2VV6A

Bjfixlh in ferric form
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
106
structure length
106
Chain Sequence
IPDAMIVIDGHGIIQLFSTAAERLFGWSELEAIGQNVNILMPEPDRSRHDSYISRYRTTSDPHIIGIGRIVTGKRRDGTTFPMHLSIGEMQSGGEPYFTGFVRDLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein, transferase
molecule keywords SENSOR PROTEIN FIXL
publication title Changes in Quaternary Structure in the Signaling Mechanisms of Pas Domains.
pubmed doi rcsb
source organism Bradyrhizobium japonicum
total genus 26
structure length 106
sequence length 106
chains with identical sequence B, C, D
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2008-06-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2vv6A00
2PDRA 4HP9A 2QWSA 4LRZE 1OJ5A 1V9ZA 1GSXA 1N9NA 3LIBA 1OTEA 4L9GA 2YKFA 1NWZA 3H7WA 1T1AA 4KUKA 2VV8A 4R70A 4EERA 3BWLA 5AVEA 3F1PB 3NOTC 1S1ZA 4HP4A 4I39A 4GCZA 2W0NA 3UB9A 1T19A 3D72A 3IS2B 4JGOA 2YKHA 4HHDA 5J7EA 4XT2A 1TS0A 4DJ2A 4LPZA 4GS9B 3ULFA 4EXOA 1DP8A 3H82B 4LRXC 5TBMA 3GDIA 4NXBA 4GW9A 4I3AA 1OTAA 5I5LA 2GJ3A 5DJUA 1BYWA 3LIAA 1MZUA 2HV1A 3BY8A 1OT9A 4H6JB 1Y28A 4WLAA 1DP6A 1DRMA 4GHIB 1GSVA 1G28A 1T1CA 4KUOA 3G6OA 4HOIA 1P97A 1KOUA 1P0ZA 4LRYC 1ODVA 4JGRA 5F6AA 5HWTA 2A24A 4HH3A 5HD3A 5KIZA 4PKYG 3F1NA 3UB6A 4LLOB 1DP9A 1XJ4A 1OT6A 2WKPA 1V9YA 4EETB 2V1AA 4R3AA 3MXQA 3NHQA 3NOPC 2WKRA 3F1OA 5DJTA 4DJ3A 1OTBA 1LSWA 2KX6A 1D06A 3HJKA 2WKQA 4EEPA 1XFNA 2KDKA 4HJ4A 3VE3A 2CMNA 3UMEA 4WN5A 2PD8A 3LICA 4F3LA 2PD7A 5DKLA 2QHKA 2JN7A 1S4RA 4HH2A 3NJAA 1TS7A 1EW0A 3MR0A 1S4SA 4R6LA 1OJGA 4HNBA 3FG8A 3HJIA 2ZOIA 5HZHA 1LSXA 1JNUA 3OLOA 2Z6DA 5HDDA 3A0VA 3T50A 2EA9A 2V0UA 1LSVA 3UB8A 3EWKA 2OWHA 3UMDA 4KQDA 4NXGA 2INWA 3CLOA 4I5SA 1T1BA 1N9OA 5IU1A 4K08A 1OTIA 5HD5A 3F1PA 4WUJA 2V1BA 5IS1A 4MN5A 4JGQA 3PYPA 4L9EA 5HDSA 2M1CA 2JHEA 1UGUA 1LT0A 3K3CA 4BBVA 1OTDA 1N9LA 3ICYA 4HJ3A 5G4YA 3MQQA 1GSWA 4GS9A 1LL8A 5F5YA 3MQOA 4JGPA 3EEHA 1WA9A 3H7WB 2W27A 2QKPA 4MN6A 1X0OA 3ZQ5A 3B33A 4H6JA 5G4ZA 2V9AA 5HSQA 5DKKA 4GHIA 4EW7A 2J80A 2PYPA 4BBUA 2VV6A 3E4OA 2PYRA 4NXFA 2R78A 4WF0A 4EEUA 4XT2B 1XJ2A 1F9IA 4NXEA 2PHYA 2K7SA 4BBTA 1UWPX 4I3JA 3LYXA 3PHYA 2H28A 3K3DA 4I38A 5TBMB 3MFXA 1S1YA 4B9OA 3LI8A 4HQAA 3SW1A 2VV7A 2BASA 4WL9A 3E4PA 5HWVA 1D7EA 3LI9A 3E4QA 1XFQA 2L4RA 4I3IA 2VLGA 2QJ7A 1VB6A 2Z6CA 5F69A 2PR5A 2P7JA 2L0WA 1XJ3A 2QJ5A 3LIEA 3UB7A 3UE6A 4EQ1A 4PKYA 2B02A 2A24B 5A8BA 2OOLA 4L9FA 3IBRA 3F1NB 3P7NA 1S66L 4HJ6A 1UWNX 5HDCA 4YWZA 3H9WA 3LUQA 1TS8A 3IS2A 3KX0X 5EFWA 3VE4A 2V0WA 3CWFA 4RQ9A 1S67L 2PR6A 3F1OB 4M4XA 4HI4A 3H82A 1TS6A 3C2WA 3RH8B 3MJQA 3RTYA 1T18A 2L1MA 3LIDA 5J4EA 4EESA 4R38A 4HY8A 1XJ6A 3VOLA 2D02A 3A0RA 3BY9A 2I9VA 5HWWA 3GECA 3LIFA 4F3LB 3NOUC 2ZOHA 3FC7A 5AVFA 3A0SA 2ZBBA 3C8CA 1F98A 4E04A 3CAXA 5F68A 4HIAA 2OWJA 2VEAA 2D01A 5J3WA
chains in the Genus database with same CATH superfamily
2V2FF 2ZC3B 4PM9A 1FIKA 1YAXA 3S7PA 1OJ5A 5HL1A 2G7UA 2WAFA 1OTEA 4OP5A 1C3BA 3IHAA 2WAEA 2EX8A 3H7WA 2VV8A 2VA0A 3VP4A 5CHUA 1YLJA 1VEUA 2LB5A 1H3QA 4LCLA 3NULA 5AVEA 1LL5A 3NOTC 4P6BA 2W0NA 3MKEA 1T19A 3ZYTA 3FWLA 3HBRA 2HGVA 1FCMA 2YKHA 2JC7A 1NYYA 3T12B 5J7EA 1KVMA 1K57A 3GSGA 4GDNA 1Z09A 1EI5A 4LPZA 3TJZC 3IXDA 4EXOA 1DP8A 1ACFA 3PXPA 2M7VA 4EUVA 3LFVA 4E3JA 4OOMA 1H8YA 4QB8A 1FSYA 1O07A 3PR6A 4DE1A 2HV1A 3BY8A 5AJGA 2O9BA 3MF0A 2ZQ9A 1SKOB 2IWCA 5TGFA 5KSCA 1GSVA 1T1CA 1CJFA 2H5SA 1S0WA 4CLCC 4KUOA 2KLIA 1FCNA 3S22A 1YLWA 2ZD8A 3AGEA 4JGRA 5F6AA 3IF5A 3M6BA 5F83A 1BLHA 5EVLA 1Y54A 3SOIA 4PKYG 5EV0A 1G6AA 2J9OA 1KE0A 1DP9A 3KYQA 5EOEA 1H8MA 2VZWA 4MLLA 5HPFA 4OONA 3UPOA 4N92A 3TE8A 3MXQA 3GV9A 3NOPC 3M2KA 3DTMA 3MXRA 3F1OA 4CLCE 4DE3A 1YLYA 4JF5A 1OTBA 1LSWA 2Y2NA 1D06A 4DDYA 2Y4AA 2Y59A 4EEPA 4GLQA 3FZCA 1O7EA 4X69A 2EXAA 4HJ4A 4EU0A 1GHPA 2WGWB 2PD8A 5HPIA 4L0LA 1U60A 3IXBA 2X71A 5DKLA 3VOYA 1YSQA 4OPQA 3G30A 3C7VA 2O0YA 2ZJ9A 3B3XA 1E3UA 3BW6A 4N9LA 4JXSA 3N8RA 1S4SA 5HAQA 4R6LA 2ZM8A 3G35A 1HD8A 4OPRA 3N8SA 3FG8A 1PWCA 2XFSA 2Y2GA 4HNBA 4KZ9A 2UV0E 4RVAA 5GLCA 1WYBA 2HDSA 1KGGA 5FASA 5DF8A 3AGFA 3EWKA 2OWHA 4KQDA 4NXGA 1ZC2A 3BFFA 3CLOA 4ZAMA 1TD5A 4ZJ1A 4K08A 3MFDA 1BLSA 5K5BA 3QP4A 1CI8A 1DJCA 4Y0OA 3DTKA 4FTXA 3BM6A 4JGQA 4L9EA 1G5UA 3LR3A 5TFQA 1W8QA 1LT0A 3CI6A 3K3CA 5FQJA 5FI6A 5FDSA 1NYMA 4OKPA 1XGIA 3UNWA 1K4FA 3A3IA 2HZ5A 4FCFA 2OLVA 3MQOA 4PHTA 3E0YA 4GDBA 4D2OA 4ZBEA 3Q07A 4PM5A 4MN6A 1X0OA 3UPPA 1GCEA 5GLAA 1K25A 3DTEA 1YLZA 1CEFA 1SKOA 1HVBA 3VFHA 4OPYA 2P9VB 4R0QA 5FQ9A 4XT2B 4Y17A 1XX2A 3C4OA 4WMCA 4O7DA 1UWPX 2X01A 1ZKJA 2WKHA 4I3JA 1ES4A 3LYXA 1TDGA 2H28A 3HLBA 3QP1A 5HW3A 3R7WB 1S1YA 2EFXA 1BSGA 3LI8A 4DDSA 3SW1A 3S1YA 3O88A 3E4PA 3V39A 3G34A 5FI7A 3PAEA 2VGJA 5EUAA 4OH0A 3UDFA 1BLCA 3DWKA 3G2ZA 3CJMA 5FQKA 3CPTB 2XROA 2L4RA 2VLGA 5CEBA 1P9WA 2BTFP 1K54A 2QJ7A 4O01A 4CLCB 4EBPA 1PRQA 3ZG8B 2PT7A 2L0WA 3HLGA 2V8CA 2V1ZA 4GN2A 3OPHA 2WGWA 3LR5A 2B02A 2A24B 1H5XA 3AGDA 4L9FA 3F1NB 4DE2A 4YINA 1L0GA 2K2NA 1IKIA 2W1TB 2OAQ1 3DAVA 3IS2A 2ZQAA 5M1AA 3MS6A 4E6WA 4WYYA 3JPUA 3ZDJA 4QY5A 1TS6A 2RL3A 3C2WA 4OQHA 5IT5A 4JXVA 4EESA 1GA9A 2D02A 4A5RA 1GHIA 1LI0A 3ITBA 4XUZA 3NDGA 1L0EA 3OPRA 1PWDA 3LIFA 1M40A 3NOUC 3T4QA 4Z1WA 3ZNTA 4Y13A 3NIAA 4R4SA 3PBRA 3A0SA 3G31A 3T4OA 1NLYA 3BRMA 3RJUA 1JTGA 1SKFA 5F68A 5FQIA 4PPRA 2EX2A 1MBLA 3EOIA 1NJ4A 5J3WA 2PDRA 1IEMA 1SHVA 3Q81A 1VETB 4WELA 2QWSA 4LRZE 2W3GA 3EQVA 1YLTA 3VOZA 1FOFA 5E2FA 3LIBA 3IT9A 4FSFA 4L9GA 4GOGA 3BQAA 4QD4A 4EERA 3LY4A 2MJ6A 3ISGA 4OLDA 3NBLA 3F1PB 4Y15A 4BD0A 1PFLA 4ZDXA 3UB9A 3D72A 5EVIA 3V5MA 2P9VA 3IWIA 3RXWA 2JKFA 1MXOA 2Y2PA 4X1MA 4HESA 4XT2A 2O9AA 3LO7A 4DJ2A 2OAP1 1DJBA 4LV1A 4BWIA 3LR0A 2EXBA 2XGNA 1F2KA 1XP4A 4HEFA 4LRXC 4X53A 1HLUP 3GDIA 3VFFA 1H8ZA 3T1XA 1IOUA 2Y2JA 4WBGA 2B5RA 4I3AA 1OTAA 2ZM0A 3O87A 2GJ3A 5DJUA 1BYWA 3DBAA 4R4RA 3CPTA 2P74A 3HLWA 4UEYA 3UE3A 1QMEA 2HP6A 4GHIB 1G28A 2QPNA 2FFYA 4CLCA 1W63Q 2VX8A 1PWGA 4OQGA 3T4KA 3G6OA 3ZVWA 2DNSA 3KSFA 2M7UA 4JPMA 1W63M 3IF6C 1AXBA 1BT5A 3KSHA 1I2SA 2WYXA 2H10A 2A24A 4P6ZM 1A0KA 3NDEA 2QZ6A 4LV0A 3F1NA 5CHJA 4LLOB 4R3JA 5FQMA 2V20A 2W1TA 2W3DA 2ZM2A 4MBHA 4GKUA 3FKVA 3N8LA 5A92A 3HLFA 5D3OA 4IUKA 2WKRA 4OOLA 4NEED 4DJ3A 5E2HA 2NUTC 3QP6A 3W4PA 5AQ7A 3IX4A 1ERQA 5CGXA 3L7HA 2ACGA 2HDUA 2KDKA 3VE3A 3KSGA 3UMEA 5F1GA 3MKFA 4FUWA 4UA7A 1SCWA 3UN7A 2QHKA 3FPVA 5M19A 3NJAA 4PMAA 3OBFA 1TS7A 2J8YA 3BFGA 3MR0A 1TF1A 4E3KA 4MCWA 3HJIA 5HZHA 1RP5A 3OLOA 4H8RA 1L0DA 2EA9A 2O99A 2HJEA 2J9PA 1VETA 4LCMA 1W7FA 1VM1A 3EGXC 1MWRA 1K55C 4KZ5A 2XD1A 2Y91A 3VSKA 5IU1A 3VMAA 5A91A 1NLZA 2WKIA 1ESUA 4WZ5A 4Y5FA 5HAIA 3UE0A 4C75A 3N7WA 3GMWA 1MWSA 1S6RA 4JF6A 2C6WB 3F1PA 2XH9A 4ARZB 5IS1A 2V1BA 3BQ8A 3PBQA 2Y2KA 2M1CA 3GTCA 4S2OA 2JHEA 1UGUA 4O8GA 3CMZA 4BBVA 4IJGA 3VV4A 3V50A 4GJ4A 2Q9NA 1N9LA 4DRTA 3FPWA 3MQQA 1GSWA 4B88A 4RX2A 1VQQA 1LL8A 2XD5A 3WS0A 1Z6FA 2ZLYA 3G4PA 4Y2FA 4S2NA 3EEHA 3HLCA 2VJWA 5GHZA 3UPNA 2EX6A 1Y4OA 3PBSA 5BOHA 4K91A 5DKKA 2A49A 1IYQA 4GHIA 3MZFA 2J80A 2PYPA 3U4LP 4BBUA 3PAGA 4EV4A 3E4OA 3N6IA 3W8KA 4EEUA 2B18A 4DKIA 2K7SA 3QP8A 2XQZA 3PHYA 1PZPA 2HDRA 5TBMB 1WE4A 2LB9A 3SH7A 4WEJA 1YQSA 4KZ4A 4BLMA 1K38A 3B42A 2VV7A 3D9YA 2ZC7A 1HZOA 1W79A 3LI9A 2DCFA 3IH8A 1YT4A 4ID4A 5EVID 4E3OA 3OPLA 4I3IA 3GRJA 5GHXA 1JVJA 1KE4A 2OV5A 3P01A 1QMFA 3WWXA 5EM0A 1XJ3A 4BQMA 4CQHA 3IF6B 2PU4A 4P6ZS 5EE8A 1K57C 5CHMA 1KDSA 2K31A 2XEPA 4JF4A 2JKTI 2ZQ8A 3OCLA 1K0KA 1MY8A 3DTIA 3IBRA 3O3VA 3P7NA 4UAAA 1S66L 2ZQDA 4HJ6A 1ES5A 1L0FA 3SH8A 3T1RA 3QNBA 2G2WA 1TS8A 3VE4A 2V0WA 3C5AA 2HPBA 2A3UA 3G32A 1IKGA 1S67L 3O86A 3HLEA 5M18A 2ZC5B 4JXGA 1SDEA 3SS3A 4HI4A 4YNRA 3V3SA 3TRCA 1ZTUA 2J3WA 2JBFA 4CPKA 3LCEA 2QMIA 3MJQA 3RTYA 2L1MA 3LIDA 4OQ0A 1MWTA 4R38A 1ALQA 3VOLA 2R9XA 3A0RA 3SS4A 3N4IA 2DRWA 4PM8A 1SZVA 3EQUA 3DWZA 3Q82A 1JWZA 5AVFA 4K0WA 2XA7M 2PBDP 3C8CA 1OMEA 3IX8A 2VKSA 4RA7A 5HFOA 4ARZA 3CITA 4DXBA 2VEAA 4IBXA 2D01A 2WZZA 1E4DA 4ZJ3A 2PAVP 3A3EA 4UQIM 4NKPA 1H0MA 3UY6A 1ONHA 1XGJA 4B4ZA 1DY6A 5HL6A 1PNEA 1K56A 2JKGA 1CF0A 2EFUA 3Q7VB 4E6XA 2YKFA 1T1AA 4PAUA 4Y7PA 1ERMA 2QYBA 2JKTM 3TG9A 4G3VA 2WUQA 3V3RA 3HL9A 4BL3A 2KOIA 2GZAA 2XRNA 1BUEA 1NY0A 2HJ9C 4IVIA 1S1ZA 4HP4A 4I39A 2Q9MA 4ETXA 3OZHA 4S2JA 4X1LA 3OPPA 4FH4A 4HHDA 1PZOA 1XXMA 1KVLA 3BLSA 4K0XA 4P0MA 1I5QA 4GS9B 1FR6A 3TW8A 2VGLM 4IVKA 3ULFA 5CRFA 3S4XA 1LL9A 4DXCA 4LV2A 2Y2LA 3EGDC 3H82B 1M6KA 4KQRA 5TBMA 2I72A 2PU2A 4NXBA 4X25A 2Z2MB 3T1QB 4Q8IA 4DF6A 3UDIA 1MZUA 5DF7A 3IXGA 1XA7A 5CXWA 1DJAA 3HUOA 5E2GA 4MEZA 4PM6A 1DP6A 2AVXA 1W5DA 5J8XA 5F82A 4FOFA 3CZDA 1P97A 4QHCA 1KOUA 1P0ZA 3IF6A 4EBNA 3CUEA 5FQQA 1EWZA 4KZAA 3ZG9B 5FSRA 1XKZA 4HH3A 1MWUA 1NXYA 5KIZA 5L10A 3BYDA 3ITAA 3PBOA 5L09A 3FV7A 1XJ4A 1OT6A 5KMWA 3T4TA 5F1FA 3Q7ZA 1V9YA 3IWOA 4UHUA 4EETB 2V1AA 3T4SA 3FYZA 1ES2A 5GHYA 2XR0A 4U0TA 1I2WA 1YPRA 5FAQA 5AQAA 3HJKA 3P98A 5FL3A 1XFNA 3ZCZA 1ZHHB 3NC8A 2W3FA 2PBYA 1CI9A 4WN5A 4UA6A 5L07A 2XSSA 3ZG5A 3UDXA 1E3UD 2E8JA 2X02A 4GD6A 4NG2A 3UO9A 2RCXA 2JN7A 3CG5A 5DFXA 1FQGA 3NECA 4GZBA 4HH2A 4JLFA 4E3NA 5JYOA 1RGYA 3VSLA 4GNUA 1VHMA 3PTEA 1E25A 3W4QA 4IHQA 4C3QA 4P85A 4Y0TA 2ZOIA 4MNRA 1D1JA 2A2LA 4JKTA 3A0VA 1YSPA 3E98A 4FD8A 2V0UA 3HREA 1K54C 1MPLA 2OLUA 3R7WA 3UMDA 4RYEA 4Q0HA 3QP5A 4I5SA 1EROA 2ZL1B 3MZEA 1T1BA 1N9OA 2XA7S 3Q7VA 3KYZA 3MZDA 3NCKA 3C38A 1GHMA 3T4LA 3PBNA 4UQIS 2EWWA 4DMZA 3PYPA 4N9KA 5HDSA 3BJNA 1IFQA 3NI9A 3R4KA 1LLBA 1OTDA 3WS1A 3B47A 1CK3A 4GS9A 2CC1A 4YFMA 3ZG0A 5MC7A 4JGPA 4MN7A 4N1HA 3G2YA 3E2KA 1WA9A 2W27A 2O9CA 4X6TA 3S7QA 3ZHHA 3ZQ5A 3JYIA 5KZHA 2Y8HA 4LV3A 4NETA 4S2KA 4C6YA 3VP0A 1Q2PA 3KYEA 3ZFZA 2J3TD 5G4ZA 4WMCD 2V9AA 5HSQA 3WRZA 4WZ4A 3V67A 4LFUA 2VV6A 2B95A 4QPRA 5CEDA 1IYPA 4NXFA 2VGLS 2R78A 4WF0A 3LEQA 5TJJA 1XJ2A 1F9IA 1K56D 4NXEA 4OQIA 4BBTA 4AFIA 4BMWA 1LHYA 4O0PA 1J3WA 4I38A 5JYPA 4II7A 5CTNA 1KE3A 3MFXA 4B9OA 1WYCA 3HCYA 4WL9A 2Z2LB 4X55A 3C30A 5CERA 5HWVA 1D7EA 4B93A 4XUXA 1KGEA 1MC0A 2XDMA 1ZG6A 1MKIA 1ZG4A 2W1RA 2VGKA 3L9KA 5FATA 1TVFA 3A3FA 4OVDA 5I94A 2H0TA 2UWXA 2Q0OA 3IBJA 4X68A 2PR5A 2WZXA 4MBFA 2Y2MA 4U0XA 5EVIC 3MSHA 4MBKA 2QJ5A 5GLDA 3T4JA 1G68A 3UB7A 4EQ1A 5GLBA 4ESPA 1IYOA 2OOLA 3LY3A 2R9WA 2FH5A 2BLSA 1PI5A 1UWNX 3P09A 5EOOA 5IHVA 3HUNA 3LUQA 1FSWA 3KX0X 5EFWA 1PYYA 5DFYA 4ZTKA 2PR6A 3S7OA 4IBRA 4M4XA 3KO6A 3W4OA 5HARA 2Y2HA 4EBLA 4Q0JA 1ONGA 4HY8A 1KGFA 3I7JA 2ZL1A 4CJNA 3BY9A 2I9VA 5HWWA 4OLGA 2XLNA 3GECA 3SZTA 2PRFA 4F3LB 2ZC6B 3BLMA 3FC7A 1PIOA 1JWPA 2IA2A 5CTMA 2ZBBA 2WKEA 1F98A 4E04A 2BG1A 2WGIA 3BEBA 2OWJA 2IWDA 5DTTA 2W3EA 3QHYA 4OPZA 4ZRRA 2JCHA 3QNCA 3ZNYA 5FI2A 2Y2IA 3HUMA 1FR1A 4G3WA 4HP9A 2XFTA 4U3TA 1V9ZA 3ZVTA 5A93A 1GSXA 5DTSA 1N9NA 5EPHA 2Y2OA 1SDNA 2G2UA 3WRTA 1NWZA 4KUKA 4IEDA 2E8IA 4R70A 2XK1A 2FZ0A 5TR7A 3BWLA 3GVBA 1YMSA 4KG6A 2OSUA 4F94A 2HP5A 4E3MA 3SH9A 4GCZA 3IS2B 1BTLA 4JGOA 4OP8A 2GNXA 5CX7A 4PM7A 2P08A 1TS0A 2HP9A 5CECA 3WS2A 4E3IA 4IUHA 4BJPA 4GW9A 5I5LA 3VP2A 1XPBA 3LIAA 3D3OA 1OT9A 4CLCD 4WZ5C 4H6JB 1Q2QA 1Y28A 2DMWA 4WLAA 1DRMA 4ME4A 4KG2A 5CGSA 2XF3A 3E2LA 3JVUA 4R3BA 4WM9A 3BECA 4HOIA 2VK3A 1L3LA 4LRYC 3FKWA 4JBFA 1ODVA 3LR4A 1TEMA 2IWBA 1N9BA 4MMNA 4R23A 5HX9A 4S2LA 3GQZA 4ETZA 5HWTA 3JVVA 5HD3A 3ZGAB 1YKDA 3PBTA 5GL9A 3UB6A 4D60A 4OOYA 4S2NC 5U47A 2WKPA 2EX9A 4QU3A 4E3LA 3T1SA 4R3AA 3NHQA 2ZMVA 5DJTA 3HLDA 5E43A 2KX6A 5EVIB 2WKQA 4YOFA 3M6HA 2W3HA 4NK3A 2CMNA 3OOVA 4Y3IA 2J7VA 3OCNA 3CHWP 3ZG7B 3LICA 5FAPA 4ZJ2A 1LI9A 4F3LA 5EECA 3QP2A 1F5MA 2PD7A 4LENA 1S4RA 2C5WB 2ZMAA 4BL2A 1OPXA 2JKRI 1EW0A 1NRFA 2V8FA 1J9MA 1OJGA 2HF6A 1LSXA 1FCOA 1JNUA 2Z6DA 2ZQ7A 5HDDA 3T50A 4QJGA 3EEAA 4KZ7A 2HDQA 2Y79A 4MDZA 4RX3A 1LSVA 4UA9A 3UB8A 3GR2A 3OC2A 5E2EA 2INWA 4HBUA 1PW1A 3IQAA 4S2PA 3MXSA 4QWOA 4WEKA 3VP1A 1K6SA 5G18A 1OTIA 4QY6A 5HD5A 4KZ6A 3TOIA 1NZOA 1N4OA 4WUJA 4MN5A 3U2AA 5LBRA 4S2IA 1IYSA 3VP3A 3DW0A 3RXXA 1K4EA 4KZ3A 5AQBA 3ICYA 1BLPA 4HJ3A 4S2MA 2NUPC 5G4YA 4EWFA 1CEGA 4XXRA 2FFFB 3LEZA 5F5YA 3IWQA 3Q1FA 4LGWA 3MMHA 1MKMA 3H7WB 3A3JA 4KQOA 1XA1A 2QKPA 3BFCA 3MBZA 1W8YA 4BENA 3B33A 4Y0UA 1VEUB 5EM1A 1L2SA 1NZUA 3K2NA 4GD8A 5FEGA 3HVFA 4H6JA 2ZC4B 1RCJA 3C7UA 1P9RA 4P87A 3UE1A 1FILA 5L8MA 4N1XA 4EW7A 2JE5A 2PYRA 2JKRM 5EVEA 2PHYA 2J3TC 5FA7A 3K3DA 4DN0A 3IXHA 3IX3A 2ZQCA 3LGOA 5FDHA 1YMXA 3NY4A 4HQAA 2BASA 3KSIA 3WS5A 5L2FA 4KQQA 1ESIA 2GX5A 1STZA 3E4QA 4EUZA 5CGWA 5DF9A 1XFQA 5AQ9A 3TSGA 1AWIA 4Q0IA 2GDNA 2WGVA 3IHBA 4X56A 1VB6A 2Z6CA 3MQ0A 4Z9QA 4DE0A 5F69A 1PW8A 3UB5P 1K55A 2P7JA 4B4XA 3LIEA 5HAPA 2Y2QA 3IH9A 1CQAA 3UE6A 1PI4A 1RGZA 1GA0A 4PKYA 1YM1A 2WADA 5A8BA 3WS4A 4KZBA 4KG5A 4GB7A 4M3KA 4EQIA 3RFBA 1BULA 1HTZA 4KZ8A 5FAOA 5DTKA 3M2JA 2WK0A 5HDCA 5A90A 4KENB 3W2ZA 4YWZA 3H9WA 5DVAA 3CWFA 4RQ9A 3C4PA 3F1OB 2P04A 1NRJA 4R1GA 3O5YA 3BFDA 2H0YA 3H82A 4HBTA 3RH8B 1T18A 4FH2A 1G6OA 5C5KA 1IELA 5J4EA 1XJ6A 1KDWA 5KSHA 3BFEA 3CUEC 4G3KA 3SS5A 1JWVA 2ZOHA 3D4FA 3A3DA 1ES3A 4BD1A 4JXWA 2Y55A 3S7NA 2EWVA 3CAXA 1JTDA 4HIAA 1K6RA 5FEFA 1YLPA 2ZMFA 1BZAA 1TDLA
chains in the Genus database with same CATH topology
2PDRA 4HP9A 4G3WA 4WELA 2QWSA 1YAXA 4LRZE 5HL6A 1OJ5A 3S7PA 2W3GA 3EQVA 1V9ZA 1GSXA 1N9NA 2G7UA 3LIBA 1OTEA 4FSFA 4L9GA 2YKFA 1NWZA 3H7WA 1T1AA 4PAUA 3BQAA 4KUKA 2VV8A 2QYBA 2VA0A 2JKTM 4G3VA 4R70A 4EERA 2MJ6A 2FZ0A 2KOIA 2GZAA 2XRNA 2LB5A 1H3QA 3BWLA 5AVEA 2HJ9C 3F1PB 3NOTC 1S1ZA 4HP4A 4I39A 4GCZA 2W0NA 3UB9A 4ETXA 3ZYTA 1T19A 3D72A 3IS2B 2HGVA 4JGOA 2GNXA 2YKHA 4HHDA 5J7EA 4XT2A 2O9AA 5CX7A 2P08A 1TS0A 4DJ2A 2OAP1 4LPZA 3TJZC 4GS9B 3TW8A 4BWIA 2VGLM 3LR0A 3ULFA 4EXOA 1DP8A 3PXPA 3EGDC 3H82B 4LRXC 2M7VA 4EUVA 3LFVA 5TBMA 4IUHA 3GDIA 4OOMA 4BJPA 4NXBA 1IOUA 4GW9A 4I3AA 1OTAA 5I5LA 2GJ3A 5DJUA 3PR6A 1BYWA 3LIAA 1MZUA 2HV1A 3BY8A 5AJGA 3DBAA 3D3OA 1OT9A 4CLCD 2O9BA 3MF0A 4H6JB 1Y28A 2DMWA 4WLAA 1DP6A 1DRMA 4UEYA 4ME4A 3UE3A 4GHIB 1GSVA 1G28A 1T1CA 4CLCA 1W63Q 4CLCC 2VX8A 3JVUA 4KUOA 3T4KA 3G6OA 4FOFA 2KLIA 3KSFA 4HOIA 2M7UA 1P97A 1KOUA 1P0ZA 1W63M 4LRYC 3CUEA 1ODVA 4JGRA 3LR4A 5F6AA 4MMNA 3KSHA 4ETZA 5HWTA 2A24A 3JVVA 4HH3A 4P6ZM 5HD3A 5KIZA 4PKYG 3F1NA 1YKDA 3PBTA 3UB6A 3PBOA 4LLOB 1DP9A 1XJ4A 2W1TA 2W3DA 1OT6A 2WKPA 3KYQA 3T4TA 1H8MA 2VZWA 5HPFA 1V9YA 4EETB 2V1AA 3T4SA 4R3AA 3TE8A 3MXQA 4IUKA 3NHQA 3NOPC 2WKRA 2ZMVA 4OOLA 3F1OA 4CLCE 4NEED 5DJTA 4DJ3A 1OTBA 2NUTC 1LSWA 2KX6A 1D06A 3HJKA 2WKQA 4YOFA 5FL3A 2W3HA 4EEPA 1XFNA 4GLQA 2KDKA 4HJ4A 4EU0A 3VE3A 1ZHHB 2CMNA 3OOVA 2W3FA 4Y3IA 3KSGA 3OCNA 3UMEA 4WN5A 2PD8A 3LICA 2XSSA 5HPIA 4L0LA 4F3LA 1F5MA 2PD7A 5DKLA 2QHKA 2JN7A 3FPVA 1S4RA 1YSQA 5DFXA 4HH2A 1OPXA 3NJAA 2O0YA 1VHMA 3OBFA 1TS7A 2JKRI 3BW6A 1EW0A 3MR0A 4IHQA 1TF1A 1S4SA 4R6LA 1OJGA 4MCWA 2HF6A 4HNBA 3FG8A 3HJIA 2ZOIA 5HZHA 1LSXA 1JNUA 2A2LA 3OLOA 2Z6DA 5HDDA 3A0VA 3T50A 1YSPA 2EA9A 3E98A 3EEAA 2O99A 2HJEA 2Y79A 4MDZA 2V0UA 1LSVA 3R7WA 3UB8A 3EWKA 2OWHA 3UMDA 4KQDA 3OC2A 4NXGA 3EGXC 4Q0HA 2INWA 3CLOA 4I5SA 1T1BA 1TD5A 1N9OA 2XA7S 5IU1A 1NLZA 3KYZA 4WEKA 4K08A 4Y5FA 1OTIA 5HD5A 5K5BA 3C38A 3T4LA 3PBNA 3F1PA 2EWWA 4UQIS 4ARZB 4WUJA 2V1BA 4DMZA 5IS1A 3BQ8A 4MN5A 4JGQA 3PYPA 4L9EA 3U2AA 3PBQA 5LBRA 3LR3A 5HDSA 2M1CA 2JHEA 3BJNA 1UGUA 4O8GA 1LT0A 1IFQA 3CI6A 3K3CA 3R4KA 4BBVA 4IJGA 3VV4A 1OTDA 4GJ4A 1N9LA 3ICYA 4HJ3A 2NUPC 3B47A 5G4YA 3FPWA 3MQQA 1GSWA 4GS9A 1LL8A 5F5YA 3MQOA 4PHTA 3E0YA 3MMHA 4Y2FA 5MC7A 1MKMA 4JGPA 4MN7A 3EEHA 1WA9A 3H7WB 4KQOA 2W27A 2QKPA 4MN6A 2O9CA 3S7QA 1X0OA 3ZQ5A 3B33A 2VJWA 2Y8HA 3K2NA 4H6JA 3PBSA 1P9RA 2J3TD 5G4ZA 2V9AA 5HSQA 5DKKA 4GHIA 5L8MA 4EW7A 3V67A 2J80A 2PYPA 4BBUA 2VV6A 4QPRA 3E4OA 2PYRA 4NXFA 2VGLS 2JKRM 2R78A 4WF0A 4EEUA 5TJJA 4XT2B 1XJ2A 1F9IA 2B18A 4NXEA 2PHYA 2K7SA 4BBTA 2J3TC 4AFIA 1UWPX 4BMWA 4I3JA 4O0PA 3LYXA 3PHYA 2H28A 3K3DA 4I38A 4DN0A 4II7A 5TBMB 3R7WB 2LB9A 4WEJA 3MFXA 1S1YA 4B9OA 3LI8A 4HQAA 3SW1A 3B42A 2VV7A 3HCYA 2BASA 3KSIA 4WL9A 3C30A 3E4PA 5HWVA 1D7EA 3LI9A 4B93A 2GX5A 1MC0A 1STZA 3E4QA 5DF9A 1XFQA 2W1RA 2XROA 2L4RA 4I3IA 2VLGA 4Q0IA 1P9WA 2QJ7A 1VB6A 4O01A 2Z6CA 3IBJA 4CLCB 3MQ0A 3P01A 5F69A 2PR5A 2P7JA 2L0WA 2PT7A 1XJ3A 4CQHA 2QJ5A 3LIEA 3T4JA 4P6ZS 3UB7A 3UE6A 2K31A 4EQ1A 2JKTI 4PKYA 3LR5A 2B02A 2A24B 5A8BA 3OCLA 2OOLA 4L9FA 3IBRA 3F1NB 3P7NA 1S66L 3RFBA 2FH5A 2K2NA 4HJ6A 2W1TB 2OAQ1 1UWNX 5HDCA 3W2ZA 4YWZA 3H9WA 3LUQA 1TS8A 3IS2A 3KX0X 5EFWA 3VE4A 2V0WA 5DFYA 3CWFA 4RQ9A 1S67L 2PR6A 3S7OA 3F1OB 2P04A 1NRJA 3KO6A 4M4XA 3O5YA 4HI4A 4YNRA 3TRCA 1ZTUA 2J3WA 3H82A 1TS6A 3C2WA 3RH8B 3MJQA 5IT5A 3RTYA 1T18A 1G6OA 5C5KA 2L1MA 3LIDA 5J4EA 4Q0JA 4EESA 4R38A 4HY8A 1XJ6A 3VOLA 2D02A 5KSHA 3A0RA 3BY9A 2I9VA 5HWWA 3CUEC 4G3KA 3GECA 3EQUA 3LIFA 4F3LB 3NOUC 3T4QA 2ZOHA 4Z1WA 3FC7A 2IA2A 5AVFA 3PBRA 3A0SA 2XA7M 3T4OA 2ZBBA 3C8CA 1F98A 2VKSA 4E04A 1NLYA 4ARZA 3S7NA 2EWVA 3CAXA 3CITA 5F68A 4HIAA 2OWJA 2VEAA 2ZMFA 2D01A 3EOIA 4UQIM 2W3EA 4NKPA 4ZRRA 5J3WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PDR A;  4HP9 A;  2QWS A;  4LRZ E;  1OJ5 A;  1V9Z A;  1GSX A;  1N9N A;  3LIB A;  1OTE A;  4L9G A;  2YKF A;  1NWZ A;  3H7W A;  1T1A A;  4KUK A;  2VV8 A;  4R70 A;  4EER A;  3BWL A;  5AVE A;  3F1P B;  3NOT C;  1S1Z A;  4HP4 A;  4I39 A;  4GCZ A;  2W0N A;  3UB9 A;  1T19 A;  3D72 A;  3IS2 B;  4JGO A;  2YKH A;  4HHD A;  5J7E A;  4XT2 A;  1TS0 A;  4DJ2 A;  4LPZ A;  4GS9 B;  3ULF A;  4EXO A;  1DP8 A;  3H82 B;  4LRX C;  5TBM A;  3GDI A;  4NXB A;  4GW9 A;  4I3A A;  1OTA A;  5I5L A;  2GJ3 A;  5DJU A;  1BYW A;  3LIA A;  1MZU A;  2HV1 A;  3BY8 A;  1OT9 A;  4H6J B;  1Y28 A;  4WLA A;  1DP6 A;  1DRM A;  4GHI B;  1GSV A;  1G28 A;  1T1C A;  4KUO A;  3G6O A;  4HOI A;  1P97 A;  1KOU A;  1P0Z A;  4LRY C;  1ODV A;  4JGR A;  5F6A A;  5HWT A;  2A24 A;  4HH3 A;  5HD3 A;  5KIZ A;  4PKY G;  3F1N A;  3UB6 A;  4LLO B;  1DP9 A;  1XJ4 A;  1OT6 A;  2WKP A;  1V9Y A;  4EET B;  2V1A A;  4R3A A;  3MXQ A;  3NHQ A;  3NOP C;  2WKR A;  3F1O A;  5DJT A;  4DJ3 A;  1OTB A;  1LSW A;  2KX6 A;  1D06 A;  3HJK A;  2WKQ A;  4EEP A;  1XFN A;  2KDK A;  4HJ4 A;  3VE3 A;  2CMN A;  3UME A;  4WN5 A;  2PD8 A;  3LIC A;  4F3L A;  2PD7 A;  5DKL A;  2QHK A;  2JN7 A;  1S4R A;  4HH2 A;  3NJA A;  1TS7 A;  1EW0 A;  3MR0 A;  1S4S A;  4R6L A;  1OJG A;  4HNB A;  3FG8 A;  3HJI A;  2ZOI A;  5HZH A;  1LSX A;  1JNU A;  3OLO A;  2Z6D A;  5HDD A;  3A0V A;  3T50 A;  2EA9 A;  2V0U A;  1LSV A;  3UB8 A;  3EWK A;  2OWH A;  3UMD A;  4KQD A;  4NXG A;  2INW A;  3CLO A;  4I5S A;  1T1B A;  1N9O A;  5IU1 A;  4K08 A;  1OTI A;  5HD5 A;  3F1P A;  4WUJ A;  2V1B A;  5IS1 A;  4MN5 A;  4JGQ A;  3PYP A;  4L9E A;  5HDS A;  2M1C A;  2JHE A;  1UGU A;  1LT0 A;  3K3C A;  4BBV A;  1OTD A;  1N9L A;  3ICY A;  4HJ3 A;  5G4Y A;  3MQQ A;  1GSW A;  4GS9 A;  1LL8 A;  5F5Y A;  3MQO A;  4JGP A;  3EEH A;  1WA9 A;  3H7W B;  2W27 A;  2QKP A;  4MN6 A;  1X0O A;  3ZQ5 A;  3B33 A;  4H6J A;  5G4Z A;  2V9A A;  5HSQ A;  5DKK A;  4GHI A;  4EW7 A;  2J80 A;  2PYP A;  4BBU A;  2VV6 A;  3E4O A;  2PYR A;  4NXF A;  2R78 A;  4WF0 A;  4EEU A;  4XT2 B;  1XJ2 A;  1F9I A;  4NXE A;  2PHY A;  2K7S A;  4BBT A;  1UWP X;  4I3J A;  3LYX A;  3PHY A;  2H28 A;  3K3D A;  4I38 A;  5TBM B;  3MFX A;  1S1Y A;  4B9O A;  3LI8 A;  4HQA A;  3SW1 A;  2VV7 A;  2BAS A;  4WL9 A;  3E4P A;  5HWV A;  1D7E A;  3LI9 A;  3E4Q A;  1XFQ A;  2L4R A;  4I3I A;  2VLG A;  2QJ7 A;  1VB6 A;  2Z6C A;  5F69 A;  2PR5 A;  2P7J A;  2L0W A;  1XJ3 A;  2QJ5 A;  3LIE A;  3UB7 A;  3UE6 A;  4EQ1 A;  4PKY A;  2B02 A;  2A24 B;  5A8B A;  2OOL A;  4L9F A;  3IBR A;  3F1N B;  3P7N A;  1S66 L;  4HJ6 A;  1UWN X;  5HDC A;  4YWZ A;  3H9W A;  3LUQ A;  1TS8 A;  3IS2 A;  3KX0 X;  5EFW A;  3VE4 A;  2V0W A;  3CWF A;  4RQ9 A;  1S67 L;  2PR6 A;  3F1O B;  4M4X A;  4HI4 A;  3H82 A;  1TS6 A;  3C2W A;  3RH8 B;  3MJQ A;  3RTY A;  1T18 A;  2L1M A;  3LID A;  5J4E A;  4EES A;  4R38 A;  4HY8 A;  1XJ6 A;  3VOL A;  2D02 A;  3A0R A;  3BY9 A;  2I9V A;  5HWW A;  3GEC A;  3LIF A;  4F3L B;  3NOU C;  2ZOH A;  3FC7 A;  5AVF A;  3A0S A;  2ZBB A;  3C8C A;  1F98 A;  4E04 A;  3CAX A;  5F68 A;  4HIA A;  2OWJ A;  2VEA A;  2D01 A;  5J3W A; 
#chains in the Genus database with same CATH topology
 2V2F F;  2ZC3 B;  4PM9 A;  1FIK A;  1YAX A;  3S7P A;  1OJ5 A;  5HL1 A;  2G7U A;  2WAF A;  1OTE A;  4OP5 A;  1C3B A;  3IHA A;  2WAE A;  2EX8 A;  3H7W A;  2VV8 A;  2VA0 A;  3VP4 A;  5CHU A;  1YLJ A;  1VEU A;  2LB5 A;  1H3Q A;  4LCL A;  3NUL A;  5AVE A;  1LL5 A;  3NOT C;  4P6B A;  2W0N A;  3MKE A;  1T19 A;  3ZYT A;  3FWL A;  3HBR A;  2HGV A;  1FCM A;  2YKH A;  2JC7 A;  1NYY A;  3T12 B;  5J7E A;  1KVM A;  1K57 A;  3GSG A;  4GDN A;  1Z09 A;  1EI5 A;  4LPZ A;  3TJZ C;  3IXD A;  4EXO A;  1DP8 A;  1ACF A;  3PXP A;  2M7V A;  4EUV A;  3LFV A;  4E3J A;  4OOM A;  1H8Y A;  4QB8 A;  1FSY A;  1O07 A;  3PR6 A;  4DE1 A;  2HV1 A;  3BY8 A;  5AJG A;  2O9B A;  3MF0 A;  2ZQ9 A;  1SKO B;  2IWC A;  5TGF A;  5KSC A;  1GSV A;  1T1C A;  1CJF A;  2H5S A;  1S0W A;  4CLC C;  4KUO A;  2KLI A;  1FCN A;  3S22 A;  1YLW A;  2ZD8 A;  3AGE A;  4JGR A;  5F6A A;  3IF5 A;  3M6B A;  5F83 A;  1BLH A;  5EVL A;  1Y54 A;  3SOI A;  4PKY G;  5EV0 A;  1G6A A;  2J9O A;  1KE0 A;  1DP9 A;  3KYQ A;  5EOE A;  1H8M A;  2VZW A;  4MLL A;  5HPF A;  4OON A;  3UPO A;  4N92 A;  3TE8 A;  3MXQ A;  3GV9 A;  3NOP C;  3M2K A;  3DTM A;  3MXR A;  3F1O A;  4CLC E;  4DE3 A;  1YLY A;  4JF5 A;  1OTB A;  1LSW A;  2Y2N A;  1D06 A;  4DDY A;  2Y4A A;  2Y59 A;  4EEP A;  4GLQ A;  3FZC A;  1O7E A;  4X69 A;  2EXA A;  4HJ4 A;  4EU0 A;  1GHP A;  2WGW B;  2PD8 A;  5HPI A;  4L0L A;  1U60 A;  3IXB A;  2X71 A;  5DKL A;  3VOY A;  1YSQ A;  4OPQ A;  3G30 A;  3C7V A;  2O0Y A;  2ZJ9 A;  3B3X A;  1E3U A;  3BW6 A;  4N9L A;  4JXS A;  3N8R A;  1S4S A;  5HAQ A;  4R6L A;  2ZM8 A;  3G35 A;  1HD8 A;  4OPR A;  3N8S A;  3FG8 A;  1PWC A;  2XFS A;  2Y2G A;  4HNB A;  4KZ9 A;  2UV0 E;  4RVA A;  5GLC A;  1WYB A;  2HDS A;  1KGG A;  5FAS A;  5DF8 A;  3AGF A;  3EWK A;  2OWH A;  4KQD A;  4NXG A;  1ZC2 A;  3BFF A;  3CLO A;  4ZAM A;  1TD5 A;  4ZJ1 A;  4K08 A;  3MFD A;  1BLS A;  5K5B A;  3QP4 A;  1CI8 A;  1DJC A;  4Y0O A;  3DTK A;  4FTX A;  3BM6 A;  4JGQ A;  4L9E A;  1G5U A;  3LR3 A;  5TFQ A;  1W8Q A;  1LT0 A;  3CI6 A;  3K3C A;  5FQJ A;  5FI6 A;  5FDS A;  1NYM A;  4OKP A;  1XGI A;  3UNW A;  1K4F A;  3A3I A;  2HZ5 A;  4FCF A;  2OLV A;  3MQO A;  4PHT A;  3E0Y A;  4GDB A;  4D2O A;  4ZBE A;  3Q07 A;  4PM5 A;  4MN6 A;  1X0O A;  3UPP A;  1GCE A;  5GLA A;  1K25 A;  3DTE A;  1YLZ A;  1CEF A;  1SKO A;  1HVB A;  3VFH A;  4OPY A;  2P9V B;  4R0Q A;  5FQ9 A;  4XT2 B;  4Y17 A;  1XX2 A;  3C4O A;  4WMC A;  4O7D A;  1UWP X;  2X01 A;  1ZKJ A;  2WKH A;  4I3J A;  1ES4 A;  3LYX A;  1TDG A;  2H28 A;  3HLB A;  3QP1 A;  5HW3 A;  3R7W B;  1S1Y A;  2EFX A;  1BSG A;  3LI8 A;  4DDS A;  3SW1 A;  3S1Y A;  3O88 A;  3E4P A;  3V39 A;  3G34 A;  5FI7 A;  3PAE A;  2VGJ A;  5EUA A;  4OH0 A;  3UDF A;  1BLC A;  3DWK A;  3G2Z A;  3CJM A;  5FQK A;  3CPT B;  2XRO A;  2L4R A;  2VLG A;  5CEB A;  1P9W A;  2BTF P;  1K54 A;  2QJ7 A;  4O01 A;  4CLC B;  4EBP A;  1PRQ A;  3ZG8 B;  2PT7 A;  2L0W A;  3HLG A;  2V8C A;  2V1Z A;  4GN2 A;  3OPH A;  2WGW A;  3LR5 A;  2B02 A;  2A24 B;  1H5X A;  3AGD A;  4L9F A;  3F1N B;  4DE2 A;  4YIN A;  1L0G A;  2K2N A;  1IKI A;  2W1T B;  2OAQ 1;  3DAV A;  3IS2 A;  2ZQA A;  5M1A A;  3MS6 A;  4E6W A;  4WYY A;  3JPU A;  3ZDJ A;  4QY5 A;  1TS6 A;  2RL3 A;  3C2W A;  4OQH A;  5IT5 A;  4JXV A;  4EES A;  1GA9 A;  2D02 A;  4A5R A;  1GHI A;  1LI0 A;  3ITB A;  4XUZ A;  3NDG A;  1L0E A;  3OPR A;  1PWD A;  3LIF A;  1M40 A;  3NOU C;  3T4Q A;  4Z1W A;  3ZNT A;  4Y13 A;  3NIA A;  4R4S A;  3PBR A;  3A0S A;  3G31 A;  3T4O A;  1NLY A;  3BRM A;  3RJU A;  1JTG A;  1SKF A;  5F68 A;  5FQI A;  4PPR A;  2EX2 A;  1MBL A;  3EOI A;  1NJ4 A;  5J3W A;  2PDR A;  1IEM A;  1SHV A;  3Q81 A;  1VET B;  4WEL A;  2QWS A;  4LRZ E;  2W3G A;  3EQV A;  1YLT A;  3VOZ A;  1FOF A;  5E2F A;  3LIB A;  3IT9 A;  4FSF A;  4L9G A;  4GOG A;  3BQA A;  4QD4 A;  4EER A;  3LY4 A;  2MJ6 A;  3ISG A;  4OLD A;  3NBL A;  3F1P B;  4Y15 A;  4BD0 A;  1PFL A;  4ZDX A;  3UB9 A;  3D72 A;  5EVI A;  3V5M A;  2P9V A;  3IWI A;  3RXW A;  2JKF A;  1MXO A;  2Y2P A;  4X1M A;  4HES A;  4XT2 A;  2O9A A;  3LO7 A;  4DJ2 A;  2OAP 1;  1DJB A;  4LV1 A;  4BWI A;  3LR0 A;  2EXB A;  2XGN A;  1F2K A;  1XP4 A;  4HEF A;  4LRX C;  4X53 A;  1HLU P;  3GDI A;  3VFF A;  1H8Z A;  3T1X A;  1IOU A;  2Y2J A;  4WBG A;  2B5R A;  4I3A A;  1OTA A;  2ZM0 A;  3O87 A;  2GJ3 A;  5DJU A;  1BYW A;  3DBA A;  4R4R A;  3CPT A;  2P74 A;  3HLW A;  4UEY A;  3UE3 A;  1QME A;  2HP6 A;  4GHI B;  1G28 A;  2QPN A;  2FFY A;  4CLC A;  1W63 Q;  2VX8 A;  1PWG A;  4OQG A;  3T4K A;  3G6O A;  3ZVW A;  2DNS A;  3KSF A;  2M7U A;  4JPM A;  1W63 M;  3IF6 C;  1AXB A;  1BT5 A;  3KSH A;  1I2S A;  2WYX A;  2H10 A;  2A24 A;  4P6Z M;  1A0K A;  3NDE A;  2QZ6 A;  4LV0 A;  3F1N A;  5CHJ A;  4LLO B;  4R3J A;  5FQM A;  2V20 A;  2W1T A;  2W3D A;  2ZM2 A;  4MBH A;  4GKU A;  3FKV A;  3N8L A;  5A92 A;  3HLF A;  5D3O A;  4IUK A;  2WKR A;  4OOL A;  4NEE D;  4DJ3 A;  5E2H A;  2NUT C;  3QP6 A;  3W4P A;  5AQ7 A;  3IX4 A;  1ERQ A;  5CGX A;  3L7H A;  2ACG A;  2HDU A;  2KDK A;  3VE3 A;  3KSG A;  3UME A;  5F1G A;  3MKF A;  4FUW A;  4UA7 A;  1SCW A;  3UN7 A;  2QHK A;  3FPV A;  5M19 A;  3NJA A;  4PMA A;  3OBF A;  1TS7 A;  2J8Y A;  3BFG A;  3MR0 A;  1TF1 A;  4E3K A;  4MCW A;  3HJI A;  5HZH A;  1RP5 A;  3OLO A;  4H8R A;  1L0D A;  2EA9 A;  2O99 A;  2HJE A;  2J9P A;  1VET A;  4LCM A;  1W7F A;  1VM1 A;  3EGX C;  1MWR A;  1K55 C;  4KZ5 A;  2XD1 A;  2Y91 A;  3VSK A;  5IU1 A;  3VMA A;  5A91 A;  1NLZ A;  2WKI A;  1ESU A;  4WZ5 A;  4Y5F A;  5HAI A;  3UE0 A;  4C75 A;  3N7W A;  3GMW A;  1MWS A;  1S6R A;  4JF6 A;  2C6W B;  3F1P A;  2XH9 A;  4ARZ B;  5IS1 A;  2V1B A;  3BQ8 A;  3PBQ A;  2Y2K A;  2M1C A;  3GTC A;  4S2O A;  2JHE A;  1UGU A;  4O8G A;  3CMZ A;  4BBV A;  4IJG A;  3VV4 A;  3V50 A;  4GJ4 A;  2Q9N A;  1N9L A;  4DRT A;  3FPW A;  3MQQ A;  1GSW A;  4B88 A;  4RX2 A;  1VQQ A;  1LL8 A;  2XD5 A;  3WS0 A;  1Z6F A;  2ZLY A;  3G4P A;  4Y2F A;  4S2N A;  3EEH A;  3HLC A;  2VJW A;  5GHZ A;  3UPN A;  2EX6 A;  1Y4O A;  3PBS A;  5BOH A;  4K91 A;  5DKK A;  2A49 A;  1IYQ A;  4GHI A;  3MZF A;  2J80 A;  2PYP A;  3U4L P;  4BBU A;  3PAG A;  4EV4 A;  3E4O A;  3N6I A;  3W8K A;  4EEU A;  2B18 A;  4DKI A;  2K7S A;  3QP8 A;  2XQZ A;  3PHY A;  1PZP A;  2HDR A;  5TBM B;  1WE4 A;  2LB9 A;  3SH7 A;  4WEJ A;  1YQS A;  4KZ4 A;  4BLM A;  1K38 A;  3B42 A;  2VV7 A;  3D9Y A;  2ZC7 A;  1HZO A;  1W79 A;  3LI9 A;  2DCF A;  3IH8 A;  1YT4 A;  4ID4 A;  5EVI D;  4E3O A;  3OPL A;  4I3I A;  3GRJ A;  5GHX A;  1JVJ A;  1KE4 A;  2OV5 A;  3P01 A;  1QMF A;  3WWX A;  5EM0 A;  1XJ3 A;  4BQM A;  4CQH A;  3IF6 B;  2PU4 A;  4P6Z S;  5EE8 A;  1K57 C;  5CHM A;  1KDS A;  2K31 A;  2XEP A;  4JF4 A;  2JKT I;  2ZQ8 A;  3OCL A;  1K0K A;  1MY8 A;  3DTI A;  3IBR A;  3O3V A;  3P7N A;  4UAA A;  1S66 L;  2ZQD A;  4HJ6 A;  1ES5 A;  1L0F A;  3SH8 A;  3T1R A;  3QNB A;  2G2W A;  1TS8 A;  3VE4 A;  2V0W A;  3C5A A;  2HPB A;  2A3U A;  3G32 A;  1IKG A;  1S67 L;  3O86 A;  3HLE A;  5M18 A;  2ZC5 B;  4JXG A;  1SDE A;  3SS3 A;  4HI4 A;  4YNR A;  3V3S A;  3TRC A;  1ZTU A;  2J3W A;  2JBF A;  4CPK A;  3LCE A;  2QMI A;  3MJQ A;  3RTY A;  2L1M A;  3LID A;  4OQ0 A;  1MWT A;  4R38 A;  1ALQ A;  3VOL A;  2R9X A;  3A0R A;  3SS4 A;  3N4I A;  2DRW A;  4PM8 A;  1SZV A;  3EQU A;  3DWZ A;  3Q82 A;  1JWZ A;  5AVF A;  4K0W A;  2XA7 M;  2PBD P;  3C8C A;  1OME A;  3IX8 A;  2VKS A;  4RA7 A;  5HFO A;  4ARZ A;  3CIT A;  4DXB A;  2VEA A;  4IBX A;  2D01 A;  2WZZ A;  1E4D A;  4ZJ3 A;  2PAV P;  3A3E A;  4UQI M;  4NKP A;  1H0M A;  3UY6 A;  1ONH A;  1XGJ A;  4B4Z A;  1DY6 A;  5HL6 A;  1PNE A;  1K56 A;  2JKG A;  1CF0 A;  2EFU A;  3Q7V B;  4E6X A;  2YKF A;  1T1A A;  4PAU A;  4Y7P A;  1ERM A;  2QYB A;  2JKT M;  3TG9 A;  4G3V A;  2WUQ A;  3V3R A;  3HL9 A;  4BL3 A;  2KOI A;  2GZA A;  2XRN A;  1BUE A;  1NY0 A;  2HJ9 C;  4IVI A;  1S1Z A;  4HP4 A;  4I39 A;  2Q9M A;  4ETX A;  3OZH A;  4S2J A;  4X1L A;  3OPP A;  4FH4 A;  4HHD A;  1PZO A;  1XXM A;  1KVL A;  3BLS A;  4K0X A;  4P0M A;  1I5Q A;  4GS9 B;  1FR6 A;  3TW8 A;  2VGL M;  4IVK A;  3ULF A;  5CRF A;  3S4X A;  1LL9 A;  4DXC A;  4LV2 A;  2Y2L A;  3EGD C;  3H82 B;  1M6K A;  4KQR A;  5TBM A;  2I72 A;  2PU2 A;  4NXB A;  4X25 A;  2Z2M B;  3T1Q B;  4Q8I A;  4DF6 A;  3UDI A;  1MZU A;  5DF7 A;  3IXG A;  1XA7 A;  5CXW A;  1DJA A;  3HUO A;  5E2G A;  4MEZ A;  4PM6 A;  1DP6 A;  2AVX A;  1W5D A;  5J8X A;  5F82 A;  4FOF A;  3CZD A;  1P97 A;  4QHC A;  1KOU A;  1P0Z A;  3IF6 A;  4EBN A;  3CUE A;  5FQQ A;  1EWZ A;  4KZA A;  3ZG9 B;  5FSR A;  1XKZ A;  4HH3 A;  1MWU A;  1NXY A;  5KIZ A;  5L10 A;  3BYD A;  3ITA A;  3PBO A;  5L09 A;  3FV7 A;  1XJ4 A;  1OT6 A;  5KMW A;  3T4T A;  5F1F A;  3Q7Z A;  1V9Y A;  3IWO A;  4UHU A;  4EET B;  2V1A A;  3T4S A;  3FYZ A;  1ES2 A;  5GHY A;  2XR0 A;  4U0T A;  1I2W A;  1YPR A;  5FAQ A;  5AQA A;  3HJK A;  3P98 A;  5FL3 A;  1XFN A;  3ZCZ A;  1ZHH B;  3NC8 A;  2W3F A;  2PBY A;  1CI9 A;  4WN5 A;  4UA6 A;  5L07 A;  2XSS A;  3ZG5 A;  3UDX A;  1E3U D;  2E8J A;  2X02 A;  4GD6 A;  4NG2 A;  3UO9 A;  2RCX A;  2JN7 A;  3CG5 A;  5DFX A;  1FQG A;  3NEC A;  4GZB A;  4HH2 A;  4JLF A;  4E3N A;  5JYO A;  1RGY A;  3VSL A;  4GNU A;  1VHM A;  3PTE A;  1E25 A;  3W4Q A;  4IHQ A;  4C3Q A;  4P85 A;  4Y0T A;  2ZOI A;  4MNR A;  1D1J A;  2A2L A;  4JKT A;  3A0V A;  1YSP A;  3E98 A;  4FD8 A;  2V0U A;  3HRE A;  1K54 C;  1MPL A;  2OLU A;  3R7W A;  3UMD A;  4RYE A;  4Q0H A;  3QP5 A;  4I5S A;  1ERO A;  2ZL1 B;  3MZE A;  1T1B A;  1N9O A;  2XA7 S;  3Q7V A;  3KYZ A;  3MZD A;  3NCK A;  3C38 A;  1GHM A;  3T4L A;  3PBN A;  4UQI S;  2EWW A;  4DMZ A;  3PYP A;  4N9K A;  5HDS A;  3BJN A;  1IFQ A;  3NI9 A;  3R4K A;  1LLB A;  1OTD A;  3WS1 A;  3B47 A;  1CK3 A;  4GS9 A;  2CC1 A;  4YFM A;  3ZG0 A;  5MC7 A;  4JGP A;  4MN7 A;  4N1H A;  3G2Y A;  3E2K A;  1WA9 A;  2W27 A;  2O9C A;  4X6T A;  3S7Q A;  3ZHH A;  3ZQ5 A;  3JYI A;  5KZH A;  2Y8H A;  4LV3 A;  4NET A;  4S2K A;  4C6Y A;  3VP0 A;  1Q2P A;  3KYE A;  3ZFZ A;  2J3T D;  5G4Z A;  4WMC D;  2V9A A;  5HSQ A;  3WRZ A;  4WZ4 A;  3V67 A;  4LFU A;  2VV6 A;  2B95 A;  4QPR A;  5CED A;  1IYP A;  4NXF A;  2VGL S;  2R78 A;  4WF0 A;  3LEQ A;  5TJJ A;  1XJ2 A;  1F9I A;  1K56 D;  4NXE A;  4OQI A;  4BBT A;  4AFI A;  4BMW A;  1LHY A;  4O0P A;  1J3W A;  4I38 A;  5JYP A;  4II7 A;  5CTN A;  1KE3 A;  3MFX A;  4B9O A;  1WYC A;  3HCY A;  4WL9 A;  2Z2L B;  4X55 A;  3C30 A;  5CER A;  5HWV A;  1D7E A;  4B93 A;  4XUX A;  1KGE A;  1MC0 A;  2XDM A;  1ZG6 A;  1MKI A;  1ZG4 A;  2W1R A;  2VGK A;  3L9K A;  5FAT A;  1TVF A;  3A3F A;  4OVD A;  5I94 A;  2H0T A;  2UWX A;  2Q0O A;  3IBJ A;  4X68 A;  2PR5 A;  2WZX A;  4MBF A;  2Y2M A;  4U0X A;  5EVI C;  3MSH A;  4MBK A;  2QJ5 A;  5GLD A;  3T4J A;  1G68 A;  3UB7 A;  4EQ1 A;  5GLB A;  4ESP A;  1IYO A;  2OOL A;  3LY3 A;  2R9W A;  2FH5 A;  2BLS A;  1PI5 A;  1UWN X;  3P09 A;  5EOO A;  5IHV A;  3HUN A;  3LUQ A;  1FSW A;  3KX0 X;  5EFW A;  1PYY A;  5DFY A;  4ZTK A;  2PR6 A;  3S7O A;  4IBR A;  4M4X A;  3KO6 A;  3W4O A;  5HAR A;  2Y2H A;  4EBL A;  4Q0J A;  1ONG A;  4HY8 A;  1KGF A;  3I7J A;  2ZL1 A;  4CJN A;  3BY9 A;  2I9V A;  5HWW A;  4OLG A;  2XLN A;  3GEC A;  3SZT A;  2PRF A;  4F3L B;  2ZC6 B;  3BLM A;  3FC7 A;  1PIO A;  1JWP A;  2IA2 A;  5CTM A;  2ZBB A;  2WKE A;  1F98 A;  4E04 A;  2BG1 A;  2WGI A;  3BEB A;  2OWJ A;  2IWD A;  5DTT A;  2W3E A;  3QHY A;  4OPZ A;  4ZRR A;  2JCH A;  3QNC A;  3ZNY A;  5FI2 A;  2Y2I A;  3HUM A;  1FR1 A;  4G3W A;  4HP9 A;  2XFT A;  4U3T A;  1V9Z A;  3ZVT A;  5A93 A;  1GSX A;  5DTS A;  1N9N A;  5EPH A;  2Y2O A;  1SDN A;  2G2U A;  3WRT A;  1NWZ A;  4KUK A;  4IED A;  2E8I A;  4R70 A;  2XK1 A;  2FZ0 A;  5TR7 A;  3BWL A;  3GVB A;  1YMS A;  4KG6 A;  2OSU A;  4F94 A;  2HP5 A;  4E3M A;  3SH9 A;  4GCZ A;  3IS2 B;  1BTL A;  4JGO A;  4OP8 A;  2GNX A;  5CX7 A;  4PM7 A;  2P08 A;  1TS0 A;  2HP9 A;  5CEC A;  3WS2 A;  4E3I A;  4IUH A;  4BJP A;  4GW9 A;  5I5L A;  3VP2 A;  1XPB A;  3LIA A;  3D3O A;  1OT9 A;  4CLC D;  4WZ5 C;  4H6J B;  1Q2Q A;  1Y28 A;  2DMW A;  4WLA A;  1DRM A;  4ME4 A;  4KG2 A;  5CGS A;  2XF3 A;  3E2L A;  3JVU A;  4R3B A;  4WM9 A;  3BEC A;  4HOI A;  2VK3 A;  1L3L A;  4LRY C;  3FKW A;  4JBF A;  1ODV A;  3LR4 A;  1TEM A;  2IWB A;  1N9B A;  4MMN A;  4R23 A;  5HX9 A;  4S2L A;  3GQZ A;  4ETZ A;  5HWT A;  3JVV A;  5HD3 A;  3ZGA B;  1YKD A;  3PBT A;  5GL9 A;  3UB6 A;  4D60 A;  4OOY A;  4S2N C;  5U47 A;  2WKP A;  2EX9 A;  4QU3 A;  4E3L A;  3T1S A;  4R3A A;  3NHQ A;  2ZMV A;  5DJT A;  3HLD A;  5E43 A;  2KX6 A;  5EVI B;  2WKQ A;  4YOF A;  3M6H A;  2W3H A;  4NK3 A;  2CMN A;  3OOV A;  4Y3I A;  2J7V A;  3OCN A;  3CHW P;  3ZG7 B;  3LIC A;  5FAP A;  4ZJ2 A;  1LI9 A;  4F3L A;  5EEC A;  3QP2 A;  1F5M A;  2PD7 A;  4LEN A;  1S4R A;  2C5W B;  2ZMA A;  4BL2 A;  1OPX A;  2JKR I;  1EW0 A;  1NRF A;  2V8F A;  1J9M A;  1OJG A;  2HF6 A;  1LSX A;  1FCO A;  1JNU A;  2Z6D A;  2ZQ7 A;  5HDD A;  3T50 A;  4QJG A;  3EEA A;  4KZ7 A;  2HDQ A;  2Y79 A;  4MDZ A;  4RX3 A;  1LSV A;  4UA9 A;  3UB8 A;  3GR2 A;  3OC2 A;  5E2E A;  2INW A;  4HBU A;  1PW1 A;  3IQA A;  4S2P A;  3MXS A;  4QWO A;  4WEK A;  3VP1 A;  1K6S A;  5G18 A;  1OTI A;  4QY6 A;  5HD5 A;  4KZ6 A;  3TOI A;  1NZO A;  1N4O A;  4WUJ A;  4MN5 A;  3U2A A;  5LBR A;  4S2I A;  1IYS A;  3VP3 A;  3DW0 A;  3RXX A;  1K4E A;  4KZ3 A;  5AQB A;  3ICY A;  1BLP A;  4HJ3 A;  4S2M A;  2NUP C;  5G4Y A;  4EWF A;  1CEG A;  4XXR A;  2FFF B;  3LEZ A;  5F5Y A;  3IWQ A;  3Q1F A;  4LGW A;  3MMH A;  1MKM A;  3H7W B;  3A3J A;  4KQO A;  1XA1 A;  2QKP A;  3BFC A;  3MBZ A;  1W8Y A;  4BEN A;  3B33 A;  4Y0U A;  1VEU B;  5EM1 A;  1L2S A;  1NZU A;  3K2N A;  4GD8 A;  5FEG A;  3HVF A;  4H6J A;  2ZC4 B;  1RCJ A;  3C7U A;  1P9R A;  4P87 A;  3UE1 A;  1FIL A;  5L8M A;  4N1X A;  4EW7 A;  2JE5 A;  2PYR A;  2JKR M;  5EVE A;  2PHY A;  2J3T C;  5FA7 A;  3K3D A;  4DN0 A;  3IXH A;  3IX3 A;  2ZQC A;  3LGO A;  5FDH A;  1YMX A;  3NY4 A;  4HQA A;  2BAS A;  3KSI A;  3WS5 A;  5L2F A;  4KQQ A;  1ESI A;  2GX5 A;  1STZ A;  3E4Q A;  4EUZ A;  5CGW A;  5DF9 A;  1XFQ A;  5AQ9 A;  3TSG A;  1AWI A;  4Q0I A;  2GDN A;  2WGV A;  3IHB A;  4X56 A;  1VB6 A;  2Z6C A;  3MQ0 A;  4Z9Q A;  4DE0 A;  5F69 A;  1PW8 A;  3UB5 P;  1K55 A;  2P7J A;  4B4X A;  3LIE A;  5HAP A;  2Y2Q A;  3IH9 A;  1CQA A;  3UE6 A;  1PI4 A;  1RGZ A;  1GA0 A;  4PKY A;  1YM1 A;  2WAD A;  5A8B A;  3WS4 A;  4KZB A;  4KG5 A;  4GB7 A;  4M3K A;  4EQI A;  3RFB A;  1BUL A;  1HTZ A;  4KZ8 A;  5FAO A;  5DTK A;  3M2J A;  2WK0 A;  5HDC A;  5A90 A;  4KEN B;  3W2Z A;  4YWZ A;  3H9W A;  5DVA A;  3CWF A;  4RQ9 A;  3C4P A;  3F1O B;  2P04 A;  1NRJ A;  4R1G A;  3O5Y A;  3BFD A;  2H0Y A;  3H82 A;  4HBT A;  3RH8 B;  1T18 A;  4FH2 A;  1G6O A;  5C5K A;  1IEL A;  5J4E A;  1XJ6 A;  1KDW A;  5KSH A;  3BFE A;  3CUE C;  4G3K A;  3SS5 A;  1JWV A;  2ZOH A;  3D4F A;  3A3D A;  1ES3 A;  4BD1 A;  4JXW A;  2Y55 A;  3S7N A;  2EWV A;  3CAX A;  1JTD A;  4HIA A;  1K6R A;  5FEF A;  1YLP A;  2ZMF A;  1BZA A;  1TDL A; 
#chains in the Genus database with same CATH homology
 2PDR A;  4HP9 A;  4G3W A;  4WEL A;  2QWS A;  1YAX A;  4LRZ E;  5HL6 A;  1OJ5 A;  3S7P A;  2W3G A;  3EQV A;  1V9Z A;  1GSX A;  1N9N A;  2G7U A;  3LIB A;  1OTE A;  4FSF A;  4L9G A;  2YKF A;  1NWZ A;  3H7W A;  1T1A A;  4PAU A;  3BQA A;  4KUK A;  2VV8 A;  2QYB A;  2VA0 A;  2JKT M;  4G3V A;  4R70 A;  4EER A;  2MJ6 A;  2FZ0 A;  2KOI A;  2GZA A;  2XRN A;  2LB5 A;  1H3Q A;  3BWL A;  5AVE A;  2HJ9 C;  3F1P B;  3NOT C;  1S1Z A;  4HP4 A;  4I39 A;  4GCZ A;  2W0N A;  3UB9 A;  4ETX A;  3ZYT A;  1T19 A;  3D72 A;  3IS2 B;  2HGV A;  4JGO A;  2GNX A;  2YKH A;  4HHD A;  5J7E A;  4XT2 A;  2O9A A;  5CX7 A;  2P08 A;  1TS0 A;  4DJ2 A;  2OAP 1;  4LPZ A;  3TJZ C;  4GS9 B;  3TW8 A;  4BWI A;  2VGL M;  3LR0 A;  3ULF A;  4EXO A;  1DP8 A;  3PXP A;  3EGD C;  3H82 B;  4LRX C;  2M7V A;  4EUV A;  3LFV A;  5TBM A;  4IUH A;  3GDI A;  4OOM A;  4BJP A;  4NXB A;  1IOU A;  4GW9 A;  4I3A A;  1OTA A;  5I5L A;  2GJ3 A;  5DJU A;  3PR6 A;  1BYW A;  3LIA A;  1MZU A;  2HV1 A;  3BY8 A;  5AJG A;  3DBA A;  3D3O A;  1OT9 A;  4CLC D;  2O9B A;  3MF0 A;  4H6J B;  1Y28 A;  2DMW A;  4WLA A;  1DP6 A;  1DRM A;  4UEY A;  4ME4 A;  3UE3 A;  4GHI B;  1GSV A;  1G28 A;  1T1C A;  4CLC A;  1W63 Q;  4CLC C;  2VX8 A;  3JVU A;  4KUO A;  3T4K A;  3G6O A;  4FOF A;  2KLI A;  3KSF A;  4HOI A;  2M7U A;  1P97 A;  1KOU A;  1P0Z A;  1W63 M;  4LRY C;  3CUE A;  1ODV A;  4JGR A;  3LR4 A;  5F6A A;  4MMN A;  3KSH A;  4ETZ A;  5HWT A;  2A24 A;  3JVV A;  4HH3 A;  4P6Z M;  5HD3 A;  5KIZ A;  4PKY G;  3F1N A;  1YKD A;  3PBT A;  3UB6 A;  3PBO A;  4LLO B;  1DP9 A;  1XJ4 A;  2W1T A;  2W3D A;  1OT6 A;  2WKP A;  3KYQ A;  3T4T A;  1H8M A;  2VZW A;  5HPF A;  1V9Y A;  4EET B;  2V1A A;  3T4S A;  4R3A A;  3TE8 A;  3MXQ A;  4IUK A;  3NHQ A;  3NOP C;  2WKR A;  2ZMV A;  4OOL A;  3F1O A;  4CLC E;  4NEE D;  5DJT A;  4DJ3 A;  1OTB A;  2NUT C;  1LSW A;  2KX6 A;  1D06 A;  3HJK A;  2WKQ A;  4YOF A;  5FL3 A;  2W3H A;  4EEP A;  1XFN A;  4GLQ A;  2KDK A;  4HJ4 A;  4EU0 A;  3VE3 A;  1ZHH B;  2CMN A;  3OOV A;  2W3F A;  4Y3I A;  3KSG A;  3OCN A;  3UME A;  4WN5 A;  2PD8 A;  3LIC A;  2XSS A;  5HPI A;  4L0L A;  4F3L A;  1F5M A;  2PD7 A;  5DKL A;  2QHK A;  2JN7 A;  3FPV A;  1S4R A;  1YSQ A;  5DFX A;  4HH2 A;  1OPX A;  3NJA A;  2O0Y A;  1VHM A;  3OBF A;  1TS7 A;  2JKR I;  3BW6 A;  1EW0 A;  3MR0 A;  4IHQ A;  1TF1 A;  1S4S A;  4R6L A;  1OJG A;  4MCW A;  2HF6 A;  4HNB A;  3FG8 A;  3HJI A;  2ZOI A;  5HZH A;  1LSX A;  1JNU A;  2A2L A;  3OLO A;  2Z6D A;  5HDD A;  3A0V A;  3T50 A;  1YSP A;  2EA9 A;  3E98 A;  3EEA A;  2O99 A;  2HJE A;  2Y79 A;  4MDZ A;  2V0U A;  1LSV A;  3R7W A;  3UB8 A;  3EWK A;  2OWH A;  3UMD A;  4KQD A;  3OC2 A;  4NXG A;  3EGX C;  4Q0H A;  2INW A;  3CLO A;  4I5S A;  1T1B A;  1TD5 A;  1N9O A;  2XA7 S;  5IU1 A;  1NLZ A;  3KYZ A;  4WEK A;  4K08 A;  4Y5F A;  1OTI A;  5HD5 A;  5K5B A;  3C38 A;  3T4L A;  3PBN A;  3F1P A;  2EWW A;  4UQI S;  4ARZ B;  4WUJ A;  2V1B A;  4DMZ A;  5IS1 A;  3BQ8 A;  4MN5 A;  4JGQ A;  3PYP A;  4L9E A;  3U2A A;  3PBQ A;  5LBR A;  3LR3 A;  5HDS A;  2M1C A;  2JHE A;  3BJN A;  1UGU A;  4O8G A;  1LT0 A;  1IFQ A;  3CI6 A;  3K3C A;  3R4K A;  4BBV A;  4IJG A;  3VV4 A;  1OTD A;  4GJ4 A;  1N9L A;  3ICY A;  4HJ3 A;  2NUP C;  3B47 A;  5G4Y A;  3FPW A;  3MQQ A;  1GSW A;  4GS9 A;  1LL8 A;  5F5Y A;  3MQO A;  4PHT A;  3E0Y A;  3MMH A;  4Y2F A;  5MC7 A;  1MKM A;  4JGP A;  4MN7 A;  3EEH A;  1WA9 A;  3H7W B;  4KQO A;  2W27 A;  2QKP A;  4MN6 A;  2O9C A;  3S7Q A;  1X0O A;  3ZQ5 A;  3B33 A;  2VJW A;  2Y8H A;  3K2N A;  4H6J A;  3PBS A;  1P9R A;  2J3T D;  5G4Z A;  2V9A A;  5HSQ A;  5DKK A;  4GHI A;  5L8M A;  4EW7 A;  3V67 A;  2J80 A;  2PYP A;  4BBU A;  2VV6 A;  4QPR A;  3E4O A;  2PYR A;  4NXF A;  2VGL S;  2JKR M;  2R78 A;  4WF0 A;  4EEU A;  5TJJ A;  4XT2 B;  1XJ2 A;  1F9I A;  2B18 A;  4NXE A;  2PHY A;  2K7S A;  4BBT A;  2J3T C;  4AFI A;  1UWP X;  4BMW A;  4I3J A;  4O0P A;  3LYX A;  3PHY A;  2H28 A;  3K3D A;  4I38 A;  4DN0 A;  4II7 A;  5TBM B;  3R7W B;  2LB9 A;  4WEJ A;  3MFX A;  1S1Y A;  4B9O A;  3LI8 A;  4HQA A;  3SW1 A;  3B42 A;  2VV7 A;  3HCY A;  2BAS A;  3KSI A;  4WL9 A;  3C30 A;  3E4P A;  5HWV A;  1D7E A;  3LI9 A;  4B93 A;  2GX5 A;  1MC0 A;  1STZ A;  3E4Q A;  5DF9 A;  1XFQ A;  2W1R A;  2XRO A;  2L4R A;  4I3I A;  2VLG A;  4Q0I A;  1P9W A;  2QJ7 A;  1VB6 A;  4O01 A;  2Z6C A;  3IBJ A;  4CLC B;  3MQ0 A;  3P01 A;  5F69 A;  2PR5 A;  2P7J A;  2L0W A;  2PT7 A;  1XJ3 A;  4CQH A;  2QJ5 A;  3LIE A;  3T4J A;  4P6Z S;  3UB7 A;  3UE6 A;  2K31 A;  4EQ1 A;  2JKT I;  4PKY A;  3LR5 A;  2B02 A;  2A24 B;  5A8B A;  3OCL A;  2OOL A;  4L9F A;  3IBR A;  3F1N B;  3P7N A;  1S66 L;  3RFB A;  2FH5 A;  2K2N A;  4HJ6 A;  2W1T B;  2OAQ 1;  1UWN X;  5HDC A;  3W2Z A;  4YWZ A;  3H9W A;  3LUQ A;  1TS8 A;  3IS2 A;  3KX0 X;  5EFW A;  3VE4 A;  2V0W A;  5DFY A;  3CWF A;  4RQ9 A;  1S67 L;  2PR6 A;  3S7O A;  3F1O B;  2P04 A;  1NRJ A;  3KO6 A;  4M4X A;  3O5Y A;  4HI4 A;  4YNR A;  3TRC A;  1ZTU A;  2J3W A;  3H82 A;  1TS6 A;  3C2W A;  3RH8 B;  3MJQ A;  5IT5 A;  3RTY A;  1T18 A;  1G6O A;  5C5K A;  2L1M A;  3LID A;  5J4E A;  4Q0J A;  4EES A;  4R38 A;  4HY8 A;  1XJ6 A;  3VOL A;  2D02 A;  5KSH A;  3A0R A;  3BY9 A;  2I9V A;  5HWW A;  3CUE C;  4G3K A;  3GEC A;  3EQU A;  3LIF A;  4F3L B;  3NOU C;  3T4Q A;  2ZOH A;  4Z1W A;  3FC7 A;  2IA2 A;  5AVF A;  3PBR A;  3A0S A;  2XA7 M;  3T4O A;  2ZBB A;  3C8C A;  1F98 A;  2VKS A;  4E04 A;  1NLY A;  4ARZ A;  3S7N A;  2EWV A;  3CAX A;  3CIT A;  5F68 A;  4HIA A;  2OWJ A;  2VEA A;  2ZMF A;  2D01 A;  3EOI A;  4UQI M;  2W3E A;  4NKP A;  4ZRR A;  5J3W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...