1RCJA

Crystal structure of e166a mutant of shv-1 beta-lactamase with the trans-enamine intermediate of tazobactam
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
265
structure length
265
Chain Sequence
SPQPLEQIKLSESQLSGRVGMIEMDLASGRTLTAWRADERFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGELCAAAITMSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWATELNEALPGDARDTTTPASMAATLRKLLTSQRLSARSQRQLLQWMVDDRVAGPLIRSVLPAGWFIADKTGAGERGARGIVALLGPNNKAERIVVIYLRDTPASMAERNQQIAGIGAALIEHWQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase SHV-1
publication title Tazobactam Forms a Stoichiometric trans-Enamine Intermediate in the E166A Variant of SHV-1 beta-Lactamase: 1.63 A Crystal Structure
pubmed rcsb
source organism Klebsiella pneumoniae
molecule tags Hydrolase
total genus 98
structure length 265
sequence length 265
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2003-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1rcjA00
4KZ6A 1PZOA 2A49A 5HAPA 4HEFA 1K4FA 4KZ7A 4UA7A 5M18A 4FH2A 1KDSA 4BD0A 2HP5A 4E6XA 4PPRA 1PI5A 4WZ5C 3HLGA 4R1GA 5CTMA 2PBYA 1RGZA 3WRZA 4JF6A 4JXGA 4DE1A 2QZ6A 5FI7A 3BEBA 4GD8A 5FQMA 3ZG7B 5KMWA 1XGIA 5EVIB 4PM7A 2WYXA 1KGFA 2Y4AA 2Y2PA 1L2SA 4N9LA 1LHYA 3NDGA 1XXMA 4LV1A 4OQIA 3OZHA 3SH8A 5HFOA 3SH9A 1BUEA 1ES3A 1I2WA 3ZFZA 3Q81A 2ZLYA 2EX6A 2JC7A 3MBZA 2EFUA 5FQIA 4RX3A 3OC2A 3Q82A 5JYOA 3V39A 2X02A 3DWKA 1O07A 4HBUA 1YLWA 1MWRA 4GDNA 2OLVA 3VMAA 5CGSA 1FOFA 1OMEA 4FH4A 1K55C 1CEFA 2R9XA 2PU4A 1BLHA 3VOYA 4DXBA 4WZ5A 2Y2OA 4F94A 2XEPA 3AGDA 3LCEA 1YLTA 4WMCD 4JPMA 4QD4A 3MZFA 5FA7A 4MBFA 1MKIA 3GR2A 1ZKJA 4CJNA 3UE0A 4OVDA 1S6RA 3G2ZA 4QY6A 1BLCA 5FI6A 2HP9A 3A3DA 3RXWA 4D2OA 5I94A 2WGVA 1L0EA 3UE1A 3S1YA 4OLDA 3VFHA 1BTLA 3IWQA 2WGWA 3C7UA 3LEZA 4KZ9A 2I72A 3UPOA 4DRTA 5HL1A 1FQGA 2PU2A 5L2FA 4KENB 3I7JA 4OPQA 3PBTA 2H0TA 1K55A 2Q9MA 4KZ5A 2WK0A 4RVAA 5FAQA 3HVFA 2ZM8A 5U47A 1S0WA 3HLDA 2Y91A 4E3IA 2J9OA 2JCHA 2E8IA 5CTNA 3OPPA 2H10A 3LY3A 4MNRA 3BLSA 3BFCA 1N4OA 1FR1A 1O7EA 4DDSA 1WE4A 1MXOA 2G2WA 3GTCA 4PMAA 3P09A 1NZUA 2ZQ8A 3HLFA 2XF3A 4GN2A 4HESA 2ZMAA 3ZCZA 4OOMA 3ZNTA 3A3EA 3IWOA 1IYOA 1ZG4A 4S2MA 4U0TA 1U60A 1W8YA 4FCFA 1K56A 2EXBA 3C7VA 1MBLA 1ERMA 1I2SA 1MWSA 3GRJA 5AQAA 3UE3A 4PM9A 4XUXA 4Y0OA 4S2PA 2XDMA 3M2JA 1XGJA 1MPLA 5E2HA 1Y54A 3FZCA 1IYQA 4IEDA 1E3UD 1DJAA 4DKIA 3TSGA 3PAEA 4LCLA 5AQBA 3WS2A 4NETA 4Z9QA 4KQRA 4ZJ2A 3SS3A 1YLPA 3O86A 3SOIA 4E3MA 3CZDA 1QMFA 2ZQCA 5CEBA 5A90A 5FAOA 1KVMA 1PWCA 1GHPA 1L0GA 4C6YA 4Y0UA 3GV9A 3IHAA 4WEKA 4LV2A 3Q1FA 4R3BA 4UAAA 4UA6A 2J7VA 5EE8A 1EI5A 3GVBA 1NZOA 4OP5A 5GL9A 3FV7A 4Y7PA 1FCNA 3OPRA 2Y59A 1GHMA 2CC1A 3IQAA 3MXSA 4JXVA 4B4ZA 2Y2IA 1JTGA 1IEMA 4JF4A 3RXXA 1BSGA 5EUAA 1H8ZA 1NYMA 2XK1A 4XXRA 5DF9A 1DJCA 3G2YA 4DE0A 1GHIA 4OPRA 4X69A 3UDIA 3WS5A 2WGIA 3VSLA 1YQSA 1H5XA 1PIOA 4O7DA 2JE5A 2IWDA 1BLSA 1BT5A 1ERQA 1RP5A 2J9PA 4BL3A 1YM1A 3PBQA 4R4SA 3Q07A 4JBFA 4S2JA 5FDHA 4X55A 5IHVA 4GB7A 4MEZA 5E2FA 4WELA 3S4XA 4B4XA 5FI2A 1W5DA 3NY4A 3Q7VB 4LV3A 3LY4A 1FR6A 2WKEA 4E6WA 3N8LA 2ZQ9A 3ISGA 2ZC7A 3TG9A 2GDNA 2A3UA 5GLAA 2ZJ9A 4KZBA 3G32A 3PBOA 2DRWA 5F1FA 3OCLA 1LL5A 1XP4A 5CHMA 3UDXA 1JVJA 2FFFB 3RJUA 1G68A 3IF6B 2Y2NA 2ZQ7A 3QNCA 3ZHHA 4MBKA 2ZC5B 5DVAA 4E3KA 1Z6FA 5CHUA 1NJ4A 1DY6A 3A3JA 2WUQA 1YMXA 4K0XA 4N9KA 5EVLA 4EBPA 5CECA 4GD6A 1G6AA 1YLJA 1FCOA 4KQQA 3LO7A 3PBNA 5GLBA 4Q8IA 1IYPA 1KDWA 2VGJA 3M6HA 2OSUA 1FCMA 4ZJ3A 4N1HA 3D4FA 4ZTKA 1ALQA 5A91A 4DE3A 3WS1A 1NXYA 1N9BA 1MWTA 4K0WA 5FAPA 4EBNA 3HUOA 5EVIC 1HVBA 1PZPA 1W8QA 2Y2KA 5FQ9A 2UWXA 3W4OA 3W4PA 1LLBA 2V20A 2HP6A 3EQVA 1M6KA 2P9VB 4R23A 1SHVA 3ZG5A 2J8YA 4R4RA 4LV0A 2X01A 4JXSA 5HAIA 3ZVWA 4UA9A 1TEMA 3G35A 4KZAA 5D3OA 4GDBA 3ZG9B 3BFGA 3O87A 1K6SA 4PM5A 4OKPA 1LL9A 1SDEA 4WBGA 4XUZA 5FATA 5G18A 5HARA 3UO9A 5GHZA 4S2NC 4P0MA 1HTZA 2Y2MA 1QMEA 2RCXA 5HAQA 1RGYA 3CJMA 3ITBA 5FSRA 1GCEA 2Y2JA 1EWZA 1K57C 4RA7A 5FASA 1K56D 2RL3A 2IWBA 5EVIA 1VQQA 1IYSA 2ZD8A 3WS0A 1WYCA 4BD1A 4X6TA 2BG1A 2Y2HA 3IWIA 3IXHA 3HREA 1I5QA 1JWVA 5CXWA 5DTTA 5EPHA 5TGFA 3UPNA 3G4PA 4ZBEA 1NY0A 3ZDJA 1BLPA 3OCNA 4GNUA 1W7FA 2EX2A 4ZJ1A 3NIAA 2XH9A 1XA7A 1KE4A 1ES4A 4U0XA 4UHUA 4P85A 3MKEA 4S2LA 4ZAMA 3V3RA 3WS4A 3HUNA 4GKUA 4S2NA 2Y55A 3C4PA 4E3OA 5DF8A 3B3XA 3A3IA 3BM6A 1PWDA 3EQUA 3FYZA 4M3KA 1ES2A 5KSHA 1CEGA 1NRFA 1YMSA 3MZEA 3P98A 4JXWA 2XLNA 1K57A 2HPBA 4OONA 3QHYA 5A93A 3PTEA 1DJBA 2H0YA 2G2UA 3HLBA 4L0LA 4OLGA 4KG6A 3IH9A 2X71A 1PI4A 1W79A 4DF6A 4HBTA 1KGEA 1JWPA 1HZOA 5CEDA 4EWFA 4BJPA 2EX9A 3MKFA 3N7WA 4QU3A 1XPBA 3HLCA 1YLYA 3M6BA 3BECA 4PM8A 5CHJA 4KZ3A 3Q7ZA 2EFXA 3UDFA 4RYEA 1XA1A 3GQZA 4YINA 4Y0TA 1FSYA 4QB8A 3W4QA 1ZC2A 1MY8A 3HLWA 3NI9A 2HDSA 4U3TA 1PWGA 3MFDA 3VFFA 4CPKA 3HUMA 3W8KA 3E2LA 4EV4A 2ZM2A 3JYIA 5M1AA 2OLUA 2Y2GA 4KG5A 2HDUA 3GMWA 1ZG6A 5CRFA 3IXBA 1ES5A 1KE3A 3UNWA 4MLLA 1YT4A 3CMZA 4OP8A 1KE0A 2ZC6B 4QJGA 3IT9A 5DF7A 3AGFA 5FQJA 4IBRA 5F1GA 3VP2A 5JYPA 3VP3A 4MBHA 4FSFA 2XD1A 3FKVA 4OOLA 5AQ9A 3VSKA 4OOYA 2XGNA 3SS5A 1BULA 3VP0A 4R3JA 5HW3A 5CGXA 1JTDA 2C5WB 3NDEA 4H8RA 4JLFA 4P87A 4BQMA 5BOHA 2Y2LA 3QNBA 4X56A 5HX9A 5E2EA 2EX8A 5GLCA 2OV5A 1TDLA 5GHYA 3N6IA 1K4EA 5CGWA 4DE2A 3IH8A 4WZ4A 1IELA 4N92A 4GZBA 3ITAA 1K25A 1SKFA 4OPYA 3V5MA 2EXAA 2HDQA 3CG5A 4NK3A 1WYBA 3GSGA 3N8SA 3O3VA 4LCMA 1SDNA 1L0DA 3OPHA 1IKIA 3HL9A 4S2OA 4WYYA 3ZVTA 2XFSA 4OQHA 1PYYA 4C3QA 3IF5A 4IBXA 3VP4A 2QPNA 5FQQA 4KZ8A 2WZXA 3V50A 1C3BA 2XQZA 1XX2A 1K6RA 4E3LA 4R0QA 4KQOA 3VP1A 2WAEA 2P74A 4WM9A 3BLMA 4EBLA 4LENA 1HD8A 4WMCA 2IWCA 1KGGA 1ESUA 4OPZA 3SH7A 1KVLA 3IXDA 1EROA 2ZQAA 4K91A 4YFMA 4E3NA 5GLDA 5A92A 4GOGA 4X53A 3IF6C 2XR0A 2HDRA 5AQ7A 4A5RA 3SS4A 3BFDA 5DTSA 1XKZA 3HBRA 3NC8A 3PBSA 1H8YA 3G31A 4S2KA 3UPPA 3DTMA 1J9MA 1TDGA 5EVID 4PM6A 1FSWA 4EUZA 1SCWA 2WAFA 3G34A 5KSCA 3N4IA 3BFFA 3IHBA 1JWZA 4X68A 4QHCA 3FKWA 4RX2A 2R9WA 4KG2A 1YLZA 1AXBA 1NYYA 2WKHA 4ID4A 4IVIA 4ZDXA 3Q7VA 4QY5A 3O88A 3ZG0A 1BZAA 2DCFA 5EOEA 2ZQDA 2XD5A 3G30A 3BRMA 3WRTA 2DNSA 1K38A 2Z2LB 3ZG8B 3NCKA 1PW1A 5EECA 3V3SA 4JF5A 3BFEA 4BLMA 2B5RA 2Q9NA 2WZZA 1IKGA 5F82A 2ZM0A 2WKIA 3N8RA 3WWXA 4WEJA 4OQ0A 3FWLA 3IF6A 1LI0A 1ONHA 1CI9A 2VGKA 3E2KA 4DDYA 4EQIA 4IVKA 4DXCA 3DWZA 3UN7A 3PAGA 2WADA 3HLEA 5E2GA 5FQKA 1K54C 3ZGAB 4OQGA 1VM1A 2ZC3B 1CI8A 1TVFA 5M19A 2V1ZA 5J8XA 1CK3A 4KZ4A 5DTKA 3NBLA 4S2IA 2V2FF 4N1XA 3IXGA 5F83A 1Q2QA 2FFYA 2JBFA 1GA0A 5KZHA 2ZC4B 1LI9A 1PW8A 3PBRA 4P6BA 4BENA 1E3UA 3C5AA 1E25A 3MZDA 4OH0A 3S22A 3AGEA 5TR7A 5EOOA 3MXRA 2QMIA 3VOZA 3OPLA 4B88A 3BYDA 5TFQA 2P9VA 2BLSA 2WGWB 1L0FA 3C4OA 4C75A 4FD8A 2XFTA 1ONGA 2Y2QA 1K54A 1RCJA 5E43A 3UY6A 3DW0A 1Q2PA 3ZNYA 2Z2MB 3M2KA 3TOIA 1E4DA 1ESIA 1GA9A 1M40A 1MWUA 5CERA 4JKTA 4E3JA 2H5SA 2C6WB 4BL2A 5GHXA 3A3FA
chains in the Genus database with same CATH superfamily
2A49A 4HEFA 4KZ7A 5M18A 1KDSA 1T19A 4PPRA 2PBYA 1RGZA 4JF6A 1MZUA 4I38A 5KMWA 1XGIA 1KGFA 2Y4AA 2Y2PA 3NDGA 5F5YA 3SH8A 1ES3A 2QWSA 2ZLYA 2EX6A 5JYOA 4E04A 1O07A 3OOVA 1YLWA 2AVXA 1FOFA 2PBDP 5DFYA 3F1PB 1CEFA 4MN5A 3LCEA 5L09A 3GR2A 1ZKJA 3CUEC 1BLCA 2V0UA 2HP9A 1LL8A 3C8CA 3HJKA 2WGVA 3UE1A 2PRFA 2Y8HA 3VFHA 4ME4A 3UPOA 4DRTA 4L9FA 3QP1A 3LUQA 4OPQA 3RTYA 3PBTA 4BMWA 1K55A 2Q9MA 2WK0A 2P04A 4DJ3A 3HVFA 4EEUA 2Y91A 4E3IA 4F3LA 3IX8A 1O7EA 2B18A 3IBRA 4EERA 3CAXA 2G2WA 4PMAA 3H9WA 2ZQ8A 4HESA 3ZCZA 3IS2A 4OOMA 4QWOA 1ZG4A 4S2MA 1U60A 2KX6A 1I2SA 5L8MA 4Y0OA 3KSIA 2XDMA 3M2JA 4K08A 2I9VA 3T4QA 4LGWA 1E3UD 3K3DA 3PXPA 3SOIA 3IX4A 4IJGA 2ZQCA 3CI6A 5A90A 5FAOA 4AFIA 3IHAA 4ESPA 3F1NA 5EE8A 1EI5A 1K0KA 3E4QA 3FV7A 4D60A 1GHMA 3IQAA 4FUWA 3MXQA 1F9IA 4B4ZA 4JF4A 3RXXA 1DJCA 1GHIA 1YQSA 1OT9A 1H5XA 4IHQA 1BLSA 1ERQA 2O9CA 3Q07A 2J80A 4X55A 4GB7A 1W5DA 3NY4A 3LY4A 1FR6A 2WKEA 3KYQA 3EGDC 4E6WA 3ISGA 2ZC7A 2A3UA 3NULA 4O8GA 1G68A 2O9AA 2ZC5B 1Z6FA 3G6OA 2FH5A 5HWWA 5C5KA 3UB6A 2VGJA 2OSUA 2XA7S 1FCMA 2Q0OA 3D3OA 1OJ5A 1OTAA 5A91A 1ACFA 4Q0HA 1YKDA 2UV0E 3HUOA 5EVIC 3CPTB 1VEUA 5FQ9A 1LLBA 2V20A 1SHVA 2PDRA 2J3TD 3S7PA 4R4RA 4JXSA 3G35A 3ZG9B 1K6SA 1LSXA 4WBGA 5FATA 5GHZA 4S2NC 4P0MA 1QMEA 3CJMA 2DMWA 3E4PA 2VZWA 5FASA 5KIZA 2RL3A 2IWBA 2ZBBA 1VQQA 3WS0A 2NUPC 5HDSA 4B93A 3P7NA 3OCNA 1VHMA 2JHEA 3MQOA 4UHUA 5DF8A 3UB5P 3BM6A 3T12B 4HJ4A 5KSHA 3MZEA 5EV0A 4PHTA 3HLBA 2X71A 4JGOA 4HBTA 1KGEA 4M4XA 5CEDA 4BJPA 2V9AA 2Y79A 3BECA 3H82B 4RYEA 2D02A 4HJ3A 3W4QA 1MY8A 3NI9A 3KYEA 3VFFA 3W8KA 3JYIA 4KG5A 5AVEA 1G5UA 4EU0A 5DF7A 4I3AA 3VP3A 5TJJA 3VSKA 3VP0A 4HH3A 3BY8A 2LB9A 4JLFA 4P87A 2EX8A 5CGWA 4DE2A 3IH8A 1IELA 1SKFA 3V5MA 2EXAA 2HDQA 3O3VA 3OPHA 2OAP1 1IKIA 4WYYA 2XFSA 3IF5A 4HH2A 4IBXA 3VP4A 2VJWA 4KZ8A 1N9LA 2WZXA 3VP1A 4NKPA 2WAEA 2P74A 3T4OA 3U4LP 4EBLA 1N9NA 1HD8A 2A24B 1EROA 2ZQAA 5G4YA 4YFMA 5GLDA 1V9YA 4GOGA 4X53A 4YOFA 3U2AA 2JN7A 5EM0A 3BFDA 3PBSA 1H8YA 4S2KA 3UPPA 4KUOA 4PM6A 5KSCA 1JWZA 3FKWA 1YLZA 4IVIA 4QY5A 3ZG0A 2DCFA 4NXBA 5EOEA 2ZQDA 3ZG8B 3V3SA 3GDIA 3TE8A 4WEJA 4WUJA 1LI0A 2VGKA 3E2KA 3VE3A 2WADA 1K54C 1CI8A 1TVFA 3NJAA 4KZ4A 3NBLA 4ARZB 2H28A 4S2IA 2V2FF 1Q2QA 2QKPA 4PKYA 3TRCA 2VK3A 4CQHA 1PW8A 3MZDA 3OPLA 3R7WB 3BYDA 3C4OA 2L1MA 4Y3IA 2JKTM 3EWKA 4HQAA 4HHDA 5DJTA 3DW0A 2M7UA 1E4DA 1ESIA 1GA9A 1M40A 1MWUA 3CWFA 4Q0JA 2HV1A 3K2NA 4MN7A 2H5SA 1K6RA 4BL2A 5M19A 3A3FA 4KZ6A 5HAPA 1K4FA 1TD5A 4FH2A 4E6XA 1PI5A 4KUKA 4Y2FA 1D7EA 3QP8A 3BEBA 4GHIB 4IUKA 5EVIB 2WYXA 4NXEA 3W2ZA 4N9LA 1LHYA 4Y17A 4LV1A 3SH9A 3ZFZA 1I2WA 4FOFA 2VV8A 3Q81A 4LRXC 3DTKA 4RX3A 3V39A 3DBAA 3VMAA 2OLVA 2B95A 3B47A 2ZL1B 3P01A 4EW7A 1OMEA 2PU4A 3TW8A 2JKGA 1YLTA 4WMCD 4QD4A 4QPRA 3MZFA 4CJNA 2J3TC 1Y4OA 4OVDA 3NECA 5I94A 4EESA 1PFLA 1S4RA 3H82A 3S1YA 3LEZA 3S7QA 4KZ9A 1S1ZA 3LIEA 3I7JA 3KSGA 1VETB 2H0TA 4O01A 4KZ5A 1TS7A 3FG8A 2V1AA 4LRYC 2E8IA 5CX7A 5L07A 5CTNA 3OPPA 2M1CA 4GW9A 1MKMA 4MNRA 3CUEA 3BFCA 4DDSA 2PHYA 4BBTA 1WE4A 3HLFA 1NLYA 3E0YA 1IYOA 4U0TA 1W8YA 1K56A 2EXBA 1MBLA 1G6OA 4XUXA 4S2PA 1MPLA 2INWA 1IYQA 4DKIA 3TSGA 1T1CA 2W3EA 3PAEA 4NETA 4Z9QA 3SS3A 4E3MA 5F68A 3T1XA 1L0GA 4Y0UA 4B9OA 3D72A 4LV2A 4UAAA 4UA6A 1X0OA 1FCNA 3OPRA 4G3WA 3LR5A 2HF6A 3PHYA 2Z6DA 2K2NA 1ZTUA 5DF9A 4XXRA 5J4EA 3CITA 4DE0A 4X69A 2W1TA 1LSVA 1J3WA 2WGIA 3VSLA 1PIOA 2IWDA 2J9PA 4L9EA 4BL3A 1YM1A 4JBFA 5IHVA 3Q7VB 3N8LA 3TG9A 1S1YA 5GLAA 2DRWA 1LL5A 5CHMA 3ULFA 3QP4A 4ARZA 2ZQ7A 3ZHHA 5DVAA 4E3KA 2PD7A 2A2LA 2PYRA 1NJ4A 1DY6A 4LLOB 1S67L 4GD6A 1YLJA 5GLBA 1IYPA 3M6HA 3UB8A 3R7WA 2VEAA 3D4FA 4ZTKA 3WS1A 4XT2A 1MWTA 4EBNA 2VA0A 1F98A 3JVUA 4I3JA 2XA7M 1YPRA 2HP6A 5J7EA 1H8MA 4UA9A 4KZAA 4GDBA 2OWHA 1JNUA 3D9YA 2Y2MA 4R6LA 1GCEA 1W63M 2OWJA 2W3FA 2Y2JA 4RA7A 4GHIA 2O9BA 5EVIA 5J3WA 3PR6A 3C30A 2Y2HA 5CXWA 5EPHA 3UPNA 4EUVA 4ZBEA 2YKFA 1XJ6A 1NY0A 4YNRA 4ZJ1A 3KO6A 2ZL1A 1KE4A 1S66L 4R38A 1G28A 3WS4A 4GKUA 4S2NA 5HPIA 4E3OA 3C38A 3EQUA 1TF1A 2XLNA 2E8JA 5A93A 4OLGA 2YKHA 4KG6A 3LI8A 3OBFA 1W79A 4DF6A 2FZ0A 4EWFA 3F1OA 3MKFA 4G3VA 4QU3A 1YLYA 4PM8A 1VETA 5CHJA 4YINA 4HI4A 3BQAA 1ZC2A 4CPKA 3HUMA 1TS6A 5CRFA 2V8FA 3UNWA 1ES5A 5A8BA 1L3LA 1KE0A 2ZC6B 3T50A 3IT9A 3VP2A 2Z6CA 4FSFA 2XD1A 3FKVA 5AQ9A 3T1SA 3NDEA 2KOIA 4CLCE 4P6ZM 4UQIM 3N6IA 1T18A 4L9GA 1K4EA 4R70A 4N92A 2MJ6A 3LIAA 3IX3A 4NK3A 3GSGA 1L0DA 3HL9A 4S2OA 3EOIA 2WKPA 3ZVTA 1PYYA 3K3CA 3MSHA 4WM9A 1ESUA 3MR0A 4PKYG 4NEED 2XR0A 5L10A 4A5RA 3SS4A 1WA9A 5DTSA 3NC8A 5DKKA 3DTMA 1TDGA 2CMNA 3N4IA 3BY9A 3DAVA 4X68A 1GSXA 3MS6A 3Q7VA 2XD5A 2PT7A 2Z2LB 1UGUA 4DMZA 1NRJA 1TS0A 2O99A 3N8RA 2WKIA 4OQ0A 4UEYA 3FWLA 4WF0A 3ZYTA 4DXCA 3UB9A 3DWZA 3PAGA 5FQKA 3ZGAB 1OTIA 1LT0A 2ZC3B 2V1ZA 4N1XA 4H6JB 2FFYA 4CLCD 5KZHA 1LI9A 4P6BA 1E3UA 1E25A 4OH0A 3S22A 3NOUC 5EOOA 3LIBA 5HWTA 4KQDA 3EGXC 2BLSA 2R78A 1A0KA 5HZHA 1T1AA 2Y2QA 1CJFA 1K54A 1KOUA 1Q2PA 2PAVP 1V9ZA 4ZRRA 4E3JA 1D1JA 2C6WB 5GHXA 4MN6A 1PZOA 2VKSA 4UA7A 2PYPA 2HP5A 4WZ5C 2L4RA 3FPWA 3A0RA 5CTMA 5I5LA 4DE1A 5FI7A 2HJ9C 4PM7A 1XJ2A 1P9WA 1L2SA 2JKRM 4OQIA 5FL3A 2JC7A 3MBZA 2EFUA 3Q82A 3DWKA 4HBUA 1MWRA 3MMHA 4FH4A 3HCYA 2R9XA 1BLHA 3L9KA 2XEPA 2B02A 4JPMA 5FA7A 1MKIA 3DTEA 3UE0A 4QY6A 3G2ZA 4NXFA 3A3DA 4D2OA 1L0EA 3LYXA 4X1LA 1DP9A 4OLDA 1BTLA 2WGWA 3C7UA 4HP9A 2BASA 2I72A 5F6AA 1FQGA 4KENB 4RVAA 5FAQA 2W1TB 3HLDA 3BLSA 1N4OA 1FR1A 3GTCA 4GN2A 4R3AA 3IWOA 2K31A 3SZTA 2IA2A 5AQAA 1ERMA 3GRJA 1BYWA 4PM9A 3R4KA 2W3DA 3ICYA 3MFXA 1Y54A 3FZCA 4IEDA 5AQBA 4KQRA 3LR0A 4ZJ2A 1W63Q 1KVMA 1GHPA 4C6YA 3GV9A 4XT2B 3BW6A 3T4JA 1OPXA 1LSWA 3GVBA 1NZOA 4I5SA 4Y7PA 1VB6A 4WN5A 4X25A 3MXSA 2Y2IA 1JTGA 1NLZA 4CLCA 4II7A 5EUAA 1H8ZA 2XK1A 4DN0A 3IBJA 3G2YA 4OPRA 2GJ3A 3WS5A 2JE5A 2XSSA 4JGRA 4R4SA 4S2JA 2OAQ1 4MEZA 4WELA 3S4XA 4B4XA 5FI2A 2XRNA 2WKQA 4NXGA 3E4OA 3EEAA 5F1FA 3GECA 3OCLA 1XP4A 4LPZA 1JVJA 3RJUA 3QNCA 4EETB 1OTEA 4H6JA 4HNBA 4MBKA 3T4TA 1SKOA 3A3JA 2WUQA 4K0XA 4Y5FA 2HJEA 5CECA 1G6AA 1FCOA 4KQQA 3PBNA 4Q8IA 1KDWA 4HY8A 4ZJ3A 1NXYA 1N9BA 4K0WA 3F1OB 1F5MA 4HJ6A 1OTBA 1PZPA 1W8QA 2V1BA 3W4OA 3FC7A 3W4PA 3EQVA 3VE4A 5DKLA 2P9VB 4R23A 1CQAA 3QP6A 1T1BA 4LV0A 1GSWA 1TEMA 5D3OA 3O87A 4PM5A 4OKPA 1LL9A 4XUZA 5HARA 1YSPA 2RCXA 4ETXA 1K57C 3ZQ5A 4WL9A 1IYSA 5IU1A 1WYCA 4X6TA 2BG1A 3IXHA 3HREA 1I5QA 5DTTA 5TGFA 2M7VA 3JPUA 3ZDJA 4CLCC 2EX2A 2XH9A 1XA7A 3RFBA 4ZAMA 1MC0A 3HUNA 2Y55A 3C4PA 2ACGA 3B3XA 1CEGA 1YMSA 3P98A 4JXWA 4G3KA 1DJBA 1YSQA 2P7JA 2H0YA 2G2UA 1TS8A 2EWVA 4L0LA 1S4SA 1IFQA 1PI4A 5AJGA 3CHWP 1P97A 2EWWA 1XPBA 4IUHA 4JGQA 4WLAA 2W1RA 4Q0IA 2BTFP 3Q7ZA 2G7UA 1FSYA 3HLWA 1NWZA 5FEGA 1PWGA 5HWVA 4EV4A 5TBMB 2ZM2A 2Y2GA 3GMWA 3IXBA 4MLLA 1YT4A 2KDKA 2PD8A 4EEPA 4OP8A 2VGLS 2ZOHA 1AWIA 4QJGA 3AGFA 5FQJA 4IBRA 5F1GA 4MBHA 5F69A 4OOLA 4OOYA 2XGNA 3MQ0A 4BQMA 5BOHA 3QNBA 4X56A 5HX9A 5E2EA 5GLCA 5GHYA 3OLOA 4WZ4A 3ITAA 4OPYA 3MQQA 3CG5A 2ZMFA 1WYBA 3N8SA 4LCMA 1SDNA 2ZOIA 3A0SA 3KYZA 3LR4A 1XFQA 2QPNA 5DJUA 3V50A 1C3BA 4E3LA 1XX2A 4R0QA 3PYPA 5LBRA 2JKRI 4LENA 4WMCA 3SH7A 1KVLA 3BQ8A 4K91A 4E3NA 3IF6C 1YAXA 5AQ7A 1XKZA 3G31A 4JGPA 3B42A 1J9MA 3B33A 1UWPX 2NUTC 1FSWA 3G34A 3JVVA 4QHCA 2R9WA 4KG2A 1F2KA 4ZDXA 4ID4A 3O88A 1BZAA 3BRMA 2DNSA 5EECA 3BFEA 4BLMA 2B5RA 2Q9NA 2WZZA 5F82A 4RQ9A 1CI9A 4DDYA 3VOLA 4IVKA 4EQIA 3HLEA 5E2GA 5EM1A 4OQGA 5MC7A 5J8XA 1CK3A 1P9RA 1ZHHB 5F83A 3A0VA 2JBFA 3C2WA 3C5AA 4PAUA 3RH8B 4B88A 5TFQA 2ZMVA 2P9VA 2WGWB 1L0FA 4FD8A 1ONGA 2WKRA 1RCJA 5E43A 3UY6A 1N9OA 3LI9A 3M2KA 3TOIA 2W27A 2Y2LA 1IOUA 4BD0A 2V0WA 2GZAA 3HLGA 1D06A 4R1GA 2JKTI 3WRZA 2HGVA 4JXGA 2QZ6A 3ZG7B 4GD8A 5FQMA 1XJ4A 1XXMA 4FTXA 3OZHA 5HFOA 1BUEA 1Z09A 3HJIA 3V67A 5FQIA 3OC2A 1UWNX 2X02A 4GDNA 5CGSA 3O5YA 3QP2A 1K55C 5HL6A 3E98A 4EQ1A 3VOYA 4DXBA 2QHKA 4WZ5A 2Y2OA 4F94A 3AGDA 2QJ7A 4MBFA 5FI6A 1S6RA 5HD3A 3RXWA 3IWQA 4ETZA 5HL1A 4CLCB 2PU2A 5L2FA 5TBMA 2L0WA 5U47A 2ZM8A 1S0WA 2VLGA 3LEQA 4NG2A 2J9OA 2JCHA 2W3HA 4Y13A 1XFNA 2H10A 3LY3A 3NHQA 1MXOA 3P09A 1NZUA 2XF3A 2ZMAA 2OOLA 3ZNTA 3A3EA 4FCFA 3C7VA 3LGOA 3UB7A 1MWSA 3UE3A 5HD5A 4O0PA 1XGJA 5E2HA 2GNXA 1DJAA 1SKOB 2VV6A 4I39A 4LCLA 3WS2A 2P08A 3F1PA 1YLPA 3O86A 1H0MA 3CZDA 1QMFA 5CEBA 2PR5A 3S7NA 1PWCA 1FILA 3L7HA 4WEKA 3Q1FA 4R3BA 2J7VA 5FEFA 4OP5A 5GL9A 2Y59A 2CC1A 4JXVA 3KX0X 4GS9B 2XROA 4LRZE 1IEMA 2QJ5A 3H7WB 1BSGA 1NYMA 3SW1A 3UDIA 4O7DA 4MDZA 1BT5A 1RP5A 3KSHA 3PBQA 5IS1A 5FDHA 5E2FA 1HLUP 4LV3A 4P6ZS 4UQIS 2ZQ9A 2GDNA 2ZJ9A 4KZBA 3G32A 3PBOA 2VX8A 2K7SA 3UDXA 4LFUA 5DFXA 2FFFB 3UMDA 3IF6B 2Y2NA 3S7OA 4Y15A 5EVEA 3LICA 5CHUA 5EVLA 4N9KA 1YMXA 4EBPA 3LO7A 2QYBA 3T4LA 3TJZC 3T4SA 2PR6A 4N1HA 1ALQA 4DE3A 5K5BA 4Z1WA 5FAPA 1HVBA 2Y2KA 2UWXA 1M6KA 3ZG5A 3LFVA 2J8YA 2W0NA 2X01A 5HAIA 3ZVWA 4YWZA 3BFGA 5HSQA 4HOIA 1SDEA 5G18A 3UO9A 1HTZA 5HAQA 1RGYA 3ITBA 4GLQA 5FSRA 1EWZA 1K56D 2ZD8A 4HP4A 3IWIA 4BD1A 1JWVA 3G4PA 1Y28A 1BLPA 4GNUA 4HIAA 1W7FA 4I3IA 1PRQA 3NIAA 4U0XA 1ES4A 3DTIA 4P85A 3MKEA 4S2LA 3V3RA 5HPFA 3A3IA 1PWDA 3FYZA 4M3KA 4BBUA 1ES2A 1NRFA 4GJ4A 1K57A 2HPBA 3LIFA 4OONA 3QHYA 3PTEA 2JKFA 3IH9A 1JWPA 1HZOA 3VV4A 2EX9A 1DP6A 3N7WA 3HLCA 3CPTA 3M6BA 1P0ZA 2KLIA 4KZ3A 2EFXA 3UDFA 1XA1A 4EXOA 3GQZA 4MCWA 1H3QA 4Y0TA 4QB8A 5FDSA 1CF0A 2HDSA 4U3TA 3MFDA 3E2LA 1PNEA 1SZVA 2EA9A 5M1AA 2OLUA 2HDUA 3T1QB 1ZG6A 1DRMA 1KE3A 3CMZA 4F3LB 3EEHA 5JYPA 3SS5A 1BULA 4R3JA 5HW3A 5CGXA 1JTDA 2C5WB 4H8RA 2GX5A 2VGLM 4BBVA 5AVFA 2J3WA 3FPVA 1TDLA 2OV5A 3IS2B 4GZBA 1K25A 1OT6A 2D01A 4DJ2A 2VV7A 3LIDA 4OQHA 3MJQA 4C3QA 2O0YA 5FQQA 2XQZA 2HZ5A 4KQOA 4GS9A 3BLMA 3F1NB 2IWCA 3H7WA 1FIKA 1KGGA 4OPZA 2V8CA 3IXDA 3UE6A 4X1MA 5A92A 2HDRA 3NOPC 1ODVA 3HBRA 3MF0A 5IT5A 5EVID 4EUZA 1SCWA 2WAFA 4BWIA 3BFFA 3IHBA 4RX2A 1AXBA 1NYYA 2WKHA 3G30A 3WRTA 1K38A 3NOTC 3NCKA 1PW1A 4JF5A 1IKGA 2ZM0A 3WWXA 1EW0A 3IF6A 1ONHA 3UN7A 2W3GA 3BJNA 3KSFA 1VM1A 2LB5A 5DTKA 5G4ZA 3CLOA 3T1RA 3IXGA 5HDDA 1GA0A 1STZA 2ZC4B 3PBRA 4BENA 3AGEA 1OTDA 5TR7A 3MXRA 2QMIA 3VOZA 3QP5A 5HDCA 1DP8A 4C75A 2XFTA 3LR3A 2A24A 4MMNA 1XJ3A 1GSVA 1VEUB 1OJGA 4GCZA 3UMEA 2Z2MB 3ZNYA 3BWLA 3T4KA 5CERA 5EFWA 4JKTA
chains in the Genus database with same CATH topology
4KZ6A 1PZOA 2A49A 5HAPA 4HEFA 1K4FA 4KZ7A 4UA7A 5M18A 4FH2A 1KDSA 4BD0A 2HP5A 4E6XA 4PPRA 1PI5A 4WZ5C 3HLGA 4R1GA 5CTMA 2PBYA 1RGZA 3WRZA 4JF6A 4JXGA 4DE1A 2QZ6A 5FI7A 3BEBA 4GD8A 5FQMA 3ZG7B 5KMWA 1XGIA 5EVIB 4PM7A 2WYXA 1KGFA 2Y4AA 2Y2PA 1L2SA 4N9LA 1LHYA 3NDGA 1XXMA 4LV1A 4OQIA 3OZHA 3SH8A 5HFOA 3SH9A 1BUEA 1ES3A 1I2WA 3ZFZA 3Q81A 2ZLYA 2EX6A 2JC7A 3MBZA 2EFUA 5FQIA 4RX3A 3OC2A 3Q82A 5JYOA 3V39A 2X02A 3DWKA 1O07A 4HBUA 1YLWA 1MWRA 4GDNA 2OLVA 3VMAA 5CGSA 1FOFA 1OMEA 4FH4A 1K55C 1CEFA 2R9XA 2PU4A 1BLHA 3VOYA 4DXBA 4WZ5A 2Y2OA 4F94A 2XEPA 3AGDA 3LCEA 1YLTA 4WMCD 4JPMA 4QD4A 3MZFA 5FA7A 4MBFA 1MKIA 3GR2A 1ZKJA 4CJNA 3UE0A 4OVDA 1S6RA 3G2ZA 4QY6A 1BLCA 5FI6A 2HP9A 3A3DA 3RXWA 4D2OA 5I94A 2WGVA 1L0EA 3UE1A 3S1YA 4OLDA 3VFHA 1BTLA 3IWQA 2WGWA 3C7UA 3LEZA 4KZ9A 2I72A 3UPOA 4DRTA 5HL1A 1FQGA 2PU2A 5L2FA 4KENB 3I7JA 4OPQA 3PBTA 2H0TA 1K55A 2Q9MA 4KZ5A 2WK0A 4RVAA 5FAQA 3HVFA 2ZM8A 5U47A 1S0WA 3HLDA 2Y91A 4E3IA 2J9OA 2JCHA 2E8IA 5CTNA 3OPPA 2H10A 3LY3A 4MNRA 3BLSA 3BFCA 1N4OA 1FR1A 1O7EA 4DDSA 1WE4A 1MXOA 2G2WA 3GTCA 4PMAA 3P09A 1NZUA 2ZQ8A 3HLFA 2XF3A 4GN2A 4HESA 2ZMAA 3ZCZA 4OOMA 3ZNTA 3A3EA 3IWOA 1IYOA 1ZG4A 4S2MA 4U0TA 1U60A 1W8YA 4FCFA 1K56A 2EXBA 3C7VA 1MBLA 1ERMA 1I2SA 1MWSA 3GRJA 5AQAA 3UE3A 4PM9A 4XUXA 4Y0OA 4S2PA 2XDMA 3M2JA 1XGJA 1MPLA 5E2HA 1Y54A 3FZCA 1IYQA 4IEDA 1E3UD 1DJAA 4DKIA 3TSGA 3PAEA 4LCLA 5AQBA 3WS2A 4NETA 4Z9QA 4KQRA 4ZJ2A 3SS3A 1YLPA 3O86A 3SOIA 4E3MA 3CZDA 1QMFA 2ZQCA 5CEBA 5A90A 5FAOA 1KVMA 1PWCA 1GHPA 1L0GA 4C6YA 4Y0UA 3GV9A 3IHAA 4WEKA 4LV2A 3Q1FA 4R3BA 4UAAA 4UA6A 2J7VA 5EE8A 1EI5A 3GVBA 1NZOA 4OP5A 5GL9A 3FV7A 4Y7PA 1FCNA 3OPRA 2Y59A 1GHMA 2CC1A 3IQAA 3MXSA 4JXVA 4B4ZA 2Y2IA 1JTGA 1IEMA 4JF4A 3RXXA 1BSGA 5EUAA 1H8ZA 1NYMA 2XK1A 4XXRA 5DF9A 1DJCA 3G2YA 4DE0A 1GHIA 4OPRA 4X69A 3UDIA 3WS5A 2WGIA 3VSLA 1YQSA 1H5XA 1PIOA 4O7DA 2JE5A 2IWDA 1BLSA 1BT5A 1ERQA 1RP5A 2J9PA 4BL3A 1YM1A 3PBQA 4R4SA 3Q07A 4JBFA 4S2JA 5FDHA 4X55A 5IHVA 4GB7A 4MEZA 5E2FA 4WELA 3S4XA 4B4XA 5FI2A 1W5DA 3NY4A 3Q7VB 4LV3A 3LY4A 1FR6A 2WKEA 4E6WA 3N8LA 2ZQ9A 3ISGA 2ZC7A 3TG9A 2GDNA 2A3UA 5GLAA 2ZJ9A 4KZBA 3G32A 3PBOA 2DRWA 5F1FA 3OCLA 1LL5A 1XP4A 5CHMA 3UDXA 1JVJA 2FFFB 3RJUA 1G68A 3IF6B 2Y2NA 2ZQ7A 3QNCA 3ZHHA 4MBKA 2ZC5B 5DVAA 4E3KA 1Z6FA 5CHUA 1NJ4A 1DY6A 3A3JA 2WUQA 1YMXA 4K0XA 4N9KA 5EVLA 4EBPA 5CECA 4GD6A 1G6AA 1YLJA 1FCOA 4KQQA 3LO7A 3PBNA 5GLBA 4Q8IA 1IYPA 1KDWA 2VGJA 3M6HA 2OSUA 1FCMA 4ZJ3A 4N1HA 3D4FA 4ZTKA 1ALQA 5A91A 4DE3A 3WS1A 1NXYA 1N9BA 1MWTA 4K0WA 5FAPA 4EBNA 3HUOA 5EVIC 1HVBA 1PZPA 1W8QA 2Y2KA 5FQ9A 2UWXA 3W4OA 3W4PA 1LLBA 2V20A 2HP6A 3EQVA 1M6KA 2P9VB 4R23A 1SHVA 3ZG5A 2J8YA 4R4RA 4LV0A 2X01A 4JXSA 5HAIA 3ZVWA 4UA9A 1TEMA 3G35A 4KZAA 5D3OA 4GDBA 3ZG9B 3BFGA 3O87A 1K6SA 4PM5A 4OKPA 1LL9A 1SDEA 4WBGA 4XUZA 5FATA 5G18A 5HARA 3UO9A 5GHZA 4S2NC 4P0MA 1HTZA 2Y2MA 1QMEA 2RCXA 5HAQA 1RGYA 3CJMA 3ITBA 5FSRA 1GCEA 2Y2JA 1EWZA 1K57C 4RA7A 5FASA 1K56D 2RL3A 2IWBA 5EVIA 1VQQA 1IYSA 2ZD8A 3WS0A 1WYCA 4BD1A 4X6TA 2BG1A 2Y2HA 3IWIA 3IXHA 3HREA 1I5QA 1JWVA 5CXWA 5DTTA 5EPHA 5TGFA 3UPNA 3G4PA 4ZBEA 1NY0A 3ZDJA 1BLPA 3OCNA 4GNUA 1W7FA 2EX2A 4ZJ1A 3NIAA 2XH9A 1XA7A 1KE4A 1ES4A 4U0XA 4UHUA 4P85A 3MKEA 4S2LA 4ZAMA 3V3RA 3WS4A 3HUNA 4GKUA 4S2NA 2Y55A 3C4PA 4E3OA 5DF8A 3B3XA 3A3IA 3BM6A 1PWDA 3EQUA 3FYZA 4M3KA 1ES2A 5KSHA 1CEGA 1NRFA 1YMSA 3MZEA 3P98A 4JXWA 2XLNA 1K57A 2HPBA 4OONA 3QHYA 5A93A 3PTEA 1DJBA 2H0YA 2G2UA 3HLBA 4L0LA 4OLGA 4KG6A 3IH9A 2X71A 1PI4A 1W79A 4DF6A 4HBTA 1KGEA 1JWPA 1HZOA 5CEDA 4EWFA 4BJPA 2EX9A 3MKFA 3N7WA 4QU3A 1XPBA 3HLCA 1YLYA 3M6BA 3BECA 4PM8A 5CHJA 4KZ3A 3Q7ZA 2EFXA 3UDFA 4RYEA 1XA1A 3GQZA 4YINA 4Y0TA 1FSYA 4QB8A 3W4QA 1ZC2A 1MY8A 3HLWA 3NI9A 2HDSA 4U3TA 1PWGA 3MFDA 3VFFA 4CPKA 3HUMA 3W8KA 3E2LA 4EV4A 2ZM2A 3JYIA 5M1AA 2OLUA 2Y2GA 4KG5A 2HDUA 3GMWA 1ZG6A 5CRFA 3IXBA 1ES5A 1KE3A 3UNWA 4MLLA 1YT4A 3CMZA 4OP8A 1KE0A 2ZC6B 4QJGA 3IT9A 5DF7A 3AGFA 5FQJA 4IBRA 5F1GA 3VP2A 5JYPA 3VP3A 4MBHA 4FSFA 2XD1A 3FKVA 4OOLA 5AQ9A 3VSKA 4OOYA 2XGNA 3SS5A 1BULA 3VP0A 4R3JA 5HW3A 5CGXA 1JTDA 2C5WB 3NDEA 4H8RA 4JLFA 4P87A 4BQMA 5BOHA 2Y2LA 3QNBA 4X56A 5HX9A 5E2EA 2EX8A 5GLCA 2OV5A 1TDLA 5GHYA 3N6IA 1K4EA 5CGWA 4DE2A 3IH8A 4WZ4A 1IELA 4N92A 4GZBA 3ITAA 1K25A 1SKFA 4OPYA 3V5MA 2EXAA 2HDQA 3CG5A 4NK3A 1WYBA 3GSGA 3N8SA 3O3VA 4LCMA 1SDNA 1L0DA 3OPHA 1IKIA 3HL9A 4S2OA 4WYYA 3ZVTA 2XFSA 4OQHA 1PYYA 4C3QA 3IF5A 4IBXA 3VP4A 2QPNA 5FQQA 4KZ8A 2WZXA 3V50A 1C3BA 2XQZA 1XX2A 1K6RA 4E3LA 4R0QA 4KQOA 3VP1A 2WAEA 2P74A 4WM9A 3BLMA 4EBLA 4LENA 1HD8A 4WMCA 2IWCA 1KGGA 1ESUA 4OPZA 3SH7A 1KVLA 3IXDA 1EROA 2ZQAA 4K91A 4YFMA 4E3NA 5GLDA 5A92A 4GOGA 4X53A 3IF6C 2XR0A 2HDRA 5AQ7A 4A5RA 3SS4A 3BFDA 5DTSA 1XKZA 3HBRA 3NC8A 3PBSA 1H8YA 3G31A 4S2KA 3UPPA 3DTMA 1J9MA 1TDGA 5EVID 4PM6A 1FSWA 4EUZA 1SCWA 2WAFA 3G34A 5KSCA 3N4IA 3BFFA 3IHBA 1JWZA 4X68A 4QHCA 3FKWA 4RX2A 2R9WA 4KG2A 1YLZA 1AXBA 1NYYA 2WKHA 4ID4A 4IVIA 4ZDXA 3Q7VA 4QY5A 3O88A 3ZG0A 1BZAA 2DCFA 5EOEA 2ZQDA 2XD5A 3G30A 3BRMA 3WRTA 2DNSA 1K38A 2Z2LB 3ZG8B 3NCKA 1PW1A 5EECA 3V3SA 4JF5A 3BFEA 4BLMA 2B5RA 2Q9NA 2WZZA 1IKGA 5F82A 2ZM0A 2WKIA 3N8RA 3WWXA 4WEJA 4OQ0A 3FWLA 3IF6A 1LI0A 1ONHA 1CI9A 2VGKA 3E2KA 4DDYA 4EQIA 4IVKA 4DXCA 3DWZA 3UN7A 3PAGA 2WADA 3HLEA 5E2GA 5FQKA 1K54C 3ZGAB 4OQGA 1VM1A 2ZC3B 1CI8A 1TVFA 5M19A 2V1ZA 5J8XA 1CK3A 4KZ4A 5DTKA 3NBLA 4S2IA 2V2FF 4N1XA 3IXGA 5F83A 1Q2QA 2FFYA 2JBFA 1GA0A 5KZHA 2ZC4B 1LI9A 1PW8A 3PBRA 4P6BA 4BENA 1E3UA 3C5AA 1E25A 3MZDA 4OH0A 3S22A 3AGEA 5TR7A 5EOOA 3MXRA 2QMIA 3VOZA 3OPLA 4B88A 3BYDA 5TFQA 2P9VA 2BLSA 2WGWB 1L0FA 3C4OA 4C75A 4FD8A 2XFTA 1ONGA 2Y2QA 1K54A 1RCJA 5E43A 3UY6A 3DW0A 1Q2PA 3ZNYA 2Z2MB 3M2KA 3TOIA 1E4DA 1ESIA 1GA9A 1M40A 1MWUA 5CERA 4JKTA 4E3JA 2H5SA 2C6WB 4BL2A 5GHXA 3A3FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KZ6 A;  1PZO A;  2A49 A;  5HAP A;  4HEF A;  1K4F A;  4KZ7 A;  4UA7 A;  5M18 A;  4FH2 A;  1KDS A;  4BD0 A;  2HP5 A;  4E6X A;  4PPR A;  1PI5 A;  4WZ5 C;  3HLG A;  4R1G A;  5CTM A;  2PBY A;  1RGZ A;  3WRZ A;  4JF6 A;  4JXG A;  4DE1 A;  2QZ6 A;  5FI7 A;  3BEB A;  4GD8 A;  5FQM A;  3ZG7 B;  5KMW A;  1XGI A;  5EVI B;  4PM7 A;  2WYX A;  1KGF A;  2Y4A A;  2Y2P A;  1L2S A;  4N9L A;  1LHY A;  3NDG A;  1XXM A;  4LV1 A;  4OQI A;  3OZH A;  3SH8 A;  5HFO A;  3SH9 A;  1BUE A;  1ES3 A;  1I2W A;  3ZFZ A;  3Q81 A;  2ZLY A;  2EX6 A;  2JC7 A;  3MBZ A;  2EFU A;  5FQI A;  4RX3 A;  3OC2 A;  3Q82 A;  5JYO A;  3V39 A;  2X02 A;  3DWK A;  1O07 A;  4HBU A;  1YLW A;  1MWR A;  4GDN A;  2OLV A;  3VMA A;  5CGS A;  1FOF A;  1OME A;  4FH4 A;  1K55 C;  1CEF A;  2R9X A;  2PU4 A;  1BLH A;  3VOY A;  4DXB A;  4WZ5 A;  2Y2O A;  4F94 A;  2XEP A;  3AGD A;  3LCE A;  1YLT A;  4WMC D;  4JPM A;  4QD4 A;  3MZF A;  5FA7 A;  4MBF A;  1MKI A;  3GR2 A;  1ZKJ A;  4CJN A;  3UE0 A;  4OVD A;  1S6R A;  3G2Z A;  4QY6 A;  1BLC A;  5FI6 A;  2HP9 A;  3A3D A;  3RXW A;  4D2O A;  5I94 A;  2WGV A;  1L0E A;  3UE1 A;  3S1Y A;  4OLD A;  3VFH A;  1BTL A;  3IWQ A;  2WGW A;  3C7U A;  3LEZ A;  4KZ9 A;  2I72 A;  3UPO A;  4DRT A;  5HL1 A;  1FQG A;  2PU2 A;  5L2F A;  4KEN B;  3I7J A;  4OPQ A;  3PBT A;  2H0T A;  1K55 A;  2Q9M A;  4KZ5 A;  2WK0 A;  4RVA A;  5FAQ A;  3HVF A;  2ZM8 A;  5U47 A;  1S0W A;  3HLD A;  2Y91 A;  4E3I A;  2J9O A;  2JCH A;  2E8I A;  5CTN A;  3OPP A;  2H10 A;  3LY3 A;  4MNR A;  3BLS A;  3BFC A;  1N4O A;  1FR1 A;  1O7E A;  4DDS A;  1WE4 A;  1MXO A;  2G2W A;  3GTC A;  4PMA A;  3P09 A;  1NZU A;  2ZQ8 A;  3HLF A;  2XF3 A;  4GN2 A;  4HES A;  2ZMA A;  3ZCZ A;  4OOM A;  3ZNT A;  3A3E A;  3IWO A;  1IYO A;  1ZG4 A;  4S2M A;  4U0T A;  1U60 A;  1W8Y A;  4FCF A;  1K56 A;  2EXB A;  3C7V A;  1MBL A;  1ERM A;  1I2S A;  1MWS A;  3GRJ A;  5AQA A;  3UE3 A;  4PM9 A;  4XUX A;  4Y0O A;  4S2P A;  2XDM A;  3M2J A;  1XGJ A;  1MPL A;  5E2H A;  1Y54 A;  3FZC A;  1IYQ A;  4IED A;  1E3U D;  1DJA A;  4DKI A;  3TSG A;  3PAE A;  4LCL A;  5AQB A;  3WS2 A;  4NET A;  4Z9Q A;  4KQR A;  4ZJ2 A;  3SS3 A;  1YLP A;  3O86 A;  3SOI A;  4E3M A;  3CZD A;  1QMF A;  2ZQC A;  5CEB A;  5A90 A;  5FAO A;  1KVM A;  1PWC A;  1GHP A;  1L0G A;  4C6Y A;  4Y0U A;  3GV9 A;  3IHA A;  4WEK A;  4LV2 A;  3Q1F A;  4R3B A;  4UAA A;  4UA6 A;  2J7V A;  5EE8 A;  1EI5 A;  3GVB A;  1NZO A;  4OP5 A;  5GL9 A;  3FV7 A;  4Y7P A;  1FCN A;  3OPR A;  2Y59 A;  1GHM A;  2CC1 A;  3IQA A;  3MXS A;  4JXV A;  4B4Z A;  2Y2I A;  1JTG A;  1IEM A;  4JF4 A;  3RXX A;  1BSG A;  5EUA A;  1H8Z A;  1NYM A;  2XK1 A;  4XXR A;  5DF9 A;  1DJC A;  3G2Y A;  4DE0 A;  1GHI A;  4OPR A;  4X69 A;  3UDI A;  3WS5 A;  2WGI A;  3VSL A;  1YQS A;  1H5X A;  1PIO A;  4O7D A;  2JE5 A;  2IWD A;  1BLS A;  1BT5 A;  1ERQ A;  1RP5 A;  2J9P A;  4BL3 A;  1YM1 A;  3PBQ A;  4R4S A;  3Q07 A;  4JBF A;  4S2J A;  5FDH A;  4X55 A;  5IHV A;  4GB7 A;  4MEZ A;  5E2F A;  4WEL A;  3S4X A;  4B4X A;  5FI2 A;  1W5D A;  3NY4 A;  3Q7V B;  4LV3 A;  3LY4 A;  1FR6 A;  2WKE A;  4E6W A;  3N8L A;  2ZQ9 A;  3ISG A;  2ZC7 A;  3TG9 A;  2GDN A;  2A3U A;  5GLA A;  2ZJ9 A;  4KZB A;  3G32 A;  3PBO A;  2DRW A;  5F1F A;  3OCL A;  1LL5 A;  1XP4 A;  5CHM A;  3UDX A;  1JVJ A;  2FFF B;  3RJU A;  1G68 A;  3IF6 B;  2Y2N A;  2ZQ7 A;  3QNC A;  3ZHH A;  4MBK A;  2ZC5 B;  5DVA A;  4E3K A;  1Z6F A;  5CHU A;  1NJ4 A;  1DY6 A;  3A3J A;  2WUQ A;  1YMX A;  4K0X A;  4N9K A;  5EVL A;  4EBP A;  5CEC A;  4GD6 A;  1G6A A;  1YLJ A;  1FCO A;  4KQQ A;  3LO7 A;  3PBN A;  5GLB A;  4Q8I A;  1IYP A;  1KDW A;  2VGJ A;  3M6H A;  2OSU A;  1FCM A;  4ZJ3 A;  4N1H A;  3D4F A;  4ZTK A;  1ALQ A;  5A91 A;  4DE3 A;  3WS1 A;  1NXY A;  1N9B A;  1MWT A;  4K0W A;  5FAP A;  4EBN A;  3HUO A;  5EVI C;  1HVB A;  1PZP A;  1W8Q A;  2Y2K A;  5FQ9 A;  2UWX A;  3W4O A;  3W4P A;  1LLB A;  2V20 A;  2HP6 A;  3EQV A;  1M6K A;  2P9V B;  4R23 A;  1SHV A;  3ZG5 A;  2J8Y A;  4R4R A;  4LV0 A;  2X01 A;  4JXS A;  5HAI A;  3ZVW A;  4UA9 A;  1TEM A;  3G35 A;  4KZA A;  5D3O A;  4GDB A;  3ZG9 B;  3BFG A;  3O87 A;  1K6S A;  4PM5 A;  4OKP A;  1LL9 A;  1SDE A;  4WBG A;  4XUZ A;  5FAT A;  5G18 A;  5HAR A;  3UO9 A;  5GHZ A;  4S2N C;  4P0M A;  1HTZ A;  2Y2M A;  1QME A;  2RCX A;  5HAQ A;  1RGY A;  3CJM A;  3ITB A;  5FSR A;  1GCE A;  2Y2J A;  1EWZ A;  1K57 C;  4RA7 A;  5FAS A;  1K56 D;  2RL3 A;  2IWB A;  5EVI A;  1VQQ A;  1IYS A;  2ZD8 A;  3WS0 A;  1WYC A;  4BD1 A;  4X6T A;  2BG1 A;  2Y2H A;  3IWI A;  3IXH A;  3HRE A;  1I5Q A;  1JWV A;  5CXW A;  5DTT A;  5EPH A;  5TGF A;  3UPN A;  3G4P A;  4ZBE A;  1NY0 A;  3ZDJ A;  1BLP A;  3OCN A;  4GNU A;  1W7F A;  2EX2 A;  4ZJ1 A;  3NIA A;  2XH9 A;  1XA7 A;  1KE4 A;  1ES4 A;  4U0X A;  4UHU A;  4P85 A;  3MKE A;  4S2L A;  4ZAM A;  3V3R A;  3WS4 A;  3HUN A;  4GKU A;  4S2N A;  2Y55 A;  3C4P A;  4E3O A;  5DF8 A;  3B3X A;  3A3I A;  3BM6 A;  1PWD A;  3EQU A;  3FYZ A;  4M3K A;  1ES2 A;  5KSH A;  1CEG A;  1NRF A;  1YMS A;  3MZE A;  3P98 A;  4JXW A;  2XLN A;  1K57 A;  2HPB A;  4OON A;  3QHY A;  5A93 A;  3PTE A;  1DJB A;  2H0Y A;  2G2U A;  3HLB A;  4L0L A;  4OLG A;  4KG6 A;  3IH9 A;  2X71 A;  1PI4 A;  1W79 A;  4DF6 A;  4HBT A;  1KGE A;  1JWP A;  1HZO A;  5CED A;  4EWF A;  4BJP A;  2EX9 A;  3MKF A;  3N7W A;  4QU3 A;  1XPB A;  3HLC A;  1YLY A;  3M6B A;  3BEC A;  4PM8 A;  5CHJ A;  4KZ3 A;  3Q7Z A;  2EFX A;  3UDF A;  4RYE A;  1XA1 A;  3GQZ A;  4YIN A;  4Y0T A;  1FSY A;  4QB8 A;  3W4Q A;  1ZC2 A;  1MY8 A;  3HLW A;  3NI9 A;  2HDS A;  4U3T A;  1PWG A;  3MFD A;  3VFF A;  4CPK A;  3HUM A;  3W8K A;  3E2L A;  4EV4 A;  2ZM2 A;  3JYI A;  5M1A A;  2OLU A;  2Y2G A;  4KG5 A;  2HDU A;  3GMW A;  1ZG6 A;  5CRF A;  3IXB A;  1ES5 A;  1KE3 A;  3UNW A;  4MLL A;  1YT4 A;  3CMZ A;  4OP8 A;  1KE0 A;  2ZC6 B;  4QJG A;  3IT9 A;  5DF7 A;  3AGF A;  5FQJ A;  4IBR A;  5F1G A;  3VP2 A;  5JYP A;  3VP3 A;  4MBH A;  4FSF A;  2XD1 A;  3FKV A;  4OOL A;  5AQ9 A;  3VSK A;  4OOY A;  2XGN A;  3SS5 A;  1BUL A;  3VP0 A;  4R3J A;  5HW3 A;  5CGX A;  1JTD A;  2C5W B;  3NDE A;  4H8R A;  4JLF A;  4P87 A;  4BQM A;  5BOH A;  2Y2L A;  3QNB A;  4X56 A;  5HX9 A;  5E2E A;  2EX8 A;  5GLC A;  2OV5 A;  1TDL A;  5GHY A;  3N6I A;  1K4E A;  5CGW A;  4DE2 A;  3IH8 A;  4WZ4 A;  1IEL A;  4N92 A;  4GZB A;  3ITA A;  1K25 A;  1SKF A;  4OPY A;  3V5M A;  2EXA A;  2HDQ A;  3CG5 A;  4NK3 A;  1WYB A;  3GSG A;  3N8S A;  3O3V A;  4LCM A;  1SDN A;  1L0D A;  3OPH A;  1IKI A;  3HL9 A;  4S2O A;  4WYY A;  3ZVT A;  2XFS A;  4OQH A;  1PYY A;  4C3Q A;  3IF5 A;  4IBX A;  3VP4 A;  2QPN A;  5FQQ A;  4KZ8 A;  2WZX A;  3V50 A;  1C3B A;  2XQZ A;  1XX2 A;  1K6R A;  4E3L A;  4R0Q A;  4KQO A;  3VP1 A;  2WAE A;  2P74 A;  4WM9 A;  3BLM A;  4EBL A;  4LEN A;  1HD8 A;  4WMC A;  2IWC A;  1KGG A;  1ESU A;  4OPZ A;  3SH7 A;  1KVL A;  3IXD A;  1ERO A;  2ZQA A;  4K91 A;  4YFM A;  4E3N A;  5GLD A;  5A92 A;  4GOG A;  4X53 A;  3IF6 C;  2XR0 A;  2HDR A;  5AQ7 A;  4A5R A;  3SS4 A;  3BFD A;  5DTS A;  1XKZ A;  3HBR A;  3NC8 A;  3PBS A;  1H8Y A;  3G31 A;  4S2K A;  3UPP A;  3DTM A;  1J9M A;  1TDG A;  5EVI D;  4PM6 A;  1FSW A;  4EUZ A;  1SCW A;  2WAF A;  3G34 A;  5KSC A;  3N4I A;  3BFF A;  3IHB A;  1JWZ A;  4X68 A;  4QHC A;  3FKW A;  4RX2 A;  2R9W A;  4KG2 A;  1YLZ A;  1AXB A;  1NYY A;  2WKH A;  4ID4 A;  4IVI A;  4ZDX A;  3Q7V A;  4QY5 A;  3O88 A;  3ZG0 A;  1BZA A;  2DCF A;  5EOE A;  2ZQD A;  2XD5 A;  3G30 A;  3BRM A;  3WRT A;  2DNS A;  1K38 A;  2Z2L B;  3ZG8 B;  3NCK A;  1PW1 A;  5EEC A;  3V3S A;  4JF5 A;  3BFE A;  4BLM A;  2B5R A;  2Q9N A;  2WZZ A;  1IKG A;  5F82 A;  2ZM0 A;  2WKI A;  3N8R A;  3WWX A;  4WEJ A;  4OQ0 A;  3FWL A;  3IF6 A;  1LI0 A;  1ONH A;  1CI9 A;  2VGK A;  3E2K A;  4DDY A;  4EQI A;  4IVK A;  4DXC A;  3DWZ A;  3UN7 A;  3PAG A;  2WAD A;  3HLE A;  5E2G A;  5FQK A;  1K54 C;  3ZGA B;  4OQG A;  1VM1 A;  2ZC3 B;  1CI8 A;  1TVF A;  5M19 A;  2V1Z A;  5J8X A;  1CK3 A;  4KZ4 A;  5DTK A;  3NBL A;  4S2I A;  2V2F F;  4N1X A;  3IXG A;  5F83 A;  1Q2Q A;  2FFY A;  2JBF A;  1GA0 A;  5KZH A;  2ZC4 B;  1LI9 A;  1PW8 A;  3PBR A;  4P6B A;  4BEN A;  1E3U A;  3C5A A;  1E25 A;  3MZD A;  4OH0 A;  3S22 A;  3AGE A;  5TR7 A;  5EOO A;  3MXR A;  2QMI A;  3VOZ A;  3OPL A;  4B88 A;  3BYD A;  5TFQ A;  2P9V A;  2BLS A;  2WGW B;  1L0F A;  3C4O A;  4C75 A;  4FD8 A;  2XFT A;  1ONG A;  2Y2Q A;  1K54 A;  1RCJ A;  5E43 A;  3UY6 A;  3DW0 A;  1Q2P A;  3ZNY A;  2Z2M B;  3M2K A;  3TOI A;  1E4D A;  1ESI A;  1GA9 A;  1M40 A;  1MWU A;  5CER A;  4JKT A;  4E3J A;  2H5S A;  2C6W B;  4BL2 A;  5GHX A;  3A3F A; 
#chains in the Genus database with same CATH topology
 2A49 A;  4HEF A;  4KZ7 A;  5M18 A;  1KDS A;  1T19 A;  4PPR A;  2PBY A;  1RGZ A;  4JF6 A;  1MZU A;  4I38 A;  5KMW A;  1XGI A;  1KGF A;  2Y4A A;  2Y2P A;  3NDG A;  5F5Y A;  3SH8 A;  1ES3 A;  2QWS A;  2ZLY A;  2EX6 A;  5JYO A;  4E04 A;  1O07 A;  3OOV A;  1YLW A;  2AVX A;  1FOF A;  2PBD P;  5DFY A;  3F1P B;  1CEF A;  4MN5 A;  3LCE A;  5L09 A;  3GR2 A;  1ZKJ A;  3CUE C;  1BLC A;  2V0U A;  2HP9 A;  1LL8 A;  3C8C A;  3HJK A;  2WGV A;  3UE1 A;  2PRF A;  2Y8H A;  3VFH A;  4ME4 A;  3UPO A;  4DRT A;  4L9F A;  3QP1 A;  3LUQ A;  4OPQ A;  3RTY A;  3PBT A;  4BMW A;  1K55 A;  2Q9M A;  2WK0 A;  2P04 A;  4DJ3 A;  3HVF A;  4EEU A;  2Y91 A;  4E3I A;  4F3L A;  3IX8 A;  1O7E A;  2B18 A;  3IBR A;  4EER A;  3CAX A;  2G2W A;  4PMA A;  3H9W A;  2ZQ8 A;  4HES A;  3ZCZ A;  3IS2 A;  4OOM A;  4QWO A;  1ZG4 A;  4S2M A;  1U60 A;  2KX6 A;  1I2S A;  5L8M A;  4Y0O A;  3KSI A;  2XDM A;  3M2J A;  4K08 A;  2I9V A;  3T4Q A;  4LGW A;  1E3U D;  3K3D A;  3PXP A;  3SOI A;  3IX4 A;  4IJG A;  2ZQC A;  3CI6 A;  5A90 A;  5FAO A;  4AFI A;  3IHA A;  4ESP A;  3F1N A;  5EE8 A;  1EI5 A;  1K0K A;  3E4Q A;  3FV7 A;  4D60 A;  1GHM A;  3IQA A;  4FUW A;  3MXQ A;  1F9I A;  4B4Z A;  4JF4 A;  3RXX A;  1DJC A;  1GHI A;  1YQS A;  1OT9 A;  1H5X A;  4IHQ A;  1BLS A;  1ERQ A;  2O9C A;  3Q07 A;  2J80 A;  4X55 A;  4GB7 A;  1W5D A;  3NY4 A;  3LY4 A;  1FR6 A;  2WKE A;  3KYQ A;  3EGD C;  4E6W A;  3ISG A;  2ZC7 A;  2A3U A;  3NUL A;  4O8G A;  1G68 A;  2O9A A;  2ZC5 B;  1Z6F A;  3G6O A;  2FH5 A;  5HWW A;  5C5K A;  3UB6 A;  2VGJ A;  2OSU A;  2XA7 S;  1FCM A;  2Q0O A;  3D3O A;  1OJ5 A;  1OTA A;  5A91 A;  1ACF A;  4Q0H A;  1YKD A;  2UV0 E;  3HUO A;  5EVI C;  3CPT B;  1VEU A;  5FQ9 A;  1LLB A;  2V20 A;  1SHV A;  2PDR A;  2J3T D;  3S7P A;  4R4R A;  4JXS A;  3G35 A;  3ZG9 B;  1K6S A;  1LSX A;  4WBG A;  5FAT A;  5GHZ A;  4S2N C;  4P0M A;  1QME A;  3CJM A;  2DMW A;  3E4P A;  2VZW A;  5FAS A;  5KIZ A;  2RL3 A;  2IWB A;  2ZBB A;  1VQQ A;  3WS0 A;  2NUP C;  5HDS A;  4B93 A;  3P7N A;  3OCN A;  1VHM A;  2JHE A;  3MQO A;  4UHU A;  5DF8 A;  3UB5 P;  3BM6 A;  3T12 B;  4HJ4 A;  5KSH A;  3MZE A;  5EV0 A;  4PHT A;  3HLB A;  2X71 A;  4JGO A;  4HBT A;  1KGE A;  4M4X A;  5CED A;  4BJP A;  2V9A A;  2Y79 A;  3BEC A;  3H82 B;  4RYE A;  2D02 A;  4HJ3 A;  3W4Q A;  1MY8 A;  3NI9 A;  3KYE A;  3VFF A;  3W8K A;  3JYI A;  4KG5 A;  5AVE A;  1G5U A;  4EU0 A;  5DF7 A;  4I3A A;  3VP3 A;  5TJJ A;  3VSK A;  3VP0 A;  4HH3 A;  3BY8 A;  2LB9 A;  4JLF A;  4P87 A;  2EX8 A;  5CGW A;  4DE2 A;  3IH8 A;  1IEL A;  1SKF A;  3V5M A;  2EXA A;  2HDQ A;  3O3V A;  3OPH A;  2OAP 1;  1IKI A;  4WYY A;  2XFS A;  3IF5 A;  4HH2 A;  4IBX A;  3VP4 A;  2VJW A;  4KZ8 A;  1N9L A;  2WZX A;  3VP1 A;  4NKP A;  2WAE A;  2P74 A;  3T4O A;  3U4L P;  4EBL A;  1N9N A;  1HD8 A;  2A24 B;  1ERO A;  2ZQA A;  5G4Y A;  4YFM A;  5GLD A;  1V9Y A;  4GOG A;  4X53 A;  4YOF A;  3U2A A;  2JN7 A;  5EM0 A;  3BFD A;  3PBS A;  1H8Y A;  4S2K A;  3UPP A;  4KUO A;  4PM6 A;  5KSC A;  1JWZ A;  3FKW A;  1YLZ A;  4IVI A;  4QY5 A;  3ZG0 A;  2DCF A;  4NXB A;  5EOE A;  2ZQD A;  3ZG8 B;  3V3S A;  3GDI A;  3TE8 A;  4WEJ A;  4WUJ A;  1LI0 A;  2VGK A;  3E2K A;  3VE3 A;  2WAD A;  1K54 C;  1CI8 A;  1TVF A;  3NJA A;  4KZ4 A;  3NBL A;  4ARZ B;  2H28 A;  4S2I A;  2V2F F;  1Q2Q A;  2QKP A;  4PKY A;  3TRC A;  2VK3 A;  4CQH A;  1PW8 A;  3MZD A;  3OPL A;  3R7W B;  3BYD A;  3C4O A;  2L1M A;  4Y3I A;  2JKT M;  3EWK A;  4HQA A;  4HHD A;  5DJT A;  3DW0 A;  2M7U A;  1E4D A;  1ESI A;  1GA9 A;  1M40 A;  1MWU A;  3CWF A;  4Q0J A;  2HV1 A;  3K2N A;  4MN7 A;  2H5S A;  1K6R A;  4BL2 A;  5M19 A;  3A3F A;  4KZ6 A;  5HAP A;  1K4F A;  1TD5 A;  4FH2 A;  4E6X A;  1PI5 A;  4KUK A;  4Y2F A;  1D7E A;  3QP8 A;  3BEB A;  4GHI B;  4IUK A;  5EVI B;  2WYX A;  4NXE A;  3W2Z A;  4N9L A;  1LHY A;  4Y17 A;  4LV1 A;  3SH9 A;  3ZFZ A;  1I2W A;  4FOF A;  2VV8 A;  3Q81 A;  4LRX C;  3DTK A;  4RX3 A;  3V39 A;  3DBA A;  3VMA A;  2OLV A;  2B95 A;  3B47 A;  2ZL1 B;  3P01 A;  4EW7 A;  1OME A;  2PU4 A;  3TW8 A;  2JKG A;  1YLT A;  4WMC D;  4QD4 A;  4QPR A;  3MZF A;  4CJN A;  2J3T C;  1Y4O A;  4OVD A;  3NEC A;  5I94 A;  4EES A;  1PFL A;  1S4R A;  3H82 A;  3S1Y A;  3LEZ A;  3S7Q A;  4KZ9 A;  1S1Z A;  3LIE A;  3I7J A;  3KSG A;  1VET B;  2H0T A;  4O01 A;  4KZ5 A;  1TS7 A;  3FG8 A;  2V1A A;  4LRY C;  2E8I A;  5CX7 A;  5L07 A;  5CTN A;  3OPP A;  2M1C A;  4GW9 A;  1MKM A;  4MNR A;  3CUE A;  3BFC A;  4DDS A;  2PHY A;  4BBT A;  1WE4 A;  3HLF A;  1NLY A;  3E0Y A;  1IYO A;  4U0T A;  1W8Y A;  1K56 A;  2EXB A;  1MBL A;  1G6O A;  4XUX A;  4S2P A;  1MPL A;  2INW A;  1IYQ A;  4DKI A;  3TSG A;  1T1C A;  2W3E A;  3PAE A;  4NET A;  4Z9Q A;  3SS3 A;  4E3M A;  5F68 A;  3T1X A;  1L0G A;  4Y0U A;  4B9O A;  3D72 A;  4LV2 A;  4UAA A;  4UA6 A;  1X0O A;  1FCN A;  3OPR A;  4G3W A;  3LR5 A;  2HF6 A;  3PHY A;  2Z6D A;  2K2N A;  1ZTU A;  5DF9 A;  4XXR A;  5J4E A;  3CIT A;  4DE0 A;  4X69 A;  2W1T A;  1LSV A;  1J3W A;  2WGI A;  3VSL A;  1PIO A;  2IWD A;  2J9P A;  4L9E A;  4BL3 A;  1YM1 A;  4JBF A;  5IHV A;  3Q7V B;  3N8L A;  3TG9 A;  1S1Y A;  5GLA A;  2DRW A;  1LL5 A;  5CHM A;  3ULF A;  3QP4 A;  4ARZ A;  2ZQ7 A;  3ZHH A;  5DVA A;  4E3K A;  2PD7 A;  2A2L A;  2PYR A;  1NJ4 A;  1DY6 A;  4LLO B;  1S67 L;  4GD6 A;  1YLJ A;  5GLB A;  1IYP A;  3M6H A;  3UB8 A;  3R7W A;  2VEA A;  3D4F A;  4ZTK A;  3WS1 A;  4XT2 A;  1MWT A;  4EBN A;  2VA0 A;  1F98 A;  3JVU A;  4I3J A;  2XA7 M;  1YPR A;  2HP6 A;  5J7E A;  1H8M A;  4UA9 A;  4KZA A;  4GDB A;  2OWH A;  1JNU A;  3D9Y A;  2Y2M A;  4R6L A;  1GCE A;  1W63 M;  2OWJ A;  2W3F A;  2Y2J A;  4RA7 A;  4GHI A;  2O9B A;  5EVI A;  5J3W A;  3PR6 A;  3C30 A;  2Y2H A;  5CXW A;  5EPH A;  3UPN A;  4EUV A;  4ZBE A;  2YKF A;  1XJ6 A;  1NY0 A;  4YNR A;  4ZJ1 A;  3KO6 A;  2ZL1 A;  1KE4 A;  1S66 L;  4R38 A;  1G28 A;  3WS4 A;  4GKU A;  4S2N A;  5HPI A;  4E3O A;  3C38 A;  3EQU A;  1TF1 A;  2XLN A;  2E8J A;  5A93 A;  4OLG A;  2YKH A;  4KG6 A;  3LI8 A;  3OBF A;  1W79 A;  4DF6 A;  2FZ0 A;  4EWF A;  3F1O A;  3MKF A;  4G3V A;  4QU3 A;  1YLY A;  4PM8 A;  1VET A;  5CHJ A;  4YIN A;  4HI4 A;  3BQA A;  1ZC2 A;  4CPK A;  3HUM A;  1TS6 A;  5CRF A;  2V8F A;  3UNW A;  1ES5 A;  5A8B A;  1L3L A;  1KE0 A;  2ZC6 B;  3T50 A;  3IT9 A;  3VP2 A;  2Z6C A;  4FSF A;  2XD1 A;  3FKV A;  5AQ9 A;  3T1S A;  3NDE A;  2KOI A;  4CLC E;  4P6Z M;  4UQI M;  3N6I A;  1T18 A;  4L9G A;  1K4E A;  4R70 A;  4N92 A;  2MJ6 A;  3LIA A;  3IX3 A;  4NK3 A;  3GSG A;  1L0D A;  3HL9 A;  4S2O A;  3EOI A;  2WKP A;  3ZVT A;  1PYY A;  3K3C A;  3MSH A;  4WM9 A;  1ESU A;  3MR0 A;  4PKY G;  4NEE D;  2XR0 A;  5L10 A;  4A5R A;  3SS4 A;  1WA9 A;  5DTS A;  3NC8 A;  5DKK A;  3DTM A;  1TDG A;  2CMN A;  3N4I A;  3BY9 A;  3DAV A;  4X68 A;  1GSX A;  3MS6 A;  3Q7V A;  2XD5 A;  2PT7 A;  2Z2L B;  1UGU A;  4DMZ A;  1NRJ A;  1TS0 A;  2O99 A;  3N8R A;  2WKI A;  4OQ0 A;  4UEY A;  3FWL A;  4WF0 A;  3ZYT A;  4DXC A;  3UB9 A;  3DWZ A;  3PAG A;  5FQK A;  3ZGA B;  1OTI A;  1LT0 A;  2ZC3 B;  2V1Z A;  4N1X A;  4H6J B;  2FFY A;  4CLC D;  5KZH A;  1LI9 A;  4P6B A;  1E3U A;  1E25 A;  4OH0 A;  3S22 A;  3NOU C;  5EOO A;  3LIB A;  5HWT A;  4KQD A;  3EGX C;  2BLS A;  2R78 A;  1A0K A;  5HZH A;  1T1A A;  2Y2Q A;  1CJF A;  1K54 A;  1KOU A;  1Q2P A;  2PAV P;  1V9Z A;  4ZRR A;  4E3J A;  1D1J A;  2C6W B;  5GHX A;  4MN6 A;  1PZO A;  2VKS A;  4UA7 A;  2PYP A;  2HP5 A;  4WZ5 C;  2L4R A;  3FPW A;  3A0R A;  5CTM A;  5I5L A;  4DE1 A;  5FI7 A;  2HJ9 C;  4PM7 A;  1XJ2 A;  1P9W A;  1L2S A;  2JKR M;  4OQI A;  5FL3 A;  2JC7 A;  3MBZ A;  2EFU A;  3Q82 A;  3DWK A;  4HBU A;  1MWR A;  3MMH A;  4FH4 A;  3HCY A;  2R9X A;  1BLH A;  3L9K A;  2XEP A;  2B02 A;  4JPM A;  5FA7 A;  1MKI A;  3DTE A;  3UE0 A;  4QY6 A;  3G2Z A;  4NXF A;  3A3D A;  4D2O A;  1L0E A;  3LYX A;  4X1L A;  1DP9 A;  4OLD A;  1BTL A;  2WGW A;  3C7U A;  4HP9 A;  2BAS A;  2I72 A;  5F6A A;  1FQG A;  4KEN B;  4RVA A;  5FAQ A;  2W1T B;  3HLD A;  3BLS A;  1N4O A;  1FR1 A;  3GTC A;  4GN2 A;  4R3A A;  3IWO A;  2K31 A;  3SZT A;  2IA2 A;  5AQA A;  1ERM A;  3GRJ A;  1BYW A;  4PM9 A;  3R4K A;  2W3D A;  3ICY A;  3MFX A;  1Y54 A;  3FZC A;  4IED A;  5AQB A;  4KQR A;  3LR0 A;  4ZJ2 A;  1W63 Q;  1KVM A;  1GHP A;  4C6Y A;  3GV9 A;  4XT2 B;  3BW6 A;  3T4J A;  1OPX A;  1LSW A;  3GVB A;  1NZO A;  4I5S A;  4Y7P A;  1VB6 A;  4WN5 A;  4X25 A;  3MXS A;  2Y2I A;  1JTG A;  1NLZ A;  4CLC A;  4II7 A;  5EUA A;  1H8Z A;  2XK1 A;  4DN0 A;  3IBJ A;  3G2Y A;  4OPR A;  2GJ3 A;  3WS5 A;  2JE5 A;  2XSS A;  4JGR A;  4R4S A;  4S2J A;  2OAQ 1;  4MEZ A;  4WEL A;  3S4X A;  4B4X A;  5FI2 A;  2XRN A;  2WKQ A;  4NXG A;  3E4O A;  3EEA A;  5F1F A;  3GEC A;  3OCL A;  1XP4 A;  4LPZ A;  1JVJ A;  3RJU A;  3QNC A;  4EET B;  1OTE A;  4H6J A;  4HNB A;  4MBK A;  3T4T A;  1SKO A;  3A3J A;  2WUQ A;  4K0X A;  4Y5F A;  2HJE A;  5CEC A;  1G6A A;  1FCO A;  4KQQ A;  3PBN A;  4Q8I A;  1KDW A;  4HY8 A;  4ZJ3 A;  1NXY A;  1N9B A;  4K0W A;  3F1O B;  1F5M A;  4HJ6 A;  1OTB A;  1PZP A;  1W8Q A;  2V1B A;  3W4O A;  3FC7 A;  3W4P A;  3EQV A;  3VE4 A;  5DKL A;  2P9V B;  4R23 A;  1CQA A;  3QP6 A;  1T1B A;  4LV0 A;  1GSW A;  1TEM A;  5D3O A;  3O87 A;  4PM5 A;  4OKP A;  1LL9 A;  4XUZ A;  5HAR A;  1YSP A;  2RCX A;  4ETX A;  1K57 C;  3ZQ5 A;  4WL9 A;  1IYS A;  5IU1 A;  1WYC A;  4X6T A;  2BG1 A;  3IXH A;  3HRE A;  1I5Q A;  5DTT A;  5TGF A;  2M7V A;  3JPU A;  3ZDJ A;  4CLC C;  2EX2 A;  2XH9 A;  1XA7 A;  3RFB A;  4ZAM A;  1MC0 A;  3HUN A;  2Y55 A;  3C4P A;  2ACG A;  3B3X A;  1CEG A;  1YMS A;  3P98 A;  4JXW A;  4G3K A;  1DJB A;  1YSQ A;  2P7J A;  2H0Y A;  2G2U A;  1TS8 A;  2EWV A;  4L0L A;  1S4S A;  1IFQ A;  1PI4 A;  5AJG A;  3CHW P;  1P97 A;  2EWW A;  1XPB A;  4IUH A;  4JGQ A;  4WLA A;  2W1R A;  4Q0I A;  2BTF P;  3Q7Z A;  2G7U A;  1FSY A;  3HLW A;  1NWZ A;  5FEG A;  1PWG A;  5HWV A;  4EV4 A;  5TBM B;  2ZM2 A;  2Y2G A;  3GMW A;  3IXB A;  4MLL A;  1YT4 A;  2KDK A;  2PD8 A;  4EEP A;  4OP8 A;  2VGL S;  2ZOH A;  1AWI A;  4QJG A;  3AGF A;  5FQJ A;  4IBR A;  5F1G A;  4MBH A;  5F69 A;  4OOL A;  4OOY A;  2XGN A;  3MQ0 A;  4BQM A;  5BOH A;  3QNB A;  4X56 A;  5HX9 A;  5E2E A;  5GLC A;  5GHY A;  3OLO A;  4WZ4 A;  3ITA A;  4OPY A;  3MQQ A;  3CG5 A;  2ZMF A;  1WYB A;  3N8S A;  4LCM A;  1SDN A;  2ZOI A;  3A0S A;  3KYZ A;  3LR4 A;  1XFQ A;  2QPN A;  5DJU A;  3V50 A;  1C3B A;  4E3L A;  1XX2 A;  4R0Q A;  3PYP A;  5LBR A;  2JKR I;  4LEN A;  4WMC A;  3SH7 A;  1KVL A;  3BQ8 A;  4K91 A;  4E3N A;  3IF6 C;  1YAX A;  5AQ7 A;  1XKZ A;  3G31 A;  4JGP A;  3B42 A;  1J9M A;  3B33 A;  1UWP X;  2NUT C;  1FSW A;  3G34 A;  3JVV A;  4QHC A;  2R9W A;  4KG2 A;  1F2K A;  4ZDX A;  4ID4 A;  3O88 A;  1BZA A;  3BRM A;  2DNS A;  5EEC A;  3BFE A;  4BLM A;  2B5R A;  2Q9N A;  2WZZ A;  5F82 A;  4RQ9 A;  1CI9 A;  4DDY A;  3VOL A;  4IVK A;  4EQI A;  3HLE A;  5E2G A;  5EM1 A;  4OQG A;  5MC7 A;  5J8X A;  1CK3 A;  1P9R A;  1ZHH B;  5F83 A;  3A0V A;  2JBF A;  3C2W A;  3C5A A;  4PAU A;  3RH8 B;  4B88 A;  5TFQ A;  2ZMV A;  2P9V A;  2WGW B;  1L0F A;  4FD8 A;  1ONG A;  2WKR A;  1RCJ A;  5E43 A;  3UY6 A;  1N9O A;  3LI9 A;  3M2K A;  3TOI A;  2W27 A;  2Y2L A;  1IOU A;  4BD0 A;  2V0W A;  2GZA A;  3HLG A;  1D06 A;  4R1G A;  2JKT I;  3WRZ A;  2HGV A;  4JXG A;  2QZ6 A;  3ZG7 B;  4GD8 A;  5FQM A;  1XJ4 A;  1XXM A;  4FTX A;  3OZH A;  5HFO A;  1BUE A;  1Z09 A;  3HJI A;  3V67 A;  5FQI A;  3OC2 A;  1UWN X;  2X02 A;  4GDN A;  5CGS A;  3O5Y A;  3QP2 A;  1K55 C;  5HL6 A;  3E98 A;  4EQ1 A;  3VOY A;  4DXB A;  2QHK A;  4WZ5 A;  2Y2O A;  4F94 A;  3AGD A;  2QJ7 A;  4MBF A;  5FI6 A;  1S6R A;  5HD3 A;  3RXW A;  3IWQ A;  4ETZ A;  5HL1 A;  4CLC B;  2PU2 A;  5L2F A;  5TBM A;  2L0W A;  5U47 A;  2ZM8 A;  1S0W A;  2VLG A;  3LEQ A;  4NG2 A;  2J9O A;  2JCH A;  2W3H A;  4Y13 A;  1XFN A;  2H10 A;  3LY3 A;  3NHQ A;  1MXO A;  3P09 A;  1NZU A;  2XF3 A;  2ZMA A;  2OOL A;  3ZNT A;  3A3E A;  4FCF A;  3C7V A;  3LGO A;  3UB7 A;  1MWS A;  3UE3 A;  5HD5 A;  4O0P A;  1XGJ A;  5E2H A;  2GNX A;  1DJA A;  1SKO B;  2VV6 A;  4I39 A;  4LCL A;  3WS2 A;  2P08 A;  3F1P A;  1YLP A;  3O86 A;  1H0M A;  3CZD A;  1QMF A;  5CEB A;  2PR5 A;  3S7N A;  1PWC A;  1FIL A;  3L7H A;  4WEK A;  3Q1F A;  4R3B A;  2J7V A;  5FEF A;  4OP5 A;  5GL9 A;  2Y59 A;  2CC1 A;  4JXV A;  3KX0 X;  4GS9 B;  2XRO A;  4LRZ E;  1IEM A;  2QJ5 A;  3H7W B;  1BSG A;  1NYM A;  3SW1 A;  3UDI A;  4O7D A;  4MDZ A;  1BT5 A;  1RP5 A;  3KSH A;  3PBQ A;  5IS1 A;  5FDH A;  5E2F A;  1HLU P;  4LV3 A;  4P6Z S;  4UQI S;  2ZQ9 A;  2GDN A;  2ZJ9 A;  4KZB A;  3G32 A;  3PBO A;  2VX8 A;  2K7S A;  3UDX A;  4LFU A;  5DFX A;  2FFF B;  3UMD A;  3IF6 B;  2Y2N A;  3S7O A;  4Y15 A;  5EVE A;  3LIC A;  5CHU A;  5EVL A;  4N9K A;  1YMX A;  4EBP A;  3LO7 A;  2QYB A;  3T4L A;  3TJZ C;  3T4S A;  2PR6 A;  4N1H A;  1ALQ A;  4DE3 A;  5K5B A;  4Z1W A;  5FAP A;  1HVB A;  2Y2K A;  2UWX A;  1M6K A;  3ZG5 A;  3LFV A;  2J8Y A;  2W0N A;  2X01 A;  5HAI A;  3ZVW A;  4YWZ A;  3BFG A;  5HSQ A;  4HOI A;  1SDE A;  5G18 A;  3UO9 A;  1HTZ A;  5HAQ A;  1RGY A;  3ITB A;  4GLQ A;  5FSR A;  1EWZ A;  1K56 D;  2ZD8 A;  4HP4 A;  3IWI A;  4BD1 A;  1JWV A;  3G4P A;  1Y28 A;  1BLP A;  4GNU A;  4HIA A;  1W7F A;  4I3I A;  1PRQ A;  3NIA A;  4U0X A;  1ES4 A;  3DTI A;  4P85 A;  3MKE A;  4S2L A;  3V3R A;  5HPF A;  3A3I A;  1PWD A;  3FYZ A;  4M3K A;  4BBU A;  1ES2 A;  1NRF A;  4GJ4 A;  1K57 A;  2HPB A;  3LIF A;  4OON A;  3QHY A;  3PTE A;  2JKF A;  3IH9 A;  1JWP A;  1HZO A;  3VV4 A;  2EX9 A;  1DP6 A;  3N7W A;  3HLC A;  3CPT A;  3M6B A;  1P0Z A;  2KLI A;  4KZ3 A;  2EFX A;  3UDF A;  1XA1 A;  4EXO A;  3GQZ A;  4MCW A;  1H3Q A;  4Y0T A;  4QB8 A;  5FDS A;  1CF0 A;  2HDS A;  4U3T A;  3MFD A;  3E2L A;  1PNE A;  1SZV A;  2EA9 A;  5M1A A;  2OLU A;  2HDU A;  3T1Q B;  1ZG6 A;  1DRM A;  1KE3 A;  3CMZ A;  4F3L B;  3EEH A;  5JYP A;  3SS5 A;  1BUL A;  4R3J A;  5HW3 A;  5CGX A;  1JTD A;  2C5W B;  4H8R A;  2GX5 A;  2VGL M;  4BBV A;  5AVF A;  2J3W A;  3FPV A;  1TDL A;  2OV5 A;  3IS2 B;  4GZB A;  1K25 A;  1OT6 A;  2D01 A;  4DJ2 A;  2VV7 A;  3LID A;  4OQH A;  3MJQ A;  4C3Q A;  2O0Y A;  5FQQ A;  2XQZ A;  2HZ5 A;  4KQO A;  4GS9 A;  3BLM A;  3F1N B;  2IWC A;  3H7W A;  1FIK A;  1KGG A;  4OPZ A;  2V8C A;  3IXD A;  3UE6 A;  4X1M A;  5A92 A;  2HDR A;  3NOP C;  1ODV A;  3HBR A;  3MF0 A;  5IT5 A;  5EVI D;  4EUZ A;  1SCW A;  2WAF A;  4BWI A;  3BFF A;  3IHB A;  4RX2 A;  1AXB A;  1NYY A;  2WKH A;  3G30 A;  3WRT A;  1K38 A;  3NOT C;  3NCK A;  1PW1 A;  4JF5 A;  1IKG A;  2ZM0 A;  3WWX A;  1EW0 A;  3IF6 A;  1ONH A;  3UN7 A;  2W3G A;  3BJN A;  3KSF A;  1VM1 A;  2LB5 A;  5DTK A;  5G4Z A;  3CLO A;  3T1R A;  3IXG A;  5HDD A;  1GA0 A;  1STZ A;  2ZC4 B;  3PBR A;  4BEN A;  3AGE A;  1OTD A;  5TR7 A;  3MXR A;  2QMI A;  3VOZ A;  3QP5 A;  5HDC A;  1DP8 A;  4C75 A;  2XFT A;  3LR3 A;  2A24 A;  4MMN A;  1XJ3 A;  1GSV A;  1VEU B;  1OJG A;  4GCZ A;  3UME A;  2Z2M B;  3ZNY A;  3BWL A;  3T4K A;  5CER A;  5EFW A;  4JKT A; 
#chains in the Genus database with same CATH homology
 4KZ6 A;  1PZO A;  2A49 A;  5HAP A;  4HEF A;  1K4F A;  4KZ7 A;  4UA7 A;  5M18 A;  4FH2 A;  1KDS A;  4BD0 A;  2HP5 A;  4E6X A;  4PPR A;  1PI5 A;  4WZ5 C;  3HLG A;  4R1G A;  5CTM A;  2PBY A;  1RGZ A;  3WRZ A;  4JF6 A;  4JXG A;  4DE1 A;  2QZ6 A;  5FI7 A;  3BEB A;  4GD8 A;  5FQM A;  3ZG7 B;  5KMW A;  1XGI A;  5EVI B;  4PM7 A;  2WYX A;  1KGF A;  2Y4A A;  2Y2P A;  1L2S A;  4N9L A;  1LHY A;  3NDG A;  1XXM A;  4LV1 A;  4OQI A;  3OZH A;  3SH8 A;  5HFO A;  3SH9 A;  1BUE A;  1ES3 A;  1I2W A;  3ZFZ A;  3Q81 A;  2ZLY A;  2EX6 A;  2JC7 A;  3MBZ A;  2EFU A;  5FQI A;  4RX3 A;  3OC2 A;  3Q82 A;  5JYO A;  3V39 A;  2X02 A;  3DWK A;  1O07 A;  4HBU A;  1YLW A;  1MWR A;  4GDN A;  2OLV A;  3VMA A;  5CGS A;  1FOF A;  1OME A;  4FH4 A;  1K55 C;  1CEF A;  2R9X A;  2PU4 A;  1BLH A;  3VOY A;  4DXB A;  4WZ5 A;  2Y2O A;  4F94 A;  2XEP A;  3AGD A;  3LCE A;  1YLT A;  4WMC D;  4JPM A;  4QD4 A;  3MZF A;  5FA7 A;  4MBF A;  1MKI A;  3GR2 A;  1ZKJ A;  4CJN A;  3UE0 A;  4OVD A;  1S6R A;  3G2Z A;  4QY6 A;  1BLC A;  5FI6 A;  2HP9 A;  3A3D A;  3RXW A;  4D2O A;  5I94 A;  2WGV A;  1L0E A;  3UE1 A;  3S1Y A;  4OLD A;  3VFH A;  1BTL A;  3IWQ A;  2WGW A;  3C7U A;  3LEZ A;  4KZ9 A;  2I72 A;  3UPO A;  4DRT A;  5HL1 A;  1FQG A;  2PU2 A;  5L2F A;  4KEN B;  3I7J A;  4OPQ A;  3PBT A;  2H0T A;  1K55 A;  2Q9M A;  4KZ5 A;  2WK0 A;  4RVA A;  5FAQ A;  3HVF A;  2ZM8 A;  5U47 A;  1S0W A;  3HLD A;  2Y91 A;  4E3I A;  2J9O A;  2JCH A;  2E8I A;  5CTN A;  3OPP A;  2H10 A;  3LY3 A;  4MNR A;  3BLS A;  3BFC A;  1N4O A;  1FR1 A;  1O7E A;  4DDS A;  1WE4 A;  1MXO A;  2G2W A;  3GTC A;  4PMA A;  3P09 A;  1NZU A;  2ZQ8 A;  3HLF A;  2XF3 A;  4GN2 A;  4HES A;  2ZMA A;  3ZCZ A;  4OOM A;  3ZNT A;  3A3E A;  3IWO A;  1IYO A;  1ZG4 A;  4S2M A;  4U0T A;  1U60 A;  1W8Y A;  4FCF A;  1K56 A;  2EXB A;  3C7V A;  1MBL A;  1ERM A;  1I2S A;  1MWS A;  3GRJ A;  5AQA A;  3UE3 A;  4PM9 A;  4XUX A;  4Y0O A;  4S2P A;  2XDM A;  3M2J A;  1XGJ A;  1MPL A;  5E2H A;  1Y54 A;  3FZC A;  1IYQ A;  4IED A;  1E3U D;  1DJA A;  4DKI A;  3TSG A;  3PAE A;  4LCL A;  5AQB A;  3WS2 A;  4NET A;  4Z9Q A;  4KQR A;  4ZJ2 A;  3SS3 A;  1YLP A;  3O86 A;  3SOI A;  4E3M A;  3CZD A;  1QMF A;  2ZQC A;  5CEB A;  5A90 A;  5FAO A;  1KVM A;  1PWC A;  1GHP A;  1L0G A;  4C6Y A;  4Y0U A;  3GV9 A;  3IHA A;  4WEK A;  4LV2 A;  3Q1F A;  4R3B A;  4UAA A;  4UA6 A;  2J7V A;  5EE8 A;  1EI5 A;  3GVB A;  1NZO A;  4OP5 A;  5GL9 A;  3FV7 A;  4Y7P A;  1FCN A;  3OPR A;  2Y59 A;  1GHM A;  2CC1 A;  3IQA A;  3MXS A;  4JXV A;  4B4Z A;  2Y2I A;  1JTG A;  1IEM A;  4JF4 A;  3RXX A;  1BSG A;  5EUA A;  1H8Z A;  1NYM A;  2XK1 A;  4XXR A;  5DF9 A;  1DJC A;  3G2Y A;  4DE0 A;  1GHI A;  4OPR A;  4X69 A;  3UDI A;  3WS5 A;  2WGI A;  3VSL A;  1YQS A;  1H5X A;  1PIO A;  4O7D A;  2JE5 A;  2IWD A;  1BLS A;  1BT5 A;  1ERQ A;  1RP5 A;  2J9P A;  4BL3 A;  1YM1 A;  3PBQ A;  4R4S A;  3Q07 A;  4JBF A;  4S2J A;  5FDH A;  4X55 A;  5IHV A;  4GB7 A;  4MEZ A;  5E2F A;  4WEL A;  3S4X A;  4B4X A;  5FI2 A;  1W5D A;  3NY4 A;  3Q7V B;  4LV3 A;  3LY4 A;  1FR6 A;  2WKE A;  4E6W A;  3N8L A;  2ZQ9 A;  3ISG A;  2ZC7 A;  3TG9 A;  2GDN A;  2A3U A;  5GLA A;  2ZJ9 A;  4KZB A;  3G32 A;  3PBO A;  2DRW A;  5F1F A;  3OCL A;  1LL5 A;  1XP4 A;  5CHM A;  3UDX A;  1JVJ A;  2FFF B;  3RJU A;  1G68 A;  3IF6 B;  2Y2N A;  2ZQ7 A;  3QNC A;  3ZHH A;  4MBK A;  2ZC5 B;  5DVA A;  4E3K A;  1Z6F A;  5CHU A;  1NJ4 A;  1DY6 A;  3A3J A;  2WUQ A;  1YMX A;  4K0X A;  4N9K A;  5EVL A;  4EBP A;  5CEC A;  4GD6 A;  1G6A A;  1YLJ A;  1FCO A;  4KQQ A;  3LO7 A;  3PBN A;  5GLB A;  4Q8I A;  1IYP A;  1KDW A;  2VGJ A;  3M6H A;  2OSU A;  1FCM A;  4ZJ3 A;  4N1H A;  3D4F A;  4ZTK A;  1ALQ A;  5A91 A;  4DE3 A;  3WS1 A;  1NXY A;  1N9B A;  1MWT A;  4K0W A;  5FAP A;  4EBN A;  3HUO A;  5EVI C;  1HVB A;  1PZP A;  1W8Q A;  2Y2K A;  5FQ9 A;  2UWX A;  3W4O A;  3W4P A;  1LLB A;  2V20 A;  2HP6 A;  3EQV A;  1M6K A;  2P9V B;  4R23 A;  1SHV A;  3ZG5 A;  2J8Y A;  4R4R A;  4LV0 A;  2X01 A;  4JXS A;  5HAI A;  3ZVW A;  4UA9 A;  1TEM A;  3G35 A;  4KZA A;  5D3O A;  4GDB A;  3ZG9 B;  3BFG A;  3O87 A;  1K6S A;  4PM5 A;  4OKP A;  1LL9 A;  1SDE A;  4WBG A;  4XUZ A;  5FAT A;  5G18 A;  5HAR A;  3UO9 A;  5GHZ A;  4S2N C;  4P0M A;  1HTZ A;  2Y2M A;  1QME A;  2RCX A;  5HAQ A;  1RGY A;  3CJM A;  3ITB A;  5FSR A;  1GCE A;  2Y2J A;  1EWZ A;  1K57 C;  4RA7 A;  5FAS A;  1K56 D;  2RL3 A;  2IWB A;  5EVI A;  1VQQ A;  1IYS A;  2ZD8 A;  3WS0 A;  1WYC A;  4BD1 A;  4X6T A;  2BG1 A;  2Y2H A;  3IWI A;  3IXH A;  3HRE A;  1I5Q A;  1JWV A;  5CXW A;  5DTT A;  5EPH A;  5TGF A;  3UPN A;  3G4P A;  4ZBE A;  1NY0 A;  3ZDJ A;  1BLP A;  3OCN A;  4GNU A;  1W7F A;  2EX2 A;  4ZJ1 A;  3NIA A;  2XH9 A;  1XA7 A;  1KE4 A;  1ES4 A;  4U0X A;  4UHU A;  4P85 A;  3MKE A;  4S2L A;  4ZAM A;  3V3R A;  3WS4 A;  3HUN A;  4GKU A;  4S2N A;  2Y55 A;  3C4P A;  4E3O A;  5DF8 A;  3B3X A;  3A3I A;  3BM6 A;  1PWD A;  3EQU A;  3FYZ A;  4M3K A;  1ES2 A;  5KSH A;  1CEG A;  1NRF A;  1YMS A;  3MZE A;  3P98 A;  4JXW A;  2XLN A;  1K57 A;  2HPB A;  4OON A;  3QHY A;  5A93 A;  3PTE A;  1DJB A;  2H0Y A;  2G2U A;  3HLB A;  4L0L A;  4OLG A;  4KG6 A;  3IH9 A;  2X71 A;  1PI4 A;  1W79 A;  4DF6 A;  4HBT A;  1KGE A;  1JWP A;  1HZO A;  5CED A;  4EWF A;  4BJP A;  2EX9 A;  3MKF A;  3N7W A;  4QU3 A;  1XPB A;  3HLC A;  1YLY A;  3M6B A;  3BEC A;  4PM8 A;  5CHJ A;  4KZ3 A;  3Q7Z A;  2EFX A;  3UDF A;  4RYE A;  1XA1 A;  3GQZ A;  4YIN A;  4Y0T A;  1FSY A;  4QB8 A;  3W4Q A;  1ZC2 A;  1MY8 A;  3HLW A;  3NI9 A;  2HDS A;  4U3T A;  1PWG A;  3MFD A;  3VFF A;  4CPK A;  3HUM A;  3W8K A;  3E2L A;  4EV4 A;  2ZM2 A;  3JYI A;  5M1A A;  2OLU A;  2Y2G A;  4KG5 A;  2HDU A;  3GMW A;  1ZG6 A;  5CRF A;  3IXB A;  1ES5 A;  1KE3 A;  3UNW A;  4MLL A;  1YT4 A;  3CMZ A;  4OP8 A;  1KE0 A;  2ZC6 B;  4QJG A;  3IT9 A;  5DF7 A;  3AGF A;  5FQJ A;  4IBR A;  5F1G A;  3VP2 A;  5JYP A;  3VP3 A;  4MBH A;  4FSF A;  2XD1 A;  3FKV A;  4OOL A;  5AQ9 A;  3VSK A;  4OOY A;  2XGN A;  3SS5 A;  1BUL A;  3VP0 A;  4R3J A;  5HW3 A;  5CGX A;  1JTD A;  2C5W B;  3NDE A;  4H8R A;  4JLF A;  4P87 A;  4BQM A;  5BOH A;  2Y2L A;  3QNB A;  4X56 A;  5HX9 A;  5E2E A;  2EX8 A;  5GLC A;  2OV5 A;  1TDL A;  5GHY A;  3N6I A;  1K4E A;  5CGW A;  4DE2 A;  3IH8 A;  4WZ4 A;  1IEL A;  4N92 A;  4GZB A;  3ITA A;  1K25 A;  1SKF A;  4OPY A;  3V5M A;  2EXA A;  2HDQ A;  3CG5 A;  4NK3 A;  1WYB A;  3GSG A;  3N8S A;  3O3V A;  4LCM A;  1SDN A;  1L0D A;  3OPH A;  1IKI A;  3HL9 A;  4S2O A;  4WYY A;  3ZVT A;  2XFS A;  4OQH A;  1PYY A;  4C3Q A;  3IF5 A;  4IBX A;  3VP4 A;  2QPN A;  5FQQ A;  4KZ8 A;  2WZX A;  3V50 A;  1C3B A;  2XQZ A;  1XX2 A;  1K6R A;  4E3L A;  4R0Q A;  4KQO A;  3VP1 A;  2WAE A;  2P74 A;  4WM9 A;  3BLM A;  4EBL A;  4LEN A;  1HD8 A;  4WMC A;  2IWC A;  1KGG A;  1ESU A;  4OPZ A;  3SH7 A;  1KVL A;  3IXD A;  1ERO A;  2ZQA A;  4K91 A;  4YFM A;  4E3N A;  5GLD A;  5A92 A;  4GOG A;  4X53 A;  3IF6 C;  2XR0 A;  2HDR A;  5AQ7 A;  4A5R A;  3SS4 A;  3BFD A;  5DTS A;  1XKZ A;  3HBR A;  3NC8 A;  3PBS A;  1H8Y A;  3G31 A;  4S2K A;  3UPP A;  3DTM A;  1J9M A;  1TDG A;  5EVI D;  4PM6 A;  1FSW A;  4EUZ A;  1SCW A;  2WAF A;  3G34 A;  5KSC A;  3N4I A;  3BFF A;  3IHB A;  1JWZ A;  4X68 A;  4QHC A;  3FKW A;  4RX2 A;  2R9W A;  4KG2 A;  1YLZ A;  1AXB A;  1NYY A;  2WKH A;  4ID4 A;  4IVI A;  4ZDX A;  3Q7V A;  4QY5 A;  3O88 A;  3ZG0 A;  1BZA A;  2DCF A;  5EOE A;  2ZQD A;  2XD5 A;  3G30 A;  3BRM A;  3WRT A;  2DNS A;  1K38 A;  2Z2L B;  3ZG8 B;  3NCK A;  1PW1 A;  5EEC A;  3V3S A;  4JF5 A;  3BFE A;  4BLM A;  2B5R A;  2Q9N A;  2WZZ A;  1IKG A;  5F82 A;  2ZM0 A;  2WKI A;  3N8R A;  3WWX A;  4WEJ A;  4OQ0 A;  3FWL A;  3IF6 A;  1LI0 A;  1ONH A;  1CI9 A;  2VGK A;  3E2K A;  4DDY A;  4EQI A;  4IVK A;  4DXC A;  3DWZ A;  3UN7 A;  3PAG A;  2WAD A;  3HLE A;  5E2G A;  5FQK A;  1K54 C;  3ZGA B;  4OQG A;  1VM1 A;  2ZC3 B;  1CI8 A;  1TVF A;  5M19 A;  2V1Z A;  5J8X A;  1CK3 A;  4KZ4 A;  5DTK A;  3NBL A;  4S2I A;  2V2F F;  4N1X A;  3IXG A;  5F83 A;  1Q2Q A;  2FFY A;  2JBF A;  1GA0 A;  5KZH A;  2ZC4 B;  1LI9 A;  1PW8 A;  3PBR A;  4P6B A;  4BEN A;  1E3U A;  3C5A A;  1E25 A;  3MZD A;  4OH0 A;  3S22 A;  3AGE A;  5TR7 A;  5EOO A;  3MXR A;  2QMI A;  3VOZ A;  3OPL A;  4B88 A;  3BYD A;  5TFQ A;  2P9V A;  2BLS A;  2WGW B;  1L0F A;  3C4O A;  4C75 A;  4FD8 A;  2XFT A;  1ONG A;  2Y2Q A;  1K54 A;  1RCJ A;  5E43 A;  3UY6 A;  3DW0 A;  1Q2P A;  3ZNY A;  2Z2M B;  3M2K A;  3TOI A;  1E4D A;  1ESI A;  1GA9 A;  1M40 A;  1MWU A;  5CER A;  4JKT A;  4E3J A;  2H5S A;  2C6W B;  4BL2 A;  5GHX A;  3A3F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...