1KGEA

Structure of beta-lactamase asn 170 met mutant
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
257
structure length
257
Chain Sequence
KELNDLEKKYNAHIGVYALDTKSGKEVKFNSDKRFAYASTSKAINSAILLEQVPYNKLNKKVHINKDDIVAYSPILEKYVGKDITLKALIEASMTYSDNTANNKIIKEIGGIKKVKQRLKELGDKVTNPVRYEIELMYYSPKSKKDTSTPAAFGKTLNKLIANGKLSKENKKFLLDLMLNNKSGDTLIKDGVPKDYKVADKSGQAITYASRNDVAFVYPKGQSEPIVLVIFTNKDNKSDKPNDKLISETAKSVMKEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-LACTAMASE
publication title Elimination of the hydrolytic water molecule in a class A beta-lactamase mutant: crystal structure and kinetics.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 95
structure length 257
sequence length 257
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 1996-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1kgeA00
4RYEA 1W7FA 3S4XA 1NRFA 2Y91A 1QMFA 4BD1A 1YLZA 4PMAA 2R9XA 3HLGA 1DJCA 1Y54A 5EOEA 4Q8IA 2Z2MB 1FCNA 1ES2A 2JBFA 2HDSA 3Q7VB 1XGIA 4PM6A 1QMEA 2QMIA 5AQAA 3BM6A 1K55A 1KE4A 1PI5A 3OPRA 5HARA 2XF3A 5FQ9A 1PW1A 5AQ9A 2B5RA 4OOLA 3IF5A 5EVID 2ZD8A 5I94A 3IXBA 4KZ9A 3SOIA 4LENA 1Z6FA 1KE3A 3A3EA 4E3NA 1ZG6A 4PM9A 4BJPA 3FYZA 1W8YA 5GLDA 2XFSA 3PBRA 2UWXA 4ZJ3A 2HDQA 4ZJ1A 2P74A 4DE0A 4E6XA 3IHBA 4MEZA 1FSYA 4OQHA 3NI9A 1XA7A 1M40A 2R9WA 2Y2KA 3SH9A 4R3JA 2IWBA 1FSWA 3V39A 2ZC7A 4U0XA 2OLVA 1VQQA 3HLBA 3RJUA 4P87A 1IELA 2BLSA 2Y4AA 3C7VA 4S2IA 3E2KA 1RGZA 1VM1A 3M2JA 1KGGA 1PZOA 3CZDA 5E43A 2EX9A 3A3DA 3Q7ZA 3QNBA 2XD5A 3DWKA 4KZ5A 1BLPA 1IKGA 1KGFA 1Q2QA 1IKIA 3CMZA 4JXGA 5M18A 1C3BA 4KZ7A 4RA7A 2ZLYA 3NIAA 3HUMA 4MBFA 3O3VA 3PAEA 3NC8A 5GLAA 5E2FA 5AQ7A 5D3OA 1CK3A 3N6IA 5DF8A 3HLFA 4ZAMA 1TDLA 1BLCA 5FQQA 3VMAA 5U47A 3IQAA 1SKFA 4K91A 5CGWA 3VP3A 1KGEA 3M6BA 5G18A 3MXSA 2RL3A 4EWFA 1H5XA 3ZHHA 5DF7A 3OPPA 3P98A 4OP8A 4WYYA 5CHMA 5AQBA 2Y2PA 4WM9A 5DTKA 2WADA 5EVIB 1K4EA 1JTGA 3FZCA 1BLSA 1NY0A 1PIOA 4CPKA 5EUAA 4LCMA 3WS5A 1PWGA 4JF4A 5FAQA 4JLFA 2E8IA 4E3LA 1LL9A 1TVFA 4LV1A 4OONA 4BQMA 2ZM8A 4JXWA 4K0WA 4OLDA 1DJAA 2WGWA 2WYXA 4UAAA 1EI5A 1ES4A 5FQKA 4QY5A 5FI7A 3V5MA 5CEBA 5HAPA 1YLYA 3VSLA 4Y0TA 3QHYA 1I2SA 4K0XA 3BFCA 2EX8A 1JVJA 3WRTA 4B4ZA 3GVBA 1GHMA 1JTDA 4WBGA 3UPNA 3Q82A 3A3IA 4HBTA 2ZC3B 3UE3A 2XK1A 2HDRA 1HD8A 4GKUA 3UDXA 1ESUA 3AGFA 2FFFB 4Y0OA 1E4DA 1FCOA 2WAEA 4A5RA 1ZG4A 4E3OA 3G2YA 4OLGA 4OVDA 4S2OA 2V2FF 1YLTA 3IWQA 4GB7A 5E2EA 3TSGA 3HLDA 2JCHA 1BULA 3V3SA 3I7JA 4H8RA 5CHJA 3ZG7B 1ZC2A 3IXGA 5IHVA 3UE0A 1WYBA 4EUZA 3UO9A 3EQVA 5JYOA 1ESIA 3ISGA 3JYIA 3G34A 2G2UA 3MFDA 4OPYA 1Q2PA 1SCWA 4ZBEA 2H0TA 3NDEA 3MKFA 1IYPA 4DKIA 3HUNA 2HP6A 1W79A 4GNUA 4OP5A 1MWTA 2XH9A 3GR2A 3NY4A 2XDMA 3GMWA 1IYOA 1BSGA 3NBLA 3ZG0A 4S2MA 5A93A 1ES3A 2WZZA 2XEPA 2Q9MA 3LO7A 5GHXA 5A92A 4KZ8A 1JWVA 1XGJA 2J9PA 4IBXA 3FV7A 1YQSA 5FQJA 5EECA 2Z2LB 2WKHA 1NJ4A 4RX3A 2ZQAA 4U0TA 1AXBA 2Y2IA 1RCJA 2QZ6A 2I72A 4QY6A 1K54A 3HBRA 2G2WA 3WS4A 1K25A 3CJMA 2HP5A 1OMEA 2WGVA 2Y2HA 3GV9A 4X68A 2C5WB 4KZ4A 3PBSA 1W8QA 2WAFA 1BLHA 4MNRA 2HP9A 4R4RA 5GL9A 1FQGA 4GDBA 5EVIC 1PZPA 4S2PA 4UA9A 5HX9A 1U60A 4ZDXA 1XX2A 5L2FA 2X02A 4XXRA 1N4OA 3VFHA 2Y2OA 1XXMA 3BFDA 3OCLA 4WEJA 3GRJA 1KVLA 4EV4A 5HW3A 4S2NC 4E6WA 1SDNA 1FCMA 1DY6A 2WUQA 2Y2LA 4EBPA 1BT5A 3FKWA 4GOGA 4OQ0A 4GN2A 5FQIA 3Q7VA 1BUEA 1K4FA 2ZQ8A 1IEMA 1K38A 4R1GA 3WS0A 5FASA 3DWZA 5F1FA 3WS2A 3ZG8B 2EXBA 1G68A 3LY4A 3UDFA 4N9KA 1BZAA 1XPBA 3PBOA 4KQRA 2J7VA 5HAQA 2EX2A 5HFOA 2V20A 1CEFA 1KE0A 4N92A 4X55A 3ZCZA 1L0FA 4KG2A 1LLBA 1LI0A 4R0QA 4S2JA 3G2ZA 4UA6A 3HLEA 3ZG5A 3DW0A 1PI4A 1GA0A 4JKTA 1CEGA 5GHZA 4RVAA 4C6YA 3MBZA 3IWIA 3LY3A 4KQOA 3UDIA 1RP5A 3HREA 3WWXA 3PTEA 2V1ZA 4WZ5A 4UHUA 2XLNA 2OV5A 2WGWB 3G35A 3AGDA 1K6SA 1L0DA 2WKIA 3IF6A 4DDSA 3VP1A 2Y2NA 1BTLA 3O86A 4MLLA 4NETA 5F1GA 4FH2A 3IHAA 4E3JA 1NZUA 2EFUA 4N1XA 5KSHA 4R23A 5EVLA 4JF6A 4OQIA 4C75A 3IH9A 3FKVA 4EBLA 3N8LA 3ZNYA 3UE1A 1SDEA 1K54C 1XKZA 1K55C 2ZC5B 2XR0A 4KZ6A 4MBHA 4B88A 4JXSA 3UY6A 4Z9QA 1RGYA 3LEZA 1H8YA 4FH4A 3Q81A 4PM7A 1ONHA 3C7UA 4KZ3A 4Y0UA 4ZJ2A 5FSRA 5TFQA 4EBNA 4JXVA 5DTSA 3WS1A 5FA7A 4FCFA 1S6RA 2ZQDA 3VP2A 1EWZA 1PWDA 1KDSA 3RXWA 4IVIA 4BD0A 2XD1A 4EQIA 1WYCA 4X53A 1ERQA 3TOIA 3VOZA 4KG5A 3E2LA 1DJBA 3FWLA 3IH8A 4U3TA 2VGJA 3SS5A 1MXOA 1PYYA 1YMXA 1HTZA 2Y2JA 3Q07A 2P9VA 2QPNA 4KQQA 3HLCA 1FR6A 3HLWA 2VGKA 1IYQA 2Y55A 4QHCA 4WEKA 4PM5A 2OLUA 4N9LA 4OPRA 3SH8A 4DE3A 3W4PA 2FFYA 4P85A 3S1YA 3V50A 2EFXA 1L0EA 5FQMA 3AGEA 1WE4A 3SS4A 4D2OA 3HVFA 2GDNA 1JWZA 3BFGA 2HDUA 3OZHA 5A90A 4JPMA 4PPRA 3BFFA 1ERMA 3O87A 3MZEA 3OPHA 3DTMA 3MXRA 4XUXA 5DVAA 3SH7A 4YFMA 3BLMA 3VP4A 3G31A 1XA1A 3IT9A 4LCLA 3V3RA 1LL5A 3VP0A 3MKEA 5GHYA 4FSFA 3N8SA 2Y59A 3ZDJA 1KVMA 4GZBA 2HPBA 1GHIA 1J9MA 4BL3A 5KMWA 5CTNA 4QJGA 5DTTA 4L0LA 4DDYA 4N1HA 4RX2A 4WZ5C 4OPQA 3PAGA 1GCEA 3HL9A 4DE1A 5E2GA 4WZ4A 1PW8A 2ZC4B 5DF9A 2A3UA 4IVKA 4F94A 2H0YA 5CEDA 1YLPA 2IWCA 2WK0A 3PBQA 1E3UA 4R4SA 1L0GA 3UPPA 2H10A 4QB8A 4OOYA 3C4PA 4JF5A 3UPOA 1K57A 3MZFA 3BRMA 4NK3A 1W5DA 3ZGAB 1O07A 5EPHA 1ES5A 1CI8A 3ZVTA 2A49A 3N8RA 4JBFA 3RXXA 3VFFA 2ZQCA 5E2HA 1MKIA 4HEFA 2EX6A 2DCFA 1ONGA 1PWCA 5CGSA 5FAPA 5EOOA 1HZOA 2J9OA 4KG6A 2ZJ9A 4UA7A 1K56A 4GD6A 4BENA 1I5QA 2ZQ9A 2C6WB 5JYPA 3ZVWA 3NDGA 1XP4A 4DXBA 4XUZA 4BLMA 1I2WA 5FI6A 4IEDA 1HVBA 3QNCA 1S0WA 1YLJA 3A3FA 3VSKA 3IXDA 5KZHA 4WMCA 1O7EA 3NCKA 1TDGA 3MZDA 5HL1A 4ZTKA 4QU3A 3GQZA 2IWDA 1IYSA 3G32A 4KZAA 4X56A 3IF6B 4O7DA 2ZQ7A 3UNWA 1CI9A 1NYYA 3GSGA 4OQGA 5F82A 4GDNA 2ZM0A 3GTCA 5HAIA 2Y2MA 4E3MA 4MBKA 3BECA 4DXCA 4DF6A 1FOFA 5M19A 1GHPA 4FD8A 3N7WA 3IXHA 3UN7A 2WGIA 2EXAA 3G30A 3ZNTA 1SHVA 1MPLA 2CC1A 2JE5A 3BEBA 3W4OA 3N4IA 4OPZA 5GLCA 4DRTA 4B4XA 5EE8A 3HUOA 1N9BA 4P0MA 1E3UD 1NXYA 4LV2A 5KSCA 3CG5A 3LCEA 2Q9NA 2ZC6B 2PU2A 3BYDA 3C5AA 4R3BA 5CXWA 4S2KA 3OPLA 3C4OA 5TGFA 5BOHA 4C3QA 2RCXA 1MY8A 2ZM2A 3Q1FA 1K57C 2P9VB 3PBTA 3TG9A 1GA9A 4Y7PA 4YINA 5CECA 4HBUA 5TR7A 4BL2A 1L2SA 3W8KA 2XQZA 4ID4A 5J8XA 4LV0A 4QD4A 5CHUA 3A3JA 5EVIA 2X01A 5FI2A 4CJNA 3IWOA 4M3KA 1K56D 2WKEA 3B3XA 4OKPA 3D4FA 4E3IA 3OC2A 1NYMA 1TEMA 1ZKJA 2PU4A 2BG1A 3M2KA 4PM8A 1FR1A 1MWUA 1KDWA 1M6KA 3ZFZA 4S2NA 2Y2QA 5CGXA 4KENB 3ZG9B 2Y2GA 1YM1A 3OCNA 1YMSA 2OSUA 5CRFA 4E3KA 2DNSA 2H5SA 4WMCD 3P09A 2J8YA 4HESA 4WELA 1NZOA 4DE2A 1E25A 3SS3A 4S2LA 1YLWA 4P6BA 1JWPA 4OH0A 2XFTA 1K6RA 4GD8A 1MBLA 3M6HA 3BLSA 5A91A 3VOYA 3ITBA 3W4QA 3WRZA 1YT4A 4KZBA 2JC7A 2PBYA 3S22A 1EROA 4IBRA 1MWRA 1MWSA 4OOMA 5CTMA 3EQUA 1LI9A 5CERA 3PBNA 5FAOA 3O88A 3IF6C 5M1AA 4X69A 2X71A 4X6TA 5GLBA 3BFEA 4LV3A 2DRWA 5F83A 1H8ZA 2ZMAA 5FDHA 1G6AA 3ITAA 1ALQA 1LHYA 3G4PA 5FATA 2WZXA 2XGNA
chains in the Genus database with same CATH superfamily
1W7FA 3S4XA 1NRFA 2Y91A 4HH2A 1YLZA 1FCNA 5HD3A 1XGIA 3BM6A 1P97A 2Z6DA 3F1PB 5AQ9A 2ZD8A 1YPRA 1NLZA 1Z6FA 3FYZA 2D02A 1LL8A 5GLDA 4DE0A 2UWXA 2HDQA 4OQHA 1XA7A 2R9WA 3V39A 4R3JA 5TBMB 2IWBA 4U0XA 2OLVA 4P87A 1PZOA 4LFUA 5E43A 3Q7ZA 4KZ5A 3DWKA 1IKIA 4JXGA 2Y8HA 3BY9A 4EEPA 4MBFA 3O3VA 1ACFA 5E2FA 1CK3A 5DF8A 1OT9A 1DP9A 1VETB 3ZHHA 4R38A 3DTIA 5AQBA 2WADA 5EVIB 4CPKA 3WS5A 4JLFA 1LL9A 4LV1A 4BQMA 3TW8A 5LBRA 4CLCD 5HDSA 1KOUA 4UAAA 3V5MA 1IFQA 2QWSA 4Y0TA 5HDCA 2EX8A 4B4ZA 4R70A 1JTDA 1T1AA 5DKKA 2B02A 1N9LA 2FFFB 3KX0X 5FL3A 4MN7A 4F3LA 4E3OA 1BULA 3I7JA 3IXGA 4EUZA 4RQ9A 3UO9A 3JYIA 1V9ZA 1PNEA 2G2UA 2VJWA 3MFDA 1Q2PA 3H7WA 3LIBA 5HPFA 3HUNA 3LYXA 1MWTA 3GR2A 3NY4A 4Y15A 3GMWA 1IYOA 1PFLA 4HJ3A 3ZG0A 2WZZA 3A0RA 1OTDA 2QJ5A 4WN5A 5EECA 2Z2LB 3LEQA 1NJ4A 1RCJA 2QZ6A 5F6AA 3HBRA 3UB6A 4WLAA 1OMEA 2WGVA 2Y2HA 1H3QA 3GV9A 3PBSA 3T4OA 1BLHA 4R4RA 2HP9A 2VKSA 5EM1A 1VHMA 4LGWA 4ZDXA 1XX2A 5L2FA 4XXRA 3T4SA 2Y2OA 2V8CA 3LR4A 5HW3A 4S2NC 4E6WA 2WUQA 1BT5A 2ZQ8A 5MC7A 3WS0A 3DWZA 1G68A 2OOLA 1UWNX 2Y79A 2PYPA 4X1LA 2EX2A 3A0SA 3LGOA 4N92A 3ZCZA 5F69A 1L0FA 1DP6A 4HNBA 2D01A 3IBJA 3DW0A 4JKTA 1F5MA 2W27A 5TBMA 1RP5A 2PDRA 2R78A 3RFBA 3D3OA 4DDSA 3O86A 4NETA 2W3DA 4FH2A 4FOFA 3CITA 5EVLA 4JF6A 3FKVA 4EBLA 3UE1A 4Z9QA 5HDDA 3Q81A 1ONHA 3C7UA 4KZ3A 2VX8A 4Y0UA 3RH8B 1VETA 1LSVA 3CWFA 3VP2A 4BD0A 2XD1A 3TOIA 4KG5A 1DJBA 2Y2JA 2P9VA 3P7NA 1IYQA 3BW6A 2AVXA 3V50A 2EFXA 5FQMA 1WE4A 3LFVA 1JWZA 3O5YA 3OZHA 1OT6A 3P01A 4R6LA 3OPHA 4R3AA 3BLMA 3G31A 3MKEA 5GHYA 3LR0A 2Y59A 2JKFA 2P08A 2M7VA 4RX2A 4DE1A 2ZC4B 3FPWA 5CEDA 2WK0A 2ZBBA 2H10A 5TJJA 1FILA 1K57A 4NK3A 3ZGAB 4G3VA 5EPHA 4QPRA 2V8FA 4ZRRA 4HEFA 1ONGA 5EVEA 1HZOA 3OOVA 2A24A 3OBFA 4IUKA 2ZOHA 3JVVA 3ZVWA 1SZVA 4DXBA 3LICA 4BLMA 2KX6A 2OWJA 1HVBA 3QNCA 2W1TB 3MF0A 5AVFA 1O7EA 4MDZA 3NCKA 2V0WA 3L9KA 4LLOB 4ZTKA 4QU3A 3GQZA 1IYSA 3S7OA 4X56A 1NYYA 2L4RA 2GZAA 5HAIA 2ZM0A 1Y4OA 3BECA 4DXCA 2EA9A 4DF6A 1GHPA 3G30A 2EXAA 2VGLS 4MN6A 3R7WB 3NOPC 3EGXC 2Q0OA 3CAXA 4OPZA 5GLCA 4DRTA 4B4XA 2NUPC 1EW0A 5EE8A 3BWLA 1G5UA 1E3UD 3ULFA 1OJ5A 3CG5A 5CXWA 2HF6A 4S2KA 2JKRM 5TGFA 2RCXA 1VEUB 2NUTC 4JGRA 3TG9A 4Y7PA 1J3WA 5TR7A 3GECA 2PR5A 3W8KA 3CI6A 1NLYA 2XQZA 4HQAA 3DBAA 4ID4A 2VEAA 3A3JA 3QP2A 5C5KA 2X01A 4M4XA 1K56D 3B3XA 2WKQA 3D4FA 1NYMA 1TEMA 2BG1A 3CHWP 3M2KA 1MWUA 1KDWA 1SKOA 4S2NA 3OLOA 2WKRA 1YMSA 2OSUA 2DNSA 4WMCD 2J8YA 4HESA 1P9WA 3MQ0A 4XT2A 1NZOA 1E25A 1YLWA 4P6BA 5DJUA 1MBLA 3WRZA 3MMHA 1EROA 3KSHA 1TF1A 1CF0A 3IF6C 4GS9A 4X6TA 5GLBA 2DRWA 1H8ZA 1UGUA 1ZTUA 2UV0E 3FG8A 4BD1A 4PMAA 1CQAA 4Q8IA 2Z2MB 1Z09A 2HDSA 4PM6A 1QMEA 1KE4A 1N9OA 1UWPX 2XF3A 5FQ9A 1PW1A 4GW9A 5I94A 3SOIA 1F9IA 1LSWA 2K2NA 4BJPA 5G4ZA 3PBRA 4MEZA 1FSYA 2HJEA 3KSGA 3NI9A 3HLBA 3RJUA 1IELA 3UE6A 3CZDA 3A3DA 3T4JA 1C3BA 4RA7A 3HUMA 3PAEA 5GLAA 3N6IA 1TDLA 3LIFA 3A0VA 4ARZB 3IQAA 3VP3A 4EESA 3MXSA 3V67A 2W1TA 2YKHA 5DF7A 4NG2A 4WYYA 2V0UA 2Y2PA 1K4EA 2GX5A 5FAQA 2E8IA 3NOUC 3F1OB 1DJAA 2WGWA 2WYXA 5HAPA 2XA7M 3VSLA 4CLCC 4K0XA 1S67L 2L0WA 3BFCA 1JVJA 2EWWA 3WRTA 3GVBA 4H6JB 2QJ7A 3A3IA 3Q82A 3T4QA 1DP8A 3AGFA 3G2YA 4OLGA 1YLTA 3IWQA 1N9NA 3TSGA 1W63Q 1VEUA 3ZG7B 5IHVA 1WYBA 3EQVA 1OJGA 4UEYA 3G34A 3H82A 4Y2FA 4HP4A 1D06A 4ME4A 4DKIA 1IYPA 1W79A 2FH5A 4I5SA 3LO7A 5A92A 2J9PA 4CLCB 2PHYA 2WKHA 4U0TA 1AXBA 2B95A 4WL9A 1K54A 4B93A 3QP4A 2G2WA 3WS4A 3ICYA 3CJMA 1D1JA 4KZ4A 3CUEC 3EEHA 4MNRA 4GDBA 5EVIC 4UA9A 5HX9A 3VOLA 3VFHA 3UB9A 1XXMA 4EV4A 3HJKA 1MKMA 2Y2LA 1DY6A 3FKWA 2JKTI 1BUEA 1IEMA 3NOTC 4Q0HA 3B42A 3LY4A 4N9KA 5HAQA 3PBOA 4KQRA 1CEFA 4WUJA 1KE0A 4KG2A 4GCZA 3UB7A 2OAQ1 4C6YA 3MBZA 3IWIA 1P0ZA 3UDIA 1MC0A 2OV5A 5EFWA 1L0DA 3IF6A 2QKPA 1BTLA 2Y2NA 5F1GA 3IHAA 4E3JA 5AJGA 2EFUA 4C75A 3IX8A 1SDEA 1K55C 4UQIS 2J80A 3R4KA 1MZUA 4EBNA 5FSRA 5DTSA 5FA7A 4EUVA 4FCFA 1AWIA 1ERQA 3VOZA 3MQOA 4U3TA 1HTZA 1XJ2A 3VE3A 4EXOA 5HD5A 4OPRA 4N9LA 3SH8A 2PAVP 2Z6CA 5HWWA 3K3CA 4IUHA 3AGEA 4HI4A 4X25A 5KIZA 2HDUA 5A90A 4PPRA 5G4YA 3BFFA 4L9GA 1ERMA 3DTMA 1S4SA 3SH7A 4Y3IA 4LCLA 1XA1A 3IT9A 1LL5A 4LPZA 4NXEA 3ZDJA 1KVMA 4L9EA 4BL3A 5KMWA 3VE4A 4QJGA 4L0LA 4N1HA 4WZ5C 3PAGA 2MJ6A 4GHIA 3C30A 2K31A 5DF9A 2A3UA 4F94A 4O01A 2IWCA 4Y13A 5DFXA 1OTBA 4OOYA 4WF0A 3MFXA 5L10A 3TRCA 2A49A 1MKIA 2EX6A 5CGSA 5EOOA 3IBRA 4UA7A 4KUKA 3PYPA 2C6WB 5JYPA 1TD5A 3NDGA 1I2WA 3F1PA 3MZDA 5HL1A 2IWDA 3S7PA 3G32A 4KZAA 3GSGA 4GDNA 2VA0A 2P04A 3T4TA 4MBKA 2IA2A 4HP9A 3T4LA 1MPLA 2CC1A 3BEBA 3W4OA 3N4IA 1N9BA 4LV2A 2ZC6B 2PU2A 3BYDA 3C5AA 2HV1A 3OPLA 3C4OA 5BOHA 4C3QA 2ZM2A 4DJ2A 4YINA 5CECA 4HBUA 3CUEA 1L2SA 2KLIA 1NWZA 5J8XA 5EVIA 5FI2A 4CJNA 4M3KA 4FUWA 1XFNA 3T50A 2PU4A 1FR1A 3D9YA 4BBUA 3W2ZA 3LIDA 1WA9A 3PXPA 2ZL1B 3P09A 3SS3A 2XFTA 5A8BA 5A91A 3BLSA 2GNXA 5EV0A 3W4QA 3S22A 3TJZC 4DJ3A 3BY8A 4L9FA 3EQUA 2YKFA 1YAXA 5M1AA 3BFEA 5F83A 5J7EA 3UB8A 5FDHA 3ITAA 3G4PA 5M19A 4RYEA 1QMFA 2R9XA 1DJCA 5EOEA 1ES2A 3Q7VB 1K55A 1PI5A 3OPRA 2VV6A 4HJ4A 5HARA 2B5RA 3IF5A 3E4OA 3IXBA 4KZ9A 4E3NA 3CPTB 4PM9A 4BWIA 4ZJ1A 2P74A 4E6XA 3KO6A 2HJ9C 3IHBA 1M40A 3C38A 3SH9A 4HIAA 2Y4AA 3C7VA 4S2IA 3E2KA 1RGZA 1VM1A 3IS2B 1KGGA 2EX9A 3QNBA 2XD5A 1BLPA 1IKGA 3CMZA 4KZ7A 5DKLA 3NIAA 3NC8A 5L8MA 5AQ7A 2OWHA 5FQQA 1G6OA 5CGWA 1LSXA 3T1SA 5G18A 2RL3A 4MCWA 4EWFA 3OPPA 5CHMA 2L1MA 3H9WA 1FIKA 4WM9A 1BLSA 1PIOA 5EUAA 1PWGA 4JF4A 4OONA 2ZM8A 4OLDA 4QY5A 5FI7A 5CEBA 1YLYA 3B33A 3QHYA 4K08A 1XJ6A 3EWKA 1CJFA 3UPNA 2PBDP 2JHEA 2ZC3B 2XK1A 2HDRA 1HD8A 4GKUA 3UDXA 1ESUA 2VLGA 4Y0OA 2WAEA 2KOIA 1ZG4A 4S2OA 2V2FF 4GB7A 5E2EA 3HLDA 2JCHA 3U2AA 1ZC2A 4HJ6A 3UE0A 3ISGA 4OPYA 2ZOIA 4ZBEA 5IU1A 2VGLM 2DMWA 2HP6A 4GNUA 4OP5A 3QP6A 2XDMA 1BSGA 5A93A 2XEPA 4KZ8A 4IBXA 3FV7A 3MQQA 2ZL1A 5FQJA 2QYBA 4RX3A 2ZQAA 1PRQA 2Y2IA 1V9YA 4QY6A 2I72A 5HWVA 1K25A 2HP5A 2C5WB 1GSXA 2M1CA 2WAFA 1FQGA 1PZPA 1U60A 4II7A 2X02A 4Q0JA 1N4OA 4WEJA 1XJ3A 3GRJA 4IHQA 1SDNA 1FCMA 4OQ0A 2W0NA 4GOGA 4GN2A 2H28A 5FQIA 3Q7VA 1K38A 5FASA 2EXBA 3UDFA 2W3GA 5HFOA 2LB5A 5HWTA 3BQAA 4X55A 4Q0IA 1LLBA 1LI0A 4R0QA 4S2JA 1GA0A 5GHZA 4YWZA 4RVAA 3HREA 3IX3A 1F98A 4UHUA 3AGDA 1K6SA 2WKIA 4MLLA 4EETB 4N1XA 3IH9A 3S7QA 3ZNYA 4B88A 4MBHA 2XR0A 4JXSA 3FC7A 3R7WA 4PM7A 2WKPA 4ZJ2A 4JXVA 3PR6A 2ZQDA 4PAUA 1EWZA 3K3DA 1KDSA 3RXWA 4IVIA 4X53A 3E2LA 3FWLA 3IH8A 2VGJA 1MXOA 1PYYA 1YMXA 1YKDA 3H7WB 2OAP1 2QPNA 3DTKA 1FR6A 3HLWA 1OTEA 4QHCA 4PM5A 1G28A 4DE3A 1HLUP 4HHDA 2CMNA 2FFYA 4P85A 3S1YA 3SZTA 3SW1A 1S4RA 3SS4A 4D2OA 3BFGA 4JPMA 3E0YA 3KYZA 3O87A 1NRJA 3MZEA 3MXRA 5DVAA 2VZWA 3V3RA 4FSFA 3N8SA 2HPBA 1GHIA 1J9MA 5DTTA 3E4QA 4NEED 5CX7A 4DDYA 3FPVA 4OPQA 3HL9A 3VV4A 5E2GA 1PW8A 3KSFA 1S1YA 3UMDA 3MZFA 3BRMA 1W5DA 4O8GA 3ZVTA 4I3AA 4JBFA 3VFFA 4ESPA 2O9AA 1PWCA 1VB6A 3EEAA 2J9OA 4KG6A 4GD6A 4B9OA 3C8CA 1I5QA 2HGVA 2ZQ9A 5FEGA 3E4PA 2VK3A 1OTIA 1D7EA 4XUZA 3HCYA 4IEDA 1S0WA 1YLJA 3A3FA 3VSKA 4HY8A 2KDKA 2G7UA 1TDGA 4O7DA 2ZQ7A 1CI9A 3GTCA 2Y2MA 1FOFA 3LIEA 3MR0A 1JNUA 1Y28A 3UN7A 2WGIA 3JVUA 3ZNTA 3QP5A 2V1AA 3HUOA 3LCEA 4O0PA 4ARZA 1K57C 2P9VB 3PBTA 4P6ZS 3KYEA 2I9VA 4KQDA 4LV0A 4QD4A 4LRXC 3IWOA 3D72A 2WKEA 4OKPA 4E3IA 3OC2A 4GJ4A 1GSVA 1ZKJA 4EERA 4AFIA 3F1OA 1P9RA 4FTXA 4PM8A 1M6KA 3ZFZA 1X0OA 2Y2QA 5CGXA 3ZG9B 2J3TD 2XRNA 3OCNA 5CRFA 4E3KA 1YSQA 1S1ZA 2H5SA 4YOFA 1IOUA 4H6JA 1XJ4A 1L3LA 4DE2A 2JKGA 4S2LA 1DRMA 1JWPA 4OH0A 3M6HA 3MSHA 3VOYA 1YT4A 2JC7A 1ZHHB 3LI9A 1MWRA 1MWSA 4OOMA 1LI9A 3O88A 1GSWA 1LT0A 4MN5A 3CLOA 4LV3A 4PKYA 2ZMAA 4UQIM 2WZXA 2XGNA 3ZG5A 2VV8A 2PD7A 3HLGA 1Y54A 2A24B 5L07A 2JBFA 2QMIA 4LRZE 4LRYC 4P6ZM 5AQAA 4CLCA 2JKTM 4G3WA 2BTFP 4OOLA 5EVID 5HPIA 2PRFA 4LENA 1KE3A 3A3EA 4E04A 1ZG6A 4BBTA 1W8YA 2XFSA 4ZJ3A 3UB5P 2O0YA 2Y2KA 1FSWA 2ZC7A 3BQ8A 1VQQA 3T1XA 1W63M 2BLSA 3NECA 3M2JA 2ZMFA 4JGPA 5HSQA 4DN0A 4JGQA 1KGFA 1Q2QA 5M18A 1XFQA 3EOIA 4I39A 2A2LA 2ZLYA 1STZA 3LI8A 5D3OA 3HLFA 4ZAMA 1BLCA 5FDSA 5U47A 3VMAA 1T1CA 1SKFA 4K91A 1KGEA 3M6BA 3E98A 2ZMVA 1H5XA 3P98A 4OP8A 1H8MA 3L7HA 5DTKA 1JTGA 3FZCA 1NY0A 5F5YA 4LCMA 3GDIA 4E3LA 1TVFA 3TE8A 4JXWA 3MJQA 4K0WA 1TS7A 1EI5A 1ES4A 1SKOB 5FQKA 1I2SA 5HL6A 3T1QB 1GHMA 4WBGA 4HBTA 2JKRI 4XT2B 3UE3A 3F1NB 1E4DA 1FCOA 4A5RA 3JPUA 3ZQ5A 4OVDA 1S66L 4DMZA 3LR3A 3LR5A 3V3SA 5CHJA 4H8RA 5L09A 3QP1A 5JYOA 3T12B 1ESIA 4ETZA 4GS9B 5AVEA 1SCWA 2M7UA 4NXFA 5J3WA 1YSPA 2H0TA 3NDEA 3MKFA 2XH9A 3NBLA 3MXQA 4CLCE 5FEFA 4S2MA 1ES3A 5GHXA 2Q9MA 1JWVA 1XGJA 1YQSA 1OTAA 1A0KA 4X68A 4NKPA 1W8QA 5GL9A 3MS6A 2FZ0A 4KUOA 5HZHA 4S2PA 4I3IA 1T1BA 4I38A 3NULA 3OCLA 3BFDA 4EQ1A 5EM0A 1KVLA 4EEUA 4EBPA 3DTEA 3EGDC 4R1GA 1K4FA 3IX4A 5F1FA 3WS2A 3ZG8B 1TS6A 1BZAA 1XPBA 2VV7A 2J7VA 2V20A 3G2ZA 3BJNA 4UA6A 3HLEA 1PI4A 2BASA 1ODVA 1CEGA 3LY3A 1OPXA 4KQOA 3WWXA 3PTEA 2V1ZA 4WZ5A 3LIAA 2XLNA 3NJAA 2WGWB 2QHKA 3G35A 2PD8A 3VP1A 3S7NA 4HOIA 1NZUA 2PYRA 3HJIA 2W3EA 5KSHA 4R23A 2XSSA 4OQIA 3N8LA 1XKZA 1K54C 2PT7A 2ZC5B 4KZ6A 2EWVA 3UY6A 1RGYA 3LEZA 1H8YA 4FH4A 5TFQA 2P7JA 3WS1A 1S6RA 1PWDA 5I5LA 4EW7A 4EQIA 1WYCA 1T19A 1T18A 4EU0A 2GJ3A 4Y17A 3SS5A 3H82B 2E8JA 2INWA 3Q07A 3T4KA 4KQQA 3HLCA 2VGKA 2O9BA 2Y55A 3LUQA 4WEKA 2OLUA 3W4PA 1L0EA 3HVFA 2GDNA 2W3HA 4G3KA 4XUXA 3B47A 3F1NA 2XROA 4YFMA 3VP4A 4GLQA 4CQHA 3VP0A 4Z1WA 4GZBA 5CTNA 3DAVA 4IJGA 3UMEA 1GCEA 4WZ4A 4IVKA 2H0YA 5J4EA 1YLPA 2W1RA 2O99A 3NHQA 3PBQA 1E3UA 2PR6A 4R4SA 1L0GA 3UPPA 4QB8A 2O9CA 3C4PA 4JF5A 3UPOA 1BYWA 1O07A 1ES5A 1CI8A 4YNRA 3N8RA 4BBVA 3RXXA 2ZQCA 5E2HA 3KYQA 2DCFA 2V1BA 2JN7A 1H0MA 2J3WA 5FAPA 4Y5FA 3T1RA 2K7SA 2ZJ9A 2V9AA 1K56A 4BENA 2XA7S 2ACGA 5IS1A 1XP4A 5FI6A 1TS8A 5F68A 3CPTA 3IXDA 5KZHA 4WMCA 1K0KA 4JGOA 4I3JA 3IF6B 3UNWA 3C2WA 4OQGA 5F82A 4ETXA 4MMNA 4E3MA 3IS2A 3RTYA 4FD8A 3N7WA 4PKYG 3IXHA 3QP8A 1SHVA 2JE5A 4P0MA 2LB9A 1NXYA 4NXBA 5KSCA 2Q9NA 4F3LB 4R3BA 2HZ5A 1MY8A 3Q1FA 5DFYA 1GA9A 4BL2A 4D60A 5CHUA 4QWOA 4BMWA 3KSIA 4PHTA 4X1MA 3U4LP 3G6OA 3PHYA 2W3FA 2B18A 1F2KA 4KENB 2Y2GA 5IT5A 3K2NA 1YM1A 4HH3A 2J3TC 4WELA 5K5BA 4GHIB 1K6RA 4GD8A 3ITBA 4KZBA 2PBYA 4IBRA 4NXGA 1TS0A 5CTMA 5CERA 3PBNA 5FAOA 4X69A 2X71A 3ZYTA 1G6AA 1ALQA 1LHYA 5DJTA 5FATA
chains in the Genus database with same CATH topology
4RYEA 1W7FA 3S4XA 1NRFA 2Y91A 1QMFA 4BD1A 1YLZA 4PMAA 2R9XA 3HLGA 1DJCA 1Y54A 5EOEA 4Q8IA 2Z2MB 1FCNA 1ES2A 2JBFA 2HDSA 3Q7VB 1XGIA 4PM6A 1QMEA 2QMIA 5AQAA 3BM6A 1K55A 1KE4A 1PI5A 3OPRA 5HARA 2XF3A 5FQ9A 1PW1A 5AQ9A 2B5RA 4OOLA 3IF5A 5EVID 2ZD8A 5I94A 3IXBA 4KZ9A 3SOIA 4LENA 1Z6FA 1KE3A 3A3EA 4E3NA 1ZG6A 4PM9A 4BJPA 3FYZA 1W8YA 5GLDA 2XFSA 3PBRA 2UWXA 4ZJ3A 2HDQA 4ZJ1A 2P74A 4DE0A 4E6XA 3IHBA 4MEZA 1FSYA 4OQHA 3NI9A 1XA7A 1M40A 2R9WA 2Y2KA 3SH9A 4R3JA 2IWBA 1FSWA 3V39A 2ZC7A 4U0XA 2OLVA 1VQQA 3HLBA 3RJUA 4P87A 1IELA 2BLSA 2Y4AA 3C7VA 4S2IA 3E2KA 1RGZA 1VM1A 3M2JA 1KGGA 1PZOA 3CZDA 5E43A 2EX9A 3A3DA 3Q7ZA 3QNBA 2XD5A 3DWKA 4KZ5A 1BLPA 1IKGA 1KGFA 1Q2QA 1IKIA 3CMZA 4JXGA 5M18A 1C3BA 4KZ7A 4RA7A 2ZLYA 3NIAA 3HUMA 4MBFA 3O3VA 3PAEA 3NC8A 5GLAA 5E2FA 5AQ7A 5D3OA 1CK3A 3N6IA 5DF8A 3HLFA 4ZAMA 1TDLA 1BLCA 5FQQA 3VMAA 5U47A 3IQAA 1SKFA 4K91A 5CGWA 3VP3A 1KGEA 3M6BA 5G18A 3MXSA 2RL3A 4EWFA 1H5XA 3ZHHA 5DF7A 3OPPA 3P98A 4OP8A 4WYYA 5CHMA 5AQBA 2Y2PA 4WM9A 5DTKA 2WADA 5EVIB 1K4EA 1JTGA 3FZCA 1BLSA 1NY0A 1PIOA 4CPKA 5EUAA 4LCMA 3WS5A 1PWGA 4JF4A 5FAQA 4JLFA 2E8IA 4E3LA 1LL9A 1TVFA 4LV1A 4OONA 4BQMA 2ZM8A 4JXWA 4K0WA 4OLDA 1DJAA 2WGWA 2WYXA 4UAAA 1EI5A 1ES4A 5FQKA 4QY5A 5FI7A 3V5MA 5CEBA 5HAPA 1YLYA 3VSLA 4Y0TA 3QHYA 1I2SA 4K0XA 3BFCA 2EX8A 1JVJA 3WRTA 4B4ZA 3GVBA 1GHMA 1JTDA 4WBGA 3UPNA 3Q82A 3A3IA 4HBTA 2ZC3B 3UE3A 2XK1A 2HDRA 1HD8A 4GKUA 3UDXA 1ESUA 3AGFA 2FFFB 4Y0OA 1E4DA 1FCOA 2WAEA 4A5RA 1ZG4A 4E3OA 3G2YA 4OLGA 4OVDA 4S2OA 2V2FF 1YLTA 3IWQA 4GB7A 5E2EA 3TSGA 3HLDA 2JCHA 1BULA 3V3SA 3I7JA 4H8RA 5CHJA 3ZG7B 1ZC2A 3IXGA 5IHVA 3UE0A 1WYBA 4EUZA 3UO9A 3EQVA 5JYOA 1ESIA 3ISGA 3JYIA 3G34A 2G2UA 3MFDA 4OPYA 1Q2PA 1SCWA 4ZBEA 2H0TA 3NDEA 3MKFA 1IYPA 4DKIA 3HUNA 2HP6A 1W79A 4GNUA 4OP5A 1MWTA 2XH9A 3GR2A 3NY4A 2XDMA 3GMWA 1IYOA 1BSGA 3NBLA 3ZG0A 4S2MA 5A93A 1ES3A 2WZZA 2XEPA 2Q9MA 3LO7A 5GHXA 5A92A 4KZ8A 1JWVA 1XGJA 2J9PA 4IBXA 3FV7A 1YQSA 5FQJA 5EECA 2Z2LB 2WKHA 1NJ4A 4RX3A 2ZQAA 4U0TA 1AXBA 2Y2IA 1RCJA 2QZ6A 2I72A 4QY6A 1K54A 3HBRA 2G2WA 3WS4A 1K25A 3CJMA 2HP5A 1OMEA 2WGVA 2Y2HA 3GV9A 4X68A 2C5WB 4KZ4A 3PBSA 1W8QA 2WAFA 1BLHA 4MNRA 2HP9A 4R4RA 5GL9A 1FQGA 4GDBA 5EVIC 1PZPA 4S2PA 4UA9A 5HX9A 1U60A 4ZDXA 1XX2A 5L2FA 2X02A 4XXRA 1N4OA 3VFHA 2Y2OA 1XXMA 3BFDA 3OCLA 4WEJA 3GRJA 1KVLA 4EV4A 5HW3A 4S2NC 4E6WA 1SDNA 1FCMA 1DY6A 2WUQA 2Y2LA 4EBPA 1BT5A 3FKWA 4GOGA 4OQ0A 4GN2A 5FQIA 3Q7VA 1BUEA 1K4FA 2ZQ8A 1IEMA 1K38A 4R1GA 3WS0A 5FASA 3DWZA 5F1FA 3WS2A 3ZG8B 2EXBA 1G68A 3LY4A 3UDFA 4N9KA 1BZAA 1XPBA 3PBOA 4KQRA 2J7VA 5HAQA 2EX2A 5HFOA 2V20A 1CEFA 1KE0A 4N92A 4X55A 3ZCZA 1L0FA 4KG2A 1LLBA 1LI0A 4R0QA 4S2JA 3G2ZA 4UA6A 3HLEA 3ZG5A 3DW0A 1PI4A 1GA0A 4JKTA 1CEGA 5GHZA 4RVAA 4C6YA 3MBZA 3IWIA 3LY3A 4KQOA 3UDIA 1RP5A 3HREA 3WWXA 3PTEA 2V1ZA 4WZ5A 4UHUA 2XLNA 2OV5A 2WGWB 3G35A 3AGDA 1K6SA 1L0DA 2WKIA 3IF6A 4DDSA 3VP1A 2Y2NA 1BTLA 3O86A 4MLLA 4NETA 5F1GA 4FH2A 3IHAA 4E3JA 1NZUA 2EFUA 4N1XA 5KSHA 4R23A 5EVLA 4JF6A 4OQIA 4C75A 3IH9A 3FKVA 4EBLA 3N8LA 3ZNYA 3UE1A 1SDEA 1K54C 1XKZA 1K55C 2ZC5B 2XR0A 4KZ6A 4MBHA 4B88A 4JXSA 3UY6A 4Z9QA 1RGYA 3LEZA 1H8YA 4FH4A 3Q81A 4PM7A 1ONHA 3C7UA 4KZ3A 4Y0UA 4ZJ2A 5FSRA 5TFQA 4EBNA 4JXVA 5DTSA 3WS1A 5FA7A 4FCFA 1S6RA 2ZQDA 3VP2A 1EWZA 1PWDA 1KDSA 3RXWA 4IVIA 4BD0A 2XD1A 4EQIA 1WYCA 4X53A 1ERQA 3TOIA 3VOZA 4KG5A 3E2LA 1DJBA 3FWLA 3IH8A 4U3TA 2VGJA 3SS5A 1MXOA 1PYYA 1YMXA 1HTZA 2Y2JA 3Q07A 2P9VA 2QPNA 4KQQA 3HLCA 1FR6A 3HLWA 2VGKA 1IYQA 2Y55A 4QHCA 4WEKA 4PM5A 2OLUA 4N9LA 4OPRA 3SH8A 4DE3A 3W4PA 2FFYA 4P85A 3S1YA 3V50A 2EFXA 1L0EA 5FQMA 3AGEA 1WE4A 3SS4A 4D2OA 3HVFA 2GDNA 1JWZA 3BFGA 2HDUA 3OZHA 5A90A 4JPMA 4PPRA 3BFFA 1ERMA 3O87A 3MZEA 3OPHA 3DTMA 3MXRA 4XUXA 5DVAA 3SH7A 4YFMA 3BLMA 3VP4A 3G31A 1XA1A 3IT9A 4LCLA 3V3RA 1LL5A 3VP0A 3MKEA 5GHYA 4FSFA 3N8SA 2Y59A 3ZDJA 1KVMA 4GZBA 2HPBA 1GHIA 1J9MA 4BL3A 5KMWA 5CTNA 4QJGA 5DTTA 4L0LA 4DDYA 4N1HA 4RX2A 4WZ5C 4OPQA 3PAGA 1GCEA 3HL9A 4DE1A 5E2GA 4WZ4A 1PW8A 2ZC4B 5DF9A 2A3UA 4IVKA 4F94A 2H0YA 5CEDA 1YLPA 2IWCA 2WK0A 3PBQA 1E3UA 4R4SA 1L0GA 3UPPA 2H10A 4QB8A 4OOYA 3C4PA 4JF5A 3UPOA 1K57A 3MZFA 3BRMA 4NK3A 1W5DA 3ZGAB 1O07A 5EPHA 1ES5A 1CI8A 3ZVTA 2A49A 3N8RA 4JBFA 3RXXA 3VFFA 2ZQCA 5E2HA 1MKIA 4HEFA 2EX6A 2DCFA 1ONGA 1PWCA 5CGSA 5FAPA 5EOOA 1HZOA 2J9OA 4KG6A 2ZJ9A 4UA7A 1K56A 4GD6A 4BENA 1I5QA 2ZQ9A 2C6WB 5JYPA 3ZVWA 3NDGA 1XP4A 4DXBA 4XUZA 4BLMA 1I2WA 5FI6A 4IEDA 1HVBA 3QNCA 1S0WA 1YLJA 3A3FA 3VSKA 3IXDA 5KZHA 4WMCA 1O7EA 3NCKA 1TDGA 3MZDA 5HL1A 4ZTKA 4QU3A 3GQZA 2IWDA 1IYSA 3G32A 4KZAA 4X56A 3IF6B 4O7DA 2ZQ7A 3UNWA 1CI9A 1NYYA 3GSGA 4OQGA 5F82A 4GDNA 2ZM0A 3GTCA 5HAIA 2Y2MA 4E3MA 4MBKA 3BECA 4DXCA 4DF6A 1FOFA 5M19A 1GHPA 4FD8A 3N7WA 3IXHA 3UN7A 2WGIA 2EXAA 3G30A 3ZNTA 1SHVA 1MPLA 2CC1A 2JE5A 3BEBA 3W4OA 3N4IA 4OPZA 5GLCA 4DRTA 4B4XA 5EE8A 3HUOA 1N9BA 4P0MA 1E3UD 1NXYA 4LV2A 5KSCA 3CG5A 3LCEA 2Q9NA 2ZC6B 2PU2A 3BYDA 3C5AA 4R3BA 5CXWA 4S2KA 3OPLA 3C4OA 5TGFA 5BOHA 4C3QA 2RCXA 1MY8A 2ZM2A 3Q1FA 1K57C 2P9VB 3PBTA 3TG9A 1GA9A 4Y7PA 4YINA 5CECA 4HBUA 5TR7A 4BL2A 1L2SA 3W8KA 2XQZA 4ID4A 5J8XA 4LV0A 4QD4A 5CHUA 3A3JA 5EVIA 2X01A 5FI2A 4CJNA 3IWOA 4M3KA 1K56D 2WKEA 3B3XA 4OKPA 3D4FA 4E3IA 3OC2A 1NYMA 1TEMA 1ZKJA 2PU4A 2BG1A 3M2KA 4PM8A 1FR1A 1MWUA 1KDWA 1M6KA 3ZFZA 4S2NA 2Y2QA 5CGXA 4KENB 3ZG9B 2Y2GA 1YM1A 3OCNA 1YMSA 2OSUA 5CRFA 4E3KA 2DNSA 2H5SA 4WMCD 3P09A 2J8YA 4HESA 4WELA 1NZOA 4DE2A 1E25A 3SS3A 4S2LA 1YLWA 4P6BA 1JWPA 4OH0A 2XFTA 1K6RA 4GD8A 1MBLA 3M6HA 3BLSA 5A91A 3VOYA 3ITBA 3W4QA 3WRZA 1YT4A 4KZBA 2JC7A 2PBYA 3S22A 1EROA 4IBRA 1MWRA 1MWSA 4OOMA 5CTMA 3EQUA 1LI9A 5CERA 3PBNA 5FAOA 3O88A 3IF6C 5M1AA 4X69A 2X71A 4X6TA 5GLBA 3BFEA 4LV3A 2DRWA 5F83A 1H8ZA 2ZMAA 5FDHA 1G6AA 3ITAA 1ALQA 1LHYA 3G4PA 5FATA 2WZXA 2XGNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RYE A;  1W7F A;  3S4X A;  1NRF A;  2Y91 A;  1QMF A;  4BD1 A;  1YLZ A;  4PMA A;  2R9X A;  3HLG A;  1DJC A;  1Y54 A;  5EOE A;  4Q8I A;  2Z2M B;  1FCN A;  1ES2 A;  2JBF A;  2HDS A;  3Q7V B;  1XGI A;  4PM6 A;  1QME A;  2QMI A;  5AQA A;  3BM6 A;  1K55 A;  1KE4 A;  1PI5 A;  3OPR A;  5HAR A;  2XF3 A;  5FQ9 A;  1PW1 A;  5AQ9 A;  2B5R A;  4OOL A;  3IF5 A;  5EVI D;  2ZD8 A;  5I94 A;  3IXB A;  4KZ9 A;  3SOI A;  4LEN A;  1Z6F A;  1KE3 A;  3A3E A;  4E3N A;  1ZG6 A;  4PM9 A;  4BJP A;  3FYZ A;  1W8Y A;  5GLD A;  2XFS A;  3PBR A;  2UWX A;  4ZJ3 A;  2HDQ A;  4ZJ1 A;  2P74 A;  4DE0 A;  4E6X A;  3IHB A;  4MEZ A;  1FSY A;  4OQH A;  3NI9 A;  1XA7 A;  1M40 A;  2R9W A;  2Y2K A;  3SH9 A;  4R3J A;  2IWB A;  1FSW A;  3V39 A;  2ZC7 A;  4U0X A;  2OLV A;  1VQQ A;  3HLB A;  3RJU A;  4P87 A;  1IEL A;  2BLS A;  2Y4A A;  3C7V A;  4S2I A;  3E2K A;  1RGZ A;  1VM1 A;  3M2J A;  1KGG A;  1PZO A;  3CZD A;  5E43 A;  2EX9 A;  3A3D A;  3Q7Z A;  3QNB A;  2XD5 A;  3DWK A;  4KZ5 A;  1BLP A;  1IKG A;  1KGF A;  1Q2Q A;  1IKI A;  3CMZ A;  4JXG A;  5M18 A;  1C3B A;  4KZ7 A;  4RA7 A;  2ZLY A;  3NIA A;  3HUM A;  4MBF A;  3O3V A;  3PAE A;  3NC8 A;  5GLA A;  5E2F A;  5AQ7 A;  5D3O A;  1CK3 A;  3N6I A;  5DF8 A;  3HLF A;  4ZAM A;  1TDL A;  1BLC A;  5FQQ A;  3VMA A;  5U47 A;  3IQA A;  1SKF A;  4K91 A;  5CGW A;  3VP3 A;  1KGE A;  3M6B A;  5G18 A;  3MXS A;  2RL3 A;  4EWF A;  1H5X A;  3ZHH A;  5DF7 A;  3OPP A;  3P98 A;  4OP8 A;  4WYY A;  5CHM A;  5AQB A;  2Y2P A;  4WM9 A;  5DTK A;  2WAD A;  5EVI B;  1K4E A;  1JTG A;  3FZC A;  1BLS A;  1NY0 A;  1PIO A;  4CPK A;  5EUA A;  4LCM A;  3WS5 A;  1PWG A;  4JF4 A;  5FAQ A;  4JLF A;  2E8I A;  4E3L A;  1LL9 A;  1TVF A;  4LV1 A;  4OON A;  4BQM A;  2ZM8 A;  4JXW A;  4K0W A;  4OLD A;  1DJA A;  2WGW A;  2WYX A;  4UAA A;  1EI5 A;  1ES4 A;  5FQK A;  4QY5 A;  5FI7 A;  3V5M A;  5CEB A;  5HAP A;  1YLY A;  3VSL A;  4Y0T A;  3QHY A;  1I2S A;  4K0X A;  3BFC A;  2EX8 A;  1JVJ A;  3WRT A;  4B4Z A;  3GVB A;  1GHM A;  1JTD A;  4WBG A;  3UPN A;  3Q82 A;  3A3I A;  4HBT A;  2ZC3 B;  3UE3 A;  2XK1 A;  2HDR A;  1HD8 A;  4GKU A;  3UDX A;  1ESU A;  3AGF A;  2FFF B;  4Y0O A;  1E4D A;  1FCO A;  2WAE A;  4A5R A;  1ZG4 A;  4E3O A;  3G2Y A;  4OLG A;  4OVD A;  4S2O A;  2V2F F;  1YLT A;  3IWQ A;  4GB7 A;  5E2E A;  3TSG A;  3HLD A;  2JCH A;  1BUL A;  3V3S A;  3I7J A;  4H8R A;  5CHJ A;  3ZG7 B;  1ZC2 A;  3IXG A;  5IHV A;  3UE0 A;  1WYB A;  4EUZ A;  3UO9 A;  3EQV A;  5JYO A;  1ESI A;  3ISG A;  3JYI A;  3G34 A;  2G2U A;  3MFD A;  4OPY A;  1Q2P A;  1SCW A;  4ZBE A;  2H0T A;  3NDE A;  3MKF A;  1IYP A;  4DKI A;  3HUN A;  2HP6 A;  1W79 A;  4GNU A;  4OP5 A;  1MWT A;  2XH9 A;  3GR2 A;  3NY4 A;  2XDM A;  3GMW A;  1IYO A;  1BSG A;  3NBL A;  3ZG0 A;  4S2M A;  5A93 A;  1ES3 A;  2WZZ A;  2XEP A;  2Q9M A;  3LO7 A;  5GHX A;  5A92 A;  4KZ8 A;  1JWV A;  1XGJ A;  2J9P A;  4IBX A;  3FV7 A;  1YQS A;  5FQJ A;  5EEC A;  2Z2L B;  2WKH A;  1NJ4 A;  4RX3 A;  2ZQA A;  4U0T A;  1AXB A;  2Y2I A;  1RCJ A;  2QZ6 A;  2I72 A;  4QY6 A;  1K54 A;  3HBR A;  2G2W A;  3WS4 A;  1K25 A;  3CJM A;  2HP5 A;  1OME A;  2WGV A;  2Y2H A;  3GV9 A;  4X68 A;  2C5W B;  4KZ4 A;  3PBS A;  1W8Q A;  2WAF A;  1BLH A;  4MNR A;  2HP9 A;  4R4R A;  5GL9 A;  1FQG A;  4GDB A;  5EVI C;  1PZP A;  4S2P A;  4UA9 A;  5HX9 A;  1U60 A;  4ZDX A;  1XX2 A;  5L2F A;  2X02 A;  4XXR A;  1N4O A;  3VFH A;  2Y2O A;  1XXM A;  3BFD A;  3OCL A;  4WEJ A;  3GRJ A;  1KVL A;  4EV4 A;  5HW3 A;  4S2N C;  4E6W A;  1SDN A;  1FCM A;  1DY6 A;  2WUQ A;  2Y2L A;  4EBP A;  1BT5 A;  3FKW A;  4GOG A;  4OQ0 A;  4GN2 A;  5FQI A;  3Q7V A;  1BUE A;  1K4F A;  2ZQ8 A;  1IEM A;  1K38 A;  4R1G A;  3WS0 A;  5FAS A;  3DWZ A;  5F1F A;  3WS2 A;  3ZG8 B;  2EXB A;  1G68 A;  3LY4 A;  3UDF A;  4N9K A;  1BZA A;  1XPB A;  3PBO A;  4KQR A;  2J7V A;  5HAQ A;  2EX2 A;  5HFO A;  2V20 A;  1CEF A;  1KE0 A;  4N92 A;  4X55 A;  3ZCZ A;  1L0F A;  4KG2 A;  1LLB A;  1LI0 A;  4R0Q A;  4S2J A;  3G2Z A;  4UA6 A;  3HLE A;  3ZG5 A;  3DW0 A;  1PI4 A;  1GA0 A;  4JKT A;  1CEG A;  5GHZ A;  4RVA A;  4C6Y A;  3MBZ A;  3IWI A;  3LY3 A;  4KQO A;  3UDI A;  1RP5 A;  3HRE A;  3WWX A;  3PTE A;  2V1Z A;  4WZ5 A;  4UHU A;  2XLN A;  2OV5 A;  2WGW B;  3G35 A;  3AGD A;  1K6S A;  1L0D A;  2WKI A;  3IF6 A;  4DDS A;  3VP1 A;  2Y2N A;  1BTL A;  3O86 A;  4MLL A;  4NET A;  5F1G A;  4FH2 A;  3IHA A;  4E3J A;  1NZU A;  2EFU A;  4N1X A;  5KSH A;  4R23 A;  5EVL A;  4JF6 A;  4OQI A;  4C75 A;  3IH9 A;  3FKV A;  4EBL A;  3N8L A;  3ZNY A;  3UE1 A;  1SDE A;  1K54 C;  1XKZ A;  1K55 C;  2ZC5 B;  2XR0 A;  4KZ6 A;  4MBH A;  4B88 A;  4JXS A;  3UY6 A;  4Z9Q A;  1RGY A;  3LEZ A;  1H8Y A;  4FH4 A;  3Q81 A;  4PM7 A;  1ONH A;  3C7U A;  4KZ3 A;  4Y0U A;  4ZJ2 A;  5FSR A;  5TFQ A;  4EBN A;  4JXV A;  5DTS A;  3WS1 A;  5FA7 A;  4FCF A;  1S6R A;  2ZQD A;  3VP2 A;  1EWZ A;  1PWD A;  1KDS A;  3RXW A;  4IVI A;  4BD0 A;  2XD1 A;  4EQI A;  1WYC A;  4X53 A;  1ERQ A;  3TOI A;  3VOZ A;  4KG5 A;  3E2L A;  1DJB A;  3FWL A;  3IH8 A;  4U3T A;  2VGJ A;  3SS5 A;  1MXO A;  1PYY A;  1YMX A;  1HTZ A;  2Y2J A;  3Q07 A;  2P9V A;  2QPN A;  4KQQ A;  3HLC A;  1FR6 A;  3HLW A;  2VGK A;  1IYQ A;  2Y55 A;  4QHC A;  4WEK A;  4PM5 A;  2OLU A;  4N9L A;  4OPR A;  3SH8 A;  4DE3 A;  3W4P A;  2FFY A;  4P85 A;  3S1Y A;  3V50 A;  2EFX A;  1L0E A;  5FQM A;  3AGE A;  1WE4 A;  3SS4 A;  4D2O A;  3HVF A;  2GDN A;  1JWZ A;  3BFG A;  2HDU A;  3OZH A;  5A90 A;  4JPM A;  4PPR A;  3BFF A;  1ERM A;  3O87 A;  3MZE A;  3OPH A;  3DTM A;  3MXR A;  4XUX A;  5DVA A;  3SH7 A;  4YFM A;  3BLM A;  3VP4 A;  3G31 A;  1XA1 A;  3IT9 A;  4LCL A;  3V3R A;  1LL5 A;  3VP0 A;  3MKE A;  5GHY A;  4FSF A;  3N8S A;  2Y59 A;  3ZDJ A;  1KVM A;  4GZB A;  2HPB A;  1GHI A;  1J9M A;  4BL3 A;  5KMW A;  5CTN A;  4QJG A;  5DTT A;  4L0L A;  4DDY A;  4N1H A;  4RX2 A;  4WZ5 C;  4OPQ A;  3PAG A;  1GCE A;  3HL9 A;  4DE1 A;  5E2G A;  4WZ4 A;  1PW8 A;  2ZC4 B;  5DF9 A;  2A3U A;  4IVK A;  4F94 A;  2H0Y A;  5CED A;  1YLP A;  2IWC A;  2WK0 A;  3PBQ A;  1E3U A;  4R4S A;  1L0G A;  3UPP A;  2H10 A;  4QB8 A;  4OOY A;  3C4P A;  4JF5 A;  3UPO A;  1K57 A;  3MZF A;  3BRM A;  4NK3 A;  1W5D A;  3ZGA B;  1O07 A;  5EPH A;  1ES5 A;  1CI8 A;  3ZVT A;  2A49 A;  3N8R A;  4JBF A;  3RXX A;  3VFF A;  2ZQC A;  5E2H A;  1MKI A;  4HEF A;  2EX6 A;  2DCF A;  1ONG A;  1PWC A;  5CGS A;  5FAP A;  5EOO A;  1HZO A;  2J9O A;  4KG6 A;  2ZJ9 A;  4UA7 A;  1K56 A;  4GD6 A;  4BEN A;  1I5Q A;  2ZQ9 A;  2C6W B;  5JYP A;  3ZVW A;  3NDG A;  1XP4 A;  4DXB A;  4XUZ A;  4BLM A;  1I2W A;  5FI6 A;  4IED A;  1HVB A;  3QNC A;  1S0W A;  1YLJ A;  3A3F A;  3VSK A;  3IXD A;  5KZH A;  4WMC A;  1O7E A;  3NCK A;  1TDG A;  3MZD A;  5HL1 A;  4ZTK A;  4QU3 A;  3GQZ A;  2IWD A;  1IYS A;  3G32 A;  4KZA A;  4X56 A;  3IF6 B;  4O7D A;  2ZQ7 A;  3UNW A;  1CI9 A;  1NYY A;  3GSG A;  4OQG A;  5F82 A;  4GDN A;  2ZM0 A;  3GTC A;  5HAI A;  2Y2M A;  4E3M A;  4MBK A;  3BEC A;  4DXC A;  4DF6 A;  1FOF A;  5M19 A;  1GHP A;  4FD8 A;  3N7W A;  3IXH A;  3UN7 A;  2WGI A;  2EXA A;  3G30 A;  3ZNT A;  1SHV A;  1MPL A;  2CC1 A;  2JE5 A;  3BEB A;  3W4O A;  3N4I A;  4OPZ A;  5GLC A;  4DRT A;  4B4X A;  5EE8 A;  3HUO A;  1N9B A;  4P0M A;  1E3U D;  1NXY A;  4LV2 A;  5KSC A;  3CG5 A;  3LCE A;  2Q9N A;  2ZC6 B;  2PU2 A;  3BYD A;  3C5A A;  4R3B A;  5CXW A;  4S2K A;  3OPL A;  3C4O A;  5TGF A;  5BOH A;  4C3Q A;  2RCX A;  1MY8 A;  2ZM2 A;  3Q1F A;  1K57 C;  2P9V B;  3PBT A;  3TG9 A;  1GA9 A;  4Y7P A;  4YIN A;  5CEC A;  4HBU A;  5TR7 A;  4BL2 A;  1L2S A;  3W8K A;  2XQZ A;  4ID4 A;  5J8X A;  4LV0 A;  4QD4 A;  5CHU A;  3A3J A;  5EVI A;  2X01 A;  5FI2 A;  4CJN A;  3IWO A;  4M3K A;  1K56 D;  2WKE A;  3B3X A;  4OKP A;  3D4F A;  4E3I A;  3OC2 A;  1NYM A;  1TEM A;  1ZKJ A;  2PU4 A;  2BG1 A;  3M2K A;  4PM8 A;  1FR1 A;  1MWU A;  1KDW A;  1M6K A;  3ZFZ A;  4S2N A;  2Y2Q A;  5CGX A;  4KEN B;  3ZG9 B;  2Y2G A;  1YM1 A;  3OCN A;  1YMS A;  2OSU A;  5CRF A;  4E3K A;  2DNS A;  2H5S A;  4WMC D;  3P09 A;  2J8Y A;  4HES A;  4WEL A;  1NZO A;  4DE2 A;  1E25 A;  3SS3 A;  4S2L A;  1YLW A;  4P6B A;  1JWP A;  4OH0 A;  2XFT A;  1K6R A;  4GD8 A;  1MBL A;  3M6H A;  3BLS A;  5A91 A;  3VOY A;  3ITB A;  3W4Q A;  3WRZ A;  1YT4 A;  4KZB A;  2JC7 A;  2PBY A;  3S22 A;  1ERO A;  4IBR A;  1MWR A;  1MWS A;  4OOM A;  5CTM A;  3EQU A;  1LI9 A;  5CER A;  3PBN A;  5FAO A;  3O88 A;  3IF6 C;  5M1A A;  4X69 A;  2X71 A;  4X6T A;  5GLB A;  3BFE A;  4LV3 A;  2DRW A;  5F83 A;  1H8Z A;  2ZMA A;  5FDH A;  1G6A A;  3ITA A;  1ALQ A;  1LHY A;  3G4P A;  5FAT A;  2WZX A;  2XGN A; 
#chains in the Genus database with same CATH topology
 1W7F A;  3S4X A;  1NRF A;  2Y91 A;  4HH2 A;  1YLZ A;  1FCN A;  5HD3 A;  1XGI A;  3BM6 A;  1P97 A;  2Z6D A;  3F1P B;  5AQ9 A;  2ZD8 A;  1YPR A;  1NLZ A;  1Z6F A;  3FYZ A;  2D02 A;  1LL8 A;  5GLD A;  4DE0 A;  2UWX A;  2HDQ A;  4OQH A;  1XA7 A;  2R9W A;  3V39 A;  4R3J A;  5TBM B;  2IWB A;  4U0X A;  2OLV A;  4P87 A;  1PZO A;  4LFU A;  5E43 A;  3Q7Z A;  4KZ5 A;  3DWK A;  1IKI A;  4JXG A;  2Y8H A;  3BY9 A;  4EEP A;  4MBF A;  3O3V A;  1ACF A;  5E2F A;  1CK3 A;  5DF8 A;  1OT9 A;  1DP9 A;  1VET B;  3ZHH A;  4R38 A;  3DTI A;  5AQB A;  2WAD A;  5EVI B;  4CPK A;  3WS5 A;  4JLF A;  1LL9 A;  4LV1 A;  4BQM A;  3TW8 A;  5LBR A;  4CLC D;  5HDS A;  1KOU A;  4UAA A;  3V5M A;  1IFQ A;  2QWS A;  4Y0T A;  5HDC A;  2EX8 A;  4B4Z A;  4R70 A;  1JTD A;  1T1A A;  5DKK A;  2B02 A;  1N9L A;  2FFF B;  3KX0 X;  5FL3 A;  4MN7 A;  4F3L A;  4E3O A;  1BUL A;  3I7J A;  3IXG A;  4EUZ A;  4RQ9 A;  3UO9 A;  3JYI A;  1V9Z A;  1PNE A;  2G2U A;  2VJW A;  3MFD A;  1Q2P A;  3H7W A;  3LIB A;  5HPF A;  3HUN A;  3LYX A;  1MWT A;  3GR2 A;  3NY4 A;  4Y15 A;  3GMW A;  1IYO A;  1PFL A;  4HJ3 A;  3ZG0 A;  2WZZ A;  3A0R A;  1OTD A;  2QJ5 A;  4WN5 A;  5EEC A;  2Z2L B;  3LEQ A;  1NJ4 A;  1RCJ A;  2QZ6 A;  5F6A A;  3HBR A;  3UB6 A;  4WLA A;  1OME A;  2WGV A;  2Y2H A;  1H3Q A;  3GV9 A;  3PBS A;  3T4O A;  1BLH A;  4R4R A;  2HP9 A;  2VKS A;  5EM1 A;  1VHM A;  4LGW A;  4ZDX A;  1XX2 A;  5L2F A;  4XXR A;  3T4S A;  2Y2O A;  2V8C A;  3LR4 A;  5HW3 A;  4S2N C;  4E6W A;  2WUQ A;  1BT5 A;  2ZQ8 A;  5MC7 A;  3WS0 A;  3DWZ A;  1G68 A;  2OOL A;  1UWN X;  2Y79 A;  2PYP A;  4X1L A;  2EX2 A;  3A0S A;  3LGO A;  4N92 A;  3ZCZ A;  5F69 A;  1L0F A;  1DP6 A;  4HNB A;  2D01 A;  3IBJ A;  3DW0 A;  4JKT A;  1F5M A;  2W27 A;  5TBM A;  1RP5 A;  2PDR A;  2R78 A;  3RFB A;  3D3O A;  4DDS A;  3O86 A;  4NET A;  2W3D A;  4FH2 A;  4FOF A;  3CIT A;  5EVL A;  4JF6 A;  3FKV A;  4EBL A;  3UE1 A;  4Z9Q A;  5HDD A;  3Q81 A;  1ONH A;  3C7U A;  4KZ3 A;  2VX8 A;  4Y0U A;  3RH8 B;  1VET A;  1LSV A;  3CWF A;  3VP2 A;  4BD0 A;  2XD1 A;  3TOI A;  4KG5 A;  1DJB A;  2Y2J A;  2P9V A;  3P7N A;  1IYQ A;  3BW6 A;  2AVX A;  3V50 A;  2EFX A;  5FQM A;  1WE4 A;  3LFV A;  1JWZ A;  3O5Y A;  3OZH A;  1OT6 A;  3P01 A;  4R6L A;  3OPH A;  4R3A A;  3BLM A;  3G31 A;  3MKE A;  5GHY A;  3LR0 A;  2Y59 A;  2JKF A;  2P08 A;  2M7V A;  4RX2 A;  4DE1 A;  2ZC4 B;  3FPW A;  5CED A;  2WK0 A;  2ZBB A;  2H10 A;  5TJJ A;  1FIL A;  1K57 A;  4NK3 A;  3ZGA B;  4G3V A;  5EPH A;  4QPR A;  2V8F A;  4ZRR A;  4HEF A;  1ONG A;  5EVE A;  1HZO A;  3OOV A;  2A24 A;  3OBF A;  4IUK A;  2ZOH A;  3JVV A;  3ZVW A;  1SZV A;  4DXB A;  3LIC A;  4BLM A;  2KX6 A;  2OWJ A;  1HVB A;  3QNC A;  2W1T B;  3MF0 A;  5AVF A;  1O7E A;  4MDZ A;  3NCK A;  2V0W A;  3L9K A;  4LLO B;  4ZTK A;  4QU3 A;  3GQZ A;  1IYS A;  3S7O A;  4X56 A;  1NYY A;  2L4R A;  2GZA A;  5HAI A;  2ZM0 A;  1Y4O A;  3BEC A;  4DXC A;  2EA9 A;  4DF6 A;  1GHP A;  3G30 A;  2EXA A;  2VGL S;  4MN6 A;  3R7W B;  3NOP C;  3EGX C;  2Q0O A;  3CAX A;  4OPZ A;  5GLC A;  4DRT A;  4B4X A;  2NUP C;  1EW0 A;  5EE8 A;  3BWL A;  1G5U A;  1E3U D;  3ULF A;  1OJ5 A;  3CG5 A;  5CXW A;  2HF6 A;  4S2K A;  2JKR M;  5TGF A;  2RCX A;  1VEU B;  2NUT C;  4JGR A;  3TG9 A;  4Y7P A;  1J3W A;  5TR7 A;  3GEC A;  2PR5 A;  3W8K A;  3CI6 A;  1NLY A;  2XQZ A;  4HQA A;  3DBA A;  4ID4 A;  2VEA A;  3A3J A;  3QP2 A;  5C5K A;  2X01 A;  4M4X A;  1K56 D;  3B3X A;  2WKQ A;  3D4F A;  1NYM A;  1TEM A;  2BG1 A;  3CHW P;  3M2K A;  1MWU A;  1KDW A;  1SKO A;  4S2N A;  3OLO A;  2WKR A;  1YMS A;  2OSU A;  2DNS A;  4WMC D;  2J8Y A;  4HES A;  1P9W A;  3MQ0 A;  4XT2 A;  1NZO A;  1E25 A;  1YLW A;  4P6B A;  5DJU A;  1MBL A;  3WRZ A;  3MMH A;  1ERO A;  3KSH A;  1TF1 A;  1CF0 A;  3IF6 C;  4GS9 A;  4X6T A;  5GLB A;  2DRW A;  1H8Z A;  1UGU A;  1ZTU A;  2UV0 E;  3FG8 A;  4BD1 A;  4PMA A;  1CQA A;  4Q8I A;  2Z2M B;  1Z09 A;  2HDS A;  4PM6 A;  1QME A;  1KE4 A;  1N9O A;  1UWP X;  2XF3 A;  5FQ9 A;  1PW1 A;  4GW9 A;  5I94 A;  3SOI A;  1F9I A;  1LSW A;  2K2N A;  4BJP A;  5G4Z A;  3PBR A;  4MEZ A;  1FSY A;  2HJE A;  3KSG A;  3NI9 A;  3HLB A;  3RJU A;  1IEL A;  3UE6 A;  3CZD A;  3A3D A;  3T4J A;  1C3B A;  4RA7 A;  3HUM A;  3PAE A;  5GLA A;  3N6I A;  1TDL A;  3LIF A;  3A0V A;  4ARZ B;  3IQA A;  3VP3 A;  4EES A;  3MXS A;  3V67 A;  2W1T A;  2YKH A;  5DF7 A;  4NG2 A;  4WYY A;  2V0U A;  2Y2P A;  1K4E A;  2GX5 A;  5FAQ A;  2E8I A;  3NOU C;  3F1O B;  1DJA A;  2WGW A;  2WYX A;  5HAP A;  2XA7 M;  3VSL A;  4CLC C;  4K0X A;  1S67 L;  2L0W A;  3BFC A;  1JVJ A;  2EWW A;  3WRT A;  3GVB A;  4H6J B;  2QJ7 A;  3A3I A;  3Q82 A;  3T4Q A;  1DP8 A;  3AGF A;  3G2Y A;  4OLG A;  1YLT A;  3IWQ A;  1N9N A;  3TSG A;  1W63 Q;  1VEU A;  3ZG7 B;  5IHV A;  1WYB A;  3EQV A;  1OJG A;  4UEY A;  3G34 A;  3H82 A;  4Y2F A;  4HP4 A;  1D06 A;  4ME4 A;  4DKI A;  1IYP A;  1W79 A;  2FH5 A;  4I5S A;  3LO7 A;  5A92 A;  2J9P A;  4CLC B;  2PHY A;  2WKH A;  4U0T A;  1AXB A;  2B95 A;  4WL9 A;  1K54 A;  4B93 A;  3QP4 A;  2G2W A;  3WS4 A;  3ICY A;  3CJM A;  1D1J A;  4KZ4 A;  3CUE C;  3EEH A;  4MNR A;  4GDB A;  5EVI C;  4UA9 A;  5HX9 A;  3VOL A;  3VFH A;  3UB9 A;  1XXM A;  4EV4 A;  3HJK A;  1MKM A;  2Y2L A;  1DY6 A;  3FKW A;  2JKT I;  1BUE A;  1IEM A;  3NOT C;  4Q0H A;  3B42 A;  3LY4 A;  4N9K A;  5HAQ A;  3PBO A;  4KQR A;  1CEF A;  4WUJ A;  1KE0 A;  4KG2 A;  4GCZ A;  3UB7 A;  2OAQ 1;  4C6Y A;  3MBZ A;  3IWI A;  1P0Z A;  3UDI A;  1MC0 A;  2OV5 A;  5EFW A;  1L0D A;  3IF6 A;  2QKP A;  1BTL A;  2Y2N A;  5F1G A;  3IHA A;  4E3J A;  5AJG A;  2EFU A;  4C75 A;  3IX8 A;  1SDE A;  1K55 C;  4UQI S;  2J80 A;  3R4K A;  1MZU A;  4EBN A;  5FSR A;  5DTS A;  5FA7 A;  4EUV A;  4FCF A;  1AWI A;  1ERQ A;  3VOZ A;  3MQO A;  4U3T A;  1HTZ A;  1XJ2 A;  3VE3 A;  4EXO A;  5HD5 A;  4OPR A;  4N9L A;  3SH8 A;  2PAV P;  2Z6C A;  5HWW A;  3K3C A;  4IUH A;  3AGE A;  4HI4 A;  4X25 A;  5KIZ A;  2HDU A;  5A90 A;  4PPR A;  5G4Y A;  3BFF A;  4L9G A;  1ERM A;  3DTM A;  1S4S A;  3SH7 A;  4Y3I A;  4LCL A;  1XA1 A;  3IT9 A;  1LL5 A;  4LPZ A;  4NXE A;  3ZDJ A;  1KVM A;  4L9E A;  4BL3 A;  5KMW A;  3VE4 A;  4QJG A;  4L0L A;  4N1H A;  4WZ5 C;  3PAG A;  2MJ6 A;  4GHI A;  3C30 A;  2K31 A;  5DF9 A;  2A3U A;  4F94 A;  4O01 A;  2IWC A;  4Y13 A;  5DFX A;  1OTB A;  4OOY A;  4WF0 A;  3MFX A;  5L10 A;  3TRC A;  2A49 A;  1MKI A;  2EX6 A;  5CGS A;  5EOO A;  3IBR A;  4UA7 A;  4KUK A;  3PYP A;  2C6W B;  5JYP A;  1TD5 A;  3NDG A;  1I2W A;  3F1P A;  3MZD A;  5HL1 A;  2IWD A;  3S7P A;  3G32 A;  4KZA A;  3GSG A;  4GDN A;  2VA0 A;  2P04 A;  3T4T A;  4MBK A;  2IA2 A;  4HP9 A;  3T4L A;  1MPL A;  2CC1 A;  3BEB A;  3W4O A;  3N4I A;  1N9B A;  4LV2 A;  2ZC6 B;  2PU2 A;  3BYD A;  3C5A A;  2HV1 A;  3OPL A;  3C4O A;  5BOH A;  4C3Q A;  2ZM2 A;  4DJ2 A;  4YIN A;  5CEC A;  4HBU A;  3CUE A;  1L2S A;  2KLI A;  1NWZ A;  5J8X A;  5EVI A;  5FI2 A;  4CJN A;  4M3K A;  4FUW A;  1XFN A;  3T50 A;  2PU4 A;  1FR1 A;  3D9Y A;  4BBU A;  3W2Z A;  3LID A;  1WA9 A;  3PXP A;  2ZL1 B;  3P09 A;  3SS3 A;  2XFT A;  5A8B A;  5A91 A;  3BLS A;  2GNX A;  5EV0 A;  3W4Q A;  3S22 A;  3TJZ C;  4DJ3 A;  3BY8 A;  4L9F A;  3EQU A;  2YKF A;  1YAX A;  5M1A A;  3BFE A;  5F83 A;  5J7E A;  3UB8 A;  5FDH A;  3ITA A;  3G4P A;  5M19 A;  4RYE A;  1QMF A;  2R9X A;  1DJC A;  5EOE A;  1ES2 A;  3Q7V B;  1K55 A;  1PI5 A;  3OPR A;  2VV6 A;  4HJ4 A;  5HAR A;  2B5R A;  3IF5 A;  3E4O A;  3IXB A;  4KZ9 A;  4E3N A;  3CPT B;  4PM9 A;  4BWI A;  4ZJ1 A;  2P74 A;  4E6X A;  3KO6 A;  2HJ9 C;  3IHB A;  1M40 A;  3C38 A;  3SH9 A;  4HIA A;  2Y4A A;  3C7V A;  4S2I A;  3E2K A;  1RGZ A;  1VM1 A;  3IS2 B;  1KGG A;  2EX9 A;  3QNB A;  2XD5 A;  1BLP A;  1IKG A;  3CMZ A;  4KZ7 A;  5DKL A;  3NIA A;  3NC8 A;  5L8M A;  5AQ7 A;  2OWH A;  5FQQ A;  1G6O A;  5CGW A;  1LSX A;  3T1S A;  5G18 A;  2RL3 A;  4MCW A;  4EWF A;  3OPP A;  5CHM A;  2L1M A;  3H9W A;  1FIK A;  4WM9 A;  1BLS A;  1PIO A;  5EUA A;  1PWG A;  4JF4 A;  4OON A;  2ZM8 A;  4OLD A;  4QY5 A;  5FI7 A;  5CEB A;  1YLY A;  3B33 A;  3QHY A;  4K08 A;  1XJ6 A;  3EWK A;  1CJF A;  3UPN A;  2PBD P;  2JHE A;  2ZC3 B;  2XK1 A;  2HDR A;  1HD8 A;  4GKU A;  3UDX A;  1ESU A;  2VLG A;  4Y0O A;  2WAE A;  2KOI A;  1ZG4 A;  4S2O A;  2V2F F;  4GB7 A;  5E2E A;  3HLD A;  2JCH A;  3U2A A;  1ZC2 A;  4HJ6 A;  3UE0 A;  3ISG A;  4OPY A;  2ZOI A;  4ZBE A;  5IU1 A;  2VGL M;  2DMW A;  2HP6 A;  4GNU A;  4OP5 A;  3QP6 A;  2XDM A;  1BSG A;  5A93 A;  2XEP A;  4KZ8 A;  4IBX A;  3FV7 A;  3MQQ A;  2ZL1 A;  5FQJ A;  2QYB A;  4RX3 A;  2ZQA A;  1PRQ A;  2Y2I A;  1V9Y A;  4QY6 A;  2I72 A;  5HWV A;  1K25 A;  2HP5 A;  2C5W B;  1GSX A;  2M1C A;  2WAF A;  1FQG A;  1PZP A;  1U60 A;  4II7 A;  2X02 A;  4Q0J A;  1N4O A;  4WEJ A;  1XJ3 A;  3GRJ A;  4IHQ A;  1SDN A;  1FCM A;  4OQ0 A;  2W0N A;  4GOG A;  4GN2 A;  2H28 A;  5FQI A;  3Q7V A;  1K38 A;  5FAS A;  2EXB A;  3UDF A;  2W3G A;  5HFO A;  2LB5 A;  5HWT A;  3BQA A;  4X55 A;  4Q0I A;  1LLB A;  1LI0 A;  4R0Q A;  4S2J A;  1GA0 A;  5GHZ A;  4YWZ A;  4RVA A;  3HRE A;  3IX3 A;  1F98 A;  4UHU A;  3AGD A;  1K6S A;  2WKI A;  4MLL A;  4EET B;  4N1X A;  3IH9 A;  3S7Q A;  3ZNY A;  4B88 A;  4MBH A;  2XR0 A;  4JXS A;  3FC7 A;  3R7W A;  4PM7 A;  2WKP A;  4ZJ2 A;  4JXV A;  3PR6 A;  2ZQD A;  4PAU A;  1EWZ A;  3K3D A;  1KDS A;  3RXW A;  4IVI A;  4X53 A;  3E2L A;  3FWL A;  3IH8 A;  2VGJ A;  1MXO A;  1PYY A;  1YMX A;  1YKD A;  3H7W B;  2OAP 1;  2QPN A;  3DTK A;  1FR6 A;  3HLW A;  1OTE A;  4QHC A;  4PM5 A;  1G28 A;  4DE3 A;  1HLU P;  4HHD A;  2CMN A;  2FFY A;  4P85 A;  3S1Y A;  3SZT A;  3SW1 A;  1S4R A;  3SS4 A;  4D2O A;  3BFG A;  4JPM A;  3E0Y A;  3KYZ A;  3O87 A;  1NRJ A;  3MZE A;  3MXR A;  5DVA A;  2VZW A;  3V3R A;  4FSF A;  3N8S A;  2HPB A;  1GHI A;  1J9M A;  5DTT A;  3E4Q A;  4NEE D;  5CX7 A;  4DDY A;  3FPV A;  4OPQ A;  3HL9 A;  3VV4 A;  5E2G A;  1PW8 A;  3KSF A;  1S1Y A;  3UMD A;  3MZF A;  3BRM A;  1W5D A;  4O8G A;  3ZVT A;  4I3A A;  4JBF A;  3VFF A;  4ESP A;  2O9A A;  1PWC A;  1VB6 A;  3EEA A;  2J9O A;  4KG6 A;  4GD6 A;  4B9O A;  3C8C A;  1I5Q A;  2HGV A;  2ZQ9 A;  5FEG A;  3E4P A;  2VK3 A;  1OTI A;  1D7E A;  4XUZ A;  3HCY A;  4IED A;  1S0W A;  1YLJ A;  3A3F A;  3VSK A;  4HY8 A;  2KDK A;  2G7U A;  1TDG A;  4O7D A;  2ZQ7 A;  1CI9 A;  3GTC A;  2Y2M A;  1FOF A;  3LIE A;  3MR0 A;  1JNU A;  1Y28 A;  3UN7 A;  2WGI A;  3JVU A;  3ZNT A;  3QP5 A;  2V1A A;  3HUO A;  3LCE A;  4O0P A;  4ARZ A;  1K57 C;  2P9V B;  3PBT A;  4P6Z S;  3KYE A;  2I9V A;  4KQD A;  4LV0 A;  4QD4 A;  4LRX C;  3IWO A;  3D72 A;  2WKE A;  4OKP A;  4E3I A;  3OC2 A;  4GJ4 A;  1GSV A;  1ZKJ A;  4EER A;  4AFI A;  3F1O A;  1P9R A;  4FTX A;  4PM8 A;  1M6K A;  3ZFZ A;  1X0O A;  2Y2Q A;  5CGX A;  3ZG9 B;  2J3T D;  2XRN A;  3OCN A;  5CRF A;  4E3K A;  1YSQ A;  1S1Z A;  2H5S A;  4YOF A;  1IOU A;  4H6J A;  1XJ4 A;  1L3L A;  4DE2 A;  2JKG A;  4S2L A;  1DRM A;  1JWP A;  4OH0 A;  3M6H A;  3MSH A;  3VOY A;  1YT4 A;  2JC7 A;  1ZHH B;  3LI9 A;  1MWR A;  1MWS A;  4OOM A;  1LI9 A;  3O88 A;  1GSW A;  1LT0 A;  4MN5 A;  3CLO A;  4LV3 A;  4PKY A;  2ZMA A;  4UQI M;  2WZX A;  2XGN A;  3ZG5 A;  2VV8 A;  2PD7 A;  3HLG A;  1Y54 A;  2A24 B;  5L07 A;  2JBF A;  2QMI A;  4LRZ E;  4LRY C;  4P6Z M;  5AQA A;  4CLC A;  2JKT M;  4G3W A;  2BTF P;  4OOL A;  5EVI D;  5HPI A;  2PRF A;  4LEN A;  1KE3 A;  3A3E A;  4E04 A;  1ZG6 A;  4BBT A;  1W8Y A;  2XFS A;  4ZJ3 A;  3UB5 P;  2O0Y A;  2Y2K A;  1FSW A;  2ZC7 A;  3BQ8 A;  1VQQ A;  3T1X A;  1W63 M;  2BLS A;  3NEC A;  3M2J A;  2ZMF A;  4JGP A;  5HSQ A;  4DN0 A;  4JGQ A;  1KGF A;  1Q2Q A;  5M18 A;  1XFQ A;  3EOI A;  4I39 A;  2A2L A;  2ZLY A;  1STZ A;  3LI8 A;  5D3O A;  3HLF A;  4ZAM A;  1BLC A;  5FDS A;  5U47 A;  3VMA A;  1T1C A;  1SKF A;  4K91 A;  1KGE A;  3M6B A;  3E98 A;  2ZMV A;  1H5X A;  3P98 A;  4OP8 A;  1H8M A;  3L7H A;  5DTK A;  1JTG A;  3FZC A;  1NY0 A;  5F5Y A;  4LCM A;  3GDI A;  4E3L A;  1TVF A;  3TE8 A;  4JXW A;  3MJQ A;  4K0W A;  1TS7 A;  1EI5 A;  1ES4 A;  1SKO B;  5FQK A;  1I2S A;  5HL6 A;  3T1Q B;  1GHM A;  4WBG A;  4HBT A;  2JKR I;  4XT2 B;  3UE3 A;  3F1N B;  1E4D A;  1FCO A;  4A5R A;  3JPU A;  3ZQ5 A;  4OVD A;  1S66 L;  4DMZ A;  3LR3 A;  3LR5 A;  3V3S A;  5CHJ A;  4H8R A;  5L09 A;  3QP1 A;  5JYO A;  3T12 B;  1ESI A;  4ETZ A;  4GS9 B;  5AVE A;  1SCW A;  2M7U A;  4NXF A;  5J3W A;  1YSP A;  2H0T A;  3NDE A;  3MKF A;  2XH9 A;  3NBL A;  3MXQ A;  4CLC E;  5FEF A;  4S2M A;  1ES3 A;  5GHX A;  2Q9M A;  1JWV A;  1XGJ A;  1YQS A;  1OTA A;  1A0K A;  4X68 A;  4NKP A;  1W8Q A;  5GL9 A;  3MS6 A;  2FZ0 A;  4KUO A;  5HZH A;  4S2P A;  4I3I A;  1T1B A;  4I38 A;  3NUL A;  3OCL A;  3BFD A;  4EQ1 A;  5EM0 A;  1KVL A;  4EEU A;  4EBP A;  3DTE A;  3EGD C;  4R1G A;  1K4F A;  3IX4 A;  5F1F A;  3WS2 A;  3ZG8 B;  1TS6 A;  1BZA A;  1XPB A;  2VV7 A;  2J7V A;  2V20 A;  3G2Z A;  3BJN A;  4UA6 A;  3HLE A;  1PI4 A;  2BAS A;  1ODV A;  1CEG A;  3LY3 A;  1OPX A;  4KQO A;  3WWX A;  3PTE A;  2V1Z A;  4WZ5 A;  3LIA A;  2XLN A;  3NJA A;  2WGW B;  2QHK A;  3G35 A;  2PD8 A;  3VP1 A;  3S7N A;  4HOI A;  1NZU A;  2PYR A;  3HJI A;  2W3E A;  5KSH A;  4R23 A;  2XSS A;  4OQI A;  3N8L A;  1XKZ A;  1K54 C;  2PT7 A;  2ZC5 B;  4KZ6 A;  2EWV A;  3UY6 A;  1RGY A;  3LEZ A;  1H8Y A;  4FH4 A;  5TFQ A;  2P7J A;  3WS1 A;  1S6R A;  1PWD A;  5I5L A;  4EW7 A;  4EQI A;  1WYC A;  1T19 A;  1T18 A;  4EU0 A;  2GJ3 A;  4Y17 A;  3SS5 A;  3H82 B;  2E8J A;  2INW A;  3Q07 A;  3T4K A;  4KQQ A;  3HLC A;  2VGK A;  2O9B A;  2Y55 A;  3LUQ A;  4WEK A;  2OLU A;  3W4P A;  1L0E A;  3HVF A;  2GDN A;  2W3H A;  4G3K A;  4XUX A;  3B47 A;  3F1N A;  2XRO A;  4YFM A;  3VP4 A;  4GLQ A;  4CQH A;  3VP0 A;  4Z1W A;  4GZB A;  5CTN A;  3DAV A;  4IJG A;  3UME A;  1GCE A;  4WZ4 A;  4IVK A;  2H0Y A;  5J4E A;  1YLP A;  2W1R A;  2O99 A;  3NHQ A;  3PBQ A;  1E3U A;  2PR6 A;  4R4S A;  1L0G A;  3UPP A;  4QB8 A;  2O9C A;  3C4P A;  4JF5 A;  3UPO A;  1BYW A;  1O07 A;  1ES5 A;  1CI8 A;  4YNR A;  3N8R A;  4BBV A;  3RXX A;  2ZQC A;  5E2H A;  3KYQ A;  2DCF A;  2V1B A;  2JN7 A;  1H0M A;  2J3W A;  5FAP A;  4Y5F A;  3T1R A;  2K7S A;  2ZJ9 A;  2V9A A;  1K56 A;  4BEN A;  2XA7 S;  2ACG A;  5IS1 A;  1XP4 A;  5FI6 A;  1TS8 A;  5F68 A;  3CPT A;  3IXD A;  5KZH A;  4WMC A;  1K0K A;  4JGO A;  4I3J A;  3IF6 B;  3UNW A;  3C2W A;  4OQG A;  5F82 A;  4ETX A;  4MMN A;  4E3M A;  3IS2 A;  3RTY A;  4FD8 A;  3N7W A;  4PKY G;  3IXH A;  3QP8 A;  1SHV A;  2JE5 A;  4P0M A;  2LB9 A;  1NXY A;  4NXB A;  5KSC A;  2Q9N A;  4F3L B;  4R3B A;  2HZ5 A;  1MY8 A;  3Q1F A;  5DFY A;  1GA9 A;  4BL2 A;  4D60 A;  5CHU A;  4QWO A;  4BMW A;  3KSI A;  4PHT A;  4X1M A;  3U4L P;  3G6O A;  3PHY A;  2W3F A;  2B18 A;  1F2K A;  4KEN B;  2Y2G A;  5IT5 A;  3K2N A;  1YM1 A;  4HH3 A;  2J3T C;  4WEL A;  5K5B A;  4GHI B;  1K6R A;  4GD8 A;  3ITB A;  4KZB A;  2PBY A;  4IBR A;  4NXG A;  1TS0 A;  5CTM A;  5CER A;  3PBN A;  5FAO A;  4X69 A;  2X71 A;  3ZYT A;  1G6A A;  1ALQ A;  1LHY A;  5DJT A;  5FAT A; 
#chains in the Genus database with same CATH homology
 4RYE A;  1W7F A;  3S4X A;  1NRF A;  2Y91 A;  1QMF A;  4BD1 A;  1YLZ A;  4PMA A;  2R9X A;  3HLG A;  1DJC A;  1Y54 A;  5EOE A;  4Q8I A;  2Z2M B;  1FCN A;  1ES2 A;  2JBF A;  2HDS A;  3Q7V B;  1XGI A;  4PM6 A;  1QME A;  2QMI A;  5AQA A;  3BM6 A;  1K55 A;  1KE4 A;  1PI5 A;  3OPR A;  5HAR A;  2XF3 A;  5FQ9 A;  1PW1 A;  5AQ9 A;  2B5R A;  4OOL A;  3IF5 A;  5EVI D;  2ZD8 A;  5I94 A;  3IXB A;  4KZ9 A;  3SOI A;  4LEN A;  1Z6F A;  1KE3 A;  3A3E A;  4E3N A;  1ZG6 A;  4PM9 A;  4BJP A;  3FYZ A;  1W8Y A;  5GLD A;  2XFS A;  3PBR A;  2UWX A;  4ZJ3 A;  2HDQ A;  4ZJ1 A;  2P74 A;  4DE0 A;  4E6X A;  3IHB A;  4MEZ A;  1FSY A;  4OQH A;  3NI9 A;  1XA7 A;  1M40 A;  2R9W A;  2Y2K A;  3SH9 A;  4R3J A;  2IWB A;  1FSW A;  3V39 A;  2ZC7 A;  4U0X A;  2OLV A;  1VQQ A;  3HLB A;  3RJU A;  4P87 A;  1IEL A;  2BLS A;  2Y4A A;  3C7V A;  4S2I A;  3E2K A;  1RGZ A;  1VM1 A;  3M2J A;  1KGG A;  1PZO A;  3CZD A;  5E43 A;  2EX9 A;  3A3D A;  3Q7Z A;  3QNB A;  2XD5 A;  3DWK A;  4KZ5 A;  1BLP A;  1IKG A;  1KGF A;  1Q2Q A;  1IKI A;  3CMZ A;  4JXG A;  5M18 A;  1C3B A;  4KZ7 A;  4RA7 A;  2ZLY A;  3NIA A;  3HUM A;  4MBF A;  3O3V A;  3PAE A;  3NC8 A;  5GLA A;  5E2F A;  5AQ7 A;  5D3O A;  1CK3 A;  3N6I A;  5DF8 A;  3HLF A;  4ZAM A;  1TDL A;  1BLC A;  5FQQ A;  3VMA A;  5U47 A;  3IQA A;  1SKF A;  4K91 A;  5CGW A;  3VP3 A;  1KGE A;  3M6B A;  5G18 A;  3MXS A;  2RL3 A;  4EWF A;  1H5X A;  3ZHH A;  5DF7 A;  3OPP A;  3P98 A;  4OP8 A;  4WYY A;  5CHM A;  5AQB A;  2Y2P A;  4WM9 A;  5DTK A;  2WAD A;  5EVI B;  1K4E A;  1JTG A;  3FZC A;  1BLS A;  1NY0 A;  1PIO A;  4CPK A;  5EUA A;  4LCM A;  3WS5 A;  1PWG A;  4JF4 A;  5FAQ A;  4JLF A;  2E8I A;  4E3L A;  1LL9 A;  1TVF A;  4LV1 A;  4OON A;  4BQM A;  2ZM8 A;  4JXW A;  4K0W A;  4OLD A;  1DJA A;  2WGW A;  2WYX A;  4UAA A;  1EI5 A;  1ES4 A;  5FQK A;  4QY5 A;  5FI7 A;  3V5M A;  5CEB A;  5HAP A;  1YLY A;  3VSL A;  4Y0T A;  3QHY A;  1I2S A;  4K0X A;  3BFC A;  2EX8 A;  1JVJ A;  3WRT A;  4B4Z A;  3GVB A;  1GHM A;  1JTD A;  4WBG A;  3UPN A;  3Q82 A;  3A3I A;  4HBT A;  2ZC3 B;  3UE3 A;  2XK1 A;  2HDR A;  1HD8 A;  4GKU A;  3UDX A;  1ESU A;  3AGF A;  2FFF B;  4Y0O A;  1E4D A;  1FCO A;  2WAE A;  4A5R A;  1ZG4 A;  4E3O A;  3G2Y A;  4OLG A;  4OVD A;  4S2O A;  2V2F F;  1YLT A;  3IWQ A;  4GB7 A;  5E2E A;  3TSG A;  3HLD A;  2JCH A;  1BUL A;  3V3S A;  3I7J A;  4H8R A;  5CHJ A;  3ZG7 B;  1ZC2 A;  3IXG A;  5IHV A;  3UE0 A;  1WYB A;  4EUZ A;  3UO9 A;  3EQV A;  5JYO A;  1ESI A;  3ISG A;  3JYI A;  3G34 A;  2G2U A;  3MFD A;  4OPY A;  1Q2P A;  1SCW A;  4ZBE A;  2H0T A;  3NDE A;  3MKF A;  1IYP A;  4DKI A;  3HUN A;  2HP6 A;  1W79 A;  4GNU A;  4OP5 A;  1MWT A;  2XH9 A;  3GR2 A;  3NY4 A;  2XDM A;  3GMW A;  1IYO A;  1BSG A;  3NBL A;  3ZG0 A;  4S2M A;  5A93 A;  1ES3 A;  2WZZ A;  2XEP A;  2Q9M A;  3LO7 A;  5GHX A;  5A92 A;  4KZ8 A;  1JWV A;  1XGJ A;  2J9P A;  4IBX A;  3FV7 A;  1YQS A;  5FQJ A;  5EEC A;  2Z2L B;  2WKH A;  1NJ4 A;  4RX3 A;  2ZQA A;  4U0T A;  1AXB A;  2Y2I A;  1RCJ A;  2QZ6 A;  2I72 A;  4QY6 A;  1K54 A;  3HBR A;  2G2W A;  3WS4 A;  1K25 A;  3CJM A;  2HP5 A;  1OME A;  2WGV A;  2Y2H A;  3GV9 A;  4X68 A;  2C5W B;  4KZ4 A;  3PBS A;  1W8Q A;  2WAF A;  1BLH A;  4MNR A;  2HP9 A;  4R4R A;  5GL9 A;  1FQG A;  4GDB A;  5EVI C;  1PZP A;  4S2P A;  4UA9 A;  5HX9 A;  1U60 A;  4ZDX A;  1XX2 A;  5L2F A;  2X02 A;  4XXR A;  1N4O A;  3VFH A;  2Y2O A;  1XXM A;  3BFD A;  3OCL A;  4WEJ A;  3GRJ A;  1KVL A;  4EV4 A;  5HW3 A;  4S2N C;  4E6W A;  1SDN A;  1FCM A;  1DY6 A;  2WUQ A;  2Y2L A;  4EBP A;  1BT5 A;  3FKW A;  4GOG A;  4OQ0 A;  4GN2 A;  5FQI A;  3Q7V A;  1BUE A;  1K4F A;  2ZQ8 A;  1IEM A;  1K38 A;  4R1G A;  3WS0 A;  5FAS A;  3DWZ A;  5F1F A;  3WS2 A;  3ZG8 B;  2EXB A;  1G68 A;  3LY4 A;  3UDF A;  4N9K A;  1BZA A;  1XPB A;  3PBO A;  4KQR A;  2J7V A;  5HAQ A;  2EX2 A;  5HFO A;  2V20 A;  1CEF A;  1KE0 A;  4N92 A;  4X55 A;  3ZCZ A;  1L0F A;  4KG2 A;  1LLB A;  1LI0 A;  4R0Q A;  4S2J A;  3G2Z A;  4UA6 A;  3HLE A;  3ZG5 A;  3DW0 A;  1PI4 A;  1GA0 A;  4JKT A;  1CEG A;  5GHZ A;  4RVA A;  4C6Y A;  3MBZ A;  3IWI A;  3LY3 A;  4KQO A;  3UDI A;  1RP5 A;  3HRE A;  3WWX A;  3PTE A;  2V1Z A;  4WZ5 A;  4UHU A;  2XLN A;  2OV5 A;  2WGW B;  3G35 A;  3AGD A;  1K6S A;  1L0D A;  2WKI A;  3IF6 A;  4DDS A;  3VP1 A;  2Y2N A;  1BTL A;  3O86 A;  4MLL A;  4NET A;  5F1G A;  4FH2 A;  3IHA A;  4E3J A;  1NZU A;  2EFU A;  4N1X A;  5KSH A;  4R23 A;  5EVL A;  4JF6 A;  4OQI A;  4C75 A;  3IH9 A;  3FKV A;  4EBL A;  3N8L A;  3ZNY A;  3UE1 A;  1SDE A;  1K54 C;  1XKZ A;  1K55 C;  2ZC5 B;  2XR0 A;  4KZ6 A;  4MBH A;  4B88 A;  4JXS A;  3UY6 A;  4Z9Q A;  1RGY A;  3LEZ A;  1H8Y A;  4FH4 A;  3Q81 A;  4PM7 A;  1ONH A;  3C7U A;  4KZ3 A;  4Y0U A;  4ZJ2 A;  5FSR A;  5TFQ A;  4EBN A;  4JXV A;  5DTS A;  3WS1 A;  5FA7 A;  4FCF A;  1S6R A;  2ZQD A;  3VP2 A;  1EWZ A;  1PWD A;  1KDS A;  3RXW A;  4IVI A;  4BD0 A;  2XD1 A;  4EQI A;  1WYC A;  4X53 A;  1ERQ A;  3TOI A;  3VOZ A;  4KG5 A;  3E2L A;  1DJB A;  3FWL A;  3IH8 A;  4U3T A;  2VGJ A;  3SS5 A;  1MXO A;  1PYY A;  1YMX A;  1HTZ A;  2Y2J A;  3Q07 A;  2P9V A;  2QPN A;  4KQQ A;  3HLC A;  1FR6 A;  3HLW A;  2VGK A;  1IYQ A;  2Y55 A;  4QHC A;  4WEK A;  4PM5 A;  2OLU A;  4N9L A;  4OPR A;  3SH8 A;  4DE3 A;  3W4P A;  2FFY A;  4P85 A;  3S1Y A;  3V50 A;  2EFX A;  1L0E A;  5FQM A;  3AGE A;  1WE4 A;  3SS4 A;  4D2O A;  3HVF A;  2GDN A;  1JWZ A;  3BFG A;  2HDU A;  3OZH A;  5A90 A;  4JPM A;  4PPR A;  3BFF A;  1ERM A;  3O87 A;  3MZE A;  3OPH A;  3DTM A;  3MXR A;  4XUX A;  5DVA A;  3SH7 A;  4YFM A;  3BLM A;  3VP4 A;  3G31 A;  1XA1 A;  3IT9 A;  4LCL A;  3V3R A;  1LL5 A;  3VP0 A;  3MKE A;  5GHY A;  4FSF A;  3N8S A;  2Y59 A;  3ZDJ A;  1KVM A;  4GZB A;  2HPB A;  1GHI A;  1J9M A;  4BL3 A;  5KMW A;  5CTN A;  4QJG A;  5DTT A;  4L0L A;  4DDY A;  4N1H A;  4RX2 A;  4WZ5 C;  4OPQ A;  3PAG A;  1GCE A;  3HL9 A;  4DE1 A;  5E2G A;  4WZ4 A;  1PW8 A;  2ZC4 B;  5DF9 A;  2A3U A;  4IVK A;  4F94 A;  2H0Y A;  5CED A;  1YLP A;  2IWC A;  2WK0 A;  3PBQ A;  1E3U A;  4R4S A;  1L0G A;  3UPP A;  2H10 A;  4QB8 A;  4OOY A;  3C4P A;  4JF5 A;  3UPO A;  1K57 A;  3MZF A;  3BRM A;  4NK3 A;  1W5D A;  3ZGA B;  1O07 A;  5EPH A;  1ES5 A;  1CI8 A;  3ZVT A;  2A49 A;  3N8R A;  4JBF A;  3RXX A;  3VFF A;  2ZQC A;  5E2H A;  1MKI A;  4HEF A;  2EX6 A;  2DCF A;  1ONG A;  1PWC A;  5CGS A;  5FAP A;  5EOO A;  1HZO A;  2J9O A;  4KG6 A;  2ZJ9 A;  4UA7 A;  1K56 A;  4GD6 A;  4BEN A;  1I5Q A;  2ZQ9 A;  2C6W B;  5JYP A;  3ZVW A;  3NDG A;  1XP4 A;  4DXB A;  4XUZ A;  4BLM A;  1I2W A;  5FI6 A;  4IED A;  1HVB A;  3QNC A;  1S0W A;  1YLJ A;  3A3F A;  3VSK A;  3IXD A;  5KZH A;  4WMC A;  1O7E A;  3NCK A;  1TDG A;  3MZD A;  5HL1 A;  4ZTK A;  4QU3 A;  3GQZ A;  2IWD A;  1IYS A;  3G32 A;  4KZA A;  4X56 A;  3IF6 B;  4O7D A;  2ZQ7 A;  3UNW A;  1CI9 A;  1NYY A;  3GSG A;  4OQG A;  5F82 A;  4GDN A;  2ZM0 A;  3GTC A;  5HAI A;  2Y2M A;  4E3M A;  4MBK A;  3BEC A;  4DXC A;  4DF6 A;  1FOF A;  5M19 A;  1GHP A;  4FD8 A;  3N7W A;  3IXH A;  3UN7 A;  2WGI A;  2EXA A;  3G30 A;  3ZNT A;  1SHV A;  1MPL A;  2CC1 A;  2JE5 A;  3BEB A;  3W4O A;  3N4I A;  4OPZ A;  5GLC A;  4DRT A;  4B4X A;  5EE8 A;  3HUO A;  1N9B A;  4P0M A;  1E3U D;  1NXY A;  4LV2 A;  5KSC A;  3CG5 A;  3LCE A;  2Q9N A;  2ZC6 B;  2PU2 A;  3BYD A;  3C5A A;  4R3B A;  5CXW A;  4S2K A;  3OPL A;  3C4O A;  5TGF A;  5BOH A;  4C3Q A;  2RCX A;  1MY8 A;  2ZM2 A;  3Q1F A;  1K57 C;  2P9V B;  3PBT A;  3TG9 A;  1GA9 A;  4Y7P A;  4YIN A;  5CEC A;  4HBU A;  5TR7 A;  4BL2 A;  1L2S A;  3W8K A;  2XQZ A;  4ID4 A;  5J8X A;  4LV0 A;  4QD4 A;  5CHU A;  3A3J A;  5EVI A;  2X01 A;  5FI2 A;  4CJN A;  3IWO A;  4M3K A;  1K56 D;  2WKE A;  3B3X A;  4OKP A;  3D4F A;  4E3I A;  3OC2 A;  1NYM A;  1TEM A;  1ZKJ A;  2PU4 A;  2BG1 A;  3M2K A;  4PM8 A;  1FR1 A;  1MWU A;  1KDW A;  1M6K A;  3ZFZ A;  4S2N A;  2Y2Q A;  5CGX A;  4KEN B;  3ZG9 B;  2Y2G A;  1YM1 A;  3OCN A;  1YMS A;  2OSU A;  5CRF A;  4E3K A;  2DNS A;  2H5S A;  4WMC D;  3P09 A;  2J8Y A;  4HES A;  4WEL A;  1NZO A;  4DE2 A;  1E25 A;  3SS3 A;  4S2L A;  1YLW A;  4P6B A;  1JWP A;  4OH0 A;  2XFT A;  1K6R A;  4GD8 A;  1MBL A;  3M6H A;  3BLS A;  5A91 A;  3VOY A;  3ITB A;  3W4Q A;  3WRZ A;  1YT4 A;  4KZB A;  2JC7 A;  2PBY A;  3S22 A;  1ERO A;  4IBR A;  1MWR A;  1MWS A;  4OOM A;  5CTM A;  3EQU A;  1LI9 A;  5CER A;  3PBN A;  5FAO A;  3O88 A;  3IF6 C;  5M1A A;  4X69 A;  2X71 A;  4X6T A;  5GLB A;  3BFE A;  4LV3 A;  2DRW A;  5F83 A;  1H8Z A;  2ZMA A;  5FDH A;  1G6A A;  3ITA A;  1ALQ A;  1LHY A;  3G4P A;  5FAT A;  2WZX A;  2XGN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...