1KGEA

Structure of beta-lactamase asn 170 met mutant
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
257
structure length
257
Chain Sequence
KELNDLEKKYNAHIGVYALDTKSGKEVKFNSDKRFAYASTSKAINSAILLEQVPYNKLNKKVHINKDDIVAYSPILEKYVGKDITLKALIEASMTYSDNTANNKIIKEIGGIKKVKQRLKELGDKVTNPVRYEIELMYYSPKSKKDTSTPAAFGKTLNKLIANGKLSKENKKFLLDLMLNNKSGDTLIKDGVPKDYKVADKSGQAITYASRNDVAFVYPKGQSEPIVLVIFTNKDNKSDKPNDKLISETAKSVMKEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords BETA-LACTAMASE
publication title Elimination of the hydrolytic water molecule in a class A beta-lactamase mutant: crystal structure and kinetics.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 95
structure length 257
sequence length 257
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 1996-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1kgeA00
4X53A 3IH9A 4N9LA 3OCNA 1W8QA 3WS4A 4YINA 4N1HA 3GSGA 4OLDA 4B4ZA 5EE8A 2EX2A 4A5RA 1IKGA 5DTKA 2HPBA 4MLLA 2XD5A 1EI5A 4EQIA 2DCFA 1KE0A 1K4FA 1YMSA 1MKIA 1AXBA 2WGWB 3IF6B 2BG1A 1XPBA 3LY4A 3Q7VB 4WMCA 1RP5A 3DWZA 1KGEA 5AQBA 3UE1A 2WGVA 2WADA 1WYBA 1PYYA 4KZBA 1W5DA 2EX9A 3AGEA 4JXVA 3AGFA 2WZZA 1PI4A 1M6KA 2RCXA 2V20A 3OPLA 4LCMA 5EOEA 4DRTA 3QHYA 5HAQA 3C4OA 1NYYA 4DF6A 1YQSA 2ZC6B 3WS2A 3A3DA 4UA6A 3ZVWA 4MEZA 3ISGA 1NYMA 2BLSA 1ALQA 5CECA 4X56A 5CEBA 3UDIA 5FQ9A 4ZBEA 2WUQA 4L0LA 1PW1A 1TDLA 1Y54A 3O88A 2EX8A 5A93A 4OP5A 4C6YA 3JYIA 3NI9A 3PAEA 5CTNA 3NIAA 5KZHA 4F94A 4BD0A 1JTGA 2WKEA 4RYEA 2J7VA 4X69A 5TFQA 1MWTA 4KZ4A 1TDGA 3I7JA 4S2NA 1K55A 3HBRA 4JF6A 3N8LA 4RX3A 4UAAA 2E8IA 5FQJA 4KG2A 5U47A 4RVAA 1S0WA 3V50A 5FI2A 2Y55A 1KE3A 1SHVA 1XGIA 3IWQA 4P85A 4PM7A 1E25A 3MFDA 3HUOA 3SH8A 3NCKA 2ZQDA 4IBRA 3VP0A 5J8XA 5AQAA 4DE2A 1LLBA 4JBFA 4GKUA 4JPMA 2JE5A 1BLCA 4S2IA 4PM5A 4WBGA 4P6BA 2Z2LB 3W4OA 1PWDA 4NK3A 3G32A 3BFFA 5DTSA 3IT9A 3UE0A 4Z9QA 2ZQ7A 3ZG0A 3LEZA 3PTEA 3Q82A 3MZFA 4LCLA 5DVAA 1LI0A 4KG6A 3M6HA 4Y0TA 4GDNA 5CERA 3PBSA 3SS5A 2ZQ9A 3M6BA 1LL5A 4EBNA 4Y0UA 3A3FA 4MBHA 1HTZA 4OH0A 4KZ6A 1VM1A 4WELA 1DJCA 4OOMA 4BD1A 4D2OA 2PBYA 4UA7A 1RGZA 1W79A 4EWFA 4WEKA 2C6WB 4KQRA 5HARA 3GTCA 2RL3A 3VSKA 3Q7VA 2H5SA 3DW0A 4KQQA 3MKFA 5F82A 4KQOA 2WK0A 5M1AA 5CGSA 5AQ9A 4E3OA 4QU3A 3NBLA 2JCHA 4E3MA 5A92A 3Q7ZA 1LI9A 1K54C 1BTLA 5DF7A 4B4XA 4RX2A 5FATA 3OZHA 1IELA 1TEMA 1JWZA 3DTMA 4GB7A 4K0XA 3BFDA 4S2MA 2WKHA 4Q8IA 1TVFA 5DF8A 2OV5A 5CGXA 3HLGA 2XH9A 4LV3A 2X71A 3SH9A 2ZM0A 4FD8A 5FQKA 1LHYA 3UE3A 1MXOA 2HDQA 3ZGAB 2WYXA 3BFCA 1XP4A 3HL9A 2I72A 3N8RA 2HDSA 1ES5A 1FR1A 4PM8A 3C4PA 1FCNA 3ZVTA 4KZ9A 3SS4A 4OQIA 4WEJA 4R4SA 3ZG7B 3A3JA 2EX6A 4S2NC 5GHXA 3TOIA 3IXDA 3OCLA 1ONHA 2Y2IA 3IHBA 3MBZA 2XFSA 4HBTA 4S2KA 3UPNA 2WGIA 4OOYA 1J9MA 1JVJA 1CI9A 3PBNA 4PM6A 1DY6A 5JYPA 1WYCA 1K6SA 5FQIA 3O87A 4HESA 3UN7A 4JXGA 5FASA 4X68A 5HFOA 4KG5A 3IH8A 3TSGA 3HLCA 2Q9MA 2ZC4B 1MWSA 3CZDA 4DXCA 5CEDA 2J9PA 2QMIA 2EFUA 3ITAA 5EUAA 3GV9A 4OVDA 2PU4A 5GHZA 4PMAA 5IHVA 1HVBA 4N92A 1ES4A 3ZCZA 4LENA 2XR0A 1ES2A 3GVBA 1MPLA 3IWOA 5E43A 4IVKA 1G6AA 4E3KA 5E2GA 2J9OA 3P09A 3Q81A 4LV1A 4U0TA 5I94A 1GHIA 1BULA 3PBQA 1FOFA 3HVFA 1PZOA 1HZOA 1O7EA 1QMFA 2WAFA 4E3IA 5EVLA 4DKIA 1SKFA 2OSUA 5EPHA 1N4OA 1K57C 2PU2A 3WRZA 1CI8A 1NXYA 4JKTA 3W4PA 3ZDJA 2JBFA 4WM9A 4ZAMA 1K25A 4FH2A 3V5MA 4E3NA 1IYSA 3WS1A 3GQZA 1O07A 1IEMA 2OLUA 3IXHA 3O3VA 5GHYA 2X02A 4QJGA 3VSLA 1KVLA 4XUZA 4IBXA 5G18A 1I2WA 2WZXA 2C5WB 2B5RA 3G31A 4OKPA 5FAOA 4S2PA 1ZC2A 3HUMA 1DJBA 3MKEA 3IQAA 3VOYA 4H8RA 1LL9A 1FQGA 2Y2QA 4JXWA 1ESIA 1PZPA 3UO9A 4BENA 2G2WA 2Y2JA 3O86A 3RJUA 1GA0A 2ZM8A 3FV7A 3LY3A 4GDBA 1GA9A 3ZG5A 5GLDA 3VMAA 5FDHA 4JXSA 2DNSA 2A49A 3WS0A 3OPRA 3BFGA 4WYYA 4E6WA 2P9VB 4IEDA 3EQUA 2J8YA 2R9WA 3EQVA 2DRWA 1YLWA 3SS3A 4NETA 3FZCA 5EVIA 4ZJ1A 5CGWA 1W7FA 3FYZA 3LO7A 3GMWA 3Q07A 1MWRA 3RXWA 5M18A 2Q9NA 1ONGA 1PWGA 2FFFB 4JF5A 3GRJA 2HP5A 1YLJA 5GLBA 1KE4A 4X55A 1CEGA 1RCJA 4O7DA 4QB8A 2WGWA 3IF6A 4GZBA 3S22A 1H8ZA 1L0FA 3GR2A 3ITBA 5CTMA 3UY6A 4EV4A 5CXWA 4OPZA 5DTTA 3ZNTA 4QY5A 1HD8A 1XA1A 1YLZA 3MXSA 1PIOA 4KENB 3VP3A 4EBPA 5KSHA 4OOLA 2Z2MB 1XA7A 4XXRA 3SOIA 2JC7A 1E4DA 4JF4A 4U0XA 4C75A 5FI7A 4DE1A 1MY8A 4ZJ2A 2IWDA 5EVID 4OONA 4S2LA 2EFXA 2EXAA 3B3XA 1JWVA 3MXRA 4MNRA 1NRFA 2XD1A 5FQMA 3N4IA 1NY0A 1ERMA 2Y2LA 4R3BA 2XLNA 3UPPA 2ZC5B 3WWXA 4YFMA 4EBLA 5A91A 1YLYA 2G2UA 4KZAA 4B88A 2Y2GA 4E6XA 3UPOA 1FCMA 1XKZA 3NC8A 2XK1A 1YMXA 1M40A 1WE4A 2H0YA 1L0DA 4OPQA 3W4QA 3VFFA 3AGDA 3OPHA 2CC1A 2X01A 1PI5A 4CJNA 2WKIA 1BUEA 1XX2A 4N9KA 1K55C 1YM1A 4R4RA 3FWLA 3C5AA 3NDGA 4R0QA 2HP6A 4Y0OA 1YLTA 1S6RA 2P74A 1ESUA 3HREA 2Y2HA 3BM6A 5E2EA 2HDRA 1N9BA 4Y7PA 4QY6A 1KDSA 1BZAA 1Q2PA 4X6TA 4E3JA 4ID4A 4GN2A 3SH7A 3ZG8B 3N6IA 3PAGA 4XUXA 4S2OA 4N1XA 2P9VA 4MBKA 3C7VA 4HBUA 1YLPA 4GOGA 4QHCA 5DF9A 5HAPA 1ES3A 5CRFA 4BL3A 3N8SA 4BQMA 1PW8A 2ZLYA 1ZG4A 2HDUA 1BSGA 5EVIC 1G68A 3IXGA 4OLGA 4QD4A 4ZJ3A 3BRMA 3IWIA 5EECA 1KGGA 2Y91A 1RGYA 2ZQAA 5JYOA 2XGNA 3N7WA 1FSWA 3PBOA 1GHMA 2V2FF 5EOOA 3E2KA 3S1YA 3LCEA 1MWUA 3UDFA 2EXBA 4R1GA 4BJPA 4FH4A 4LV2A 3S4XA 3V3SA 1L0EA 3UDXA 2GDNA 3WS5A 5TR7A 2WAEA 2HP9A 3IF6C 3UNWA 1I2SA 4PPRA 1H5XA 3ZFZA 1K54A 3DWKA 3IHAA 1L2SA 3HLEA 5E2HA 1XGJA 5FSRA 1BLPA 1W8YA 1KDWA 4BL2A 4EUZA 2ZC7A 3P98A 3A3EA 4WZ5A 1QMEA 1ZKJA 4IVIA 3TG9A 3NY4A 3ZNYA 4RA7A 3RXXA 1YT4A 1JWPA 1XXMA 4R3JA 5BOHA 5KMWA 4ZDXA 1SCWA 1CK3A 1JTDA 1Q2QA 2A3UA 1H8YA 4GD6A 4P0MA 2XEPA 4UA9A 3OPPA 4OP8A 4OPYA 4U3TA 5FQQA 1NJ4A 5M19A 5F83A 2ZQCA 1K6RA 5HW3A 5GLAA 3G4PA 2Y2PA 3M2KA 1FR6A 2XFTA 5GL9A 1C3BA 2ZD8A 3MZDA 3VP1A 2QPNA 1SDEA 4WMCD 4DE3A 3G30A 5HL1A 4P87A 4KZ5A 3CG5A 4KZ7A 5FAQA 1ZG6A 1K56A 4K0WA 3BECA 1FSYA 3D4FA 5FI6A 2Y2OA 4PM9A 1IYPA 1L0GA 1EWZA 1I5QA 3HLFA 2XF3A 4KZ3A 4ZTKA 1KGFA 3FKVA 1BT5A 5CHUA 3HUNA 1KVMA 1GHPA 4BLMA 5GLCA 2Y59A 2ZMAA 2QZ6A 2VGJA 3G34A 3G2YA 5AQ7A 2XQZA 4DXBA 2H0TA 4R23A 3QNCA 2Y4AA 3IXBA 5HAIA 1DJAA 1MBLA 3BEBA 3NDEA 4S2JA 3WRTA 1K4EA 4GD8A 3OC2A 5FA7A 3BLMA 3G35A 2XDMA 1K56D 4CPKA 4DE0A 4C3QA 2Y2MA 1ERQA 2R9XA 5CHJA 3V39A 3HLBA 4GNUA 1K57A 1E3UA 4KZ8A 3FKWA 3W8KA 3HLDA 5A90A 3E2LA 4FSFA 3QNBA 2OLVA 4M3KA 3V3RA 4DDYA 4UHUA 2ZJ9A 1GCEA 2ZM2A 1EROA 1Z6FA 3BLSA 1IKIA 2ZC3B 4FCFA 4OQ0A 4DDSA 5F1FA 3PBRA 1IYOA 4JLFA 1K38A 3PBTA 3VP2A 3M2JA 2UWXA 1FCOA 2Y2NA 2Y2KA 2V1ZA 4WZ5C 1OMEA 4LV0A 4OQHA 1SDNA 3MZEA 1VQQA 2H10A 4K91A 1PWCA 3BFEA 4HEFA 5F1GA 1U60A 3CJMA 3IF5A 1IYQA 3HLWA 1NZOA 5HX9A 5KSCA 4E3LA 2IWCA 5CHMA 3VP4A 1NZUA 1E3UD 5D3OA 5TGFA 1BLSA 5FAPA 3CMZA 4WZ4A 3A3IA 3Q1FA 3ZHHA 3ZG9B 1CEFA 2FFYA 2VGKA 2ZQ8A 4MBFA 2IWBA 3C7UA 3VFHA 5EVIB 1BLHA 3VOZA 5E2FA 4OPRA 3BYDA 5L2FA 3G2ZA 4OQGA
chains in the Genus database with same CATH superfamily
4X53A 3T4LA 3F1PA 3WS4A 4N1HA 2QYBA 4HQAA 4A5RA 4MLLA 1EI5A 3IX4A 3NDGA 4DE0A 1MKIA 3LY4A 2BG1A 4Q0HA 5AQBA 2WADA 1WYBA 1W5DA 3AGEA 4JXVA 4Q0IA 4PAUA 1TS8A 2RCXA 4LCMA 2G7UA 3T4OA 3C4OA 1YQSA 3ISGA 4HP9A 2BLSA 1ZTUA 2B18A 5CEBA 4L0LA 2L1MA 5LBRA 3O88A 3F1NB 2EX8A 3NI9A 4EQ1A 5CTNA 5KZHA 5TFQA 3N8LA 4RX3A 2ZL1B 2LB5A 5U47A 1S0WA 3V50A 5FI2A 1YPRA 1XGIA 3EWKA 3MFDA 3VP0A 2ZQDA 4DE2A 1BLCA 2OWHA 4P6BA 3W4OA 5DTSA 3UE0A 2A24B 4Z9QA 3UE6A 3PTEA 1VEUA 4LCLA 3B42A 3QP2A 1LI0A 3M6HA 4GDNA 3T4TA 4EBNA 2VA0A 1XFNA 4MBHA 4G3KA 2M7UA 1DJCA 4D2OA 2PBYA 4UA7A 4P6ZS 4WEKA 5EFWA 4KQRA 5HARA 3GTCA 3E98A 3VSKA 4KQOA 2ZOIA 4E3OA 3IBRA 1LI9A 4Y15A 5DF7A 4B4XA 4EW7A 1IELA 3DTMA 4Q8IA 2X71A 3BFCA 3HL9A 3F1NA 4E04A 4I3IA 3T4SA 5L09A 3SS4A 2E8JA 1LT0A 3NHQA 3UMEA 4S2KA 3DTEA 2WGIA 3UPNA 1J9MA 3PBNA 4PM6A 4UEYA 1K6SA 4AFIA 1BYWA 3H82A 4X68A 4JGOA 3IH8A 2M1CA 1MWSA 2OAP1 4DXCA 3LYXA 1L3LA 5EUAA 3GV9A 5GHZA 1LSXA 2XR0A 3S7QA 3P09A 4LV1A 1YAXA 4U0TA 3PBQA 3A0RA 3B47A 1PZOA 1QMFA 2EWVA 3MJQA 5L8MA 3DTKA 3K3CA 5EPHA 3WRZA 1CI8A 3W4PA 1IYSA 3WS1A 3GQZA 4MCWA 1IEMA 2VK3A 3VSLA 1KVLA 4XUZA 3MSHA 4IBXA 5G18A 1I2WA 2WZXA 2PD7A 5EVEA 3HUMA 3JPUA 4H8RA 2ZOHA 2HJEA 4JXWA 2G2WA 2Y2JA 1GA0A 1GA9A 3ZG5A 1MKMA 5FDHA 1T1CA 3OPRA 4E6WA 2R9WA 2O9BA 2DRWA 3SS3A 2Y79A 4EU0A 2MJ6A 5M18A 3RXWA 1OPXA 3GRJA 4Y2FA 1MZUA 1KE4A 1CEGA 4QB8A 4O7DA 2WGWA 3IF6A 4GZBA 1H8ZA 3UY6A 4OPZA 4MN7A 3ZNTA 1TD5A 5KSHA 4EBPA 4XXRA 1E4DA 4C75A 2IWDA 5EVID 2EFXA 3B3XA 5FQMA 2XD1A 1ERMA 1N9OA 2XLNA 3UPPA 5A91A 4B88A 2G2UA 3NC8A 2XK1A 1YMXA 1WE4A 3ICYA 3BY9A 4HOIA 1BUEA 3IS2A 1K55C 5HL6A 3C5AA 2VLGA 4HP4A 2HP6A 3LIBA 4Y0OA 4BBVA 2Y2HA 5E2EA 4Y7PA 4QY6A 1KDSA 3LIEA 4X6TA 4GN2A 3PAGA 3LIDA 3C7VA 5HPIA 2W0NA 4QHCA 1ES3A 5CRFA 4CLCB 3QP4A 1XJ4A 2QHKA 2HDUA 1P9RA 3IXGA 2J80A 2Y91A 1RGYA 2ZQAA 2XGNA 3N7WA 5EOOA 4H6JB 5MC7A 3ZYTA 2GDNA 3MR0A 2WAEA 2HP9A 3UNWA 3ZFZA 1K54A 3DWKA 5IU1A 3DAVA 1BLPA 1W8YA 4BL2A 3A3EA 1DRMA 1OTDA 3NY4A 3QP8A 4RA7A 1GSVA 1XXMA 5BOHA 5KMWA 2P7JA 2XEPA 3OPPA 4OP8A 2B95A 2W3HA 2ZQCA 5HW3A 2Y2PA 3M2KA 2XFTA 3MZDA 3PHYA 1SDEA 2PAVP 4WMCD 5TJJA 4KZ5A 4KZ7A 2O0YA 1ZG6A 2JKFA 5HDDA 3KSIA 2V9AA 1XFQA 3FG8A 3FKVA 3HUNA 1GHPA 4BLMA 1DP8A 4CLCA 1OTIA 4R23A 5HAIA 1DJAA 1K4EA 4GD8A 3LIFA 1T1BA 2INWA 2Y2MA 2R9XA 4H6JA 1K57A 3HLDA 1YKDA 3QNBA 2OLVA 3V3RA 2ZJ9A 2ZM2A 1Z6FA 2ZC3B 4QWOA 5F1FA 3PBRA 4RQ9A 1Y4OA 2UWXA 1FCOA 3NOPC 2V1ZA 4IHQA 3QP5A 3MZEA 4HEFA 5F1GA 3IF5A 3CJMA 4QPRA 1S1ZA 5HX9A 2IWCA 1G5UA 2V8FA 5CHMA 1E3UD 4R3AA 2PBDP 5FAPA 4WZ4A 3Q1FA 1D06A 3C7UA 2PHYA 3CWFA 4OPRA 4EESA 1JNUA 3F1OA 5F5YA 4I39A 2VGLM 3PYPA 4OLDA 1IKGA 2XD5A 1AXBA 3Q7VB 2OWJA 3DWZA 1KGEA 3UE1A 3AGFA 2WZZA 1VB6A 1F2KA 5EOEA 2W3GA 5HAQA 3T1SA 1NYYA 4UA6A 3SZTA 3ZVWA 3C30A 1PNEA 4DJ3A 1Y54A 4OP5A 3NIAA 4BD0A 1JTGA 4RYEA 5AVEA 4KZ4A 3I7JA 5J7EA 1UGUA 1OTBA 3K3DA 4KG2A 3QP1A 3BWLA 1KE3A 3IWQA 3HUOA 4IBRA 3T1QB 4JBFA 4GKUA 4S2IA 4PM5A 4WBGA 2DMWA 5HSQA 3MQ0A 2ZQ7A 3LEZA 5I5LA 5DVAA 5HWTA 3PBSA 3SS5A 3M6BA 2YKHA 1HTZA 4WELA 3CAXA 2L4RA 2VV6A 2W3FA 2FZ0A 4EWFA 2J3WA 4GHIB 2RL3A 3Q7VA 3DW0A 5F82A 2JCHA 5A92A 1BTLA 5FATA 1TEMA 2K31A 1JWZA 4K0XA 2WKHA 2V1AA 4LV3A 3GECA 3K2NA 3SH9A 4FD8A 1LHYA 2HDQA 3ZGAB 1XP4A 3KYQA 2HDSA 1FCNA 5F68A 4XT2A 3NOUC 3T50A 5GHXA 3TOIA 3MBZA 3CI6A 4OOYA 1JVJA 1WYCA 5FQIA 4HESA 3UN7A 4GLQA 3MQOA 3TSGA 2Q9MA 4R38A 2ZC4B 1OJGA 2EFUA 3ITAA 4OVDA 2OOLA 3IWOA 5E2GA 2J9OA 2WKPA 3R7WA 5DKKA 5I94A 1BULA 1FOFA 1ACFA 3GDIA 1O7EA 2WAFA 4E3IA 5EVLA 2OSUA 1N4OA 5EV0A 2PU2A 2EWWA 4M4XA 3ZDJA 1N9NA 1TS0A 4FH2A 3LR0A 3OOVA 2C5WB 2B5RA 4JGPA 4ETZA 1MC0A 5FEGA 1ZC2A 4NXFA 2Q0OA 4Z1WA 1FQGA 3UO9A 3HJIA 4LRZE 2ZM8A 3FV7A 3OBFA 3WS0A 2A49A 4WYYA 1YLWA 4NETA 5EVIA 1W7FA 3FYZA 1T1AA 1ONGA 3VE4A 1D7EA 4JF5A 2XA7S 1YLJA 2GZAA 4Y3IA 4HI4A 3S22A 3ITBA 3UB9A 3G6OA 5CXWA 3L9KA 5DTTA 4QY5A 3MXSA 4KENB 4OOLA 4JF4A 4DE1A 4U0XA 4HH2A 4S2LA 2PRFA 1H3QA 1JWVA 3MXRA 4MNRA 1NY0A 3WWXA 1XJ3A 4EBLA 2Y2GA 4E6XA 2O99A 4YOFA 2H0YA 2M7VA 4HIAA 5HZHA 3MXQA 1PI5A 3HJKA 2ZL1A 3DTIA 3FWLA 4R4RA 4NXEA 4R70A 1S6RA 5EM0A 3HREA 2GX5A 3BM6A 3PXPA 1Q2PA 4E3JA 3QP6A 4G3VA 5HD5A 2K2NA 1NWZA 4LPZA 5DF9A 3BJNA 2A24A 4BL3A 3N8SA 4NKPA 1PW8A 5EM1A 1ZG4A 4OLGA 3BRMA 4CLCE 2W27A 3VE3A 5JYOA 1NLYA 5HWVA 3PBOA 2HJ9C 1GHMA 2V2FF 3LCEA 5FEFA 2EXBA 4BJPA 1F9IA 3WS5A 3IF6C 1H5XA 1L2SA 3HLEA 3FPWA 1KDWA 2ZC7A 3P98A 3JVUA 4WZ5A 3ZNYA 3RXXA 1YT4A 1FIKA 4ZDXA 2ACGA 4P0MA 1JTDA 2A3UA 4GD6A 1H8YA 2XROA 3R4KA 5F83A 1TS6A 3G4PA 1FR6A 4ETXA 4DE3A 3UB5P 1S67L 3CG5A 5FAQA 4K0WA 2IA2A 3D4FA 1Z09A 1EWZA 3HLFA 1BT5A 4NXGA 1KVMA 2VGJA 3G2YA 2XQZA 2XA7M 2BTFP 3OC2A 5FA7A 3BLMA 4GNUA 4BMWA 1E3UA 1TS7A 3FKWA 2Y8HA 3ZQ5A 3E2LA 4UHUA 1EROA 1IKIA 3C38A 3U2AA 4DDSA 1PRQA 1IYOA 3O5YA 3PBTA 1T18A 2Y2NA 4ARZB 2Y2KA 4HY8A 1SKOB 3KSGA 4OQHA 1SDNA 1IYQA 5KSCA 4E3LA 3VP4A 1H8MA 3MF0A 3A3IA 5DJTA 5J3WA 3ZG9B 3T12B 3E0YA 1CEFA 4WUJA 2VGLS 3IX3A 5F6AA 4OH0A 4OQGA 1G28A 1STZA 3IH9A 4N9LA 3OCNA 1W8QA 3T1RA 4B4ZA 5EE8A 3H9WA 2QJ7A 2EX2A 2HPBA 4EQIA 2DCFA 1KE0A 2W1TB 1RP5A 3DBAA 2LB9A 1PYYA 2EX9A 1PI4A 3QHYA 4MDZA 2JHEA 3A3DA 4HJ4A 1NYMA 1ALQA 5CECA 3MMHA 4X56A 4LRXC 5FQ9A 2WUQA 1P9WA 3MFXA 1PW1A 5AJGA 1TDLA 5KIZA 3PAEA 4F94A 2WKEA 3TRCA 4X69A 1MWTA 4S2NA 1K55A 4JF6A 4GCZA 2E8IA 4P85A 4PM7A 5J8XA 3EEHA 3ULFA 1LLBA 4EETB 5HPFA 2Z2LB 3MQQA 3ZG0A 3BY8A 4KG6A 1LL5A 3A3FA 1VM1A 4OOMA 3RTYA 1RGZA 1W79A 2C6WB 3FPVA 4D60A 4KQQA 3MKFA 4NG2A 2V0UA 3CITA 5M1AA 5CGSA 4K08A 1V9ZA 3U4LP 4RX2A 3PR6A 3OZHA 4S2MA 4GB7A 1TVFA 5DF8A 2OV5A 5CGXA 2UV0E 3HLGA 2XH9A 2QJ5A 4L9GA 3UE3A 2GNXA 1MXOA 2I72A 3N8RA 3ZVTA 4KZ9A 3CHWP 2PR6A 4GJ4A 4I38A 3ZG7B 3UB8A 3OCLA 1ONHA 2Y2IA 4UQIS 3IHBA 1KOUA 2XFSA 4HBTA 5JYPA 4KQDA 1EW0A 3O87A 2O9CA 5FASA 5HFOA 4KG5A 4EEPA 5J4EA 3CZDA 2J9PA 2QMIA 4PKYA 4N92A 1ES4A 3ZCZA 3KSHA 1ES2A 1MPLA 5E43A 4IVKA 4YNRA 4E3KA 1DP6A 2GJ3A 3BW6A 1PFLA 1W63M 2XRNA 4HHDA 2V8CA 3LFVA 4WLAA 4DKIA 1SKFA 1ZHHB 3D3OA 3LI9A 3TE8A 5HWWA 2JBFA 4WM9A 4ZAMA 3KYEA 4E3NA 1O07A 3O3VA 2X02A 1UWPX 4QJGA 5FAOA 4S2PA 3MKEA 3LEQA 3VOYA 1LL9A 5FL3A 2Y2QA 1ESIA 3UMDA 4GDBA 2O9AA 3VMAA 4GW9A 1IOUA 1N9LA 4L9FA 4IEDA 3CUEA 3EQUA 3EQVA 4DN0A 5AVFA 4ZJ1A 2AVXA 5CGWA 1SZVA 4G3WA 3LO7A 3Q07A 5CX7A 3KX0X 2Q9NA 1X0OA 5GLBA 2W3EA 4X55A 1RCJA 3GR2A 4IJGA 1ODVA 1XA1A 1YLZA 3VP3A 2JC7A 4F3LB 4ESPA 3EEAA 3N4IA 2Y2LA 4R3BA 2ZC5B 4YFMA 1VHMA 3UPOA 2VX8A 4KZAA 1FCMA 1S4SA 1M40A 4O0PA 3W4QA 1OTAA 3AGDA 2CC1A 4CJNA 1XX2A 1YM1A 1YLTA 2P74A 1ESUA 3D9YA 3A0VA 2P08A 2VZWA 4HNBA 4UQIM 2PYRA 3ZG8B 4XUXA 2VJWA 4HBUA 4GOGA 1F98A 5HAPA 4BQMA 5HDCA 3IBJA 1BSGA 5EVIC 1G68A 1FSWA 3S1YA 3E2KA 1HLUP 3UDFA 4GHIA 4R1GA 4FH4A 4LV2A 1L0EA 3UDXA 1I2SA 4PPRA 5E2HA 4F3LA 4WN5A 4EUZA 2PT7A 1QMEA 1T19A 3TG9A 1OT9A 4R3JA 2WKQA 4UA9A 1SCWA 1CK3A 1Q2QA 3C8CA 4OPYA 5FQQA 3P01A 1NJ4A 2V1BA 5M19A 4PHTA 5GLAA 1C3BA 2ZD8A 3NECA 3VP1A 1GSWA 2QPNA 4MN6A 1P97A 3B33A 3G30A 5HL1A 4LRYC 4X1MA 1FSYA 3EGDC 5FI6A 3UB7A 3E4QA 3LR3A 1I5QA 3RFBA 2XF3A 4KZ3A 3H82B 4HJ3A 1KGFA 5CHUA 2FH5A 1AWIA 2Y59A 1F5MA 2QZ6A 2H0TA 3IXBA 1MBLA 3BEBA 3NDEA 4S2JA 3WRTA 4BBUA 1LSVA 3G35A 2XDMA 1K56D 4CPKA 1XJ2A 3T1XA 4B93A 2PDRA 2VV8A 4C3QA 1ERQA 5CHJA 3V39A 3HLBA 4Q0JA 5HDSA 4KZ8A 3W8KA 3NOTC 1S4RA 4M3KA 1LSWA 4FCFA 4OQ0A 4B9OA 2VEAA 1K38A 3M2JA 2HZ5A 3TJZC 4WZ5C 4K91A 4WL9A 1U60A 4PKYG 3HLWA 2ZMFA 3S7OA 5D3OA 5TGFA 1UWNX 1BLSA 3MS6A 3CMZA 4HH3A 3E4OA 2KDKA 2PYPA 2ZQ8A 2IWBA 1OT6A 3P7NA 1BLHA 3VOZA 5E2FA 4R6LA 1VETB 3BYDA 5L2FA 2HF6A 5FDSA 3NULA 4YINA 3GSGA 5DTKA 1K4FA 1YMSA 2WGWB 3IF6B 5IHVA 1XPBA 4WMCA 2WGVA 4KZBA 1P0ZA 1M6KA 2V20A 3OPLA 4DRTA 4EEUA 4DF6A 2ZC6B 3WS2A 3UB6A 1WA9A 4MEZA 3VOLA 2HV1A 4NXBA 4Y5FA 3UDIA 2JKGA 2OAQ1 3HCYA 4ZBEA 3L7HA 5A93A 4C6YA 3JYIA 1K0KA 2J7VA 4I3AA 1TDGA 3HBRA 1NLZA 2D02A 2KX6A 1DP9A 3IS2B 4UAAA 3BQ8A 5FQJA 4RVAA 2ZBBA 1S1YA 2YKFA 2Y55A 1SHVA 1E25A 3KYZA 3SH8A 3NCKA 3CPTB 5AQAA 2XSSA 4JPMA 2JE5A 4X25A 1PWDA 4NK3A 3G32A 3BFFA 3IT9A 3Q82A 3MZFA 4Y0TA 1VETA 5CERA 2ZQ9A 4Y0UA 4LFUA 4KZ6A 4GS9B 4BD1A 4FTXA 4LGWA 5IS1A 1FILA 1CJFA 1A0KA 2H5SA 4O8GA 2WK0A 4P6ZM 2JKRM 5AQ9A 4QU3A 3NBLA 4E3MA 3Q7ZA 1K54C 2Z6CA 2J3TC 3BFDA 2PD8A 2ZM0A 3BQAA 5FQKA 3LUQA 2WYXA 5DJUA 4FUWA 4KUKA 1ES5A 1FR1A 3JVVA 4IUHA 3C4PA 4L9EA 4PM8A 2WKRA 4DMZA 4OQIA 4WEJA 4R4SA 3A3JA 2EX6A 4S2NC 1YSPA 3IXDA 1TF1A 1CI9A 4EXOA 4II7A 1DY6A 4DJ2A 1G6OA 4JXGA 1OJ5A 3HLCA 3CPTA 2EA9A 1CQAA 4WF0A 5CEDA 1V9YA 4JGQA 3LIAA 2PU4A 4PMAA 4I3JA 4BBTA 1HVBA 4LENA 5HD3A 3GVBA 4CLCC 1G6AA 4YWZA 3Q81A 1GHIA 4GS9A 3HVFA 1HZOA 1K57C 1NXYA 4JKTA 4MN5A 3KSFA 1K25A 3V5MA 2R78A 5C5KA 2OLUA 3IXHA 4KUOA 5GHYA 3S7PA 3TW8A 4Y13A 2JKRI 4ARZA 1D1JA 1SKOA 3G31A 4OKPA 2BASA 2CMNA 2KOIA 1DJBA 4IUKA 2HGVA 3IQAA 5F69A 1PZPA 4BENA 4O01A 3O86A 3RJUA 4JGRA 3LY3A 5GLDA 1LL8A 2VKSA 4JXSA 2DNSA 2H28A 3CLOA 3S7NA 2QWSA 3BFGA 2P9VB 3LICA 1H0MA 2J8YA 3VV4A 3FZCA 4CQHA 3GMWA 4HJ6A 5L07A 1MWRA 1PWGA 2FFFB 3F1OB 3T4QA 2HP5A 4BWIA 2L0WA 4ME4A 2W1TA 5CTMA 1L0FA 4EV4A 1HD8A 1PIOA 2B02A 2Z2MB 1XA7A 3SOIA 4EUVA 3H7WB 1GSXA 5FI7A 3LI8A 1MY8A 4ZJ2A 3SW1A 1CF0A 4OONA 2EXAA 5G4YA 4I5SA 1NRFA 3LR5A 4Y17A 2JKTM 2P04A 4EERA 5A8BA 1YLYA 1XKZA 3FC7A 1L0DA 2ZMVA 4OPQA 3VFFA 1XJ6A 3IX8A 3OPHA 2X01A 2WKIA 4N9KA 1OTEA 4R0QA 3LGOA 3KO6A 3D72A 2HDRA 1N9BA 2W3DA 3E4PA 1BZAA 4ID4A 3SH7A 3N6IA 4S2OA 4N1XA 2P9VA 4MBKA 1YLPA 3CUEC 2ZLYA 5L10A 4QD4A 4ZJ3A 3IWIA 5EECA 1KGGA 1Y28A 2D01A 3NJAA 3EOIA 5K5BA 1MWUA 5TBMB 3S4XA 5DFYA 3V3SA 5TR7A 3OLOA 3IHAA 1XGJA 3H7WA 5FSRA 3T4KA 1ZKJA 4IVIA 1JWPA 3V67A 1S66L 4U3TA 1K6RA 2JKTI 5IT5A 5GL9A 1W63Q 2Z6DA 4XT2B 4LLOB 4P87A 1K56A 3BECA 3EGXC 2Y2OA 4PM9A 2NUPC 1IYPA 2J3TD 1L0GA 3RH8B 4ZTKA 4MMNA 2VV7A 3F1PB 3LR4A 5GLCA 2ZMAA 3G34A 5AQ7A 4DXBA 3QNCA 2PR5A 2K7SA 2Y4AA 3C2WA 3R7WB 5G4ZA 4FOFA 2NUTC 2I9VA 3A0SA 2A2LA 3T4JA 5TBMA 5A90A 2JN7A 4FSFA 4X1LA 4DDYA 3W2ZA 1GCEA 3BLSA 1IFQA 4JLFA 4ZRRA 3VP2A 2V0WA 2QKPA 4CLCD 1OMEA 4LV0A 5DKLA 1VQQA 2H10A 1PWCA 3BFEA 1NZOA 2W1RA 1YSQA 1NZUA 1NRJA 2KLIA 3ZHHA 2FFYA 2VGKA 5DFXA 4MBFA 3VFHA 1VEUB 5EVIB 1J3WA 4NEED 3G2ZA
chains in the Genus database with same CATH topology
4X53A 3IH9A 4N9LA 3OCNA 1W8QA 3WS4A 4YINA 4N1HA 3GSGA 4OLDA 4B4ZA 5EE8A 2EX2A 4A5RA 1IKGA 5DTKA 2HPBA 4MLLA 2XD5A 1EI5A 4EQIA 2DCFA 1KE0A 1K4FA 1YMSA 1MKIA 1AXBA 2WGWB 3IF6B 2BG1A 1XPBA 3LY4A 3Q7VB 4WMCA 1RP5A 3DWZA 1KGEA 5AQBA 3UE1A 2WGVA 2WADA 1WYBA 1PYYA 4KZBA 1W5DA 2EX9A 3AGEA 4JXVA 3AGFA 2WZZA 1PI4A 1M6KA 2RCXA 2V20A 3OPLA 4LCMA 5EOEA 4DRTA 3QHYA 5HAQA 3C4OA 1NYYA 4DF6A 1YQSA 2ZC6B 3WS2A 3A3DA 4UA6A 3ZVWA 4MEZA 3ISGA 1NYMA 2BLSA 1ALQA 5CECA 4X56A 5CEBA 3UDIA 5FQ9A 4ZBEA 2WUQA 4L0LA 1PW1A 1TDLA 1Y54A 3O88A 2EX8A 5A93A 4OP5A 4C6YA 3JYIA 3NI9A 3PAEA 5CTNA 3NIAA 5KZHA 4F94A 4BD0A 1JTGA 2WKEA 4RYEA 2J7VA 4X69A 5TFQA 1MWTA 4KZ4A 1TDGA 3I7JA 4S2NA 1K55A 3HBRA 4JF6A 3N8LA 4RX3A 4UAAA 2E8IA 5FQJA 4KG2A 5U47A 4RVAA 1S0WA 3V50A 5FI2A 2Y55A 1KE3A 1SHVA 1XGIA 3IWQA 4P85A 4PM7A 1E25A 3MFDA 3HUOA 3SH8A 3NCKA 2ZQDA 4IBRA 3VP0A 5J8XA 5AQAA 4DE2A 1LLBA 4JBFA 4GKUA 4JPMA 2JE5A 1BLCA 4S2IA 4PM5A 4WBGA 4P6BA 2Z2LB 3W4OA 1PWDA 4NK3A 3G32A 3BFFA 5DTSA 3IT9A 3UE0A 4Z9QA 2ZQ7A 3ZG0A 3LEZA 3PTEA 3Q82A 3MZFA 4LCLA 5DVAA 1LI0A 4KG6A 3M6HA 4Y0TA 4GDNA 5CERA 3PBSA 3SS5A 2ZQ9A 3M6BA 1LL5A 4EBNA 4Y0UA 3A3FA 4MBHA 1HTZA 4OH0A 4KZ6A 1VM1A 4WELA 1DJCA 4OOMA 4BD1A 4D2OA 2PBYA 4UA7A 1RGZA 1W79A 4EWFA 4WEKA 2C6WB 4KQRA 5HARA 3GTCA 2RL3A 3VSKA 3Q7VA 2H5SA 3DW0A 4KQQA 3MKFA 5F82A 4KQOA 2WK0A 5M1AA 5CGSA 5AQ9A 4E3OA 4QU3A 3NBLA 2JCHA 4E3MA 5A92A 3Q7ZA 1LI9A 1K54C 1BTLA 5DF7A 4B4XA 4RX2A 5FATA 3OZHA 1IELA 1TEMA 1JWZA 3DTMA 4GB7A 4K0XA 3BFDA 4S2MA 2WKHA 4Q8IA 1TVFA 5DF8A 2OV5A 5CGXA 3HLGA 2XH9A 4LV3A 2X71A 3SH9A 2ZM0A 4FD8A 5FQKA 1LHYA 3UE3A 1MXOA 2HDQA 3ZGAB 2WYXA 3BFCA 1XP4A 3HL9A 2I72A 3N8RA 2HDSA 1ES5A 1FR1A 4PM8A 3C4PA 1FCNA 3ZVTA 4KZ9A 3SS4A 4OQIA 4WEJA 4R4SA 3ZG7B 3A3JA 2EX6A 4S2NC 5GHXA 3TOIA 3IXDA 3OCLA 1ONHA 2Y2IA 3IHBA 3MBZA 2XFSA 4HBTA 4S2KA 3UPNA 2WGIA 4OOYA 1J9MA 1JVJA 1CI9A 3PBNA 4PM6A 1DY6A 5JYPA 1WYCA 1K6SA 5FQIA 3O87A 4HESA 3UN7A 4JXGA 5FASA 4X68A 5HFOA 4KG5A 3IH8A 3TSGA 3HLCA 2Q9MA 2ZC4B 1MWSA 3CZDA 4DXCA 5CEDA 2J9PA 2QMIA 2EFUA 3ITAA 5EUAA 3GV9A 4OVDA 2PU4A 5GHZA 4PMAA 5IHVA 1HVBA 4N92A 1ES4A 3ZCZA 4LENA 2XR0A 1ES2A 3GVBA 1MPLA 3IWOA 5E43A 4IVKA 1G6AA 4E3KA 5E2GA 2J9OA 3P09A 3Q81A 4LV1A 4U0TA 5I94A 1GHIA 1BULA 3PBQA 1FOFA 3HVFA 1PZOA 1HZOA 1O7EA 1QMFA 2WAFA 4E3IA 5EVLA 4DKIA 1SKFA 2OSUA 5EPHA 1N4OA 1K57C 2PU2A 3WRZA 1CI8A 1NXYA 4JKTA 3W4PA 3ZDJA 2JBFA 4WM9A 4ZAMA 1K25A 4FH2A 3V5MA 4E3NA 1IYSA 3WS1A 3GQZA 1O07A 1IEMA 2OLUA 3IXHA 3O3VA 5GHYA 2X02A 4QJGA 3VSLA 1KVLA 4XUZA 4IBXA 5G18A 1I2WA 2WZXA 2C5WB 2B5RA 3G31A 4OKPA 5FAOA 4S2PA 1ZC2A 3HUMA 1DJBA 3MKEA 3IQAA 3VOYA 4H8RA 1LL9A 1FQGA 2Y2QA 4JXWA 1ESIA 1PZPA 3UO9A 4BENA 2G2WA 2Y2JA 3O86A 3RJUA 1GA0A 2ZM8A 3FV7A 3LY3A 4GDBA 1GA9A 3ZG5A 5GLDA 3VMAA 5FDHA 4JXSA 2DNSA 2A49A 3WS0A 3OPRA 3BFGA 4WYYA 4E6WA 2P9VB 4IEDA 3EQUA 2J8YA 2R9WA 3EQVA 2DRWA 1YLWA 3SS3A 4NETA 3FZCA 5EVIA 4ZJ1A 5CGWA 1W7FA 3FYZA 3LO7A 3GMWA 3Q07A 1MWRA 3RXWA 5M18A 2Q9NA 1ONGA 1PWGA 2FFFB 4JF5A 3GRJA 2HP5A 1YLJA 5GLBA 1KE4A 4X55A 1CEGA 1RCJA 4O7DA 4QB8A 2WGWA 3IF6A 4GZBA 3S22A 1H8ZA 1L0FA 3GR2A 3ITBA 5CTMA 3UY6A 4EV4A 5CXWA 4OPZA 5DTTA 3ZNTA 4QY5A 1HD8A 1XA1A 1YLZA 3MXSA 1PIOA 4KENB 3VP3A 4EBPA 5KSHA 4OOLA 2Z2MB 1XA7A 4XXRA 3SOIA 2JC7A 1E4DA 4JF4A 4U0XA 4C75A 5FI7A 4DE1A 1MY8A 4ZJ2A 2IWDA 5EVID 4OONA 4S2LA 2EFXA 2EXAA 3B3XA 1JWVA 3MXRA 4MNRA 1NRFA 2XD1A 5FQMA 3N4IA 1NY0A 1ERMA 2Y2LA 4R3BA 2XLNA 3UPPA 2ZC5B 3WWXA 4YFMA 4EBLA 5A91A 1YLYA 2G2UA 4KZAA 4B88A 2Y2GA 4E6XA 3UPOA 1FCMA 1XKZA 3NC8A 2XK1A 1YMXA 1M40A 1WE4A 2H0YA 1L0DA 4OPQA 3W4QA 3VFFA 3AGDA 3OPHA 2CC1A 2X01A 1PI5A 4CJNA 2WKIA 1BUEA 1XX2A 4N9KA 1K55C 1YM1A 4R4RA 3FWLA 3C5AA 3NDGA 4R0QA 2HP6A 4Y0OA 1YLTA 1S6RA 2P74A 1ESUA 3HREA 2Y2HA 3BM6A 5E2EA 2HDRA 1N9BA 4Y7PA 4QY6A 1KDSA 1BZAA 1Q2PA 4X6TA 4E3JA 4ID4A 4GN2A 3SH7A 3ZG8B 3N6IA 3PAGA 4XUXA 4S2OA 4N1XA 2P9VA 4MBKA 3C7VA 4HBUA 1YLPA 4GOGA 4QHCA 5DF9A 5HAPA 1ES3A 5CRFA 4BL3A 3N8SA 4BQMA 1PW8A 2ZLYA 1ZG4A 2HDUA 1BSGA 5EVIC 1G68A 3IXGA 4OLGA 4QD4A 4ZJ3A 3BRMA 3IWIA 5EECA 1KGGA 2Y91A 1RGYA 2ZQAA 5JYOA 2XGNA 3N7WA 1FSWA 3PBOA 1GHMA 2V2FF 5EOOA 3E2KA 3S1YA 3LCEA 1MWUA 3UDFA 2EXBA 4R1GA 4BJPA 4FH4A 4LV2A 3S4XA 3V3SA 1L0EA 3UDXA 2GDNA 3WS5A 5TR7A 2WAEA 2HP9A 3IF6C 3UNWA 1I2SA 4PPRA 1H5XA 3ZFZA 1K54A 3DWKA 3IHAA 1L2SA 3HLEA 5E2HA 1XGJA 5FSRA 1BLPA 1W8YA 1KDWA 4BL2A 4EUZA 2ZC7A 3P98A 3A3EA 4WZ5A 1QMEA 1ZKJA 4IVIA 3TG9A 3NY4A 3ZNYA 4RA7A 3RXXA 1YT4A 1JWPA 1XXMA 4R3JA 5BOHA 5KMWA 4ZDXA 1SCWA 1CK3A 1JTDA 1Q2QA 2A3UA 1H8YA 4GD6A 4P0MA 2XEPA 4UA9A 3OPPA 4OP8A 4OPYA 4U3TA 5FQQA 1NJ4A 5M19A 5F83A 2ZQCA 1K6RA 5HW3A 5GLAA 3G4PA 2Y2PA 3M2KA 1FR6A 2XFTA 5GL9A 1C3BA 2ZD8A 3MZDA 3VP1A 2QPNA 1SDEA 4WMCD 4DE3A 3G30A 5HL1A 4P87A 4KZ5A 3CG5A 4KZ7A 5FAQA 1ZG6A 1K56A 4K0WA 3BECA 1FSYA 3D4FA 5FI6A 2Y2OA 4PM9A 1IYPA 1L0GA 1EWZA 1I5QA 3HLFA 2XF3A 4KZ3A 4ZTKA 1KGFA 3FKVA 1BT5A 5CHUA 3HUNA 1KVMA 1GHPA 4BLMA 5GLCA 2Y59A 2ZMAA 2QZ6A 2VGJA 3G34A 3G2YA 5AQ7A 2XQZA 4DXBA 2H0TA 4R23A 3QNCA 2Y4AA 3IXBA 5HAIA 1DJAA 1MBLA 3BEBA 3NDEA 4S2JA 3WRTA 1K4EA 4GD8A 3OC2A 5FA7A 3BLMA 3G35A 2XDMA 1K56D 4CPKA 4DE0A 4C3QA 2Y2MA 1ERQA 2R9XA 5CHJA 3V39A 3HLBA 4GNUA 1K57A 1E3UA 4KZ8A 3FKWA 3W8KA 3HLDA 5A90A 3E2LA 4FSFA 3QNBA 2OLVA 4M3KA 3V3RA 4DDYA 4UHUA 2ZJ9A 1GCEA 2ZM2A 1EROA 1Z6FA 3BLSA 1IKIA 2ZC3B 4FCFA 4OQ0A 4DDSA 5F1FA 3PBRA 1IYOA 4JLFA 1K38A 3PBTA 3VP2A 3M2JA 2UWXA 1FCOA 2Y2NA 2Y2KA 2V1ZA 4WZ5C 1OMEA 4LV0A 4OQHA 1SDNA 3MZEA 1VQQA 2H10A 4K91A 1PWCA 3BFEA 4HEFA 5F1GA 1U60A 3CJMA 3IF5A 1IYQA 3HLWA 1NZOA 5HX9A 5KSCA 4E3LA 2IWCA 5CHMA 3VP4A 1NZUA 1E3UD 5D3OA 5TGFA 1BLSA 5FAPA 3CMZA 4WZ4A 3A3IA 3Q1FA 3ZHHA 3ZG9B 1CEFA 2FFYA 2VGKA 2ZQ8A 4MBFA 2IWBA 3C7UA 3VFHA 5EVIB 1BLHA 3VOZA 5E2FA 4OPRA 3BYDA 5L2FA 3G2ZA 4OQGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X53 A;  3IH9 A;  4N9L A;  3OCN A;  1W8Q A;  3WS4 A;  4YIN A;  4N1H A;  3GSG A;  4OLD A;  4B4Z A;  5EE8 A;  2EX2 A;  4A5R A;  1IKG A;  5DTK A;  2HPB A;  4MLL A;  2XD5 A;  1EI5 A;  4EQI A;  2DCF A;  1KE0 A;  1K4F A;  1YMS A;  1MKI A;  1AXB A;  2WGW B;  3IF6 B;  2BG1 A;  1XPB A;  3LY4 A;  3Q7V B;  4WMC A;  1RP5 A;  3DWZ A;  1KGE A;  5AQB A;  3UE1 A;  2WGV A;  2WAD A;  1WYB A;  1PYY A;  4KZB A;  1W5D A;  2EX9 A;  3AGE A;  4JXV A;  3AGF A;  2WZZ A;  1PI4 A;  1M6K A;  2RCX A;  2V20 A;  3OPL A;  4LCM A;  5EOE A;  4DRT A;  3QHY A;  5HAQ A;  3C4O A;  1NYY A;  4DF6 A;  1YQS A;  2ZC6 B;  3WS2 A;  3A3D A;  4UA6 A;  3ZVW A;  4MEZ A;  3ISG A;  1NYM A;  2BLS A;  1ALQ A;  5CEC A;  4X56 A;  5CEB A;  3UDI A;  5FQ9 A;  4ZBE A;  2WUQ A;  4L0L A;  1PW1 A;  1TDL A;  1Y54 A;  3O88 A;  2EX8 A;  5A93 A;  4OP5 A;  4C6Y A;  3JYI A;  3NI9 A;  3PAE A;  5CTN A;  3NIA A;  5KZH A;  4F94 A;  4BD0 A;  1JTG A;  2WKE A;  4RYE A;  2J7V A;  4X69 A;  5TFQ A;  1MWT A;  4KZ4 A;  1TDG A;  3I7J A;  4S2N A;  1K55 A;  3HBR A;  4JF6 A;  3N8L A;  4RX3 A;  4UAA A;  2E8I A;  5FQJ A;  4KG2 A;  5U47 A;  4RVA A;  1S0W A;  3V50 A;  5FI2 A;  2Y55 A;  1KE3 A;  1SHV A;  1XGI A;  3IWQ A;  4P85 A;  4PM7 A;  1E25 A;  3MFD A;  3HUO A;  3SH8 A;  3NCK A;  2ZQD A;  4IBR A;  3VP0 A;  5J8X A;  5AQA A;  4DE2 A;  1LLB A;  4JBF A;  4GKU A;  4JPM A;  2JE5 A;  1BLC A;  4S2I A;  4PM5 A;  4WBG A;  4P6B A;  2Z2L B;  3W4O A;  1PWD A;  4NK3 A;  3G32 A;  3BFF A;  5DTS A;  3IT9 A;  3UE0 A;  4Z9Q A;  2ZQ7 A;  3ZG0 A;  3LEZ A;  3PTE A;  3Q82 A;  3MZF A;  4LCL A;  5DVA A;  1LI0 A;  4KG6 A;  3M6H A;  4Y0T A;  4GDN A;  5CER A;  3PBS A;  3SS5 A;  2ZQ9 A;  3M6B A;  1LL5 A;  4EBN A;  4Y0U A;  3A3F A;  4MBH A;  1HTZ A;  4OH0 A;  4KZ6 A;  1VM1 A;  4WEL A;  1DJC A;  4OOM A;  4BD1 A;  4D2O A;  2PBY A;  4UA7 A;  1RGZ A;  1W79 A;  4EWF A;  4WEK A;  2C6W B;  4KQR A;  5HAR A;  3GTC A;  2RL3 A;  3VSK A;  3Q7V A;  2H5S A;  3DW0 A;  4KQQ A;  3MKF A;  5F82 A;  4KQO A;  2WK0 A;  5M1A A;  5CGS A;  5AQ9 A;  4E3O A;  4QU3 A;  3NBL A;  2JCH A;  4E3M A;  5A92 A;  3Q7Z A;  1LI9 A;  1K54 C;  1BTL A;  5DF7 A;  4B4X A;  4RX2 A;  5FAT A;  3OZH A;  1IEL A;  1TEM A;  1JWZ A;  3DTM A;  4GB7 A;  4K0X A;  3BFD A;  4S2M A;  2WKH A;  4Q8I A;  1TVF A;  5DF8 A;  2OV5 A;  5CGX A;  3HLG A;  2XH9 A;  4LV3 A;  2X71 A;  3SH9 A;  2ZM0 A;  4FD8 A;  5FQK A;  1LHY A;  3UE3 A;  1MXO A;  2HDQ A;  3ZGA B;  2WYX A;  3BFC A;  1XP4 A;  3HL9 A;  2I72 A;  3N8R A;  2HDS A;  1ES5 A;  1FR1 A;  4PM8 A;  3C4P A;  1FCN A;  3ZVT A;  4KZ9 A;  3SS4 A;  4OQI A;  4WEJ A;  4R4S A;  3ZG7 B;  3A3J A;  2EX6 A;  4S2N C;  5GHX A;  3TOI A;  3IXD A;  3OCL A;  1ONH A;  2Y2I A;  3IHB A;  3MBZ A;  2XFS A;  4HBT A;  4S2K A;  3UPN A;  2WGI A;  4OOY A;  1J9M A;  1JVJ A;  1CI9 A;  3PBN A;  4PM6 A;  1DY6 A;  5JYP A;  1WYC A;  1K6S A;  5FQI A;  3O87 A;  4HES A;  3UN7 A;  4JXG A;  5FAS A;  4X68 A;  5HFO A;  4KG5 A;  3IH8 A;  3TSG A;  3HLC A;  2Q9M A;  2ZC4 B;  1MWS A;  3CZD A;  4DXC A;  5CED A;  2J9P A;  2QMI A;  2EFU A;  3ITA A;  5EUA A;  3GV9 A;  4OVD A;  2PU4 A;  5GHZ A;  4PMA A;  5IHV A;  1HVB A;  4N92 A;  1ES4 A;  3ZCZ A;  4LEN A;  2XR0 A;  1ES2 A;  3GVB A;  1MPL A;  3IWO A;  5E43 A;  4IVK A;  1G6A A;  4E3K A;  5E2G A;  2J9O A;  3P09 A;  3Q81 A;  4LV1 A;  4U0T A;  5I94 A;  1GHI A;  1BUL A;  3PBQ A;  1FOF A;  3HVF A;  1PZO A;  1HZO A;  1O7E A;  1QMF A;  2WAF A;  4E3I A;  5EVL A;  4DKI A;  1SKF A;  2OSU A;  5EPH A;  1N4O A;  1K57 C;  2PU2 A;  3WRZ A;  1CI8 A;  1NXY A;  4JKT A;  3W4P A;  3ZDJ A;  2JBF A;  4WM9 A;  4ZAM A;  1K25 A;  4FH2 A;  3V5M A;  4E3N A;  1IYS A;  3WS1 A;  3GQZ A;  1O07 A;  1IEM A;  2OLU A;  3IXH A;  3O3V A;  5GHY A;  2X02 A;  4QJG A;  3VSL A;  1KVL A;  4XUZ A;  4IBX A;  5G18 A;  1I2W A;  2WZX A;  2C5W B;  2B5R A;  3G31 A;  4OKP A;  5FAO A;  4S2P A;  1ZC2 A;  3HUM A;  1DJB A;  3MKE A;  3IQA A;  3VOY A;  4H8R A;  1LL9 A;  1FQG A;  2Y2Q A;  4JXW A;  1ESI A;  1PZP A;  3UO9 A;  4BEN A;  2G2W A;  2Y2J A;  3O86 A;  3RJU A;  1GA0 A;  2ZM8 A;  3FV7 A;  3LY3 A;  4GDB A;  1GA9 A;  3ZG5 A;  5GLD A;  3VMA A;  5FDH A;  4JXS A;  2DNS A;  2A49 A;  3WS0 A;  3OPR A;  3BFG A;  4WYY A;  4E6W A;  2P9V B;  4IED A;  3EQU A;  2J8Y A;  2R9W A;  3EQV A;  2DRW A;  1YLW A;  3SS3 A;  4NET A;  3FZC A;  5EVI A;  4ZJ1 A;  5CGW A;  1W7F A;  3FYZ A;  3LO7 A;  3GMW A;  3Q07 A;  1MWR A;  3RXW A;  5M18 A;  2Q9N A;  1ONG A;  1PWG A;  2FFF B;  4JF5 A;  3GRJ A;  2HP5 A;  1YLJ A;  5GLB A;  1KE4 A;  4X55 A;  1CEG A;  1RCJ A;  4O7D A;  4QB8 A;  2WGW A;  3IF6 A;  4GZB A;  3S22 A;  1H8Z A;  1L0F A;  3GR2 A;  3ITB A;  5CTM A;  3UY6 A;  4EV4 A;  5CXW A;  4OPZ A;  5DTT A;  3ZNT A;  4QY5 A;  1HD8 A;  1XA1 A;  1YLZ A;  3MXS A;  1PIO A;  4KEN B;  3VP3 A;  4EBP A;  5KSH A;  4OOL A;  2Z2M B;  1XA7 A;  4XXR A;  3SOI A;  2JC7 A;  1E4D A;  4JF4 A;  4U0X A;  4C75 A;  5FI7 A;  4DE1 A;  1MY8 A;  4ZJ2 A;  2IWD A;  5EVI D;  4OON A;  4S2L A;  2EFX A;  2EXA A;  3B3X A;  1JWV A;  3MXR A;  4MNR A;  1NRF A;  2XD1 A;  5FQM A;  3N4I A;  1NY0 A;  1ERM A;  2Y2L A;  4R3B A;  2XLN A;  3UPP A;  2ZC5 B;  3WWX A;  4YFM A;  4EBL A;  5A91 A;  1YLY A;  2G2U A;  4KZA A;  4B88 A;  2Y2G A;  4E6X A;  3UPO A;  1FCM A;  1XKZ A;  3NC8 A;  2XK1 A;  1YMX A;  1M40 A;  1WE4 A;  2H0Y A;  1L0D A;  4OPQ A;  3W4Q A;  3VFF A;  3AGD A;  3OPH A;  2CC1 A;  2X01 A;  1PI5 A;  4CJN A;  2WKI A;  1BUE A;  1XX2 A;  4N9K A;  1K55 C;  1YM1 A;  4R4R A;  3FWL A;  3C5A A;  3NDG A;  4R0Q A;  2HP6 A;  4Y0O A;  1YLT A;  1S6R A;  2P74 A;  1ESU A;  3HRE A;  2Y2H A;  3BM6 A;  5E2E A;  2HDR A;  1N9B A;  4Y7P A;  4QY6 A;  1KDS A;  1BZA A;  1Q2P A;  4X6T A;  4E3J A;  4ID4 A;  4GN2 A;  3SH7 A;  3ZG8 B;  3N6I A;  3PAG A;  4XUX A;  4S2O A;  4N1X A;  2P9V A;  4MBK A;  3C7V A;  4HBU A;  1YLP A;  4GOG A;  4QHC A;  5DF9 A;  5HAP A;  1ES3 A;  5CRF A;  4BL3 A;  3N8S A;  4BQM A;  1PW8 A;  2ZLY A;  1ZG4 A;  2HDU A;  1BSG A;  5EVI C;  1G68 A;  3IXG A;  4OLG A;  4QD4 A;  4ZJ3 A;  3BRM A;  3IWI A;  5EEC A;  1KGG A;  2Y91 A;  1RGY A;  2ZQA A;  5JYO A;  2XGN A;  3N7W A;  1FSW A;  3PBO A;  1GHM A;  2V2F F;  5EOO A;  3E2K A;  3S1Y A;  3LCE A;  1MWU A;  3UDF A;  2EXB A;  4R1G A;  4BJP A;  4FH4 A;  4LV2 A;  3S4X A;  3V3S A;  1L0E A;  3UDX A;  2GDN A;  3WS5 A;  5TR7 A;  2WAE A;  2HP9 A;  3IF6 C;  3UNW A;  1I2S A;  4PPR A;  1H5X A;  3ZFZ A;  1K54 A;  3DWK A;  3IHA A;  1L2S A;  3HLE A;  5E2H A;  1XGJ A;  5FSR A;  1BLP A;  1W8Y A;  1KDW A;  4BL2 A;  4EUZ A;  2ZC7 A;  3P98 A;  3A3E A;  4WZ5 A;  1QME A;  1ZKJ A;  4IVI A;  3TG9 A;  3NY4 A;  3ZNY A;  4RA7 A;  3RXX A;  1YT4 A;  1JWP A;  1XXM A;  4R3J A;  5BOH A;  5KMW A;  4ZDX A;  1SCW A;  1CK3 A;  1JTD A;  1Q2Q A;  2A3U A;  1H8Y A;  4GD6 A;  4P0M A;  2XEP A;  4UA9 A;  3OPP A;  4OP8 A;  4OPY A;  4U3T A;  5FQQ A;  1NJ4 A;  5M19 A;  5F83 A;  2ZQC A;  1K6R A;  5HW3 A;  5GLA A;  3G4P A;  2Y2P A;  3M2K A;  1FR6 A;  2XFT A;  5GL9 A;  1C3B A;  2ZD8 A;  3MZD A;  3VP1 A;  2QPN A;  1SDE A;  4WMC D;  4DE3 A;  3G30 A;  5HL1 A;  4P87 A;  4KZ5 A;  3CG5 A;  4KZ7 A;  5FAQ A;  1ZG6 A;  1K56 A;  4K0W A;  3BEC A;  1FSY A;  3D4F A;  5FI6 A;  2Y2O A;  4PM9 A;  1IYP A;  1L0G A;  1EWZ A;  1I5Q A;  3HLF A;  2XF3 A;  4KZ3 A;  4ZTK A;  1KGF A;  3FKV A;  1BT5 A;  5CHU A;  3HUN A;  1KVM A;  1GHP A;  4BLM A;  5GLC A;  2Y59 A;  2ZMA A;  2QZ6 A;  2VGJ A;  3G34 A;  3G2Y A;  5AQ7 A;  2XQZ A;  4DXB A;  2H0T A;  4R23 A;  3QNC A;  2Y4A A;  3IXB A;  5HAI A;  1DJA A;  1MBL A;  3BEB A;  3NDE A;  4S2J A;  3WRT A;  1K4E A;  4GD8 A;  3OC2 A;  5FA7 A;  3BLM A;  3G35 A;  2XDM A;  1K56 D;  4CPK A;  4DE0 A;  4C3Q A;  2Y2M A;  1ERQ A;  2R9X A;  5CHJ A;  3V39 A;  3HLB A;  4GNU A;  1K57 A;  1E3U A;  4KZ8 A;  3FKW A;  3W8K A;  3HLD A;  5A90 A;  3E2L A;  4FSF A;  3QNB A;  2OLV A;  4M3K A;  3V3R A;  4DDY A;  4UHU A;  2ZJ9 A;  1GCE A;  2ZM2 A;  1ERO A;  1Z6F A;  3BLS A;  1IKI A;  2ZC3 B;  4FCF A;  4OQ0 A;  4DDS A;  5F1F A;  3PBR A;  1IYO A;  4JLF A;  1K38 A;  3PBT A;  3VP2 A;  3M2J A;  2UWX A;  1FCO A;  2Y2N A;  2Y2K A;  2V1Z A;  4WZ5 C;  1OME A;  4LV0 A;  4OQH A;  1SDN A;  3MZE A;  1VQQ A;  2H10 A;  4K91 A;  1PWC A;  3BFE A;  4HEF A;  5F1G A;  1U60 A;  3CJM A;  3IF5 A;  1IYQ A;  3HLW A;  1NZO A;  5HX9 A;  5KSC A;  4E3L A;  2IWC A;  5CHM A;  3VP4 A;  1NZU A;  1E3U D;  5D3O A;  5TGF A;  1BLS A;  5FAP A;  3CMZ A;  4WZ4 A;  3A3I A;  3Q1F A;  3ZHH A;  3ZG9 B;  1CEF A;  2FFY A;  2VGK A;  2ZQ8 A;  4MBF A;  2IWB A;  3C7U A;  3VFH A;  5EVI B;  1BLH A;  3VOZ A;  5E2F A;  4OPR A;  3BYD A;  5L2F A;  3G2Z A;  4OQG A; 
#chains in the Genus database with same CATH topology
 4X53 A;  3T4L A;  3F1P A;  3WS4 A;  4N1H A;  2QYB A;  4HQA A;  4A5R A;  4MLL A;  1EI5 A;  3IX4 A;  3NDG A;  4DE0 A;  1MKI A;  3LY4 A;  2BG1 A;  4Q0H A;  5AQB A;  2WAD A;  1WYB A;  1W5D A;  3AGE A;  4JXV A;  4Q0I A;  4PAU A;  1TS8 A;  2RCX A;  4LCM A;  2G7U A;  3T4O A;  3C4O A;  1YQS A;  3ISG A;  4HP9 A;  2BLS A;  1ZTU A;  2B18 A;  5CEB A;  4L0L A;  2L1M A;  5LBR A;  3O88 A;  3F1N B;  2EX8 A;  3NI9 A;  4EQ1 A;  5CTN A;  5KZH A;  5TFQ A;  3N8L A;  4RX3 A;  2ZL1 B;  2LB5 A;  5U47 A;  1S0W A;  3V50 A;  5FI2 A;  1YPR A;  1XGI A;  3EWK A;  3MFD A;  3VP0 A;  2ZQD A;  4DE2 A;  1BLC A;  2OWH A;  4P6B A;  3W4O A;  5DTS A;  3UE0 A;  2A24 B;  4Z9Q A;  3UE6 A;  3PTE A;  1VEU A;  4LCL A;  3B42 A;  3QP2 A;  1LI0 A;  3M6H A;  4GDN A;  3T4T A;  4EBN A;  2VA0 A;  1XFN A;  4MBH A;  4G3K A;  2M7U A;  1DJC A;  4D2O A;  2PBY A;  4UA7 A;  4P6Z S;  4WEK A;  5EFW A;  4KQR A;  5HAR A;  3GTC A;  3E98 A;  3VSK A;  4KQO A;  2ZOI A;  4E3O A;  3IBR A;  1LI9 A;  4Y15 A;  5DF7 A;  4B4X A;  4EW7 A;  1IEL A;  3DTM A;  4Q8I A;  2X71 A;  3BFC A;  3HL9 A;  3F1N A;  4E04 A;  4I3I A;  3T4S A;  5L09 A;  3SS4 A;  2E8J A;  1LT0 A;  3NHQ A;  3UME A;  4S2K A;  3DTE A;  2WGI A;  3UPN A;  1J9M A;  3PBN A;  4PM6 A;  4UEY A;  1K6S A;  4AFI A;  1BYW A;  3H82 A;  4X68 A;  4JGO A;  3IH8 A;  2M1C A;  1MWS A;  2OAP 1;  4DXC A;  3LYX A;  1L3L A;  5EUA A;  3GV9 A;  5GHZ A;  1LSX A;  2XR0 A;  3S7Q A;  3P09 A;  4LV1 A;  1YAX A;  4U0T A;  3PBQ A;  3A0R A;  3B47 A;  1PZO A;  1QMF A;  2EWV A;  3MJQ A;  5L8M A;  3DTK A;  3K3C A;  5EPH A;  3WRZ A;  1CI8 A;  3W4P A;  1IYS A;  3WS1 A;  3GQZ A;  4MCW A;  1IEM A;  2VK3 A;  3VSL A;  1KVL A;  4XUZ A;  3MSH A;  4IBX A;  5G18 A;  1I2W A;  2WZX A;  2PD7 A;  5EVE A;  3HUM A;  3JPU A;  4H8R A;  2ZOH A;  2HJE A;  4JXW A;  2G2W A;  2Y2J A;  1GA0 A;  1GA9 A;  3ZG5 A;  1MKM A;  5FDH A;  1T1C A;  3OPR A;  4E6W A;  2R9W A;  2O9B A;  2DRW A;  3SS3 A;  2Y79 A;  4EU0 A;  2MJ6 A;  5M18 A;  3RXW A;  1OPX A;  3GRJ A;  4Y2F A;  1MZU A;  1KE4 A;  1CEG A;  4QB8 A;  4O7D A;  2WGW A;  3IF6 A;  4GZB A;  1H8Z A;  3UY6 A;  4OPZ A;  4MN7 A;  3ZNT A;  1TD5 A;  5KSH A;  4EBP A;  4XXR A;  1E4D A;  4C75 A;  2IWD A;  5EVI D;  2EFX A;  3B3X A;  5FQM A;  2XD1 A;  1ERM A;  1N9O A;  2XLN A;  3UPP A;  5A91 A;  4B88 A;  2G2U A;  3NC8 A;  2XK1 A;  1YMX A;  1WE4 A;  3ICY A;  3BY9 A;  4HOI A;  1BUE A;  3IS2 A;  1K55 C;  5HL6 A;  3C5A A;  2VLG A;  4HP4 A;  2HP6 A;  3LIB A;  4Y0O A;  4BBV A;  2Y2H A;  5E2E A;  4Y7P A;  4QY6 A;  1KDS A;  3LIE A;  4X6T A;  4GN2 A;  3PAG A;  3LID A;  3C7V A;  5HPI A;  2W0N A;  4QHC A;  1ES3 A;  5CRF A;  4CLC B;  3QP4 A;  1XJ4 A;  2QHK A;  2HDU A;  1P9R A;  3IXG A;  2J80 A;  2Y91 A;  1RGY A;  2ZQA A;  2XGN A;  3N7W A;  5EOO A;  4H6J B;  5MC7 A;  3ZYT A;  2GDN A;  3MR0 A;  2WAE A;  2HP9 A;  3UNW A;  3ZFZ A;  1K54 A;  3DWK A;  5IU1 A;  3DAV A;  1BLP A;  1W8Y A;  4BL2 A;  3A3E A;  1DRM A;  1OTD A;  3NY4 A;  3QP8 A;  4RA7 A;  1GSV A;  1XXM A;  5BOH A;  5KMW A;  2P7J A;  2XEP A;  3OPP A;  4OP8 A;  2B95 A;  2W3H A;  2ZQC A;  5HW3 A;  2Y2P A;  3M2K A;  2XFT A;  3MZD A;  3PHY A;  1SDE A;  2PAV P;  4WMC D;  5TJJ A;  4KZ5 A;  4KZ7 A;  2O0Y A;  1ZG6 A;  2JKF A;  5HDD A;  3KSI A;  2V9A A;  1XFQ A;  3FG8 A;  3FKV A;  3HUN A;  1GHP A;  4BLM A;  1DP8 A;  4CLC A;  1OTI A;  4R23 A;  5HAI A;  1DJA A;  1K4E A;  4GD8 A;  3LIF A;  1T1B A;  2INW A;  2Y2M A;  2R9X A;  4H6J A;  1K57 A;  3HLD A;  1YKD A;  3QNB A;  2OLV A;  3V3R A;  2ZJ9 A;  2ZM2 A;  1Z6F A;  2ZC3 B;  4QWO A;  5F1F A;  3PBR A;  4RQ9 A;  1Y4O A;  2UWX A;  1FCO A;  3NOP C;  2V1Z A;  4IHQ A;  3QP5 A;  3MZE A;  4HEF A;  5F1G A;  3IF5 A;  3CJM A;  4QPR A;  1S1Z A;  5HX9 A;  2IWC A;  1G5U A;  2V8F A;  5CHM A;  1E3U D;  4R3A A;  2PBD P;  5FAP A;  4WZ4 A;  3Q1F A;  1D06 A;  3C7U A;  2PHY A;  3CWF A;  4OPR A;  4EES A;  1JNU A;  3F1O A;  5F5Y A;  4I39 A;  2VGL M;  3PYP A;  4OLD A;  1IKG A;  2XD5 A;  1AXB A;  3Q7V B;  2OWJ A;  3DWZ A;  1KGE A;  3UE1 A;  3AGF A;  2WZZ A;  1VB6 A;  1F2K A;  5EOE A;  2W3G A;  5HAQ A;  3T1S A;  1NYY A;  4UA6 A;  3SZT A;  3ZVW A;  3C30 A;  1PNE A;  4DJ3 A;  1Y54 A;  4OP5 A;  3NIA A;  4BD0 A;  1JTG A;  4RYE A;  5AVE A;  4KZ4 A;  3I7J A;  5J7E A;  1UGU A;  1OTB A;  3K3D A;  4KG2 A;  3QP1 A;  3BWL A;  1KE3 A;  3IWQ A;  3HUO A;  4IBR A;  3T1Q B;  4JBF A;  4GKU A;  4S2I A;  4PM5 A;  4WBG A;  2DMW A;  5HSQ A;  3MQ0 A;  2ZQ7 A;  3LEZ A;  5I5L A;  5DVA A;  5HWT A;  3PBS A;  3SS5 A;  3M6B A;  2YKH A;  1HTZ A;  4WEL A;  3CAX A;  2L4R A;  2VV6 A;  2W3F A;  2FZ0 A;  4EWF A;  2J3W A;  4GHI B;  2RL3 A;  3Q7V A;  3DW0 A;  5F82 A;  2JCH A;  5A92 A;  1BTL A;  5FAT A;  1TEM A;  2K31 A;  1JWZ A;  4K0X A;  2WKH A;  2V1A A;  4LV3 A;  3GEC A;  3K2N A;  3SH9 A;  4FD8 A;  1LHY A;  2HDQ A;  3ZGA B;  1XP4 A;  3KYQ A;  2HDS A;  1FCN A;  5F68 A;  4XT2 A;  3NOU C;  3T50 A;  5GHX A;  3TOI A;  3MBZ A;  3CI6 A;  4OOY A;  1JVJ A;  1WYC A;  5FQI A;  4HES A;  3UN7 A;  4GLQ A;  3MQO A;  3TSG A;  2Q9M A;  4R38 A;  2ZC4 B;  1OJG A;  2EFU A;  3ITA A;  4OVD A;  2OOL A;  3IWO A;  5E2G A;  2J9O A;  2WKP A;  3R7W A;  5DKK A;  5I94 A;  1BUL A;  1FOF A;  1ACF A;  3GDI A;  1O7E A;  2WAF A;  4E3I A;  5EVL A;  2OSU A;  1N4O A;  5EV0 A;  2PU2 A;  2EWW A;  4M4X A;  3ZDJ A;  1N9N A;  1TS0 A;  4FH2 A;  3LR0 A;  3OOV A;  2C5W B;  2B5R A;  4JGP A;  4ETZ A;  1MC0 A;  5FEG A;  1ZC2 A;  4NXF A;  2Q0O A;  4Z1W A;  1FQG A;  3UO9 A;  3HJI A;  4LRZ E;  2ZM8 A;  3FV7 A;  3OBF A;  3WS0 A;  2A49 A;  4WYY A;  1YLW A;  4NET A;  5EVI A;  1W7F A;  3FYZ A;  1T1A A;  1ONG A;  3VE4 A;  1D7E A;  4JF5 A;  2XA7 S;  1YLJ A;  2GZA A;  4Y3I A;  4HI4 A;  3S22 A;  3ITB A;  3UB9 A;  3G6O A;  5CXW A;  3L9K A;  5DTT A;  4QY5 A;  3MXS A;  4KEN B;  4OOL A;  4JF4 A;  4DE1 A;  4U0X A;  4HH2 A;  4S2L A;  2PRF A;  1H3Q A;  1JWV A;  3MXR A;  4MNR A;  1NY0 A;  3WWX A;  1XJ3 A;  4EBL A;  2Y2G A;  4E6X A;  2O99 A;  4YOF A;  2H0Y A;  2M7V A;  4HIA A;  5HZH A;  3MXQ A;  1PI5 A;  3HJK A;  2ZL1 A;  3DTI A;  3FWL A;  4R4R A;  4NXE A;  4R70 A;  1S6R A;  5EM0 A;  3HRE A;  2GX5 A;  3BM6 A;  3PXP A;  1Q2P A;  4E3J A;  3QP6 A;  4G3V A;  5HD5 A;  2K2N A;  1NWZ A;  4LPZ A;  5DF9 A;  3BJN A;  2A24 A;  4BL3 A;  3N8S A;  4NKP A;  1PW8 A;  5EM1 A;  1ZG4 A;  4OLG A;  3BRM A;  4CLC E;  2W27 A;  3VE3 A;  5JYO A;  1NLY A;  5HWV A;  3PBO A;  2HJ9 C;  1GHM A;  2V2F F;  3LCE A;  5FEF A;  2EXB A;  4BJP A;  1F9I A;  3WS5 A;  3IF6 C;  1H5X A;  1L2S A;  3HLE A;  3FPW A;  1KDW A;  2ZC7 A;  3P98 A;  3JVU A;  4WZ5 A;  3ZNY A;  3RXX A;  1YT4 A;  1FIK A;  4ZDX A;  2ACG A;  4P0M A;  1JTD A;  2A3U A;  4GD6 A;  1H8Y A;  2XRO A;  3R4K A;  5F83 A;  1TS6 A;  3G4P A;  1FR6 A;  4ETX A;  4DE3 A;  3UB5 P;  1S67 L;  3CG5 A;  5FAQ A;  4K0W A;  2IA2 A;  3D4F A;  1Z09 A;  1EWZ A;  3HLF A;  1BT5 A;  4NXG A;  1KVM A;  2VGJ A;  3G2Y A;  2XQZ A;  2XA7 M;  2BTF P;  3OC2 A;  5FA7 A;  3BLM A;  4GNU A;  4BMW A;  1E3U A;  1TS7 A;  3FKW A;  2Y8H A;  3ZQ5 A;  3E2L A;  4UHU A;  1ERO A;  1IKI A;  3C38 A;  3U2A A;  4DDS A;  1PRQ A;  1IYO A;  3O5Y A;  3PBT A;  1T18 A;  2Y2N A;  4ARZ B;  2Y2K A;  4HY8 A;  1SKO B;  3KSG A;  4OQH A;  1SDN A;  1IYQ A;  5KSC A;  4E3L A;  3VP4 A;  1H8M A;  3MF0 A;  3A3I A;  5DJT A;  5J3W A;  3ZG9 B;  3T12 B;  3E0Y A;  1CEF A;  4WUJ A;  2VGL S;  3IX3 A;  5F6A A;  4OH0 A;  4OQG A;  1G28 A;  1STZ A;  3IH9 A;  4N9L A;  3OCN A;  1W8Q A;  3T1R A;  4B4Z A;  5EE8 A;  3H9W A;  2QJ7 A;  2EX2 A;  2HPB A;  4EQI A;  2DCF A;  1KE0 A;  2W1T B;  1RP5 A;  3DBA A;  2LB9 A;  1PYY A;  2EX9 A;  1PI4 A;  3QHY A;  4MDZ A;  2JHE A;  3A3D A;  4HJ4 A;  1NYM A;  1ALQ A;  5CEC A;  3MMH A;  4X56 A;  4LRX C;  5FQ9 A;  2WUQ A;  1P9W A;  3MFX A;  1PW1 A;  5AJG A;  1TDL A;  5KIZ A;  3PAE A;  4F94 A;  2WKE A;  3TRC A;  4X69 A;  1MWT A;  4S2N A;  1K55 A;  4JF6 A;  4GCZ A;  2E8I A;  4P85 A;  4PM7 A;  5J8X A;  3EEH A;  3ULF A;  1LLB A;  4EET B;  5HPF A;  2Z2L B;  3MQQ A;  3ZG0 A;  3BY8 A;  4KG6 A;  1LL5 A;  3A3F A;  1VM1 A;  4OOM A;  3RTY A;  1RGZ A;  1W79 A;  2C6W B;  3FPV A;  4D60 A;  4KQQ A;  3MKF A;  4NG2 A;  2V0U A;  3CIT A;  5M1A A;  5CGS A;  4K08 A;  1V9Z A;  3U4L P;  4RX2 A;  3PR6 A;  3OZH A;  4S2M A;  4GB7 A;  1TVF A;  5DF8 A;  2OV5 A;  5CGX A;  2UV0 E;  3HLG A;  2XH9 A;  2QJ5 A;  4L9G A;  3UE3 A;  2GNX A;  1MXO A;  2I72 A;  3N8R A;  3ZVT A;  4KZ9 A;  3CHW P;  2PR6 A;  4GJ4 A;  4I38 A;  3ZG7 B;  3UB8 A;  3OCL A;  1ONH A;  2Y2I A;  4UQI S;  3IHB A;  1KOU A;  2XFS A;  4HBT A;  5JYP A;  4KQD A;  1EW0 A;  3O87 A;  2O9C A;  5FAS A;  5HFO A;  4KG5 A;  4EEP A;  5J4E A;  3CZD A;  2J9P A;  2QMI A;  4PKY A;  4N92 A;  1ES4 A;  3ZCZ A;  3KSH A;  1ES2 A;  1MPL A;  5E43 A;  4IVK A;  4YNR A;  4E3K A;  1DP6 A;  2GJ3 A;  3BW6 A;  1PFL A;  1W63 M;  2XRN A;  4HHD A;  2V8C A;  3LFV A;  4WLA A;  4DKI A;  1SKF A;  1ZHH B;  3D3O A;  3LI9 A;  3TE8 A;  5HWW A;  2JBF A;  4WM9 A;  4ZAM A;  3KYE A;  4E3N A;  1O07 A;  3O3V A;  2X02 A;  1UWP X;  4QJG A;  5FAO A;  4S2P A;  3MKE A;  3LEQ A;  3VOY A;  1LL9 A;  5FL3 A;  2Y2Q A;  1ESI A;  3UMD A;  4GDB A;  2O9A A;  3VMA A;  4GW9 A;  1IOU A;  1N9L A;  4L9F A;  4IED A;  3CUE A;  3EQU A;  3EQV A;  4DN0 A;  5AVF A;  4ZJ1 A;  2AVX A;  5CGW A;  1SZV A;  4G3W A;  3LO7 A;  3Q07 A;  5CX7 A;  3KX0 X;  2Q9N A;  1X0O A;  5GLB A;  2W3E A;  4X55 A;  1RCJ A;  3GR2 A;  4IJG A;  1ODV A;  1XA1 A;  1YLZ A;  3VP3 A;  2JC7 A;  4F3L B;  4ESP A;  3EEA A;  3N4I A;  2Y2L A;  4R3B A;  2ZC5 B;  4YFM A;  1VHM A;  3UPO A;  2VX8 A;  4KZA A;  1FCM A;  1S4S A;  1M40 A;  4O0P A;  3W4Q A;  1OTA A;  3AGD A;  2CC1 A;  4CJN A;  1XX2 A;  1YM1 A;  1YLT A;  2P74 A;  1ESU A;  3D9Y A;  3A0V A;  2P08 A;  2VZW A;  4HNB A;  4UQI M;  2PYR A;  3ZG8 B;  4XUX A;  2VJW A;  4HBU A;  4GOG A;  1F98 A;  5HAP A;  4BQM A;  5HDC A;  3IBJ A;  1BSG A;  5EVI C;  1G68 A;  1FSW A;  3S1Y A;  3E2K A;  1HLU P;  3UDF A;  4GHI A;  4R1G A;  4FH4 A;  4LV2 A;  1L0E A;  3UDX A;  1I2S A;  4PPR A;  5E2H A;  4F3L A;  4WN5 A;  4EUZ A;  2PT7 A;  1QME A;  1T19 A;  3TG9 A;  1OT9 A;  4R3J A;  2WKQ A;  4UA9 A;  1SCW A;  1CK3 A;  1Q2Q A;  3C8C A;  4OPY A;  5FQQ A;  3P01 A;  1NJ4 A;  2V1B A;  5M19 A;  4PHT A;  5GLA A;  1C3B A;  2ZD8 A;  3NEC A;  3VP1 A;  1GSW A;  2QPN A;  4MN6 A;  1P97 A;  3B33 A;  3G30 A;  5HL1 A;  4LRY C;  4X1M A;  1FSY A;  3EGD C;  5FI6 A;  3UB7 A;  3E4Q A;  3LR3 A;  1I5Q A;  3RFB A;  2XF3 A;  4KZ3 A;  3H82 B;  4HJ3 A;  1KGF A;  5CHU A;  2FH5 A;  1AWI A;  2Y59 A;  1F5M A;  2QZ6 A;  2H0T A;  3IXB A;  1MBL A;  3BEB A;  3NDE A;  4S2J A;  3WRT A;  4BBU A;  1LSV A;  3G35 A;  2XDM A;  1K56 D;  4CPK A;  1XJ2 A;  3T1X A;  4B93 A;  2PDR A;  2VV8 A;  4C3Q A;  1ERQ A;  5CHJ A;  3V39 A;  3HLB A;  4Q0J A;  5HDS A;  4KZ8 A;  3W8K A;  3NOT C;  1S4R A;  4M3K A;  1LSW A;  4FCF A;  4OQ0 A;  4B9O A;  2VEA A;  1K38 A;  3M2J A;  2HZ5 A;  3TJZ C;  4WZ5 C;  4K91 A;  4WL9 A;  1U60 A;  4PKY G;  3HLW A;  2ZMF A;  3S7O A;  5D3O A;  5TGF A;  1UWN X;  1BLS A;  3MS6 A;  3CMZ A;  4HH3 A;  3E4O A;  2KDK A;  2PYP A;  2ZQ8 A;  2IWB A;  1OT6 A;  3P7N A;  1BLH A;  3VOZ A;  5E2F A;  4R6L A;  1VET B;  3BYD A;  5L2F A;  2HF6 A;  5FDS A;  3NUL A;  4YIN A;  3GSG A;  5DTK A;  1K4F A;  1YMS A;  2WGW B;  3IF6 B;  5IHV A;  1XPB A;  4WMC A;  2WGV A;  4KZB A;  1P0Z A;  1M6K A;  2V20 A;  3OPL A;  4DRT A;  4EEU A;  4DF6 A;  2ZC6 B;  3WS2 A;  3UB6 A;  1WA9 A;  4MEZ A;  3VOL A;  2HV1 A;  4NXB A;  4Y5F A;  3UDI A;  2JKG A;  2OAQ 1;  3HCY A;  4ZBE A;  3L7H A;  5A93 A;  4C6Y A;  3JYI A;  1K0K A;  2J7V A;  4I3A A;  1TDG A;  3HBR A;  1NLZ A;  2D02 A;  2KX6 A;  1DP9 A;  3IS2 B;  4UAA A;  3BQ8 A;  5FQJ A;  4RVA A;  2ZBB A;  1S1Y A;  2YKF A;  2Y55 A;  1SHV A;  1E25 A;  3KYZ A;  3SH8 A;  3NCK A;  3CPT B;  5AQA A;  2XSS A;  4JPM A;  2JE5 A;  4X25 A;  1PWD A;  4NK3 A;  3G32 A;  3BFF A;  3IT9 A;  3Q82 A;  3MZF A;  4Y0T A;  1VET A;  5CER A;  2ZQ9 A;  4Y0U A;  4LFU A;  4KZ6 A;  4GS9 B;  4BD1 A;  4FTX A;  4LGW A;  5IS1 A;  1FIL A;  1CJF A;  1A0K A;  2H5S A;  4O8G A;  2WK0 A;  4P6Z M;  2JKR M;  5AQ9 A;  4QU3 A;  3NBL A;  4E3M A;  3Q7Z A;  1K54 C;  2Z6C A;  2J3T C;  3BFD A;  2PD8 A;  2ZM0 A;  3BQA A;  5FQK A;  3LUQ A;  2WYX A;  5DJU A;  4FUW A;  4KUK A;  1ES5 A;  1FR1 A;  3JVV A;  4IUH A;  3C4P A;  4L9E A;  4PM8 A;  2WKR A;  4DMZ A;  4OQI A;  4WEJ A;  4R4S A;  3A3J A;  2EX6 A;  4S2N C;  1YSP A;  3IXD A;  1TF1 A;  1CI9 A;  4EXO A;  4II7 A;  1DY6 A;  4DJ2 A;  1G6O A;  4JXG A;  1OJ5 A;  3HLC A;  3CPT A;  2EA9 A;  1CQA A;  4WF0 A;  5CED A;  1V9Y A;  4JGQ A;  3LIA A;  2PU4 A;  4PMA A;  4I3J A;  4BBT A;  1HVB A;  4LEN A;  5HD3 A;  3GVB A;  4CLC C;  1G6A A;  4YWZ A;  3Q81 A;  1GHI A;  4GS9 A;  3HVF A;  1HZO A;  1K57 C;  1NXY A;  4JKT A;  4MN5 A;  3KSF A;  1K25 A;  3V5M A;  2R78 A;  5C5K A;  2OLU A;  3IXH A;  4KUO A;  5GHY A;  3S7P A;  3TW8 A;  4Y13 A;  2JKR I;  4ARZ A;  1D1J A;  1SKO A;  3G31 A;  4OKP A;  2BAS A;  2CMN A;  2KOI A;  1DJB A;  4IUK A;  2HGV A;  3IQA A;  5F69 A;  1PZP A;  4BEN A;  4O01 A;  3O86 A;  3RJU A;  4JGR A;  3LY3 A;  5GLD A;  1LL8 A;  2VKS A;  4JXS A;  2DNS A;  2H28 A;  3CLO A;  3S7N A;  2QWS A;  3BFG A;  2P9V B;  3LIC A;  1H0M A;  2J8Y A;  3VV4 A;  3FZC A;  4CQH A;  3GMW A;  4HJ6 A;  5L07 A;  1MWR A;  1PWG A;  2FFF B;  3F1O B;  3T4Q A;  2HP5 A;  4BWI A;  2L0W A;  4ME4 A;  2W1T A;  5CTM A;  1L0F A;  4EV4 A;  1HD8 A;  1PIO A;  2B02 A;  2Z2M B;  1XA7 A;  3SOI A;  4EUV A;  3H7W B;  1GSX A;  5FI7 A;  3LI8 A;  1MY8 A;  4ZJ2 A;  3SW1 A;  1CF0 A;  4OON A;  2EXA A;  5G4Y A;  4I5S A;  1NRF A;  3LR5 A;  4Y17 A;  2JKT M;  2P04 A;  4EER A;  5A8B A;  1YLY A;  1XKZ A;  3FC7 A;  1L0D A;  2ZMV A;  4OPQ A;  3VFF A;  1XJ6 A;  3IX8 A;  3OPH A;  2X01 A;  2WKI A;  4N9K A;  1OTE A;  4R0Q A;  3LGO A;  3KO6 A;  3D72 A;  2HDR A;  1N9B A;  2W3D A;  3E4P A;  1BZA A;  4ID4 A;  3SH7 A;  3N6I A;  4S2O A;  4N1X A;  2P9V A;  4MBK A;  1YLP A;  3CUE C;  2ZLY A;  5L10 A;  4QD4 A;  4ZJ3 A;  3IWI A;  5EEC A;  1KGG A;  1Y28 A;  2D01 A;  3NJA A;  3EOI A;  5K5B A;  1MWU A;  5TBM B;  3S4X A;  5DFY A;  3V3S A;  5TR7 A;  3OLO A;  3IHA A;  1XGJ A;  3H7W A;  5FSR A;  3T4K A;  1ZKJ A;  4IVI A;  1JWP A;  3V67 A;  1S66 L;  4U3T A;  1K6R A;  2JKT I;  5IT5 A;  5GL9 A;  1W63 Q;  2Z6D A;  4XT2 B;  4LLO B;  4P87 A;  1K56 A;  3BEC A;  3EGX C;  2Y2O A;  4PM9 A;  2NUP C;  1IYP A;  2J3T D;  1L0G A;  3RH8 B;  4ZTK A;  4MMN A;  2VV7 A;  3F1P B;  3LR4 A;  5GLC A;  2ZMA A;  3G34 A;  5AQ7 A;  4DXB A;  3QNC A;  2PR5 A;  2K7S A;  2Y4A A;  3C2W A;  3R7W B;  5G4Z A;  4FOF A;  2NUT C;  2I9V A;  3A0S A;  2A2L A;  3T4J A;  5TBM A;  5A90 A;  2JN7 A;  4FSF A;  4X1L A;  4DDY A;  3W2Z A;  1GCE A;  3BLS A;  1IFQ A;  4JLF A;  4ZRR A;  3VP2 A;  2V0W A;  2QKP A;  4CLC D;  1OME A;  4LV0 A;  5DKL A;  1VQQ A;  2H10 A;  1PWC A;  3BFE A;  1NZO A;  2W1R A;  1YSQ A;  1NZU A;  1NRJ A;  2KLI A;  3ZHH A;  2FFY A;  2VGK A;  5DFX A;  4MBF A;  3VFH A;  1VEU B;  5EVI B;  1J3W A;  4NEE D;  3G2Z A; 
#chains in the Genus database with same CATH homology
 4X53 A;  3IH9 A;  4N9L A;  3OCN A;  1W8Q A;  3WS4 A;  4YIN A;  4N1H A;  3GSG A;  4OLD A;  4B4Z A;  5EE8 A;  2EX2 A;  4A5R A;  1IKG A;  5DTK A;  2HPB A;  4MLL A;  2XD5 A;  1EI5 A;  4EQI A;  2DCF A;  1KE0 A;  1K4F A;  1YMS A;  1MKI A;  1AXB A;  2WGW B;  3IF6 B;  2BG1 A;  1XPB A;  3LY4 A;  3Q7V B;  4WMC A;  1RP5 A;  3DWZ A;  1KGE A;  5AQB A;  3UE1 A;  2WGV A;  2WAD A;  1WYB A;  1PYY A;  4KZB A;  1W5D A;  2EX9 A;  3AGE A;  4JXV A;  3AGF A;  2WZZ A;  1PI4 A;  1M6K A;  2RCX A;  2V20 A;  3OPL A;  4LCM A;  5EOE A;  4DRT A;  3QHY A;  5HAQ A;  3C4O A;  1NYY A;  4DF6 A;  1YQS A;  2ZC6 B;  3WS2 A;  3A3D A;  4UA6 A;  3ZVW A;  4MEZ A;  3ISG A;  1NYM A;  2BLS A;  1ALQ A;  5CEC A;  4X56 A;  5CEB A;  3UDI A;  5FQ9 A;  4ZBE A;  2WUQ A;  4L0L A;  1PW1 A;  1TDL A;  1Y54 A;  3O88 A;  2EX8 A;  5A93 A;  4OP5 A;  4C6Y A;  3JYI A;  3NI9 A;  3PAE A;  5CTN A;  3NIA A;  5KZH A;  4F94 A;  4BD0 A;  1JTG A;  2WKE A;  4RYE A;  2J7V A;  4X69 A;  5TFQ A;  1MWT A;  4KZ4 A;  1TDG A;  3I7J A;  4S2N A;  1K55 A;  3HBR A;  4JF6 A;  3N8L A;  4RX3 A;  4UAA A;  2E8I A;  5FQJ A;  4KG2 A;  5U47 A;  4RVA A;  1S0W A;  3V50 A;  5FI2 A;  2Y55 A;  1KE3 A;  1SHV A;  1XGI A;  3IWQ A;  4P85 A;  4PM7 A;  1E25 A;  3MFD A;  3HUO A;  3SH8 A;  3NCK A;  2ZQD A;  4IBR A;  3VP0 A;  5J8X A;  5AQA A;  4DE2 A;  1LLB A;  4JBF A;  4GKU A;  4JPM A;  2JE5 A;  1BLC A;  4S2I A;  4PM5 A;  4WBG A;  4P6B A;  2Z2L B;  3W4O A;  1PWD A;  4NK3 A;  3G32 A;  3BFF A;  5DTS A;  3IT9 A;  3UE0 A;  4Z9Q A;  2ZQ7 A;  3ZG0 A;  3LEZ A;  3PTE A;  3Q82 A;  3MZF A;  4LCL A;  5DVA A;  1LI0 A;  4KG6 A;  3M6H A;  4Y0T A;  4GDN A;  5CER A;  3PBS A;  3SS5 A;  2ZQ9 A;  3M6B A;  1LL5 A;  4EBN A;  4Y0U A;  3A3F A;  4MBH A;  1HTZ A;  4OH0 A;  4KZ6 A;  1VM1 A;  4WEL A;  1DJC A;  4OOM A;  4BD1 A;  4D2O A;  2PBY A;  4UA7 A;  1RGZ A;  1W79 A;  4EWF A;  4WEK A;  2C6W B;  4KQR A;  5HAR A;  3GTC A;  2RL3 A;  3VSK A;  3Q7V A;  2H5S A;  3DW0 A;  4KQQ A;  3MKF A;  5F82 A;  4KQO A;  2WK0 A;  5M1A A;  5CGS A;  5AQ9 A;  4E3O A;  4QU3 A;  3NBL A;  2JCH A;  4E3M A;  5A92 A;  3Q7Z A;  1LI9 A;  1K54 C;  1BTL A;  5DF7 A;  4B4X A;  4RX2 A;  5FAT A;  3OZH A;  1IEL A;  1TEM A;  1JWZ A;  3DTM A;  4GB7 A;  4K0X A;  3BFD A;  4S2M A;  2WKH A;  4Q8I A;  1TVF A;  5DF8 A;  2OV5 A;  5CGX A;  3HLG A;  2XH9 A;  4LV3 A;  2X71 A;  3SH9 A;  2ZM0 A;  4FD8 A;  5FQK A;  1LHY A;  3UE3 A;  1MXO A;  2HDQ A;  3ZGA B;  2WYX A;  3BFC A;  1XP4 A;  3HL9 A;  2I72 A;  3N8R A;  2HDS A;  1ES5 A;  1FR1 A;  4PM8 A;  3C4P A;  1FCN A;  3ZVT A;  4KZ9 A;  3SS4 A;  4OQI A;  4WEJ A;  4R4S A;  3ZG7 B;  3A3J A;  2EX6 A;  4S2N C;  5GHX A;  3TOI A;  3IXD A;  3OCL A;  1ONH A;  2Y2I A;  3IHB A;  3MBZ A;  2XFS A;  4HBT A;  4S2K A;  3UPN A;  2WGI A;  4OOY A;  1J9M A;  1JVJ A;  1CI9 A;  3PBN A;  4PM6 A;  1DY6 A;  5JYP A;  1WYC A;  1K6S A;  5FQI A;  3O87 A;  4HES A;  3UN7 A;  4JXG A;  5FAS A;  4X68 A;  5HFO A;  4KG5 A;  3IH8 A;  3TSG A;  3HLC A;  2Q9M A;  2ZC4 B;  1MWS A;  3CZD A;  4DXC A;  5CED A;  2J9P A;  2QMI A;  2EFU A;  3ITA A;  5EUA A;  3GV9 A;  4OVD A;  2PU4 A;  5GHZ A;  4PMA A;  5IHV A;  1HVB A;  4N92 A;  1ES4 A;  3ZCZ A;  4LEN A;  2XR0 A;  1ES2 A;  3GVB A;  1MPL A;  3IWO A;  5E43 A;  4IVK A;  1G6A A;  4E3K A;  5E2G A;  2J9O A;  3P09 A;  3Q81 A;  4LV1 A;  4U0T A;  5I94 A;  1GHI A;  1BUL A;  3PBQ A;  1FOF A;  3HVF A;  1PZO A;  1HZO A;  1O7E A;  1QMF A;  2WAF A;  4E3I A;  5EVL A;  4DKI A;  1SKF A;  2OSU A;  5EPH A;  1N4O A;  1K57 C;  2PU2 A;  3WRZ A;  1CI8 A;  1NXY A;  4JKT A;  3W4P A;  3ZDJ A;  2JBF A;  4WM9 A;  4ZAM A;  1K25 A;  4FH2 A;  3V5M A;  4E3N A;  1IYS A;  3WS1 A;  3GQZ A;  1O07 A;  1IEM A;  2OLU A;  3IXH A;  3O3V A;  5GHY A;  2X02 A;  4QJG A;  3VSL A;  1KVL A;  4XUZ A;  4IBX A;  5G18 A;  1I2W A;  2WZX A;  2C5W B;  2B5R A;  3G31 A;  4OKP A;  5FAO A;  4S2P A;  1ZC2 A;  3HUM A;  1DJB A;  3MKE A;  3IQA A;  3VOY A;  4H8R A;  1LL9 A;  1FQG A;  2Y2Q A;  4JXW A;  1ESI A;  1PZP A;  3UO9 A;  4BEN A;  2G2W A;  2Y2J A;  3O86 A;  3RJU A;  1GA0 A;  2ZM8 A;  3FV7 A;  3LY3 A;  4GDB A;  1GA9 A;  3ZG5 A;  5GLD A;  3VMA A;  5FDH A;  4JXS A;  2DNS A;  2A49 A;  3WS0 A;  3OPR A;  3BFG A;  4WYY A;  4E6W A;  2P9V B;  4IED A;  3EQU A;  2J8Y A;  2R9W A;  3EQV A;  2DRW A;  1YLW A;  3SS3 A;  4NET A;  3FZC A;  5EVI A;  4ZJ1 A;  5CGW A;  1W7F A;  3FYZ A;  3LO7 A;  3GMW A;  3Q07 A;  1MWR A;  3RXW A;  5M18 A;  2Q9N A;  1ONG A;  1PWG A;  2FFF B;  4JF5 A;  3GRJ A;  2HP5 A;  1YLJ A;  5GLB A;  1KE4 A;  4X55 A;  1CEG A;  1RCJ A;  4O7D A;  4QB8 A;  2WGW A;  3IF6 A;  4GZB A;  3S22 A;  1H8Z A;  1L0F A;  3GR2 A;  3ITB A;  5CTM A;  3UY6 A;  4EV4 A;  5CXW A;  4OPZ A;  5DTT A;  3ZNT A;  4QY5 A;  1HD8 A;  1XA1 A;  1YLZ A;  3MXS A;  1PIO A;  4KEN B;  3VP3 A;  4EBP A;  5KSH A;  4OOL A;  2Z2M B;  1XA7 A;  4XXR A;  3SOI A;  2JC7 A;  1E4D A;  4JF4 A;  4U0X A;  4C75 A;  5FI7 A;  4DE1 A;  1MY8 A;  4ZJ2 A;  2IWD A;  5EVI D;  4OON A;  4S2L A;  2EFX A;  2EXA A;  3B3X A;  1JWV A;  3MXR A;  4MNR A;  1NRF A;  2XD1 A;  5FQM A;  3N4I A;  1NY0 A;  1ERM A;  2Y2L A;  4R3B A;  2XLN A;  3UPP A;  2ZC5 B;  3WWX A;  4YFM A;  4EBL A;  5A91 A;  1YLY A;  2G2U A;  4KZA A;  4B88 A;  2Y2G A;  4E6X A;  3UPO A;  1FCM A;  1XKZ A;  3NC8 A;  2XK1 A;  1YMX A;  1M40 A;  1WE4 A;  2H0Y A;  1L0D A;  4OPQ A;  3W4Q A;  3VFF A;  3AGD A;  3OPH A;  2CC1 A;  2X01 A;  1PI5 A;  4CJN A;  2WKI A;  1BUE A;  1XX2 A;  4N9K A;  1K55 C;  1YM1 A;  4R4R A;  3FWL A;  3C5A A;  3NDG A;  4R0Q A;  2HP6 A;  4Y0O A;  1YLT A;  1S6R A;  2P74 A;  1ESU A;  3HRE A;  2Y2H A;  3BM6 A;  5E2E A;  2HDR A;  1N9B A;  4Y7P A;  4QY6 A;  1KDS A;  1BZA A;  1Q2P A;  4X6T A;  4E3J A;  4ID4 A;  4GN2 A;  3SH7 A;  3ZG8 B;  3N6I A;  3PAG A;  4XUX A;  4S2O A;  4N1X A;  2P9V A;  4MBK A;  3C7V A;  4HBU A;  1YLP A;  4GOG A;  4QHC A;  5DF9 A;  5HAP A;  1ES3 A;  5CRF A;  4BL3 A;  3N8S A;  4BQM A;  1PW8 A;  2ZLY A;  1ZG4 A;  2HDU A;  1BSG A;  5EVI C;  1G68 A;  3IXG A;  4OLG A;  4QD4 A;  4ZJ3 A;  3BRM A;  3IWI A;  5EEC A;  1KGG A;  2Y91 A;  1RGY A;  2ZQA A;  5JYO A;  2XGN A;  3N7W A;  1FSW A;  3PBO A;  1GHM A;  2V2F F;  5EOO A;  3E2K A;  3S1Y A;  3LCE A;  1MWU A;  3UDF A;  2EXB A;  4R1G A;  4BJP A;  4FH4 A;  4LV2 A;  3S4X A;  3V3S A;  1L0E A;  3UDX A;  2GDN A;  3WS5 A;  5TR7 A;  2WAE A;  2HP9 A;  3IF6 C;  3UNW A;  1I2S A;  4PPR A;  1H5X A;  3ZFZ A;  1K54 A;  3DWK A;  3IHA A;  1L2S A;  3HLE A;  5E2H A;  1XGJ A;  5FSR A;  1BLP A;  1W8Y A;  1KDW A;  4BL2 A;  4EUZ A;  2ZC7 A;  3P98 A;  3A3E A;  4WZ5 A;  1QME A;  1ZKJ A;  4IVI A;  3TG9 A;  3NY4 A;  3ZNY A;  4RA7 A;  3RXX A;  1YT4 A;  1JWP A;  1XXM A;  4R3J A;  5BOH A;  5KMW A;  4ZDX A;  1SCW A;  1CK3 A;  1JTD A;  1Q2Q A;  2A3U A;  1H8Y A;  4GD6 A;  4P0M A;  2XEP A;  4UA9 A;  3OPP A;  4OP8 A;  4OPY A;  4U3T A;  5FQQ A;  1NJ4 A;  5M19 A;  5F83 A;  2ZQC A;  1K6R A;  5HW3 A;  5GLA A;  3G4P A;  2Y2P A;  3M2K A;  1FR6 A;  2XFT A;  5GL9 A;  1C3B A;  2ZD8 A;  3MZD A;  3VP1 A;  2QPN A;  1SDE A;  4WMC D;  4DE3 A;  3G30 A;  5HL1 A;  4P87 A;  4KZ5 A;  3CG5 A;  4KZ7 A;  5FAQ A;  1ZG6 A;  1K56 A;  4K0W A;  3BEC A;  1FSY A;  3D4F A;  5FI6 A;  2Y2O A;  4PM9 A;  1IYP A;  1L0G A;  1EWZ A;  1I5Q A;  3HLF A;  2XF3 A;  4KZ3 A;  4ZTK A;  1KGF A;  3FKV A;  1BT5 A;  5CHU A;  3HUN A;  1KVM A;  1GHP A;  4BLM A;  5GLC A;  2Y59 A;  2ZMA A;  2QZ6 A;  2VGJ A;  3G34 A;  3G2Y A;  5AQ7 A;  2XQZ A;  4DXB A;  2H0T A;  4R23 A;  3QNC A;  2Y4A A;  3IXB A;  5HAI A;  1DJA A;  1MBL A;  3BEB A;  3NDE A;  4S2J A;  3WRT A;  1K4E A;  4GD8 A;  3OC2 A;  5FA7 A;  3BLM A;  3G35 A;  2XDM A;  1K56 D;  4CPK A;  4DE0 A;  4C3Q A;  2Y2M A;  1ERQ A;  2R9X A;  5CHJ A;  3V39 A;  3HLB A;  4GNU A;  1K57 A;  1E3U A;  4KZ8 A;  3FKW A;  3W8K A;  3HLD A;  5A90 A;  3E2L A;  4FSF A;  3QNB A;  2OLV A;  4M3K A;  3V3R A;  4DDY A;  4UHU A;  2ZJ9 A;  1GCE A;  2ZM2 A;  1ERO A;  1Z6F A;  3BLS A;  1IKI A;  2ZC3 B;  4FCF A;  4OQ0 A;  4DDS A;  5F1F A;  3PBR A;  1IYO A;  4JLF A;  1K38 A;  3PBT A;  3VP2 A;  3M2J A;  2UWX A;  1FCO A;  2Y2N A;  2Y2K A;  2V1Z A;  4WZ5 C;  1OME A;  4LV0 A;  4OQH A;  1SDN A;  3MZE A;  1VQQ A;  2H10 A;  4K91 A;  1PWC A;  3BFE A;  4HEF A;  5F1G A;  1U60 A;  3CJM A;  3IF5 A;  1IYQ A;  3HLW A;  1NZO A;  5HX9 A;  5KSC A;  4E3L A;  2IWC A;  5CHM A;  3VP4 A;  1NZU A;  1E3U D;  5D3O A;  5TGF A;  1BLS A;  5FAP A;  3CMZ A;  4WZ4 A;  3A3I A;  3Q1F A;  3ZHH A;  3ZG9 B;  1CEF A;  2FFY A;  2VGK A;  2ZQ8 A;  4MBF A;  2IWB A;  3C7U A;  3VFH A;  5EVI B;  1BLH A;  3VOZ A;  5E2F A;  4OPR A;  3BYD A;  5L2F A;  3G2Z A;  4OQG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...