2VV6A

Bjfixlh in ferric form
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
106
structure length
106
Chain Sequence
IPDAMIVIDGHGIIQLFSTAAERLFGWSELEAIGQNVNILMPEPDRSRHDSYISRYRTTSDPHIIGIGRIVTGKRRDGTTFPMHLSIGEMQSGGEPYFTGFVRDLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Changes in Quaternary Structure in the Signaling Mechanisms of Pas Domains.
pubmed doi rcsb
source organism Bradyrhizobium japonicum
molecule tags Signaling protein, transferase
molecule keywords SENSOR PROTEIN FIXL
total genus 26
structure length 106
sequence length 106
chains with identical sequence B, C, D
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2008-06-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2vv6A00
1N9LA 2V0UA 2W27A 2WKRA 3F1NB 3LIBA 5EFWA 5G4YA 3H7WA 5F6AA 5HD5A 2GJ3A 4R38A 3LIAA 1OJ5A 1X0OA 1VB6A 4HY8A 4KUKA 4PKYA 3UMEA 2J80A 4LRXC 1F9IA 3SW1A 2L0WA 1TS8A 1D06A 2PYRA 3KX0X 3ULFA 5HWWA 4R3AA 1T1BA 4KUOA 1P97A 1S67L 2QWSA 3E4OA 5J3WA 4EEUA 3FG8A 1XJ3A 1BYWA 2CMNA 1TS0A 3NOTC 4LPZA 4NXBA 4R70A 4XT2B 3UB8A 3LI8A 1DP6A 4MN6A 2W0NA 3VOLA 5AVEA 2QJ5A 2VV8A 5HDDA 4HNBA 4GCZA 3C2WA 3LICA 4F3LA 2V0WA 3UMDA 3NOUC 2VLGA 3F1OA 4WUJA 1LL8A 5IU1A 1XJ2A 1GSWA 3UE6A 5HZHA 3HJKA 3LYXA 1T18A 3D72A 2JHEA 4EW7A 2V1BA 1S66L 5F68A 3MR0A 5HSQA 1T1CA 2BASA 4WL9A 2B02A 2KX6A 3UB9A 4LLOB 5A8BA 1Y28A 2Z6CA 3F1PA 4JGPA 1DRMA 2ZOIA 4HJ4A 3VE3A 2PHYA 4WF0A 3GDIA 3K3CA 3PHYA 5DJTA 4L9GA 5I5LA 4JGRA 4LRZE 4H6JA 5IS1A 5DJUA 5KIZA 3T50A 3LIEA 5HWTA 4I5SA 2PD7A 3F1NA 5DKLA 4EERA 3F1PB 3H7WB 3A0VA 2V9AA 4GHIB 4NXFA 3P7NA 2HV1A 4LRYC 4DJ2A 4BBVA 3LI9A 3LIFA 1ODVA 2PD8A 1OT9A 1OTIA 3MQQA 3ICYA 1S4RA 1GSXA 3EWKA 3GECA 4I3AA 3E4QA 3IS2B 3C8CA 4HOIA 1UWNX 4E04A 3OLOA 5HWVA 1GSVA 4HHDA 2JN7A 1JNUA 1LT0A 4B9OA 1UWPX 2WKPA 4GS9B 5HDSA 1D7EA 1KOUA 4HQAA 3HJIA 2EA9A 1UGUA 4EEPA 5F69A 4R6LA 3UB7A 3ZQ5A 5J7EA 4NXGA 1OT6A 1LSWA 1V9ZA 4WN5A 1F98A 1P0ZA 3IS2A 2H28A 3A0SA 2QHKA 2OWJA 2QJ7A 2V1AA 1XFNA 3CWFA 5J4EA 4GS9A 3CLOA 4HI4A 2YKFA 3UB6A 3IBRA 4HH2A 4BBTA 4I38A 5TBMB 3H9WA 3MXQA 3NOPC 5TBMA 1TS6A 3CAXA 3EEHA 3MJQA 3BY8A 2PR6A 3BY9A 4YWZA 4HH3A 1T1AA 2I9VA 3BWLA 4F3LB 2VEAA 5DKKA 4NXEA 2KDKA 3F1OB 2P7JA 2VV7A 3NHQA 4MN5A 1N9NA 4XT2A 1OTBA 2PDRA 2OOLA 4EESA 4I3IA 4L9EA 1G28A 3H82B 1NWZA 3PYPA 2PYPA 4M4XA 3H82A 3RTYA 3E4PA 1DP9A 1OTAA 1T19A 3B33A 3G6OA 4GW9A 1OTDA 3RH8B 4I3JA 4K08A 4KQDA 5HD3A 2ZOHA 2K7SA 2OWHA 2QKPA 2PR5A 2YKHA 1EW0A 2L1MA 2VV6A 2ZBBA 3LIDA 4DJ3A 3K3DA 1V9YA 1OTEA 1S1ZA 2D02A 1MZUA 1TS7A 4HIAA 4HP9A 2R78A 1DP8A 4L9FA 2A24B 5AVFA 2Z6DA 3A0RA 4I39A 4JGQA 3VE4A 3LUQA 4PKYG 4EXOA 4EQ1A 1LSVA 2WKQA 4WLAA 1WA9A 2M1CA 4GHIA 3MFXA 4EETB 4HJ3A 5F5YA 4HJ6A 5G4ZA 4HP4A 1XJ4A 1S4SA 5HDCA 2D01A 1XJ6A 2INWA 1LSXA 3FC7A 3MQOA 1OJGA 1N9OA 4JGOA 4BBUA 1XFQA 3NJAA 2A24A 1S1YA 4H6JB 2L4RA 4RQ9A
chains in the Genus database with same CATH superfamily
3BFEA 3F1NB 3FV7A 3VP4A 1VB6A 3NBLA 3PBSA 3Q82A 1K57A 1FSWA 1TD5A 2PT7A 3IX3A 2CMNA 3PR6A 1RCJA 2Y2LA 1JWVA 1NRJA 4CLCC 3UY6A 5IHVA 4P87A 4JF4A 4F3LA 2MJ6A 3CJMA 1WYCA 4WZ4A 3Q07A 4WYYA 3FPWA 4BL3A 5EVIC 5HFOA 4DDYA 2LB5A 5DF8A 3IF6A 2ZM2A 1Y54A 2XLNA 5DJTA 3DW0A 1ONHA 5FA7A 4KZ3A 4G3WA 3UPNA 5DJUA 3LIEA 3IXBA 1ZG4A 1OPXA 4BBVA 3LI9A 5DFXA 4OQGA 2XA7S 2QYBA 3GVBA 5HW3A 3G4PA 1LL9A 3ZQ5A 4ESPA 4QHCA 2QHKA 2QJ7A 2IWCA 3T4QA 3GRJA 4UA6A 3T4JA 2A49A 1XA7A 2P7JA 4X69A 3NHQA 3OC2A 4X56A 4DE3A 3SH7A 3VOZA 1PNEA 1PRQA 1NWZA 1HLUP 2EX8A 2JKGA 3ZNYA 3IHBA 2UWXA 2VGJA 1IFQA 2A24B 5FQQA 3PBTA 2KLIA 3FYZA 5CHUA 4JGOA 1L0EA 3QHYA 2FZ0A 3IHAA 3JVUA 4OVDA 1IEMA 5CRFA 2ZQDA 2M7UA 1F9IA 1YT4A 1VHMA 2ZMAA 3CPTB 4X1MA 3IWQA 3FG8A 1S6RA 3V3RA 1CI8A 5IU1A 2ZC3B 2Y2GA 3LYXA 1T18A 3KSGA 4KZ7A 3ZG7B 1ERQA 1S66L 3Q81A 4QY5A 2EWWA 3UB9A 3L7HA 2K2NA 3FWLA 3VP0A 3WS2A 4WF0A 1JTGA 5HAIA 4GN2A 4DRTA 1HZOA 3A0VA 4ETXA 4R23A 3MXRA 3CITA 1CJFA 2IWBA 1NYYA 1FQGA 1ZG6A 1OMEA 1W7FA 5BOHA 1F98A 1P0ZA 4DE1A 5TJJA 3IBRA 1TS6A 4YWZA 3BWLA 2X02A 3F1OB 4JXWA 1FCNA 1K4EA 5GLBA 1KDSA 1TEMA 4XT2A 1OTBA 3IX8A 3B33A 4LV0A 4OOMA 2P08A 1KDWA 3RH8B 5FDHA 4KQDA 4E6WA 3HREA 5GHZA 1O07A 5L8MA 1S1ZA 1PI4A 4Q8IA 2R78A 3NECA 1VEUB 3GSGA 2J9OA 1H0MA 1XGIA 3NDGA 1HVBA 3UB5P 3RFBA 4WM9A 2Y2JA 1TS8A 2FFYA 2Z2LB 3IQAA 5HWWA 2V2FF 4X68A 1LI9A 4Y7PA 2J3WA 3N8RA 4EUVA 2ZL1B 3LI8A 1L0FA 3G2ZA 2J3TC 1PWGA 3T1QB 3CZDA 4EV4A 4YOFA 4DN0A 3OPRA 3BQAA 2ZLYA 2M7VA 1IYSA 2ZOIA 1CK3A 2H5SA 2Y2MA 4P6ZS 4PM5A 4BQMA 3Q7VA 4ZRRA 5JYPA 1ESUA 3EWKA 3GQZA 2PU4A 4IBRA 1ES4A 2O0YA 3HLEA 4E6XA 3G2YA 1OT6A 1LSWA 4ZJ3A 5LBRA 4A5RA 4X25A 3U4LP 5KMWA 5TBMB 3JVVA 4P6BA 2VV7A 2VKSA 4EESA 5FEGA 3E4PA 4GW9A 4LV3A 1OTDA 4BWIA 3WS0A 4OLGA 4HIAA 4HP9A 2HP5A 3KYEA 4KZ8A 2XRNA 5EVIB 2B5RA 4IJGA 1TDLA 2X01A 5CTNA 1LSXA 3MQOA 4GDBA 5FL3A 1H8ZA 2W27A 4OP8A 1MXOA 3Q7ZA 1YAXA 4O8GA 3N8SA 4R70A 1ES2A 2HJ9C 4UHUA 4NKPA 5DTKA 3SZTA 5KSCA 5FASA 2WGWB 1AWIA 4S2MA 5CX7A 2JKTM 4LRZE 4OQHA 5EVID 3LR4A 3TJZC 2WGWA 3BFDA 3K2NA 2WUQA 2OAQ1 4JXSA 1UWNX 2W3DA 3S7NA 3UB7A 2HDRA 2DRWA 1ES3A 2WZZA 3CLOA 1ZC2A 3NIAA 3UO9A 1K38A 2BG1A 3Q1FA 4MN5A 3N6IA 2WGIA 3OOVA 3QNBA 3N4IA 5JYOA 1CEFA 4C75A 4E3MA 1XP4A 1U60A 1Y4OA 2VGKA 2W3GA 4I39A 3LO7A 4Q0IA 3TRCA 2WKQA 4MBHA 5HARA 5CHJA 1XFQA 4BL2A 2JC7A 2GJ3A 4UA9A 1X0OA 4KUKA 4NEED 3GTCA 2KOIA 3VV4A 2CC1A 4LCLA 5U47A 1XJ3A 1BYWA 2Q0OA 3T4LA 3IBJA 3T4KA 2VV8A 3ISGA 4LGWA 2XD5A 2G2UA 2GNXA 4K0WA 2W3EA 3C5AA 2K31A 3C38A 4OP5A 1G5UA 5L07A 3IF5A 1EROA 4JGPA 2EWVA 3LCEA 5DF7A 4Q0HA 2H10A 3IF6B 5IS1A 4PM9A 3M6HA 2BTFP 3T50A 1XKZA 3WS4A 4XUZA 4GHIB 4IVKA 3LR3A 1OTIA 3MQQA 5GLAA 4I3AA 1F2KA 4KG2A 3BM6A 3QNCA 1FIKA 1G68A 5M19A 2OSUA 3E2LA 2EXBA 3PBQA 3A0SA 4GNUA 5J4EA 2VK3A 2HPBA 4I38A 2Y79A 2PR6A 4Y15A 5M18A 2J9PA 5CEDA 2O99A 1G28A 3H82B 2G7UA 1FCMA 4LENA 4KZAA 4RYEA 3S7QA 5AVFA 1CQAA 4PKYG 5F1GA 3ZYTA 3A3EA 3MFXA 3VOYA 4Y17A 1XJ4A 1FR6A 1SHVA 3GR2A 1K55C 5CTMA 4OQ0A 4CQHA 4JKTA 1P9RA 4JBFA 2Z2MB 2BLSA 4EQIA 3UN7A 1W79A 4E3NA 5F82A 3ULFA 4QPRA 2WK0A 3MBZA 4ZDXA 1TF1A 1FILA 3E0YA 2QJ5A 5E2FA 1GSWA 2X71A 1L3LA 3G32A 3T1SA 2GDNA 2XEPA 3HLDA 4HJ4A 3N7WA 1BLPA 4HESA 1BSGA 2XSSA 5DKLA 3UPOA 1SDNA 3AGDA 1GCEA 5G4ZA 1OT9A 4Y0OA 1GSVA 3CG5A 4ME4A 4PM8A 1MKIA 1UGUA 1I5QA 3VFHA 4KZ5A 4MBFA 2XFSA 3CHWP 1YPRA 2HZ5A 2Y8HA 4EUZA 5F83A 3BY9A 1VETA 5FQMA 1K25A 1NXYA 4U0TA 3HVFA 4MLLA 4G3KA 4M4XA 4DXBA 1OTAA 3G6OA 4KZBA 3LIDA 5EOOA 3K3DA 5FAQA 4Y2FA 3DTIA 5DTTA 1YLZA 3T1RA 4UQIM 1KE3A 4YNRA 5HDCA 2Y2NA 2D01A 4N1HA 4BBUA 3NJAA 4EBPA 2V1AA 1S1YA 4NK3A 1DJBA 2GX5A 4X1LA 1VEUA 1H3QA 4WMCA 1PZOA 4DE0A 3UE0A 4DF6A 4Y0TA 3B42A 1GHMA 4R3AA 1P97A 4X6TA 3UDXA 2Y2KA 4XT2B 3UNWA 2Y59A 1YLPA 2DNSA 5EM1A 3SS4A 4MCWA 5A92A 4D60A 1LL8A 1MWSA 1XJ2A 3UE6A 2FH5A 3D72A 3R4KA 4O7DA 3P09A 3IXDA 2HDSA 1BT5A 1YLJA 1BLCA 2XDMA 4E3LA 2P04A 4B4ZA 2VGLM 3MQ0A 4HEFA 4CLCA 2V9AA 2HV1A 1WE4A 3LIFA 3ZNTA 4ZBEA 2ZL1A 3MS6A 4NXGA 3CUEA 2PAVP 2G2WA 3ZG8B 1IYOA 2V20A 4HH3A 4PMAA 1YSQA 1PYYA 4EBNA 3NY4A 4AFIA 4NG2A 4OH0A 4OOLA 5EPHA 1YMSA 5CERA 4PAUA 3GV9A 5GLCA 2D02A 1MZUA 4II7A 1YLTA 3UDFA 4CJNA 3IH9A 1CI9A 3PBRA 4GLQA 4HP4A 1XJ6A 3FC7A 1K57C 4B93A 2EFUA 3PBNA 1XXMA 5FQIA 2ZC4B 4OPQA 1OJ5A 2OLVA 2ZC6B 4E3JA 3V39A 3LFVA 2HF6A 2XF3A 3A3FA 4S2PA 1VM1A 3IX4A 5EV0A 1JTDA 4GCZA 1C3BA 3NOUC 3HJKA 2O9BA 1XA1A 4EW7A 2V1BA 4FCFA 3CUEC 4LV1A 3VFFA 2R9XA 5F68A 1T1CA 3V5MA 2B02A 3SS5A 4KZ6A 1K56A 4JGRA 4KQRA 3AGEA 3F1PB 4C3QA 5L10A 1CF0A 2ZQ9A 5HD5A 1ERMA 1W63M 1BTLA 2P74A 1LT0A 4OOYA 4KG6A 2ZQ8A 4R6LA 5J7EA 3SH9A 1PFLA 3U2AA 2H28A 3TE8A 3BYDA 2PU2A 2IA2A 1W8QA 2JKTI 2EX9A 5TBMA 1TDGA 1SCWA 2I9VA 4S2LA 4BLMA 4PM6A 1W5DA 1PWCA 2PDRA 2OOLA 1IYPA 3RTYA 2PYPA 2ZM0A 3BECA 1KGGA 3GMWA 2XD1A 3TSGA 1PW8A 4S2NC 4WELA 2ZC7A 3HLWA 4DE2A 4DMZA 4HBTA 1BLHA 3WS1A 2RL3A 4S2NA 2W1TB 1HD8A 2V8CA 1OJGA 2OLUA 3DTEA 1JWPA 5HL6A 4E3KA 2VGLS 1JVJA 4EBLA 5K5BA 1XGJA 4HY8A 1IOUA 2XQZA 5E2GA 3KX0X 3T12B 5J3WA 3NOTC 2J8YA 2HDQA 2AVXA 4BMWA 1LLBA 4FTXA 3V50A 4WUJA 4WZ5C 3HUMA 2WKEA 4EWFA 1FCOA 4FD8A 3B3XA 3CI6A 4MN7A 3KSFA 2PHYA 3HLCA 5AQ9A 2DCFA 1ES5A 1Q2QA 2Y55A 1NLYA 1HTZA 3OPLA 3P7NA 3RJUA 3GECA 4HQAA 4H8RA 5F69A 1YKDA 1MC0A 5C5KA 1O7EA 4GS9A 3R7WB 4BBTA 3NOPC 3D3OA 2HJEA 5DKKA 2ZD8A 1BLSA 4PPRA 3C7VA 3M2JA 1GA0A 4GJ4A 1BULA 4R3JA 1BUEA 3ZCZA 4KENB 3FPVA 1K56D 4I3JA 3MFDA 4PHTA 3S4XA 5FATA 4CLCE 5FQKA 1SDEA 1PIOA 5CGXA 4S2KA 3W4PA 4GHIA 2Y2HA 3ZVTA 1S4SA 4UEYA 1D1JA 2OV5A 3M6BA 4IHQA 3WWXA 2V0UA 2WKRA 4IBXA 3H7WA 4LRXC 3SW1A 1NY0A 3PBOA 2RCXA 2R9WA 4LPZA 2V8FA 3VOLA 5FI2A 1L2SA 3C2WA 4JPMA 3W2ZA 2HGVA 1XX2A 3C30A 5DVAA 2Y2IA 3IWIA 1MKMA 3MSHA 3NC8A 3KSHA 3BQ8A 4LLOB 1Y28A 4RA7A 2W3HA 4R4RA 3BFCA 3UPPA 4H6JA 1MBLA 2PD7A 3H7WB 4DJ2A 5AQAA 1J9MA 5FQ9A 3G35A 4R3BA 5FAPA 4Z1WA 3ITAA 2EX6A 1K54C 3HJIA 3KSIA 1QMFA 4KZ4A 1Z09A 4Y13A 1A0KA 3TW8A 4N1XA 3FZCA 2WYXA 3UE3A 1ESIA 4GD6A 1M40A 4LCMA 3JYIA 1NZOA 1N9NA 4GB7A 3A3IA 4Y5FA 2J7VA 4FH4A 1YSPA 3H82A 3LR5A 4R1GA 2IWDA 5HD3A 2JKRI 1K0KA 2B95A 1OTEA 1TVFA 3MXSA 5IT5A 2M1CA 4EETB 3T4TA 4HJ3A 5L2FA 4U0XA 1N9LA 1JWZA 3ZG0A 4R38A 3LIAA 4UAAA 4WEKA 3WS5A 2WAFA 2VX8A 5CGSA 2PYRA 4S2OA 5GHXA 2QWSA 4EEUA 3UB8A 1TS0A 5FQJA 4B4XA 2H0YA 4ZJ2A 3OCNA 4HNBA 1GHPA 4CPKA 2V0WA 4GD8A 3VSLA 4JXVA 3HLBA 1W63Q 3O3VA 2XROA 3O5YA 3S7OA 1DRMA 3DTKA 3F1NA 3JPUA 1LHYA 3MF0A 2O9CA 1GSXA 5HWVA 3C8CA 2JCHA 4JXGA 2ZQ7A 3IT9A 1CEGA 5CECA 5TR7A 3T1XA 3O88A 3E2KA 2YKFA 5FI7A 5EVEA 5A90A 3HCYA 1ALQA 1K6SA 4OONA 1IKIA 3LEQA 5CXWA 5EUAA 2PR5A 4UQIS 4DJ3A 1DP8A 4RX2A 2XR0A 5KZHA 5CEBA 3WRZA 4WLAA 2E8IA 3QP6A 4JLFA 2INWA 4WZ5A 4JF5A 2W1RA 1PW1A 3LIBA 3ZDJA 3M2KA 1BZAA 4MBKA 1NYMA 1DJAA 2L0WA 5HL1A 2XK1A 4OQIA 1D06A 1MWUA 4MDZA 1T1BA 3QP5A 1S67L 1IYQA 5D3OA 4OPZA 3IH8A 3ZG9B 4G3VA 3FKWA 1QMEA 1WYBA 2Y4AA 2GZAA 3MKEA 1RGYA 3EQUA 4GZBA 3EQVA 5F1FA 4YFMA 4Y3IA 3DWKA 1K6RA 3GDIA 3DBAA 1VQQA 2DMWA 4EERA 3BW6A 4NXFA 4DXCA 3G34A 4CLCD 3E4QA 3HLFA 4F94A 2WKPA 5HDSA 3LR0A 3LEZA 2EA9A 5A91A 4X53A 1PZPA 3IS2A 4DKIA 4GOGA 5HPIA 4HI4A 4R0QA 3R7WA 1IELA 3ZFZA 1T1AA 3NULA 3KYQA 4NXEA 5TGFA 1H8YA 5J8XA 3P01A 3V3SA 1S0WA 3PYPA 1KGFA 2V1ZA 3BLMA 1GA9A 4K08A 3VP2A 5DTSA 3WRTA 4WMCD 4R4SA 3VP1A 1FOFA 3A0RA 4ETZA 4JGQA 1LSVA 1H5XA 4RVAA 3L9KA 5TFQA 2Y2QA 2QKPA 3NCKA 2L4RA 4ARZB 2Q9NA 4CLCB 5AJGA 4X55A 3UMEA 4D2OA 3W4QA 3HUOA 3QP4A 2ZQCA 3E4OA 5G4YA 4NXBA 4Y0UA 2W0NA 3D9YA 1YMXA 4OPYA 3UMDA 3F1OA 3PTEA 3P98A 4OPRA 3SOIA 1N4OA 3TOIA 3BJNA 3MMHA 3MR0A 1G6AA 5HSQA 4WL9A 2KX6A 3A3JA 5EOEA 3RXXA 3DAVA 4Q0JA 3BEBA 2W1TA 4IVIA 2ZMVA 3OBFA 3TG9A 1NLZA 1DJCA 1PI5A 1P9WA 4E3OA 3OLOA 4P6ZM 1JNUA 1D7EA 2PBDP 2JKRM 3S1YA 3NI9A 4WN5A 5E43A 3T4OA 2Q9MA 3IWOA 2WGVA 1SKOB 4QWOA 3H9WA 3CAXA 3EEHA 1SZVA 1LI0A 3S7PA 4ID4A 1KVLA 2EXAA 2KDKA 3SH8A 5G18A 2JE5A 2WADA 3C4PA 5I94A 2I72A 4L9EA 4BJPA 1DP9A 1ZTUA 2EX2A 2K7SA 2YKHA 3LY4A 1EW0A 2L1MA 3O87A 1EWZA 1GHIA 3NDEA 1RP5A 2QZ6A 5MC7A 1TS7A 2ZM8A 2OAP1 4Z9QA 4KZ9A 1E25A 4MEZA 3Q7VB 1ZKJA 2EFXA 1WA9A 1L0DA 4KQQA 4YINA 3BLSA 4MNRA 5FAOA 3HL9A 5F6AA 3MKFA 4LV2A 5AVEA 5HDDA 3C4OA 5FI6A 4PM7A 3ZG5A 4QB8A 5E2EA 4B88A 1KE4A 1NJ4A 5HZHA 5E2HA 1I2WA 3LY3A 4BD0A 4QD4A 2HP6A 5HPFA 2ACGA 4XUXA 3ZGAB 3F1PA 4N9KA 5EVLA 5I5LA 3FKVA 1YQSA 2XFTA 1I2SA 1E3UA 1KVMA 3UDIA 2LB9A 1MWTA 3ICYA 4E04A 3IS2B 4HOIA 5AQ7A 5DFYA 1N9BA 2WAEA 3IF6C 1XPBA 2B18A 4FOFA 3T4SA 2ZMFA 3OCLA 1M6KA 2QPNA 3MZFA 5EE8A 3CWFA 5EECA 4HH2A 4XXRA 2VZWA 4IEDA 1LL5A 2VEAA 2QMIA 4IUHA 2A3UA 5EM0A 5HX9A 2JBFA 5A93A 3OPPA 3ZVWA 3EGXC 1MWRA 1T19A 4QJGA 1J3WA 4JF6A 1PWDA 3A3DA 2ZBBA 4UA7A 5FDSA 5GHYA 4FSFA 5GLDA 4L9FA 2Z6DA 2H0TA 4EXOA 3O86A 5L09A 2C5WB 3AGFA 4WBGA 3E98A 4HJ6A 4IUKA 4NETA 4RQ9A 2ZJ9A 2WZXA 4PKYA 2J80A 1NZUA 5KSHA 2ZQAA 4LFUA 5GL9A 1E4DA 3BFGA 4ZJ1A 5FSRA 3ZHHA 4KUOA 3BFFA 3PXPA 4EU0A 1ONGA 1DP6A 1RGZA 2VA0A 3DTMA 5CHMA 3VP3A 3LICA 1SKOA 4BENA 3W4OA 2XH9A 3SS3A 1K54A 2PBYA 4KQOA 1NRFA 4FUWA 2Z6CA 3VE3A 4M3KA 4RX3A 3EOIA 3PHYA 3K3CA 3MZEA 4L9GA 3HLGA 3PAEA 3OZHA 4P85A 3QP2A 5HWTA 4I5SA 2Y91A 4DDSA 4GKUA 2PD8A 2ZC5B 4HHDA 2JN7A 2HDUA 1UWPX 2UV0E 4GS9B 1KOUA 5M1AA 4K91A 5CGWA 1L0GA 2OWJA 2WKIA 1XFNA 3BY8A 3HBRA 2VJWA 3LGOA 4N9LA 4WEJA 2W3FA 1KGEA 2FFFB 1FSYA 5EVIA 3QP1A 2ZOHA 4FH2A 3VSKA 1ACFA 3IXGA 3LUQA 5DF9A 4EQ1A 1MPLA 5FEFA 5F5YA 1F5MA 3OPHA 3QP8A 4OLDA 4H6JB 2A24A 2JKFA 2NUPC 5EFWA 4ARZA 1FR1A 1MY8A 1YM1A 4O01A 4QU3A 3ITBA 3N8LA 3UB6A 3BRMA 3W8KA 2O9AA 4MN6A 4S2JA 2XA7M 2VLGA 2PRFA 3D4FA 1YLYA 1W8YA 2Y2OA 2JHEA 1IKGA 4KG5A 2BASA 1SKFA 4E3IA 3HUNA 4MMNA 2A2LA 4ZTKA 3CMZA 4BD1A 5A8BA 5HAPA 1EI5A 4S2IA 1Z6FA 2P9VA 5KIZA 3G31A 1K55A 2WKHA 4U3TA 4LRYC 1DY6A 1ODVA 4I3IA 1S4RA 1H8MA 4L0LA 4B9OA 2NUTC 3CPTA 4EEPA 5HAQA 2J3TD 3PAGA 2XGNA 1V9ZA 4C6YA 1E3UD 3V67A 3MXQA 4OKPA 3KYZA 3MJQA 3RXWA 4ZAMA 4F3LB 1STZA 3KO6A 3MZDA 3S22A 1ZHHB 3C7UA 4N92A 2Y2PA 1VETB 4P0MA 3I7JA 3EEAA 2E8JA 4O0PA 4HBUA 1Q2PA 2OWHA 1AXBA 2VV6A 4K0XA 5AQBA 1V9YA 3EGDC 3G30A 3VE4A 3B47A 2P9VB 3IXHA 1K4FA 2HP9A 3DWZA 4QY6A 3UE1A 1YLWA 4GDNA 3VMAA 1G6OA 1N9OA 2C6WB 1KE0A
chains in the Genus database with same CATH topology
2VGLS 4ARZB 3F1NB 4CLCB 2GJ3A 5AJGA 5K5BA 1X0OA 4HY8A 1VB6A 4KUKA 4NEED 3UMEA 1IOUA 2KOIA 3VV4A 3PBSA 3KX0X 3E4OA 5J3WA 1TD5A 2PT7A 3NOTC 1XJ3A 1BYWA 2CMNA 5G4YA 4NXBA 3PR6A 3T4LA 2W0NA 1NRJA 3IBJA 3T4KA 4CLCC 2VV8A 4BMWA 4F3LA 3UMDA 2MJ6A 3F1OA 2GNXA 4WUJA 2W3EA 3FPWA 2K31A 3C38A 2LB5A 3BJNA 3MMHA 3MR0A 5HSQA 4WL9A 3CI6A 2KX6A 4JGPA 2EWVA 4MN7A 3KSFA 4Q0JA 2PHYA 2W1TA 5DJTA 4Q0HA 4G3WA 2ZMVA 1NLYA 3OBFA 5IS1A 5DJUA 3T50A 3LIEA 1NLZA 4GHIB 3P7NA 1OPXA 3LR3A 4BBVA 3LI9A 1P9WA 1OTIA 3MQQA 5DFXA 3GECA 4I3AA 3OLOA 4P6ZM 1JNUA 2XA7S 1D7EA 4HQAA 2QYBA 2JKRM 5F69A 1YKDA 3ZQ5A 4WN5A 1MC0A 3A0SA 2QHKA 3PBQA 5C5KA 3T4OA 2QJ7A 5J4EA 4GS9A 3R7WB 4BBTA 4I38A 2Y79A 3H9WA 3NOPC 3T4QA 3CAXA 3D3OA 3EEHA 2HJEA 2PR6A 3T4JA 3S7PA 5DKKA 2KDKA 2P7JA 3NHQA 3OC2A 4GJ4A 2O99A 4L9EA 1G28A 3FPVA 1NWZA 2G7UA 3H82B 4BJPA 1DP9A 1ZTUA 4I3JA 2K7SA 2YKHA 4PHTA 1EW0A 2L1MA 4CLCE 5MC7A 1TS7A 1IFQA 2OAP1 3S7QA 5AVFA 2A24B 3PBTA 4PKYG 2KLIA 1WA9A 3ZYTA 4GHIA 3MFXA 1S4SA 1XJ4A 4UEYA 4JGOA 4IHQA 2V0UA 2WKRA 4CQHA 2FZ0A 3JVUA 1P9RA 3H7WA 5F6AA 2M7UA 4LRXC 1F9IA 1VHMA 3SW1A 3PBOA 3ULFA 4QPRA 3FG8A 4LPZA 3VOLA 1TF1A 3E0YA 5AVEA 2QJ5A 5HDDA 3C2WA 3W2ZA 2HGVA 3C30A 5IU1A 1GSWA 5HZHA 3LYXA 1T18A 3KSGA 1MKMA 1S66L 5HPFA 2EWWA 3KSHA 3BQ8A 3UB9A 4LLOB 1Y28A 2K2NA 3F1PA 2W3HA 4HJ4A 4WF0A 5I5LA 4H6JA 2XSSA 2PD7A 2LB9A 5DKLA 3H7WB 3A0VA 4DJ2A 4ETXA 3CITA 1OT9A 5G4ZA 3ICYA 4E04A 4Z1WA 3IS2B 4HOIA 1GSVA 5DFYA 4ME4A 3HJIA 3KSIA 1UGUA 2B18A 4FOFA 3T4SA 2ZMFA 3OCLA 1F98A 1P0ZA 3CWFA 3TW8A 5TJJA 3IBRA 4HH2A 2Y8HA 2VZWA 1TS6A 4YWZA 3BY9A 3UE3A 3BWLA 2VEAA 4IUHA 3F1OB 1N9NA 4XT2A 1OTBA 4Y5FA 4G3KA 4M4XA 1YSPA 3EGXC 3H82A 3LR5A 1OTAA 1T19A 3B33A 3G6OA 2P08A 4OOMA 3RH8B 4KQDA 5HD3A 2JKRI 3LIDA 2ZBBA 3K3DA 5L8MA 4Y2FA 1OTEA 1S1ZA 4FSFA 2R78A 4L9FA 2Z6DA 4UQIM 4EXOA 5IT5A 2M1CA 4EETB 3E98A 4YNRA 4HJ3A 3T4TA 4HJ6A 4IUKA 5HDCA 2D01A 4BBUA 3NJAA 2V1AA 1S1YA 4RQ9A 1N9LA 2GX5A 3RFBA 1H3QA 4R38A 3LIAA 4PKYA 4WEKA 2J80A 5KSHA 1TS8A 2VX8A 3B42A 2PYRA 5HWWA 4R3AA 4KUOA 1P97A 2QWSA 4EEUA 2J3WA 4EUVA 3UB8A 1TS0A 3PXPA 4XT2B 4EU0A 3LI8A 1DP6A 2J3TC 2VA0A 3OCNA 4HNBA 3LICA 2V0WA 4MCWA 1LL8A 1XJ2A 3UE6A 2FH5A 3D72A 1W63Q 3R4KA 2XROA 4YOFA 4DN0A 4KQOA 3BQAA 3O5YA 3S7OA 2Z6CA 2M7VA 1DRMA 2ZOIA 3VE3A 3EOIA 3PHYA 3K3CA 4L9GA 2P04A 4P6ZS 2VGLM 3MQ0A 5HWTA 4I5SA 3F1NA 4ZRRA 4CLCA 2V9AA 2HV1A 3MF0A 3LIFA 2PD8A 2O9CA 3EWKA 1GSXA 5HWVA 3C8CA 2O0YA 4HHDA 2JN7A 1UWPX 4GS9B 1KOUA 4NXGA 1OT6A 3CUEA 1LSWA 2OWJA 5LBRA 1XFNA 2YKFA 5TBMB 3BY8A 3HCYA 4HH3A 3JVVA 2VJWA 2VV7A 2VKSA 1YSQA 4AFIA 4EESA 3E4PA 4GW9A 4WEJA 2W3FA 1OTDA 4BWIA 4OOLA 2ZOHA 2PR5A 4UQIS 4DJ3A 4PAUA 2D02A 1MZUA 4HIAA 4HP9A 1DP8A 4II7A 3LUQA 5DF9A 4EQ1A 2XRNA 4WLAA 4IJGA 5F5YA 3PBRA 4GLQA 1F5MA 4HP4A 1XJ6A 2INWA 1LSXA 3FC7A 3MQOA 4H6JB 2A24A 5FL3A 2W1RA 2NUPC 2W27A 4B93A 3PBNA 3LIBA 5EFWA 4ARZA 1OJ5A 2L0WA 4O01A 3LFVA 2HF6A 1D06A 1YAXA 4O8GA 4MDZA 1T1BA 1S67L 4R70A 3UB6A 2O9AA 2HJ9C 4MN6A 4G3VA 4GCZA 4NKPA 2XA7M 3NOUC 2VLGA 2GZAA 3HJKA 2O9BA 3EQUA 2JHEA 3EQVA 4EW7A 2V1BA 3CUEC 5F68A 1T1CA 2BASA 4MMNA 2A2LA 2B02A 5A8BA 2L4RA 4Y3IA 5CX7A 2JKTM 3GDIA 3DBAA 4JGRA 4LRZE 2DMWA 3LR4A 3TJZC 5KIZA 4EERA 3F1PB 3BW6A 4LRYC 4NXFA 3K2NA 1ODVA 4I3IA 5HD5A 2OAQ1 1S4RA 4CLCD 1H8MA 3E4QA 1W63M 1UWNX 4L0LA 4B9OA 1LT0A 2NUTC 2WKPA 5HDSA 3LR0A 2W3DA 3S7NA 2EA9A 4EEPA 4R6LA 3UB7A 2J3TD 5J7EA 1V9ZA 3IS2A 3U2AA 2H28A 3TE8A 3V67A 2IA2A 3CLOA 4HI4A 2JKTI 5HPIA 3R7WA 3MXQA 5TBMA 3KYZA 3MJQA 1T1AA 2I9VA 4F3LB 1STZA 3KO6A 3KYQA 4NXEA 4MN5A 3P01A 1ZHHB 2PDRA 2OOLA 3PYPA 3RTYA 2PYPA 3EEAA 3OOVA 4O0PA 4K08A 2OWHA 2VV6A 1V9YA 2W3GA 3EGDC 4WELA 3A0RA 4I39A 4JGQA 3VE4A 3B47A 4ETZA 4Q0IA 4DMZA 1LSVA 3TRCA 2WKQA 2W1TB 1OJGA 1G6OA 1N9OA 1XFQA 5HL6A 2QKPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N9L A;  2V0U A;  2W27 A;  2WKR A;  3F1N B;  3LIB A;  5EFW A;  5G4Y A;  3H7W A;  5F6A A;  5HD5 A;  2GJ3 A;  4R38 A;  3LIA A;  1OJ5 A;  1X0O A;  1VB6 A;  4HY8 A;  4KUK A;  4PKY A;  3UME A;  2J80 A;  4LRX C;  1F9I A;  3SW1 A;  2L0W A;  1TS8 A;  1D06 A;  2PYR A;  3KX0 X;  3ULF A;  5HWW A;  4R3A A;  1T1B A;  4KUO A;  1P97 A;  1S67 L;  2QWS A;  3E4O A;  5J3W A;  4EEU A;  3FG8 A;  1XJ3 A;  1BYW A;  2CMN A;  1TS0 A;  3NOT C;  4LPZ A;  4NXB A;  4R70 A;  4XT2 B;  3UB8 A;  3LI8 A;  1DP6 A;  4MN6 A;  2W0N A;  3VOL A;  5AVE A;  2QJ5 A;  2VV8 A;  5HDD A;  4HNB A;  4GCZ A;  3C2W A;  3LIC A;  4F3L A;  2V0W A;  3UMD A;  3NOU C;  2VLG A;  3F1O A;  4WUJ A;  1LL8 A;  5IU1 A;  1XJ2 A;  1GSW A;  3UE6 A;  5HZH A;  3HJK A;  3LYX A;  1T18 A;  3D72 A;  2JHE A;  4EW7 A;  2V1B A;  1S66 L;  5F68 A;  3MR0 A;  5HSQ A;  1T1C A;  2BAS A;  4WL9 A;  2B02 A;  2KX6 A;  3UB9 A;  4LLO B;  5A8B A;  1Y28 A;  2Z6C A;  3F1P A;  4JGP A;  1DRM A;  2ZOI A;  4HJ4 A;  3VE3 A;  2PHY A;  4WF0 A;  3GDI A;  3K3C A;  3PHY A;  5DJT A;  4L9G A;  5I5L A;  4JGR A;  4LRZ E;  4H6J A;  5IS1 A;  5DJU A;  5KIZ A;  3T50 A;  3LIE A;  5HWT A;  4I5S A;  2PD7 A;  3F1N A;  5DKL A;  4EER A;  3F1P B;  3H7W B;  3A0V A;  2V9A A;  4GHI B;  4NXF A;  3P7N A;  2HV1 A;  4LRY C;  4DJ2 A;  4BBV A;  3LI9 A;  3LIF A;  1ODV A;  2PD8 A;  1OT9 A;  1OTI A;  3MQQ A;  3ICY A;  1S4R A;  1GSX A;  3EWK A;  3GEC A;  4I3A A;  3E4Q A;  3IS2 B;  3C8C A;  4HOI A;  1UWN X;  4E04 A;  3OLO A;  5HWV A;  1GSV A;  4HHD A;  2JN7 A;  1JNU A;  1LT0 A;  4B9O A;  1UWP X;  2WKP A;  4GS9 B;  5HDS A;  1D7E A;  1KOU A;  4HQA A;  3HJI A;  2EA9 A;  1UGU A;  4EEP A;  5F69 A;  4R6L A;  3UB7 A;  3ZQ5 A;  5J7E A;  4NXG A;  1OT6 A;  1LSW A;  1V9Z A;  4WN5 A;  1F98 A;  1P0Z A;  3IS2 A;  2H28 A;  3A0S A;  2QHK A;  2OWJ A;  2QJ7 A;  2V1A A;  1XFN A;  3CWF A;  5J4E A;  4GS9 A;  3CLO A;  4HI4 A;  2YKF A;  3UB6 A;  3IBR A;  4HH2 A;  4BBT A;  4I38 A;  5TBM B;  3H9W A;  3MXQ A;  3NOP C;  5TBM A;  1TS6 A;  3CAX A;  3EEH A;  3MJQ A;  3BY8 A;  2PR6 A;  3BY9 A;  4YWZ A;  4HH3 A;  1T1A A;  2I9V A;  3BWL A;  4F3L B;  2VEA A;  5DKK A;  4NXE A;  2KDK A;  3F1O B;  2P7J A;  2VV7 A;  3NHQ A;  4MN5 A;  1N9N A;  4XT2 A;  1OTB A;  2PDR A;  2OOL A;  4EES A;  4I3I A;  4L9E A;  1G28 A;  3H82 B;  1NWZ A;  3PYP A;  2PYP A;  4M4X A;  3H82 A;  3RTY A;  3E4P A;  1DP9 A;  1OTA A;  1T19 A;  3B33 A;  3G6O A;  4GW9 A;  1OTD A;  3RH8 B;  4I3J A;  4K08 A;  4KQD A;  5HD3 A;  2ZOH A;  2K7S A;  2OWH A;  2QKP A;  2PR5 A;  2YKH A;  1EW0 A;  2L1M A;  2VV6 A;  2ZBB A;  3LID A;  4DJ3 A;  3K3D A;  1V9Y A;  1OTE A;  1S1Z A;  2D02 A;  1MZU A;  1TS7 A;  4HIA A;  4HP9 A;  2R78 A;  1DP8 A;  4L9F A;  2A24 B;  5AVF A;  2Z6D A;  3A0R A;  4I39 A;  4JGQ A;  3VE4 A;  3LUQ A;  4PKY G;  4EXO A;  4EQ1 A;  1LSV A;  2WKQ A;  4WLA A;  1WA9 A;  2M1C A;  4GHI A;  3MFX A;  4EET B;  4HJ3 A;  5F5Y A;  4HJ6 A;  5G4Z A;  4HP4 A;  1XJ4 A;  1S4S A;  5HDC A;  2D01 A;  1XJ6 A;  2INW A;  1LSX A;  3FC7 A;  3MQO A;  1OJG A;  1N9O A;  4JGO A;  4BBU A;  1XFQ A;  3NJA A;  2A24 A;  1S1Y A;  4H6J B;  2L4R A;  4RQ9 A; 
#chains in the Genus database with same CATH topology
 3BFE A;  3F1N B;  3FV7 A;  3VP4 A;  1VB6 A;  3NBL A;  3PBS A;  3Q82 A;  1K57 A;  1FSW A;  1TD5 A;  2PT7 A;  3IX3 A;  2CMN A;  3PR6 A;  1RCJ A;  2Y2L A;  1JWV A;  1NRJ A;  4CLC C;  3UY6 A;  5IHV A;  4P87 A;  4JF4 A;  4F3L A;  2MJ6 A;  3CJM A;  1WYC A;  4WZ4 A;  3Q07 A;  4WYY A;  3FPW A;  4BL3 A;  5EVI C;  5HFO A;  4DDY A;  2LB5 A;  5DF8 A;  3IF6 A;  2ZM2 A;  1Y54 A;  2XLN A;  5DJT A;  3DW0 A;  1ONH A;  5FA7 A;  4KZ3 A;  4G3W A;  3UPN A;  5DJU A;  3LIE A;  3IXB A;  1ZG4 A;  1OPX A;  4BBV A;  3LI9 A;  5DFX A;  4OQG A;  2XA7 S;  2QYB A;  3GVB A;  5HW3 A;  3G4P A;  1LL9 A;  3ZQ5 A;  4ESP A;  4QHC A;  2QHK A;  2QJ7 A;  2IWC A;  3T4Q A;  3GRJ A;  4UA6 A;  3T4J A;  2A49 A;  1XA7 A;  2P7J A;  4X69 A;  3NHQ A;  3OC2 A;  4X56 A;  4DE3 A;  3SH7 A;  3VOZ A;  1PNE A;  1PRQ A;  1NWZ A;  1HLU P;  2EX8 A;  2JKG A;  3ZNY A;  3IHB A;  2UWX A;  2VGJ A;  1IFQ A;  2A24 B;  5FQQ A;  3PBT A;  2KLI A;  3FYZ A;  5CHU A;  4JGO A;  1L0E A;  3QHY A;  2FZ0 A;  3IHA A;  3JVU A;  4OVD A;  1IEM A;  5CRF A;  2ZQD A;  2M7U A;  1F9I A;  1YT4 A;  1VHM A;  2ZMA A;  3CPT B;  4X1M A;  3IWQ A;  3FG8 A;  1S6R A;  3V3R A;  1CI8 A;  5IU1 A;  2ZC3 B;  2Y2G A;  3LYX A;  1T18 A;  3KSG A;  4KZ7 A;  3ZG7 B;  1ERQ A;  1S66 L;  3Q81 A;  4QY5 A;  2EWW A;  3UB9 A;  3L7H A;  2K2N A;  3FWL A;  3VP0 A;  3WS2 A;  4WF0 A;  1JTG A;  5HAI A;  4GN2 A;  4DRT A;  1HZO A;  3A0V A;  4ETX A;  4R23 A;  3MXR A;  3CIT A;  1CJF A;  2IWB A;  1NYY A;  1FQG A;  1ZG6 A;  1OME A;  1W7F A;  5BOH A;  1F98 A;  1P0Z A;  4DE1 A;  5TJJ A;  3IBR A;  1TS6 A;  4YWZ A;  3BWL A;  2X02 A;  3F1O B;  4JXW A;  1FCN A;  1K4E A;  5GLB A;  1KDS A;  1TEM A;  4XT2 A;  1OTB A;  3IX8 A;  3B33 A;  4LV0 A;  4OOM A;  2P08 A;  1KDW A;  3RH8 B;  5FDH A;  4KQD A;  4E6W A;  3HRE A;  5GHZ A;  1O07 A;  5L8M A;  1S1Z A;  1PI4 A;  4Q8I A;  2R78 A;  3NEC A;  1VEU B;  3GSG A;  2J9O A;  1H0M A;  1XGI A;  3NDG A;  1HVB A;  3UB5 P;  3RFB A;  4WM9 A;  2Y2J A;  1TS8 A;  2FFY A;  2Z2L B;  3IQA A;  5HWW A;  2V2F F;  4X68 A;  1LI9 A;  4Y7P A;  2J3W A;  3N8R A;  4EUV A;  2ZL1 B;  3LI8 A;  1L0F A;  3G2Z A;  2J3T C;  1PWG A;  3T1Q B;  3CZD A;  4EV4 A;  4YOF A;  4DN0 A;  3OPR A;  3BQA A;  2ZLY A;  2M7V A;  1IYS A;  2ZOI A;  1CK3 A;  2H5S A;  2Y2M A;  4P6Z S;  4PM5 A;  4BQM A;  3Q7V A;  4ZRR A;  5JYP A;  1ESU A;  3EWK A;  3GQZ A;  2PU4 A;  4IBR A;  1ES4 A;  2O0Y A;  3HLE A;  4E6X A;  3G2Y A;  1OT6 A;  1LSW A;  4ZJ3 A;  5LBR A;  4A5R A;  4X25 A;  3U4L P;  5KMW A;  5TBM B;  3JVV A;  4P6B A;  2VV7 A;  2VKS A;  4EES A;  5FEG A;  3E4P A;  4GW9 A;  4LV3 A;  1OTD A;  4BWI A;  3WS0 A;  4OLG A;  4HIA A;  4HP9 A;  2HP5 A;  3KYE A;  4KZ8 A;  2XRN A;  5EVI B;  2B5R A;  4IJG A;  1TDL A;  2X01 A;  5CTN A;  1LSX A;  3MQO A;  4GDB A;  5FL3 A;  1H8Z A;  2W27 A;  4OP8 A;  1MXO A;  3Q7Z A;  1YAX A;  4O8G A;  3N8S A;  4R70 A;  1ES2 A;  2HJ9 C;  4UHU A;  4NKP A;  5DTK A;  3SZT A;  5KSC A;  5FAS A;  2WGW B;  1AWI A;  4S2M A;  5CX7 A;  2JKT M;  4LRZ E;  4OQH A;  5EVI D;  3LR4 A;  3TJZ C;  2WGW A;  3BFD A;  3K2N A;  2WUQ A;  2OAQ 1;  4JXS A;  1UWN X;  2W3D A;  3S7N A;  3UB7 A;  2HDR A;  2DRW A;  1ES3 A;  2WZZ A;  3CLO A;  1ZC2 A;  3NIA A;  3UO9 A;  1K38 A;  2BG1 A;  3Q1F A;  4MN5 A;  3N6I A;  2WGI A;  3OOV A;  3QNB A;  3N4I A;  5JYO A;  1CEF A;  4C75 A;  4E3M A;  1XP4 A;  1U60 A;  1Y4O A;  2VGK A;  2W3G A;  4I39 A;  3LO7 A;  4Q0I A;  3TRC A;  2WKQ A;  4MBH A;  5HAR A;  5CHJ A;  1XFQ A;  4BL2 A;  2JC7 A;  2GJ3 A;  4UA9 A;  1X0O A;  4KUK A;  4NEE D;  3GTC A;  2KOI A;  3VV4 A;  2CC1 A;  4LCL A;  5U47 A;  1XJ3 A;  1BYW A;  2Q0O A;  3T4L A;  3IBJ A;  3T4K A;  2VV8 A;  3ISG A;  4LGW A;  2XD5 A;  2G2U A;  2GNX A;  4K0W A;  2W3E A;  3C5A A;  2K31 A;  3C38 A;  4OP5 A;  1G5U A;  5L07 A;  3IF5 A;  1ERO A;  4JGP A;  2EWV A;  3LCE A;  5DF7 A;  4Q0H A;  2H10 A;  3IF6 B;  5IS1 A;  4PM9 A;  3M6H A;  2BTF P;  3T50 A;  1XKZ A;  3WS4 A;  4XUZ A;  4GHI B;  4IVK A;  3LR3 A;  1OTI A;  3MQQ A;  5GLA A;  4I3A A;  1F2K A;  4KG2 A;  3BM6 A;  3QNC A;  1FIK A;  1G68 A;  5M19 A;  2OSU A;  3E2L A;  2EXB A;  3PBQ A;  3A0S A;  4GNU A;  5J4E A;  2VK3 A;  2HPB A;  4I38 A;  2Y79 A;  2PR6 A;  4Y15 A;  5M18 A;  2J9P A;  5CED A;  2O99 A;  1G28 A;  3H82 B;  2G7U A;  1FCM A;  4LEN A;  4KZA A;  4RYE A;  3S7Q A;  5AVF A;  1CQA A;  4PKY G;  5F1G A;  3ZYT A;  3A3E A;  3MFX A;  3VOY A;  4Y17 A;  1XJ4 A;  1FR6 A;  1SHV A;  3GR2 A;  1K55 C;  5CTM A;  4OQ0 A;  4CQH A;  4JKT A;  1P9R A;  4JBF A;  2Z2M B;  2BLS A;  4EQI A;  3UN7 A;  1W79 A;  4E3N A;  5F82 A;  3ULF A;  4QPR A;  2WK0 A;  3MBZ A;  4ZDX A;  1TF1 A;  1FIL A;  3E0Y A;  2QJ5 A;  5E2F A;  1GSW A;  2X71 A;  1L3L A;  3G32 A;  3T1S A;  2GDN A;  2XEP A;  3HLD A;  4HJ4 A;  3N7W A;  1BLP A;  4HES A;  1BSG A;  2XSS A;  5DKL A;  3UPO A;  1SDN A;  3AGD A;  1GCE A;  5G4Z A;  1OT9 A;  4Y0O A;  1GSV A;  3CG5 A;  4ME4 A;  4PM8 A;  1MKI A;  1UGU A;  1I5Q A;  3VFH A;  4KZ5 A;  4MBF A;  2XFS A;  3CHW P;  1YPR A;  2HZ5 A;  2Y8H A;  4EUZ A;  5F83 A;  3BY9 A;  1VET A;  5FQM A;  1K25 A;  1NXY A;  4U0T A;  3HVF A;  4MLL A;  4G3K A;  4M4X A;  4DXB A;  1OTA A;  3G6O A;  4KZB A;  3LID A;  5EOO A;  3K3D A;  5FAQ A;  4Y2F A;  3DTI A;  5DTT A;  1YLZ A;  3T1R A;  4UQI M;  1KE3 A;  4YNR A;  5HDC A;  2Y2N A;  2D01 A;  4N1H A;  4BBU A;  3NJA A;  4EBP A;  2V1A A;  1S1Y A;  4NK3 A;  1DJB A;  2GX5 A;  4X1L A;  1VEU A;  1H3Q A;  4WMC A;  1PZO A;  4DE0 A;  3UE0 A;  4DF6 A;  4Y0T A;  3B42 A;  1GHM A;  4R3A A;  1P97 A;  4X6T A;  3UDX A;  2Y2K A;  4XT2 B;  3UNW A;  2Y59 A;  1YLP A;  2DNS A;  5EM1 A;  3SS4 A;  4MCW A;  5A92 A;  4D60 A;  1LL8 A;  1MWS A;  1XJ2 A;  3UE6 A;  2FH5 A;  3D72 A;  3R4K A;  4O7D A;  3P09 A;  3IXD A;  2HDS A;  1BT5 A;  1YLJ A;  1BLC A;  2XDM A;  4E3L A;  2P04 A;  4B4Z A;  2VGL M;  3MQ0 A;  4HEF A;  4CLC A;  2V9A A;  2HV1 A;  1WE4 A;  3LIF A;  3ZNT A;  4ZBE A;  2ZL1 A;  3MS6 A;  4NXG A;  3CUE A;  2PAV P;  2G2W A;  3ZG8 B;  1IYO A;  2V20 A;  4HH3 A;  4PMA A;  1YSQ A;  1PYY A;  4EBN A;  3NY4 A;  4AFI A;  4NG2 A;  4OH0 A;  4OOL A;  5EPH A;  1YMS A;  5CER A;  4PAU A;  3GV9 A;  5GLC A;  2D02 A;  1MZU A;  4II7 A;  1YLT A;  3UDF A;  4CJN A;  3IH9 A;  1CI9 A;  3PBR A;  4GLQ A;  4HP4 A;  1XJ6 A;  3FC7 A;  1K57 C;  4B93 A;  2EFU A;  3PBN A;  1XXM A;  5FQI A;  2ZC4 B;  4OPQ A;  1OJ5 A;  2OLV A;  2ZC6 B;  4E3J A;  3V39 A;  3LFV A;  2HF6 A;  2XF3 A;  3A3F A;  4S2P A;  1VM1 A;  3IX4 A;  5EV0 A;  1JTD A;  4GCZ A;  1C3B A;  3NOU C;  3HJK A;  2O9B A;  1XA1 A;  4EW7 A;  2V1B A;  4FCF A;  3CUE C;  4LV1 A;  3VFF A;  2R9X A;  5F68 A;  1T1C A;  3V5M A;  2B02 A;  3SS5 A;  4KZ6 A;  1K56 A;  4JGR A;  4KQR A;  3AGE A;  3F1P B;  4C3Q A;  5L10 A;  1CF0 A;  2ZQ9 A;  5HD5 A;  1ERM A;  1W63 M;  1BTL A;  2P74 A;  1LT0 A;  4OOY A;  4KG6 A;  2ZQ8 A;  4R6L A;  5J7E A;  3SH9 A;  1PFL A;  3U2A A;  2H28 A;  3TE8 A;  3BYD A;  2PU2 A;  2IA2 A;  1W8Q A;  2JKT I;  2EX9 A;  5TBM A;  1TDG A;  1SCW A;  2I9V A;  4S2L A;  4BLM A;  4PM6 A;  1W5D A;  1PWC A;  2PDR A;  2OOL A;  1IYP A;  3RTY A;  2PYP A;  2ZM0 A;  3BEC A;  1KGG A;  3GMW A;  2XD1 A;  3TSG A;  1PW8 A;  4S2N C;  4WEL A;  2ZC7 A;  3HLW A;  4DE2 A;  4DMZ A;  4HBT A;  1BLH A;  3WS1 A;  2RL3 A;  4S2N A;  2W1T B;  1HD8 A;  2V8C A;  1OJG A;  2OLU A;  3DTE A;  1JWP A;  5HL6 A;  4E3K A;  2VGL S;  1JVJ A;  4EBL A;  5K5B A;  1XGJ A;  4HY8 A;  1IOU A;  2XQZ A;  5E2G A;  3KX0 X;  3T12 B;  5J3W A;  3NOT C;  2J8Y A;  2HDQ A;  2AVX A;  4BMW A;  1LLB A;  4FTX A;  3V50 A;  4WUJ A;  4WZ5 C;  3HUM A;  2WKE A;  4EWF A;  1FCO A;  4FD8 A;  3B3X A;  3CI6 A;  4MN7 A;  3KSF A;  2PHY A;  3HLC A;  5AQ9 A;  2DCF A;  1ES5 A;  1Q2Q A;  2Y55 A;  1NLY A;  1HTZ A;  3OPL A;  3P7N A;  3RJU A;  3GEC A;  4HQA A;  4H8R A;  5F69 A;  1YKD A;  1MC0 A;  5C5K A;  1O7E A;  4GS9 A;  3R7W B;  4BBT A;  3NOP C;  3D3O A;  2HJE A;  5DKK A;  2ZD8 A;  1BLS A;  4PPR A;  3C7V A;  3M2J A;  1GA0 A;  4GJ4 A;  1BUL A;  4R3J A;  1BUE A;  3ZCZ A;  4KEN B;  3FPV A;  1K56 D;  4I3J A;  3MFD A;  4PHT A;  3S4X A;  5FAT A;  4CLC E;  5FQK A;  1SDE A;  1PIO A;  5CGX A;  4S2K A;  3W4P A;  4GHI A;  2Y2H A;  3ZVT A;  1S4S A;  4UEY A;  1D1J A;  2OV5 A;  3M6B A;  4IHQ A;  3WWX A;  2V0U A;  2WKR A;  4IBX A;  3H7W A;  4LRX C;  3SW1 A;  1NY0 A;  3PBO A;  2RCX A;  2R9W A;  4LPZ A;  2V8F A;  3VOL A;  5FI2 A;  1L2S A;  3C2W A;  4JPM A;  3W2Z A;  2HGV A;  1XX2 A;  3C30 A;  5DVA A;  2Y2I A;  3IWI A;  1MKM A;  3MSH A;  3NC8 A;  3KSH A;  3BQ8 A;  4LLO B;  1Y28 A;  4RA7 A;  2W3H A;  4R4R A;  3BFC A;  3UPP A;  4H6J A;  1MBL A;  2PD7 A;  3H7W B;  4DJ2 A;  5AQA A;  1J9M A;  5FQ9 A;  3G35 A;  4R3B A;  5FAP A;  4Z1W A;  3ITA A;  2EX6 A;  1K54 C;  3HJI A;  3KSI A;  1QMF A;  4KZ4 A;  1Z09 A;  4Y13 A;  1A0K A;  3TW8 A;  4N1X A;  3FZC A;  2WYX A;  3UE3 A;  1ESI A;  4GD6 A;  1M40 A;  4LCM A;  3JYI A;  1NZO A;  1N9N A;  4GB7 A;  3A3I A;  4Y5F A;  2J7V A;  4FH4 A;  1YSP A;  3H82 A;  3LR5 A;  4R1G A;  2IWD A;  5HD3 A;  2JKR I;  1K0K A;  2B95 A;  1OTE A;  1TVF A;  3MXS A;  5IT5 A;  2M1C A;  4EET B;  3T4T A;  4HJ3 A;  5L2F A;  4U0X A;  1N9L A;  1JWZ A;  3ZG0 A;  4R38 A;  3LIA A;  4UAA A;  4WEK A;  3WS5 A;  2WAF A;  2VX8 A;  5CGS A;  2PYR A;  4S2O A;  5GHX A;  2QWS A;  4EEU A;  3UB8 A;  1TS0 A;  5FQJ A;  4B4X A;  2H0Y A;  4ZJ2 A;  3OCN A;  4HNB A;  1GHP A;  4CPK A;  2V0W A;  4GD8 A;  3VSL A;  4JXV A;  3HLB A;  1W63 Q;  3O3V A;  2XRO A;  3O5Y A;  3S7O A;  1DRM A;  3DTK A;  3F1N A;  3JPU A;  1LHY A;  3MF0 A;  2O9C A;  1GSX A;  5HWV A;  3C8C A;  2JCH A;  4JXG A;  2ZQ7 A;  3IT9 A;  1CEG A;  5CEC A;  5TR7 A;  3T1X A;  3O88 A;  3E2K A;  2YKF A;  5FI7 A;  5EVE A;  5A90 A;  3HCY A;  1ALQ A;  1K6S A;  4OON A;  1IKI A;  3LEQ A;  5CXW A;  5EUA A;  2PR5 A;  4UQI S;  4DJ3 A;  1DP8 A;  4RX2 A;  2XR0 A;  5KZH A;  5CEB A;  3WRZ A;  4WLA A;  2E8I A;  3QP6 A;  4JLF A;  2INW A;  4WZ5 A;  4JF5 A;  2W1R A;  1PW1 A;  3LIB A;  3ZDJ A;  3M2K A;  1BZA A;  4MBK A;  1NYM A;  1DJA A;  2L0W A;  5HL1 A;  2XK1 A;  4OQI A;  1D06 A;  1MWU A;  4MDZ A;  1T1B A;  3QP5 A;  1S67 L;  1IYQ A;  5D3O A;  4OPZ A;  3IH8 A;  3ZG9 B;  4G3V A;  3FKW A;  1QME A;  1WYB A;  2Y4A A;  2GZA A;  3MKE A;  1RGY A;  3EQU A;  4GZB A;  3EQV A;  5F1F A;  4YFM A;  4Y3I A;  3DWK A;  1K6R A;  3GDI A;  3DBA A;  1VQQ A;  2DMW A;  4EER A;  3BW6 A;  4NXF A;  4DXC A;  3G34 A;  4CLC D;  3E4Q A;  3HLF A;  4F94 A;  2WKP A;  5HDS A;  3LR0 A;  3LEZ A;  2EA9 A;  5A91 A;  4X53 A;  1PZP A;  3IS2 A;  4DKI A;  4GOG A;  5HPI A;  4HI4 A;  4R0Q A;  3R7W A;  1IEL A;  3ZFZ A;  1T1A A;  3NUL A;  3KYQ A;  4NXE A;  5TGF A;  1H8Y A;  5J8X A;  3P01 A;  3V3S A;  1S0W A;  3PYP A;  1KGF A;  2V1Z A;  3BLM A;  1GA9 A;  4K08 A;  3VP2 A;  5DTS A;  3WRT A;  4WMC D;  4R4S A;  3VP1 A;  1FOF A;  3A0R A;  4ETZ A;  4JGQ A;  1LSV A;  1H5X A;  4RVA A;  3L9K A;  5TFQ A;  2Y2Q A;  2QKP A;  3NCK A;  2L4R A;  4ARZ B;  2Q9N A;  4CLC B;  5AJG A;  4X55 A;  3UME A;  4D2O A;  3W4Q A;  3HUO A;  3QP4 A;  2ZQC A;  3E4O A;  5G4Y A;  4NXB A;  4Y0U A;  2W0N A;  3D9Y A;  1YMX A;  4OPY A;  3UMD A;  3F1O A;  3PTE A;  3P98 A;  4OPR A;  3SOI A;  1N4O A;  3TOI A;  3BJN A;  3MMH A;  3MR0 A;  1G6A A;  5HSQ A;  4WL9 A;  2KX6 A;  3A3J A;  5EOE A;  3RXX A;  3DAV A;  4Q0J A;  3BEB A;  2W1T A;  4IVI A;  2ZMV A;  3OBF A;  3TG9 A;  1NLZ A;  1DJC A;  1PI5 A;  1P9W A;  4E3O A;  3OLO A;  4P6Z M;  1JNU A;  1D7E A;  2PBD P;  2JKR M;  3S1Y A;  3NI9 A;  4WN5 A;  5E43 A;  3T4O A;  2Q9M A;  3IWO A;  2WGV A;  1SKO B;  4QWO A;  3H9W A;  3CAX A;  3EEH A;  1SZV A;  1LI0 A;  3S7P A;  4ID4 A;  1KVL A;  2EXA A;  2KDK A;  3SH8 A;  5G18 A;  2JE5 A;  2WAD A;  3C4P A;  5I94 A;  2I72 A;  4L9E A;  4BJP A;  1DP9 A;  1ZTU A;  2EX2 A;  2K7S A;  2YKH A;  3LY4 A;  1EW0 A;  2L1M A;  3O87 A;  1EWZ A;  1GHI A;  3NDE A;  1RP5 A;  2QZ6 A;  5MC7 A;  1TS7 A;  2ZM8 A;  2OAP 1;  4Z9Q A;  4KZ9 A;  1E25 A;  4MEZ A;  3Q7V B;  1ZKJ A;  2EFX A;  1WA9 A;  1L0D A;  4KQQ A;  4YIN A;  3BLS A;  4MNR A;  5FAO A;  3HL9 A;  5F6A A;  3MKF A;  4LV2 A;  5AVE A;  5HDD A;  3C4O A;  5FI6 A;  4PM7 A;  3ZG5 A;  4QB8 A;  5E2E A;  4B88 A;  1KE4 A;  1NJ4 A;  5HZH A;  5E2H A;  1I2W A;  3LY3 A;  4BD0 A;  4QD4 A;  2HP6 A;  5HPF A;  2ACG A;  4XUX A;  3ZGA B;  3F1P A;  4N9K A;  5EVL A;  5I5L A;  3FKV A;  1YQS A;  2XFT A;  1I2S A;  1E3U A;  1KVM A;  3UDI A;  2LB9 A;  1MWT A;  3ICY A;  4E04 A;  3IS2 B;  4HOI A;  5AQ7 A;  5DFY A;  1N9B A;  2WAE A;  3IF6 C;  1XPB A;  2B18 A;  4FOF A;  3T4S A;  2ZMF A;  3OCL A;  1M6K A;  2QPN A;  3MZF A;  5EE8 A;  3CWF A;  5EEC A;  4HH2 A;  4XXR A;  2VZW A;  4IED A;  1LL5 A;  2VEA A;  2QMI A;  4IUH A;  2A3U A;  5EM0 A;  5HX9 A;  2JBF A;  5A93 A;  3OPP A;  3ZVW A;  3EGX C;  1MWR A;  1T19 A;  4QJG A;  1J3W A;  4JF6 A;  1PWD A;  3A3D A;  2ZBB A;  4UA7 A;  5FDS A;  5GHY A;  4FSF A;  5GLD A;  4L9F A;  2Z6D A;  2H0T A;  4EXO A;  3O86 A;  5L09 A;  2C5W B;  3AGF A;  4WBG A;  3E98 A;  4HJ6 A;  4IUK A;  4NET A;  4RQ9 A;  2ZJ9 A;  2WZX A;  4PKY A;  2J80 A;  1NZU A;  5KSH A;  2ZQA A;  4LFU A;  5GL9 A;  1E4D A;  3BFG A;  4ZJ1 A;  5FSR A;  3ZHH A;  4KUO A;  3BFF A;  3PXP A;  4EU0 A;  1ONG A;  1DP6 A;  1RGZ A;  2VA0 A;  3DTM A;  5CHM A;  3VP3 A;  3LIC A;  1SKO A;  4BEN A;  3W4O A;  2XH9 A;  3SS3 A;  1K54 A;  2PBY A;  4KQO A;  1NRF A;  4FUW A;  2Z6C A;  3VE3 A;  4M3K A;  4RX3 A;  3EOI A;  3PHY A;  3K3C A;  3MZE A;  4L9G A;  3HLG A;  3PAE A;  3OZH A;  4P85 A;  3QP2 A;  5HWT A;  4I5S A;  2Y91 A;  4DDS A;  4GKU A;  2PD8 A;  2ZC5 B;  4HHD A;  2JN7 A;  2HDU A;  1UWP X;  2UV0 E;  4GS9 B;  1KOU A;  5M1A A;  4K91 A;  5CGW A;  1L0G A;  2OWJ A;  2WKI A;  1XFN A;  3BY8 A;  3HBR A;  2VJW A;  3LGO A;  4N9L A;  4WEJ A;  2W3F A;  1KGE A;  2FFF B;  1FSY A;  5EVI A;  3QP1 A;  2ZOH A;  4FH2 A;  3VSK A;  1ACF A;  3IXG A;  3LUQ A;  5DF9 A;  4EQ1 A;  1MPL A;  5FEF A;  5F5Y A;  1F5M A;  3OPH A;  3QP8 A;  4OLD A;  4H6J B;  2A24 A;  2JKF A;  2NUP C;  5EFW A;  4ARZ A;  1FR1 A;  1MY8 A;  1YM1 A;  4O01 A;  4QU3 A;  3ITB A;  3N8L A;  3UB6 A;  3BRM A;  3W8K A;  2O9A A;  4MN6 A;  4S2J A;  2XA7 M;  2VLG A;  2PRF A;  3D4F A;  1YLY A;  1W8Y A;  2Y2O A;  2JHE A;  1IKG A;  4KG5 A;  2BAS A;  1SKF A;  4E3I A;  3HUN A;  4MMN A;  2A2L A;  4ZTK A;  3CMZ A;  4BD1 A;  5A8B A;  5HAP A;  1EI5 A;  4S2I A;  1Z6F A;  2P9V A;  5KIZ A;  3G31 A;  1K55 A;  2WKH A;  4U3T A;  4LRY C;  1DY6 A;  1ODV A;  4I3I A;  1S4R A;  1H8M A;  4L0L A;  4B9O A;  2NUT C;  3CPT A;  4EEP A;  5HAQ A;  2J3T D;  3PAG A;  2XGN A;  1V9Z A;  4C6Y A;  1E3U D;  3V67 A;  3MXQ A;  4OKP A;  3KYZ A;  3MJQ A;  3RXW A;  4ZAM A;  4F3L B;  1STZ A;  3KO6 A;  3MZD A;  3S22 A;  1ZHH B;  3C7U A;  4N92 A;  2Y2P A;  1VET B;  4P0M A;  3I7J A;  3EEA A;  2E8J A;  4O0P A;  4HBU A;  1Q2P A;  2OWH A;  1AXB A;  2VV6 A;  4K0X A;  5AQB A;  1V9Y A;  3EGD C;  3G30 A;  3VE4 A;  3B47 A;  2P9V B;  3IXH A;  1K4F A;  2HP9 A;  3DWZ A;  4QY6 A;  3UE1 A;  1YLW A;  4GDN A;  3VMA A;  1G6O A;  1N9O A;  2C6W B;  1KE0 A; 
#chains in the Genus database with same CATH homology
 2VGL S;  4ARZ B;  3F1N B;  4CLC B;  2GJ3 A;  5AJG A;  5K5B A;  1X0O A;  4HY8 A;  1VB6 A;  4KUK A;  4NEE D;  3UME A;  1IOU A;  2KOI A;  3VV4 A;  3PBS A;  3KX0 X;  3E4O A;  5J3W A;  1TD5 A;  2PT7 A;  3NOT C;  1XJ3 A;  1BYW A;  2CMN A;  5G4Y A;  4NXB A;  3PR6 A;  3T4L A;  2W0N A;  1NRJ A;  3IBJ A;  3T4K A;  4CLC C;  2VV8 A;  4BMW A;  4F3L A;  3UMD A;  2MJ6 A;  3F1O A;  2GNX A;  4WUJ A;  2W3E A;  3FPW A;  2K31 A;  3C38 A;  2LB5 A;  3BJN A;  3MMH A;  3MR0 A;  5HSQ A;  4WL9 A;  3CI6 A;  2KX6 A;  4JGP A;  2EWV A;  4MN7 A;  3KSF A;  4Q0J A;  2PHY A;  2W1T A;  5DJT A;  4Q0H A;  4G3W A;  2ZMV A;  1NLY A;  3OBF A;  5IS1 A;  5DJU A;  3T50 A;  3LIE A;  1NLZ A;  4GHI B;  3P7N A;  1OPX A;  3LR3 A;  4BBV A;  3LI9 A;  1P9W A;  1OTI A;  3MQQ A;  5DFX A;  3GEC A;  4I3A A;  3OLO A;  4P6Z M;  1JNU A;  2XA7 S;  1D7E A;  4HQA A;  2QYB A;  2JKR M;  5F69 A;  1YKD A;  3ZQ5 A;  4WN5 A;  1MC0 A;  3A0S A;  2QHK A;  3PBQ A;  5C5K A;  3T4O A;  2QJ7 A;  5J4E A;  4GS9 A;  3R7W B;  4BBT A;  4I38 A;  2Y79 A;  3H9W A;  3NOP C;  3T4Q A;  3CAX A;  3D3O A;  3EEH A;  2HJE A;  2PR6 A;  3T4J A;  3S7P A;  5DKK A;  2KDK A;  2P7J A;  3NHQ A;  3OC2 A;  4GJ4 A;  2O99 A;  4L9E A;  1G28 A;  3FPV A;  1NWZ A;  2G7U A;  3H82 B;  4BJP A;  1DP9 A;  1ZTU A;  4I3J A;  2K7S A;  2YKH A;  4PHT A;  1EW0 A;  2L1M A;  4CLC E;  5MC7 A;  1TS7 A;  1IFQ A;  2OAP 1;  3S7Q A;  5AVF A;  2A24 B;  3PBT A;  4PKY G;  2KLI A;  1WA9 A;  3ZYT A;  4GHI A;  3MFX A;  1S4S A;  1XJ4 A;  4UEY A;  4JGO A;  4IHQ A;  2V0U A;  2WKR A;  4CQH A;  2FZ0 A;  3JVU A;  1P9R A;  3H7W A;  5F6A A;  2M7U A;  4LRX C;  1F9I A;  1VHM A;  3SW1 A;  3PBO A;  3ULF A;  4QPR A;  3FG8 A;  4LPZ A;  3VOL A;  1TF1 A;  3E0Y A;  5AVE A;  2QJ5 A;  5HDD A;  3C2W A;  3W2Z A;  2HGV A;  3C30 A;  5IU1 A;  1GSW A;  5HZH A;  3LYX A;  1T18 A;  3KSG A;  1MKM A;  1S66 L;  5HPF A;  2EWW A;  3KSH A;  3BQ8 A;  3UB9 A;  4LLO B;  1Y28 A;  2K2N A;  3F1P A;  2W3H A;  4HJ4 A;  4WF0 A;  5I5L A;  4H6J A;  2XSS A;  2PD7 A;  2LB9 A;  5DKL A;  3H7W B;  3A0V A;  4DJ2 A;  4ETX A;  3CIT A;  1OT9 A;  5G4Z A;  3ICY A;  4E04 A;  4Z1W A;  3IS2 B;  4HOI A;  1GSV A;  5DFY A;  4ME4 A;  3HJI A;  3KSI A;  1UGU A;  2B18 A;  4FOF A;  3T4S A;  2ZMF A;  3OCL A;  1F98 A;  1P0Z A;  3CWF A;  3TW8 A;  5TJJ A;  3IBR A;  4HH2 A;  2Y8H A;  2VZW A;  1TS6 A;  4YWZ A;  3BY9 A;  3UE3 A;  3BWL A;  2VEA A;  4IUH A;  3F1O B;  1N9N A;  4XT2 A;  1OTB A;  4Y5F A;  4G3K A;  4M4X A;  1YSP A;  3EGX C;  3H82 A;  3LR5 A;  1OTA A;  1T19 A;  3B33 A;  3G6O A;  2P08 A;  4OOM A;  3RH8 B;  4KQD A;  5HD3 A;  2JKR I;  3LID A;  2ZBB A;  3K3D A;  5L8M A;  4Y2F A;  1OTE A;  1S1Z A;  4FSF A;  2R78 A;  4L9F A;  2Z6D A;  4UQI M;  4EXO A;  5IT5 A;  2M1C A;  4EET B;  3E98 A;  4YNR A;  4HJ3 A;  3T4T A;  4HJ6 A;  4IUK A;  5HDC A;  2D01 A;  4BBU A;  3NJA A;  2V1A A;  1S1Y A;  4RQ9 A;  1N9L A;  2GX5 A;  3RFB A;  1H3Q A;  4R38 A;  3LIA A;  4PKY A;  4WEK A;  2J80 A;  5KSH A;  1TS8 A;  2VX8 A;  3B42 A;  2PYR A;  5HWW A;  4R3A A;  4KUO A;  1P97 A;  2QWS A;  4EEU A;  2J3W A;  4EUV A;  3UB8 A;  1TS0 A;  3PXP A;  4XT2 B;  4EU0 A;  3LI8 A;  1DP6 A;  2J3T C;  2VA0 A;  3OCN A;  4HNB A;  3LIC A;  2V0W A;  4MCW A;  1LL8 A;  1XJ2 A;  3UE6 A;  2FH5 A;  3D72 A;  1W63 Q;  3R4K A;  2XRO A;  4YOF A;  4DN0 A;  4KQO A;  3BQA A;  3O5Y A;  3S7O A;  2Z6C A;  2M7V A;  1DRM A;  2ZOI A;  3VE3 A;  3EOI A;  3PHY A;  3K3C A;  4L9G A;  2P04 A;  4P6Z S;  2VGL M;  3MQ0 A;  5HWT A;  4I5S A;  3F1N A;  4ZRR A;  4CLC A;  2V9A A;  2HV1 A;  3MF0 A;  3LIF A;  2PD8 A;  2O9C A;  3EWK A;  1GSX A;  5HWV A;  3C8C A;  2O0Y A;  4HHD A;  2JN7 A;  1UWP X;  4GS9 B;  1KOU A;  4NXG A;  1OT6 A;  3CUE A;  1LSW A;  2OWJ A;  5LBR A;  1XFN A;  2YKF A;  5TBM B;  3BY8 A;  3HCY A;  4HH3 A;  3JVV A;  2VJW A;  2VV7 A;  2VKS A;  1YSQ A;  4AFI A;  4EES A;  3E4P A;  4GW9 A;  4WEJ A;  2W3F A;  1OTD A;  4BWI A;  4OOL A;  2ZOH A;  2PR5 A;  4UQI S;  4DJ3 A;  4PAU A;  2D02 A;  1MZU A;  4HIA A;  4HP9 A;  1DP8 A;  4II7 A;  3LUQ A;  5DF9 A;  4EQ1 A;  2XRN A;  4WLA A;  4IJG A;  5F5Y A;  3PBR A;  4GLQ A;  1F5M A;  4HP4 A;  1XJ6 A;  2INW A;  1LSX A;  3FC7 A;  3MQO A;  4H6J B;  2A24 A;  5FL3 A;  2W1R A;  2NUP C;  2W27 A;  4B93 A;  3PBN A;  3LIB A;  5EFW A;  4ARZ A;  1OJ5 A;  2L0W A;  4O01 A;  3LFV A;  2HF6 A;  1D06 A;  1YAX A;  4O8G A;  4MDZ A;  1T1B A;  1S67 L;  4R70 A;  3UB6 A;  2O9A A;  2HJ9 C;  4MN6 A;  4G3V A;  4GCZ A;  4NKP A;  2XA7 M;  3NOU C;  2VLG A;  2GZA A;  3HJK A;  2O9B A;  3EQU A;  2JHE A;  3EQV A;  4EW7 A;  2V1B A;  3CUE C;  5F68 A;  1T1C A;  2BAS A;  4MMN A;  2A2L A;  2B02 A;  5A8B A;  2L4R A;  4Y3I A;  5CX7 A;  2JKT M;  3GDI A;  3DBA A;  4JGR A;  4LRZ E;  2DMW A;  3LR4 A;  3TJZ C;  5KIZ A;  4EER A;  3F1P B;  3BW6 A;  4LRY C;  4NXF A;  3K2N A;  1ODV A;  4I3I A;  5HD5 A;  2OAQ 1;  1S4R A;  4CLC D;  1H8M A;  3E4Q A;  1W63 M;  1UWN X;  4L0L A;  4B9O A;  1LT0 A;  2NUT C;  2WKP A;  5HDS A;  3LR0 A;  2W3D A;  3S7N A;  2EA9 A;  4EEP A;  4R6L A;  3UB7 A;  2J3T D;  5J7E A;  1V9Z A;  3IS2 A;  3U2A A;  2H28 A;  3TE8 A;  3V67 A;  2IA2 A;  3CLO A;  4HI4 A;  2JKT I;  5HPI A;  3R7W A;  3MXQ A;  5TBM A;  3KYZ A;  3MJQ A;  1T1A A;  2I9V A;  4F3L B;  1STZ A;  3KO6 A;  3KYQ A;  4NXE A;  4MN5 A;  3P01 A;  1ZHH B;  2PDR A;  2OOL A;  3PYP A;  3RTY A;  2PYP A;  3EEA A;  3OOV A;  4O0P A;  4K08 A;  2OWH A;  2VV6 A;  1V9Y A;  2W3G A;  3EGD C;  4WEL A;  3A0R A;  4I39 A;  4JGQ A;  3VE4 A;  3B47 A;  4ETZ A;  4Q0I A;  4DMZ A;  1LSV A;  3TRC A;  2WKQ A;  2W1T B;  1OJG A;  1G6O A;  1N9O A;  1XFQ A;  5HL6 A;  2QKP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...