELCAAAITMSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWATELNEALPGDARDTTTPASMAATLRKLLTSQRLSARSQRQLLQWMVDDRVAGPLIRSVLPAGWFIADKTGAGERGARGIVALLGPNNKAERIVVIYLRDTPASMAERNQQIAGIGAALIEHWQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase SHV-1
publication title Tazobactam Forms a Stoichiometric trans-Enamine Intermediate in the E166A Variant of SHV-1 beta-Lactamase: 1.63 A Crystal Structure
pubmed rcsb
source organism Klebsiella pneumoniae
molecule tags Hydrolase
total genus 98
structure length 265
sequence length 265
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2003-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1rcjA00
3RXXA 3IF6B 1TEMA 4KQRA 3VFFA 2XH9A 3V50A 4EBLA 1K38A 1W8YA 4OVDA 3GVBA 3FV7A 1K57C 3Q81A 5FQ9A 2OLUA 4KZ4A 3GR2A 3UPPA 3G2ZA 1L2SA 1EROA 4JKTA 4EQIA 5HAPA 5E2EA 2VGJA 4BL3A 3IWIA 3O86A 1BLPA 4QD4A 3WRZA 4B4ZA 5HL1A 4JBFA 2H5SA 3HUNA 1PWGA 4K0WA 2FFFB 3DW0A 5CHMA 1NJ4A 4MBHA 4OLGA 5GLCA 4UA9A 5GLAA 3IHBA 3IF6A 4GDBA 2XQZA 5DF9A 4DXBA 1SKFA 3AGFA 2P9VA 4ZAMA 2RL3A 4PM9A 3DWKA 4EBPA 4N9KA 4MBKA 4OPRA 5EVIC 5FASA 4QHCA 5FQJA 2G2UA 2ZJ9A 5CRFA 1E4DA 3BEBA 5D3OA 3V5MA 3ITBA 1K54C 5TFQA 2X01A 3PAEA 1K56D 4R4RA 4FD8A 5E2GA 4JXSA 2CC1A 3PBQA 4OKPA 4DDYA 1CK3A 4UHUA 4PM5A 1BLCA 1TDGA 2Y4AA 1MBLA 1K56A 4MLLA 1JWPA 2ZQDA 1MXOA 5E2HA 4ZJ2A 2WKHA 3ZGAB 1GA0A 4RX3A 4K0XA 3NDEA 3DWZA 4JXVA 3WS2A 4JLFA 5DF7A 4FH4A 2C5WB 3BYDA 4P85A 4BENA 1L0EA 3ZVWA 2EX8A 1O7EA 4KZ8A 2J8YA 4JF5A 4N9LA 1ZG6A 2XEPA 1FR6A 2WAFA 3ZVTA 4HBUA 4ZJ3A 3BFCA 2ZC6B 2WKIA 3BM6A 1RP5A 3PTEA 4ID4A 4KENB 4XUZA 3G2YA 2A3UA 4LENA 3VP4A 4RA7A 2QZ6A 4FH2A 3BFGA 3N8SA 3IF6C 4HESA 1ES4A 2WGIA 3BRMA 4U0TA 1YLTA 4A5RA 4JPMA 5A93A 1KGEA 4PMAA 4DRTA 4NETA 3CMZA 3ZG5A 5L2FA 2I72A 1L0GA 3BFDA 1I2SA 1XA7A 4OQGA 3VMAA 3WWXA 5F82A 1PZOA 3C5AA 1IKGA 3HLGA 2DRWA 4Q8IA 4IVIA 5FA7A 5GL9A 1LL5A 3IXDA 1K4FA 3PBNA 1KDSA 2XF3A 5CEBA 1YLYA 5M19A 3LEZA 3NCKA 5CGXA 4Y0OA 3MXSA 5AQ9A 3EQUA 5EVIB 3UE1A 2EFXA 3Q1FA 5GHYA 5EPHA 3UY6A 4RX2A 3UO9A 2Y2QA 4EWFA 4LV0A 3O87A 4UA7A 2WUQA 1Y54A 3C7VA 4S2KA 2WAEA 1KGGA 3W4QA 1LLBA 4QJGA 4DKIA 2ZQ9A 3GRJA 1H5XA 1PYYA 3O88A 4Y7PA 5HFOA 4E3IA 5EUAA 4B4XA 4KZ5A 1C3BA 2WZZA 3G30A 5CTNA 4KG6A 3FZCA 3IXBA 5EVID 1NXYA 1IYOA 2BG1A 1PW1A 2HP9A 5FATA 3QHYA 2GDNA 1ZG4A 2UWXA 2JBFA 1N4OA 4KZ9A 2PBYA 5EVIA 5HX9A 2Y55A 5F1GA 1ES2A 3CG5A 2EX2A 4P6BA 4GDNA 3Q7ZA 2Y2KA 5TGFA 1HTZA 1K54A 2IWCA 2Y59A 3PAGA 4OH0A 2HDUA 2IWBA 4YINA 4DDSA 3O3VA 1I5QA 3D4FA 3HLCA 3C4OA 3IQAA 3OCLA 4WEKA 5DTKA 3MZFA 4GNUA 3G32A 4DE0A 3BFEA 3NBLA 3V39A 3SS4A 4DF6A 4ZDXA 1S0WA 2J9PA 4PPRA 3G31A 4GD8A 4QY6A 3WS5A 2ZLYA 1DJCA 1K4EA 4O7DA 1AXBA 2WKEA 4KG2A 1ES5A 4JXWA 2EX9A 1KVLA 5KMWA 5E43A 1BLHA 4E3KA 3G35A 5FQKA 4KQQA 1ZKJA 1BZAA 4QB8A 4UA6A 3FWLA 3JYIA 3N8LA 5GLDA 3G34A 3E2LA 3VOZA 4R23A 1IEMA 1XPBA 2ZMAA 3LY4A 2Q9MA 5FAQA 2JC7A 4X69A 4OQIA 4C6YA 4KZ3A 2DCFA 2XFSA 3I7JA 4JF4A 4N92A 5EVLA 4S2PA 3SH8A 1WYBA 4GN2A 4R1GA 1CI9A 2ZQCA 4ZTKA 3CZDA 4BL2A 1K6SA 4WZ5A 1LI0A 3HREA 1LI9A 2HDQA 2H0TA 3A3FA 3ITAA 5CHUA 2ZC5B 1ZC2A 4E3MA 5CEDA 4EUZA 4XUXA 2RCXA 3OPLA 4JF6A 3LY3A 1ES3A 4Z9QA 3UE3A 3PBSA 4S2NC 1E25A 2A49A 4QU3A 1Q2QA 4E3OA 2OLVA 3HLEA 2EX6A 1FCOA 4PM6A 5KZHA 3DTMA 4E3NA 4OQ0A 5FDHA 3HUOA 4S2JA 3A3EA 5FQMA 1PWDA 1MWUA 5JYOA 1E3UA 5DVAA 2H10A 4IBRA 3MBZA 1WE4A 4R4SA 3SS3A 2Y2JA 4S2MA 2PU2A 5GHZA 1MPLA 5J8XA 1CEGA 1BUEA 1JTDA 1SCWA 1DY6A 5FAOA 1JWZA 3VOYA 3S1YA 5CGSA 2XFTA 1IKIA 4JXGA 5TR7A 5CHJA 1OMEA 1W7FA 3OPHA 1PW8A 2WYXA 1RGZA 4DE1A 4L0LA 2R9WA 1YMSA 4OP5A 4GB7A 4NK3A 3M2JA 1CEFA 1L0FA 2G2WA 3N4IA 4C75A 1XXMA 5DTSA 3HUMA 5A90A 5F1FA 5KSHA 2HDSA 5EOOA 3UPNA 1SDNA 1GCEA 2EFUA 1YLZA 1GA9A 4WZ5C 4P0MA 2HP5A 3ZG9B 2X71A 1BT5A 3GMWA 5FI6A 4GOGA 4U0XA 2ZC3B 3TSGA 4DE3A 2EXBA 3A3IA 3GSGA 1NZUA 3VFHA 3BFFA 4E3JA 3IH8A 4X55A 5FI2A 4E3LA 5HAIA 2QPNA 3IT9A 4X56A 3GTCA 3M2KA 1BULA 1SDEA 3UNWA 4PM7A 1HVBA 1PI4A 1YT4A 5IHVA 2C6WB 3OZHA 3Q82A 4X68A 4Y0TA 3RXWA 5HW3A 2XK1A 4XXRA 1ONHA 1PWCA 4BQMA 5M1AA 4FCFA 3OC2A 3OPRA 3ZG8B 3ZCZA 2H0YA 1Q2PA 1YMXA 3ZFZA 4IVKA 2IWDA 1YLJA 3A3JA 4PM8A 4U3TA 4MEZA 1IYQA 3GV9A 4LV3A 1MWTA 4LV2A 1ESUA 4OP8A 4R3BA 4E6XA 3W4OA 4KZAA 3HVFA 3FKWA 1JVJA 3EQVA 3GQZA 4WM9A 2Z2LB 4H8RA 4S2NA 4R0QA 3ZNYA 4F94A 5AQAA 1EWZA 4C3QA 2Z2MB 4OONA 5AQBA 1FOFA 1PZPA 4MBFA 1TDLA 1XP4A 3MKFA 5FQIA 3BLMA 1GHPA 1GHMA 2XLNA 5EECA 4CPKA 3IH9A 2ZD8A 3MKEA 5CTMA 5AQ7A 3UN7A 2Y2HA 3S22A 3SH9A 5A92A 1H8YA 2WGWB 4HBTA 2ZM2A 3SH7A 1FR1A 1M40A 4Y0UA 3Q7VB 1QMEA 1KVMA 3UDIA 5FI7A 4GZBA 3Q07A 2OV5A 3N7WA 4BLMA 5CECA 5DTTA 1N9BA 2Y91A 3UE0A 4RYEA 2Y2PA 5CGWA 1FCNA 3UPOA 1JTGA 1MKIA 1MWSA 1L0DA 3AGDA 5GLBA 3OCNA 1NY0A 2P9VB 4OQHA 4MNRA 4BD1A 1W79A 1XA1A 4ZBEA 1XKZA 3NY4A 1KGFA 1YM1A 3C4PA 1MWRA 4K91A 4OPZA 4QY5A 3C7UA 1PI5A 3M6BA 1FSYA 2JE5A 2V2FF 2XDMA 2Y2MA 2ZQ7A 1BLSA 2BLSA 1HD8A 2WGWA 4DXCA 1XX2A 3A3DA 5F83A 1K25A 3N6IA 4KZ7A 5HARA 2PU4A 3FYZA 3PBRA 3Q7VA 4HEFA 1EI5A 4OOMA 3AGEA 4OPYA 4RVAA 3PBTA 1K55A 3BECA 1E3UD 3MZEA 2E8IA 2WGVA 5U47A 4FSFA 2Y2GA 3LO7A 3MXRA 3ZDJA 4KQOA 3N8RA 4ZJ1A 4WELA 3VP2A 2ZC7A 4WZ4A 3SOIA 3E2KA 1DJBA 4IBXA 1W8QA 3P09A 4LV1A 3UDFA 2FFYA 1ERMA 4EV4A 3HBRA 4GD6A 1G68A 3HLFA 4BJPA 1IYSA 2Y2LA 5G18A 3WS4A 4KZBA 3B3XA 1H8ZA 1O07A 4WEJA 2JCHA 1I2WA 4DE2A 1NYMA 1Z6FA 2ZM8A 1LHYA 3IWQA 1KE3A 1JWVA 1XGJA 2ZQ8A 1XGIA 1DJAA 3TOIA 2ZQAA 3FKVA 1NYYA 3VSKA 3CJMA 1YLWA 4S2IA 3LCEA 1HZOA 3SS5A 2OSUA 3NI9A 3WS0A 3G4PA 2XGNA 2HDRA 1FCMA 3ZG0A 2WADA 2QMIA 5FSRA 5E2FA 1KE0A 2Y2OA 2R9XA 4WBGA 1RGYA 4S2OA 1WYCA 4CJNA 1ERQA 3BLSA 5FAPA 4BD0A 3W8KA 2ZC4B 1G6AA 1K55C 2VGKA 4OLDA 4OOLA 1ESIA 3IWOA 2Q9NA 4LCMA 1BTLA 1U60A 1MY8A 2XR0A 4WMCD 2XD5A 3TG9A 3W4PA 2HP6A 3IXHA 3VP0A 1QMFA 4OOYA 1K57A 4KZ6A 5GHXA 1IELA 3WS1A 4WMCA 2B5RA 4X6TA 3IXGA 3IF5A 3S4XA 4P87A 3ZNTA 3ZG7B 2WZXA 4IEDA 3UDXA 1LL9A 5CERA 3M6HA 4YFMA 5A91A 3ISGA 3HLBA 3ZHHA 5JYPA 2DNSA 3NIAA 1M6KA 1YLPA 4X53A 3IHAA 3V3SA 5FQQA 1TVFA 3QNCA 5EE8A 1GHIA 1KE4A 3QNBA 5EOEA 2XD1A 3RJUA 1BSGA 1FSWA 4S2LA 1J9MA 1ONGA 5M18A 2J9OA 1KDWA 2EXAA 1YQSA 4N1HA 2HPBA 3P98A 1CI8A 3NC8A 1SHVA 4KG5A 4D2OA 4WYYA 2Y2NA 2V20A 5HAQA 1FQGA 4R3JA 2V1ZA 2P74A 3HLWA 2Y2IA 5DF8A 3PBOA 1K6RA 2X02A 3MZDA 1NRFA 4M3KA 1VM1A 1ALQA 3WRTA 4OPQA 5BOHA 2WK0A 2ZM0A 3VSLA 1RCJA 2J7VA 5CXWA 3VP1A 4GKUA 1VQQA 1IYPA 1NZOA 3VP3A 5KSCA 3HL9A 4B88A 5I94A 3HLDA 3NDGA 3MFDA 4UAAA 1S6RA 3V3RA 4N1XA 3OPPA 4E6WA 4EBNA 1PIOA 4LCLA 1W5DA
chains in the Genus database with same CATH superfamily
3VFFA 2WKPA 2JKGA 3B47A 2OLUA 2J3WA 4DN0A 3K2NA 1D06A 3UPPA 3G2ZA 1L2SA 4EQIA 5HAPA 2VGJA 4QD4A 5HL1A 3KX0X 3HUNA 1G28A 3DW0A 5CHMA 5GLCA 4OLGA 3E0YA 2XQZA 4LFUA 1Z09A 3GDIA 2R78A 3PHYA 4MBKA 4WF0A 3BY8A 2ZJ9A 3BEBA 3V5MA 5TFQA 2X01A 4R6LA 4JXSA 3PBQA 1XJ3A 4UHUA 2NUTC 1JWPA 3ZGAB 3FC7A 3R7WB 3WS2A 3NDEA 3DWZA 4JLFA 3T4JA 2C5WB 4BENA 4P85A 3LIFA 3LR0A 2XEPA 2WAFA 4MN5A 4HBUA 2ZC6B 3BM6A 3PTEA 4ID4A 4XUZA 3VP4A 4LENA 2QZ6A 3OOVA 4HESA 2GX5A 4EXOA 4HHDA 4A5RA 4JPMA 1W63Q 5L2FA 2I72A 1L0GA 4O0PA 5F82A 4Q8IA 5GL9A 1K4FA 1CJFA 1YLYA 1CF0A 3NCKA 4Y0OA 3MXSA 3EQUA 5EVIB 3UE1A 4LRYC 3Q1FA 5GHYA 2INWA 4LV0A 2WAEA 3EGXC 3E4OA 3O88A 4E3IA 5CTNA 2BG1A 2O9CA 5FATA 1ZG4A 3BWLA 3NECA 2JBFA 1N4OA 5HX9A 2VV7A 5AVEA 1HTZA 1N9LA 1T1CA 2PD7A 2HDUA 1L3LA 3IQAA 1S66L 3C2WA 5DTKA 2V0UA 2EA9A 1S4RA 3NBLA 3V39A 4ZDXA 4DF6A 2O9AA 3G31A 4GD8A 4QY6A 4CLCE 4O7DA 1AXBA 3V67A 3LYXA 5KMWA 2XA7M 3T50A 2W3HA 5FQKA 4KQQA 4ARZB 4NEED 4UA6A 5GLDA 3LIBA 3VOZA 1MKMA 4R23A 2W3DA 2P7JA 1IEMA 1UWNX 4X69A 4OQIA 2I9VA 3S7OA 5EVLA 1WYBA 2K7SA 4R1GA 2D02A 1K6SA 4WLAA 3HREA 4Y2FA 2HDQA 1EW0A 4GHIB 1ZC2A 4L9EA 3OPLA 4IUKA 4O8GA 3HLEA 2JKRI 1FCOA 2J80A 5FDHA 3C8CA 3RH8B 2L4RA 3T4SA 2L0WA 3C30A 1DP6A 5J8XA 2VLGA 2ZBBA 5FAOA 3KSGA 3S1YA 5CGSA 1IKIA 2PR6A 5TR7A 5CHJA 5EV0A 1NLZA 3OPHA 2R9WA 1CEFA 1XXMA 1H8MA 2ZMVA 3H7WA 5EOOA 3VE4A 4WZ5C 4MMNA 4GOGA 3TSGA 4DE3A 4E3JA 3ZQ5A 1T1BA 2L1MA 3KSIA 4CLCC 5IHVA 2C6WB 4Y0TA 3RXWA 2XK1A 2W3FA 3LFVA 4F3LB 4BQMA 4FCFA 4LRXC 3OPRA 4IVKA 4PM8A 2V8FA 4U3TA 2A24A 1IYQA 4LV3A 4LV2A 4WL9A 4BBUA 3HJKA 3EQVA 1PNEA 4F94A 4G3KA 2Z2MB 4MCWA 2KX6A 2P04A 1PZPA 2LB5A 3QP2A 3BLMA 3CUEC 5AQ7A 3S22A 5A92A 2ZM2A 1T19A 3SH7A 1M40A 1P9WA 3CWFA 2OV5A 5CECA 2HJEA 4BMWA 1SKOB 2ZL1A 3UPOA 3AGDA 5GLBA 3LUQA 3OCNA 1S1YA 4EUVA 2QJ7A 1XA1A 1XKZA 1YM1A 3IX4A 4QY5A 3M6BA 2XDMA 2JE5A 1HD8A 4DXCA 2IA2A 1K25A 2PU4A 2GJ3A 1EI5A 3BY9A 4CLCD 1NRJA 2VGLM 4KQOA 1DJBA 4LV1A 5IS1A 1ERMA 4EV4A 1G68A 1IYSA 3WS4A 1VHMA 2YKHA 3HCYA 4UQIS 3MQ0A 1NYMA 1LHYA 1XGJA 3FKVA 1NYYA 1VB6A 2V1BA 3B42A 3NI9A 1FCMA 5FSRA 1K0KA 5J3WA 2Y79A 1ERQA 5FAPA 1K55C 5J7EA 4OOLA 2W1RA 3IWOA 1U60A 1MY8A 3W4PA 5FL3A 3IXHA 3VP0A 3RTYA 3WS1A 2B5RA 2CMNA 3ZNTA 3IS2B 2D01A 3DAVA 1LL9A 4R70A 3ISGA 2DNSA 3EEHA 1M6KA 1YLPA 3V3SA 2ZOIA 3RJUA 1FSWA 3EEAA 3MQOA 2J9OA 4N1HA 3MJQA 4D2OA 3NC8A 4KG5A 2Y2NA 2V20A 3MZDA 1NRFA 2DMWA 1LT0A 3KYQA 2WK0A 3L9KA 1RCJA 5CXWA 4FUWA 4DJ2A 3H82A 4I3AA 5FEFA 1IOUA 4PKYA 5I94A 3MFDA 1S6RA 3V3RA 4N1XA 1K57C 1W5DA 3IF6B 3BQ8A 4KQRA 2XH9A 4HJ6A 4OVDA 1W8YA 3GVBA 5E2EA 3CAXA 3IWIA 3VOLA 4DJ3A 2K2NA 4B9OA 3FPWA 3JPUA 1NJ4A 4MBHA 5GLAA 4JGQA 1SKFA 4Y17A 3JVVA 4ZAMA 3DWKA 3KO6A 1X0OA 3IBRA 4Q0JA 1ACFA 2VA0A 4M4XA 5FASA 3PYPA 5E2GA 4DDYA 1CK3A 2QKPA 4O01A 1TDGA 1YPRA 1MBLA 2ZQDA 4ZJ2A 2WKHA 1TS7A 4H6JA 4JXVA 5DF7A 4FH4A 4KZ8A 4LRZE 1VETB 1ZG6A 3ZVTA 1H0MA 3S7QA 2PRFA 4EETB 2WKIA 4KENB 5AVFA 3G2YA 2A3UA 4Y15A 4FH2A 3BFGA 3IF6C 3A0SA 2WGIA 3BRMA 1YLTA 1AWIA 4PMAA 3ZG5A 5HDCA 1I2SA 1HLUP 4MDZA 1IKGA 4IVIA 5FA7A 1LL5A 3KSHA 5TBMB 3S7PA 5M19A 3LEZA 1XJ2A 5AQ9A 3UY6A 5EPHA 3UO9A 3O87A 3C7VA 4S2KA 1S67L 3QP6A 3T1XA 2ZQ9A 4CQHA 1H5XA 3LR4A 5EUAA 4KZ5A 3IXBA 1UWPX 3QHYA 2GDNA 4HI4A 5F1GA 4EESA 1ES2A 2Y2KA 4ESPA 2IWBA 4YINA 3D4FA 3MMHA 1WA9A 4PPRA 1Y28A 2O9BA 2ZLYA 5HL6A 1KVLA 4I3IA 5E43A 1LSXA 3CLOA 4HH3A 2AVXA 2HJ9C 3N8LA 3NHQA 2XA7S 2ZMAA 3T4OA 3QP1A 3U4LP 4C6YA 2XFSA 4S2PA 4GN2A 2VX8A 2ZQCA 4K08A 4ZTKA 3CZDA 1P9RA 1LI0A 4IHQA 2H0TA 5CHUA 1XJ4A 4YNRA 4XUXA 3T4QA 1ES3A 2JKTI 1T1AA 1GSWA 1E25A 2A49A 4QU3A 4E3OA 3QP5A 2OLVA 2W1TA 3DTMA 4KUKA 4E3NA 5EFWA 1PWDA 1E3UA 3MBZA 1WE4A 2Y2JA 4S2MA 2PU2A 5GHZA 1MPLA 1SCWA 1DY6A 1J3WA 4JXGA 3C38A 4DE1A 3LIAA 5DKLA 1L0FA 2G2WA 4II7A 3KYEA 3HUMA 5KSHA 4G3WA 4HP9A 4Q0HA 1SDNA 1YLZA 1GA9A 2HP5A 3ZG9B 3GMWA 4U0XA 3F1NB 3GSGA 2UV0E 3IH8A 2OAQ1 4X55A 4GS9B 5MC7A 4GCZA 4X56A 1SDEA 4PM7A 5FDSA 4XXRA 3LIEA 2HZ5A 1ONHA 3H9WA 5M1AA 2G7UA 1YMXA 2BASA 3F1OB 5EVEA 5IU1A 1PRQA 3SZTA 3MXQA 2GNXA 5L09A 5L10A 4KZAA 3GQZA 2PAVP 4H8RA 4OONA 1LSWA 2QJ5A 1TDLA 1XP4A 2XLNA 1GHMA 5EECA 4CPKA 2ZD8A 3MKEA 3VV4A 3UN7A 3UB7A 2WGWB 4HBTA 1NWZA 1QMEA 4BLMA 2KDKA 2Y91A 3D72A 3UE0A 3P7NA 4RYEA 2Y2PA 5CGWA 2MJ6A 4CLCB 1MWSA 4JGPA 4OQHA 4BD1A 4OPZA 3C7UA 1PI5A 1VEUA 2V2FF 2ZQ7A 2Y2MA 3A3DA 5F83A 3N6IA 3Q7VA 4OOMA 3AGEA 5LBRA 3PBTA 3BECA 3MZEA 4FSFA 2Y2GA 3ZDJA 5F68A 3N8RA 4ZJ1A 4NG2A 2ZC7A 2ZMFA 3UDFA 1W8QA 2VGLS 3HBRA 3HLFA 3UB5P 2Y2LA 3B3XA 1JNUA 1H8ZA 3LEQA 1I2WA 2W3GA 3BQAA 4DE2A 1JWVA 4HNBA 2B18A 3TOIA 3UE6A 3IX8A 4Z1WA 3SS5A 2V1AA 2OSUA 1DP8A 4GJ4A 2XRNA 3U2AA 3E98A 3ZG0A 4HH2A 4HJ4A 5F69A 2R9XA 1RGYA 4S2OA 4CJNA 3BLSA 1TS8A 1ESIA 2KLIA 3MQQA 4L9FA 1BTLA 1D1JA 2XD5A 1MZUA 2Y8HA 2HP6A 4WMCA 5A8BA 2WZXA 4IEDA 3M6HA 1YAXA 5L8MA 3ZHHA 3A0RA 3NIAA 4B93A 3IHAA 4XT2B 1FILA 5EOEA 2XD1A 4S2LA 1J9MA 2V0WA 2KOIA 4HY8A 3UMEA 2OWHA 1KDWA 1YQSA 2HPBA 1CI8A 1SHVA 3G6OA 5HAQA 2P74A 2V1ZA 2VKSA 3HLWA 2Y2IA 2X02A 4M3KA 3T4TA 1VM1A 1ALQA 5BOHA 3W2ZA 2ZM0A 4IUHA 4GKUA 4BWIA 1VQQA 1IYPA 5KSCA 3HLDA 4E6WA 1PIOA 3RXXA 1TEMA 3V50A 4EBLA 3NJAA 1LL8A 1K38A 3FV7A 4KZ4A 3F1PA 3GR2A 1EROA 2PD8A 3UB9A 3O86A 4B4ZA 3WRZA 4YOFA 4NXBA 2H5SA 4K0WA 3K3DA 3NOTC 4GDBA 5HD5A 5DF9A 1ZHHB 1OPXA 4PM9A 5L07A 4E04A 4N9KA 3GECA 5FQJA 3LGOA 5CRFA 3PAEA 4R4RA 2CC1A 4OKPA 4QPRA 4PM5A 2Y4AA 1K56A 4RX3A 2QHKA 3ZVWA 5G4YA 1O7EA 1P97A 2FH5A 4ZJ3A 3S7NA 3BFCA 2XROA 3N8SA 1DP9A 1ES4A 5EM1A 4PHTA 5A93A 5AJGA 4NETA 3R7WA 2PT7A 4LPZA 4BBVA 3BFDA 3WWXA 4Y3IA 3IXDA 3PBNA 1TS6A 2XF3A 5CGXA 3ICYA 2EFXA 4RX2A 2Y2QA 4UA7A 1LLBA 4DKIA 1FIKA 4R38A 3GRJA 4Y7PA 5HFOA 2WZZA 3DBAA 4KG6A 1OTDA 5HWTA 3UMDA 3OBFA 2UWXA 3RFBA 4KZ9A 1S1ZA 5EVIA 2Y55A 4P6BA 5TGFA 1K54A 2IWCA 1TD5A 4OH0A 3SW1A 3O3VA 1I5QA 3OCLA 4WEKA 3C4OA 4GNUA 3DTEA 3BFEA 1S0WA 2J9PA 2WKEA 4JXWA 2O0YA 4EU0A 1BZAA 3A0VA 3FWLA 4I38A 5IT5A 2W0NA 3G34A 1XPBA 3LY4A 2Q9MA 2JC7A 1OTEA 3I7JA 4N92A 2B02A 1CI9A 3CI6A 4BL2A 4WZ5A 1LI9A 4E3MA 4P6ZM 5CEDA 3MF0A 2V8CA 2RCXA 4JF6A 4ARZA 3LY3A 3MSHA 4Z9QA 3UE3A 2E8JA 4PM6A 4OQ0A 3HUOA 3LI9A 4S2JA 3ZYTA 4GW9A 5JYOA 2H10A 4IBRA 4R4SA 3SS3A 3H7WB 1JTDA 2ZOHA 1GSXA 1JWZA 3VOYA 4GHIA 2XFTA 4HJ3A 1OMEA 3NULA 2WYXA 1RGZA 2M7UA 4GB7A 1OT9A 5I5LA 4ME4A 5DTSA 1OJGA 5F1FA 1D7EA 3UPNA 1GCEA 1OJ5A 3CITA 4P0MA 1BT5A 5FI6A 2ZC3B 2EXBA 3A3IA 3CUEA 3VFHA 1NZUA 3BFFA 2A24B 2QPNA 3IT9A 3M2KA 1BULA 1NLYA 5HW3A 2PR5A 4HOIA 3T4KA 3EWKA 3OC2A 3ZCZA 2ACGA 3ZFZA 3A3JA 3LIDA 5DKKA 3GV9A 4OP8A 1ESUA 4E6XA 3HVFA 3FKWA 1JVJA 2VEAA 3CPTA 1T18A 4S2NA 2ZL1B 4R0QA 5AQBA 4F3LA 2JKRM 4MBFA 4EERA 1GHPA 2JKFA 2GZAA 3IH9A 3SH9A 1OT6A 1KVMA 3UDIA 1YKDA 5DTTA 2VV8A 1JTGA 1L0DA 4ETXA 1NY0A 3DTKA 4ZBEA 3KYZA 1KGFA 3C4PA 4K91A 3EGDC 1FSYA 1BLSA 2BLSA 1XX2A 4MN7A 5HARA 3FYZA 3PBRA 2QWSA 4HEFA 4RQ9A 1K55A 2A2LA 5HD3A 5U47A 2WGVA 3LO7A 1SKOA 1H3QA 4I3JA 3VP2A 4WZ4A 4IBXA 2NUPC 2OWJA 4GD6A 5F6AA 5G18A 4I39A 4KZBA 1F5MA 5DFXA 1LSVA 2ZM8A 4G3VA 1XGIA 2ZQAA 4HP4A 4WN5A 1A0KA 1YLWA 4S2IA 1ZTUA 3LCEA 2K31A 1STZA 1HZOA 4NXGA 2PYPA 3WS0A 3G4PA 2XGNA 2HDRA 2WADA 2QMIA 5E2FA 2Y2OA 1YSQA 4BD0A 2ZC4B 2VGKA 4OLDA 3HJIA 4D60A 3P01A 4WMCD 2XR0A 4L9GA 4NKPA 1QMFA 3MS6A 1K57A 4X6TA 3IF5A 2J3TC 3T4LA 5CERA 1XJ6A 3O5YA 4Q0IA 2HV1A 5FQQA 1OTBA 3H82B 5EE8A 1GHIA 1KE4A 1ONGA 5M18A 2V9AA 3P98A 4WYYA 1FQGA 4R3JA 3IS2A 4X1MA 2WKQA 3PBOA 5HWWA 5K5BA 3WRTA 2PDRA 3VSLA 2J7VA 4AFIA 5C5KA 2QYBA 3VP3A 4B88A 2W3EA 3NDGA 3OPPA 4EBNA 1N9OA 3PXPA 3Q81A 5FQ9A 2B95A 2Q0OA 1G6OA 4IJGA 4JKTA 2Z6DA 3CHWP 4BL3A 1BLPA 4JBFA 3BJNA 1PWGA 3TW8A 2FFFB 4UA9A 3IHBA 3IF6A 4MN6A 3LI8A 4DXBA 4H6JB 2J3TD 2P9VA 3AGFA 2RL3A 4EBPA 4EQ1A 4JGOA 5DJUA 4OPRA 5EVIC 4QHCA 1V9ZA 2G2UA 1E4DA 3NOPC 5D3OA 3ITBA 1K54C 3T1SA 1K56D 4FD8A 2FZ0A 3D3OA 3LICA 2LB9A 4PAUA 3ULFA 1BLCA 4MLLA 1MXOA 5E2HA 3FG8A 1GA0A 3LR5A 4I5SA 4K0XA 5EM0A 3QP4A 4DMZA 4Y5FA 3BYDA 1L0EA 4FOFA 2EX8A 2EWWA 2J8YA 4JF5A 4N9LA 1FR6A 4JGRA 3B33A 4EEUA 1RP5A 4RA7A 3NOUC 1OTAA 4U0TA 1KGEA 4DRTA 2VK3A 3CMZA 4X1LA 1XA7A 4OQGA 3VMAA 2HF6A 1PZOA 3C5AA 1TF1A 2DRWA 3HLGA 5CEBA 1VETA 1KDSA 1F98A 1P0ZA 2P08A 1YSPA 4EW7A 3MFXA 4EWFA 1XFQA 2WUQA 1Y54A 4ETZA 4QJGA 3CPTB 1KGGA 3W4QA 3E4QA 5HDDA 1PYYA 1ODVA 4B4XA 1C3BA 3G30A 2XSSA 3FZCA 5EVID 1NXYA 1IYOA 2HP9A 1PW1A 5TBMA 2PBYA 5HZHA 3CG5A 2VZWA 2EX2A 4GDNA 3Q7ZA 1BYWA 2Y59A 3PAGA 4DDSA 3HLCA 3MZFA 2WKRA 3G32A 3R4KA 4HIAA 4DE0A 3SS4A 4WUJA 5KIZA 3WS5A 1DJCA 1K4EA 4KG2A 3TRCA 3BW6A 1ES5A 2EX9A 1BLHA 4E3KA 3G35A 4LGWA 1IFQA 1ZKJA 3UB6A 3TE8A 4QB8A 3JYIA 3E2LA 2BTFP 2W1TB 4NXFA 5FAQA 2M1CA 3FPVA 2DCFA 4KZ3A 3SH8A 4JF4A 3KSFA 3QP8A 3A3FA 3ITAA 1SZVA 2ZC5B 4EUZA 2JN7A 3PBSA 4S2NC 5J4EA 3T12B 1Q2QA 3TJZC 4P6ZS 2EX6A 5KZHA 3DTIA 3A3EA 5FQMA 1MWUA 5DVAA 2PYRA 3D9YA 1CEGA 1BUEA 5HSQA 2O99A 1W7FA 1PW8A 4EEPA 4L0LA 1YMSA 4OP5A 4NK3A 3M2JA 1S4SA 3N4IA 4C75A 5G4ZA 5A90A 2YKFA 1F9IA 2HDSA 2EFUA 2X71A 1DRMA 1TS0A 2HGVA 5FI2A 5HAIA 4E3LA 3GTCA 3UNWA 1HVBA 1PI4A 1XFNA 2VJWA 4LLOB 1YT4A 3T1RA 3L7HA 3MR0A 3OZHA 3Q82A 4X68A 1PWCA 3EOIA 3ZG8B 2H0YA 1Q2PA 2IWDA 1YLJA 3F1NA 4MEZA 4YWZA 4GS9A 1MWTA 4R3BA 3W4OA 4WM9A 2Z2LB 4X25A 2JKTM 3ZNYA 2OOLA 5AQAA 5CX7A 1EWZA 4QWOA 4C3QA 1FOFA 1MC0A 3MKFA 5FQIA 4ZRRA 3F1OA 5HWVA 1VEUB 4FTXA 5CTMA 2Y2HA 5HPFA 1H8YA 1FR1A 4Y0UA 3Q7VB 5FI7A 4GZBA 3Q07A 3N7WA 1N9BA 2VV6A 3T1QB 1FCNA 1MKIA 3IX3A 2P9VB 4KQDA 4MNRA 1G5UA 5F5YA 4HQAA 1W79A 5FEGA 3NY4A 1MWRA 1V9YA 2WGWA 4KZ7A 4OPYA 4KUOA 4RVAA 1E3UD 2E8IA 3JVUA 3MXRA 2PHYA 4CLCA 4WELA 3UB8A 3SOIA 4UQIM 3E2KA 3P09A 3PR6A 2FFYA 5DJTA 5DFYA 4BJPA 1KOUA 1O07A 4WEJA 2JCHA 4UEYA 1Z6FA 3K3CA 3IWQA 1KE3A 2ZQ8A 1Y4OA 1DJAA 4GLQA 1PFLA 3VSKA 3CJMA 4PKYG 2PBDP 3LR3A 1KE0A 4WBGA 1F2KA 1WYCA 2W27A 5HDSA 1OTIA 3W8KA 1G6AA 3VE3A 2Q9NA 1W63M 4LCMA 3TG9A 1N9NA 5HPIA 2Z6CA 4OOYA 2JHEA 4KZ6A 5GHXA 1IELA 3IXGA 3S4XA 4P87A 3ZG7B 3UDXA 4YFMA 5A91A 3HLBA 5JYPA 2M7VA 4X53A 1TVFA 3QNCA 1UGUA 3QNBA 3IBJA 1BSGA 4R3AA 2EXAA 2EWVA 1GSVA 2OAP1 4NXEA 3OLOA 5DF8A 1K6RA 3F1PB 1CQAA 3E4PA 4OPQA 2H28A 3VP1A 4Y13A 4XT2A 1NZOA 5TJJA 3HL9A 4BBTA 4UAAA 4LCLA
chains in the Genus database with same CATH topology
3RXXA 3IF6B 1TEMA 4KQRA 3VFFA 2XH9A 3V50A 4EBLA 1K38A 1W8YA 4OVDA 3GVBA 3FV7A 1K57C 3Q81A 5FQ9A 2OLUA 4KZ4A 3GR2A 3UPPA 3G2ZA 1L2SA 1EROA 4JKTA 4EQIA 5HAPA 5E2EA 2VGJA 4BL3A 3IWIA 3O86A 1BLPA 4QD4A 3WRZA 4B4ZA 5HL1A 4JBFA 2H5SA 3HUNA 1PWGA 4K0WA 2FFFB 3DW0A 5CHMA 1NJ4A 4MBHA 4OLGA 5GLCA 4UA9A 5GLAA 3IHBA 3IF6A 4GDBA 2XQZA 5DF9A 4DXBA 1SKFA 3AGFA 2P9VA 4ZAMA 2RL3A 4PM9A 3DWKA 4EBPA 4N9KA 4MBKA 4OPRA 5EVIC 5FASA 4QHCA 5FQJA 2G2UA 2ZJ9A 5CRFA 1E4DA 3BEBA 5D3OA 3V5MA 3ITBA 1K54C 5TFQA 2X01A 3PAEA 1K56D 4R4RA 4FD8A 5E2GA 4JXSA 2CC1A 3PBQA 4OKPA 4DDYA 1CK3A 4UHUA 4PM5A 1BLCA 1TDGA 2Y4AA 1MBLA 1K56A 4MLLA 1JWPA 2ZQDA 1MXOA 5E2HA 4ZJ2A 2WKHA 3ZGAB 1GA0A 4RX3A 4K0XA 3NDEA 3DWZA 4JXVA 3WS2A 4JLFA 5DF7A 4FH4A 2C5WB 3BYDA 4P85A 4BENA 1L0EA 3ZVWA 2EX8A 1O7EA 4KZ8A 2J8YA 4JF5A 4N9LA 1ZG6A 2XEPA 1FR6A 2WAFA 3ZVTA 4HBUA 4ZJ3A 3BFCA 2ZC6B 2WKIA 3BM6A 1RP5A 3PTEA 4ID4A 4KENB 4XUZA 3G2YA 2A3UA 4LENA 3VP4A 4RA7A 2QZ6A 4FH2A 3BFGA 3N8SA 3IF6C 4HESA 1ES4A 2WGIA 3BRMA 4U0TA 1YLTA 4A5RA 4JPMA 5A93A 1KGEA 4PMAA 4DRTA 4NETA 3CMZA 3ZG5A 5L2FA 2I72A 1L0GA 3BFDA 1I2SA 1XA7A 4OQGA 3VMAA 3WWXA 5F82A 1PZOA 3C5AA 1IKGA 3HLGA 2DRWA 4Q8IA 4IVIA 5FA7A 5GL9A 1LL5A 3IXDA 1K4FA 3PBNA 1KDSA 2XF3A 5CEBA 1YLYA 5M19A 3LEZA 3NCKA 5CGXA 4Y0OA 3MXSA 5AQ9A 3EQUA 5EVIB 3UE1A 2EFXA 3Q1FA 5GHYA 5EPHA 3UY6A 4RX2A 3UO9A 2Y2QA 4EWFA 4LV0A 3O87A 4UA7A 2WUQA 1Y54A 3C7VA 4S2KA 2WAEA 1KGGA 3W4QA 1LLBA 4QJGA 4DKIA 2ZQ9A 3GRJA 1H5XA 1PYYA 3O88A 4Y7PA 5HFOA 4E3IA 5EUAA 4B4XA 4KZ5A 1C3BA 2WZZA 3G30A 5CTNA 4KG6A 3FZCA 3IXBA 5EVID 1NXYA 1IYOA 2BG1A 1PW1A 2HP9A 5FATA 3QHYA 2GDNA 1ZG4A 2UWXA 2JBFA 1N4OA 4KZ9A 2PBYA 5EVIA 5HX9A 2Y55A 5F1GA 1ES2A 3CG5A 2EX2A 4P6BA 4GDNA 3Q7ZA 2Y2KA 5TGFA 1HTZA 1K54A 2IWCA 2Y59A 3PAGA 4OH0A 2HDUA 2IWBA 4YINA 4DDSA 3O3VA 1I5QA 3D4FA 3HLCA 3C4OA 3IQAA 3OCLA 4WEKA 5DTKA 3MZFA 4GNUA 3G32A 4DE0A 3BFEA 3NBLA 3V39A 3SS4A 4DF6A 4ZDXA 1S0WA 2J9PA 4PPRA 3G31A 4GD8A 4QY6A 3WS5A 2ZLYA 1DJCA 1K4EA 4O7DA 1AXBA 2WKEA 4KG2A 1ES5A 4JXWA 2EX9A 1KVLA 5KMWA 5E43A 1BLHA 4E3KA 3G35A 5FQKA 4KQQA 1ZKJA 1BZAA 4QB8A 4UA6A 3FWLA 3JYIA 3N8LA 5GLDA 3G34A 3E2LA 3VOZA 4R23A 1IEMA 1XPBA 2ZMAA 3LY4A 2Q9MA 5FAQA 2JC7A 4X69A 4OQIA 4C6YA 4KZ3A 2DCFA 2XFSA 3I7JA 4JF4A 4N92A 5EVLA 4S2PA 3SH8A 1WYBA 4GN2A 4R1GA 1CI9A 2ZQCA 4ZTKA 3CZDA 4BL2A 1K6SA 4WZ5A 1LI0A 3HREA 1LI9A 2HDQA 2H0TA 3A3FA 3ITAA 5CHUA 2ZC5B 1ZC2A 4E3MA 5CEDA 4EUZA 4XUXA 2RCXA 3OPLA 4JF6A 3LY3A 1ES3A 4Z9QA 3UE3A 3PBSA 4S2NC 1E25A 2A49A 4QU3A 1Q2QA 4E3OA 2OLVA 3HLEA 2EX6A 1FCOA 4PM6A 5KZHA 3DTMA 4E3NA 4OQ0A 5FDHA 3HUOA 4S2JA 3A3EA 5FQMA 1PWDA 1MWUA 5JYOA 1E3UA 5DVAA 2H10A 4IBRA 3MBZA 1WE4A 4R4SA 3SS3A 2Y2JA 4S2MA 2PU2A 5GHZA 1MPLA 5J8XA 1CEGA 1BUEA 1JTDA 1SCWA 1DY6A 5FAOA 1JWZA 3VOYA 3S1YA 5CGSA 2XFTA 1IKIA 4JXGA 5TR7A 5CHJA 1OMEA 1W7FA 3OPHA 1PW8A 2WYXA 1RGZA 4DE1A 4L0LA 2R9WA 1YMSA 4OP5A 4GB7A 4NK3A 3M2JA 1CEFA 1L0FA 2G2WA 3N4IA 4C75A 1XXMA 5DTSA 3HUMA 5A90A 5F1FA 5KSHA 2HDSA 5EOOA 3UPNA 1SDNA 1GCEA 2EFUA 1YLZA 1GA9A 4WZ5C 4P0MA 2HP5A 3ZG9B 2X71A 1BT5A 3GMWA 5FI6A 4GOGA 4U0XA 2ZC3B 3TSGA 4DE3A 2EXBA 3A3IA 3GSGA 1NZUA 3VFHA 3BFFA 4E3JA 3IH8A 4X55A 5FI2A 4E3LA 5HAIA 2QPNA 3IT9A 4X56A 3GTCA 3M2KA 1BULA 1SDEA 3UNWA 4PM7A 1HVBA 1PI4A 1YT4A 5IHVA 2C6WB 3OZHA 3Q82A 4X68A 4Y0TA 3RXWA 5HW3A 2XK1A 4XXRA 1ONHA 1PWCA 4BQMA 5M1AA 4FCFA 3OC2A 3OPRA 3ZG8B 3ZCZA 2H0YA 1Q2PA 1YMXA 3ZFZA 4IVKA 2IWDA 1YLJA 3A3JA 4PM8A 4U3TA 4MEZA 1IYQA 3GV9A 4LV3A 1MWTA 4LV2A 1ESUA 4OP8A 4R3BA 4E6XA 3W4OA 4KZAA 3HVFA 3FKWA 1JVJA 3EQVA 3GQZA 4WM9A 2Z2LB 4H8RA 4S2NA 4R0QA 3ZNYA 4F94A 5AQAA 1EWZA 4C3QA 2Z2MB 4OONA 5AQBA 1FOFA 1PZPA 4MBFA 1TDLA 1XP4A 3MKFA 5FQIA 3BLMA 1GHPA 1GHMA 2XLNA 5EECA 4CPKA 3IH9A 2ZD8A 3MKEA 5CTMA 5AQ7A 3UN7A 2Y2HA 3S22A 3SH9A 5A92A 1H8YA 2WGWB 4HBTA 2ZM2A 3SH7A 1FR1A 1M40A 4Y0UA 3Q7VB 1QMEA 1KVMA 3UDIA 5FI7A 4GZBA 3Q07A 2OV5A 3N7WA 4BLMA 5CECA 5DTTA 1N9BA 2Y91A 3UE0A 4RYEA 2Y2PA 5CGWA 1FCNA 3UPOA 1JTGA 1MKIA 1MWSA 1L0DA 3AGDA 5GLBA 3OCNA 1NY0A 2P9VB 4OQHA 4MNRA 4BD1A 1W79A 1XA1A 4ZBEA 1XKZA 3NY4A 1KGFA 1YM1A 3C4PA 1MWRA 4K91A 4OPZA 4QY5A 3C7UA 1PI5A 3M6BA 1FSYA 2JE5A 2V2FF 2XDMA 2Y2MA 2ZQ7A 1BLSA 2BLSA 1HD8A 2WGWA 4DXCA 1XX2A 3A3DA 5F83A 1K25A 3N6IA 4KZ7A 5HARA 2PU4A 3FYZA 3PBRA 3Q7VA 4HEFA 1EI5A 4OOMA 3AGEA 4OPYA 4RVAA 3PBTA 1K55A 3BECA 1E3UD 3MZEA 2E8IA 2WGVA 5U47A 4FSFA 2Y2GA 3LO7A 3MXRA 3ZDJA 4KQOA 3N8RA 4ZJ1A 4WELA 3VP2A 2ZC7A 4WZ4A 3SOIA 3E2KA 1DJBA 4IBXA 1W8QA 3P09A 4LV1A 3UDFA 2FFYA 1ERMA 4EV4A 3HBRA 4GD6A 1G68A 3HLFA 4BJPA 1IYSA 2Y2LA 5G18A 3WS4A 4KZBA 3B3XA 1H8ZA 1O07A 4WEJA 2JCHA 1I2WA 4DE2A 1NYMA 1Z6FA 2ZM8A 1LHYA 3IWQA 1KE3A 1JWVA 1XGJA 2ZQ8A 1XGIA 1DJAA 3TOIA 2ZQAA 3FKVA 1NYYA 3VSKA 3CJMA 1YLWA 4S2IA 3LCEA 1HZOA 3SS5A 2OSUA 3NI9A 3WS0A 3G4PA 2XGNA 2HDRA 1FCMA 3ZG0A 2WADA 2QMIA 5FSRA 5E2FA 1KE0A 2Y2OA 2R9XA 4WBGA 1RGYA 4S2OA 1WYCA 4CJNA 1ERQA 3BLSA 5FAPA 4BD0A 3W8KA 2ZC4B 1G6AA 1K55C 2VGKA 4OLDA 4OOLA 1ESIA 3IWOA 2Q9NA 4LCMA 1BTLA 1U60A 1MY8A 2XR0A 4WMCD 2XD5A 3TG9A 3W4PA 2HP6A 3IXHA 3VP0A 1QMFA 4OOYA 1K57A 4KZ6A 5GHXA 1IELA 3WS1A 4WMCA 2B5RA 4X6TA 3IXGA 3IF5A 3S4XA 4P87A 3ZNTA 3ZG7B 2WZXA 4IEDA 3UDXA 1LL9A 5CERA 3M6HA 4YFMA 5A91A 3ISGA 3HLBA 3ZHHA 5JYPA 2DNSA 3NIAA 1M6KA 1YLPA 4X53A 3IHAA 3V3SA 5FQQA 1TVFA 3QNCA 5EE8A 1GHIA 1KE4A 3QNBA 5EOEA 2XD1A 3RJUA 1BSGA 1FSWA 4S2LA 1J9MA 1ONGA 5M18A 2J9OA 1KDWA 2EXAA 1YQSA 4N1HA 2HPBA 3P98A 1CI8A 3NC8A 1SHVA 4KG5A 4D2OA 4WYYA 2Y2NA 2V20A 5HAQA 1FQGA 4R3JA 2V1ZA 2P74A 3HLWA 2Y2IA 5DF8A 3PBOA 1K6RA 2X02A 3MZDA 1NRFA 4M3KA 1VM1A 1ALQA 3WRTA 4OPQA 5BOHA 2WK0A 2ZM0A 3VSLA 1RCJA 2J7VA 5CXWA 3VP1A 4GKUA 1VQQA 1IYPA 1NZOA 3VP3A 5KSCA 3HL9A 4B88A 5I94A 3HLDA 3NDGA 3MFDA 4UAAA 1S6RA 3V3RA 4N1XA 3OPPA 4E6WA 4EBNA 1PIOA 4LCLA 1W5DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RXX A;  3IF6 B;  1TEM A;  4KQR A;  3VFF A;  2XH9 A;  3V50 A;  4EBL A;  1K38 A;  1W8Y A;  4OVD A;  3GVB A;  3FV7 A;  1K57 C;  3Q81 A;  5FQ9 A;  2OLU A;  4KZ4 A;  3GR2 A;  3UPP A;  3G2Z A;  1L2S A;  1ERO A;  4JKT A;  4EQI A;  5HAP A;  5E2E A;  2VGJ A;  4BL3 A;  3IWI A;  3O86 A;  1BLP A;  4QD4 A;  3WRZ A;  4B4Z A;  5HL1 A;  4JBF A;  2H5S A;  3HUN A;  1PWG A;  4K0W A;  2FFF B;  3DW0 A;  5CHM A;  1NJ4 A;  4MBH A;  4OLG A;  5GLC A;  4UA9 A;  5GLA A;  3IHB A;  3IF6 A;  4GDB A;  2XQZ A;  5DF9 A;  4DXB A;  1SKF A;  3AGF A;  2P9V A;  4ZAM A;  2RL3 A;  4PM9 A;  3DWK A;  4EBP A;  4N9K A;  4MBK A;  4OPR A;  5EVI C;  5FAS A;  4QHC A;  5FQJ A;  2G2U A;  2ZJ9 A;  5CRF A;  1E4D A;  3BEB A;  5D3O A;  3V5M A;  3ITB A;  1K54 C;  5TFQ A;  2X01 A;  3PAE A;  1K56 D;  4R4R A;  4FD8 A;  5E2G A;  4JXS A;  2CC1 A;  3PBQ A;  4OKP A;  4DDY A;  1CK3 A;  4UHU A;  4PM5 A;  1BLC A;  1TDG A;  2Y4A A;  1MBL A;  1K56 A;  4MLL A;  1JWP A;  2ZQD A;  1MXO A;  5E2H A;  4ZJ2 A;  2WKH A;  3ZGA B;  1GA0 A;  4RX3 A;  4K0X A;  3NDE A;  3DWZ A;  4JXV A;  3WS2 A;  4JLF A;  5DF7 A;  4FH4 A;  2C5W B;  3BYD A;  4P85 A;  4BEN A;  1L0E A;  3ZVW A;  2EX8 A;  1O7E A;  4KZ8 A;  2J8Y A;  4JF5 A;  4N9L A;  1ZG6 A;  2XEP A;  1FR6 A;  2WAF A;  3ZVT A;  4HBU A;  4ZJ3 A;  3BFC A;  2ZC6 B;  2WKI A;  3BM6 A;  1RP5 A;  3PTE A;  4ID4 A;  4KEN B;  4XUZ A;  3G2Y A;  2A3U A;  4LEN A;  3VP4 A;  4RA7 A;  2QZ6 A;  4FH2 A;  3BFG A;  3N8S A;  3IF6 C;  4HES A;  1ES4 A;  2WGI A;  3BRM A;  4U0T A;  1YLT A;  4A5R A;  4JPM A;  5A93 A;  1KGE A;  4PMA A;  4DRT A;  4NET A;  3CMZ A;  3ZG5 A;  5L2F A;  2I72 A;  1L0G A;  3BFD A;  1I2S A;  1XA7 A;  4OQG A;  3VMA A;  3WWX A;  5F82 A;  1PZO A;  3C5A A;  1IKG A;  3HLG A;  2DRW A;  4Q8I A;  4IVI A;  5FA7 A;  5GL9 A;  1LL5 A;  3IXD A;  1K4F A;  3PBN A;  1KDS A;  2XF3 A;  5CEB A;  1YLY A;  5M19 A;  3LEZ A;  3NCK A;  5CGX A;  4Y0O A;  3MXS A;  5AQ9 A;  3EQU A;  5EVI B;  3UE1 A;  2EFX A;  3Q1F A;  5GHY A;  5EPH A;  3UY6 A;  4RX2 A;  3UO9 A;  2Y2Q A;  4EWF A;  4LV0 A;  3O87 A;  4UA7 A;  2WUQ A;  1Y54 A;  3C7V A;  4S2K A;  2WAE A;  1KGG A;  3W4Q A;  1LLB A;  4QJG A;  4DKI A;  2ZQ9 A;  3GRJ A;  1H5X A;  1PYY A;  3O88 A;  4Y7P A;  5HFO A;  4E3I A;  5EUA A;  4B4X A;  4KZ5 A;  1C3B A;  2WZZ A;  3G30 A;  5CTN A;  4KG6 A;  3FZC A;  3IXB A;  5EVI D;  1NXY A;  1IYO A;  2BG1 A;  1PW1 A;  2HP9 A;  5FAT A;  3QHY A;  2GDN A;  1ZG4 A;  2UWX A;  2JBF A;  1N4O A;  4KZ9 A;  2PBY A;  5EVI A;  5HX9 A;  2Y55 A;  5F1G A;  1ES2 A;  3CG5 A;  2EX2 A;  4P6B A;  4GDN A;  3Q7Z A;  2Y2K A;  5TGF A;  1HTZ A;  1K54 A;  2IWC A;  2Y59 A;  3PAG A;  4OH0 A;  2HDU A;  2IWB A;  4YIN A;  4DDS A;  3O3V A;  1I5Q A;  3D4F A;  3HLC A;  3C4O A;  3IQA A;  3OCL A;  4WEK A;  5DTK A;  3MZF A;  4GNU A;  3G32 A;  4DE0 A;  3BFE A;  3NBL A;  3V39 A;  3SS4 A;  4DF6 A;  4ZDX A;  1S0W A;  2J9P A;  4PPR A;  3G31 A;  4GD8 A;  4QY6 A;  3WS5 A;  2ZLY A;  1DJC A;  1K4E A;  4O7D A;  1AXB A;  2WKE A;  4KG2 A;  1ES5 A;  4JXW A;  2EX9 A;  1KVL A;  5KMW A;  5E43 A;  1BLH A;  4E3K A;  3G35 A;  5FQK A;  4KQQ A;  1ZKJ A;  1BZA A;  4QB8 A;  4UA6 A;  3FWL A;  3JYI A;  3N8L A;  5GLD A;  3G34 A;  3E2L A;  3VOZ A;  4R23 A;  1IEM A;  1XPB A;  2ZMA A;  3LY4 A;  2Q9M A;  5FAQ A;  2JC7 A;  4X69 A;  4OQI A;  4C6Y A;  4KZ3 A;  2DCF A;  2XFS A;  3I7J A;  4JF4 A;  4N92 A;  5EVL A;  4S2P A;  3SH8 A;  1WYB A;  4GN2 A;  4R1G A;  1CI9 A;  2ZQC A;  4ZTK A;  3CZD A;  4BL2 A;  1K6S A;  4WZ5 A;  1LI0 A;  3HRE A;  1LI9 A;  2HDQ A;  2H0T A;  3A3F A;  3ITA A;  5CHU A;  2ZC5 B;  1ZC2 A;  4E3M A;  5CED A;  4EUZ A;  4XUX A;  2RCX A;  3OPL A;  4JF6 A;  3LY3 A;  1ES3 A;  4Z9Q A;  3UE3 A;  3PBS A;  4S2N C;  1E25 A;  2A49 A;  4QU3 A;  1Q2Q A;  4E3O A;  2OLV A;  3HLE A;  2EX6 A;  1FCO A;  4PM6 A;  5KZH A;  3DTM A;  4E3N A;  4OQ0 A;  5FDH A;  3HUO A;  4S2J A;  3A3E A;  5FQM A;  1PWD A;  1MWU A;  5JYO A;  1E3U A;  5DVA A;  2H10 A;  4IBR A;  3MBZ A;  1WE4 A;  4R4S A;  3SS3 A;  2Y2J A;  4S2M A;  2PU2 A;  5GHZ A;  1MPL A;  5J8X A;  1CEG A;  1BUE A;  1JTD A;  1SCW A;  1DY6 A;  5FAO A;  1JWZ A;  3VOY A;  3S1Y A;  5CGS A;  2XFT A;  1IKI A;  4JXG A;  5TR7 A;  5CHJ A;  1OME A;  1W7F A;  3OPH A;  1PW8 A;  2WYX A;  1RGZ A;  4DE1 A;  4L0L A;  2R9W A;  1YMS A;  4OP5 A;  4GB7 A;  4NK3 A;  3M2J A;  1CEF A;  1L0F A;  2G2W A;  3N4I A;  4C75 A;  1XXM A;  5DTS A;  3HUM A;  5A90 A;  5F1F A;  5KSH A;  2HDS A;  5EOO A;  3UPN A;  1SDN A;  1GCE A;  2EFU A;  1YLZ A;  1GA9 A;  4WZ5 C;  4P0M A;  2HP5 A;  3ZG9 B;  2X71 A;  1BT5 A;  3GMW A;  5FI6 A;  4GOG A;  4U0X A;  2ZC3 B;  3TSG A;  4DE3 A;  2EXB A;  3A3I A;  3GSG A;  1NZU A;  3VFH A;  3BFF A;  4E3J A;  3IH8 A;  4X55 A;  5FI2 A;  4E3L A;  5HAI A;  2QPN A;  3IT9 A;  4X56 A;  3GTC A;  3M2K A;  1BUL A;  1SDE A;  3UNW A;  4PM7 A;  1HVB A;  1PI4 A;  1YT4 A;  5IHV A;  2C6W B;  3OZH A;  3Q82 A;  4X68 A;  4Y0T A;  3RXW A;  5HW3 A;  2XK1 A;  4XXR A;  1ONH A;  1PWC A;  4BQM A;  5M1A A;  4FCF A;  3OC2 A;  3OPR A;  3ZG8 B;  3ZCZ A;  2H0Y A;  1Q2P A;  1YMX A;  3ZFZ A;  4IVK A;  2IWD A;  1YLJ A;  3A3J A;  4PM8 A;  4U3T A;  4MEZ A;  1IYQ A;  3GV9 A;  4LV3 A;  1MWT A;  4LV2 A;  1ESU A;  4OP8 A;  4R3B A;  4E6X A;  3W4O A;  4KZA A;  3HVF A;  3FKW A;  1JVJ A;  3EQV A;  3GQZ A;  4WM9 A;  2Z2L B;  4H8R A;  4S2N A;  4R0Q A;  3ZNY A;  4F94 A;  5AQA A;  1EWZ A;  4C3Q A;  2Z2M B;  4OON A;  5AQB A;  1FOF A;  1PZP A;  4MBF A;  1TDL A;  1XP4 A;  3MKF A;  5FQI A;  3BLM A;  1GHP A;  1GHM A;  2XLN A;  5EEC A;  4CPK A;  3IH9 A;  2ZD8 A;  3MKE A;  5CTM A;  5AQ7 A;  3UN7 A;  2Y2H A;  3S22 A;  3SH9 A;  5A92 A;  1H8Y A;  2WGW B;  4HBT A;  2ZM2 A;  3SH7 A;  1FR1 A;  1M40 A;  4Y0U A;  3Q7V B;  1QME A;  1KVM A;  3UDI A;  5FI7 A;  4GZB A;  3Q07 A;  2OV5 A;  3N7W A;  4BLM A;  5CEC A;  5DTT A;  1N9B A;  2Y91 A;  3UE0 A;  4RYE A;  2Y2P A;  5CGW A;  1FCN A;  3UPO A;  1JTG A;  1MKI A;  1MWS A;  1L0D A;  3AGD A;  5GLB A;  3OCN A;  1NY0 A;  2P9V B;  4OQH A;  4MNR A;  4BD1 A;  1W79 A;  1XA1 A;  4ZBE A;  1XKZ A;  3NY4 A;  1KGF A;  1YM1 A;  3C4P A;  1MWR A;  4K91 A;  4OPZ A;  4QY5 A;  3C7U A;  1PI5 A;  3M6B A;  1FSY A;  2JE5 A;  2V2F F;  2XDM A;  2Y2M A;  2ZQ7 A;  1BLS A;  2BLS A;  1HD8 A;  2WGW A;  4DXC A;  1XX2 A;  3A3D A;  5F83 A;  1K25 A;  3N6I A;  4KZ7 A;  5HAR A;  2PU4 A;  3FYZ A;  3PBR A;  3Q7V A;  4HEF A;  1EI5 A;  4OOM A;  3AGE A;  4OPY A;  4RVA A;  3PBT A;  1K55 A;  3BEC A;  1E3U D;  3MZE A;  2E8I A;  2WGV A;  5U47 A;  4FSF A;  2Y2G A;  3LO7 A;  3MXR A;  3ZDJ A;  4KQO A;  3N8R A;  4ZJ1 A;  4WEL A;  3VP2 A;  2ZC7 A;  4WZ4 A;  3SOI A;  3E2K A;  1DJB A;  4IBX A;  1W8Q A;  3P09 A;  4LV1 A;  3UDF A;  2FFY A;  1ERM A;  4EV4 A;  3HBR A;  4GD6 A;  1G68 A;  3HLF A;  4BJP A;  1IYS A;  2Y2L A;  5G18 A;  3WS4 A;  4KZB A;  3B3X A;  1H8Z A;  1O07 A;  4WEJ A;  2JCH A;  1I2W A;  4DE2 A;  1NYM A;  1Z6F A;  2ZM8 A;  1LHY A;  3IWQ A;  1KE3 A;  1JWV A;  1XGJ A;  2ZQ8 A;  1XGI A;  1DJA A;  3TOI A;  2ZQA A;  3FKV A;  1NYY A;  3VSK A;  3CJM A;  1YLW A;  4S2I A;  3LCE A;  1HZO A;  3SS5 A;  2OSU A;  3NI9 A;  3WS0 A;  3G4P A;  2XGN A;  2HDR A;  1FCM A;  3ZG0 A;  2WAD A;  2QMI A;  5FSR A;  5E2F A;  1KE0 A;  2Y2O A;  2R9X A;  4WBG A;  1RGY A;  4S2O A;  1WYC A;  4CJN A;  1ERQ A;  3BLS A;  5FAP A;  4BD0 A;  3W8K A;  2ZC4 B;  1G6A A;  1K55 C;  2VGK A;  4OLD A;  4OOL A;  1ESI A;  3IWO A;  2Q9N A;  4LCM A;  1BTL A;  1U60 A;  1MY8 A;  2XR0 A;  4WMC D;  2XD5 A;  3TG9 A;  3W4P A;  2HP6 A;  3IXH A;  3VP0 A;  1QMF A;  4OOY A;  1K57 A;  4KZ6 A;  5GHX A;  1IEL A;  3WS1 A;  4WMC A;  2B5R A;  4X6T A;  3IXG A;  3IF5 A;  3S4X A;  4P87 A;  3ZNT A;  3ZG7 B;  2WZX A;  4IED A;  3UDX A;  1LL9 A;  5CER A;  3M6H A;  4YFM A;  5A91 A;  3ISG A;  3HLB A;  3ZHH A;  5JYP A;  2DNS A;  3NIA A;  1M6K A;  1YLP A;  4X53 A;  3IHA A;  3V3S A;  5FQQ A;  1TVF A;  3QNC A;  5EE8 A;  1GHI A;  1KE4 A;  3QNB A;  5EOE A;  2XD1 A;  3RJU A;  1BSG A;  1FSW A;  4S2L A;  1J9M A;  1ONG A;  5M18 A;  2J9O A;  1KDW A;  2EXA A;  1YQS A;  4N1H A;  2HPB A;  3P98 A;  1CI8 A;  3NC8 A;  1SHV A;  4KG5 A;  4D2O A;  4WYY A;  2Y2N A;  2V20 A;  5HAQ A;  1FQG A;  4R3J A;  2V1Z A;  2P74 A;  3HLW A;  2Y2I A;  5DF8 A;  3PBO A;  1K6R A;  2X02 A;  3MZD A;  1NRF A;  4M3K A;  1VM1 A;  1ALQ A;  3WRT A;  4OPQ A;  5BOH A;  2WK0 A;  2ZM0 A;  3VSL A;  1RCJ A;  2J7V A;  5CXW A;  3VP1 A;  4GKU A;  1VQQ A;  1IYP A;  1NZO A;  3VP3 A;  5KSC A;  3HL9 A;  4B88 A;  5I94 A;  3HLD A;  3NDG A;  3MFD A;  4UAA A;  1S6R A;  3V3R A;  4N1X A;  3OPP A;  4E6W A;  4EBN A;  1PIO A;  4LCL A;  1W5D A; 
#chains in the Genus database with same CATH topology
 3VFF A;  2WKP A;  2JKG A;  3B47 A;  2OLU A;  2J3W A;  4DN0 A;  3K2N A;  1D06 A;  3UPP A;  3G2Z A;  1L2S A;  4EQI A;  5HAP A;  2VGJ A;  4QD4 A;  5HL1 A;  3KX0 X;  3HUN A;  1G28 A;  3DW0 A;  5CHM A;  5GLC A;  4OLG A;  3E0Y A;  2XQZ A;  4LFU A;  1Z09 A;  3GDI A;  2R78 A;  3PHY A;  4MBK A;  4WF0 A;  3BY8 A;  2ZJ9 A;  3BEB A;  3V5M A;  5TFQ A;  2X01 A;  4R6L A;  4JXS A;  3PBQ A;  1XJ3 A;  4UHU A;  2NUT C;  1JWP A;  3ZGA B;  3FC7 A;  3R7W B;  3WS2 A;  3NDE A;  3DWZ A;  4JLF A;  3T4J A;  2C5W B;  4BEN A;  4P85 A;  3LIF A;  3LR0 A;  2XEP A;  2WAF A;  4MN5 A;  4HBU A;  2ZC6 B;  3BM6 A;  3PTE A;  4ID4 A;  4XUZ A;  3VP4 A;  4LEN A;  2QZ6 A;  3OOV A;  4HES A;  2GX5 A;  4EXO A;  4HHD A;  4A5R A;  4JPM A;  1W63 Q;  5L2F A;  2I72 A;  1L0G A;  4O0P A;  5F82 A;  4Q8I A;  5GL9 A;  1K4F A;  1CJF A;  1YLY A;  1CF0 A;  3NCK A;  4Y0O A;  3MXS A;  3EQU A;  5EVI B;  3UE1 A;  4LRY C;  3Q1F A;  5GHY A;  2INW A;  4LV0 A;  2WAE A;  3EGX C;  3E4O A;  3O88 A;  4E3I A;  5CTN A;  2BG1 A;  2O9C A;  5FAT A;  1ZG4 A;  3BWL A;  3NEC A;  2JBF A;  1N4O A;  5HX9 A;  2VV7 A;  5AVE A;  1HTZ A;  1N9L A;  1T1C A;  2PD7 A;  2HDU A;  1L3L A;  3IQA A;  1S66 L;  3C2W A;  5DTK A;  2V0U A;  2EA9 A;  1S4R A;  3NBL A;  3V39 A;  4ZDX A;  4DF6 A;  2O9A A;  3G31 A;  4GD8 A;  4QY6 A;  4CLC E;  4O7D A;  1AXB A;  3V67 A;  3LYX A;  5KMW A;  2XA7 M;  3T50 A;  2W3H A;  5FQK A;  4KQQ A;  4ARZ B;  4NEE D;  4UA6 A;  5GLD A;  3LIB A;  3VOZ A;  1MKM A;  4R23 A;  2W3D A;  2P7J A;  1IEM A;  1UWN X;  4X69 A;  4OQI A;  2I9V A;  3S7O A;  5EVL A;  1WYB A;  2K7S A;  4R1G A;  2D02 A;  1K6S A;  4WLA A;  3HRE A;  4Y2F A;  2HDQ A;  1EW0 A;  4GHI B;  1ZC2 A;  4L9E A;  3OPL A;  4IUK A;  4O8G A;  3HLE A;  2JKR I;  1FCO A;  2J80 A;  5FDH A;  3C8C A;  3RH8 B;  2L4R A;  3T4S A;  2L0W A;  3C30 A;  1DP6 A;  5J8X A;  2VLG A;  2ZBB A;  5FAO A;  3KSG A;  3S1Y A;  5CGS A;  1IKI A;  2PR6 A;  5TR7 A;  5CHJ A;  5EV0 A;  1NLZ A;  3OPH A;  2R9W A;  1CEF A;  1XXM A;  1H8M A;  2ZMV A;  3H7W A;  5EOO A;  3VE4 A;  4WZ5 C;  4MMN A;  4GOG A;  3TSG A;  4DE3 A;  4E3J A;  3ZQ5 A;  1T1B A;  2L1M A;  3KSI A;  4CLC C;  5IHV A;  2C6W B;  4Y0T A;  3RXW A;  2XK1 A;  2W3F A;  3LFV A;  4F3L B;  4BQM A;  4FCF A;  4LRX C;  3OPR A;  4IVK A;  4PM8 A;  2V8F A;  4U3T A;  2A24 A;  1IYQ A;  4LV3 A;  4LV2 A;  4WL9 A;  4BBU A;  3HJK A;  3EQV A;  1PNE A;  4F94 A;  4G3K A;  2Z2M B;  4MCW A;  2KX6 A;  2P04 A;  1PZP A;  2LB5 A;  3QP2 A;  3BLM A;  3CUE C;  5AQ7 A;  3S22 A;  5A92 A;  2ZM2 A;  1T19 A;  3SH7 A;  1M40 A;  1P9W A;  3CWF A;  2OV5 A;  5CEC A;  2HJE A;  4BMW A;  1SKO B;  2ZL1 A;  3UPO A;  3AGD A;  5GLB A;  3LUQ A;  3OCN A;  1S1Y A;  4EUV A;  2QJ7 A;  1XA1 A;  1XKZ A;  1YM1 A;  3IX4 A;  4QY5 A;  3M6B A;  2XDM A;  2JE5 A;  1HD8 A;  4DXC A;  2IA2 A;  1K25 A;  2PU4 A;  2GJ3 A;  1EI5 A;  3BY9 A;  4CLC D;  1NRJ A;  2VGL M;  4KQO A;  1DJB A;  4LV1 A;  5IS1 A;  1ERM A;  4EV4 A;  1G68 A;  1IYS A;  3WS4 A;  1VHM A;  2YKH A;  3HCY A;  4UQI S;  3MQ0 A;  1NYM A;  1LHY A;  1XGJ A;  3FKV A;  1NYY A;  1VB6 A;  2V1B A;  3B42 A;  3NI9 A;  1FCM A;  5FSR A;  1K0K A;  5J3W A;  2Y79 A;  1ERQ A;  5FAP A;  1K55 C;  5J7E A;  4OOL A;  2W1R A;  3IWO A;  1U60 A;  1MY8 A;  3W4P A;  5FL3 A;  3IXH A;  3VP0 A;  3RTY A;  3WS1 A;  2B5R A;  2CMN A;  3ZNT A;  3IS2 B;  2D01 A;  3DAV A;  1LL9 A;  4R70 A;  3ISG A;  2DNS A;  3EEH A;  1M6K A;  1YLP A;  3V3S A;  2ZOI A;  3RJU A;  1FSW A;  3EEA A;  3MQO A;  2J9O A;  4N1H A;  3MJQ A;  4D2O A;  3NC8 A;  4KG5 A;  2Y2N A;  2V20 A;  3MZD A;  1NRF A;  2DMW A;  1LT0 A;  3KYQ A;  2WK0 A;  3L9K A;  1RCJ A;  5CXW A;  4FUW A;  4DJ2 A;  3H82 A;  4I3A A;  5FEF A;  1IOU A;  4PKY A;  5I94 A;  3MFD A;  1S6R A;  3V3R A;  4N1X A;  1K57 C;  1W5D A;  3IF6 B;  3BQ8 A;  4KQR A;  2XH9 A;  4HJ6 A;  4OVD A;  1W8Y A;  3GVB A;  5E2E A;  3CAX A;  3IWI A;  3VOL A;  4DJ3 A;  2K2N A;  4B9O A;  3FPW A;  3JPU A;  1NJ4 A;  4MBH A;  5GLA A;  4JGQ A;  1SKF A;  4Y17 A;  3JVV A;  4ZAM A;  3DWK A;  3KO6 A;  1X0O A;  3IBR A;  4Q0J A;  1ACF A;  2VA0 A;  4M4X A;  5FAS A;  3PYP A;  5E2G A;  4DDY A;  1CK3 A;  2QKP A;  4O01 A;  1TDG A;  1YPR A;  1MBL A;  2ZQD A;  4ZJ2 A;  2WKH A;  1TS7 A;  4H6J A;  4JXV A;  5DF7 A;  4FH4 A;  4KZ8 A;  4LRZ E;  1VET B;  1ZG6 A;  3ZVT A;  1H0M A;  3S7Q A;  2PRF A;  4EET B;  2WKI A;  4KEN B;  5AVF A;  3G2Y A;  2A3U A;  4Y15 A;  4FH2 A;  3BFG A;  3IF6 C;  3A0S A;  2WGI A;  3BRM A;  1YLT A;  1AWI A;  4PMA A;  3ZG5 A;  5HDC A;  1I2S A;  1HLU P;  4MDZ A;  1IKG A;  4IVI A;  5FA7 A;  1LL5 A;  3KSH A;  5TBM B;  3S7P A;  5M19 A;  3LEZ A;  1XJ2 A;  5AQ9 A;  3UY6 A;  5EPH A;  3UO9 A;  3O87 A;  3C7V A;  4S2K A;  1S67 L;  3QP6 A;  3T1X A;  2ZQ9 A;  4CQH A;  1H5X A;  3LR4 A;  5EUA A;  4KZ5 A;  3IXB A;  1UWP X;  3QHY A;  2GDN A;  4HI4 A;  5F1G A;  4EES A;  1ES2 A;  2Y2K A;  4ESP A;  2IWB A;  4YIN A;  3D4F A;  3MMH A;  1WA9 A;  4PPR A;  1Y28 A;  2O9B A;  2ZLY A;  5HL6 A;  1KVL A;  4I3I A;  5E43 A;  1LSX A;  3CLO A;  4HH3 A;  2AVX A;  2HJ9 C;  3N8L A;  3NHQ A;  2XA7 S;  2ZMA A;  3T4O A;  3QP1 A;  3U4L P;  4C6Y A;  2XFS A;  4S2P A;  4GN2 A;  2VX8 A;  2ZQC A;  4K08 A;  4ZTK A;  3CZD A;  1P9R A;  1LI0 A;  4IHQ A;  2H0T A;  5CHU A;  1XJ4 A;  4YNR A;  4XUX A;  3T4Q A;  1ES3 A;  2JKT I;  1T1A A;  1GSW A;  1E25 A;  2A49 A;  4QU3 A;  4E3O A;  3QP5 A;  2OLV A;  2W1T A;  3DTM A;  4KUK A;  4E3N A;  5EFW A;  1PWD A;  1E3U A;  3MBZ A;  1WE4 A;  2Y2J A;  4S2M A;  2PU2 A;  5GHZ A;  1MPL A;  1SCW A;  1DY6 A;  1J3W A;  4JXG A;  3C38 A;  4DE1 A;  3LIA A;  5DKL A;  1L0F A;  2G2W A;  4II7 A;  3KYE A;  3HUM A;  5KSH A;  4G3W A;  4HP9 A;  4Q0H A;  1SDN A;  1YLZ A;  1GA9 A;  2HP5 A;  3ZG9 B;  3GMW A;  4U0X A;  3F1N B;  3GSG A;  2UV0 E;  3IH8 A;  2OAQ 1;  4X55 A;  4GS9 B;  5MC7 A;  4GCZ A;  4X56 A;  1SDE A;  4PM7 A;  5FDS A;  4XXR A;  3LIE A;  2HZ5 A;  1ONH A;  3H9W A;  5M1A A;  2G7U A;  1YMX A;  2BAS A;  3F1O B;  5EVE A;  5IU1 A;  1PRQ A;  3SZT A;  3MXQ A;  2GNX A;  5L09 A;  5L10 A;  4KZA A;  3GQZ A;  2PAV P;  4H8R A;  4OON A;  1LSW A;  2QJ5 A;  1TDL A;  1XP4 A;  2XLN A;  1GHM A;  5EEC A;  4CPK A;  2ZD8 A;  3MKE A;  3VV4 A;  3UN7 A;  3UB7 A;  2WGW B;  4HBT A;  1NWZ A;  1QME A;  4BLM A;  2KDK A;  2Y91 A;  3D72 A;  3UE0 A;  3P7N A;  4RYE A;  2Y2P A;  5CGW A;  2MJ6 A;  4CLC B;  1MWS A;  4JGP A;  4OQH A;  4BD1 A;  4OPZ A;  3C7U A;  1PI5 A;  1VEU A;  2V2F F;  2ZQ7 A;  2Y2M A;  3A3D A;  5F83 A;  3N6I A;  3Q7V A;  4OOM A;  3AGE A;  5LBR A;  3PBT A;  3BEC A;  3MZE A;  4FSF A;  2Y2G A;  3ZDJ A;  5F68 A;  3N8R A;  4ZJ1 A;  4NG2 A;  2ZC7 A;  2ZMF A;  3UDF A;  1W8Q A;  2VGL S;  3HBR A;  3HLF A;  3UB5 P;  2Y2L A;  3B3X A;  1JNU A;  1H8Z A;  3LEQ A;  1I2W A;  2W3G A;  3BQA A;  4DE2 A;  1JWV A;  4HNB A;  2B18 A;  3TOI A;  3UE6 A;  3IX8 A;  4Z1W A;  3SS5 A;  2V1A A;  2OSU A;  1DP8 A;  4GJ4 A;  2XRN A;  3U2A A;  3E98 A;  3ZG0 A;  4HH2 A;  4HJ4 A;  5F69 A;  2R9X A;  1RGY A;  4S2O A;  4CJN A;  3BLS A;  1TS8 A;  1ESI A;  2KLI A;  3MQQ A;  4L9F A;  1BTL A;  1D1J A;  2XD5 A;  1MZU A;  2Y8H A;  2HP6 A;  4WMC A;  5A8B A;  2WZX A;  4IED A;  3M6H A;  1YAX A;  5L8M A;  3ZHH A;  3A0R A;  3NIA A;  4B93 A;  3IHA A;  4XT2 B;  1FIL A;  5EOE A;  2XD1 A;  4S2L A;  1J9M A;  2V0W A;  2KOI A;  4HY8 A;  3UME A;  2OWH A;  1KDW A;  1YQS A;  2HPB A;  1CI8 A;  1SHV A;  3G6O A;  5HAQ A;  2P74 A;  2V1Z A;  2VKS A;  3HLW A;  2Y2I A;  2X02 A;  4M3K A;  3T4T A;  1VM1 A;  1ALQ A;  5BOH A;  3W2Z A;  2ZM0 A;  4IUH A;  4GKU A;  4BWI A;  1VQQ A;  1IYP A;  5KSC A;  3HLD A;  4E6W A;  1PIO A;  3RXX A;  1TEM A;  3V50 A;  4EBL A;  3NJA A;  1LL8 A;  1K38 A;  3FV7 A;  4KZ4 A;  3F1P A;  3GR2 A;  1ERO A;  2PD8 A;  3UB9 A;  3O86 A;  4B4Z A;  3WRZ A;  4YOF A;  4NXB A;  2H5S A;  4K0W A;  3K3D A;  3NOT C;  4GDB A;  5HD5 A;  5DF9 A;  1ZHH B;  1OPX A;  4PM9 A;  5L07 A;  4E04 A;  4N9K A;  3GEC A;  5FQJ A;  3LGO A;  5CRF A;  3PAE A;  4R4R A;  2CC1 A;  4OKP A;  4QPR A;  4PM5 A;  2Y4A A;  1K56 A;  4RX3 A;  2QHK A;  3ZVW A;  5G4Y A;  1O7E A;  1P97 A;  2FH5 A;  4ZJ3 A;  3S7N A;  3BFC A;  2XRO A;  3N8S A;  1DP9 A;  1ES4 A;  5EM1 A;  4PHT A;  5A93 A;  5AJG A;  4NET A;  3R7W A;  2PT7 A;  4LPZ A;  4BBV A;  3BFD A;  3WWX A;  4Y3I A;  3IXD A;  3PBN A;  1TS6 A;  2XF3 A;  5CGX A;  3ICY A;  2EFX A;  4RX2 A;  2Y2Q A;  4UA7 A;  1LLB A;  4DKI A;  1FIK A;  4R38 A;  3GRJ A;  4Y7P A;  5HFO A;  2WZZ A;  3DBA A;  4KG6 A;  1OTD A;  5HWT A;  3UMD A;  3OBF A;  2UWX A;  3RFB A;  4KZ9 A;  1S1Z A;  5EVI A;  2Y55 A;  4P6B A;  5TGF A;  1K54 A;  2IWC A;  1TD5 A;  4OH0 A;  3SW1 A;  3O3V A;  1I5Q A;  3OCL A;  4WEK A;  3C4O A;  4GNU A;  3DTE A;  3BFE A;  1S0W A;  2J9P A;  2WKE A;  4JXW A;  2O0Y A;  4EU0 A;  1BZA A;  3A0V A;  3FWL A;  4I38 A;  5IT5 A;  2W0N A;  3G34 A;  1XPB A;  3LY4 A;  2Q9M A;  2JC7 A;  1OTE A;  3I7J A;  4N92 A;  2B02 A;  1CI9 A;  3CI6 A;  4BL2 A;  4WZ5 A;  1LI9 A;  4E3M A;  4P6Z M;  5CED A;  3MF0 A;  2V8C A;  2RCX A;  4JF6 A;  4ARZ A;  3LY3 A;  3MSH A;  4Z9Q A;  3UE3 A;  2E8J A;  4PM6 A;  4OQ0 A;  3HUO A;  3LI9 A;  4S2J A;  3ZYT A;  4GW9 A;  5JYO A;  2H10 A;  4IBR A;  4R4S A;  3SS3 A;  3H7W B;  1JTD A;  2ZOH A;  1GSX A;  1JWZ A;  3VOY A;  4GHI A;  2XFT A;  4HJ3 A;  1OME A;  3NUL A;  2WYX A;  1RGZ A;  2M7U A;  4GB7 A;  1OT9 A;  5I5L A;  4ME4 A;  5DTS A;  1OJG A;  5F1F A;  1D7E A;  3UPN A;  1GCE A;  1OJ5 A;  3CIT A;  4P0M A;  1BT5 A;  5FI6 A;  2ZC3 B;  2EXB A;  3A3I A;  3CUE A;  3VFH A;  1NZU A;  3BFF A;  2A24 B;  2QPN A;  3IT9 A;  3M2K A;  1BUL A;  1NLY A;  5HW3 A;  2PR5 A;  4HOI A;  3T4K A;  3EWK A;  3OC2 A;  3ZCZ A;  2ACG A;  3ZFZ A;  3A3J A;  3LID A;  5DKK A;  3GV9 A;  4OP8 A;  1ESU A;  4E6X A;  3HVF A;  3FKW A;  1JVJ A;  2VEA A;  3CPT A;  1T18 A;  4S2N A;  2ZL1 B;  4R0Q A;  5AQB A;  4F3L A;  2JKR M;  4MBF A;  4EER A;  1GHP A;  2JKF A;  2GZA A;  3IH9 A;  3SH9 A;  1OT6 A;  1KVM A;  3UDI A;  1YKD A;  5DTT A;  2VV8 A;  1JTG A;  1L0D A;  4ETX A;  1NY0 A;  3DTK A;  4ZBE A;  3KYZ A;  1KGF A;  3C4P A;  4K91 A;  3EGD C;  1FSY A;  1BLS A;  2BLS A;  1XX2 A;  4MN7 A;  5HAR A;  3FYZ A;  3PBR A;  2QWS A;  4HEF A;  4RQ9 A;  1K55 A;  2A2L A;  5HD3 A;  5U47 A;  2WGV A;  3LO7 A;  1SKO A;  1H3Q A;  4I3J A;  3VP2 A;  4WZ4 A;  4IBX A;  2NUP C;  2OWJ A;  4GD6 A;  5F6A A;  5G18 A;  4I39 A;  4KZB A;  1F5M A;  5DFX A;  1LSV A;  2ZM8 A;  4G3V A;  1XGI A;  2ZQA A;  4HP4 A;  4WN5 A;  1A0K A;  1YLW A;  4S2I A;  1ZTU A;  3LCE A;  2K31 A;  1STZ A;  1HZO A;  4NXG A;  2PYP A;  3WS0 A;  3G4P A;  2XGN A;  2HDR A;  2WAD A;  2QMI A;  5E2F A;  2Y2O A;  1YSQ A;  4BD0 A;  2ZC4 B;  2VGK A;  4OLD A;  3HJI A;  4D60 A;  3P01 A;  4WMC D;  2XR0 A;  4L9G A;  4NKP A;  1QMF A;  3MS6 A;  1K57 A;  4X6T A;  3IF5 A;  2J3T C;  3T4L A;  5CER A;  1XJ6 A;  3O5Y A;  4Q0I A;  2HV1 A;  5FQQ A;  1OTB A;  3H82 B;  5EE8 A;  1GHI A;  1KE4 A;  1ONG A;  5M18 A;  2V9A A;  3P98 A;  4WYY A;  1FQG A;  4R3J A;  3IS2 A;  4X1M A;  2WKQ A;  3PBO A;  5HWW A;  5K5B A;  3WRT A;  2PDR A;  3VSL A;  2J7V A;  4AFI A;  5C5K A;  2QYB A;  3VP3 A;  4B88 A;  2W3E A;  3NDG A;  3OPP A;  4EBN A;  1N9O A;  3PXP A;  3Q81 A;  5FQ9 A;  2B95 A;  2Q0O A;  1G6O A;  4IJG A;  4JKT A;  2Z6D A;  3CHW P;  4BL3 A;  1BLP A;  4JBF A;  3BJN A;  1PWG A;  3TW8 A;  2FFF B;  4UA9 A;  3IHB A;  3IF6 A;  4MN6 A;  3LI8 A;  4DXB A;  4H6J B;  2J3T D;  2P9V A;  3AGF A;  2RL3 A;  4EBP A;  4EQ1 A;  4JGO A;  5DJU A;  4OPR A;  5EVI C;  4QHC A;  1V9Z A;  2G2U A;  1E4D A;  3NOP C;  5D3O A;  3ITB A;  1K54 C;  3T1S A;  1K56 D;  4FD8 A;  2FZ0 A;  3D3O A;  3LIC A;  2LB9 A;  4PAU A;  3ULF A;  1BLC A;  4MLL A;  1MXO A;  5E2H A;  3FG8 A;  1GA0 A;  3LR5 A;  4I5S A;  4K0X A;  5EM0 A;  3QP4 A;  4DMZ A;  4Y5F A;  3BYD A;  1L0E A;  4FOF A;  2EX8 A;  2EWW A;  2J8Y A;  4JF5 A;  4N9L A;  1FR6 A;  4JGR A;  3B33 A;  4EEU A;  1RP5 A;  4RA7 A;  3NOU C;  1OTA A;  4U0T A;  1KGE A;  4DRT A;  2VK3 A;  3CMZ A;  4X1L A;  1XA7 A;  4OQG A;  3VMA A;  2HF6 A;  1PZO A;  3C5A A;  1TF1 A;  2DRW A;  3HLG A;  5CEB A;  1VET A;  1KDS A;  1F98 A;  1P0Z A;  2P08 A;  1YSP A;  4EW7 A;  3MFX A;  4EWF A;  1XFQ A;  2WUQ A;  1Y54 A;  4ETZ A;  4QJG A;  3CPT B;  1KGG A;  3W4Q A;  3E4Q A;  5HDD A;  1PYY A;  1ODV A;  4B4X A;  1C3B A;  3G30 A;  2XSS A;  3FZC A;  5EVI D;  1NXY A;  1IYO A;  2HP9 A;  1PW1 A;  5TBM A;  2PBY A;  5HZH A;  3CG5 A;  2VZW A;  2EX2 A;  4GDN A;  3Q7Z A;  1BYW A;  2Y59 A;  3PAG A;  4DDS A;  3HLC A;  3MZF A;  2WKR A;  3G32 A;  3R4K A;  4HIA A;  4DE0 A;  3SS4 A;  4WUJ A;  5KIZ A;  3WS5 A;  1DJC A;  1K4E A;  4KG2 A;  3TRC A;  3BW6 A;  1ES5 A;  2EX9 A;  1BLH A;  4E3K A;  3G35 A;  4LGW A;  1IFQ A;  1ZKJ A;  3UB6 A;  3TE8 A;  4QB8 A;  3JYI A;  3E2L A;  2BTF P;  2W1T B;  4NXF A;  5FAQ A;  2M1C A;  3FPV A;  2DCF A;  4KZ3 A;  3SH8 A;  4JF4 A;  3KSF A;  3QP8 A;  3A3F A;  3ITA A;  1SZV A;  2ZC5 B;  4EUZ A;  2JN7 A;  3PBS A;  4S2N C;  5J4E A;  3T12 B;  1Q2Q A;  3TJZ C;  4P6Z S;  2EX6 A;  5KZH A;  3DTI A;  3A3E A;  5FQM A;  1MWU A;  5DVA A;  2PYR A;  3D9Y A;  1CEG A;  1BUE A;  5HSQ A;  2O99 A;  1W7F A;  1PW8 A;  4EEP A;  4L0L A;  1YMS A;  4OP5 A;  4NK3 A;  3M2J A;  1S4S A;  3N4I A;  4C75 A;  5G4Z A;  5A90 A;  2YKF A;  1F9I A;  2HDS A;  2EFU A;  2X71 A;  1DRM A;  1TS0 A;  2HGV A;  5FI2 A;  5HAI A;  4E3L A;  3GTC A;  3UNW A;  1HVB A;  1PI4 A;  1XFN A;  2VJW A;  4LLO B;  1YT4 A;  3T1R A;  3L7H A;  3MR0 A;  3OZH A;  3Q82 A;  4X68 A;  1PWC A;  3EOI A;  3ZG8 B;  2H0Y A;  1Q2P A;  2IWD A;  1YLJ A;  3F1N A;  4MEZ A;  4YWZ A;  4GS9 A;  1MWT A;  4R3B A;  3W4O A;  4WM9 A;  2Z2L B;  4X25 A;  2JKT M;  3ZNY A;  2OOL A;  5AQA A;  5CX7 A;  1EWZ A;  4QWO A;  4C3Q A;  1FOF A;  1MC0 A;  3MKF A;  5FQI A;  4ZRR A;  3F1O A;  5HWV A;  1VEU B;  4FTX A;  5CTM A;  2Y2H A;  5HPF A;  1H8Y A;  1FR1 A;  4Y0U A;  3Q7V B;  5FI7 A;  4GZB A;  3Q07 A;  3N7W A;  1N9B A;  2VV6 A;  3T1Q B;  1FCN A;  1MKI A;  3IX3 A;  2P9V B;  4KQD A;  4MNR A;  1G5U A;  5F5Y A;  4HQA A;  1W79 A;  5FEG A;  3NY4 A;  1MWR A;  1V9Y A;  2WGW A;  4KZ7 A;  4OPY A;  4KUO A;  4RVA A;  1E3U D;  2E8I A;  3JVU A;  3MXR A;  2PHY A;  4CLC A;  4WEL A;  3UB8 A;  3SOI A;  4UQI M;  3E2K A;  3P09 A;  3PR6 A;  2FFY A;  5DJT A;  5DFY A;  4BJP A;  1KOU A;  1O07 A;  4WEJ A;  2JCH A;  4UEY A;  1Z6F A;  3K3C A;  3IWQ A;  1KE3 A;  2ZQ8 A;  1Y4O A;  1DJA A;  4GLQ A;  1PFL A;  3VSK A;  3CJM A;  4PKY G;  2PBD P;  3LR3 A;  1KE0 A;  4WBG A;  1F2K A;  1WYC A;  2W27 A;  5HDS A;  1OTI A;  3W8K A;  1G6A A;  3VE3 A;  2Q9N A;  1W63 M;  4LCM A;  3TG9 A;  1N9N A;  5HPI A;  2Z6C A;  4OOY A;  2JHE A;  4KZ6 A;  5GHX A;  1IEL A;  3IXG A;  3S4X A;  4P87 A;  3ZG7 B;  3UDX A;  4YFM A;  5A91 A;  3HLB A;  5JYP A;  2M7V A;  4X53 A;  1TVF A;  3QNC A;  1UGU A;  3QNB A;  3IBJ A;  1BSG A;  4R3A A;  2EXA A;  2EWV A;  1GSV A;  2OAP 1;  4NXE A;  3OLO A;  5DF8 A;  1K6R A;  3F1P B;  1CQA A;  3E4P A;  4OPQ A;  2H28 A;  3VP1 A;  4Y13 A;  4XT2 A;  1NZO A;  5TJJ A;  3HL9 A;  4BBT A;  4UAA A;  4LCL A; 
#chains in the Genus database with same CATH homology
 3RXX A;  3IF6 B;  1TEM A;  4KQR A;  3VFF A;  2XH9 A;  3V50 A;  4EBL A;  1K38 A;  1W8Y A;  4OVD A;  3GVB A;  3FV7 A;  1K57 C;  3Q81 A;  5FQ9 A;  2OLU A;  4KZ4 A;  3GR2 A;  3UPP A;  3G2Z A;  1L2S A;  1ERO A;  4JKT A;  4EQI A;  5HAP A;  5E2E A;  2VGJ A;  4BL3 A;  3IWI A;  3O86 A;  1BLP A;  4QD4 A;  3WRZ A;  4B4Z A;  5HL1 A;  4JBF A;  2H5S A;  3HUN A;  1PWG A;  4K0W A;  2FFF B;  3DW0 A;  5CHM A;  1NJ4 A;  4MBH A;  4OLG A;  5GLC A;  4UA9 A;  5GLA A;  3IHB A;  3IF6 A;  4GDB A;  2XQZ A;  5DF9 A;  4DXB A;  1SKF A;  3AGF A;  2P9V A;  4ZAM A;  2RL3 A;  4PM9 A;  3DWK A;  4EBP A;  4N9K A;  4MBK A;  4OPR A;  5EVI C;  5FAS A;  4QHC A;  5FQJ A;  2G2U A;  2ZJ9 A;  5CRF A;  1E4D A;  3BEB A;  5D3O A;  3V5M A;  3ITB A;  1K54 C;  5TFQ A;  2X01 A;  3PAE A;  1K56 D;  4R4R A;  4FD8 A;  5E2G A;  4JXS A;  2CC1 A;  3PBQ A;  4OKP A;  4DDY A;  1CK3 A;  4UHU A;  4PM5 A;  1BLC A;  1TDG A;  2Y4A A;  1MBL A;  1K56 A;  4MLL A;  1JWP A;  2ZQD A;  1MXO A;  5E2H A;  4ZJ2 A;  2WKH A;  3ZGA B;  1GA0 A;  4RX3 A;  4K0X A;  3NDE A;  3DWZ A;  4JXV A;  3WS2 A;  4JLF A;  5DF7 A;  4FH4 A;  2C5W B;  3BYD A;  4P85 A;  4BEN A;  1L0E A;  3ZVW A;  2EX8 A;  1O7E A;  4KZ8 A;  2J8Y A;  4JF5 A;  4N9L A;  1ZG6 A;  2XEP A;  1FR6 A;  2WAF A;  3ZVT A;  4HBU A;  4ZJ3 A;  3BFC A;  2ZC6 B;  2WKI A;  3BM6 A;  1RP5 A;  3PTE A;  4ID4 A;  4KEN B;  4XUZ A;  3G2Y A;  2A3U A;  4LEN A;  3VP4 A;  4RA7 A;  2QZ6 A;  4FH2 A;  3BFG A;  3N8S A;  3IF6 C;  4HES A;  1ES4 A;  2WGI A;  3BRM A;  4U0T A;  1YLT A;  4A5R A;  4JPM A;  5A93 A;  1KGE A;  4PMA A;  4DRT A;  4NET A;  3CMZ A;  3ZG5 A;  5L2F A;  2I72 A;  1L0G A;  3BFD A;  1I2S A;  1XA7 A;  4OQG A;  3VMA A;  3WWX A;  5F82 A;  1PZO A;  3C5A A;  1IKG A;  3HLG A;  2DRW A;  4Q8I A;  4IVI A;  5FA7 A;  5GL9 A;  1LL5 A;  3IXD A;  1K4F A;  3PBN A;  1KDS A;  2XF3 A;  5CEB A;  1YLY A;  5M19 A;  3LEZ A;  3NCK A;  5CGX A;  4Y0O A;  3MXS A;  5AQ9 A;  3EQU A;  5EVI B;  3UE1 A;  2EFX A;  3Q1F A;  5GHY A;  5EPH A;  3UY6 A;  4RX2 A;  3UO9 A;  2Y2Q A;  4EWF A;  4LV0 A;  3O87 A;  4UA7 A;  2WUQ A;  1Y54 A;  3C7V A;  4S2K A;  2WAE A;  1KGG A;  3W4Q A;  1LLB A;  4QJG A;  4DKI A;  2ZQ9 A;  3GRJ A;  1H5X A;  1PYY A;  3O88 A;  4Y7P A;  5HFO A;  4E3I A;  5EUA A;  4B4X A;  4KZ5 A;  1C3B A;  2WZZ A;  3G30 A;  5CTN A;  4KG6 A;  3FZC A;  3IXB A;  5EVI D;  1NXY A;  1IYO A;  2BG1 A;  1PW1 A;  2HP9 A;  5FAT A;  3QHY A;  2GDN A;  1ZG4 A;  2UWX A;  2JBF A;  1N4O A;  4KZ9 A;  2PBY A;  5EVI A;  5HX9 A;  2Y55 A;  5F1G A;  1ES2 A;  3CG5 A;  2EX2 A;  4P6B A;  4GDN A;  3Q7Z A;  2Y2K A;  5TGF A;  1HTZ A;  1K54 A;  2IWC A;  2Y59 A;  3PAG A;  4OH0 A;  2HDU A;  2IWB A;  4YIN A;  4DDS A;  3O3V A;  1I5Q A;  3D4F A;  3HLC A;  3C4O A;  3IQA A;  3OCL A;  4WEK A;  5DTK A;  3MZF A;  4GNU A;  3G32 A;  4DE0 A;  3BFE A;  3NBL A;  3V39 A;  3SS4 A;  4DF6 A;  4ZDX A;  1S0W A;  2J9P A;  4PPR A;  3G31 A;  4GD8 A;  4QY6 A;  3WS5 A;  2ZLY A;  1DJC A;  1K4E A;  4O7D A;  1AXB A;  2WKE A;  4KG2 A;  1ES5 A;  4JXW A;  2EX9 A;  1KVL A;  5KMW A;  5E43 A;  1BLH A;  4E3K A;  3G35 A;  5FQK A;  4KQQ A;  1ZKJ A;  1BZA A;  4QB8 A;  4UA6 A;  3FWL A;  3JYI A;  3N8L A;  5GLD A;  3G34 A;  3E2L A;  3VOZ A;  4R23 A;  1IEM A;  1XPB A;  2ZMA A;  3LY4 A;  2Q9M A;  5FAQ A;  2JC7 A;  4X69 A;  4OQI A;  4C6Y A;  4KZ3 A;  2DCF A;  2XFS A;  3I7J A;  4JF4 A;  4N92 A;  5EVL A;  4S2P A;  3SH8 A;  1WYB A;  4GN2 A;  4R1G A;  1CI9 A;  2ZQC A;  4ZTK A;  3CZD A;  4BL2 A;  1K6S A;  4WZ5 A;  1LI0 A;  3HRE A;  1LI9 A;  2HDQ A;  2H0T A;  3A3F A;  3ITA A;  5CHU A;  2ZC5 B;  1ZC2 A;  4E3M A;  5CED A;  4EUZ A;  4XUX A;  2RCX A;  3OPL A;  4JF6 A;  3LY3 A;  1ES3 A;  4Z9Q A;  3UE3 A;  3PBS A;  4S2N C;  1E25 A;  2A49 A;  4QU3 A;  1Q2Q A;  4E3O A;  2OLV A;  3HLE A;  2EX6 A;  1FCO A;  4PM6 A;  5KZH A;  3DTM A;  4E3N A;  4OQ0 A;  5FDH A;  3HUO A;  4S2J A;  3A3E A;  5FQM A;  1PWD A;  1MWU A;  5JYO A;  1E3U A;  5DVA A;  2H10 A;  4IBR A;  3MBZ A;  1WE4 A;  4R4S A;  3SS3 A;  2Y2J A;  4S2M A;  2PU2 A;  5GHZ A;  1MPL A;  5J8X A;  1CEG A;  1BUE A;  1JTD A;  1SCW A;  1DY6 A;  5FAO A;  1JWZ A;  3VOY A;  3S1Y A;  5CGS A;  2XFT A;  1IKI A;  4JXG A;  5TR7 A;  5CHJ A;  1OME A;  1W7F A;  3OPH A;  1PW8 A;  2WYX A;  1RGZ A;  4DE1 A;  4L0L A;  2R9W A;  1YMS A;  4OP5 A;  4GB7 A;  4NK3 A;  3M2J A;  1CEF A;  1L0F A;  2G2W A;  3N4I A;  4C75 A;  1XXM A;  5DTS A;  3HUM A;  5A90 A;  5F1F A;  5KSH A;  2HDS A;  5EOO A;  3UPN A;  1SDN A;  1GCE A;  2EFU A;  1YLZ A;  1GA9 A;  4WZ5 C;  4P0M A;  2HP5 A;  3ZG9 B;  2X71 A;  1BT5 A;  3GMW A;  5FI6 A;  4GOG A;  4U0X A;  2ZC3 B;  3TSG A;  4DE3 A;  2EXB A;  3A3I A;  3GSG A;  1NZU A;  3VFH A;  3BFF A;  4E3J A;  3IH8 A;  4X55 A;  5FI2 A;  4E3L A;  5HAI A;  2QPN A;  3IT9 A;  4X56 A;  3GTC A;  3M2K A;  1BUL A;  1SDE A;  3UNW A;  4PM7 A;  1HVB A;  1PI4 A;  1YT4 A;  5IHV A;  2C6W B;  3OZH A;  3Q82 A;  4X68 A;  4Y0T A;  3RXW A;  5HW3 A;  2XK1 A;  4XXR A;  1ONH A;  1PWC A;  4BQM A;  5M1A A;  4FCF A;  3OC2 A;  3OPR A;  3ZG8 B;  3ZCZ A;  2H0Y A;  1Q2P A;  1YMX A;  3ZFZ A;  4IVK A;  2IWD A;  1YLJ A;  3A3J A;  4PM8 A;  4U3T A;  4MEZ A;  1IYQ A;  3GV9 A;  4LV3 A;  1MWT A;  4LV2 A;  1ESU A;  4OP8 A;  4R3B A;  4E6X A;  3W4O A;  4KZA A;  3HVF A;  3FKW A;  1JVJ A;  3EQV A;  3GQZ A;  4WM9 A;  2Z2L B;  4H8R A;  4S2N A;  4R0Q A;  3ZNY A;  4F94 A;  5AQA A;  1EWZ A;  4C3Q A;  2Z2M B;  4OON A;  5AQB A;  1FOF A;  1PZP A;  4MBF A;  1TDL A;  1XP4 A;  3MKF A;  5FQI A;  3BLM A;  1GHP A;  1GHM A;  2XLN A;  5EEC A;  4CPK A;  3IH9 A;  2ZD8 A;  3MKE A;  5CTM A;  5AQ7 A;  3UN7 A;  2Y2H A;  3S22 A;  3SH9 A;  5A92 A;  1H8Y A;  2WGW B;  4HBT A;  2ZM2 A;  3SH7 A;  1FR1 A;  1M40 A;  4Y0U A;  3Q7V B;  1QME A;  1KVM A;  3UDI A;  5FI7 A;  4GZB A;  3Q07 A;  2OV5 A;  3N7W A;  4BLM A;  5CEC A;  5DTT A;  1N9B A;  2Y91 A;  3UE0 A;  4RYE A;  2Y2P A;  5CGW A;  1FCN A;  3UPO A;  1JTG A;  1MKI A;  1MWS A;  1L0D A;  3AGD A;  5GLB A;  3OCN A;  1NY0 A;  2P9V B;  4OQH A;  4MNR A;  4BD1 A;  1W79 A;  1XA1 A;  4ZBE A;  1XKZ A;  3NY4 A;  1KGF A;  1YM1 A;  3C4P A;  1MWR A;  4K91 A;  4OPZ A;  4QY5 A;  3C7U A;  1PI5 A;  3M6B A;  1FSY A;  2JE5 A;  2V2F F;  2XDM A;  2Y2M A;  2ZQ7 A;  1BLS A;  2BLS A;  1HD8 A;  2WGW A;  4DXC A;  1XX2 A;  3A3D A;  5F83 A;  1K25 A;  3N6I A;  4KZ7 A;  5HAR A;  2PU4 A;  3FYZ A;  3PBR A;  3Q7V A;  4HEF A;  1EI5 A;  4OOM A;  3AGE A;  4OPY A;  4RVA A;  3PBT A;  1K55 A;  3BEC A;  1E3U D;  3MZE A;  2E8I A;  2WGV A;  5U47 A;  4FSF A;  2Y2G A;  3LO7 A;  3MXR A;  3ZDJ A;  4KQO A;  3N8R A;  4ZJ1 A;  4WEL A;  3VP2 A;  2ZC7 A;  4WZ4 A;  3SOI A;  3E2K A;  1DJB A;  4IBX A;  1W8Q A;  3P09 A;  4LV1 A;  3UDF A;  2FFY A;  1ERM A;  4EV4 A;  3HBR A;  4GD6 A;  1G68 A;  3HLF A;  4BJP A;  1IYS A;  2Y2L A;  5G18 A;  3WS4 A;  4KZB A;  3B3X A;  1H8Z A;  1O07 A;  4WEJ A;  2JCH A;  1I2W A;  4DE2 A;  1NYM A;  1Z6F A;  2ZM8 A;  1LHY A;  3IWQ A;  1KE3 A;  1JWV A;  1XGJ A;  2ZQ8 A;  1XGI A;  1DJA A;  3TOI A;  2ZQA A;  3FKV A;  1NYY A;  3VSK A;  3CJM A;  1YLW A;  4S2I A;  3LCE A;  1HZO A;  3SS5 A;  2OSU A;  3NI9 A;  3WS0 A;  3G4P A;  2XGN A;  2HDR A;  1FCM A;  3ZG0 A;  2WAD A;  2QMI A;  5FSR A;  5E2F A;  1KE0 A;  2Y2O A;  2R9X A;  4WBG A;  1RGY A;  4S2O A;  1WYC A;  4CJN A;  1ERQ A;  3BLS A;  5FAP A;  4BD0 A;  3W8K A;  2ZC4 B;  1G6A A;  1K55 C;  2VGK A;  4OLD A;  4OOL A;  1ESI A;  3IWO A;  2Q9N A;  4LCM A;  1BTL A;  1U60 A;  1MY8 A;  2XR0 A;  4WMC D;  2XD5 A;  3TG9 A;  3W4P A;  2HP6 A;  3IXH A;  3VP0 A;  1QMF A;  4OOY A;  1K57 A;  4KZ6 A;  5GHX A;  1IEL A;  3WS1 A;  4WMC A;  2B5R A;  4X6T A;  3IXG A;  3IF5 A;  3S4X A;  4P87 A;  3ZNT A;  3ZG7 B;  2WZX A;  4IED A;  3UDX A;  1LL9 A;  5CER A;  3M6H A;  4YFM A;  5A91 A;  3ISG A;  3HLB A;  3ZHH A;  5JYP A;  2DNS A;  3NIA A;  1M6K A;  1YLP A;  4X53 A;  3IHA A;  3V3S A;  5FQQ A;  1TVF A;  3QNC A;  5EE8 A;  1GHI A;  1KE4 A;  3QNB A;  5EOE A;  2XD1 A;  3RJU A;  1BSG A;  1FSW A;  4S2L A;  1J9M A;  1ONG A;  5M18 A;  2J9O A;  1KDW A;  2EXA A;  1YQS A;  4N1H A;  2HPB A;  3P98 A;  1CI8 A;  3NC8 A;  1SHV A;  4KG5 A;  4D2O A;  4WYY A;  2Y2N A;  2V20 A;  5HAQ A;  1FQG A;  4R3J A;  2V1Z A;  2P74 A;  3HLW A;  2Y2I A;  5DF8 A;  3PBO A;  1K6R A;  2X02 A;  3MZD A;  1NRF A;  4M3K A;  1VM1 A;  1ALQ A;  3WRT A;  4OPQ A;  5BOH A;  2WK0 A;  2ZM0 A;  3VSL A;  1RCJ A;  2J7V A;  5CXW A;  3VP1 A;  4GKU A;  1VQQ A;  1IYP A;  1NZO A;  3VP3 A;  5KSC A;  3HL9 A;  4B88 A;  5I94 A;  3HLD A;  3NDG A;  3MFD A;  4UAA A;  1S6R A;  3V3R A;  4N1X A;  3OPP A;  4E6W A;  4EBN A;  1PIO A;  4LCL A;  1W5D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...