1KGEA

Structure of beta-lactamase asn 170 met mutant
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
257
structure length
257
Chain Sequence
b'KELNDLEKKYNAHIGVYALDTKSGKEVKFNSDKRFAYASTSKAINSAILLEQVPYNKLNKKVHINKDDIVAYSPILEKYVGKDITLKALIEASMTYSDNTANNKIIKEIGGIKKVKQRLKELGDKVTNPVRYEIELMYYSPKSKKDTSTPAAFGKTLNKLIANGKLSKENKKFLLDLMLNNKSGDTLIKDGVPKDYKVADKSGQAITYASRNDVAFVYPKGQSEPIVLVIFTNKDNKSDKPNDKLISETAKSVMKEF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-LACTAMASE
publication title Elimination of the hydrolytic water molecule in a class A beta-lactamase mutant: crystal structure and kinetics.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 95
structure length 257
sequence length 257
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 1996-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1kgeA00
4R0QA 2XH9A 1IYOA 1HVBA 3N7WA 4N9KA 1YMXA 4S2MA 4WMCD 5I94A 3C4OA 4IEDA 2WKHA 4U0XA 3C7UA 3N8SA 3Q1FA 3M2KA 4KZ3A 3O86A 4UA9A 5FDHA 3ZG7B 1K6RA 1E4DA 1RGZA 3OC2A 1K25A 3MFDA 1ONGA 4R1GA 3IXDA 1XXMA 2B5RA 5M1AA 4OQ0A 2XF3A 2Y2QA 5D3OA 4X53A 2ZM2A 1YQSA 1RGYA 2A3UA 4Y0UA 3A3EA 2XEPA 4MBKA 1DJAA 2XFSA 4XUZA 2WUQA 2JC7A 2X71A 4WEKA 1XP4A 1IYQA 3WS5A 5FAQA 4BL2A 5CECA 5F82A 3UPOA 3OZHA 5FI7A 1JWVA 1H5XA 4N9LA 5FQIA 1H8YA 2ZQAA 4X6TA 5HARA 3W8KA 3IH9A 5EVIB 2G2WA 1MBLA 4OVDA 1IEMA 2V2FF 5EVID 3UDXA 3IXGA 3G2YA 1G68A 3O3VA 5FQ9A 3TSGA 4E3KA 1PWGA 2Y2NA 1LLBA 3IQAA 1S0WA 5GHZA 3GVBA 5DTSA 1OMEA 1NZUA 3IHAA 2IWBA 2QZ6A 5FA7A 4GZBA 4E6WA 2ZC5B 3AGFA 3UDFA 4X55A 3A3FA 5TFQA 4BENA 3SS5A 1E3UA 3TG9A 1FR6A 3LCEA 3UNWA 3P98A 1W79A 2EX8A 5E2GA 2WKEA 1BSGA 3IWOA 5M19A 5GLCA 2H0TA 2HPBA 5F1GA 1BZAA 5KZHA 3IXBA 2WAEA 2XGNA 1L0DA 4NETA 1LL9A 3NCKA 4RVAA 2FFFB 3BRMA 3UY6A 3Q7ZA 4X68A 4PM9A 4YFMA 4BJPA 3MKEA 4A5RA 1MKIA 4M3KA 5CHJA 1KGFA 1KVMA 1S6RA 3MXRA 4JXSA 4KZ4A 1XPBA 3ZGAB 3OPRA 1PZPA 3MBZA 2ZM8A 3NIAA 4LCMA 4P6BA 4R3JA 4FSFA 3GSGA 4LV1A 3UO9A 2IWDA 2WAFA 4JLFA 4PM6A 4DE2A 4E3LA 5HW3A 3N6IA 3BFFA 3UDIA 3GTCA 4Q8IA 2Z2MB 4L0LA 3Q81A 4IVIA 3HUOA 4HBTA 1DY6A 3ZG9B 5FSRA 4OQHA 2ZQ7A 4WM9A 4BL3A 2WGVA 2V1ZA 3G30A 4OPRA 1LL5A 4X69A 5E2FA 1YLJA 3UPNA 4D2OA 2EX2A 3AGEA 2WK0A 5JYPA 2EX6A 4B88A 5L2FA 2ZQCA 3IF6B 3Q7VB 5EOEA 3GQZA 5FAPA 2EXBA 3GMWA 4K0WA 1VQQA 4EQIA 3IF5A 3G34A 5CEDA 4GKUA 3DTMA 4R4SA 4WZ4A 2WZXA 2Y2LA 1MXOA 2HP9A 3BYDA 3GRJA 4PM8A 4S2JA 1L0GA 5HL1A 1DJCA 2OSUA 3SH7A 1MWTA 4HEFA 3ZVWA 5M18A 3C7VA 3VP3A 1GA0A 2Y2GA 4EBNA 4EUZA 1ES5A 4RX2A 1K57C 2DCFA 3HLCA 1EWZA 1SCWA 5GLDA 5KMWA 2JCHA 3ZDJA 2ZC4B 3BM6A 3IT9A 4GOGA 4GN2A 4E3OA 3G4PA 2X01A 4GD8A 3MZFA 1TDGA 1K55A 3UPPA 3BFCA 1W5DA 4WEJA 3M2JA 1Q2QA 4U0TA 4ID4A 3ZCZA 1K4EA 1YLZA 4JF5A 4P0MA 4DXCA 1QMFA 4QHCA 5HX9A 4IBXA 4IBRA 5BOHA 4ZTKA 4BLMA 3O87A 5FASA 1ONHA 5HAIA 2WYXA 1JWPA 4GDNA 4DKIA 3VMAA 5GL9A 2J7VA 4KG2A 3EQVA 3FKWA 5EOOA 2Y2KA 1CEGA 4FH4A 5CEBA 4S2KA 1KDWA 3VOYA 1ERMA 3I7JA 4QY5A 5CHUA 4ZBEA 1GHIA 3BFGA 3NDEA 4C75A 1Z6FA 3PBTA 5FQJA 2DRWA 3MXSA 4HBUA 2EFXA 2H0YA 1NYMA 4DE3A 3ZVTA 1ZC2A 4O7DA 4RA7A 1PI5A 3HLDA 4N1XA 1G6AA 1ES4A 1H8ZA 2P74A 2C6WB 3BLMA 1O07A 1SHVA 3WS1A 1BLCA 1E3UD 4KZ7A 4WMCA 3OCLA 3NBLA 3UE1A 4JPMA 5EUAA 3V3SA 2H10A 3N8RA 1VM1A 3E2LA 3V3RA 5FQMA 5HAPA 1BUEA 5A90A 2FFYA 5FQKA 4S2NA 3FV7A 5FATA 2XR0A 1W7FA 4QJGA 1GA9A 3EQUA 3CG5A 4QB8A 1RCJA 1FSYA 1L0FA 1ZG4A 1FCOA 4FH2A 4QD4A 3PAGA 3W4QA 3IWIA 5A93A 1E25A 2CC1A 3IF6C 4WZ5C 2J9PA 1K56A 5AQ7A 1FCMA 1FCNA 1K6SA 4KZBA 4CJNA 3LY3A 1MWUA 1IELA 3MKFA 3PBRA 4FCFA 1JWZA 1NJ4A 3G32A 5GHXA 3PBOA 1IKGA 1ERQA 2UWXA 5HAQA 3BFEA 3SH8A 1N9BA 3ITBA 3IHBA 1K54A 3W4OA 4OPQA 1YT4A 4OKPA 3PBNA 4KQRA 4GB7A 4UHUA 1MPLA 2E8IA 1W8QA 2WZZA 2VGJA 1YMSA 5J8XA 3ZFZA 2Y4AA 1K55C 4KZ8A 2J8YA 4OOYA 3C5AA 3RXXA 3ZNYA 3QHYA 4QU3A 3BECA 5TGFA 3DWZA 4U3TA 4F94A 3IXHA 4LCLA 5DF8A 1DJBA 2PU2A 4KZ9A 4OPYA 1XGIA 1M6KA 4JF4A 4LV0A 3JYIA 1ESIA 4R3BA 3VSKA 4HESA 4OQGA 5IHVA 2HP5A 3GV9A 2OV5A 4BQMA 2OLUA 1L2SA 1JTDA 5EVLA 2IWCA 2Z2LB 2P9VA 4Y0TA 1GHMA 2HP6A 2Y2PA 1BTLA 4K91A 2WGWA 1MY8A 3ZHHA 3ZG0A 3HLWA 2QMIA 1KE3A 4RYEA 1YLWA 4S2PA 5FAOA 1CI9A 4H8RA 4E3JA 1BT5A 2EXAA 3OPHA 3ZG8B 4DF6A 3CJMA 5DF9A 1BLHA 1QMEA 3FWLA 2XD1A 1I2WA 3A3JA 4OP5A 3VFFA 5DTKA 1XX2A 4X56A 3UE3A 3BEBA 1KGEA 3BFDA 3V39A 1MWRA 3FYZA 2DNSA 3TOIA 1PWDA 4OQIA 1FQGA 4QY6A 4GDBA 3IWQA 1NXYA 3VP4A 1ZKJA 4S2OA 3ZNTA 4KZAA 2XQZA 4EBPA 1RP5A 2Y2HA 1K38A 2ZC7A 3DW0A 4E3IA 1WYBA 4S2NC 3PTEA 3S1YA 2ZD8A 5GLAA 4WBGA 3S22A 2XK1A 5AQBA 3HBRA 1Q2PA 1TVFA 2Y59A 4P85A 3VOZA 1C3BA 1XGJA 4KQQA 4DRTA 1CK3A 2BLSA 2ZMAA 2JBFA 1W8YA 3HREA 3P09A 4E3NA 2ZC3B 1MWSA 3NI9A 3A3IA 4C3QA 3DWKA 3HL9A 4LV2A 4OLGA 3E2KA 3IH8A 2RCXA 3MZDA 3UN7A 3WRZA 5CGSA 2EX9A 4UA7A 2WKIA 4Y7PA 5JYOA 2EFUA 3A3DA 4ZJ2A 4JXVA 3N8LA 1ALQA 4YINA 2ZLYA 2VGKA 3VSLA 4KZ5A 4KENB 5TR7A 3V5MA 1ZG6A 4OOLA 3CMZA 3M6BA 2GDNA 5G18A 4B4ZA 5AQAA 1ESUA 1ES2A 2OLVA 2Q9NA 2ZQ9A 4MLLA 3HLBA 1JTGA 1GHPA 2J9OA 1YLPA 4PMAA 3RXWA 2V20A 4XUXA 4KG6A 5CRFA 5AQ9A 1KVLA 2QPNA 3HLEA 4KZ6A 3WS2A 3SH9A 4K0XA 1YM1A 2JE5A 3OCNA 4EBLA 1KE4A 3SS3A 3BLSA 1LHYA 2WGIA 1LI0A 3O88A 3W4PA 4B4XA 4DE1A 4IVKA 1PWCA 4EV4A 3G2ZA 1EI5A 4P87A 1KE0A 1CEFA 1M40A 1K56D 4CPKA 4DDSA 3PAEA 2XD5A 3HLFA 1IYSA 3M6HA 2HDSA 4S2IA 3V50A 4BD1A 5CXWA 4DDYA 1N4OA 4E6XA 5CGXA 3S4XA 4JKTA 1HZOA 1PIOA 3SS4A 5DVAA 3G31A 3Q07A 1XKZA 2WADA 3WS4A 1NZOA 3LO7A 1GCEA 1K57A 4S2LA 5CTNA 5DF7A 5A92A 1PZOA 5F83A 4FD8A 1LI9A 3VP2A 2XFTA 5FQQA 5GHYA 1CI8A 2Y2OA 2X02A 3LEZA 4KG5A 4PM7A 4OLDA 5E2EA 1KDSA 5HFOA 1EROA 3ITAA 3HUNA 5CERA 1NRFA 3CZDA 4JBFA 3PBQA 1AXBA 1I5QA 5EVIA 4ZJ3A 2Y2JA 2RL3A 4RX3A 4GD6A 1IYPA 4N92A 4OOMA 5EE8A 2BG1A 1O7EA 4ZAMA 2Y2IA 4UA6A 3WS0A 3HVFA 5E43A 5FI6A 2PU4A 2Y55A 2P9VB 1K4FA 2ZM0A 1TEMA 1FOFA 1U60A 1BULA 4WYYA 3HUMA 2WGWB 5GLBA 3D4FA 2XDMA 4OPZA 5FI2A 4C6YA 2I72A 3WWXA 1SKFA 1J9MA 3FKVA 1KGGA 3AGDA 2HDRA 5EECA 3WRTA 3OPPA 4GNUA 4MBFA 4EWFA 4MNRA 5CGWA 4E3MA 4PPRA 5F1FA 4KQOA 2ZJ9A 5CTMA 1XA1A 3VP0A 3LY4A 4LENA 4ZJ1A 3UE0A 4DXBA 4R23A 2C5WB 4MBHA 1WE4A 1SDNA 1YLTA 2HDQA 4JF6A 3NC8A 1NY0A 3GR2A 4MEZA 5DTTA 5KSHA 1SDEA 4WELA 1Y54A 5E2HA 3QNCA 2PBYA 3SOIA 3FZCA 4ZDXA 1PW1A 5CHMA 2HDUA 2R9XA 3NDGA 4LV3A 4XXRA 3N4IA 4OONA 5A91A 4OH0A 1FR1A 3PBSA 3Q82A 1BLSA 5U47A 4PM5A 1L0EA 1PI4A 2A49A 3HLGA 3QNBA 2R9WA 1NYYA 4BD0A 3OPLA 1WYCA 2G2UA 3C4PA 3IF6A 4R4RA 1HD8A 1I2SA 4WZ5A 1BLPA 3Q7VA 2ZQDA 4DE0A 2H5SA 3B3XA 4JXWA 3VP1A 3NY4A 5KSCA 1ES3A 1IKIA 1XA7A 4N1HA 4Y0OA 4Z9QA 2Y91A 1YLYA 2Q9MA 3ISGA 1PYYA 4OP8A 3VFHA 5EPHA 3MZEA 4JXGA 1JVJA 1TDLA 3ZG5A 2ZC6B 1PW8A 3G35A 1K54C 2ZQ8A 4NK3A 1HTZA 5EVIC 2Y2MA 4UAAA 1FSWA 3RJUA 2XLNA
chains in the Genus database with same CATH superfamily
4R0QA 1HVBA 3N7WA 4FUWA 4IUHA 4RQ9A 3Q1FA 4UA9A 5FDHA 3O86A 1K6RA 1E4DA 3H9WA 3MFDA 3IXDA 3G6OA 2W3EA 4OQ0A 2XF3A 2HF6A 4X53A 1YQSA 1RGYA 2A3UA 5DFXA 4WEKA 1XP4A 5FAQA 4BL2A 5F82A 4CLCA 5FI7A 1CQAA 3W8KA 1MBLA 5EVID 3O3VA 3P01A 1S0WA 1XJ6A 5DTSA 1OMEA 3MF0A 4GZBA 3A3FA 3TG9A 3LCEA 2Y79A 5E2GA 1BSGA 1TS6A 5F1GA 5KZHA 4NETA 1L0DA 2INWA 1LL9A 4RVAA 3BRMA 3UY6A 4YFMA 4I3JA 3E4PA 1MKIA 1KVMA 1XPBA 3KO6A 3FPVA 3NIAA 2JHEA 4R3JA 2IWDA 4DE2A 4JLFA 2KOIA 4PM6A 3H7WB 5FEFA 3UDIA 4Q8IA 2Z2MB 4L0LA 3Q81A 1DY6A 3ZG9B 5FSRA 1XJ4A 4NXGA 1VB6A 4BL3A 2WGVA 4OPRA 4X69A 2EX2A 1PRQA 1VEUB 3AGEA 4B88A 3R7WA 2L4RA 5L8MA 5EOEA 3EGXC 3F1OB 5CEDA 1OTDA 3KSHA 2Y2LA 5HL1A 3BQ8A 2OSUA 4HEFA 2K2NA 2JCHA 5F69A 4GOGA 1S66L 2IA2A 4NXFA 2VKSA 4I5SA 1P97A 3BFCA 2ZL1A 4UQIM 3ZCZA 1K4EA 1OJ5A 3O5YA 4L9FA 1YLZA 3LR5A 4JF5A 3TJZC 4EERA 3KSIA 4BLMA 1ONHA 5HAIA 4GDNA 4CLCD 5CEBA 3NHQA 5CHUA 2HGVA 3PBTA 2DRWA 3MXSA 4EU0A 4O7DA 4N1XA 3UE6A 2V8CA 2C6WB 1O07A 1BLCA 2J3TD 4KZ7A 4LLOB 3OCLA 3UE1A 1ZTUA 2H10A 1VM1A 3E2LA 5HAPA 1BUEA 4HJ6A 1GSWA 2GNXA 3EQUA 3CG5A 1T1BA 4QB8A 1FSYA 1VETB 4FH2A 3PAGA 5A93A 3A0RA 5G4YA 3EGDC 3FC7A 4CJNA 1IELA 3MKFA 3U4LP 3PBRA 1S1YA 3G32A 1N9BA 3IHBA 3PBNA 4KQRA 2E8IA 2VGJA 1D1JA 1SKOA 5HDCA 2J8YA 3RXXA 3LGOA 5TGFA 4F94A 5DF8A 1DJBA 4KZ9A 4OPYA 1XGIA 1KOUA 1M6KA 4JF4A 4LV0A 3IX4A 4NXBA 5EVLA 1JTDA 3ULFA 4ARZB 4Q0IA 3HLWA 1KE3A 4RYEA 1YLWA 3RTYA 1T18A 2EXAA 3LUQA 5HDSA 3FWLA 4CLCC 3VFFA 4WN5A 3UE3A 1LSXA 1PWDA 4QY6A 4GDBA 3IWQA 4E04A 3L7HA 2ZC7A 4GS9A 4UEYA 5TBMB 1WYBA 3PTEA 5GLAA 2P04A 4II7A 3HBRA 2J3TC 4EW7A 1C3BA 1XGJA 1CK3A 2ZMAA 3KYEA 3DAVA 3P09A 5J7EA 4O8GA 3A3IA 2ACGA 3HL9A 3MXQA 3MZDA 4UA7A 5JYOA 3ICYA 4KZ5A 2Q9NA 1JTGA 3RXWA 4BBVA 2K31A 1D7EA 3HLEA 4KZ6A 3WS2A 1YM1A 2JE5A 3OCNA 4IVKA 1PWCA 1EI5A 1F98A 2VGLS 1CEFA 5IT5A 2ZMFA 4ZRRA 3QP6A 4DDSA 3HLFA 3V50A 1WA9A 3EEHA 1XKZA 5EFWA 4S2LA 3CLOA 1PZOA 4WLAA 3KX0X 2XFTA 1HLUP 5FL3A 2X02A 4PM7A 4H6JA 2K7SA 1I5QA 2W1TA 2Y2JA 4RX3A 4MN5A 3LR4A 5FI6A 2A2LA 1K4FA 1FOFA 1U60A 2WGWB 5L09A 2XDMA 3OOVA 1OTEA 3FKVA 3QP5A 1AWIA 4AFIA 3LR3A 4E3MA 1F2KA 3E4QA 4ZJ1A 1YLTA 3CPTB 4JF6A 4WL9A 1NY0A 5DTTA 1L3LA 1Y54A 1N9NA 3SOIA 2V1AA 2YKFA 2HDUA 2HJEA 3IBRA 2PHYA 3PBSA 5U47A 1L0EA 1Y4OA 4I3AA 4BD0A 3K2NA 3IF6A 2Z6DA 4R4RA 1HD8A 5KSCA 3VP1A 3T1RA 3BW6A 3D72A 2V0UA 4Y0OA 3UB5P 2Q9MA 3ISGA 4FTXA 4JXGA 2W1RA 2ZC6B 4NXEA 4Q0JA 4QWOA 3T4OA 2EWVA 2A24B 4IHQA 1IYOA 3C4OA 2WKHA 4U0XA 3N8SA 3M2KA 1K25A 1ONGA 4I38A 4R1GA 2A24A 5F5YA 1DP8A 3CUEC 4LRXC 5M1AA 1SZVA 2XFSA 3T1SA 2QHKA 1IYQA 3F1PB 3WS5A 3IX8A 4X1MA 3UPOA 4N9LA 3MSHA 5EVIB 4OVDA 3PR6A 1IEMA 3UDXA 1G68A 5FQ9A 3UMDA 2Y2NA 1LLBA 3VOLA 2UV0E 3IHAA 3UDFA 4CLCE 1W79A 2EX8A 2WKEA 5M19A 2JN7A 4YNRA 2WAEA 3NCKA 2FFFB 4X68A 4A5RA 5CHJA 4YWZA 4XT2B 4JXSA 3MBZA 3IS2B 2WAFA 4P6ZM 1CJFA 2O9CA 4WF0A 3GTCA 3LIDA 2ZQ7A 3CITA 3G30A 4D2OA 3LIFA 2EX6A 5L2FA 3LEQA 2VA0A 3S7QA 4K0WA 1N9LA 3G34A 4JGRA 3VE4A 1MXOA 2HP9A 3BYDA 4S2JA 2HZ5A 3SH7A 5M18A 2D01A 2W27A 1GA0A 4EUZA 5KMWA 3C8CA 2E8JA 3G4PA 4GD8A 4WEJA 4ID4A 1ACFA 4QHCA 5HX9A 4IBXA 1LL8A 3ZQ5A 1H8MA 2WYXA 1JWPA 5AVFA 5GL9A 3VMAA 2J7VA 3FKWA 4CLCB 4FH4A 4S2KA 3VOYA 5DFYA 1ERMA 4ZBEA 4MN7A 3P7NA 4IUKA 4HH2A 3BFGA 4C75A 4BWIA 2H0YA 2JKTM 3E4OA 3CHWP 4GHIA 1ZC2A 4L9GA 1PI5A 1G6AA 5HPIA 1H8ZA 2P74A 1SHVA 3WS1A 3SW1A 4WMCA 1XJ3A 5EUAA 1DRMA 2O0YA 3N8RA 3V3RA 2PRFA 1DP6A 5A90A 5HWTA 5FQKA 3FV7A 2L0WA 1RCJA 1L0FA 1E25A 3IF6C 2QWSA 2J9PA 1K56A 5AQ7A 1K6SA 3T4KA 1MWUA 5MC7A 1IKGA 2PYPA 3SH8A 3W4OA 3C38A 4HJ4A 3NJAA 1K55C 4KZ8A 2I9VA 3V67A 4OOYA 3C5AA 4ETZA 1IFQA 3R7WB 3C30A 2W3GA 2VEAA 3HCYA 4LCLA 5LBRA 5K5BA 4HESA 2EA9A 5IHVA 4BQMA 2OLUA 2Z2LB 3CAXA 4FOFA 4BBTA 2Y2PA 4K91A 2OAP1 4NKPA 4S2PA 1CI9A 3OPHA 1XJ2A 3CJMA 1BLHA 1QMEA 2VLGA 4OP5A 2PBDP 3BEBA 3GECA 4IJGA 1MWRA 2DNSA 2ZL1B 1PFLA 1NXYA 2NUPC 4MDZA 4S2OA 4EBPA 2LB9A 1K38A 3DW0A 3TE8A 4S2NC 3S1YA 2ZD8A 4WBGA 1EW0A 2XK1A 2CMNA 2Y59A 4P85A 4KQQA 3MQQA 3S7NA 4DRTA 1W8YA 4ETXA 1GSVA 2B02A 4OLGA 3S7PA 1G5UA 3WRZA 1NLYA 4YINA 3FPWA 3V5MA 1ZG6A 3CMZA 4X25A 2GDNA 5G18A 5AQAA 1ESUA 3K3DA 2PR5A 3HLBA 5AQ9A 3SH9A 4K0XA 4EBLA 1NWZA 3SS3A 2WGIA 1YSQA 4B4XA 2V0WA 4HJ3A 4DE1A 4M4XA 3G2ZA 4P87A 4CPKA 1K56D 2XROA 2V8FA 3A0VA 4BBUA 3M6HA 4BD1A 2D02A 1PIOA 3G31A 5HDDA 3WS4A 2XSSA 1K57A 5A92A 1ODVA 1SKOB 2FH5A 2Y2OA 1STZA 4KG5A 2QKPA 1EROA 3HUNA 2EWWA 1NRFA 3CZDA 4EEPA 1YKDA 4LRYC 1IYPA 3H82A 1LT0A 4OOMA 1H0MA 2KX6A 2PU4A 2Y55A 2ZM0A 4WYYA 1BULA 3BWLA 4F3LA 1K0KA 3CUEA 3QP4A 1SKFA 2NUTC 3LR0A 1J9MA 3JPUA 1KGGA 2WKQA 2HDRA 2KLIA 3WRTA 4GNUA 4MBFA 4EWFA 4PPRA 2ZJ9A 1XA1A 4K08A 3NECA 4R23A 4GS9B 1SDNA 4KQDA 3GR2A 2VZWA 3CWFA 4ZDXA 2WKPA 5CHMA 2PD7A 3NDGA 4XXRA 3N4IA 4OONA 1YPRA 1FR1A 2W0NA 4PM5A 2A49A 4O01A 2R9WA 3LI8A 1WYCA 4WZ5A 2G2UA 3Q7VA 1OPXA 3B3XA 3CI6A 3PYPA 2YKHA 5C5KA 2GZAA 3UB7A 1PYYA 3VFHA 1NLZA 3KYZA 3MZEA 5EPHA 1JVJA 3IX3A 3ZG5A 3G35A 2ZQ8A 2W3FA 2JKFA 4BMWA 5DJTA 2PYRA 5HD5A 2XH9A 4N9KA 3LIEA 2JKTI 1S67L 4PKYG 3C7UA 3ZG7B 1RGZA 2B5RA 3OLOA 2Y2QA 5D3OA 2XEPA 3OBFA 4MBKA 4XUZA 2JC7A 2X71A 5DKLA 3OZHA 5FQIA 1H5XA 1H8YA 4H6JB 4LRZE 2V2FF 2W1TB 3IXGA 1A0KA 4B9OA 3IQAA 5GHZA 3GVBA 2H28A 1NZUA 5FA7A 1T1AA 4E6WA 4X55A 3SS5A 1FR6A 3P98A 5I5LA 2H0TA 2HPBA 3HJIA 3EEAA 2XGNA 3EWKA 4HP9A 2FZ0A 4BJPA 4PM9A 1KGFA 1ZHHB 2XA7S 4EQ1A 3MXRA 3ZGAB 2ZM8A 4D60A 4G3WA 3DTEA 4FSFA 3GSGA 4I39A 4ESPA 5HW3A 3T1QB 3N6IA 3BFFA 3NOPC 4HBTA 4OQHA 2O9BA 4WM9A 5KIZA 1P0ZA 2V1ZA 3MJQA 3MQOA 1BYWA 1LL5A 1YLJA 3UPNA 4PKYA 4EESA 3IF6B 1XFNA 3GQZA 1VQQA 1LSVA 4EQIA 3IF5A 4GKUA 3DTMA 3T50A 4Y2FA 4R4SA 4WZ4A 2WZXA 3GRJA 4GJ4A 1DJCA 1MWTA 3MS6A 5J3WA 3ZVWA 2OAQ1 5CX7A 1ES5A 4RX2A 1K57C 3HLCA 1SCWA 2ZOIA 1T1CA 1CF0A 2ZC4B 3IT9A 2JKRM 2O99A 4GN2A 1TD5A 1K55A 1YSPA 3M2JA 1Q2QA 4Y13A 4IBRA 3O87A 1W63M 3MQ0A 1NRJA 1PNEA 2VGLM 1KDWA 5L10A 3I7JA 3NOUC 5FQJA 4HBUA 3ZVTA 5HWVA 3HLDA 4PHTA 3BLMA 2VV7A 2LB5A 1IOUA 3NBLA 4JPMA 2P7JA 5AJGA 2FFYA 2GX5A 4S2NA 5FATA 4CQHA 4NG2A 4QJGA 2PDRA 1FCOA 4QD4A 4WZ5C 5HPFA 4EUVA 1FCMA 1FCNA 1TS8A 3LY3A 1JWZA 5GHXA 2UWXA 1D06A 4KUKA 3ITBA 1K54A 4OKPA 4UHUA 4GB7A 4Y3IA 1W8QA 2WZZA 2HV1A 2R78A 3DBAA 3DTIA 3ZNYA 3QHYA 4QU3A 5FEGA 3DWZA 2PU2A 5BOHA 3VSKA 5HSQA 4R3BA 3JYIA 5FDSA 1TF1A 2HP5A 2P9VA 4EETB 2V9AA 4QPRA 5DKKA 3SZTA 1MY8A 3ZHHA 3F1NA 3ZG0A 3T4TA 4HHDA 4H8RA 4E3JA 3MMHA 1OTAA 4DF6A 5DF9A 2XD1A 3A3JA 3K3CA 3V39A 3FYZA 4OQIA 1FQGA 1ZKJA 3ZNTA 4JGPA 4KZAA 2Y2HA 3S22A 1TVFA 2Q0OA 5EVEA 2BLSA 2JBFA 4E3NA 2ZC3B 2OOLA 4I3IA 4C3QA 3DWKA 2WKRA 4LV2A 3IH8A 2RCXA 2P08A 2Z6CA 2EX9A 2WKIA 2EFUA 4GHIB 4ZJ2A 4JXVA 2ZLYA 4JGQA 1TS7A 2VGKA 4KENB 3M6BA 4B4ZA 4EEUA 4R3AA 2ZMVA 2ZQ9A 4PMAA 4UQIS 2V20A 2JKGA 4KG6A 4XUXA 5CRFA 1KVLA 2QPNA 3T4JA 3BY9A 3LI9A 1KE4A 3BLSA 3O88A 5HWWA 1T19A 3A0SA 1M40A 3PAEA 2XD5A 1IYSA 2HDSA 4MMNA 4E6XA 4JKTA 3SS4A 5DVAA 1NZOA 3R4KA 5DF7A 2BTFP 5F83A 1LI9A 5GHYA 4DN0A 1CI8A 3UB6A 3LYXA 3ITAA 4JBFA 3PBQA 4NEED 4ZJ3A 3T1XA 4ZAMA 1OJGA 2Y2IA 4UA6A 3WS0A 3HVFA 3MFXA 4HI4A 5E43A 4HP4A 3FG8A 2OWHA 3KSGA 3PXPA 3HUMA 4OPZA 2I72A 3WWXA 4R6LA 1MC0A 3E0YA 4MCWA 3TW8A 1FIKA 3OPPA 1FILA 4MNRA 3NULA 5CTMA 3VP0A 4LENA 1H3QA 3UE0A 2C5WB 2V1BA 4MBHA 1Y28A 3EOIA 2HDQA 3NC8A 3H7WA 4MEZA 3RH8B 5KSHA 1SDEA 4WELA 2PBYA 3FZCA 5EV0A 1MKMA 2R9XA 4LV3A 3DTKA 2JKRI 1OT9A 5A91A 3JVVA 4OH0A 1VEUA 3UB9A 3QNBA 3OPLA 3C4PA 1BLPA 4DE0A 4JXWA 3F1OA 1IKIA 1XA7A 2OWJA 3BQAA 4N1HA 4Z9QA 3T4QA 2Y91A 2J3WA 1YLYA 4OP8A 1TDLA 1PW8A 1K54C 4NK3A 1HTZA 5EVIC 2Y2MA 3BY8A 4L9EA 2M7VA 1FSWA 3RJUA 4S2MA 1YMXA 4WMCD 5I94A 4IEDA 4KZ3A 3OC2A 3E98A 1XXMA 3B33A 4HH3A 2ZM2A 4Y0UA 4HQAA 3A3EA 1OTBA 1DJAA 3KSFA 2WUQA 3PHYA 4Y17A 1G6OA 4GLQA 5CECA 1JWVA 3ZYTA 2ZQAA 4X6TA 5HARA 3IH9A 2G2WA 1GSXA 3G2YA 3H82B 3TSGA 4E3KA 1PWGA 4HNBA 4LGWA 2IWBA 2GJ3A 2QZ6A 5G4ZA 2QYBA 2ZC5B 3AGFA 4BENA 5TFQA 1E3UA 4F3LB 3UNWA 3IWOA 5GLCA 1BZAA 3IXBA 4B93A 3Q7ZA 3MKEA 4M3KA 5HD3A 3U2AA 3T4SA 5J4EA 1S6RA 1VETA 4KZ4A 3OPRA 1PZPA 4JGOA 4LCMA 4P6BA 3UO9A 4LV1A 4E3LA 4IVIA 3HUOA 2W3DA 1UGUA 5E2FA 4GW9A 2WK0A 5JYPA 2ZQCA 3UMEA 3Q7VB 5FAPA 4O0PA 2VJWA 2EXBA 3GMWA 2ZBBA 2G7UA 1OT6A 1N9OA 5HL6A 3LICA 1W63Q 3QP8A 1L0GA 4PM8A 4ARZA 3B47A 1S4SA 3C7VA 3VP3A 1OTIA 2Y2GA 2O9AA 3C2WA 4EBNA 5AVEA 2DCFA 5GLDA 1EWZA 3LIBA 3ZDJA 3BM6A 2VX8A 4E3OA 1XFQA 2X01A 3MZFA 3IBJA 1TDGA 5L07A 3RFBA 3UPPA 1W5DA 4U0TA 4P0MA 4DXCA 1QMFA 2QJ7A 5TBMA 2DMWA 4ZTKA 5FASA 4DKIA 3NOTC 4KG2A 3EQVA 5EOOA 2Y2KA 1CEGA 4R38A 4QY5A 1GHIA 3NDEA 3TRCA 1Z6FA 2EFXA 4Q0HA 1NYMA 4DE3A 3KYQA 4RA7A 3HJKA 2B95A 1F9IA 1F5MA 2M1CA 1ES4A 4PAUA 1E3UD 2PR6A 3V3SA 1J3WA 5FQMA 2W3HA 3W2ZA 2XR0A 1W7FA 3GDIA 1GA9A 1ZG4A 1X0OA 4DJ2A 3W4QA 3IWIA 2CC1A 5IU1A 4KZBA 4FCFA 1NJ4A 1LSWA 3PBOA 1ERQA 2M7UA 3BFEA 5HAQA 4YOFA 4OPQA 1YT4A 1MPLA 3UB8A 1YMSA 5J8XA 3ZFZA 2Y4AA 1V9ZA 3BECA 4U3TA 3IXHA 1ESIA 4OQGA 3GV9A 2OV5A 3MR0A 1L2SA 1UWPX 4Y0TA 2IWCA 1GHMA 2HP6A 1BTLA 4HY8A 2WGWA 2QMIA 3D3OA 3L9KA 4P6ZS 5FAOA 1JNUA 5DJUA 1S4RA 1BT5A 3JVUA 4MN6A 3ZG8B 1I2WA 5DTKA 1XX2A 4X56A 2L1MA 1KGEA 3BFDA 2KDKA 5F6AA 3TOIA 4G3KA 4KUOA 2VK3A 3VP4A 2XQZA 1MZUA 1RP5A 3T12B 4E3IA 3T4LA 3CPTA 2MJ6A 4HIAA 5AQBA 1Q2PA 3VOZA 3HREA 1MWSA 3NI9A 2HJ9C 3E2KA 3UN7A 5CGSA 4Y7PA 3A3DA 3N8LA 1ALQA 3VSLA 5TR7A 2Y8HA 4OOLA 1DP9A 4LFUA 1ES2A 2OLVA 2QJ5A 4MLLA 1GHPA 2J9OA 1YLPA 5EM1A 4DMZA 5HZHA 1V9YA 4ME4A 2XRNA 3LFVA 2AVXA 3VV4A 1LHYA 2PT7A 1LI0A 4HOIA 5TJJA 3W4PA 1UWNX 4EV4A 1KE0A 4R70A 1VHMA 4S2IA 4DDYA 5CXWA 1N4OA 4Z1WA 5CGXA 3S4XA 1HZOA 5IS1A 3Q07A 2WADA 3LO7A 1GCEA 5CTNA 4DJ3A 4FD8A 3VP2A 2XA7M 5FQQA 3F1PA 5EM0A 3LEZA 3LIAA 4OLDA 5E2EA 1KDSA 5HFOA 5CERA 2ZOHA 5EVIA 1AXBA 2RL3A 4GD6A 4N92A 5EE8A 2BG1A 3QP2A 1O7EA 4WUJA 3VE3A 1YAXA 2P9VB 4LPZA 1TEMA 5GLBA 3F1NB 2PD8A 3D4FA 5FI2A 4C6YA 3AGDA 3S7OA 1TS0A 5EECA 5CGWA 1G28A 4XT2A 5F1FA 4KQOA 2B18A 3BJNA 4GCZA 3IS2A 1Z09A 3LY4A 3QP1A 5F68A 4DXBA 5A8BA 1P9RA 1WE4A 5E2HA 3QNCA 4EXOA 1PW1A 3D9YA 4G3VA 3Q82A 1BLSA 1PI4A 3HLGA 4Y5FA 1NYYA 3B42A 2J80A 1I2SA 2ZQDA 2H5SA 3NY4A 1ES3A 4Y15A 2PAVP 1P9WA 2VV6A 4X1LA 2VV8A 4UAAA 1S1ZA 2XLNA 2BASA
chains in the Genus database with same CATH topology
4R0QA 2XH9A 1IYOA 1HVBA 3N7WA 4N9KA 1YMXA 4S2MA 4WMCD 5I94A 3C4OA 4IEDA 2WKHA 4U0XA 3C7UA 3N8SA 3Q1FA 3M2KA 4KZ3A 3O86A 4UA9A 5FDHA 3ZG7B 1K6RA 1E4DA 1RGZA 3OC2A 1K25A 3MFDA 1ONGA 4R1GA 3IXDA 1XXMA 2B5RA 5M1AA 4OQ0A 2XF3A 2Y2QA 5D3OA 4X53A 2ZM2A 1YQSA 1RGYA 2A3UA 4Y0UA 3A3EA 2XEPA 4MBKA 1DJAA 2XFSA 4XUZA 2WUQA 2JC7A 2X71A 4WEKA 1XP4A 1IYQA 3WS5A 5FAQA 4BL2A 5CECA 5F82A 3UPOA 3OZHA 5FI7A 1JWVA 1H5XA 4N9LA 5FQIA 1H8YA 2ZQAA 4X6TA 5HARA 3W8KA 3IH9A 5EVIB 2G2WA 1MBLA 4OVDA 1IEMA 2V2FF 5EVID 3UDXA 3IXGA 3G2YA 1G68A 3O3VA 5FQ9A 3TSGA 4E3KA 1PWGA 2Y2NA 1LLBA 3IQAA 1S0WA 5GHZA 3GVBA 5DTSA 1OMEA 1NZUA 3IHAA 2IWBA 2QZ6A 5FA7A 4GZBA 4E6WA 2ZC5B 3AGFA 3UDFA 4X55A 3A3FA 5TFQA 4BENA 3SS5A 1E3UA 3TG9A 1FR6A 3LCEA 3UNWA 3P98A 1W79A 2EX8A 5E2GA 2WKEA 1BSGA 3IWOA 5M19A 5GLCA 2H0TA 2HPBA 5F1GA 1BZAA 5KZHA 3IXBA 2WAEA 2XGNA 1L0DA 4NETA 1LL9A 3NCKA 4RVAA 2FFFB 3BRMA 3UY6A 3Q7ZA 4X68A 4PM9A 4YFMA 4BJPA 3MKEA 4A5RA 1MKIA 4M3KA 5CHJA 1KGFA 1KVMA 1S6RA 3MXRA 4JXSA 4KZ4A 1XPBA 3ZGAB 3OPRA 1PZPA 3MBZA 2ZM8A 3NIAA 4LCMA 4P6BA 4R3JA 4FSFA 3GSGA 4LV1A 3UO9A 2IWDA 2WAFA 4JLFA 4PM6A 4DE2A 4E3LA 5HW3A 3N6IA 3BFFA 3UDIA 3GTCA 4Q8IA 2Z2MB 4L0LA 3Q81A 4IVIA 3HUOA 4HBTA 1DY6A 3ZG9B 5FSRA 4OQHA 2ZQ7A 4WM9A 4BL3A 2WGVA 2V1ZA 3G30A 4OPRA 1LL5A 4X69A 5E2FA 1YLJA 3UPNA 4D2OA 2EX2A 3AGEA 2WK0A 5JYPA 2EX6A 4B88A 5L2FA 2ZQCA 3IF6B 3Q7VB 5EOEA 3GQZA 5FAPA 2EXBA 3GMWA 4K0WA 1VQQA 4EQIA 3IF5A 3G34A 5CEDA 4GKUA 3DTMA 4R4SA 4WZ4A 2WZXA 2Y2LA 1MXOA 2HP9A 3BYDA 3GRJA 4PM8A 4S2JA 1L0GA 5HL1A 1DJCA 2OSUA 3SH7A 1MWTA 4HEFA 3ZVWA 5M18A 3C7VA 3VP3A 1GA0A 2Y2GA 4EBNA 4EUZA 1ES5A 4RX2A 1K57C 2DCFA 3HLCA 1EWZA 1SCWA 5GLDA 5KMWA 2JCHA 3ZDJA 2ZC4B 3BM6A 3IT9A 4GOGA 4GN2A 4E3OA 3G4PA 2X01A 4GD8A 3MZFA 1TDGA 1K55A 3UPPA 3BFCA 1W5DA 4WEJA 3M2JA 1Q2QA 4U0TA 4ID4A 3ZCZA 1K4EA 1YLZA 4JF5A 4P0MA 4DXCA 1QMFA 4QHCA 5HX9A 4IBXA 4IBRA 5BOHA 4ZTKA 4BLMA 3O87A 5FASA 1ONHA 5HAIA 2WYXA 1JWPA 4GDNA 4DKIA 3VMAA 5GL9A 2J7VA 4KG2A 3EQVA 3FKWA 5EOOA 2Y2KA 1CEGA 4FH4A 5CEBA 4S2KA 1KDWA 3VOYA 1ERMA 3I7JA 4QY5A 5CHUA 4ZBEA 1GHIA 3BFGA 3NDEA 4C75A 1Z6FA 3PBTA 5FQJA 2DRWA 3MXSA 4HBUA 2EFXA 2H0YA 1NYMA 4DE3A 3ZVTA 1ZC2A 4O7DA 4RA7A 1PI5A 3HLDA 4N1XA 1G6AA 1ES4A 1H8ZA 2P74A 2C6WB 3BLMA 1O07A 1SHVA 3WS1A 1BLCA 1E3UD 4KZ7A 4WMCA 3OCLA 3NBLA 3UE1A 4JPMA 5EUAA 3V3SA 2H10A 3N8RA 1VM1A 3E2LA 3V3RA 5FQMA 5HAPA 1BUEA 5A90A 2FFYA 5FQKA 4S2NA 3FV7A 5FATA 2XR0A 1W7FA 4QJGA 1GA9A 3EQUA 3CG5A 4QB8A 1RCJA 1FSYA 1L0FA 1ZG4A 1FCOA 4FH2A 4QD4A 3PAGA 3W4QA 3IWIA 5A93A 1E25A 2CC1A 3IF6C 4WZ5C 2J9PA 1K56A 5AQ7A 1FCMA 1FCNA 1K6SA 4KZBA 4CJNA 3LY3A 1MWUA 1IELA 3MKFA 3PBRA 4FCFA 1JWZA 1NJ4A 3G32A 5GHXA 3PBOA 1IKGA 1ERQA 2UWXA 5HAQA 3BFEA 3SH8A 1N9BA 3ITBA 3IHBA 1K54A 3W4OA 4OPQA 1YT4A 4OKPA 3PBNA 4KQRA 4GB7A 4UHUA 1MPLA 2E8IA 1W8QA 2WZZA 2VGJA 1YMSA 5J8XA 3ZFZA 2Y4AA 1K55C 4KZ8A 2J8YA 4OOYA 3C5AA 3RXXA 3ZNYA 3QHYA 4QU3A 3BECA 5TGFA 3DWZA 4U3TA 4F94A 3IXHA 4LCLA 5DF8A 1DJBA 2PU2A 4KZ9A 4OPYA 1XGIA 1M6KA 4JF4A 4LV0A 3JYIA 1ESIA 4R3BA 3VSKA 4HESA 4OQGA 5IHVA 2HP5A 3GV9A 2OV5A 4BQMA 2OLUA 1L2SA 1JTDA 5EVLA 2IWCA 2Z2LB 2P9VA 4Y0TA 1GHMA 2HP6A 2Y2PA 1BTLA 4K91A 2WGWA 1MY8A 3ZHHA 3ZG0A 3HLWA 2QMIA 1KE3A 4RYEA 1YLWA 4S2PA 5FAOA 1CI9A 4H8RA 4E3JA 1BT5A 2EXAA 3OPHA 3ZG8B 4DF6A 3CJMA 5DF9A 1BLHA 1QMEA 3FWLA 2XD1A 1I2WA 3A3JA 4OP5A 3VFFA 5DTKA 1XX2A 4X56A 3UE3A 3BEBA 1KGEA 3BFDA 3V39A 1MWRA 3FYZA 2DNSA 3TOIA 1PWDA 4OQIA 1FQGA 4QY6A 4GDBA 3IWQA 1NXYA 3VP4A 1ZKJA 4S2OA 3ZNTA 4KZAA 2XQZA 4EBPA 1RP5A 2Y2HA 1K38A 2ZC7A 3DW0A 4E3IA 1WYBA 4S2NC 3PTEA 3S1YA 2ZD8A 5GLAA 4WBGA 3S22A 2XK1A 5AQBA 3HBRA 1Q2PA 1TVFA 2Y59A 4P85A 3VOZA 1C3BA 1XGJA 4KQQA 4DRTA 1CK3A 2BLSA 2ZMAA 2JBFA 1W8YA 3HREA 3P09A 4E3NA 2ZC3B 1MWSA 3NI9A 3A3IA 4C3QA 3DWKA 3HL9A 4LV2A 4OLGA 3E2KA 3IH8A 2RCXA 3MZDA 3UN7A 3WRZA 5CGSA 2EX9A 4UA7A 2WKIA 4Y7PA 5JYOA 2EFUA 3A3DA 4ZJ2A 4JXVA 3N8LA 1ALQA 4YINA 2ZLYA 2VGKA 3VSLA 4KZ5A 4KENB 5TR7A 3V5MA 1ZG6A 4OOLA 3CMZA 3M6BA 2GDNA 5G18A 4B4ZA 5AQAA 1ESUA 1ES2A 2OLVA 2Q9NA 2ZQ9A 4MLLA 3HLBA 1JTGA 1GHPA 2J9OA 1YLPA 4PMAA 3RXWA 2V20A 4XUXA 4KG6A 5CRFA 5AQ9A 1KVLA 2QPNA 3HLEA 4KZ6A 3WS2A 3SH9A 4K0XA 1YM1A 2JE5A 3OCNA 4EBLA 1KE4A 3SS3A 3BLSA 1LHYA 2WGIA 1LI0A 3O88A 3W4PA 4B4XA 4DE1A 4IVKA 1PWCA 4EV4A 3G2ZA 1EI5A 4P87A 1KE0A 1CEFA 1M40A 1K56D 4CPKA 4DDSA 3PAEA 2XD5A 3HLFA 1IYSA 3M6HA 2HDSA 4S2IA 3V50A 4BD1A 5CXWA 4DDYA 1N4OA 4E6XA 5CGXA 3S4XA 4JKTA 1HZOA 1PIOA 3SS4A 5DVAA 3G31A 3Q07A 1XKZA 2WADA 3WS4A 1NZOA 3LO7A 1GCEA 1K57A 4S2LA 5CTNA 5DF7A 5A92A 1PZOA 5F83A 4FD8A 1LI9A 3VP2A 2XFTA 5FQQA 5GHYA 1CI8A 2Y2OA 2X02A 3LEZA 4KG5A 4PM7A 4OLDA 5E2EA 1KDSA 5HFOA 1EROA 3ITAA 3HUNA 5CERA 1NRFA 3CZDA 4JBFA 3PBQA 1AXBA 1I5QA 5EVIA 4ZJ3A 2Y2JA 2RL3A 4RX3A 4GD6A 1IYPA 4N92A 4OOMA 5EE8A 2BG1A 1O7EA 4ZAMA 2Y2IA 4UA6A 3WS0A 3HVFA 5E43A 5FI6A 2PU4A 2Y55A 2P9VB 1K4FA 2ZM0A 1TEMA 1FOFA 1U60A 1BULA 4WYYA 3HUMA 2WGWB 5GLBA 3D4FA 2XDMA 4OPZA 5FI2A 4C6YA 2I72A 3WWXA 1SKFA 1J9MA 3FKVA 1KGGA 3AGDA 2HDRA 5EECA 3WRTA 3OPPA 4GNUA 4MBFA 4EWFA 4MNRA 5CGWA 4E3MA 4PPRA 5F1FA 4KQOA 2ZJ9A 5CTMA 1XA1A 3VP0A 3LY4A 4LENA 4ZJ1A 3UE0A 4DXBA 4R23A 2C5WB 4MBHA 1WE4A 1SDNA 1YLTA 2HDQA 4JF6A 3NC8A 1NY0A 3GR2A 4MEZA 5DTTA 5KSHA 1SDEA 4WELA 1Y54A 5E2HA 3QNCA 2PBYA 3SOIA 3FZCA 4ZDXA 1PW1A 5CHMA 2HDUA 2R9XA 3NDGA 4LV3A 4XXRA 3N4IA 4OONA 5A91A 4OH0A 1FR1A 3PBSA 3Q82A 1BLSA 5U47A 4PM5A 1L0EA 1PI4A 2A49A 3HLGA 3QNBA 2R9WA 1NYYA 4BD0A 3OPLA 1WYCA 2G2UA 3C4PA 3IF6A 4R4RA 1HD8A 1I2SA 4WZ5A 1BLPA 3Q7VA 2ZQDA 4DE0A 2H5SA 3B3XA 4JXWA 3VP1A 3NY4A 5KSCA 1ES3A 1IKIA 1XA7A 4N1HA 4Y0OA 4Z9QA 2Y91A 1YLYA 2Q9MA 3ISGA 1PYYA 4OP8A 3VFHA 5EPHA 3MZEA 4JXGA 1JVJA 1TDLA 3ZG5A 2ZC6B 1PW8A 3G35A 1K54C 2ZQ8A 4NK3A 1HTZA 5EVIC 2Y2MA 4UAAA 1FSWA 3RJUA 2XLNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R0Q A;  2XH9 A;  1IYO A;  1HVB A;  3N7W A;  4N9K A;  1YMX A;  4S2M A;  4WMC D;  5I94 A;  3C4O A;  4IED A;  2WKH A;  4U0X A;  3C7U A;  3N8S A;  3Q1F A;  3M2K A;  4KZ3 A;  3O86 A;  4UA9 A;  5FDH A;  3ZG7 B;  1K6R A;  1E4D A;  1RGZ A;  3OC2 A;  1K25 A;  3MFD A;  1ONG A;  4R1G A;  3IXD A;  1XXM A;  2B5R A;  5M1A A;  4OQ0 A;  2XF3 A;  2Y2Q A;  5D3O A;  4X53 A;  2ZM2 A;  1YQS A;  1RGY A;  2A3U A;  4Y0U A;  3A3E A;  2XEP A;  4MBK A;  1DJA A;  2XFS A;  4XUZ A;  2WUQ A;  2JC7 A;  2X71 A;  4WEK A;  1XP4 A;  1IYQ A;  3WS5 A;  5FAQ A;  4BL2 A;  5CEC A;  5F82 A;  3UPO A;  3OZH A;  5FI7 A;  1JWV A;  1H5X A;  4N9L A;  5FQI A;  1H8Y A;  2ZQA A;  4X6T A;  5HAR A;  3W8K A;  3IH9 A;  5EVI B;  2G2W A;  1MBL A;  4OVD A;  1IEM A;  2V2F F;  5EVI D;  3UDX A;  3IXG A;  3G2Y A;  1G68 A;  3O3V A;  5FQ9 A;  3TSG A;  4E3K A;  1PWG A;  2Y2N A;  1LLB A;  3IQA A;  1S0W A;  5GHZ A;  3GVB A;  5DTS A;  1OME A;  1NZU A;  3IHA A;  2IWB A;  2QZ6 A;  5FA7 A;  4GZB A;  4E6W A;  2ZC5 B;  3AGF A;  3UDF A;  4X55 A;  3A3F A;  5TFQ A;  4BEN A;  3SS5 A;  1E3U A;  3TG9 A;  1FR6 A;  3LCE A;  3UNW A;  3P98 A;  1W79 A;  2EX8 A;  5E2G A;  2WKE A;  1BSG A;  3IWO A;  5M19 A;  5GLC A;  2H0T A;  2HPB A;  5F1G A;  1BZA A;  5KZH A;  3IXB A;  2WAE A;  2XGN A;  1L0D A;  4NET A;  1LL9 A;  3NCK A;  4RVA A;  2FFF B;  3BRM A;  3UY6 A;  3Q7Z A;  4X68 A;  4PM9 A;  4YFM A;  4BJP A;  3MKE A;  4A5R A;  1MKI A;  4M3K A;  5CHJ A;  1KGF A;  1KVM A;  1S6R A;  3MXR A;  4JXS A;  4KZ4 A;  1XPB A;  3ZGA B;  3OPR A;  1PZP A;  3MBZ A;  2ZM8 A;  3NIA A;  4LCM A;  4P6B A;  4R3J A;  4FSF A;  3GSG A;  4LV1 A;  3UO9 A;  2IWD A;  2WAF A;  4JLF A;  4PM6 A;  4DE2 A;  4E3L A;  5HW3 A;  3N6I A;  3BFF A;  3UDI A;  3GTC A;  4Q8I A;  2Z2M B;  4L0L A;  3Q81 A;  4IVI A;  3HUO A;  4HBT A;  1DY6 A;  3ZG9 B;  5FSR A;  4OQH A;  2ZQ7 A;  4WM9 A;  4BL3 A;  2WGV A;  2V1Z A;  3G30 A;  4OPR A;  1LL5 A;  4X69 A;  5E2F A;  1YLJ A;  3UPN A;  4D2O A;  2EX2 A;  3AGE A;  2WK0 A;  5JYP A;  2EX6 A;  4B88 A;  5L2F A;  2ZQC A;  3IF6 B;  3Q7V B;  5EOE A;  3GQZ A;  5FAP A;  2EXB A;  3GMW A;  4K0W A;  1VQQ A;  4EQI A;  3IF5 A;  3G34 A;  5CED A;  4GKU A;  3DTM A;  4R4S A;  4WZ4 A;  2WZX A;  2Y2L A;  1MXO A;  2HP9 A;  3BYD A;  3GRJ A;  4PM8 A;  4S2J A;  1L0G A;  5HL1 A;  1DJC A;  2OSU A;  3SH7 A;  1MWT A;  4HEF A;  3ZVW A;  5M18 A;  3C7V A;  3VP3 A;  1GA0 A;  2Y2G A;  4EBN A;  4EUZ A;  1ES5 A;  4RX2 A;  1K57 C;  2DCF A;  3HLC A;  1EWZ A;  1SCW A;  5GLD A;  5KMW A;  2JCH A;  3ZDJ A;  2ZC4 B;  3BM6 A;  3IT9 A;  4GOG A;  4GN2 A;  4E3O A;  3G4P A;  2X01 A;  4GD8 A;  3MZF A;  1TDG A;  1K55 A;  3UPP A;  3BFC A;  1W5D A;  4WEJ A;  3M2J A;  1Q2Q A;  4U0T A;  4ID4 A;  3ZCZ A;  1K4E A;  1YLZ A;  4JF5 A;  4P0M A;  4DXC A;  1QMF A;  4QHC A;  5HX9 A;  4IBX A;  4IBR A;  5BOH A;  4ZTK A;  4BLM A;  3O87 A;  5FAS A;  1ONH A;  5HAI A;  2WYX A;  1JWP A;  4GDN A;  4DKI A;  3VMA A;  5GL9 A;  2J7V A;  4KG2 A;  3EQV A;  3FKW A;  5EOO A;  2Y2K A;  1CEG A;  4FH4 A;  5CEB A;  4S2K A;  1KDW A;  3VOY A;  1ERM A;  3I7J A;  4QY5 A;  5CHU A;  4ZBE A;  1GHI A;  3BFG A;  3NDE A;  4C75 A;  1Z6F A;  3PBT A;  5FQJ A;  2DRW A;  3MXS A;  4HBU A;  2EFX A;  2H0Y A;  1NYM A;  4DE3 A;  3ZVT A;  1ZC2 A;  4O7D A;  4RA7 A;  1PI5 A;  3HLD A;  4N1X A;  1G6A A;  1ES4 A;  1H8Z A;  2P74 A;  2C6W B;  3BLM A;  1O07 A;  1SHV A;  3WS1 A;  1BLC A;  1E3U D;  4KZ7 A;  4WMC A;  3OCL A;  3NBL A;  3UE1 A;  4JPM A;  5EUA A;  3V3S A;  2H10 A;  3N8R A;  1VM1 A;  3E2L A;  3V3R A;  5FQM A;  5HAP A;  1BUE A;  5A90 A;  2FFY A;  5FQK A;  4S2N A;  3FV7 A;  5FAT A;  2XR0 A;  1W7F A;  4QJG A;  1GA9 A;  3EQU A;  3CG5 A;  4QB8 A;  1RCJ A;  1FSY A;  1L0F A;  1ZG4 A;  1FCO A;  4FH2 A;  4QD4 A;  3PAG A;  3W4Q A;  3IWI A;  5A93 A;  1E25 A;  2CC1 A;  3IF6 C;  4WZ5 C;  2J9P A;  1K56 A;  5AQ7 A;  1FCM A;  1FCN A;  1K6S A;  4KZB A;  4CJN A;  3LY3 A;  1MWU A;  1IEL A;  3MKF A;  3PBR A;  4FCF A;  1JWZ A;  1NJ4 A;  3G32 A;  5GHX A;  3PBO A;  1IKG A;  1ERQ A;  2UWX A;  5HAQ A;  3BFE A;  3SH8 A;  1N9B A;  3ITB A;  3IHB A;  1K54 A;  3W4O A;  4OPQ A;  1YT4 A;  4OKP A;  3PBN A;  4KQR A;  4GB7 A;  4UHU A;  1MPL A;  2E8I A;  1W8Q A;  2WZZ A;  2VGJ A;  1YMS A;  5J8X A;  3ZFZ A;  2Y4A A;  1K55 C;  4KZ8 A;  2J8Y A;  4OOY A;  3C5A A;  3RXX A;  3ZNY A;  3QHY A;  4QU3 A;  3BEC A;  5TGF A;  3DWZ A;  4U3T A;  4F94 A;  3IXH A;  4LCL A;  5DF8 A;  1DJB A;  2PU2 A;  4KZ9 A;  4OPY A;  1XGI A;  1M6K A;  4JF4 A;  4LV0 A;  3JYI A;  1ESI A;  4R3B A;  3VSK A;  4HES A;  4OQG A;  5IHV A;  2HP5 A;  3GV9 A;  2OV5 A;  4BQM A;  2OLU A;  1L2S A;  1JTD A;  5EVL A;  2IWC A;  2Z2L B;  2P9V A;  4Y0T A;  1GHM A;  2HP6 A;  2Y2P A;  1BTL A;  4K91 A;  2WGW A;  1MY8 A;  3ZHH A;  3ZG0 A;  3HLW A;  2QMI A;  1KE3 A;  4RYE A;  1YLW A;  4S2P A;  5FAO A;  1CI9 A;  4H8R A;  4E3J A;  1BT5 A;  2EXA A;  3OPH A;  3ZG8 B;  4DF6 A;  3CJM A;  5DF9 A;  1BLH A;  1QME A;  3FWL A;  2XD1 A;  1I2W A;  3A3J A;  4OP5 A;  3VFF A;  5DTK A;  1XX2 A;  4X56 A;  3UE3 A;  3BEB A;  1KGE A;  3BFD A;  3V39 A;  1MWR A;  3FYZ A;  2DNS A;  3TOI A;  1PWD A;  4OQI A;  1FQG A;  4QY6 A;  4GDB A;  3IWQ A;  1NXY A;  3VP4 A;  1ZKJ A;  4S2O A;  3ZNT A;  4KZA A;  2XQZ A;  4EBP A;  1RP5 A;  2Y2H A;  1K38 A;  2ZC7 A;  3DW0 A;  4E3I A;  1WYB A;  4S2N C;  3PTE A;  3S1Y A;  2ZD8 A;  5GLA A;  4WBG A;  3S22 A;  2XK1 A;  5AQB A;  3HBR A;  1Q2P A;  1TVF A;  2Y59 A;  4P85 A;  3VOZ A;  1C3B A;  1XGJ A;  4KQQ A;  4DRT A;  1CK3 A;  2BLS A;  2ZMA A;  2JBF A;  1W8Y A;  3HRE A;  3P09 A;  4E3N A;  2ZC3 B;  1MWS A;  3NI9 A;  3A3I A;  4C3Q A;  3DWK A;  3HL9 A;  4LV2 A;  4OLG A;  3E2K A;  3IH8 A;  2RCX A;  3MZD A;  3UN7 A;  3WRZ A;  5CGS A;  2EX9 A;  4UA7 A;  2WKI A;  4Y7P A;  5JYO A;  2EFU A;  3A3D A;  4ZJ2 A;  4JXV A;  3N8L A;  1ALQ A;  4YIN A;  2ZLY A;  2VGK A;  3VSL A;  4KZ5 A;  4KEN B;  5TR7 A;  3V5M A;  1ZG6 A;  4OOL A;  3CMZ A;  3M6B A;  2GDN A;  5G18 A;  4B4Z A;  5AQA A;  1ESU A;  1ES2 A;  2OLV A;  2Q9N A;  2ZQ9 A;  4MLL A;  3HLB A;  1JTG A;  1GHP A;  2J9O A;  1YLP A;  4PMA A;  3RXW A;  2V20 A;  4XUX A;  4KG6 A;  5CRF A;  5AQ9 A;  1KVL A;  2QPN A;  3HLE A;  4KZ6 A;  3WS2 A;  3SH9 A;  4K0X A;  1YM1 A;  2JE5 A;  3OCN A;  4EBL A;  1KE4 A;  3SS3 A;  3BLS A;  1LHY A;  2WGI A;  1LI0 A;  3O88 A;  3W4P A;  4B4X A;  4DE1 A;  4IVK A;  1PWC A;  4EV4 A;  3G2Z A;  1EI5 A;  4P87 A;  1KE0 A;  1CEF A;  1M40 A;  1K56 D;  4CPK A;  4DDS A;  3PAE A;  2XD5 A;  3HLF A;  1IYS A;  3M6H A;  2HDS A;  4S2I A;  3V50 A;  4BD1 A;  5CXW A;  4DDY A;  1N4O A;  4E6X A;  5CGX A;  3S4X A;  4JKT A;  1HZO A;  1PIO A;  3SS4 A;  5DVA A;  3G31 A;  3Q07 A;  1XKZ A;  2WAD A;  3WS4 A;  1NZO A;  3LO7 A;  1GCE A;  1K57 A;  4S2L A;  5CTN A;  5DF7 A;  5A92 A;  1PZO A;  5F83 A;  4FD8 A;  1LI9 A;  3VP2 A;  2XFT A;  5FQQ A;  5GHY A;  1CI8 A;  2Y2O A;  2X02 A;  3LEZ A;  4KG5 A;  4PM7 A;  4OLD A;  5E2E A;  1KDS A;  5HFO A;  1ERO A;  3ITA A;  3HUN A;  5CER A;  1NRF A;  3CZD A;  4JBF A;  3PBQ A;  1AXB A;  1I5Q A;  5EVI A;  4ZJ3 A;  2Y2J A;  2RL3 A;  4RX3 A;  4GD6 A;  1IYP A;  4N92 A;  4OOM A;  5EE8 A;  2BG1 A;  1O7E A;  4ZAM A;  2Y2I A;  4UA6 A;  3WS0 A;  3HVF A;  5E43 A;  5FI6 A;  2PU4 A;  2Y55 A;  2P9V B;  1K4F A;  2ZM0 A;  1TEM A;  1FOF A;  1U60 A;  1BUL A;  4WYY A;  3HUM A;  2WGW B;  5GLB A;  3D4F A;  2XDM A;  4OPZ A;  5FI2 A;  4C6Y A;  2I72 A;  3WWX A;  1SKF A;  1J9M A;  3FKV A;  1KGG A;  3AGD A;  2HDR A;  5EEC A;  3WRT A;  3OPP A;  4GNU A;  4MBF A;  4EWF A;  4MNR A;  5CGW A;  4E3M A;  4PPR A;  5F1F A;  4KQO A;  2ZJ9 A;  5CTM A;  1XA1 A;  3VP0 A;  3LY4 A;  4LEN A;  4ZJ1 A;  3UE0 A;  4DXB A;  4R23 A;  2C5W B;  4MBH A;  1WE4 A;  1SDN A;  1YLT A;  2HDQ A;  4JF6 A;  3NC8 A;  1NY0 A;  3GR2 A;  4MEZ A;  5DTT A;  5KSH A;  1SDE A;  4WEL A;  1Y54 A;  5E2H A;  3QNC A;  2PBY A;  3SOI A;  3FZC A;  4ZDX A;  1PW1 A;  5CHM A;  2HDU A;  2R9X A;  3NDG A;  4LV3 A;  4XXR A;  3N4I A;  4OON A;  5A91 A;  4OH0 A;  1FR1 A;  3PBS A;  3Q82 A;  1BLS A;  5U47 A;  4PM5 A;  1L0E A;  1PI4 A;  2A49 A;  3HLG A;  3QNB A;  2R9W A;  1NYY A;  4BD0 A;  3OPL A;  1WYC A;  2G2U A;  3C4P A;  3IF6 A;  4R4R A;  1HD8 A;  1I2S A;  4WZ5 A;  1BLP A;  3Q7V A;  2ZQD A;  4DE0 A;  2H5S A;  3B3X A;  4JXW A;  3VP1 A;  3NY4 A;  5KSC A;  1ES3 A;  1IKI A;  1XA7 A;  4N1H A;  4Y0O A;  4Z9Q A;  2Y91 A;  1YLY A;  2Q9M A;  3ISG A;  1PYY A;  4OP8 A;  3VFH A;  5EPH A;  3MZE A;  4JXG A;  1JVJ A;  1TDL A;  3ZG5 A;  2ZC6 B;  1PW8 A;  3G35 A;  1K54 C;  2ZQ8 A;  4NK3 A;  1HTZ A;  5EVI C;  2Y2M A;  4UAA A;  1FSW A;  3RJU A;  2XLN A; 
#chains in the Genus database with same CATH topology
 4R0Q A;  1HVB A;  3N7W A;  4FUW A;  4IUH A;  4RQ9 A;  3Q1F A;  4UA9 A;  5FDH A;  3O86 A;  1K6R A;  1E4D A;  3H9W A;  3MFD A;  3IXD A;  3G6O A;  2W3E A;  4OQ0 A;  2XF3 A;  2HF6 A;  4X53 A;  1YQS A;  1RGY A;  2A3U A;  5DFX A;  4WEK A;  1XP4 A;  5FAQ A;  4BL2 A;  5F82 A;  4CLC A;  5FI7 A;  1CQA A;  3W8K A;  1MBL A;  5EVI D;  3O3V A;  3P01 A;  1S0W A;  1XJ6 A;  5DTS A;  1OME A;  3MF0 A;  4GZB A;  3A3F A;  3TG9 A;  3LCE A;  2Y79 A;  5E2G A;  1BSG A;  1TS6 A;  5F1G A;  5KZH A;  4NET A;  1L0D A;  2INW A;  1LL9 A;  4RVA A;  3BRM A;  3UY6 A;  4YFM A;  4I3J A;  3E4P A;  1MKI A;  1KVM A;  1XPB A;  3KO6 A;  3FPV A;  3NIA A;  2JHE A;  4R3J A;  2IWD A;  4DE2 A;  4JLF A;  2KOI A;  4PM6 A;  3H7W B;  5FEF A;  3UDI A;  4Q8I A;  2Z2M B;  4L0L A;  3Q81 A;  1DY6 A;  3ZG9 B;  5FSR A;  1XJ4 A;  4NXG A;  1VB6 A;  4BL3 A;  2WGV A;  4OPR A;  4X69 A;  2EX2 A;  1PRQ A;  1VEU B;  3AGE A;  4B88 A;  3R7W A;  2L4R A;  5L8M A;  5EOE A;  3EGX C;  3F1O B;  5CED A;  1OTD A;  3KSH A;  2Y2L A;  5HL1 A;  3BQ8 A;  2OSU A;  4HEF A;  2K2N A;  2JCH A;  5F69 A;  4GOG A;  1S66 L;  2IA2 A;  4NXF A;  2VKS A;  4I5S A;  1P97 A;  3BFC A;  2ZL1 A;  4UQI M;  3ZCZ A;  1K4E A;  1OJ5 A;  3O5Y A;  4L9F A;  1YLZ A;  3LR5 A;  4JF5 A;  3TJZ C;  4EER A;  3KSI A;  4BLM A;  1ONH A;  5HAI A;  4GDN A;  4CLC D;  5CEB A;  3NHQ A;  5CHU A;  2HGV A;  3PBT A;  2DRW A;  3MXS A;  4EU0 A;  4O7D A;  4N1X A;  3UE6 A;  2V8C A;  2C6W B;  1O07 A;  1BLC A;  2J3T D;  4KZ7 A;  4LLO B;  3OCL A;  3UE1 A;  1ZTU A;  2H10 A;  1VM1 A;  3E2L A;  5HAP A;  1BUE A;  4HJ6 A;  1GSW A;  2GNX A;  3EQU A;  3CG5 A;  1T1B A;  4QB8 A;  1FSY A;  1VET B;  4FH2 A;  3PAG A;  5A93 A;  3A0R A;  5G4Y A;  3EGD C;  3FC7 A;  4CJN A;  1IEL A;  3MKF A;  3U4L P;  3PBR A;  1S1Y A;  3G32 A;  1N9B A;  3IHB A;  3PBN A;  4KQR A;  2E8I A;  2VGJ A;  1D1J A;  1SKO A;  5HDC A;  2J8Y A;  3RXX A;  3LGO A;  5TGF A;  4F94 A;  5DF8 A;  1DJB A;  4KZ9 A;  4OPY A;  1XGI A;  1KOU A;  1M6K A;  4JF4 A;  4LV0 A;  3IX4 A;  4NXB A;  5EVL A;  1JTD A;  3ULF A;  4ARZ B;  4Q0I A;  3HLW A;  1KE3 A;  4RYE A;  1YLW A;  3RTY A;  1T18 A;  2EXA A;  3LUQ A;  5HDS A;  3FWL A;  4CLC C;  3VFF A;  4WN5 A;  3UE3 A;  1LSX A;  1PWD A;  4QY6 A;  4GDB A;  3IWQ A;  4E04 A;  3L7H A;  2ZC7 A;  4GS9 A;  4UEY A;  5TBM B;  1WYB A;  3PTE A;  5GLA A;  2P04 A;  4II7 A;  3HBR A;  2J3T C;  4EW7 A;  1C3B A;  1XGJ A;  1CK3 A;  2ZMA A;  3KYE A;  3DAV A;  3P09 A;  5J7E A;  4O8G A;  3A3I A;  2ACG A;  3HL9 A;  3MXQ A;  3MZD A;  4UA7 A;  5JYO A;  3ICY A;  4KZ5 A;  2Q9N A;  1JTG A;  3RXW A;  4BBV A;  2K31 A;  1D7E A;  3HLE A;  4KZ6 A;  3WS2 A;  1YM1 A;  2JE5 A;  3OCN A;  4IVK A;  1PWC A;  1EI5 A;  1F98 A;  2VGL S;  1CEF A;  5IT5 A;  2ZMF A;  4ZRR A;  3QP6 A;  4DDS A;  3HLF A;  3V50 A;  1WA9 A;  3EEH A;  1XKZ A;  5EFW A;  4S2L A;  3CLO A;  1PZO A;  4WLA A;  3KX0 X;  2XFT A;  1HLU P;  5FL3 A;  2X02 A;  4PM7 A;  4H6J A;  2K7S A;  1I5Q A;  2W1T A;  2Y2J A;  4RX3 A;  4MN5 A;  3LR4 A;  5FI6 A;  2A2L A;  1K4F A;  1FOF A;  1U60 A;  2WGW B;  5L09 A;  2XDM A;  3OOV A;  1OTE A;  3FKV A;  3QP5 A;  1AWI A;  4AFI A;  3LR3 A;  4E3M A;  1F2K A;  3E4Q A;  4ZJ1 A;  1YLT A;  3CPT B;  4JF6 A;  4WL9 A;  1NY0 A;  5DTT A;  1L3L A;  1Y54 A;  1N9N A;  3SOI A;  2V1A A;  2YKF A;  2HDU A;  2HJE A;  3IBR A;  2PHY A;  3PBS A;  5U47 A;  1L0E A;  1Y4O A;  4I3A A;  4BD0 A;  3K2N A;  3IF6 A;  2Z6D A;  4R4R A;  1HD8 A;  5KSC A;  3VP1 A;  3T1R A;  3BW6 A;  3D72 A;  2V0U A;  4Y0O A;  3UB5 P;  2Q9M A;  3ISG A;  4FTX A;  4JXG A;  2W1R A;  2ZC6 B;  4NXE A;  4Q0J A;  4QWO A;  3T4O A;  2EWV A;  2A24 B;  4IHQ A;  1IYO A;  3C4O A;  2WKH A;  4U0X A;  3N8S A;  3M2K A;  1K25 A;  1ONG A;  4I38 A;  4R1G A;  2A24 A;  5F5Y A;  1DP8 A;  3CUE C;  4LRX C;  5M1A A;  1SZV A;  2XFS A;  3T1S A;  2QHK A;  1IYQ A;  3F1P B;  3WS5 A;  3IX8 A;  4X1M A;  3UPO A;  4N9L A;  3MSH A;  5EVI B;  4OVD A;  3PR6 A;  1IEM A;  3UDX A;  1G68 A;  5FQ9 A;  3UMD A;  2Y2N A;  1LLB A;  3VOL A;  2UV0 E;  3IHA A;  3UDF A;  4CLC E;  1W79 A;  2EX8 A;  2WKE A;  5M19 A;  2JN7 A;  4YNR A;  2WAE A;  3NCK A;  2FFF B;  4X68 A;  4A5R A;  5CHJ A;  4YWZ A;  4XT2 B;  4JXS A;  3MBZ A;  3IS2 B;  2WAF A;  4P6Z M;  1CJF A;  2O9C A;  4WF0 A;  3GTC A;  3LID A;  2ZQ7 A;  3CIT A;  3G30 A;  4D2O A;  3LIF A;  2EX6 A;  5L2F A;  3LEQ A;  2VA0 A;  3S7Q A;  4K0W A;  1N9L A;  3G34 A;  4JGR A;  3VE4 A;  1MXO A;  2HP9 A;  3BYD A;  4S2J A;  2HZ5 A;  3SH7 A;  5M18 A;  2D01 A;  2W27 A;  1GA0 A;  4EUZ A;  5KMW A;  3C8C A;  2E8J A;  3G4P A;  4GD8 A;  4WEJ A;  4ID4 A;  1ACF A;  4QHC A;  5HX9 A;  4IBX A;  1LL8 A;  3ZQ5 A;  1H8M A;  2WYX A;  1JWP A;  5AVF A;  5GL9 A;  3VMA A;  2J7V A;  3FKW A;  4CLC B;  4FH4 A;  4S2K A;  3VOY A;  5DFY A;  1ERM A;  4ZBE A;  4MN7 A;  3P7N A;  4IUK A;  4HH2 A;  3BFG A;  4C75 A;  4BWI A;  2H0Y A;  2JKT M;  3E4O A;  3CHW P;  4GHI A;  1ZC2 A;  4L9G A;  1PI5 A;  1G6A A;  5HPI A;  1H8Z A;  2P74 A;  1SHV A;  3WS1 A;  3SW1 A;  4WMC A;  1XJ3 A;  5EUA A;  1DRM A;  2O0Y A;  3N8R A;  3V3R A;  2PRF A;  1DP6 A;  5A90 A;  5HWT A;  5FQK A;  3FV7 A;  2L0W A;  1RCJ A;  1L0F A;  1E25 A;  3IF6 C;  2QWS A;  2J9P A;  1K56 A;  5AQ7 A;  1K6S A;  3T4K A;  1MWU A;  5MC7 A;  1IKG A;  2PYP A;  3SH8 A;  3W4O A;  3C38 A;  4HJ4 A;  3NJA A;  1K55 C;  4KZ8 A;  2I9V A;  3V67 A;  4OOY A;  3C5A A;  4ETZ A;  1IFQ A;  3R7W B;  3C30 A;  2W3G A;  2VEA A;  3HCY A;  4LCL A;  5LBR A;  5K5B A;  4HES A;  2EA9 A;  5IHV A;  4BQM A;  2OLU A;  2Z2L B;  3CAX A;  4FOF A;  4BBT A;  2Y2P A;  4K91 A;  2OAP 1;  4NKP A;  4S2P A;  1CI9 A;  3OPH A;  1XJ2 A;  3CJM A;  1BLH A;  1QME A;  2VLG A;  4OP5 A;  2PBD P;  3BEB A;  3GEC A;  4IJG A;  1MWR A;  2DNS A;  2ZL1 B;  1PFL A;  1NXY A;  2NUP C;  4MDZ A;  4S2O A;  4EBP A;  2LB9 A;  1K38 A;  3DW0 A;  3TE8 A;  4S2N C;  3S1Y A;  2ZD8 A;  4WBG A;  1EW0 A;  2XK1 A;  2CMN A;  2Y59 A;  4P85 A;  4KQQ A;  3MQQ A;  3S7N A;  4DRT A;  1W8Y A;  4ETX A;  1GSV A;  2B02 A;  4OLG A;  3S7P A;  1G5U A;  3WRZ A;  1NLY A;  4YIN A;  3FPW A;  3V5M A;  1ZG6 A;  3CMZ A;  4X25 A;  2GDN A;  5G18 A;  5AQA A;  1ESU A;  3K3D A;  2PR5 A;  3HLB A;  5AQ9 A;  3SH9 A;  4K0X A;  4EBL A;  1NWZ A;  3SS3 A;  2WGI A;  1YSQ A;  4B4X A;  2V0W A;  4HJ3 A;  4DE1 A;  4M4X A;  3G2Z A;  4P87 A;  4CPK A;  1K56 D;  2XRO A;  2V8F A;  3A0V A;  4BBU A;  3M6H A;  4BD1 A;  2D02 A;  1PIO A;  3G31 A;  5HDD A;  3WS4 A;  2XSS A;  1K57 A;  5A92 A;  1ODV A;  1SKO B;  2FH5 A;  2Y2O A;  1STZ A;  4KG5 A;  2QKP A;  1ERO A;  3HUN A;  2EWW A;  1NRF A;  3CZD A;  4EEP A;  1YKD A;  4LRY C;  1IYP A;  3H82 A;  1LT0 A;  4OOM A;  1H0M A;  2KX6 A;  2PU4 A;  2Y55 A;  2ZM0 A;  4WYY A;  1BUL A;  3BWL A;  4F3L A;  1K0K A;  3CUE A;  3QP4 A;  1SKF A;  2NUT C;  3LR0 A;  1J9M A;  3JPU A;  1KGG A;  2WKQ A;  2HDR A;  2KLI A;  3WRT A;  4GNU A;  4MBF A;  4EWF A;  4PPR A;  2ZJ9 A;  1XA1 A;  4K08 A;  3NEC A;  4R23 A;  4GS9 B;  1SDN A;  4KQD A;  3GR2 A;  2VZW A;  3CWF A;  4ZDX A;  2WKP A;  5CHM A;  2PD7 A;  3NDG A;  4XXR A;  3N4I A;  4OON A;  1YPR A;  1FR1 A;  2W0N A;  4PM5 A;  2A49 A;  4O01 A;  2R9W A;  3LI8 A;  1WYC A;  4WZ5 A;  2G2U A;  3Q7V A;  1OPX A;  3B3X A;  3CI6 A;  3PYP A;  2YKH A;  5C5K A;  2GZA A;  3UB7 A;  1PYY A;  3VFH A;  1NLZ A;  3KYZ A;  3MZE A;  5EPH A;  1JVJ A;  3IX3 A;  3ZG5 A;  3G35 A;  2ZQ8 A;  2W3F A;  2JKF A;  4BMW A;  5DJT A;  2PYR A;  5HD5 A;  2XH9 A;  4N9K A;  3LIE A;  2JKT I;  1S67 L;  4PKY G;  3C7U A;  3ZG7 B;  1RGZ A;  2B5R A;  3OLO A;  2Y2Q A;  5D3O A;  2XEP A;  3OBF A;  4MBK A;  4XUZ A;  2JC7 A;  2X71 A;  5DKL A;  3OZH A;  5FQI A;  1H5X A;  1H8Y A;  4H6J B;  4LRZ E;  2V2F F;  2W1T B;  3IXG A;  1A0K A;  4B9O A;  3IQA A;  5GHZ A;  3GVB A;  2H28 A;  1NZU A;  5FA7 A;  1T1A A;  4E6W A;  4X55 A;  3SS5 A;  1FR6 A;  3P98 A;  5I5L A;  2H0T A;  2HPB A;  3HJI A;  3EEA A;  2XGN A;  3EWK A;  4HP9 A;  2FZ0 A;  4BJP A;  4PM9 A;  1KGF A;  1ZHH B;  2XA7 S;  4EQ1 A;  3MXR A;  3ZGA B;  2ZM8 A;  4D60 A;  4G3W A;  3DTE A;  4FSF A;  3GSG A;  4I39 A;  4ESP A;  5HW3 A;  3T1Q B;  3N6I A;  3BFF A;  3NOP C;  4HBT A;  4OQH A;  2O9B A;  4WM9 A;  5KIZ A;  1P0Z A;  2V1Z A;  3MJQ A;  3MQO A;  1BYW A;  1LL5 A;  1YLJ A;  3UPN A;  4PKY A;  4EES A;  3IF6 B;  1XFN A;  3GQZ A;  1VQQ A;  1LSV A;  4EQI A;  3IF5 A;  4GKU A;  3DTM A;  3T50 A;  4Y2F A;  4R4S A;  4WZ4 A;  2WZX A;  3GRJ A;  4GJ4 A;  1DJC A;  1MWT A;  3MS6 A;  5J3W A;  3ZVW A;  2OAQ 1;  5CX7 A;  1ES5 A;  4RX2 A;  1K57 C;  3HLC A;  1SCW A;  2ZOI A;  1T1C A;  1CF0 A;  2ZC4 B;  3IT9 A;  2JKR M;  2O99 A;  4GN2 A;  1TD5 A;  1K55 A;  1YSP A;  3M2J A;  1Q2Q A;  4Y13 A;  4IBR A;  3O87 A;  1W63 M;  3MQ0 A;  1NRJ A;  1PNE A;  2VGL M;  1KDW A;  5L10 A;  3I7J A;  3NOU C;  5FQJ A;  4HBU A;  3ZVT A;  5HWV A;  3HLD A;  4PHT A;  3BLM A;  2VV7 A;  2LB5 A;  1IOU A;  3NBL A;  4JPM A;  2P7J A;  5AJG A;  2FFY A;  2GX5 A;  4S2N A;  5FAT A;  4CQH A;  4NG2 A;  4QJG A;  2PDR A;  1FCO A;  4QD4 A;  4WZ5 C;  5HPF A;  4EUV A;  1FCM A;  1FCN A;  1TS8 A;  3LY3 A;  1JWZ A;  5GHX A;  2UWX A;  1D06 A;  4KUK A;  3ITB A;  1K54 A;  4OKP A;  4UHU A;  4GB7 A;  4Y3I A;  1W8Q A;  2WZZ A;  2HV1 A;  2R78 A;  3DBA A;  3DTI A;  3ZNY A;  3QHY A;  4QU3 A;  5FEG A;  3DWZ A;  2PU2 A;  5BOH A;  3VSK A;  5HSQ A;  4R3B A;  3JYI A;  5FDS A;  1TF1 A;  2HP5 A;  2P9V A;  4EET B;  2V9A A;  4QPR A;  5DKK A;  3SZT A;  1MY8 A;  3ZHH A;  3F1N A;  3ZG0 A;  3T4T A;  4HHD A;  4H8R A;  4E3J A;  3MMH A;  1OTA A;  4DF6 A;  5DF9 A;  2XD1 A;  3A3J A;  3K3C A;  3V39 A;  3FYZ A;  4OQI A;  1FQG A;  1ZKJ A;  3ZNT A;  4JGP A;  4KZA A;  2Y2H A;  3S22 A;  1TVF A;  2Q0O A;  5EVE A;  2BLS A;  2JBF A;  4E3N A;  2ZC3 B;  2OOL A;  4I3I A;  4C3Q A;  3DWK A;  2WKR A;  4LV2 A;  3IH8 A;  2RCX A;  2P08 A;  2Z6C A;  2EX9 A;  2WKI A;  2EFU A;  4GHI B;  4ZJ2 A;  4JXV A;  2ZLY A;  4JGQ A;  1TS7 A;  2VGK A;  4KEN B;  3M6B A;  4B4Z A;  4EEU A;  4R3A A;  2ZMV A;  2ZQ9 A;  4PMA A;  4UQI S;  2V20 A;  2JKG A;  4KG6 A;  4XUX A;  5CRF A;  1KVL A;  2QPN A;  3T4J A;  3BY9 A;  3LI9 A;  1KE4 A;  3BLS A;  3O88 A;  5HWW A;  1T19 A;  3A0S A;  1M40 A;  3PAE A;  2XD5 A;  1IYS A;  2HDS A;  4MMN A;  4E6X A;  4JKT A;  3SS4 A;  5DVA A;  1NZO A;  3R4K A;  5DF7 A;  2BTF P;  5F83 A;  1LI9 A;  5GHY A;  4DN0 A;  1CI8 A;  3UB6 A;  3LYX A;  3ITA A;  4JBF A;  3PBQ A;  4NEE D;  4ZJ3 A;  3T1X A;  4ZAM A;  1OJG A;  2Y2I A;  4UA6 A;  3WS0 A;  3HVF A;  3MFX A;  4HI4 A;  5E43 A;  4HP4 A;  3FG8 A;  2OWH A;  3KSG A;  3PXP A;  3HUM A;  4OPZ A;  2I72 A;  3WWX A;  4R6L A;  1MC0 A;  3E0Y A;  4MCW A;  3TW8 A;  1FIK A;  3OPP A;  1FIL A;  4MNR A;  3NUL A;  5CTM A;  3VP0 A;  4LEN A;  1H3Q A;  3UE0 A;  2C5W B;  2V1B A;  4MBH A;  1Y28 A;  3EOI A;  2HDQ A;  3NC8 A;  3H7W A;  4MEZ A;  3RH8 B;  5KSH A;  1SDE A;  4WEL A;  2PBY A;  3FZC A;  5EV0 A;  1MKM A;  2R9X A;  4LV3 A;  3DTK A;  2JKR I;  1OT9 A;  5A91 A;  3JVV A;  4OH0 A;  1VEU A;  3UB9 A;  3QNB A;  3OPL A;  3C4P A;  1BLP A;  4DE0 A;  4JXW A;  3F1O A;  1IKI A;  1XA7 A;  2OWJ A;  3BQA A;  4N1H A;  4Z9Q A;  3T4Q A;  2Y91 A;  2J3W A;  1YLY A;  4OP8 A;  1TDL A;  1PW8 A;  1K54 C;  4NK3 A;  1HTZ A;  5EVI C;  2Y2M A;  3BY8 A;  4L9E A;  2M7V A;  1FSW A;  3RJU A;  4S2M A;  1YMX A;  4WMC D;  5I94 A;  4IED A;  4KZ3 A;  3OC2 A;  3E98 A;  1XXM A;  3B33 A;  4HH3 A;  2ZM2 A;  4Y0U A;  4HQA A;  3A3E A;  1OTB A;  1DJA A;  3KSF A;  2WUQ A;  3PHY A;  4Y17 A;  1G6O A;  4GLQ A;  5CEC A;  1JWV A;  3ZYT A;  2ZQA A;  4X6T A;  5HAR A;  3IH9 A;  2G2W A;  1GSX A;  3G2Y A;  3H82 B;  3TSG A;  4E3K A;  1PWG A;  4HNB A;  4LGW A;  2IWB A;  2GJ3 A;  2QZ6 A;  5G4Z A;  2QYB A;  2ZC5 B;  3AGF A;  4BEN A;  5TFQ A;  1E3U A;  4F3L B;  3UNW A;  3IWO A;  5GLC A;  1BZA A;  3IXB A;  4B93 A;  3Q7Z A;  3MKE A;  4M3K A;  5HD3 A;  3U2A A;  3T4S A;  5J4E A;  1S6R A;  1VET A;  4KZ4 A;  3OPR A;  1PZP A;  4JGO A;  4LCM A;  4P6B A;  3UO9 A;  4LV1 A;  4E3L A;  4IVI A;  3HUO A;  2W3D A;  1UGU A;  5E2F A;  4GW9 A;  2WK0 A;  5JYP A;  2ZQC A;  3UME A;  3Q7V B;  5FAP A;  4O0P A;  2VJW A;  2EXB A;  3GMW A;  2ZBB A;  2G7U A;  1OT6 A;  1N9O A;  5HL6 A;  3LIC A;  1W63 Q;  3QP8 A;  1L0G A;  4PM8 A;  4ARZ A;  3B47 A;  1S4S A;  3C7V A;  3VP3 A;  1OTI A;  2Y2G A;  2O9A A;  3C2W A;  4EBN A;  5AVE A;  2DCF A;  5GLD A;  1EWZ A;  3LIB A;  3ZDJ A;  3BM6 A;  2VX8 A;  4E3O A;  1XFQ A;  2X01 A;  3MZF A;  3IBJ A;  1TDG A;  5L07 A;  3RFB A;  3UPP A;  1W5D A;  4U0T A;  4P0M A;  4DXC A;  1QMF A;  2QJ7 A;  5TBM A;  2DMW A;  4ZTK A;  5FAS A;  4DKI A;  3NOT C;  4KG2 A;  3EQV A;  5EOO A;  2Y2K A;  1CEG A;  4R38 A;  4QY5 A;  1GHI A;  3NDE A;  3TRC A;  1Z6F A;  2EFX A;  4Q0H A;  1NYM A;  4DE3 A;  3KYQ A;  4RA7 A;  3HJK A;  2B95 A;  1F9I A;  1F5M A;  2M1C A;  1ES4 A;  4PAU A;  1E3U D;  2PR6 A;  3V3S A;  1J3W A;  5FQM A;  2W3H A;  3W2Z A;  2XR0 A;  1W7F A;  3GDI A;  1GA9 A;  1ZG4 A;  1X0O A;  4DJ2 A;  3W4Q A;  3IWI A;  2CC1 A;  5IU1 A;  4KZB A;  4FCF A;  1NJ4 A;  1LSW A;  3PBO A;  1ERQ A;  2M7U A;  3BFE A;  5HAQ A;  4YOF A;  4OPQ A;  1YT4 A;  1MPL A;  3UB8 A;  1YMS A;  5J8X A;  3ZFZ A;  2Y4A A;  1V9Z A;  3BEC A;  4U3T A;  3IXH A;  1ESI A;  4OQG A;  3GV9 A;  2OV5 A;  3MR0 A;  1L2S A;  1UWP X;  4Y0T A;  2IWC A;  1GHM A;  2HP6 A;  1BTL A;  4HY8 A;  2WGW A;  2QMI A;  3D3O A;  3L9K A;  4P6Z S;  5FAO A;  1JNU A;  5DJU A;  1S4R A;  1BT5 A;  3JVU A;  4MN6 A;  3ZG8 B;  1I2W A;  5DTK A;  1XX2 A;  4X56 A;  2L1M A;  1KGE A;  3BFD A;  2KDK A;  5F6A A;  3TOI A;  4G3K A;  4KUO A;  2VK3 A;  3VP4 A;  2XQZ A;  1MZU A;  1RP5 A;  3T12 B;  4E3I A;  3T4L A;  3CPT A;  2MJ6 A;  4HIA A;  5AQB A;  1Q2P A;  3VOZ A;  3HRE A;  1MWS A;  3NI9 A;  2HJ9 C;  3E2K A;  3UN7 A;  5CGS A;  4Y7P A;  3A3D A;  3N8L A;  1ALQ A;  3VSL A;  5TR7 A;  2Y8H A;  4OOL A;  1DP9 A;  4LFU A;  1ES2 A;  2OLV A;  2QJ5 A;  4MLL A;  1GHP A;  2J9O A;  1YLP A;  5EM1 A;  4DMZ A;  5HZH A;  1V9Y A;  4ME4 A;  2XRN A;  3LFV A;  2AVX A;  3VV4 A;  1LHY A;  2PT7 A;  1LI0 A;  4HOI A;  5TJJ A;  3W4P A;  1UWN X;  4EV4 A;  1KE0 A;  4R70 A;  1VHM A;  4S2I A;  4DDY A;  5CXW A;  1N4O A;  4Z1W A;  5CGX A;  3S4X A;  1HZO A;  5IS1 A;  3Q07 A;  2WAD A;  3LO7 A;  1GCE A;  5CTN A;  4DJ3 A;  4FD8 A;  3VP2 A;  2XA7 M;  5FQQ A;  3F1P A;  5EM0 A;  3LEZ A;  3LIA A;  4OLD A;  5E2E A;  1KDS A;  5HFO A;  5CER A;  2ZOH A;  5EVI A;  1AXB A;  2RL3 A;  4GD6 A;  4N92 A;  5EE8 A;  2BG1 A;  3QP2 A;  1O7E A;  4WUJ A;  3VE3 A;  1YAX A;  2P9V B;  4LPZ A;  1TEM A;  5GLB A;  3F1N B;  2PD8 A;  3D4F A;  5FI2 A;  4C6Y A;  3AGD A;  3S7O A;  1TS0 A;  5EEC A;  5CGW A;  1G28 A;  4XT2 A;  5F1F A;  4KQO A;  2B18 A;  3BJN A;  4GCZ A;  3IS2 A;  1Z09 A;  3LY4 A;  3QP1 A;  5F68 A;  4DXB A;  5A8B A;  1P9R A;  1WE4 A;  5E2H A;  3QNC A;  4EXO A;  1PW1 A;  3D9Y A;  4G3V A;  3Q82 A;  1BLS A;  1PI4 A;  3HLG A;  4Y5F A;  1NYY A;  3B42 A;  2J80 A;  1I2S A;  2ZQD A;  2H5S A;  3NY4 A;  1ES3 A;  4Y15 A;  2PAV P;  1P9W A;  2VV6 A;  4X1L A;  2VV8 A;  4UAA A;  1S1Z A;  2XLN A;  2BAS A; 
#chains in the Genus database with same CATH homology
 4R0Q A;  2XH9 A;  1IYO A;  1HVB A;  3N7W A;  4N9K A;  1YMX A;  4S2M A;  4WMC D;  5I94 A;  3C4O A;  4IED A;  2WKH A;  4U0X A;  3C7U A;  3N8S A;  3Q1F A;  3M2K A;  4KZ3 A;  3O86 A;  4UA9 A;  5FDH A;  3ZG7 B;  1K6R A;  1E4D A;  1RGZ A;  3OC2 A;  1K25 A;  3MFD A;  1ONG A;  4R1G A;  3IXD A;  1XXM A;  2B5R A;  5M1A A;  4OQ0 A;  2XF3 A;  2Y2Q A;  5D3O A;  4X53 A;  2ZM2 A;  1YQS A;  1RGY A;  2A3U A;  4Y0U A;  3A3E A;  2XEP A;  4MBK A;  1DJA A;  2XFS A;  4XUZ A;  2WUQ A;  2JC7 A;  2X71 A;  4WEK A;  1XP4 A;  1IYQ A;  3WS5 A;  5FAQ A;  4BL2 A;  5CEC A;  5F82 A;  3UPO A;  3OZH A;  5FI7 A;  1JWV A;  1H5X A;  4N9L A;  5FQI A;  1H8Y A;  2ZQA A;  4X6T A;  5HAR A;  3W8K A;  3IH9 A;  5EVI B;  2G2W A;  1MBL A;  4OVD A;  1IEM A;  2V2F F;  5EVI D;  3UDX A;  3IXG A;  3G2Y A;  1G68 A;  3O3V A;  5FQ9 A;  3TSG A;  4E3K A;  1PWG A;  2Y2N A;  1LLB A;  3IQA A;  1S0W A;  5GHZ A;  3GVB A;  5DTS A;  1OME A;  1NZU A;  3IHA A;  2IWB A;  2QZ6 A;  5FA7 A;  4GZB A;  4E6W A;  2ZC5 B;  3AGF A;  3UDF A;  4X55 A;  3A3F A;  5TFQ A;  4BEN A;  3SS5 A;  1E3U A;  3TG9 A;  1FR6 A;  3LCE A;  3UNW A;  3P98 A;  1W79 A;  2EX8 A;  5E2G A;  2WKE A;  1BSG A;  3IWO A;  5M19 A;  5GLC A;  2H0T A;  2HPB A;  5F1G A;  1BZA A;  5KZH A;  3IXB A;  2WAE A;  2XGN A;  1L0D A;  4NET A;  1LL9 A;  3NCK A;  4RVA A;  2FFF B;  3BRM A;  3UY6 A;  3Q7Z A;  4X68 A;  4PM9 A;  4YFM A;  4BJP A;  3MKE A;  4A5R A;  1MKI A;  4M3K A;  5CHJ A;  1KGF A;  1KVM A;  1S6R A;  3MXR A;  4JXS A;  4KZ4 A;  1XPB A;  3ZGA B;  3OPR A;  1PZP A;  3MBZ A;  2ZM8 A;  3NIA A;  4LCM A;  4P6B A;  4R3J A;  4FSF A;  3GSG A;  4LV1 A;  3UO9 A;  2IWD A;  2WAF A;  4JLF A;  4PM6 A;  4DE2 A;  4E3L A;  5HW3 A;  3N6I A;  3BFF A;  3UDI A;  3GTC A;  4Q8I A;  2Z2M B;  4L0L A;  3Q81 A;  4IVI A;  3HUO A;  4HBT A;  1DY6 A;  3ZG9 B;  5FSR A;  4OQH A;  2ZQ7 A;  4WM9 A;  4BL3 A;  2WGV A;  2V1Z A;  3G30 A;  4OPR A;  1LL5 A;  4X69 A;  5E2F A;  1YLJ A;  3UPN A;  4D2O A;  2EX2 A;  3AGE A;  2WK0 A;  5JYP A;  2EX6 A;  4B88 A;  5L2F A;  2ZQC A;  3IF6 B;  3Q7V B;  5EOE A;  3GQZ A;  5FAP A;  2EXB A;  3GMW A;  4K0W A;  1VQQ A;  4EQI A;  3IF5 A;  3G34 A;  5CED A;  4GKU A;  3DTM A;  4R4S A;  4WZ4 A;  2WZX A;  2Y2L A;  1MXO A;  2HP9 A;  3BYD A;  3GRJ A;  4PM8 A;  4S2J A;  1L0G A;  5HL1 A;  1DJC A;  2OSU A;  3SH7 A;  1MWT A;  4HEF A;  3ZVW A;  5M18 A;  3C7V A;  3VP3 A;  1GA0 A;  2Y2G A;  4EBN A;  4EUZ A;  1ES5 A;  4RX2 A;  1K57 C;  2DCF A;  3HLC A;  1EWZ A;  1SCW A;  5GLD A;  5KMW A;  2JCH A;  3ZDJ A;  2ZC4 B;  3BM6 A;  3IT9 A;  4GOG A;  4GN2 A;  4E3O A;  3G4P A;  2X01 A;  4GD8 A;  3MZF A;  1TDG A;  1K55 A;  3UPP A;  3BFC A;  1W5D A;  4WEJ A;  3M2J A;  1Q2Q A;  4U0T A;  4ID4 A;  3ZCZ A;  1K4E A;  1YLZ A;  4JF5 A;  4P0M A;  4DXC A;  1QMF A;  4QHC A;  5HX9 A;  4IBX A;  4IBR A;  5BOH A;  4ZTK A;  4BLM A;  3O87 A;  5FAS A;  1ONH A;  5HAI A;  2WYX A;  1JWP A;  4GDN A;  4DKI A;  3VMA A;  5GL9 A;  2J7V A;  4KG2 A;  3EQV A;  3FKW A;  5EOO A;  2Y2K A;  1CEG A;  4FH4 A;  5CEB A;  4S2K A;  1KDW A;  3VOY A;  1ERM A;  3I7J A;  4QY5 A;  5CHU A;  4ZBE A;  1GHI A;  3BFG A;  3NDE A;  4C75 A;  1Z6F A;  3PBT A;  5FQJ A;  2DRW A;  3MXS A;  4HBU A;  2EFX A;  2H0Y A;  1NYM A;  4DE3 A;  3ZVT A;  1ZC2 A;  4O7D A;  4RA7 A;  1PI5 A;  3HLD A;  4N1X A;  1G6A A;  1ES4 A;  1H8Z A;  2P74 A;  2C6W B;  3BLM A;  1O07 A;  1SHV A;  3WS1 A;  1BLC A;  1E3U D;  4KZ7 A;  4WMC A;  3OCL A;  3NBL A;  3UE1 A;  4JPM A;  5EUA A;  3V3S A;  2H10 A;  3N8R A;  1VM1 A;  3E2L A;  3V3R A;  5FQM A;  5HAP A;  1BUE A;  5A90 A;  2FFY A;  5FQK A;  4S2N A;  3FV7 A;  5FAT A;  2XR0 A;  1W7F A;  4QJG A;  1GA9 A;  3EQU A;  3CG5 A;  4QB8 A;  1RCJ A;  1FSY A;  1L0F A;  1ZG4 A;  1FCO A;  4FH2 A;  4QD4 A;  3PAG A;  3W4Q A;  3IWI A;  5A93 A;  1E25 A;  2CC1 A;  3IF6 C;  4WZ5 C;  2J9P A;  1K56 A;  5AQ7 A;  1FCM A;  1FCN A;  1K6S A;  4KZB A;  4CJN A;  3LY3 A;  1MWU A;  1IEL A;  3MKF A;  3PBR A;  4FCF A;  1JWZ A;  1NJ4 A;  3G32 A;  5GHX A;  3PBO A;  1IKG A;  1ERQ A;  2UWX A;  5HAQ A;  3BFE A;  3SH8 A;  1N9B A;  3ITB A;  3IHB A;  1K54 A;  3W4O A;  4OPQ A;  1YT4 A;  4OKP A;  3PBN A;  4KQR A;  4GB7 A;  4UHU A;  1MPL A;  2E8I A;  1W8Q A;  2WZZ A;  2VGJ A;  1YMS A;  5J8X A;  3ZFZ A;  2Y4A A;  1K55 C;  4KZ8 A;  2J8Y A;  4OOY A;  3C5A A;  3RXX A;  3ZNY A;  3QHY A;  4QU3 A;  3BEC A;  5TGF A;  3DWZ A;  4U3T A;  4F94 A;  3IXH A;  4LCL A;  5DF8 A;  1DJB A;  2PU2 A;  4KZ9 A;  4OPY A;  1XGI A;  1M6K A;  4JF4 A;  4LV0 A;  3JYI A;  1ESI A;  4R3B A;  3VSK A;  4HES A;  4OQG A;  5IHV A;  2HP5 A;  3GV9 A;  2OV5 A;  4BQM A;  2OLU A;  1L2S A;  1JTD A;  5EVL A;  2IWC A;  2Z2L B;  2P9V A;  4Y0T A;  1GHM A;  2HP6 A;  2Y2P A;  1BTL A;  4K91 A;  2WGW A;  1MY8 A;  3ZHH A;  3ZG0 A;  3HLW A;  2QMI A;  1KE3 A;  4RYE A;  1YLW A;  4S2P A;  5FAO A;  1CI9 A;  4H8R A;  4E3J A;  1BT5 A;  2EXA A;  3OPH A;  3ZG8 B;  4DF6 A;  3CJM A;  5DF9 A;  1BLH A;  1QME A;  3FWL A;  2XD1 A;  1I2W A;  3A3J A;  4OP5 A;  3VFF A;  5DTK A;  1XX2 A;  4X56 A;  3UE3 A;  3BEB A;  1KGE A;  3BFD A;  3V39 A;  1MWR A;  3FYZ A;  2DNS A;  3TOI A;  1PWD A;  4OQI A;  1FQG A;  4QY6 A;  4GDB A;  3IWQ A;  1NXY A;  3VP4 A;  1ZKJ A;  4S2O A;  3ZNT A;  4KZA A;  2XQZ A;  4EBP A;  1RP5 A;  2Y2H A;  1K38 A;  2ZC7 A;  3DW0 A;  4E3I A;  1WYB A;  4S2N C;  3PTE A;  3S1Y A;  2ZD8 A;  5GLA A;  4WBG A;  3S22 A;  2XK1 A;  5AQB A;  3HBR A;  1Q2P A;  1TVF A;  2Y59 A;  4P85 A;  3VOZ A;  1C3B A;  1XGJ A;  4KQQ A;  4DRT A;  1CK3 A;  2BLS A;  2ZMA A;  2JBF A;  1W8Y A;  3HRE A;  3P09 A;  4E3N A;  2ZC3 B;  1MWS A;  3NI9 A;  3A3I A;  4C3Q A;  3DWK A;  3HL9 A;  4LV2 A;  4OLG A;  3E2K A;  3IH8 A;  2RCX A;  3MZD A;  3UN7 A;  3WRZ A;  5CGS A;  2EX9 A;  4UA7 A;  2WKI A;  4Y7P A;  5JYO A;  2EFU A;  3A3D A;  4ZJ2 A;  4JXV A;  3N8L A;  1ALQ A;  4YIN A;  2ZLY A;  2VGK A;  3VSL A;  4KZ5 A;  4KEN B;  5TR7 A;  3V5M A;  1ZG6 A;  4OOL A;  3CMZ A;  3M6B A;  2GDN A;  5G18 A;  4B4Z A;  5AQA A;  1ESU A;  1ES2 A;  2OLV A;  2Q9N A;  2ZQ9 A;  4MLL A;  3HLB A;  1JTG A;  1GHP A;  2J9O A;  1YLP A;  4PMA A;  3RXW A;  2V20 A;  4XUX A;  4KG6 A;  5CRF A;  5AQ9 A;  1KVL A;  2QPN A;  3HLE A;  4KZ6 A;  3WS2 A;  3SH9 A;  4K0X A;  1YM1 A;  2JE5 A;  3OCN A;  4EBL A;  1KE4 A;  3SS3 A;  3BLS A;  1LHY A;  2WGI A;  1LI0 A;  3O88 A;  3W4P A;  4B4X A;  4DE1 A;  4IVK A;  1PWC A;  4EV4 A;  3G2Z A;  1EI5 A;  4P87 A;  1KE0 A;  1CEF A;  1M40 A;  1K56 D;  4CPK A;  4DDS A;  3PAE A;  2XD5 A;  3HLF A;  1IYS A;  3M6H A;  2HDS A;  4S2I A;  3V50 A;  4BD1 A;  5CXW A;  4DDY A;  1N4O A;  4E6X A;  5CGX A;  3S4X A;  4JKT A;  1HZO A;  1PIO A;  3SS4 A;  5DVA A;  3G31 A;  3Q07 A;  1XKZ A;  2WAD A;  3WS4 A;  1NZO A;  3LO7 A;  1GCE A;  1K57 A;  4S2L A;  5CTN A;  5DF7 A;  5A92 A;  1PZO A;  5F83 A;  4FD8 A;  1LI9 A;  3VP2 A;  2XFT A;  5FQQ A;  5GHY A;  1CI8 A;  2Y2O A;  2X02 A;  3LEZ A;  4KG5 A;  4PM7 A;  4OLD A;  5E2E A;  1KDS A;  5HFO A;  1ERO A;  3ITA A;  3HUN A;  5CER A;  1NRF A;  3CZD A;  4JBF A;  3PBQ A;  1AXB A;  1I5Q A;  5EVI A;  4ZJ3 A;  2Y2J A;  2RL3 A;  4RX3 A;  4GD6 A;  1IYP A;  4N92 A;  4OOM A;  5EE8 A;  2BG1 A;  1O7E A;  4ZAM A;  2Y2I A;  4UA6 A;  3WS0 A;  3HVF A;  5E43 A;  5FI6 A;  2PU4 A;  2Y55 A;  2P9V B;  1K4F A;  2ZM0 A;  1TEM A;  1FOF A;  1U60 A;  1BUL A;  4WYY A;  3HUM A;  2WGW B;  5GLB A;  3D4F A;  2XDM A;  4OPZ A;  5FI2 A;  4C6Y A;  2I72 A;  3WWX A;  1SKF A;  1J9M A;  3FKV A;  1KGG A;  3AGD A;  2HDR A;  5EEC A;  3WRT A;  3OPP A;  4GNU A;  4MBF A;  4EWF A;  4MNR A;  5CGW A;  4E3M A;  4PPR A;  5F1F A;  4KQO A;  2ZJ9 A;  5CTM A;  1XA1 A;  3VP0 A;  3LY4 A;  4LEN A;  4ZJ1 A;  3UE0 A;  4DXB A;  4R23 A;  2C5W B;  4MBH A;  1WE4 A;  1SDN A;  1YLT A;  2HDQ A;  4JF6 A;  3NC8 A;  1NY0 A;  3GR2 A;  4MEZ A;  5DTT A;  5KSH A;  1SDE A;  4WEL A;  1Y54 A;  5E2H A;  3QNC A;  2PBY A;  3SOI A;  3FZC A;  4ZDX A;  1PW1 A;  5CHM A;  2HDU A;  2R9X A;  3NDG A;  4LV3 A;  4XXR A;  3N4I A;  4OON A;  5A91 A;  4OH0 A;  1FR1 A;  3PBS A;  3Q82 A;  1BLS A;  5U47 A;  4PM5 A;  1L0E A;  1PI4 A;  2A49 A;  3HLG A;  3QNB A;  2R9W A;  1NYY A;  4BD0 A;  3OPL A;  1WYC A;  2G2U A;  3C4P A;  3IF6 A;  4R4R A;  1HD8 A;  1I2S A;  4WZ5 A;  1BLP A;  3Q7V A;  2ZQD A;  4DE0 A;  2H5S A;  3B3X A;  4JXW A;  3VP1 A;  3NY4 A;  5KSC A;  1ES3 A;  1IKI A;  1XA7 A;  4N1H A;  4Y0O A;  4Z9Q A;  2Y91 A;  1YLY A;  2Q9M A;  3ISG A;  1PYY A;  4OP8 A;  3VFH A;  5EPH A;  3MZE A;  4JXG A;  1JVJ A;  1TDL A;  3ZG5 A;  2ZC6 B;  1PW8 A;  3G35 A;  1K54 C;  2ZQ8 A;  4NK3 A;  1HTZ A;  5EVI C;  2Y2M A;  4UAA A;  1FSW A;  3RJU A;  2XLN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...