2VV6A

Bjfixlh in ferric form
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
106
structure length
106
Chain Sequence
IPDAMIVIDGHGIIQLFSTAAERLFGWSELEAIGQNVNILMPEPDRSRHDSYISRYRTTSDPHIIGIGRIVTGKRRDGTTFPMHLSIGEMQSGGEPYFTGFVRDLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Changes in Quaternary Structure in the Signaling Mechanisms of Pas Domains.
pubmed doi rcsb
source organism Bradyrhizobium japonicum
molecule tags Signaling protein, transferase
molecule keywords SENSOR PROTEIN FIXL
total genus 26
structure length 106
sequence length 106
chains with identical sequence B, C, D
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2008-06-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2vv6A00
3MQQA 1XJ3A 5HZHA 5F5YA 4H6JA 1LT0A 3CAXA 4HIAA 4R38A 1P0ZA 1UGUA 1T1BA 3UB7A 1S4RA 1S1YA 1X0OA 2V1AA 3A0VA 4LRYC 1LSWA 4M4XA 4PKYA 2R78A 1OJ5A 3VE4A 2J80A 1MZUA 4LLOB 5IU1A 2PR6A 2WKRA 5HDDA 3ULFA 5G4ZA 2D02A 3B33A 4GS9A 4HOIA 1BYWA 1S66L 2OWJA 4HHDA 4MN5A 4R6LA 2L1MA 4MN6A 2OWHA 5G4YA 3SW1A 2QHKA 3MQOA 4L9GA 3UE6A 3K3CA 5HDCA 1D7EA 3ICYA 4GHIB 2VV6A 3H82B 4GW9A 1UWNX 4HJ4A 3E4OA 4RQ9A 3LIEA 5J4EA 2B02A 4PKYG 3FG8A 2ZBBA 4LRXC 1TS0A 2PHYA 3CWFA 1XFQA 3CLOA 1EW0A 4R70A 2CMNA 2A24B 4I5SA 4R3AA 1D06A 3C2WA 4YWZA 3LICA 3LI9A 3MJQA 1N9OA 2H28A 1GSVA 1OT6A 2A24A 2Z6CA 4HY8A 1OTIA 3UMDA 4EQ1A 1OTBA 3EWKA 3H9WA 2EA9A 4DJ2A 1T18A 1V9YA 2OOLA 4I3JA 2PYRA 5F69A 3UB8A 5AVFA 5AVEA 2QKPA 5DJUA 3BY8A 4JGQA 5DKLA 5I5LA 1NWZA 4JGOA 3RTYA 4BBUA 1GSXA 3H7WB 5HWWA 1DP9A 4L9FA 3K3DA 3GECA 4HH2A 3UB9A 4BBTA 4HH3A 4HNBA 1N9LA 3FC7A 3UB6A 2VEAA 3F1OB 1Y28A 2W27A 2Z6DA 1T1CA 1VB6A 2V9AA 3LIBA 1OJGA 4KUKA 3NHQA 1DP8A 1TS6A 2PR5A 4XT2A 3EEHA 2KDKA 3LYXA 3E4PA 3F1OA 4HI4A 4DJ3A 2VLGA 3UMEA 2QJ5A 1S1ZA 1WA9A 1S67L 3F1NB 3H82A 4XT2B 3NOUC 2BASA 4GHIA 3LUQA 3OLOA 2GJ3A 4WLAA 2WKPA 4F3LB 4GS9B 2JHEA 4LRZE 3NJAA 3MXQA 4EXOA 3A0SA 3VE3A 1TS7A 4I3AA 1JNUA 2YKHA 3H7WA 5EFWA 4KUOA 1LSVA 1T19A 2D01A 5HD3A 4WF0A 2PDRA 2K7SA 1OTDA 1DP6A 2I9VA 1LSXA 1N9NA 3MR0A 1T1AA 3A0RA 1P97A 4B9OA 5HSQA 1XJ2A 4NXFA 1S4SA 1OTEA 4I3IA 5F6AA 5HWVA 2L0WA 3T50A 3G6OA 4NXGA 4HJ6A 2PD8A 4EW7A 5TBMA 4HP9A 2P7JA 1F9IA 4JGPA 4WUJA 5DKKA 2VV7A 2ZOHA 3F1NA 1TS8A 3LI8A 5F68A 4KQDA 4NXEA 3C8CA 1OT9A 3PYPA 1LL8A 4I38A 1XJ4A 3KX0X 4EETB 4EEUA 3P7NA 3NOPC 2ZOIA 3LIFA 3HJIA 4WN5A 4HJ3A 3PHYA 3VOLA 1UWPX 4JGRA 2VV8A 2YKFA 2WKQA 2HV1A 3IS2B 4L9EA 1GSWA 2L4RA 1DRMA 1XJ6A 2PD7A 2QJ7A 3BY9A 3D72A 3IBRA 5J3WA 5A8BA 1OTAA 5KIZA 1G28A 3F1PB 4EEPA 4EERA 5HWTA 2QWSA 4EESA 5J7EA 3NOTC 2V0WA 4WL9A 5TBMB 3ZQ5A 4F3LA 2INWA 2M1CA 4HQAA 2KX6A 5IS1A 2PYPA 3F1PA 3LIAA 4HP4A 5HD5A 1V9ZA 3HJKA 4E04A 3GDIA 3LIDA 4GCZA 4K08A 1KOUA 5HDSA 2V0UA 5DJTA 4NXBA 2V1BA 3MFXA 3E4QA 1ODVA 2JN7A 1F98A 3IS2A 2W0NA 3BWLA 4I39A 1XFNA 4H6JB 3RH8B 4LPZA 4BBVA
chains in the Genus database with same CATH superfamily
1XJ3A 4KZ8A 5DF9A 2V1AA 4QY6A 1ACFA 1MZUA 1PWDA 4EQIA 1CI8A 4ARZA 1BYWA 4MN5A 5DF7A 1G68A 2VV6A 1JWPA 5J4EA 4OKPA 3V5MA 1TS0A 2BTFP 3CWFA 4ZAMA 1D06A 2JKFA 1H8YA 3BFFA 1WYCA 5TFQA 4CLCA 4S2MA 2J3WA 3OCNA 5DKLA 3G2ZA 4X1LA 5FQKA 3U2AA 2Y2MA 3ZFZA 4Y2FA 4OPYA 3TRCA 2EX2A 3LR3A 5HFOA 3UMEA 3WRZA 4FTXA 3MXQA 3WS2A 2Y91A 4OH0A 3A0RA 3QP6A 1K57C 2EFXA 4HP9A 4WUJA 4M3KA 3C8CA 2QZ6A 4QU3A 3RXWA 4EEUA 2NUPC 3PAGA 4HESA 4DMZA 4GD6A 5L07A 5DJUA 2ZM2A 5TGFA 5FEGA 2QJ7A 3IBRA 3MSHA 5CX7A 3MBZA 4EEPA 4EERA 3WS4A 2O9AA 5CGXA 4HQAA 1V9ZA 3MZFA 2OV5A 4DE0A 5M1AA 5IT5A 4FUWA 3MFXA 2M7VA 1NRFA 3AGDA 2XEPA 1W63M 1NLZA 3KYEA 4CLCD 4N9KA 2WYXA 3NCKA 1OPXA 1S4RA 1LSWA 3IXGA 5GLBA 1WE4A 1S66L 1BULA 1YPRA 4BWIA 2Z2MB 2H0TA 1J3WA 4R0QA 3H82B 3E4OA 5HW3A 3OPRA 5JYOA 5AJGA 2ZBBA 2CMNA 3MZDA 4C75A 3QP8A 1TDLA 2Y2OA 2HPBA 2WGWA 2OOLA 4I3JA 4WMCD 1W79A 1ES2A 2HJ9C 5EUAA 2B18A 3T4LA 1TVFA 4BBTA 2VEAA 3Q81A 1PRQA 3ZG9B 4O0PA 2PU4A 3N7WA 3S7PA 4HBUA 3RFBA 4FD8A 3BLSA 2JHEA 2I9VA 5GLAA 2HJEA 1FOFA 4OOYA 4NXGA 3T50A 4KZAA 3NC8A 3GTCA 4MBHA 4DN0A 3TJZC 3NULA 2H5SA 1XA7A 1K55A 3HJIA 3G31A 4WELA 1MBLA 2WGVA 3VP1A 1BT5A 5A8BA 3KYZA 3F1PB 5DFYA 2PU2A 3R7WA 3HREA 3ZQ5A 5FQQA 2INWA 4S2JA 4E04A 3GDIA 4DXBA 1DJAA 3FV7A 4L0LA 2C6WB 2ZM0A 1PZPA 2ZL1A 1N9BA 4H6JA 3OBFA 3SZTA 3VSKA 1RGZA 3T4KA 3HUOA 3VP0A 3WRTA 1TDGA 2L1MA 2M7UA 3BQ8A 3EEAA 3HL9A 2QHKA 5G4YA 2JKGA 4OLDA 2XROA 2XF3A 1ONHA 1SDEA 1C3BA 2JC7A 3MJQA 5DTSA 3UMDA 2QMIA 4DJ2A 1YSPA 3PXPA 2PYRA 2GX5A 1VM1A 4P6BA 3VOZA 3UB6A 2Z6DA 2XRNA 1K6SA 1EWZA 1K38A 4XT2A 2AVXA 5FDSA 2BASA 5FAQA 3T1RA 5HAIA 1JNUA 3K2NA 1LSVA 2G2WA 2R9XA 4NG2A 1KGGA 4B9OA 3IXBA 1XGIA 2Y8HA 3G6OA 3ZYTA 1JWVA 1F9IA 1O07A 4Z9QA 1NYYA 1LI9A 3WS1A 3BYDA 1KGEA 4NXEA 3T4QA 3OCLA 3PAEA 4Q0JA 4WMCA 4BD0A 1YM1A 1L3LA 5CHJA 2QWSA 2M1CA 3CZDA 2BG1A 3OC2A 1XXMA 3S22A 2V1BA 3VMAA 3B3XA 5HARA 3UDIA 3UB7A 3FPWA 4PKYA 3IHAA 4Q8IA 4BD1A 4G3WA 1MXOA 4U0TA 4QHCA 3JVVA 4OQIA 1YQSA 4DXCA 2W3FA 3LFVA 4HJ4A 4RQ9A 3ZNYA 3FG8A 1EW0A 3S7QA 3LR0A 1N9OA 4YOFA 5DTKA 2CC1A 1T18A 3MKFA 4WYYA 4E3OA 2KOIA 1DJCA 5F69A 2Y2KA 5CTMA 1I5QA 4L9FA 4JXSA 3K3DA 3GECA 4PM6A 1E3UD 1BLSA 1Y28A 4DDSA 4FSFA 1SDNA 3PBNA 1FCNA 1S1ZA 3IX4A 4XUZA 3NOUC 2XD5A 1FILA 1FR6A 3C30A 4I3AA 1GHPA 3MR0A 5HPIA 4GOGA 2P9VB 4JXVA 4NEED 1Q2PA 3HLCA 4LENA 2PAVP 3ZNTA 3MXRA 3UO9A 3HBRA 2W3EA 3P7NA 2VGKA 1FSWA 2GZAA 4BL3A 4S2PA 4D60A 1I2SA 1MWSA 3SS4A 3C7VA 3GQZA 3HJKA 1PW8A 3SS5A 4OQGA 4CPKA 3FPVA 3BJNA 4KQRA 4ZBEA 3IXDA 3G35A 1KVLA 5F83A 1SKFA 1CEGA 2JN7A 4Y0UA 1Y4OA 1XX2A 2DRWA 4P85A 1X0OA 3T4SA 2XFSA 1K57A 1ZG4A 2O9BA 2WKRA 3PBTA 4S2IA 5D3OA 3SW1A 1ZC2A 1MWUA 3MQOA 5HDCA 4GW9A 4PMAA 5EVIB 2ZMFA 4WEKA 4XUXA 4LRXC 1E25A 5BOHA 5AQ9A 2X71A 2JKTI 4ZTKA 3LR5A 2H28A 3C38A 4F94A 4S2KA 4UA6A 3T4TA 3DTKA 4UAAA 3CUEC 5AVFA 3TG9A 1HZOA 4JGQA 3QNCA 4MNRA 4UQIM 5F1GA 3DTMA 4KUKA 1IKIA 4S2NA 2PR5A 4HI4A 5F82A 3LEZA 1M6KA 2V8CA 3H82A 2A3UA 3PBQA 4P6ZS 3H7WA 3SOIA 2WZZA 4B88A 2ZM8A 2L0WA 1H3QA 4GKUA 5DKKA 3CMZA 5A90A 1H5XA 4UQIS 4I38A 3G4PA 5GHXA 4BLMA 4IBXA 1W8QA 1XPBA 3GSGA 2YKFA 1K25A 3BY9A 3V3RA 1JTDA 4JBFA 3NI9A 4OLGA 4X25A 1NRJA 2XFTA 4JPMA 2OAQ1 4IJGA 4MBFA 3M6HA 3LY3A 3FWLA 3UNWA 4PPRA 1P9RA 1YLYA 3O5YA 1F98A 5FEFA 3PBOA 3EOIA 5F5YA 5A91A 4EBNA 5J7EA 4OQ0A 4GDBA 2J80A 3A3JA 3ULFA 4RVAA 1FIKA 5J8XA 3ZDJA 5EM1A 1ERMA 2Q9MA 5E43A 1NZUA 3G2YA 2J8YA 2A24B 2O9CA 4IUHA 5EVIA 4X55A 2HDRA 1PW1A 4HY8A 3BQAA 4KZ6A 3NBLA 3FKWA 1IEMA 3AGFA 1Y54A 2Z2LB 5HAPA 1N4OA 1YLZA 1FQGA 2ZQ7A 3NDGA 5EVIC 1WYBA 3BFCA 2ZC7A 3ZVWA 4LRZE 3NJAA 5AQBA 4K91A 2YKHA 2WAFA 4GB7A 1DP6A 2XA7S 1T1AA 4ETZA 2Y2JA 4JLFA 3LY4A 5CHMA 4MDZA 3Q82A 4KZBA 3UPNA 1QMFA 2H10A 3F1NA 3W8KA 2G7UA 1CQAA 1BLHA 3IX8A 4GN2A 1XJ4A 1G5UA 3VOLA 2ZOIA 4HJ3A 3S7OA 3G30A 2L4RA 1DRMA 5GHYA 2VK3A 3OPPA 1GA9A 1SZVA 3PBSA 3QP2A 1MWTA 3RXXA 4U3TA 3LIDA 4GCZA 3BFEA 3ZG8B 1NXYA 2J9PA 3IWQA 4LCLA 4E6XA 2HGVA 2H0YA 1LL9A 4OONA 3ZCZA 1NLYA 1JWZA 1UGUA 5L2FA 1ES5A 5HDDA 5EOEA 3B33A 2OWJA 2J9OA 1YT4A 5FI7A 3AGEA 3B47A 1XFQA 1PI5A 1KGFA 2EXBA 4KG6A 4UHUA 1GCEA 4WZ5C 2B95A 2JKRI 4BBUA 3H7WB 1YLJA 3V39A 5CGSA 1TD5A 2RL3A 3MZEA 5EE8A 5CERA 3WWXA 3T4OA 4GJ4A 4RA7A 4U0XA 1K56D 3OLOA 5CXWA 1Q2QA 3A0SA 4JF6A 3M2JA 1XKZA 4DE2A 4C3QA 3BW6A 1K4EA 2FZ0A 3ZG0A 2MJ6A 3O86A 4E3KA 3I7JA 2Y2LA 5EVLA 3NY4A 1KE4A 2XR0A 4Y0TA 1FSYA 4AFIA 4X69A 3QHYA 1YMSA 3N8SA 2WKQA 3IWIA 3KYQA 1K56A 4Y15A 5FQJA 4S2OA 3UN7A 3LR4A 4ZJ3A 2ZQDA 5TBMB 5U47A 5CECA 4OOMA 3E2KA 2UV0E 1TF1A 5FL3A 5G18A 3JVUA 3BWLA 2BLSA 4PAUA 4K0WA 1MC0A 3BFGA 2EWVA 5I94A 4IEDA 2OSUA 4B93A 1MWRA 4R6LA 2WKEA 1NZOA 1O7EA 1LL5A 4ID4A 2GNXA 1ESIA 2Q9NA 4PHTA 4QJGA 2A24A 2Z6CA 3H9WA 1Z09A 3DWKA 1DP9A 3OZHA 2ZL1B 4NK3A 5HX9A 4CJNA 2IA2A 5AQAA 1WA9A 4GLQA 5FSRA 5KSCA 3UE0A 4QWOA 3CPTB 4ZRRA 4EXOA 5EV0A 3O87A 2B5RA 1CK3A 2W3GA 1XJ2A 4NXFA 3G32A 3C4PA 3S7NA 1BSGA 3UDFA 3Q1FA 5GLDA 2P7JA 4LV2A 4O01A 2ZOHA 3LI8A 3G34A 3PYPA 4Q0IA 5KMWA 3PHYA 3IS2B 2EX9A 5KIZA 3IXHA 4FH4A 4OPQA 4ZJ2A 3LCEA 3EGDC 4WZ5A 1J9MA 5DTTA 2ZC3B 1KOUA 1Z6FA 4NXBA 3PTEA 3DBAA 4UA9A 5FQIA 2EX6A 2I72A 2P74A 3CI6A 5EVID 2XGNA 3O88A 3ITAA 1IOUA 5G4ZA 4GS9A 1JVJA 4HOIA 2QYBA 4HHDA 1L2SA 2XLNA 4L9GA 2J3TD 3K3CA 1UWNX 1IELA 5LBRA 5E2GA 4YINA 4FCFA 2IWDA 3HLFA 1GSVA 1OTBA 1L0EA 3EWKA 2EA9A 4DKIA 2P9VA 1V9YA 5I5LA 3DTEA 5HWWA 1GSXA 3RJUA 2HF6A 4R4RA 3T1QB 1T1CA 3D3OA 2C5WB 3FYZA 3W4OA 2QJ5A 5EOOA 3CG5A 3LUQA 4WLAA 3U4LP 4LV0A 3UE3A 4IHQA 4DE3A 5HSQA 3FKVA 1A0KA 1S4SA 2FFFB 3UY6A 3ISGA 5TBMA 3ITBA 1FCMA 1CJFA 4LV1A 3VV4A 4FH2A 2XQZA 1OTAA 3L7HA 5EVEA 5M19A 5DF8A 3Q7VB 3QP5A 3VFHA 2ZMAA 2HDSA 4D2OA 5HD5A 3IF6C 3CUEA 5FI2A 3QNBA 4B4XA 3VFFA 5HDSA 1ZHHB 4O8GA 3TE8A 3KSIA 3VP4A 1E4DA 1YLTA 1YAXA 3WS0A 1K0KA 2JE5A 2V20A 4H6JB 2P04A 3DTIA 3E98A 5L10A 4E3IA 1VQQA 1AWIA 3VE4A 2Y2IA 4X56A 2PR6A 1NYMA 4N1HA 3OPHA 1DJBA 4KQOA 3UDXA 2HP6A 3N4IA 1JTGA 3EGXC 4OPZA 5KSHA 2WKIA 4Y3IA 2JKTM 4JXWA 4N1XA 4EV4A 1OTIA 4KZ5A 3QP4A 4WM9A 3ZG5A 4Y0OA 2QKPA 2VGLM 4GZBA 4HH3A 3S4XA 1N9LA 3UPPA 4ARZB 4OP5A 4EU0A 4MCWA 3C5AA 2V8FA 5MC7A 3C7UA 4ZDXA 3QP1A 4X1MA 2W1TB 3VE3A 5EFWA 2JCHA 3BLMA 2D01A 2K7SA 1OTDA 4E3MA 4DRTA 1HLUP 5F6AA 1IYOA 4LCMA 3T4JA 4DE1A 4EW7A 2V1ZA 4ZJ1A 2ZMVA 1W7FA 4G3KA 1UWPX 3L9KA 1XP4A 3KO6A 3UE6A 3IF5A 1EROA 2ZC6B 3VOYA 1VETB 5IS1A 4MMNA 3SH7A 3BECA 4K08A 1H8ZA 4CLCB 4IVKA 3A3FA 5DJTA 4CLCE 1OMEA 1L0GA 2XDMA 4R4SA 1K55C 2XD1A 3HLBA 1RGYA 4Y5FA 3RH8B 4C6YA 3GVBA 1HTZA 3MQQA 1YSQA 4LRYC 1MKMA 5FASA 1OJ5A 3GRJA 4KENB 1GHMA 1SKOB 3D4FA 5CEBA 3IH8A 3ICYA 2K31A 4B4ZA 3LIEA 5CGWA 2B02A 4EBLA 5A92A 4N9LA 2VGLS 3T12B 4FOFA 1CEFA 2ZQ8A 4MLLA 3SH9A 2WGIA 1GA0A 4HH2A 4JF5A 3Q7VA 2V9AA 3VP3A 3WS5A 3LGOA 5GLCA 3IF6A 3EEHA 3LYXA 2HP9A 2WADA 1IYSA 5FATA 4CQHA 2PDRA 3HLEA 4RYEA 2Y55A 4DDYA 2ZC5B 1KE3A 3IHBA 3TW8A 4X53A 1PYYA 4JGPA 2J3TC 2IWCA 1LI0A 2PRFA 3M2KA 4PM5A 2QPNA 2ZJ9A 2VA0A 3PBRA 2VV8A 1W63Q 2K2NA 5J3WA 4R3BA 1XJ6A 3BM6A 1MPLA 1YMXA 4F3LA 3GMWA 4KZ4A 3V67A 2PYPA 3F1PA 3A3IA 4MBKA 1QMEA 3SH8A 3MMHA 3IX3A 4R23A 1M40A 4I39A 1XA1A 2ZQ9A 4WBGA 5EPHA 1T1BA 5HL6A 3A0VA 3KSFA 5GHZA 2R78A 3HUMA 2WGWB 2JBFA 3IT9A 4XXRA 1S0WA 4QY5A 3ZG7B 2X02A 3EQVA 4R3AA 3C2WA 3E2LA 3LICA 4KG5A 1OT6A 4ME4A 2Y79A 3T1SA 3D9YA 5CHUA 3LIBA 3MFDA 2OLVA 1DP8A 2VGJA 4Z1WA 3E4PA 1G6OA 1H8MA 4WEJA 3SS3A 4XT2B 4NKPA 5HPFA 2J7VA 1ALQA 2Y2QA 1KVMA 1LSXA 1P97A 2NUTC 3UB5P 5EM0A 4E3NA 3R7WB 4BL2A 4ESPA 4PM8A 2GDNA 3HUNA 1RP5A 3KSGA 4CLCC 2LB5A 2A49A 4G3VA 4UEYA 1G28A 1YLPA 4YFMA 3DAVA 4EESA 4OPRA 1FR1A 4UA7A 3V50A 2HZ5A 5FAPA 2VX8A 4GNUA 1AXBA 4P6ZM 5HAQA 1BZAA 2VJWA 1DY6A 1S6RA 3LO7A 3HCYA 1LT0A 3CAXA 4IVIA 4EWFA 4LLOB 1PIOA 3Q07A 1ERQA 2W3DA 3IQAA 3P98A 3VP2A 4P0MA 1KDWA 1BUEA 1G6AA 2PBDP 2OWHA 2RCXA 5JYPA 1P9WA 4WZ4A 1MKIA 2EXAA 2PHYA 4Y17A 1FCOA 1PNEA 3EQUA 2V2FF 4S2LA 1VHMA 1ES3A 3BY8A 2WAEA 3RTYA 4BJPA 2OAP1 3FC7A 3MXSA 5FAOA 3F1OB 1VB6A 3TOIA 3NHQA 1IFQA 4DJ3A 4EUVA 1BLCA 3N8RA 3MF0A 1TEMA 1W8YA 2WUQA 1SHVA 2WKPA 2P08A 2OLUA 3CJMA 5HD3A 1PI4A 3V3SA 1OTEA 4I3IA 2PD8A 3A3EA 4N92A 2Y4AA 4DF6A 1IYPA 5F68A 4ETXA 4E3LA 2VZWA 2JKRM 3LIFA 4JKTA 3MKEA 4JGRA 3GV9A 3IF6B 1VEUB 3D72A 4KZ7A 3MQ0A 1LLBA 5FA7A 5L09A 3NOTC 1K4FA 5GL9A 1U60A 5CRFA 1KDSA 2V0UA 5E2HA 4PM7A 5E2FA 1ODVA 3R4KA 3HVFA 3JPUA 3KSHA 5HZHA 1EI5A 3S1YA 4M4XA 1IKGA 4KZ9A 5IU1A 4KG2A 2D02A 2DMWA 3ZGAB 3LEQA 4MN6A 4P87A 2UWXA 1D7EA 4GHIB 3CPTA 4E6WA 4PKYG 4QPRA 3CLOA 3C4OA 3VSLA 1STZA 4EQ1A 4EUZA 3BEBA 5AVEA 2O99A 5M18A 5C5KA 5A93A 2W1RA 4LV3A 5IHVA 1OJGA 1PWGA 4EBPA 1PWCA 2KDKA 3HLDA 3IWOA 3F1OA 4R1GA 4Y7PA 2ACGA 2VLGA 3OOVA 1S67L 2E8IA 4LFUA 1SCWA 1ZTUA 2ZLYA 3A3DA 1XGJA 3W4PA 3MS6A 2HP5A 2EFUA 1KE0A 3DWZA 1TS8A 1BLPA 1LL8A 4OOLA 1F5MA 4Q0HA 3FZCA 2PD7A 1GHIA 1H0MA 5HWTA 2V0WA 4A5RA 4R3JA 1E3UA 3DW0A 1CI9A 5K5BA 3E4QA 3IS2A 3B42A 2W0NA 4MN7A 5FQMA 4BBVA 1ZKJA 4PM9A 1L0FA 3BRMA 5FQ9A 2E8JA 2DNSA 2XSSA 5E2EA 5AQ7A 4OP8A 1K54C 4KQQA 5DFXA 2XH9A 4IBRA 2FH5A 5EECA 2HDQA 4JF4A 4R70A 2Y2NA 1CF0A 1K6RA 4YWZA 4HBTA 3LI9A 3CHWP 3O3VA 4GD8A 4NETA 3T1XA 3UB8A 3W4QA 4JGOA 5TR7A 2HDUA 5FDHA 3UPOA 2W27A 2ZC4B 1TS6A 3HLGA 1F2KA 1VETA 4GS9B 2WKHA 4X6TA 1TS7A 4KUOA 3N6IA 3BFDA 4WF0A 5FI6A 1VEUA 1N9NA 4BMWA 3NIAA 4GDNA 2EWWA 4OQHA 3UE1A 3KX0X 3NECA 3NOPC 3JYIA 4L9EA 2HV1A 1SKOA 2PT7A 2R9WA 4Y13A 4JXGA 1HVBA 4WL9A 3N8LA 3LIAA 3IH9A 5L8MA 3HLWA 3M6BA 2EX8A 2Y2GA 1RCJA 2W1TA 4X68A 3P09A 1PFLA 2G2UA 2Y2HA 3ZHHA 4HIAA 1ONGA 4R38A 1P0ZA 1S1YA 2O0YA 4YNRA 4BQMA 2Q0OA 1HD8A 4LGWA 5TJJA 1I2WA 3TSGA 4QB8A 3W2ZA 3CITA 2DCFA 1LHYA 3GR2A 2A2LA 4I5SA 2FFYA 1NJ4A 3E0YA 2XA7M 5KZHA 1L0DA 2Y2PA 4MEZA 1PZOA 2PBYA 2IWBA 1NWZA 1ES4A 4KZ3A 3UB9A 3Q7ZA 4HNBA 5CEDA 2ZQCA 1ESUA 2KLIA 5DVAA 4II7A 2LB9A 1NY0A 1D1JA 3P01A 3F1NB 4GHIA 2X01A 2GJ3A 1W5DA 4F3LB 4BENA 4RX2A 2ZD8A 1T19A 4OVDA 2XK1A 5CTNA 2VKSA 3OPLA 5HWVA 1MY8A 4HJ6A 2WK0A 1YLWA 2VV7A 2ZQAA 4K0XA 3PR6A 4KQDA 1OT9A 2WZXA 4EETB 3ZVTA 4WN5A 1K54A 4HEFA 5F1FA 1GSWA 3IBJA 4QD4A 2W3HA 4S2NC 2KX6A 4HP4A 4IUKA 4O7DA 3NDEA 4RX3A 4H8RA 2Y59A 4E3JA 1ZG6A 1XFNA 1BTLA 5HL1A 1IYQA 4LPZA 1YKDA
chains in the Genus database with same CATH topology
1XJ3A 3HCYA 5DF9A 1LT0A 3CAXA 2V1AA 1X0OA 3T4SA 3CI6A 2O9BA 1MZUA 4LLOB 2W3DA 2WKRA 3PBTA 1IOUA 5G4ZA 4ARZA 4GS9A 4HOIA 1BYWA 2QYBA 4HHDA 4MN5A 2OWHA 3SW1A 4L9GA 3MQOA 2J3TD 3K3CA 5HDCA 4GW9A 1P9WA 2VV6A 1UWNX 2ZMFA 5LBRA 5J4EA 4WEKA 4LRXC 1TS0A 2PHYA 3CWFA 1D06A 2JKTI 3LR5A 3EQUA 2H28A 1GSVA 3C38A 1OTBA 3EWKA 2EA9A 1V9YA 3T4TA 1VHMA 4CLCA 3CUEC 2J3WA 3OCNA 5AVFA 5I5LA 3BY8A 4JGQA 5DKLA 3RTYA 4BJPA 2OAP1 5HWWA 1GSXA 4UQIM 2HF6A 3FC7A 3U2AA 3F1OB 1T1CA 1VB6A 3D3OA 4Y2FA 4KUKA 3NHQA 2PR5A 1IFQA 4HI4A 3TRCA 4DJ3A 4EUVA 3LR3A 2QJ5A 3UMEA 3MF0A 3H82A 3LUQA 4WLAA 2WKPA 3PBQA 2P08A 3MXQA 4P6ZS 5HD3A 3H7WA 3UE3A 4IHQA 5HSQA 3A0RA 1S4SA 1OTEA 4I3IA 2L0WA 1H3QA 2PD8A 5TBMA 4HP9A 4WUJA 5DKKA 5F68A 4ETXA 3C8CA 4UQIS 4I38A 2VZWA 2JKRM 4EEUA 3LIFA 2NUPC 4DMZA 3VV4A 4JGRA 2YKFA 5DJUA 2QJ7A 3D72A 3BY9A 3IBRA 1OTAA 5CX7A 3MQ0A 4EEPA 4EERA 3NOTC 1NRJA 2O9AA 4HQAA 5HD5A 1V9ZA 2OAQ1 4IJGA 3CUEA 5HDSA 1ZHHB 4O8GA 3TE8A 5IT5A 2V0UA 3KSIA 1P9RA 3MFXA 2M7VA 1ODVA 3O5YA 1YAXA 1F98A 1W63M 1NLZA 4H6JB 4CLCD 3R4KA 2P04A 3E98A 3PBOA 3KSHA 5HZHA 3EOIA 5F5YA 1OPXA 5J7EA 1S4RA 4M4XA 1LSWA 3VE4A 2J80A 5IU1A 2PR6A 3ULFA 2D02A 2DMWA 1S66L 4KQOA 4MN6A 4BWIA 1D7EA 4GHIB 3H82B 3E4OA 4PKYG 5AJGA 2ZBBA 3EGXC 4QPRA 3CLOA 5KSHA 2CMNA 2A24B 2O9CA 4IUHA 4Y3IA 1STZA 4HY8A 2JKTM 1OTIA 4EQ1A 3BQAA 2OOLA 4I3JA 5AVEA 2HJ9C 2QKPA 2B18A 2VGLM 3T4LA 2O99A 4BBTA 4HH3A 5C5KA 1N9LA 4ARZB 4EU0A 2VEAA 2W1RA 4O0PA 1OJGA 3S7PA 2KDKA 3F1OA 4MCWA 2VLGA 3RFBA 5MC7A 3OOVA 1S67L 2JHEA 4LRZE 1ZTUA 2W1TB 3NJAA 3VE3A 5EFWA 2YKHA 2D01A 2K7SA 1OTDA 1DP6A 2I9VA 2XA7S 1T1AA 4ETZA 2HJEA 5F6AA 3T50A 4NXGA 3T4JA 4EW7A 4MDZA 4DN0A 3F1NA 1TS8A 2G7UA 3TJZC 1LL8A 2ZMVA 1XJ4A 4G3KA 3VOLA 2ZOIA 3HJIA 4HJ3A 4OOLA 4WELA 1UWPX 1F5MA 4Q0HA 3S7OA 3KO6A 3UE6A 2L4RA 1DRMA 2PD7A 5A8BA 3KYZA 3F1PB 5DFYA 3PBSA 3R7WA 5HWTA 2V0WA 3ZQ5A 5IS1A 2INWA 4MMNA 4E04A 3GDIA 3LIDA 4GCZA 4K08A 4CLCB 5DJTA 5K5BA 4CLCE 3E4QA 3IS2A 3B42A 2W0NA 2HGVA 4L0LA 4Y5FA 3RH8B 4MN7A 4BBVA 3MQQA 1NLYA 4H6JA 1YSQA 1UGUA 3OBFA 4LRYC 1MKMA 1OJ5A 3T4KA 5HDDA 3B33A 2XSSA 2OWJA 2L1MA 3BQ8A 3EEAA 5G4YA 2M7UA 2QHKA 3ICYA 5DFXA 2K31A 2XROA 2FH5A 3LIEA 2B02A 4R70A 3B47A 1XFQA 4YWZA 3LI9A 3MJQA 3UMDA 2VGLS 4DJ2A 4FOFA 1YSPA 3PXPA 2PYRA 3UB8A 2GX5A 2JKRI 4JGOA 4BBUA 3H7WB 4HH2A 3UB6A 1TD5A 2Z6DA 2W27A 2V9AA 2XRNA 1TS6A 4XT2A 3LYXA 3EEHA 3T4OA 4GJ4A 2BASA 3OLOA 4GS9B 3A0SA 1TS7A 1JNUA 3BW6A 4CQHA 2FZ0A 3K2NA 1LSVA 4KUOA 4WF0A 2PDRA 2MJ6A 1N9NA 4B9OA 4BMWA 2Y8HA 3G6OA 3TW8A 3ZYTA 1F9IA 4JGPA 2J3TC 2EWWA 4NXEA 3T4QA 3OCLA 3KX0X 4Q0JA 3NOPC 4AFIA 2VA0A 3PBRA 4L9EA 2VV8A 1W63Q 2K2NA 2HV1A 2WKQA 5J3WA 3KYQA 1XJ6A 2PT7A 3LR4A 2QWSA 4F3LA 4WL9A 5TBMB 3V67A 2M1CA 2PYPA 3F1PA 3LIAA 4OOMA 5L8MA 3MMHA 3OC2A 2V1BA 1TF1A 5FL3A 2W1TA 3JVUA 3BWLA 4I39A 4PAUA 4HIAA 3UB7A 4R38A 1P0ZA 1T1BA 5HL6A 1MC0A 1S1YA 3A0VA 2O0YA 4YNRA 3FPWA 3KSFA 4PKYA 2R78A 2EWVA 4G3WA 4B93A 5TJJA 4R6LA 3JVVA 2W3FA 3LFVA 4HJ4A 4RQ9A 3W2ZA 3CITA 3EQVA 3FG8A 2GNXA 1EW0A 2A2LA 4I5SA 3S7QA 4R3AA 3C2WA 3LICA 3E0YA 3LR0A 2XA7M 4PHTA 1N9OA 1OT6A 4YOFA 2A24A 2Z6CA 3H9WA 1T18A 4ME4A 2Y79A 2KOIA 5F69A 1NWZA 1DP9A 4L9FA 3K3DA 3GECA 3UB9A 4HNBA 1Y28A 3LIBA 1DP8A 4FSFA 2IA2A 2KLIA 3E4PA 1G6OA 1H8MA 4II7A 4Z1WA 2LB9A 3PBNA 4WEJA 1S1ZA 1WA9A 3P01A 3F1NB 4GLQA 4XT2B 3NOUC 4GHIA 4NKPA 2GJ3A 5HPFA 4F3LB 4ZRRA 4EXOA 3C30A 4I3AA 1T19A 3MR0A 1LSXA 1P97A 2W3GA 2NUTC 1XJ2A 4NXFA 5HPIA 2VKSA 5HWVA 3R7WB 3S7NA 4HJ6A 4NEED 2P7JA 2VV7A 4O01A 2ZOHA 3LI8A 3PR6A 4KQDA 1OT9A 3PYPA 4EETB 2W3EA 4Q0IA 3P7NA 4WN5A 3KSGA 3PHYA 2GZAA 4CLCC 3IS2B 2LB5A 1GSWA 3IBJA 5KIZA 4G3VA 4UEYA 2W3HA 1G28A 3EGDC 4EESA 2KX6A 4HP4A 3HJKA 2VX8A 4IUKA 1KOUA 3FPVA 3BJNA 4NXBA 4P6ZM 2JN7A 2VJWA 3DBAA 1XFNA 4LPZA 1YKDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MQQ A;  1XJ3 A;  5HZH A;  5F5Y A;  4H6J A;  1LT0 A;  3CAX A;  4HIA A;  4R38 A;  1P0Z A;  1UGU A;  1T1B A;  3UB7 A;  1S4R A;  1S1Y A;  1X0O A;  2V1A A;  3A0V A;  4LRY C;  1LSW A;  4M4X A;  4PKY A;  2R78 A;  1OJ5 A;  3VE4 A;  2J80 A;  1MZU A;  4LLO B;  5IU1 A;  2PR6 A;  2WKR A;  5HDD A;  3ULF A;  5G4Z A;  2D02 A;  3B33 A;  4GS9 A;  4HOI A;  1BYW A;  1S66 L;  2OWJ A;  4HHD A;  4MN5 A;  4R6L A;  2L1M A;  4MN6 A;  2OWH A;  5G4Y A;  3SW1 A;  2QHK A;  3MQO A;  4L9G A;  3UE6 A;  3K3C A;  5HDC A;  1D7E A;  3ICY A;  4GHI B;  2VV6 A;  3H82 B;  4GW9 A;  1UWN X;  4HJ4 A;  3E4O A;  4RQ9 A;  3LIE A;  5J4E A;  2B02 A;  4PKY G;  3FG8 A;  2ZBB A;  4LRX C;  1TS0 A;  2PHY A;  3CWF A;  1XFQ A;  3CLO A;  1EW0 A;  4R70 A;  2CMN A;  2A24 B;  4I5S A;  4R3A A;  1D06 A;  3C2W A;  4YWZ A;  3LIC A;  3LI9 A;  3MJQ A;  1N9O A;  2H28 A;  1GSV A;  1OT6 A;  2A24 A;  2Z6C A;  4HY8 A;  1OTI A;  3UMD A;  4EQ1 A;  1OTB A;  3EWK A;  3H9W A;  2EA9 A;  4DJ2 A;  1T18 A;  1V9Y A;  2OOL A;  4I3J A;  2PYR A;  5F69 A;  3UB8 A;  5AVF A;  5AVE A;  2QKP A;  5DJU A;  3BY8 A;  4JGQ A;  5DKL A;  5I5L A;  1NWZ A;  4JGO A;  3RTY A;  4BBU A;  1GSX A;  3H7W B;  5HWW A;  1DP9 A;  4L9F A;  3K3D A;  3GEC A;  4HH2 A;  3UB9 A;  4BBT A;  4HH3 A;  4HNB A;  1N9L A;  3FC7 A;  3UB6 A;  2VEA A;  3F1O B;  1Y28 A;  2W27 A;  2Z6D A;  1T1C A;  1VB6 A;  2V9A A;  3LIB A;  1OJG A;  4KUK A;  3NHQ A;  1DP8 A;  1TS6 A;  2PR5 A;  4XT2 A;  3EEH A;  2KDK A;  3LYX A;  3E4P A;  3F1O A;  4HI4 A;  4DJ3 A;  2VLG A;  3UME A;  2QJ5 A;  1S1Z A;  1WA9 A;  1S67 L;  3F1N B;  3H82 A;  4XT2 B;  3NOU C;  2BAS A;  4GHI A;  3LUQ A;  3OLO A;  2GJ3 A;  4WLA A;  2WKP A;  4F3L B;  4GS9 B;  2JHE A;  4LRZ E;  3NJA A;  3MXQ A;  4EXO A;  3A0S A;  3VE3 A;  1TS7 A;  4I3A A;  1JNU A;  2YKH A;  3H7W A;  5EFW A;  4KUO A;  1LSV A;  1T19 A;  2D01 A;  5HD3 A;  4WF0 A;  2PDR A;  2K7S A;  1OTD A;  1DP6 A;  2I9V A;  1LSX A;  1N9N A;  3MR0 A;  1T1A A;  3A0R A;  1P97 A;  4B9O A;  5HSQ A;  1XJ2 A;  4NXF A;  1S4S A;  1OTE A;  4I3I A;  5F6A A;  5HWV A;  2L0W A;  3T50 A;  3G6O A;  4NXG A;  4HJ6 A;  2PD8 A;  4EW7 A;  5TBM A;  4HP9 A;  2P7J A;  1F9I A;  4JGP A;  4WUJ A;  5DKK A;  2VV7 A;  2ZOH A;  3F1N A;  1TS8 A;  3LI8 A;  5F68 A;  4KQD A;  4NXE A;  3C8C A;  1OT9 A;  3PYP A;  1LL8 A;  4I38 A;  1XJ4 A;  3KX0 X;  4EET B;  4EEU A;  3P7N A;  3NOP C;  2ZOI A;  3LIF A;  3HJI A;  4WN5 A;  4HJ3 A;  3PHY A;  3VOL A;  1UWP X;  4JGR A;  2VV8 A;  2YKF A;  2WKQ A;  2HV1 A;  3IS2 B;  4L9E A;  1GSW A;  2L4R A;  1DRM A;  1XJ6 A;  2PD7 A;  2QJ7 A;  3BY9 A;  3D72 A;  3IBR A;  5J3W A;  5A8B A;  1OTA A;  5KIZ A;  1G28 A;  3F1P B;  4EEP A;  4EER A;  5HWT A;  2QWS A;  4EES A;  5J7E A;  3NOT C;  2V0W A;  4WL9 A;  5TBM B;  3ZQ5 A;  4F3L A;  2INW A;  2M1C A;  4HQA A;  2KX6 A;  5IS1 A;  2PYP A;  3F1P A;  3LIA A;  4HP4 A;  5HD5 A;  1V9Z A;  3HJK A;  4E04 A;  3GDI A;  3LID A;  4GCZ A;  4K08 A;  1KOU A;  5HDS A;  2V0U A;  5DJT A;  4NXB A;  2V1B A;  3MFX A;  3E4Q A;  1ODV A;  2JN7 A;  1F98 A;  3IS2 A;  2W0N A;  3BWL A;  4I39 A;  1XFN A;  4H6J B;  3RH8 B;  4LPZ A;  4BBV A; 
#chains in the Genus database with same CATH topology
 1XJ3 A;  4KZ8 A;  5DF9 A;  2V1A A;  4QY6 A;  1ACF A;  1MZU A;  1PWD A;  4EQI A;  1CI8 A;  4ARZ A;  1BYW A;  4MN5 A;  5DF7 A;  1G68 A;  2VV6 A;  1JWP A;  5J4E A;  4OKP A;  3V5M A;  1TS0 A;  2BTF P;  3CWF A;  4ZAM A;  1D06 A;  2JKF A;  1H8Y A;  3BFF A;  1WYC A;  5TFQ A;  4CLC A;  4S2M A;  2J3W A;  3OCN A;  5DKL A;  3G2Z A;  4X1L A;  5FQK A;  3U2A A;  2Y2M A;  3ZFZ A;  4Y2F A;  4OPY A;  3TRC A;  2EX2 A;  3LR3 A;  5HFO A;  3UME A;  3WRZ A;  4FTX A;  3MXQ A;  3WS2 A;  2Y91 A;  4OH0 A;  3A0R A;  3QP6 A;  1K57 C;  2EFX A;  4HP9 A;  4WUJ A;  4M3K A;  3C8C A;  2QZ6 A;  4QU3 A;  3RXW A;  4EEU A;  2NUP C;  3PAG A;  4HES A;  4DMZ A;  4GD6 A;  5L07 A;  5DJU A;  2ZM2 A;  5TGF A;  5FEG A;  2QJ7 A;  3IBR A;  3MSH A;  5CX7 A;  3MBZ A;  4EEP A;  4EER A;  3WS4 A;  2O9A A;  5CGX A;  4HQA A;  1V9Z A;  3MZF A;  2OV5 A;  4DE0 A;  5M1A A;  5IT5 A;  4FUW A;  3MFX A;  2M7V A;  1NRF A;  3AGD A;  2XEP A;  1W63 M;  1NLZ A;  3KYE A;  4CLC D;  4N9K A;  2WYX A;  3NCK A;  1OPX A;  1S4R A;  1LSW A;  3IXG A;  5GLB A;  1WE4 A;  1S66 L;  1BUL A;  1YPR A;  4BWI A;  2Z2M B;  2H0T A;  1J3W A;  4R0Q A;  3H82 B;  3E4O A;  5HW3 A;  3OPR A;  5JYO A;  5AJG A;  2ZBB A;  2CMN A;  3MZD A;  4C75 A;  3QP8 A;  1TDL A;  2Y2O A;  2HPB A;  2WGW A;  2OOL A;  4I3J A;  4WMC D;  1W79 A;  1ES2 A;  2HJ9 C;  5EUA A;  2B18 A;  3T4L A;  1TVF A;  4BBT A;  2VEA A;  3Q81 A;  1PRQ A;  3ZG9 B;  4O0P A;  2PU4 A;  3N7W A;  3S7P A;  4HBU A;  3RFB A;  4FD8 A;  3BLS A;  2JHE A;  2I9V A;  5GLA A;  2HJE A;  1FOF A;  4OOY A;  4NXG A;  3T50 A;  4KZA A;  3NC8 A;  3GTC A;  4MBH A;  4DN0 A;  3TJZ C;  3NUL A;  2H5S A;  1XA7 A;  1K55 A;  3HJI A;  3G31 A;  4WEL A;  1MBL A;  2WGV A;  3VP1 A;  1BT5 A;  5A8B A;  3KYZ A;  3F1P B;  5DFY A;  2PU2 A;  3R7W A;  3HRE A;  3ZQ5 A;  5FQQ A;  2INW A;  4S2J A;  4E04 A;  3GDI A;  4DXB A;  1DJA A;  3FV7 A;  4L0L A;  2C6W B;  2ZM0 A;  1PZP A;  2ZL1 A;  1N9B A;  4H6J A;  3OBF A;  3SZT A;  3VSK A;  1RGZ A;  3T4K A;  3HUO A;  3VP0 A;  3WRT A;  1TDG A;  2L1M A;  2M7U A;  3BQ8 A;  3EEA A;  3HL9 A;  2QHK A;  5G4Y A;  2JKG A;  4OLD A;  2XRO A;  2XF3 A;  1ONH A;  1SDE A;  1C3B A;  2JC7 A;  3MJQ A;  5DTS A;  3UMD A;  2QMI A;  4DJ2 A;  1YSP A;  3PXP A;  2PYR A;  2GX5 A;  1VM1 A;  4P6B A;  3VOZ A;  3UB6 A;  2Z6D A;  2XRN A;  1K6S A;  1EWZ A;  1K38 A;  4XT2 A;  2AVX A;  5FDS A;  2BAS A;  5FAQ A;  3T1R A;  5HAI A;  1JNU A;  3K2N A;  1LSV A;  2G2W A;  2R9X A;  4NG2 A;  1KGG A;  4B9O A;  3IXB A;  1XGI A;  2Y8H A;  3G6O A;  3ZYT A;  1JWV A;  1F9I A;  1O07 A;  4Z9Q A;  1NYY A;  1LI9 A;  3WS1 A;  3BYD A;  1KGE A;  4NXE A;  3T4Q A;  3OCL A;  3PAE A;  4Q0J A;  4WMC A;  4BD0 A;  1YM1 A;  1L3L A;  5CHJ A;  2QWS A;  2M1C A;  3CZD A;  2BG1 A;  3OC2 A;  1XXM A;  3S22 A;  2V1B A;  3VMA A;  3B3X A;  5HAR A;  3UDI A;  3UB7 A;  3FPW A;  4PKY A;  3IHA A;  4Q8I A;  4BD1 A;  4G3W A;  1MXO A;  4U0T A;  4QHC A;  3JVV A;  4OQI A;  1YQS A;  4DXC A;  2W3F A;  3LFV A;  4HJ4 A;  4RQ9 A;  3ZNY A;  3FG8 A;  1EW0 A;  3S7Q A;  3LR0 A;  1N9O A;  4YOF A;  5DTK A;  2CC1 A;  1T18 A;  3MKF A;  4WYY A;  4E3O A;  2KOI A;  1DJC A;  5F69 A;  2Y2K A;  5CTM A;  1I5Q A;  4L9F A;  4JXS A;  3K3D A;  3GEC A;  4PM6 A;  1E3U D;  1BLS A;  1Y28 A;  4DDS A;  4FSF A;  1SDN A;  3PBN A;  1FCN A;  1S1Z A;  3IX4 A;  4XUZ A;  3NOU C;  2XD5 A;  1FIL A;  1FR6 A;  3C30 A;  4I3A A;  1GHP A;  3MR0 A;  5HPI A;  4GOG A;  2P9V B;  4JXV A;  4NEE D;  1Q2P A;  3HLC A;  4LEN A;  2PAV P;  3ZNT A;  3MXR A;  3UO9 A;  3HBR A;  2W3E A;  3P7N A;  2VGK A;  1FSW A;  2GZA A;  4BL3 A;  4S2P A;  4D60 A;  1I2S A;  1MWS A;  3SS4 A;  3C7V A;  3GQZ A;  3HJK A;  1PW8 A;  3SS5 A;  4OQG A;  4CPK A;  3FPV A;  3BJN A;  4KQR A;  4ZBE A;  3IXD A;  3G35 A;  1KVL A;  5F83 A;  1SKF A;  1CEG A;  2JN7 A;  4Y0U A;  1Y4O A;  1XX2 A;  2DRW A;  4P85 A;  1X0O A;  3T4S A;  2XFS A;  1K57 A;  1ZG4 A;  2O9B A;  2WKR A;  3PBT A;  4S2I A;  5D3O A;  3SW1 A;  1ZC2 A;  1MWU A;  3MQO A;  5HDC A;  4GW9 A;  4PMA A;  5EVI B;  2ZMF A;  4WEK A;  4XUX A;  4LRX C;  1E25 A;  5BOH A;  5AQ9 A;  2X71 A;  2JKT I;  4ZTK A;  3LR5 A;  2H28 A;  3C38 A;  4F94 A;  4S2K A;  4UA6 A;  3T4T A;  3DTK A;  4UAA A;  3CUE C;  5AVF A;  3TG9 A;  1HZO A;  4JGQ A;  3QNC A;  4MNR A;  4UQI M;  5F1G A;  3DTM A;  4KUK A;  1IKI A;  4S2N A;  2PR5 A;  4HI4 A;  5F82 A;  3LEZ A;  1M6K A;  2V8C A;  3H82 A;  2A3U A;  3PBQ A;  4P6Z S;  3H7W A;  3SOI A;  2WZZ A;  4B88 A;  2ZM8 A;  2L0W A;  1H3Q A;  4GKU A;  5DKK A;  3CMZ A;  5A90 A;  1H5X A;  4UQI S;  4I38 A;  3G4P A;  5GHX A;  4BLM A;  4IBX A;  1W8Q A;  1XPB A;  3GSG A;  2YKF A;  1K25 A;  3BY9 A;  3V3R A;  1JTD A;  4JBF A;  3NI9 A;  4OLG A;  4X25 A;  1NRJ A;  2XFT A;  4JPM A;  2OAQ 1;  4IJG A;  4MBF A;  3M6H A;  3LY3 A;  3FWL A;  3UNW A;  4PPR A;  1P9R A;  1YLY A;  3O5Y A;  1F98 A;  5FEF A;  3PBO A;  3EOI A;  5F5Y A;  5A91 A;  4EBN A;  5J7E A;  4OQ0 A;  4GDB A;  2J80 A;  3A3J A;  3ULF A;  4RVA A;  1FIK A;  5J8X A;  3ZDJ A;  5EM1 A;  1ERM A;  2Q9M A;  5E43 A;  1NZU A;  3G2Y A;  2J8Y A;  2A24 B;  2O9C A;  4IUH A;  5EVI A;  4X55 A;  2HDR A;  1PW1 A;  4HY8 A;  3BQA A;  4KZ6 A;  3NBL A;  3FKW A;  1IEM A;  3AGF A;  1Y54 A;  2Z2L B;  5HAP A;  1N4O A;  1YLZ A;  1FQG A;  2ZQ7 A;  3NDG A;  5EVI C;  1WYB A;  3BFC A;  2ZC7 A;  3ZVW A;  4LRZ E;  3NJA A;  5AQB A;  4K91 A;  2YKH A;  2WAF A;  4GB7 A;  1DP6 A;  2XA7 S;  1T1A A;  4ETZ A;  2Y2J A;  4JLF A;  3LY4 A;  5CHM A;  4MDZ A;  3Q82 A;  4KZB A;  3UPN A;  1QMF A;  2H10 A;  3F1N A;  3W8K A;  2G7U A;  1CQA A;  1BLH A;  3IX8 A;  4GN2 A;  1XJ4 A;  1G5U A;  3VOL A;  2ZOI A;  4HJ3 A;  3S7O A;  3G30 A;  2L4R A;  1DRM A;  5GHY A;  2VK3 A;  3OPP A;  1GA9 A;  1SZV A;  3PBS A;  3QP2 A;  1MWT A;  3RXX A;  4U3T A;  3LID A;  4GCZ A;  3BFE A;  3ZG8 B;  1NXY A;  2J9P A;  3IWQ A;  4LCL A;  4E6X A;  2HGV A;  2H0Y A;  1LL9 A;  4OON A;  3ZCZ A;  1NLY A;  1JWZ A;  1UGU A;  5L2F A;  1ES5 A;  5HDD A;  5EOE A;  3B33 A;  2OWJ A;  2J9O A;  1YT4 A;  5FI7 A;  3AGE A;  3B47 A;  1XFQ A;  1PI5 A;  1KGF A;  2EXB A;  4KG6 A;  4UHU A;  1GCE A;  4WZ5 C;  2B95 A;  2JKR I;  4BBU A;  3H7W B;  1YLJ A;  3V39 A;  5CGS A;  1TD5 A;  2RL3 A;  3MZE A;  5EE8 A;  5CER A;  3WWX A;  3T4O A;  4GJ4 A;  4RA7 A;  4U0X A;  1K56 D;  3OLO A;  5CXW A;  1Q2Q A;  3A0S A;  4JF6 A;  3M2J A;  1XKZ A;  4DE2 A;  4C3Q A;  3BW6 A;  1K4E A;  2FZ0 A;  3ZG0 A;  2MJ6 A;  3O86 A;  4E3K A;  3I7J A;  2Y2L A;  5EVL A;  3NY4 A;  1KE4 A;  2XR0 A;  4Y0T A;  1FSY A;  4AFI A;  4X69 A;  3QHY A;  1YMS A;  3N8S A;  2WKQ A;  3IWI A;  3KYQ A;  1K56 A;  4Y15 A;  5FQJ A;  4S2O A;  3UN7 A;  3LR4 A;  4ZJ3 A;  2ZQD A;  5TBM B;  5U47 A;  5CEC A;  4OOM A;  3E2K A;  2UV0 E;  1TF1 A;  5FL3 A;  5G18 A;  3JVU A;  3BWL A;  2BLS A;  4PAU A;  4K0W A;  1MC0 A;  3BFG A;  2EWV A;  5I94 A;  4IED A;  2OSU A;  4B93 A;  1MWR A;  4R6L A;  2WKE A;  1NZO A;  1O7E A;  1LL5 A;  4ID4 A;  2GNX A;  1ESI A;  2Q9N A;  4PHT A;  4QJG A;  2A24 A;  2Z6C A;  3H9W A;  1Z09 A;  3DWK A;  1DP9 A;  3OZH A;  2ZL1 B;  4NK3 A;  5HX9 A;  4CJN A;  2IA2 A;  5AQA A;  1WA9 A;  4GLQ A;  5FSR A;  5KSC A;  3UE0 A;  4QWO A;  3CPT B;  4ZRR A;  4EXO A;  5EV0 A;  3O87 A;  2B5R A;  1CK3 A;  2W3G A;  1XJ2 A;  4NXF A;  3G32 A;  3C4P A;  3S7N A;  1BSG A;  3UDF A;  3Q1F A;  5GLD A;  2P7J A;  4LV2 A;  4O01 A;  2ZOH A;  3LI8 A;  3G34 A;  3PYP A;  4Q0I A;  5KMW A;  3PHY A;  3IS2 B;  2EX9 A;  5KIZ A;  3IXH A;  4FH4 A;  4OPQ A;  4ZJ2 A;  3LCE A;  3EGD C;  4WZ5 A;  1J9M A;  5DTT A;  2ZC3 B;  1KOU A;  1Z6F A;  4NXB A;  3PTE A;  3DBA A;  4UA9 A;  5FQI A;  2EX6 A;  2I72 A;  2P74 A;  3CI6 A;  5EVI D;  2XGN A;  3O88 A;  3ITA A;  1IOU A;  5G4Z A;  4GS9 A;  1JVJ A;  4HOI A;  2QYB A;  4HHD A;  1L2S A;  2XLN A;  4L9G A;  2J3T D;  3K3C A;  1UWN X;  1IEL A;  5LBR A;  5E2G A;  4YIN A;  4FCF A;  2IWD A;  3HLF A;  1GSV A;  1OTB A;  1L0E A;  3EWK A;  2EA9 A;  4DKI A;  2P9V A;  1V9Y A;  5I5L A;  3DTE A;  5HWW A;  1GSX A;  3RJU A;  2HF6 A;  4R4R A;  3T1Q B;  1T1C A;  3D3O A;  2C5W B;  3FYZ A;  3W4O A;  2QJ5 A;  5EOO A;  3CG5 A;  3LUQ A;  4WLA A;  3U4L P;  4LV0 A;  3UE3 A;  4IHQ A;  4DE3 A;  5HSQ A;  3FKV A;  1A0K A;  1S4S A;  2FFF B;  3UY6 A;  3ISG A;  5TBM A;  3ITB A;  1FCM A;  1CJF A;  4LV1 A;  3VV4 A;  4FH2 A;  2XQZ A;  1OTA A;  3L7H A;  5EVE A;  5M19 A;  5DF8 A;  3Q7V B;  3QP5 A;  3VFH A;  2ZMA A;  2HDS A;  4D2O A;  5HD5 A;  3IF6 C;  3CUE A;  5FI2 A;  3QNB A;  4B4X A;  3VFF A;  5HDS A;  1ZHH B;  4O8G A;  3TE8 A;  3KSI A;  3VP4 A;  1E4D A;  1YLT A;  1YAX A;  3WS0 A;  1K0K A;  2JE5 A;  2V20 A;  4H6J B;  2P04 A;  3DTI A;  3E98 A;  5L10 A;  4E3I A;  1VQQ A;  1AWI A;  3VE4 A;  2Y2I A;  4X56 A;  2PR6 A;  1NYM A;  4N1H A;  3OPH A;  1DJB A;  4KQO A;  3UDX A;  2HP6 A;  3N4I A;  1JTG A;  3EGX C;  4OPZ A;  5KSH A;  2WKI A;  4Y3I A;  2JKT M;  4JXW A;  4N1X A;  4EV4 A;  1OTI A;  4KZ5 A;  3QP4 A;  4WM9 A;  3ZG5 A;  4Y0O A;  2QKP A;  2VGL M;  4GZB A;  4HH3 A;  3S4X A;  1N9L A;  3UPP A;  4ARZ B;  4OP5 A;  4EU0 A;  4MCW A;  3C5A A;  2V8F A;  5MC7 A;  3C7U A;  4ZDX A;  3QP1 A;  4X1M A;  2W1T B;  3VE3 A;  5EFW A;  2JCH A;  3BLM A;  2D01 A;  2K7S A;  1OTD A;  4E3M A;  4DRT A;  1HLU P;  5F6A A;  1IYO A;  4LCM A;  3T4J A;  4DE1 A;  4EW7 A;  2V1Z A;  4ZJ1 A;  2ZMV A;  1W7F A;  4G3K A;  1UWP X;  3L9K A;  1XP4 A;  3KO6 A;  3UE6 A;  3IF5 A;  1ERO A;  2ZC6 B;  3VOY A;  1VET B;  5IS1 A;  4MMN A;  3SH7 A;  3BEC A;  4K08 A;  1H8Z A;  4CLC B;  4IVK A;  3A3F A;  5DJT A;  4CLC E;  1OME A;  1L0G A;  2XDM A;  4R4S A;  1K55 C;  2XD1 A;  3HLB A;  1RGY A;  4Y5F A;  3RH8 B;  4C6Y A;  3GVB A;  1HTZ A;  3MQQ A;  1YSQ A;  4LRY C;  1MKM A;  5FAS A;  1OJ5 A;  3GRJ A;  4KEN B;  1GHM A;  1SKO B;  3D4F A;  5CEB A;  3IH8 A;  3ICY A;  2K31 A;  4B4Z A;  3LIE A;  5CGW A;  2B02 A;  4EBL A;  5A92 A;  4N9L A;  2VGL S;  3T12 B;  4FOF A;  1CEF A;  2ZQ8 A;  4MLL A;  3SH9 A;  2WGI A;  1GA0 A;  4HH2 A;  4JF5 A;  3Q7V A;  2V9A A;  3VP3 A;  3WS5 A;  3LGO A;  5GLC A;  3IF6 A;  3EEH A;  3LYX A;  2HP9 A;  2WAD A;  1IYS A;  5FAT A;  4CQH A;  2PDR A;  3HLE A;  4RYE A;  2Y55 A;  4DDY A;  2ZC5 B;  1KE3 A;  3IHB A;  3TW8 A;  4X53 A;  1PYY A;  4JGP A;  2J3T C;  2IWC A;  1LI0 A;  2PRF A;  3M2K A;  4PM5 A;  2QPN A;  2ZJ9 A;  2VA0 A;  3PBR A;  2VV8 A;  1W63 Q;  2K2N A;  5J3W A;  4R3B A;  1XJ6 A;  3BM6 A;  1MPL A;  1YMX A;  4F3L A;  3GMW A;  4KZ4 A;  3V67 A;  2PYP A;  3F1P A;  3A3I A;  4MBK A;  1QME A;  3SH8 A;  3MMH A;  3IX3 A;  4R23 A;  1M40 A;  4I39 A;  1XA1 A;  2ZQ9 A;  4WBG A;  5EPH A;  1T1B A;  5HL6 A;  3A0V A;  3KSF A;  5GHZ A;  2R78 A;  3HUM A;  2WGW B;  2JBF A;  3IT9 A;  4XXR A;  1S0W A;  4QY5 A;  3ZG7 B;  2X02 A;  3EQV A;  4R3A A;  3C2W A;  3E2L A;  3LIC A;  4KG5 A;  1OT6 A;  4ME4 A;  2Y79 A;  3T1S A;  3D9Y A;  5CHU A;  3LIB A;  3MFD A;  2OLV A;  1DP8 A;  2VGJ A;  4Z1W A;  3E4P A;  1G6O A;  1H8M A;  4WEJ A;  3SS3 A;  4XT2 B;  4NKP A;  5HPF A;  2J7V A;  1ALQ A;  2Y2Q A;  1KVM A;  1LSX A;  1P97 A;  2NUT C;  3UB5 P;  5EM0 A;  4E3N A;  3R7W B;  4BL2 A;  4ESP A;  4PM8 A;  2GDN A;  3HUN A;  1RP5 A;  3KSG A;  4CLC C;  2LB5 A;  2A49 A;  4G3V A;  4UEY A;  1G28 A;  1YLP A;  4YFM A;  3DAV A;  4EES A;  4OPR A;  1FR1 A;  4UA7 A;  3V50 A;  2HZ5 A;  5FAP A;  2VX8 A;  4GNU A;  1AXB A;  4P6Z M;  5HAQ A;  1BZA A;  2VJW A;  1DY6 A;  1S6R A;  3LO7 A;  3HCY A;  1LT0 A;  3CAX A;  4IVI A;  4EWF A;  4LLO B;  1PIO A;  3Q07 A;  1ERQ A;  2W3D A;  3IQA A;  3P98 A;  3VP2 A;  4P0M A;  1KDW A;  1BUE A;  1G6A A;  2PBD P;  2OWH A;  2RCX A;  5JYP A;  1P9W A;  4WZ4 A;  1MKI A;  2EXA A;  2PHY A;  4Y17 A;  1FCO A;  1PNE A;  3EQU A;  2V2F F;  4S2L A;  1VHM A;  1ES3 A;  3BY8 A;  2WAE A;  3RTY A;  4BJP A;  2OAP 1;  3FC7 A;  3MXS A;  5FAO A;  3F1O B;  1VB6 A;  3TOI A;  3NHQ A;  1IFQ A;  4DJ3 A;  4EUV A;  1BLC A;  3N8R A;  3MF0 A;  1TEM A;  1W8Y A;  2WUQ A;  1SHV A;  2WKP A;  2P08 A;  2OLU A;  3CJM A;  5HD3 A;  1PI4 A;  3V3S A;  1OTE A;  4I3I A;  2PD8 A;  3A3E A;  4N92 A;  2Y4A A;  4DF6 A;  1IYP A;  5F68 A;  4ETX A;  4E3L A;  2VZW A;  2JKR M;  3LIF A;  4JKT A;  3MKE A;  4JGR A;  3GV9 A;  3IF6 B;  1VEU B;  3D72 A;  4KZ7 A;  3MQ0 A;  1LLB A;  5FA7 A;  5L09 A;  3NOT C;  1K4F A;  5GL9 A;  1U60 A;  5CRF A;  1KDS A;  2V0U A;  5E2H A;  4PM7 A;  5E2F A;  1ODV A;  3R4K A;  3HVF A;  3JPU A;  3KSH A;  5HZH A;  1EI5 A;  3S1Y A;  4M4X A;  1IKG A;  4KZ9 A;  5IU1 A;  4KG2 A;  2D02 A;  2DMW A;  3ZGA B;  3LEQ A;  4MN6 A;  4P87 A;  2UWX A;  1D7E A;  4GHI B;  3CPT A;  4E6W A;  4PKY G;  4QPR A;  3CLO A;  3C4O A;  3VSL A;  1STZ A;  4EQ1 A;  4EUZ A;  3BEB A;  5AVE A;  2O99 A;  5M18 A;  5C5K A;  5A93 A;  2W1R A;  4LV3 A;  5IHV A;  1OJG A;  1PWG A;  4EBP A;  1PWC A;  2KDK A;  3HLD A;  3IWO A;  3F1O A;  4R1G A;  4Y7P A;  2ACG A;  2VLG A;  3OOV A;  1S67 L;  2E8I A;  4LFU A;  1SCW A;  1ZTU A;  2ZLY A;  3A3D A;  1XGJ A;  3W4P A;  3MS6 A;  2HP5 A;  2EFU A;  1KE0 A;  3DWZ A;  1TS8 A;  1BLP A;  1LL8 A;  4OOL A;  1F5M A;  4Q0H A;  3FZC A;  2PD7 A;  1GHI A;  1H0M A;  5HWT A;  2V0W A;  4A5R A;  4R3J A;  1E3U A;  3DW0 A;  1CI9 A;  5K5B A;  3E4Q A;  3IS2 A;  3B42 A;  2W0N A;  4MN7 A;  5FQM A;  4BBV A;  1ZKJ A;  4PM9 A;  1L0F A;  3BRM A;  5FQ9 A;  2E8J A;  2DNS A;  2XSS A;  5E2E A;  5AQ7 A;  4OP8 A;  1K54 C;  4KQQ A;  5DFX A;  2XH9 A;  4IBR A;  2FH5 A;  5EEC A;  2HDQ A;  4JF4 A;  4R70 A;  2Y2N A;  1CF0 A;  1K6R A;  4YWZ A;  4HBT A;  3LI9 A;  3CHW P;  3O3V A;  4GD8 A;  4NET A;  3T1X A;  3UB8 A;  3W4Q A;  4JGO A;  5TR7 A;  2HDU A;  5FDH A;  3UPO A;  2W27 A;  2ZC4 B;  1TS6 A;  3HLG A;  1F2K A;  1VET A;  4GS9 B;  2WKH A;  4X6T A;  1TS7 A;  4KUO A;  3N6I A;  3BFD A;  4WF0 A;  5FI6 A;  1VEU A;  1N9N A;  4BMW A;  3NIA A;  4GDN A;  2EWW A;  4OQH A;  3UE1 A;  3KX0 X;  3NEC A;  3NOP C;  3JYI A;  4L9E A;  2HV1 A;  1SKO A;  2PT7 A;  2R9W A;  4Y13 A;  4JXG A;  1HVB A;  4WL9 A;  3N8L A;  3LIA A;  3IH9 A;  5L8M A;  3HLW A;  3M6B A;  2EX8 A;  2Y2G A;  1RCJ A;  2W1T A;  4X68 A;  3P09 A;  1PFL A;  2G2U A;  2Y2H A;  3ZHH A;  4HIA A;  1ONG A;  4R38 A;  1P0Z A;  1S1Y A;  2O0Y A;  4YNR A;  4BQM A;  2Q0O A;  1HD8 A;  4LGW A;  5TJJ A;  1I2W A;  3TSG A;  4QB8 A;  3W2Z A;  3CIT A;  2DCF A;  1LHY A;  3GR2 A;  2A2L A;  4I5S A;  2FFY A;  1NJ4 A;  3E0Y A;  2XA7 M;  5KZH A;  1L0D A;  2Y2P A;  4MEZ A;  1PZO A;  2PBY A;  2IWB A;  1NWZ A;  1ES4 A;  4KZ3 A;  3UB9 A;  3Q7Z A;  4HNB A;  5CED A;  2ZQC A;  1ESU A;  2KLI A;  5DVA A;  4II7 A;  2LB9 A;  1NY0 A;  1D1J A;  3P01 A;  3F1N B;  4GHI A;  2X01 A;  2GJ3 A;  1W5D A;  4F3L B;  4BEN A;  4RX2 A;  2ZD8 A;  1T19 A;  4OVD A;  2XK1 A;  5CTN A;  2VKS A;  3OPL A;  5HWV A;  1MY8 A;  4HJ6 A;  2WK0 A;  1YLW A;  2VV7 A;  2ZQA A;  4K0X A;  3PR6 A;  4KQD A;  1OT9 A;  2WZX A;  4EET B;  3ZVT A;  4WN5 A;  1K54 A;  4HEF A;  5F1F A;  1GSW A;  3IBJ A;  4QD4 A;  2W3H A;  4S2N C;  2KX6 A;  4HP4 A;  4IUK A;  4O7D A;  3NDE A;  4RX3 A;  4H8R A;  2Y59 A;  4E3J A;  1ZG6 A;  1XFN A;  1BTL A;  5HL1 A;  1IYQ A;  4LPZ A;  1YKD A; 
#chains in the Genus database with same CATH homology
 1XJ3 A;  3HCY A;  5DF9 A;  1LT0 A;  3CAX A;  2V1A A;  1X0O A;  3T4S A;  3CI6 A;  2O9B A;  1MZU A;  4LLO B;  2W3D A;  2WKR A;  3PBT A;  1IOU A;  5G4Z A;  4ARZ A;  4GS9 A;  4HOI A;  1BYW A;  2QYB A;  4HHD A;  4MN5 A;  2OWH A;  3SW1 A;  4L9G A;  3MQO A;  2J3T D;  3K3C A;  5HDC A;  4GW9 A;  1P9W A;  2VV6 A;  1UWN X;  2ZMF A;  5LBR A;  5J4E A;  4WEK A;  4LRX C;  1TS0 A;  2PHY A;  3CWF A;  1D06 A;  2JKT I;  3LR5 A;  3EQU A;  2H28 A;  1GSV A;  3C38 A;  1OTB A;  3EWK A;  2EA9 A;  1V9Y A;  3T4T A;  1VHM A;  4CLC A;  3CUE C;  2J3W A;  3OCN A;  5AVF A;  5I5L A;  3BY8 A;  4JGQ A;  5DKL A;  3RTY A;  4BJP A;  2OAP 1;  5HWW A;  1GSX A;  4UQI M;  2HF6 A;  3FC7 A;  3U2A A;  3F1O B;  1T1C A;  1VB6 A;  3D3O A;  4Y2F A;  4KUK A;  3NHQ A;  2PR5 A;  1IFQ A;  4HI4 A;  3TRC A;  4DJ3 A;  4EUV A;  3LR3 A;  2QJ5 A;  3UME A;  3MF0 A;  3H82 A;  3LUQ A;  4WLA A;  2WKP A;  3PBQ A;  2P08 A;  3MXQ A;  4P6Z S;  5HD3 A;  3H7W A;  3UE3 A;  4IHQ A;  5HSQ A;  3A0R A;  1S4S A;  1OTE A;  4I3I A;  2L0W A;  1H3Q A;  2PD8 A;  5TBM A;  4HP9 A;  4WUJ A;  5DKK A;  5F68 A;  4ETX A;  3C8C A;  4UQI S;  4I38 A;  2VZW A;  2JKR M;  4EEU A;  3LIF A;  2NUP C;  4DMZ A;  3VV4 A;  4JGR A;  2YKF A;  5DJU A;  2QJ7 A;  3D72 A;  3BY9 A;  3IBR A;  1OTA A;  5CX7 A;  3MQ0 A;  4EEP A;  4EER A;  3NOT C;  1NRJ A;  2O9A A;  4HQA A;  5HD5 A;  1V9Z A;  2OAQ 1;  4IJG A;  3CUE A;  5HDS A;  1ZHH B;  4O8G A;  3TE8 A;  5IT5 A;  2V0U A;  3KSI A;  1P9R A;  3MFX A;  2M7V A;  1ODV A;  3O5Y A;  1YAX A;  1F98 A;  1W63 M;  1NLZ A;  4H6J B;  4CLC D;  3R4K A;  2P04 A;  3E98 A;  3PBO A;  3KSH A;  5HZH A;  3EOI A;  5F5Y A;  1OPX A;  5J7E A;  1S4R A;  4M4X A;  1LSW A;  3VE4 A;  2J80 A;  5IU1 A;  2PR6 A;  3ULF A;  2D02 A;  2DMW A;  1S66 L;  4KQO A;  4MN6 A;  4BWI A;  1D7E A;  4GHI B;  3H82 B;  3E4O A;  4PKY G;  5AJG A;  2ZBB A;  3EGX C;  4QPR A;  3CLO A;  5KSH A;  2CMN A;  2A24 B;  2O9C A;  4IUH A;  4Y3I A;  1STZ A;  4HY8 A;  2JKT M;  1OTI A;  4EQ1 A;  3BQA A;  2OOL A;  4I3J A;  5AVE A;  2HJ9 C;  2QKP A;  2B18 A;  2VGL M;  3T4L A;  2O99 A;  4BBT A;  4HH3 A;  5C5K A;  1N9L A;  4ARZ B;  4EU0 A;  2VEA A;  2W1R A;  4O0P A;  1OJG A;  3S7P A;  2KDK A;  3F1O A;  4MCW A;  2VLG A;  3RFB A;  5MC7 A;  3OOV A;  1S67 L;  2JHE A;  4LRZ E;  1ZTU A;  2W1T B;  3NJA A;  3VE3 A;  5EFW A;  2YKH A;  2D01 A;  2K7S A;  1OTD A;  1DP6 A;  2I9V A;  2XA7 S;  1T1A A;  4ETZ A;  2HJE A;  5F6A A;  3T50 A;  4NXG A;  3T4J A;  4EW7 A;  4MDZ A;  4DN0 A;  3F1N A;  1TS8 A;  2G7U A;  3TJZ C;  1LL8 A;  2ZMV A;  1XJ4 A;  4G3K A;  3VOL A;  2ZOI A;  3HJI A;  4HJ3 A;  4OOL A;  4WEL A;  1UWP X;  1F5M A;  4Q0H A;  3S7O A;  3KO6 A;  3UE6 A;  2L4R A;  1DRM A;  2PD7 A;  5A8B A;  3KYZ A;  3F1P B;  5DFY A;  3PBS A;  3R7W A;  5HWT A;  2V0W A;  3ZQ5 A;  5IS1 A;  2INW A;  4MMN A;  4E04 A;  3GDI A;  3LID A;  4GCZ A;  4K08 A;  4CLC B;  5DJT A;  5K5B A;  4CLC E;  3E4Q A;  3IS2 A;  3B42 A;  2W0N A;  2HGV A;  4L0L A;  4Y5F A;  3RH8 B;  4MN7 A;  4BBV A;  3MQQ A;  1NLY A;  4H6J A;  1YSQ A;  1UGU A;  3OBF A;  4LRY C;  1MKM A;  1OJ5 A;  3T4K A;  5HDD A;  3B33 A;  2XSS A;  2OWJ A;  2L1M A;  3BQ8 A;  3EEA A;  5G4Y A;  2M7U A;  2QHK A;  3ICY A;  5DFX A;  2K31 A;  2XRO A;  2FH5 A;  3LIE A;  2B02 A;  4R70 A;  3B47 A;  1XFQ A;  4YWZ A;  3LI9 A;  3MJQ A;  3UMD A;  2VGL S;  4DJ2 A;  4FOF A;  1YSP A;  3PXP A;  2PYR A;  3UB8 A;  2GX5 A;  2JKR I;  4JGO A;  4BBU A;  3H7W B;  4HH2 A;  3UB6 A;  1TD5 A;  2Z6D A;  2W27 A;  2V9A A;  2XRN A;  1TS6 A;  4XT2 A;  3LYX A;  3EEH A;  3T4O A;  4GJ4 A;  2BAS A;  3OLO A;  4GS9 B;  3A0S A;  1TS7 A;  1JNU A;  3BW6 A;  4CQH A;  2FZ0 A;  3K2N A;  1LSV A;  4KUO A;  4WF0 A;  2PDR A;  2MJ6 A;  1N9N A;  4B9O A;  4BMW A;  2Y8H A;  3G6O A;  3TW8 A;  3ZYT A;  1F9I A;  4JGP A;  2J3T C;  2EWW A;  4NXE A;  3T4Q A;  3OCL A;  3KX0 X;  4Q0J A;  3NOP C;  4AFI A;  2VA0 A;  3PBR A;  4L9E A;  2VV8 A;  1W63 Q;  2K2N A;  2HV1 A;  2WKQ A;  5J3W A;  3KYQ A;  1XJ6 A;  2PT7 A;  3LR4 A;  2QWS A;  4F3L A;  4WL9 A;  5TBM B;  3V67 A;  2M1C A;  2PYP A;  3F1P A;  3LIA A;  4OOM A;  5L8M A;  3MMH A;  3OC2 A;  2V1B A;  1TF1 A;  5FL3 A;  2W1T A;  3JVU A;  3BWL A;  4I39 A;  4PAU A;  4HIA A;  3UB7 A;  4R38 A;  1P0Z A;  1T1B A;  5HL6 A;  1MC0 A;  1S1Y A;  3A0V A;  2O0Y A;  4YNR A;  3FPW A;  3KSF A;  4PKY A;  2R78 A;  2EWV A;  4G3W A;  4B93 A;  5TJJ A;  4R6L A;  3JVV A;  2W3F A;  3LFV A;  4HJ4 A;  4RQ9 A;  3W2Z A;  3CIT A;  3EQV A;  3FG8 A;  2GNX A;  1EW0 A;  2A2L A;  4I5S A;  3S7Q A;  4R3A A;  3C2W A;  3LIC A;  3E0Y A;  3LR0 A;  2XA7 M;  4PHT A;  1N9O A;  1OT6 A;  4YOF A;  2A24 A;  2Z6C A;  3H9W A;  1T18 A;  4ME4 A;  2Y79 A;  2KOI A;  5F69 A;  1NWZ A;  1DP9 A;  4L9F A;  3K3D A;  3GEC A;  3UB9 A;  4HNB A;  1Y28 A;  3LIB A;  1DP8 A;  4FSF A;  2IA2 A;  2KLI A;  3E4P A;  1G6O A;  1H8M A;  4II7 A;  4Z1W A;  2LB9 A;  3PBN A;  4WEJ A;  1S1Z A;  1WA9 A;  3P01 A;  3F1N B;  4GLQ A;  4XT2 B;  3NOU C;  4GHI A;  4NKP A;  2GJ3 A;  5HPF A;  4F3L B;  4ZRR A;  4EXO A;  3C30 A;  4I3A A;  1T19 A;  3MR0 A;  1LSX A;  1P97 A;  2W3G A;  2NUT C;  1XJ2 A;  4NXF A;  5HPI A;  2VKS A;  5HWV A;  3R7W B;  3S7N A;  4HJ6 A;  4NEE D;  2P7J A;  2VV7 A;  4O01 A;  2ZOH A;  3LI8 A;  3PR6 A;  4KQD A;  1OT9 A;  3PYP A;  4EET B;  2W3E A;  4Q0I A;  3P7N A;  4WN5 A;  3KSG A;  3PHY A;  2GZA A;  4CLC C;  3IS2 B;  2LB5 A;  1GSW A;  3IBJ A;  5KIZ A;  4G3V A;  4UEY A;  2W3H A;  1G28 A;  3EGD C;  4EES A;  2KX6 A;  4HP4 A;  3HJK A;  2VX8 A;  4IUK A;  1KOU A;  3FPV A;  3BJN A;  4NXB A;  4P6Z M;  2JN7 A;  2VJW A;  3DBA A;  1XFN A;  4LPZ A;  1YKD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...