2VV6A

Bjfixlh in ferric form
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
106
structure length
106
Chain Sequence
b'IPDAMIVIDGHGIIQLFSTAAERLFGWSELEAIGQNVNILMPEPDRSRHDSYISRYRTTSDPHIIGIGRIVTGKRRDGTTFPMHLSIGEMQSGGEPYFTGFVRDLT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords SENSOR PROTEIN FIXL
publication title Changes in Quaternary Structure in the Signaling Mechanisms of Pas Domains.
pubmed doi rcsb
source organism Bradyrhizobium japonicum
molecule tags Signaling protein, transferase
total genus 26
structure length 106
sequence length 106
chains with identical sequence B, C, D
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2008-06-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2vv6A00
1XFNA 2QWSA 4YWZA 2WKQA 5HZHA 4EXOA 4H6JA 2INWA 5HSQA 2A24A 2KDKA 4F3LB 3F1NB 1ODVA 3VE3A 2VLGA 1DP9A 3GECA 2QJ5A 4HHDA 1LL8A 4NXBA 3UB9A 1GSWA 1LSWA 2R78A 3CLOA 2VEAA 1VB6A 3MXQA 1OTDA 1EW0A 1LSXA 3H82B 1S4SA 1OT6A 1KOUA 3C8CA 4HJ3A 3H9WA 1D7EA 4PKYA 5HD3A 2Z6CA 5EFWA 4PKYG 3C2WA 3NHQA 1DRMA 4DJ2A 1V9ZA 1X0OA 4HH3A 2JN7A 3NOTC 4MN6A 2CMNA 1UGUA 2GJ3A 4XT2B 3VOLA 3ZQ5A 5A8BA 5IS1A 3UB7A 3H82A 4EQ1A 3UE6A 1OTAA 3SW1A 1XJ3A 5HDDA 1JNUA 5J7EA 2J80A 2K7SA 3LIBA 2QJ7A 3NOUC 3MFXA 4M4XA 1GSVA 1T18A 3PYPA 4WF0A 3CWFA 1T19A 1OTEA 1MZUA 1DP6A 2OWJA 1P97A 1BYWA 3E4PA 2V1BA 1XJ4A 2KX6A 4EESA 3H7WA 3LIEA 3CAXA 4GHIB 1LSVA 2B02A 2PR6A 3ICYA 1UWNX 2PD8A 5TBMB 3IBRA 3LI9A 5F68A 2YKHA 2QHKA 5HWTA 1D06A 2QKPA 4HNBA 4NXGA 3D72A 1T1AA 4HJ4A 1TS0A 2HV1A 4GCZA 5F5YA 2L1MA 2ZOHA 1LT0A 4NXFA 4EETB 5DJTA 4LRXC 4I38A 3FC7A 4HP9A 3E4OA 3KX0X 3LIFA 1P0ZA 4GHIA 2L4RA 1T1CA 1WA9A 5DKKA 5TBMA 4R3AA 4WN5A 1S1ZA 1GSXA 4F3LA 3F1NA 5F6AA 3MR0A 5KIZA 5G4YA 2I9VA 4LLOB 1N9OA 4LPZA 4HH2A 4I3IA 2V1AA 2JHEA 3MJQA 3UB6A 1T1BA 3NOPC 4R70A 3UMEA 4HP4A 4EERA 2ZBBA 4EEPA 2M1CA 3NJAA 2PDRA 4BBVA 2D01A 2PYRA 3K3CA 2P7JA 3E4QA 5DJUA 2OOLA 4WL9A 4EW7A 1Y28A 2D02A 3A0VA 3RTYA 3LIAA 3B33A 3EWKA 3K3DA 2VV8A 4WUJA 4I39A 2PHYA 5HWWA 3EEHA 4KQDA 3VE4A 2PD7A 4XT2A 4L9GA 5HDSA 4HIAA 3F1PB 4HOIA 3LYXA 4K08A 4KUOA 1NWZA 3IS2B 4R38A 1OTBA 3GDIA 3MQQA 3RH8B 2W27A 5AVEA 1OTIA 5AVFA 1S66L 3G6OA 1UWPX 2WKRA 4HJ6A 4BBUA 3LIDA 3BY9A 5F69A 4NXEA 3F1OB 4LRYC 3MQOA 4JGQA 2V0WA 4BBTA 5G4ZA 4GW9A 4KUKA 5HDCA 5HWVA 1XJ6A 3F1PA 3A0SA 4R6LA 1G28A 1S1YA 4L9FA 3BY8A 3IS2A 1F9IA 2W0NA 1TS7A 4E04A 3BWLA 3HJIA 1XJ2A 2YKFA 2V9AA 4GS9B 4LRZE 4MN5A 4HQAA 3F1OA 5DKLA 2VV7A 5IU1A 4DJ3A 4B9OA 1S4RA 4WLAA 3A0RA 3FG8A 4JGRA 3PHYA 2PYPA 4I3AA 1N9LA 2H28A 4HI4A 4JGOA 3LI8A 2VV6A 3UMDA 1OJGA 5J4EA 4RQ9A 3H7WB 2Z6DA 3UB8A 3P7NA 3OLOA 4L9EA 1TS8A 4GS9A 4H6JB 1XFQA 3LUQA 2A24B 1N9NA 2PR5A 5I5LA 2WKPA 4I3JA 2EA9A 4EEUA 1DP8A 5J3WA 5HD5A 3HJKA 4HY8A 2L0WA 2ZOIA 1OT9A 1OJ5A 1TS6A 3LICA 4I5SA 2V0UA 1V9YA 2BASA 1F98A 3ULFA 4JGPA 2OWHA 1S67L 3T50A
chains in the Genus database with same CATH superfamily
1TDLA 3IQAA 1HTZA 1L2SA 2OV5A 5G18A 3PAGA 4DE2A 3IT9A 1GCEA 4H6JA 1K0KA 2INWA 5HSQA 2W1RA 1OPXA 1FOFA 2Z2LB 1G68A 4IEDA 4QU3A 2VLGA 3GMWA 3MFDA 4E6WA 4CLCA 4B4ZA 3CI6A 3MSHA 3KSGA 3VP0A 4PM8A 2R78A 2WAEA 3G4PA 2HDUA 4B88A 4CQHA 2J9PA 4UQIM 3QP4A 2MJ6A 1G5UA 1OTDA 4CLCD 1KGFA 4P6ZM 4OOYA 4Y17A 4QY5A 4DXBA 3UB5P 4IUKA 3EGXC 3T4OA 3OC2A 1JVJA 2WADA 4O0PA 1V9ZA 4HH3A 1KE4A 4MN6A 3PAEA 2GDNA 5IT5A 2GJ3A 2PAVP 4EBPA 4DE3A 4N1HA 4ETZA 4BD1A 5CGWA 3CJMA 2Y2NA 3UE6A 3R7WB 1K56D 2H0YA 3C7UA 4Y15A 1H8YA 1XJ3A 5CXWA 1YLTA 1SZVA 2K7SA 3LIBA 1XXMA 2FFYA 1K55A 5FASA 4UA7A 1NZUA 3G32A 1NXYA 3MKFA 1T19A 1MZUA 1LL9A 3V3RA 4NK3A 2V1BA 3NIAA 4BLMA 1XA1A 4KZ9A 1SKOA 5EE8A 5KZHA 2XROA 3FWLA 1LSVA 2V1ZA 3IBRA 3IWOA 3VFFA 2JBFA 3TOIA 1FR1A 4LFUA 3LI9A 5F83A 2X02A 3SH7A 1VQQA 5KMWA 3D72A 1H8ZA 1YQSA 4HJ4A 1P9WA 1LT0A 4NXFA 4EETB 4OQHA 5EM1A 5L10A 4FOFA 4HESA 4E3IA 2Y2PA 3G2ZA 2K2NA 2L4RA 3WS1A 1WA9A 4R3AA 2O0YA 3A3EA 3ITAA 3IH8A 4O7DA 3IX8A 2WUQA 3BYDA 3QNCA 4QD4A 1CQAA 4WN5A 3B47A 4OP5A 1GSXA 1QMEA 1Y4OA 1TDGA 4AFIA 3KSHA 2B5RA 1NYMA 2HJEA 3MJQA 2EX6A 2XGNA 1T1BA 4HP4A 4DN0A 2XFSA 1P9RA 1PZPA 1K38A 3ZYTA 3IHAA 3IXBA 3V5MA 2PDRA 4HEFA 3N6IA 2EX2A 4BBVA 3OOVA 5FA7A 2PYRA 3OCLA 5DJUA 5FI2A 3HLWA 3UNWA 4OP8A 3MXRA 5EECA 3LIAA 4WUJA 4I39A 1C3BA 2ZMVA 3IXDA 3VE4A 2HP6A 4EV4A 3M6HA 4WM9A 1HVBA 4WYYA 4L9GA 1CK3A 5EVIB 4GZBA 4E3MA 3F1PB 4KZ3A 3SS4A 3UN7A 1W63Q 4K08A 4NEED 2P9VB 3EQUA 2XH9A 2PBDP 1STZA 2JC7A 3CITA 5AVEA 5GLCA 5AVFA 1RP5A 4DE0A 1Z09A 2Q9NA 4ZJ1A 4HJ6A 3JPUA 3T12B 4BBUA 3LIDA 3V39A 4N9LA 4Y3IA 3F1OB 4M3KA 3QNBA 4PM5A 1IYQA 3MQOA 5EVIC 1KGEA 2WKHA 4LENA 3RXWA 2VK3A 4MN7A 3G30A 4L0LA 2IA2A 5CEBA 1FCNA 3A0SA 3DBAA 3ZFZA 4R6LA 2ZC5B 5HX9A 3UDFA 4ARZA 4L9FA 3BY8A 3IS2A 1YMSA 3WS2A 3BWLA 5EPHA 2JCHA 2P04A 1XJ2A 4OOLA 2A2LA 5HL1A 3LY3A 5EOOA 1SDEA 1I2WA 1EWZA 4LRZE 3FPVA 1ZG4A 3T1XA 4MBFA 5EVEA 4KZ7A 1Q2PA 5D3OA 1MWRA 4WLAA 4JGRA 4EQIA 3CUEA 5FI6A 5DFXA 4D2OA 3DTMA 1PW1A 4S2JA 3CG5A 2EFUA 1OJGA 5J4EA 3IX3A 1EI5A 3IF6B 4A5RA 3BECA 3P7NA 4E3KA 1O7EA 4L9EA 5FQIA 4UHUA 2KOIA 1TS8A 2ACGA 1AWIA 5I94A 3CPTB 2A24B 1A0KA 1MKIA 4EEUA 2J3TD 2R9XA 4ZTKA 1S6RA 2L0WA 3ZGAB 4X1LA 1OJ5A 4YNRA 3MS6A 3LICA 1HLUP 5DTKA 3NULA 2Q0OA 1F98A 4CLCE 3O3VA 1FCMA 1E25A 2QYBA 1J3WA 3O87A 1FQGA 3B42A 3HUNA 3U4LP 4YWZA 5HZHA 1MWSA 3RXXA 2O9BA 4OOMA 2VGLM 4F3LB 4EU0A 3VE3A 3AGEA 4Y13A 1PFLA 1DP9A 2Z2MB 4HHDA 1LL8A 5FQMA 3UB9A 2VGJA 1GSWA 2WGIA 1LSWA 2Y2KA 3T1RA 3ZDJA 4KZ4A 2JKGA 2VEAA 2W1TB 4S2IA 3S7NA 2GNXA 3G31A 3H82B 4JXWA 2WGVA 4HJ3A 2NUPC 3QHYA 2ZC6B 3QP6A 4DE1A 3W4PA 3C4OA 2WAFA 3QP8A 5FAQA 3C2WA 2JKRI 4IUHA 2XEPA 3FZCA 3A3FA 2QZ6A 5CRFA 4MBHA 2I72A 5FQ9A 2WYXA 1UGUA 1MXOA 4Y0OA 3ZQ5A 3P09A 4RYEA 4NG2A 3MF0A 1MY8A 3WS0A 1K54C 3TJZC 4EQ1A 5DTTA 2O9CA 1O07A 1PWGA 3FPWA 3DAVA 4P0MA 2J80A 2VGKA 3DWKA 5F82A 2UV0E 3FKWA 3C38A 3NOUC 4XUXA 4RX2A 1GSVA 3GSGA 3IXGA 2W3GA 5GLAA 5L8MA 2PT7A 4QPRA 4MDZA 3BFFA 3RJUA 1DP6A 1FR6A 2ZMFA 3BW6A 3P98A 3ZHHA 3ZVTA 1NLZA 4IHQA 5FSRA 2R9WA 4WBGA 3JVVA 4ME4A 1NZOA 5TBMB 1UWNX 1IYPA 1ONHA 5AQBA 1E4DA 1ES3A 4WZ5C 3R7WA 5F68A 2EWVA 4UAAA 4KQRA 4LV0A 5DF9A 4OVDA 3KSIA 2QKPA 4HBTA 4HNBA 3TW8A 3LGOA 4KZ8A 1GA9A 1TS0A 2HV1A 4GKUA 5F5YA 3S4XA 4YFMA 2L1MA 2ZOHA 3WS4A 4JPMA 5L07A 3U2AA 5U47A 1NY0A 3W2ZA 1MPLA 3C5AA 3OPRA 1JWVA 4LRXC 5EM0A 4I38A 3FC7A 3W4OA 4OPQA 3HLGA 4LCMA 1ERQA 4KG2A 3PTEA 1YKDA 3E4OA 4Y2FA 3VV4A 1CEFA 4WMCD 5CX7A 1MKMA 4B4XA 5EVLA 1S1ZA 2C6WB 3F1NA 4FD8A 4D60A 3MR0A 3K2NA 5DTSA 5G4YA 2I9VA 1VHMA 4LLOB 1N9OA 4E3JA 5TFQA 4KZBA 1K56A 2Y2QA 3UMEA 4EERA 4OQGA 2ZBBA 3V50A 3BLSA 2XA7S 5FQJA 4EEPA 5KSCA 3Q7VB 4S2NC 1BUEA 5CTNA 2JE5A 5M18A 1D1JA 4PAUA 4ETXA 5FL3A 1N9BA 4F94A 2D01A 4OONA 3IH9A 1MWTA 3SH8A 4WEKA 2OOLA 4WL9A 4S2PA 4EW7A 3O88A 1ZG6A 3A0VA 5MC7A 1L3LA 1ZHHB 3I7JA 5DF8A 3S7OA 3HLEA 2VV8A 5E2FA 2PHYA 4K0WA 3EEHA 4LCLA 4KQDA 5FQQA 1DY6A 3VSLA 2PD7A 2Y2OA 4GDNA 2J9OA 4XT2A 4LV1A 5HDSA 4JF5A 4BL2A 4HIAA 1W5DA 4HOIA 1XA7A 3SS3A 1Y54A 3ISGA 4WELA 1OTBA 3GDIA 3MZEA 3KO6A 1K6SA 4WZ4A 4KQOA 2Y8HA 3T4JA 1IYOA 3BQ8A 3NDGA 3NY4A 4XXRA 1OTIA 2V8FA 4E3OA 2VZWA 4DRTA 4KZAA 1UWPX 4R3BA 1PIOA 3BY9A 3FYZA 2ZLYA 2EX9A 1ZKJA 4NXEA 5HL6A 3IWIA 4DKIA 3TE8A 3SS5A 1KE0A 1BTLA 5E43A 1YLYA 3VMAA 4CLCC 2H10A 3M6BA 5FI7A 4KUKA 2O99A 2IWCA 2XDMA 3BFDA 5CHMA 3N7WA 5HDCA 3F1PA 4OQIA 2PRFA 5F1FA 2Y2IA 4X56A 1H0MA 4JXSA 2W0NA 1TS7A 4X68A 2W3FA 3HJIA 5EVID 1RCJA 2Y2JA 3AGFA 1OMEA 1K4EA 4BENA 2PU4A 4MN5A 4DMZA 5E2HA 1TD5A 3T4SA 3F1OA 5DKLA 2VV7A 3O86A 5IU1A 2OSUA 2ZQAA 4DJ3A 5CEDA 4G3KA 1S4RA 3A0RA 3FG8A 4BWIA 1W8QA 4LGWA 2PYPA 2H5SA 1H8MA 4ZAMA 2Y55A 2ZM2A 1GHPA 2WGWB 2BTFP 3T1SA 1N9LA 2H28A 1KDWA 3TRCA 3VP3A 4EBNA 4S2LA 2VV6A 4BJPA 1M6KA 3N8LA 5A93A 1Z6FA 3VP1A 3NBLA 4MNRA 3UB8A 5E2GA 3LR0A 3DW0A 3OLOA 1IKIA 2ZC4B 1L0GA 1YLJA 4UA6A 4NETA 5HAIA 3HLDA 2X71A 1XFQA 5FAOA 1VEUA 2B18A 3LUQA 5BOHA 1N9NA 1K55C 3N8SA 2EA9A 3CZDA 4BD0A 5FDSA 1E3UA 3A3JA 3L9KA 3IHBA 3S7PA 1HD8A 4KQQA 3CMZA 2G7UA 3ZVWA 5FEGA 1CEGA 4OLGA 3MMHA 3UDXA 3NECA 3S22A 4ZJ3A 4PMAA 2BASA 2WKIA 4GN2A 1E3UD 3Q81A 1XPBA 3IF6A 5L2FA 1YM1A 5A90A 4RX3A 4N1XA 2ZL1B 2G2WA 2WKQA 3FV7A 4GNUA 1AXBA 4OLDA 3CHWP 4IVIA 2A24A 2KDKA 4QY6A 3NCKA 1G6AA 3HUOA 2ZC7A 2M7UA 2QJ5A 4NXBA 3ZG7B 3BM6A 3BLMA 4KENB 3CLOA 1K57A 4JXVA 1ES4A 3DTIA 2B95A 3OBFA 3HLCA 1EW0A 1KOUA 4Y7PA 3C8CA 1SKFA 2XRNA 3H9WA 3HL9A 4MEZA 5L09A 2EXAA 3SOIA 2HZ5A 5HD3A 5EFWA 2Y79A 4PKYG 3UY6A 1DJBA 1L0DA 3NHQA 3W8KA 5TGFA 1DRMA 1BLSA 3AGDA 3BJNA 1TF1A 3VP4A 1VETB 3NOTC 3JVUA 2CMNA 4JKTA 1J9MA 3O5YA 1N4OA 2ZMAA 1IELA 3VOLA 3OPLA 4PPRA 3VOYA 4C3QA 5FATA 4LV3A 4FTXA 5AQAA 2DRWA 3H82A 1F5MA 5C5KA 1OTAA 2A49A 3IX4A 3GRJA 1MC0A 1JNUA 2K31A 2JKTI 3ZNYA 2QJ7A 4P87A 1YMXA 3A3IA 4M4XA 1T18A 4Q8IA 3IXHA 1YLWA 5HAPA 4WF0A 2EFXA 1ERMA 2C5WB 1XGJA 4GDBA 2V20A 3TSGA 3T4TA 2E8IA 2OWJA 1P97A 5CTMA 5HARA 3HLBA 3E4PA 5M19A 1BLPA 1IOUA 5AQ9A 2ZQ8A 5HAQA 3H7WA 3LIEA 4GHIB 2E8JA 4OPRA 1MWUA 2B02A 3ICYA 3LEQA 1ACFA 4MBKA 1NRJA 4ARZB 1SDNA 1FIKA 5HWTA 2ZM0A 4NXGA 3KYZA 5DVAA 3NC8A 2WZXA 4OPZA 3V67A 5GL9A 2WZZA 5A91A 2IWBA 5E2EA 1FCOA 1JWPA 4BMWA 3A3DA 4HP9A 1TVFA 5KSHA 1H5XA 3KX0X 3UPNA 2HJ9C 5EV0A 2A3UA 1P0ZA 3IWQA 1M40A 5DKKA 5EOEA 5TBMA 3E0YA 3MZFA 5GHYA 1XKZA 1QMFA 2VA0A 1DJAA 2LB9A 2W3EA 4PM6A 1ONGA 5F6AA 2PBYA 4G3VA 2J7VA 4EWFA 3Q82A 1NLYA 4LPZA 1RGYA 2ZD8A 2V1AA 3GR2A 3BRMA 3CUEC 2JHEA 4Q0HA 1CI8A 4ID4A 4RA7A 5DF7A 3ZG0A 1YLZA 3OZHA 2M1CA 1JTDA 4FH2A 4P6BA 4PM7A 3LFVA 2FH5A 3UE1A 3UDIA 4OPYA 3D3OA 2Y59A 1LLBA 3K3CA 2P7JA 3RFBA 2W3HA 4ZJ2A 4N92A 1I2SA 5TR7A 3NI9A 3PBTA 2HP5A 1LL5A 5F1GA 3B33A 5K5BA 5HWWA 3HBRA 1S0WA 2XQZA 3GVBA 2DMWA 4Y5FA 3HLFA 4KZ5A 4KUOA 1NWZA 3N4IA 5TJJA 3RH8B 4K0XA 1W7FA 4IJGA 3EQVA 1EROA 1L0FA 2XA7M 1DJCA 4OH0A 3G6OA 3ZNTA 3GQZA 2QPNA 2LB5A 4FUWA 5F69A 4WEJA 1PRQA 2J8YA 4X6TA 1PYYA 4JGQA 4BBTA 4WMCA 2RL3A 2ZQ7A 5G4ZA 3ITBA 2EX8A 2PU2A 1SCWA 4GOGA 3MZDA 1G28A 5EUAA 1S1YA 1W63M 3HREA 4X25A 5CHJA 4E3LA 5FEFA 3HCYA 3W4QA 4E04A 2EWWA 2V2FF 3S7QA 4U0XA 2V9AA 4GS9B 4GJ4A 1K25A 2JKRM 4EUVA 4HQAA 3V3SA 2XD1A 3JYIA 2W3DA 4R4SA 4GD6A 3PHYA 4KG6A 5CGXA 4CPKA 1ESIA 3KYEA 4HI4A 3OPPA 3UMDA 2IWDA 2HDRA 3D9YA 4RQ9A 1WYCA 4IVKA 5JYPA 2Z6DA 1IKGA 1ZTUA 1YLPA 4ZRRA 4S2OA 1VM1A 4H6JB 1CI9A 5I5LA 1LHYA 2WKPA 1PI5A 2O9AA 4UQIS 1LI9A 3BEBA 5HD5A 1KDSA 4HY8A 2DNSA 1OT9A 4CLCB 2WGWA 4MCWA 2OLVA 1BLHA 5FDHA 4IBXA 3KSFA 3UO9A 1K6RA 4P6ZS 2ZQCA 3HUMA 4DXCA 1HZOA 3ULFA 2OWHA 1IEMA 1XFNA 1JWZA 2QWSA 4X55A 2XR0A 3G35A 3PBOA 1FILA 4EXOA 3G2YA 1NRFA 3ZG8B 4Z9QA 3M2KA 2Y2LA 4Y0UA 2VKSA 2BLSA 2HPBA 3F1NB 3UPOA 1ODVA 2ZQDA 1XX2A 1YPRA 5EVIA 1Q2QA 3PBNA 1L0EA 4DDSA 3GECA 4NKPA 1K4FA 3C4PA 2Y2GA 3PXPA 4PHTA 1XGIA 2P9VA 4E6XA 4CJNA 4R1GA 2X01A 5GHZA 1VB6A 4S2MA 2CC1A 3MXQA 4X53A 4S2KA 1LSXA 1S4SA 4C75A 1OT6A 2ZM8A 3M2JA 3MBZA 4C6YA 4R3JA 2ZL1A 4IBRA 1D7EA 2Y4AA 1I5QA 4PKYA 3N8RA 5AQ7A 2Z6CA 3PBSA 4ZBEA 4YINA 5IHVA 3T4KA 4UEYA 4DJ2A 1ES5A 1X0OA 4QB8A 2JN7A 2Y2MA 1GHIA 1YAXA 3LR5A 4UA9A 3DTKA 3Q1FA 4MLLA 3EOIA 4ESPA 1SKOB 4XT2B 5A8BA 1XP4A 2P74A 5IS1A 4ZDXA 1KGGA 2QMIA 2NUTC 3UB7A 1ESUA 1PW8A 2P08A 3SW1A 1YSQA 4EBLA 5HDDA 2OAQ1 1FSYA 5J7EA 3LR4A 2XK1A 2Q9MA 3MFXA 1WYBA 3Q07A 1NYYA 3PYPA 3CWFA 1KVLA 1OTEA 1MBLA 4OQ0A 1VETA 4H8RA 4LV2A 4BL3A 5LBRA 1WE4A 4JLFA 4KG5A 1BYWA 1XJ4A 2KX6A 5J8XA 4EESA 3ZG9B 3CAXA 3QP5A 3PR6A 2PR6A 4E3NA 2PD8A 3ZG5A 4BQMA 1IFQA 1BULA 4EUZA 2YKHA 3CPTA 5HPIA 5CGSA 2QHKA 3MXSA 3L7HA 2EXBA 2Y2HA 1D06A 3D4FA 4FH4A 1T1AA 1U60A 3GV9A 3WRZA 4P85A 4GCZA 1BSGA 1ES2A 4B93A 3SZTA 1BZAA 5CERA 5DJTA 4O8GA 3EEAA 3LIFA 4GHIA 1T1CA 2ZQ9A 5JYOA 4XUZA 4PM9A 3NDEA 3PBRA 3E2LA 4JF6A 3GTCA 4QWOA 1BLCA 4F3LA 2GX5A 4JF4A 5FAPA 5KIZA 3MKEA 4X1MA 1IYSA 1KE3A 1PZOA 4HH2A 1JTGA 1VEUB 1BT5A 1F2KA 4I3IA 3UB6A 3HVFA 3R4KA 3NOPC 2DCFA 4R70A 1LI0A 2W1TA 3VP2A 2VX8A 3WS5A 4K91A 3E98A 3NJAA 4II7A 5M1AA 2VJWA 3BQAA 3T4LA 3VFHA 1G6OA 3QP2A 1K54A 3E4QA 2HF6A 2XLNA 3ZCZA 5A92A 3PBQA 5HFOA 1Y28A 2WK0A 2D02A 3RTYA 1ALQA 2H0TA 1FSWA 1SHVA 2RCXA 2HDSA 3EWKA 3K3DA 3FKVA 1PWDA 2Y91A 3LCEA 3TG9A 4GLQA 5CHUA 1H3QA 1GA0A 4HBUA 3QP1A 4U0TA 3LR3A 2HDQA 3T1QB 3LYXA 2HP9A 3IS2B 4R38A 3LO7A 2XSSA 3C7VA 3MQQA 3IF6C 2W27A 5HW3A 2WKEA 1RGZA 2XD5A 3BFCA 1S66L 5HPFA 2WKRA 4DF6A 4WZ5A 2J3WA 3G34A 3LY4A 4RVAA 3BFEA 4QJGA 4Y0TA 3UPPA 2XFTA 2ZJ9A 5FQKA 2OLUA 1GHMA 1NJ4A 3VOZA 4KZ6A 4R4RA 4LRYC 3LEZA 1PNEA 3S1YA 2V0WA 4N9KA 2AVXA 2ZC3B 2XF3A 3OCNA 4GW9A 4YOFA 3EGDC 5HWVA 1K57C 1XJ6A 3UE0A 3KYQA 2BG1A 2FFFB 1PI4A 2KLIA 1F9IA 3BFGA 1CJFA 3DWZA 3WWXA 1YT4A 3IF5A 4JXGA 2YKFA 5DFYA 1W79A 1ZC2A 3T4QA 1YSPA 2HGVA 2G2UA 4B9OA 4O01A 2JKFA 1CF0A 2GZAA 5GLBA 4U3TA 4FCFA 4JBFA 4I3AA 3P01A 5GLDA 4JGOA 3LI8A 2UWXA 2OAP1 5CECA 3OPHA 4S2NA 4OKPA 4Z1WA 3Q7ZA 5AJGA 4GB7A 3VSKA 2J3TC 2VGLS 3H7WB 4X69A 3DTEA 3SH9A 2JKTM 3E2KA 4GS9A 2M7VA 4G3WA 3B3XA 1PWCA 4Q0IA 1KVMA 3UE3A 2PR5A 4Q0JA 4I3JA 2FZ0A 4MMNA 3MQ0A 3IBJA 1DP8A 3WRTA 5J3WA 3HJKA 2ZOIA 2V8CA 1TS6A 5GHXA 4QHCA 4R23A 3Q7VA 4DDYA 4R0QA 1W8YA 4I5SA 4FSFA 2V0UA 1V9YA 4GD8A 4JGPA 3C30A 1S67L 1TEMA 3T50A
chains in the Genus database with same CATH topology
2QYBA 1XFNA 2QWSA 3B42A 4YWZA 3PBOA 2WKQA 5HZHA 4EXOA 2O9BA 4OOMA 4H6JA 2INWA 2VGLM 5HSQA 2VKSA 2A24A 2W1RA 2KDKA 4F3LB 3F1NB 1ODVA 1OPXA 4EU0A 3VE3A 3PBNA 2VLGA 2M7UA 1DP9A 3GECA 2QJ5A 4HHDA 1LL8A 4NKPA 4NXBA 4CLCA 3CI6A 3PXPA 4PHTA 3KSGA 3UB9A 1GSWA 1LSWA 2R78A 3CLOA 4CQHA 4UQIM 2VEAA 2W1TB 3OBFA 1VB6A 3S7NA 2MJ6A 3MXQA 2GNXA 1OTDA 1EW0A 4CLCD 1LSXA 3H82B 1S4SA 1OT6A 1KOUA 4P6ZM 3C8CA 4HJ3A 2NUPC 2XRNA 3H9WA 1D7EA 4PKYA 5HD3A 2Z6CA 3PBSA 5EFWA 2Y79A 4IUKA 4PKYG 3C2WA 3EGXC 2JKRI 4IUHA 3T4OA 3OC2A 3NHQA 3T4KA 1DRMA 4UEYA 4O0PA 3BJNA 1TF1A 4DJ2A 1V9ZA 1X0OA 4HH3A 2JN7A 3NOTC 3JVUA 4MN6A 1YAXA 2CMNA 3LR5A 3O5YA 1UGUA 5IT5A 2GJ3A 3EOIA 4XT2B 3VOLA 3ZQ5A 5A8BA 4ETZA 5IS1A 3MF0A 2NUTC 3UB7A 3H82A 5C5KA 1F5MA 2P08A 3TJZC 4EQ1A 3UE6A 1OTAA 2O9CA 3R7WB 3SW1A 1YSQA 1XJ3A 1MC0A 2OAQ1 1JNUA 3FPWA 5HDDA 5J7EA 2J80A 3LR4A 2K31A 2K7SA 2JKTI 3LIBA 2QJ7A 3C38A 3NOUC 3MFXA 4M4XA 1GSVA 1T18A 2W3GA 3PYPA 5L8MA 2PT7A 4QPRA 3CWFA 4WF0A 4MDZA 1T19A 1OTEA 1MZUA 1DP6A 2ZMFA 3T4TA 2OWJA 1P97A 3BW6A 5LBRA 1BYWA 3E4PA 2V1BA 1XJ4A 1NLZA 2KX6A 4IHQA 1IOUA 4EESA 3JVVA 4ME4A 2XROA 3H7WA 3LIEA 3CAXA 4GHIB 1LSVA 3PR6A 2B02A 2PR6A 3ICYA 1UWNX 2PD8A 5TBMB 1NRJA 3IBRA 4ARZB 1IFQA 3R7WA 3LI9A 5F68A 2EWVA 2YKHA 5HPIA 2QHKA 5DF9A 5HWTA 3KSIA 1D06A 2QKPA 4HNBA 3TW8A 4NXGA 3D72A 1T1AA 3KYZA 4HJ4A 1TS0A 2HV1A 4GCZA 4B93A 5F5YA 1P9WA 2L1MA 3V67A 2ZOHA 1LT0A 3U2AA 4NXFA 4EETB 3W2ZA 5DJTA 4LRXC 4I38A 3FC7A 4FOFA 4BMWA 4O8GA 4HP9A 5KSHA 1YKDA 3E4OA 3KX0X 3EEAA 2HJ9C 3LIFA 2K2NA 1P0ZA 4GHIA 2L4RA 4Y2FA 1T1CA 3VV4A 1WA9A 5DKKA 5TBMA 3E0YA 4R3AA 2O0YA 2VA0A 5CX7A 1MKMA 2LB9A 3PBRA 2W3EA 4WN5A 3B47A 1S1ZA 1GSXA 4F3LA 3F1NA 5F6AA 2GX5A 3MR0A 5KIZA 4G3VA 3K2NA 5G4YA 2I9VA 1VHMA 1NLYA 4LLOB 1N9OA 4LPZA 4AFIA 4HH2A 3KSHA 4I3IA 2V1AA 3CUEC 2JHEA 2HJEA 3MJQA 3UB6A 3R4KA 4Q0HA 1T1BA 3NOPC 4R70A 3UMEA 4HP4A 4DN0A 4EERA 2W1TA 2ZBBA 1P9RA 2XA7S 4EEPA 2VX8A 2M1CA 3ZYTA 3LFVA 2FH5A 3E98A 3NJAA 2PDRA 4PAUA 4ETXA 4II7A 5FL3A 2VJWA 3D3OA 3BQAA 3T4LA 1G6OA 4BBVA 3OOVA 2D01A 2PYRA 3K3CA 2P7JA 3E4QA 2HF6A 3RFBA 3OCLA 5DJUA 4WEKA 2OOLA 3PBQA 2W3HA 4WL9A 4EW7A 1Y28A 2D02A 3A0VA 5MC7A 3RTYA 3PBTA 1ZHHB 5K5BA 3LIAA 3B33A 3EWKA 3K3DA 3S7OA 2VV8A 4WUJA 4I39A 2PHYA 5HWWA 3EEHA 4KQDA 2ZMVA 4GLQA 3VE4A 1H3QA 2PD7A 2DMWA 4XT2A 4L9GA 5HDSA 4HIAA 3F1PB 4Y5FA 4HOIA 3LR3A 1W63Q 3LYXA 4K08A 4KUOA 1NWZA 3IS2B 4R38A 4NEED 1OTBA 3GDIA 2XSSA 4WELA 3KO6A 5TJJA 3EQUA 3MQQA 3RH8B 2W27A 4KQOA 2Y8HA 1STZA 3T4JA 3BQ8A 4IJGA 3CITA 5AVEA 3EQVA 1OTIA 5AVFA 2XA7M 2VZWA 1S66L 5HPFA 3G6OA 1UWPX 2WKRA 4HJ6A 2J3WA 4BBUA 2LB5A 3LIDA 3BY9A 5F69A 4WEJA 4NXEA 5HL6A 4Y3IA 3TE8A 3F1OB 4LRYC 3MQOA 4JGQA 2V0WA 4BBTA 4MN7A 3OCNA 4CLCC 4L0LA 5G4ZA 2IA2A 4GW9A 4YOFA 4KUKA 2O99A 5HDCA 3EGDC 5HWVA 1XJ6A 3F1PA 3DBAA 3A0SA 3KYQA 4R6LA 1G28A 1S1YA 4ARZA 1W63M 4L9FA 3BY8A 3IS2A 2KLIA 1F9IA 3HCYA 2W0NA 1TS7A 4E04A 2EWWA 3BWLA 2W3FA 3HJIA 2P04A 3S7QA 1XJ2A 4OOLA 2A2LA 2YKFA 5DFYA 2V9AA 4GS9B 4GJ4A 4LRZE 3FPVA 4MN5A 4DMZA 3T4QA 2JKRM 4EUVA 4HQAA 1TD5A 3T4SA 3F1OA 5DKLA 2VV7A 5IU1A 1YSPA 2HGVA 4DJ3A 2W3DA 4B9OA 4G3KA 1S4RA 4WLAA 3A0RA 3FG8A 4JGRA 4O01A 4BWIA 3PHYA 2PYPA 1H8MA 3CUEA 2GZAA 4I3AA 3P01A 1N9LA 2H28A 5DFXA 4HI4A 3TRCA 4JGOA 3LI8A 2VV6A 2OAP1 4BJPA 3UMDA 1OJGA 4Z1WA 5J4EA 4RQ9A 5AJGA 2J3TC 2VGLS 3H7WB 2Z6DA 3UB8A 3P7NA 1ZTUA 3LR0A 3OLOA 4L9EA 4ZRRA 2JKTM 2KOIA 1TS8A 4GS9A 2M7VA 4G3WA 4H6JB 1XFQA 2B18A 3LUQA 4Q0IA 2A24B 1N9NA 3UE3A 2PR5A 5I5LA 4Q0JA 2WKPA 4I3JA 2FZ0A 2EA9A 3MQ0A 2O9AA 4MMNA 3IBJA 4EEUA 1DP8A 4UQIS 5J3WA 5HD5A 3HJKA 2J3TD 4HY8A 2L0WA 2ZOIA 1OT9A 1OJ5A 3S7PA 1TS6A 4CLCB 2G7UA 4YNRA 4MCWA 3LICA 4I5SA 4FSFA 3KSFA 2V0UA 1V9YA 4P6ZS 3MMHA 2BASA 1F98A 3ULFA 4JGPA 2OWHA 4CLCE 3C30A 1S67L 3T50A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XFN A;  2QWS A;  4YWZ A;  2WKQ A;  5HZH A;  4EXO A;  4H6J A;  2INW A;  5HSQ A;  2A24 A;  2KDK A;  4F3L B;  3F1N B;  1ODV A;  3VE3 A;  2VLG A;  1DP9 A;  3GEC A;  2QJ5 A;  4HHD A;  1LL8 A;  4NXB A;  3UB9 A;  1GSW A;  1LSW A;  2R78 A;  3CLO A;  2VEA A;  1VB6 A;  3MXQ A;  1OTD A;  1EW0 A;  1LSX A;  3H82 B;  1S4S A;  1OT6 A;  1KOU A;  3C8C A;  4HJ3 A;  3H9W A;  1D7E A;  4PKY A;  5HD3 A;  2Z6C A;  5EFW A;  4PKY G;  3C2W A;  3NHQ A;  1DRM A;  4DJ2 A;  1V9Z A;  1X0O A;  4HH3 A;  2JN7 A;  3NOT C;  4MN6 A;  2CMN A;  1UGU A;  2GJ3 A;  4XT2 B;  3VOL A;  3ZQ5 A;  5A8B A;  5IS1 A;  3UB7 A;  3H82 A;  4EQ1 A;  3UE6 A;  1OTA A;  3SW1 A;  1XJ3 A;  5HDD A;  1JNU A;  5J7E A;  2J80 A;  2K7S A;  3LIB A;  2QJ7 A;  3NOU C;  3MFX A;  4M4X A;  1GSV A;  1T18 A;  3PYP A;  4WF0 A;  3CWF A;  1T19 A;  1OTE A;  1MZU A;  1DP6 A;  2OWJ A;  1P97 A;  1BYW A;  3E4P A;  2V1B A;  1XJ4 A;  2KX6 A;  4EES A;  3H7W A;  3LIE A;  3CAX A;  4GHI B;  1LSV A;  2B02 A;  2PR6 A;  3ICY A;  1UWN X;  2PD8 A;  5TBM B;  3IBR A;  3LI9 A;  5F68 A;  2YKH A;  2QHK A;  5HWT A;  1D06 A;  2QKP A;  4HNB A;  4NXG A;  3D72 A;  1T1A A;  4HJ4 A;  1TS0 A;  2HV1 A;  4GCZ A;  5F5Y A;  2L1M A;  2ZOH A;  1LT0 A;  4NXF A;  4EET B;  5DJT A;  4LRX C;  4I38 A;  3FC7 A;  4HP9 A;  3E4O A;  3KX0 X;  3LIF A;  1P0Z A;  4GHI A;  2L4R A;  1T1C A;  1WA9 A;  5DKK A;  5TBM A;  4R3A A;  4WN5 A;  1S1Z A;  1GSX A;  4F3L A;  3F1N A;  5F6A A;  3MR0 A;  5KIZ A;  5G4Y A;  2I9V A;  4LLO B;  1N9O A;  4LPZ A;  4HH2 A;  4I3I A;  2V1A A;  2JHE A;  3MJQ A;  3UB6 A;  1T1B A;  3NOP C;  4R70 A;  3UME A;  4HP4 A;  4EER A;  2ZBB A;  4EEP A;  2M1C A;  3NJA A;  2PDR A;  4BBV A;  2D01 A;  2PYR A;  3K3C A;  2P7J A;  3E4Q A;  5DJU A;  2OOL A;  4WL9 A;  4EW7 A;  1Y28 A;  2D02 A;  3A0V A;  3RTY A;  3LIA A;  3B33 A;  3EWK A;  3K3D A;  2VV8 A;  4WUJ A;  4I39 A;  2PHY A;  5HWW A;  3EEH A;  4KQD A;  3VE4 A;  2PD7 A;  4XT2 A;  4L9G A;  5HDS A;  4HIA A;  3F1P B;  4HOI A;  3LYX A;  4K08 A;  4KUO A;  1NWZ A;  3IS2 B;  4R38 A;  1OTB A;  3GDI A;  3MQQ A;  3RH8 B;  2W27 A;  5AVE A;  1OTI A;  5AVF A;  1S66 L;  3G6O A;  1UWP X;  2WKR A;  4HJ6 A;  4BBU A;  3LID A;  3BY9 A;  5F69 A;  4NXE A;  3F1O B;  4LRY C;  3MQO A;  4JGQ A;  2V0W A;  4BBT A;  5G4Z A;  4GW9 A;  4KUK A;  5HDC A;  5HWV A;  1XJ6 A;  3F1P A;  3A0S A;  4R6L A;  1G28 A;  1S1Y A;  4L9F A;  3BY8 A;  3IS2 A;  1F9I A;  2W0N A;  1TS7 A;  4E04 A;  3BWL A;  3HJI A;  1XJ2 A;  2YKF A;  2V9A A;  4GS9 B;  4LRZ E;  4MN5 A;  4HQA A;  3F1O A;  5DKL A;  2VV7 A;  5IU1 A;  4DJ3 A;  4B9O A;  1S4R A;  4WLA A;  3A0R A;  3FG8 A;  4JGR A;  3PHY A;  2PYP A;  4I3A A;  1N9L A;  2H28 A;  4HI4 A;  4JGO A;  3LI8 A;  2VV6 A;  3UMD A;  1OJG A;  5J4E A;  4RQ9 A;  3H7W B;  2Z6D A;  3UB8 A;  3P7N A;  3OLO A;  4L9E A;  1TS8 A;  4GS9 A;  4H6J B;  1XFQ A;  3LUQ A;  2A24 B;  1N9N A;  2PR5 A;  5I5L A;  2WKP A;  4I3J A;  2EA9 A;  4EEU A;  1DP8 A;  5J3W A;  5HD5 A;  3HJK A;  4HY8 A;  2L0W A;  2ZOI A;  1OT9 A;  1OJ5 A;  1TS6 A;  3LIC A;  4I5S A;  2V0U A;  1V9Y A;  2BAS A;  1F98 A;  3ULF A;  4JGP A;  2OWH A;  1S67 L;  3T50 A; 
#chains in the Genus database with same CATH topology
 1TDL A;  3IQA A;  1HTZ A;  1L2S A;  2OV5 A;  5G18 A;  3PAG A;  4DE2 A;  3IT9 A;  1GCE A;  4H6J A;  1K0K A;  2INW A;  5HSQ A;  2W1R A;  1OPX A;  1FOF A;  2Z2L B;  1G68 A;  4IED A;  4QU3 A;  2VLG A;  3GMW A;  3MFD A;  4E6W A;  4CLC A;  4B4Z A;  3CI6 A;  3MSH A;  3KSG A;  3VP0 A;  4PM8 A;  2R78 A;  2WAE A;  3G4P A;  2HDU A;  4B88 A;  4CQH A;  2J9P A;  4UQI M;  3QP4 A;  2MJ6 A;  1G5U A;  1OTD A;  4CLC D;  1KGF A;  4P6Z M;  4OOY A;  4Y17 A;  4QY5 A;  4DXB A;  3UB5 P;  4IUK A;  3EGX C;  3T4O A;  3OC2 A;  1JVJ A;  2WAD A;  4O0P A;  1V9Z A;  4HH3 A;  1KE4 A;  4MN6 A;  3PAE A;  2GDN A;  5IT5 A;  2GJ3 A;  2PAV P;  4EBP A;  4DE3 A;  4N1H A;  4ETZ A;  4BD1 A;  5CGW A;  3CJM A;  2Y2N A;  3UE6 A;  3R7W B;  1K56 D;  2H0Y A;  3C7U A;  4Y15 A;  1H8Y A;  1XJ3 A;  5CXW A;  1YLT A;  1SZV A;  2K7S A;  3LIB A;  1XXM A;  2FFY A;  1K55 A;  5FAS A;  4UA7 A;  1NZU A;  3G32 A;  1NXY A;  3MKF A;  1T19 A;  1MZU A;  1LL9 A;  3V3R A;  4NK3 A;  2V1B A;  3NIA A;  4BLM A;  1XA1 A;  4KZ9 A;  1SKO A;  5EE8 A;  5KZH A;  2XRO A;  3FWL A;  1LSV A;  2V1Z A;  3IBR A;  3IWO A;  3VFF A;  2JBF A;  3TOI A;  1FR1 A;  4LFU A;  3LI9 A;  5F83 A;  2X02 A;  3SH7 A;  1VQQ A;  5KMW A;  3D72 A;  1H8Z A;  1YQS A;  4HJ4 A;  1P9W A;  1LT0 A;  4NXF A;  4EET B;  4OQH A;  5EM1 A;  5L10 A;  4FOF A;  4HES A;  4E3I A;  2Y2P A;  3G2Z A;  2K2N A;  2L4R A;  3WS1 A;  1WA9 A;  4R3A A;  2O0Y A;  3A3E A;  3ITA A;  3IH8 A;  4O7D A;  3IX8 A;  2WUQ A;  3BYD A;  3QNC A;  4QD4 A;  1CQA A;  4WN5 A;  3B47 A;  4OP5 A;  1GSX A;  1QME A;  1Y4O A;  1TDG A;  4AFI A;  3KSH A;  2B5R A;  1NYM A;  2HJE A;  3MJQ A;  2EX6 A;  2XGN A;  1T1B A;  4HP4 A;  4DN0 A;  2XFS A;  1P9R A;  1PZP A;  1K38 A;  3ZYT A;  3IHA A;  3IXB A;  3V5M A;  2PDR A;  4HEF A;  3N6I A;  2EX2 A;  4BBV A;  3OOV A;  5FA7 A;  2PYR A;  3OCL A;  5DJU A;  5FI2 A;  3HLW A;  3UNW A;  4OP8 A;  3MXR A;  5EEC A;  3LIA A;  4WUJ A;  4I39 A;  1C3B A;  2ZMV A;  3IXD A;  3VE4 A;  2HP6 A;  4EV4 A;  3M6H A;  4WM9 A;  1HVB A;  4WYY A;  4L9G A;  1CK3 A;  5EVI B;  4GZB A;  4E3M A;  3F1P B;  4KZ3 A;  3SS4 A;  3UN7 A;  1W63 Q;  4K08 A;  4NEE D;  2P9V B;  3EQU A;  2XH9 A;  2PBD P;  1STZ A;  2JC7 A;  3CIT A;  5AVE A;  5GLC A;  5AVF A;  1RP5 A;  4DE0 A;  1Z09 A;  2Q9N A;  4ZJ1 A;  4HJ6 A;  3JPU A;  3T12 B;  4BBU A;  3LID A;  3V39 A;  4N9L A;  4Y3I A;  3F1O B;  4M3K A;  3QNB A;  4PM5 A;  1IYQ A;  3MQO A;  5EVI C;  1KGE A;  2WKH A;  4LEN A;  3RXW A;  2VK3 A;  4MN7 A;  3G30 A;  4L0L A;  2IA2 A;  5CEB A;  1FCN A;  3A0S A;  3DBA A;  3ZFZ A;  4R6L A;  2ZC5 B;  5HX9 A;  3UDF A;  4ARZ A;  4L9F A;  3BY8 A;  3IS2 A;  1YMS A;  3WS2 A;  3BWL A;  5EPH A;  2JCH A;  2P04 A;  1XJ2 A;  4OOL A;  2A2L A;  5HL1 A;  3LY3 A;  5EOO A;  1SDE A;  1I2W A;  1EWZ A;  4LRZ E;  3FPV A;  1ZG4 A;  3T1X A;  4MBF A;  5EVE A;  4KZ7 A;  1Q2P A;  5D3O A;  1MWR A;  4WLA A;  4JGR A;  4EQI A;  3CUE A;  5FI6 A;  5DFX A;  4D2O A;  3DTM A;  1PW1 A;  4S2J A;  3CG5 A;  2EFU A;  1OJG A;  5J4E A;  3IX3 A;  1EI5 A;  3IF6 B;  4A5R A;  3BEC A;  3P7N A;  4E3K A;  1O7E A;  4L9E A;  5FQI A;  4UHU A;  2KOI A;  1TS8 A;  2ACG A;  1AWI A;  5I94 A;  3CPT B;  2A24 B;  1A0K A;  1MKI A;  4EEU A;  2J3T D;  2R9X A;  4ZTK A;  1S6R A;  2L0W A;  3ZGA B;  4X1L A;  1OJ5 A;  4YNR A;  3MS6 A;  3LIC A;  1HLU P;  5DTK A;  3NUL A;  2Q0O A;  1F98 A;  4CLC E;  3O3V A;  1FCM A;  1E25 A;  2QYB A;  1J3W A;  3O87 A;  1FQG A;  3B42 A;  3HUN A;  3U4L P;  4YWZ A;  5HZH A;  1MWS A;  3RXX A;  2O9B A;  4OOM A;  2VGL M;  4F3L B;  4EU0 A;  3VE3 A;  3AGE A;  4Y13 A;  1PFL A;  1DP9 A;  2Z2M B;  4HHD A;  1LL8 A;  5FQM A;  3UB9 A;  2VGJ A;  1GSW A;  2WGI A;  1LSW A;  2Y2K A;  3T1R A;  3ZDJ A;  4KZ4 A;  2JKG A;  2VEA A;  2W1T B;  4S2I A;  3S7N A;  2GNX A;  3G31 A;  3H82 B;  4JXW A;  2WGV A;  4HJ3 A;  2NUP C;  3QHY A;  2ZC6 B;  3QP6 A;  4DE1 A;  3W4P A;  3C4O A;  2WAF A;  3QP8 A;  5FAQ A;  3C2W A;  2JKR I;  4IUH A;  2XEP A;  3FZC A;  3A3F A;  2QZ6 A;  5CRF A;  4MBH A;  2I72 A;  5FQ9 A;  2WYX A;  1UGU A;  1MXO A;  4Y0O A;  3ZQ5 A;  3P09 A;  4RYE A;  4NG2 A;  3MF0 A;  1MY8 A;  3WS0 A;  1K54 C;  3TJZ C;  4EQ1 A;  5DTT A;  2O9C A;  1O07 A;  1PWG A;  3FPW A;  3DAV A;  4P0M A;  2J80 A;  2VGK A;  3DWK A;  5F82 A;  2UV0 E;  3FKW A;  3C38 A;  3NOU C;  4XUX A;  4RX2 A;  1GSV A;  3GSG A;  3IXG A;  2W3G A;  5GLA A;  5L8M A;  2PT7 A;  4QPR A;  4MDZ A;  3BFF A;  3RJU A;  1DP6 A;  1FR6 A;  2ZMF A;  3BW6 A;  3P98 A;  3ZHH A;  3ZVT A;  1NLZ A;  4IHQ A;  5FSR A;  2R9W A;  4WBG A;  3JVV A;  4ME4 A;  1NZO A;  5TBM B;  1UWN X;  1IYP A;  1ONH A;  5AQB A;  1E4D A;  1ES3 A;  4WZ5 C;  3R7W A;  5F68 A;  2EWV A;  4UAA A;  4KQR A;  4LV0 A;  5DF9 A;  4OVD A;  3KSI A;  2QKP A;  4HBT A;  4HNB A;  3TW8 A;  3LGO A;  4KZ8 A;  1GA9 A;  1TS0 A;  2HV1 A;  4GKU A;  5F5Y A;  3S4X A;  4YFM A;  2L1M A;  2ZOH A;  3WS4 A;  4JPM A;  5L07 A;  3U2A A;  5U47 A;  1NY0 A;  3W2Z A;  1MPL A;  3C5A A;  3OPR A;  1JWV A;  4LRX C;  5EM0 A;  4I38 A;  3FC7 A;  3W4O A;  4OPQ A;  3HLG A;  4LCM A;  1ERQ A;  4KG2 A;  3PTE A;  1YKD A;  3E4O A;  4Y2F A;  3VV4 A;  1CEF A;  4WMC D;  5CX7 A;  1MKM A;  4B4X A;  5EVL A;  1S1Z A;  2C6W B;  3F1N A;  4FD8 A;  4D60 A;  3MR0 A;  3K2N A;  5DTS A;  5G4Y A;  2I9V A;  1VHM A;  4LLO B;  1N9O A;  4E3J A;  5TFQ A;  4KZB A;  1K56 A;  2Y2Q A;  3UME A;  4EER A;  4OQG A;  2ZBB A;  3V50 A;  3BLS A;  2XA7 S;  5FQJ A;  4EEP A;  5KSC A;  3Q7V B;  4S2N C;  1BUE A;  5CTN A;  2JE5 A;  5M18 A;  1D1J A;  4PAU A;  4ETX A;  5FL3 A;  1N9B A;  4F94 A;  2D01 A;  4OON A;  3IH9 A;  1MWT A;  3SH8 A;  4WEK A;  2OOL A;  4WL9 A;  4S2P A;  4EW7 A;  3O88 A;  1ZG6 A;  3A0V A;  5MC7 A;  1L3L A;  1ZHH B;  3I7J A;  5DF8 A;  3S7O A;  3HLE A;  2VV8 A;  5E2F A;  2PHY A;  4K0W A;  3EEH A;  4LCL A;  4KQD A;  5FQQ A;  1DY6 A;  3VSL A;  2PD7 A;  2Y2O A;  4GDN A;  2J9O A;  4XT2 A;  4LV1 A;  5HDS A;  4JF5 A;  4BL2 A;  4HIA A;  1W5D A;  4HOI A;  1XA7 A;  3SS3 A;  1Y54 A;  3ISG A;  4WEL A;  1OTB A;  3GDI A;  3MZE A;  3KO6 A;  1K6S A;  4WZ4 A;  4KQO A;  2Y8H A;  3T4J A;  1IYO A;  3BQ8 A;  3NDG A;  3NY4 A;  4XXR A;  1OTI A;  2V8F A;  4E3O A;  2VZW A;  4DRT A;  4KZA A;  1UWP X;  4R3B A;  1PIO A;  3BY9 A;  3FYZ A;  2ZLY A;  2EX9 A;  1ZKJ A;  4NXE A;  5HL6 A;  3IWI A;  4DKI A;  3TE8 A;  3SS5 A;  1KE0 A;  1BTL A;  5E43 A;  1YLY A;  3VMA A;  4CLC C;  2H10 A;  3M6B A;  5FI7 A;  4KUK A;  2O99 A;  2IWC A;  2XDM A;  3BFD A;  5CHM A;  3N7W A;  5HDC A;  3F1P A;  4OQI A;  2PRF A;  5F1F A;  2Y2I A;  4X56 A;  1H0M A;  4JXS A;  2W0N A;  1TS7 A;  4X68 A;  2W3F A;  3HJI A;  5EVI D;  1RCJ A;  2Y2J A;  3AGF A;  1OME A;  1K4E A;  4BEN A;  2PU4 A;  4MN5 A;  4DMZ A;  5E2H A;  1TD5 A;  3T4S A;  3F1O A;  5DKL A;  2VV7 A;  3O86 A;  5IU1 A;  2OSU A;  2ZQA A;  4DJ3 A;  5CED A;  4G3K A;  1S4R A;  3A0R A;  3FG8 A;  4BWI A;  1W8Q A;  4LGW A;  2PYP A;  2H5S A;  1H8M A;  4ZAM A;  2Y55 A;  2ZM2 A;  1GHP A;  2WGW B;  2BTF P;  3T1S A;  1N9L A;  2H28 A;  1KDW A;  3TRC A;  3VP3 A;  4EBN A;  4S2L A;  2VV6 A;  4BJP A;  1M6K A;  3N8L A;  5A93 A;  1Z6F A;  3VP1 A;  3NBL A;  4MNR A;  3UB8 A;  5E2G A;  3LR0 A;  3DW0 A;  3OLO A;  1IKI A;  2ZC4 B;  1L0G A;  1YLJ A;  4UA6 A;  4NET A;  5HAI A;  3HLD A;  2X71 A;  1XFQ A;  5FAO A;  1VEU A;  2B18 A;  3LUQ A;  5BOH A;  1N9N A;  1K55 C;  3N8S A;  2EA9 A;  3CZD A;  4BD0 A;  5FDS A;  1E3U A;  3A3J A;  3L9K A;  3IHB A;  3S7P A;  1HD8 A;  4KQQ A;  3CMZ A;  2G7U A;  3ZVW A;  5FEG A;  1CEG A;  4OLG A;  3MMH A;  3UDX A;  3NEC A;  3S22 A;  4ZJ3 A;  4PMA A;  2BAS A;  2WKI A;  4GN2 A;  1E3U D;  3Q81 A;  1XPB A;  3IF6 A;  5L2F A;  1YM1 A;  5A90 A;  4RX3 A;  4N1X A;  2ZL1 B;  2G2W A;  2WKQ A;  3FV7 A;  4GNU A;  1AXB A;  4OLD A;  3CHW P;  4IVI A;  2A24 A;  2KDK A;  4QY6 A;  3NCK A;  1G6A A;  3HUO A;  2ZC7 A;  2M7U A;  2QJ5 A;  4NXB A;  3ZG7 B;  3BM6 A;  3BLM A;  4KEN B;  3CLO A;  1K57 A;  4JXV A;  1ES4 A;  3DTI A;  2B95 A;  3OBF A;  3HLC A;  1EW0 A;  1KOU A;  4Y7P A;  3C8C A;  1SKF A;  2XRN A;  3H9W A;  3HL9 A;  4MEZ A;  5L09 A;  2EXA A;  3SOI A;  2HZ5 A;  5HD3 A;  5EFW A;  2Y79 A;  4PKY G;  3UY6 A;  1DJB A;  1L0D A;  3NHQ A;  3W8K A;  5TGF A;  1DRM A;  1BLS A;  3AGD A;  3BJN A;  1TF1 A;  3VP4 A;  1VET B;  3NOT C;  3JVU A;  2CMN A;  4JKT A;  1J9M A;  3O5Y A;  1N4O A;  2ZMA A;  1IEL A;  3VOL A;  3OPL A;  4PPR A;  3VOY A;  4C3Q A;  5FAT A;  4LV3 A;  4FTX A;  5AQA A;  2DRW A;  3H82 A;  1F5M A;  5C5K A;  1OTA A;  2A49 A;  3IX4 A;  3GRJ A;  1MC0 A;  1JNU A;  2K31 A;  2JKT I;  3ZNY A;  2QJ7 A;  4P87 A;  1YMX A;  3A3I A;  4M4X A;  1T18 A;  4Q8I A;  3IXH A;  1YLW A;  5HAP A;  4WF0 A;  2EFX A;  1ERM A;  2C5W B;  1XGJ A;  4GDB A;  2V20 A;  3TSG A;  3T4T A;  2E8I A;  2OWJ A;  1P97 A;  5CTM A;  5HAR A;  3HLB A;  3E4P A;  5M19 A;  1BLP A;  1IOU A;  5AQ9 A;  2ZQ8 A;  5HAQ A;  3H7W A;  3LIE A;  4GHI B;  2E8J A;  4OPR A;  1MWU A;  2B02 A;  3ICY A;  3LEQ A;  1ACF A;  4MBK A;  1NRJ A;  4ARZ B;  1SDN A;  1FIK A;  5HWT A;  2ZM0 A;  4NXG A;  3KYZ A;  5DVA A;  3NC8 A;  2WZX A;  4OPZ A;  3V67 A;  5GL9 A;  2WZZ A;  5A91 A;  2IWB A;  5E2E A;  1FCO A;  1JWP A;  4BMW A;  3A3D A;  4HP9 A;  1TVF A;  5KSH A;  1H5X A;  3KX0 X;  3UPN A;  2HJ9 C;  5EV0 A;  2A3U A;  1P0Z A;  3IWQ A;  1M40 A;  5DKK A;  5EOE A;  5TBM A;  3E0Y A;  3MZF A;  5GHY A;  1XKZ A;  1QMF A;  2VA0 A;  1DJA A;  2LB9 A;  2W3E A;  4PM6 A;  1ONG A;  5F6A A;  2PBY A;  4G3V A;  2J7V A;  4EWF A;  3Q82 A;  1NLY A;  4LPZ A;  1RGY A;  2ZD8 A;  2V1A A;  3GR2 A;  3BRM A;  3CUE C;  2JHE A;  4Q0H A;  1CI8 A;  4ID4 A;  4RA7 A;  5DF7 A;  3ZG0 A;  1YLZ A;  3OZH A;  2M1C A;  1JTD A;  4FH2 A;  4P6B A;  4PM7 A;  3LFV A;  2FH5 A;  3UE1 A;  3UDI A;  4OPY A;  3D3O A;  2Y59 A;  1LLB A;  3K3C A;  2P7J A;  3RFB A;  2W3H A;  4ZJ2 A;  4N92 A;  1I2S A;  5TR7 A;  3NI9 A;  3PBT A;  2HP5 A;  1LL5 A;  5F1G A;  3B33 A;  5K5B A;  5HWW A;  3HBR A;  1S0W A;  2XQZ A;  3GVB A;  2DMW A;  4Y5F A;  3HLF A;  4KZ5 A;  4KUO A;  1NWZ A;  3N4I A;  5TJJ A;  3RH8 B;  4K0X A;  1W7F A;  4IJG A;  3EQV A;  1ERO A;  1L0F A;  2XA7 M;  1DJC A;  4OH0 A;  3G6O A;  3ZNT A;  3GQZ A;  2QPN A;  2LB5 A;  4FUW A;  5F69 A;  4WEJ A;  1PRQ A;  2J8Y A;  4X6T A;  1PYY A;  4JGQ A;  4BBT A;  4WMC A;  2RL3 A;  2ZQ7 A;  5G4Z A;  3ITB A;  2EX8 A;  2PU2 A;  1SCW A;  4GOG A;  3MZD A;  1G28 A;  5EUA A;  1S1Y A;  1W63 M;  3HRE A;  4X25 A;  5CHJ A;  4E3L A;  5FEF A;  3HCY A;  3W4Q A;  4E04 A;  2EWW A;  2V2F F;  3S7Q A;  4U0X A;  2V9A A;  4GS9 B;  4GJ4 A;  1K25 A;  2JKR M;  4EUV A;  4HQA A;  3V3S A;  2XD1 A;  3JYI A;  2W3D A;  4R4S A;  4GD6 A;  3PHY A;  4KG6 A;  5CGX A;  4CPK A;  1ESI A;  3KYE A;  4HI4 A;  3OPP A;  3UMD A;  2IWD A;  2HDR A;  3D9Y A;  4RQ9 A;  1WYC A;  4IVK A;  5JYP A;  2Z6D A;  1IKG A;  1ZTU A;  1YLP A;  4ZRR A;  4S2O A;  1VM1 A;  4H6J B;  1CI9 A;  5I5L A;  1LHY A;  2WKP A;  1PI5 A;  2O9A A;  4UQI S;  1LI9 A;  3BEB A;  5HD5 A;  1KDS A;  4HY8 A;  2DNS A;  1OT9 A;  4CLC B;  2WGW A;  4MCW A;  2OLV A;  1BLH A;  5FDH A;  4IBX A;  3KSF A;  3UO9 A;  1K6R A;  4P6Z S;  2ZQC A;  3HUM A;  4DXC A;  1HZO A;  3ULF A;  2OWH A;  1IEM A;  1XFN A;  1JWZ A;  2QWS A;  4X55 A;  2XR0 A;  3G35 A;  3PBO A;  1FIL A;  4EXO A;  3G2Y A;  1NRF A;  3ZG8 B;  4Z9Q A;  3M2K A;  2Y2L A;  4Y0U A;  2VKS A;  2BLS A;  2HPB A;  3F1N B;  3UPO A;  1ODV A;  2ZQD A;  1XX2 A;  1YPR A;  5EVI A;  1Q2Q A;  3PBN A;  1L0E A;  4DDS A;  3GEC A;  4NKP A;  1K4F A;  3C4P A;  2Y2G A;  3PXP A;  4PHT A;  1XGI A;  2P9V A;  4E6X A;  4CJN A;  4R1G A;  2X01 A;  5GHZ A;  1VB6 A;  4S2M A;  2CC1 A;  3MXQ A;  4X53 A;  4S2K A;  1LSX A;  1S4S A;  4C75 A;  1OT6 A;  2ZM8 A;  3M2J A;  3MBZ A;  4C6Y A;  4R3J A;  2ZL1 A;  4IBR A;  1D7E A;  2Y4A A;  1I5Q A;  4PKY A;  3N8R A;  5AQ7 A;  2Z6C A;  3PBS A;  4ZBE A;  4YIN A;  5IHV A;  3T4K A;  4UEY A;  4DJ2 A;  1ES5 A;  1X0O A;  4QB8 A;  2JN7 A;  2Y2M A;  1GHI A;  1YAX A;  3LR5 A;  4UA9 A;  3DTK A;  3Q1F A;  4MLL A;  3EOI A;  4ESP A;  1SKO B;  4XT2 B;  5A8B A;  1XP4 A;  2P74 A;  5IS1 A;  4ZDX A;  1KGG A;  2QMI A;  2NUT C;  3UB7 A;  1ESU A;  1PW8 A;  2P08 A;  3SW1 A;  1YSQ A;  4EBL A;  5HDD A;  2OAQ 1;  1FSY A;  5J7E A;  3LR4 A;  2XK1 A;  2Q9M A;  3MFX A;  1WYB A;  3Q07 A;  1NYY A;  3PYP A;  3CWF A;  1KVL A;  1OTE A;  1MBL A;  4OQ0 A;  1VET A;  4H8R A;  4LV2 A;  4BL3 A;  5LBR A;  1WE4 A;  4JLF A;  4KG5 A;  1BYW A;  1XJ4 A;  2KX6 A;  5J8X A;  4EES A;  3ZG9 B;  3CAX A;  3QP5 A;  3PR6 A;  2PR6 A;  4E3N A;  2PD8 A;  3ZG5 A;  4BQM A;  1IFQ A;  1BUL A;  4EUZ A;  2YKH A;  3CPT A;  5HPI A;  5CGS A;  2QHK A;  3MXS A;  3L7H A;  2EXB A;  2Y2H A;  1D06 A;  3D4F A;  4FH4 A;  1T1A A;  1U60 A;  3GV9 A;  3WRZ A;  4P85 A;  4GCZ A;  1BSG A;  1ES2 A;  4B93 A;  3SZT A;  1BZA A;  5CER A;  5DJT A;  4O8G A;  3EEA A;  3LIF A;  4GHI A;  1T1C A;  2ZQ9 A;  5JYO A;  4XUZ A;  4PM9 A;  3NDE A;  3PBR A;  3E2L A;  4JF6 A;  3GTC A;  4QWO A;  1BLC A;  4F3L A;  2GX5 A;  4JF4 A;  5FAP A;  5KIZ A;  3MKE A;  4X1M A;  1IYS A;  1KE3 A;  1PZO A;  4HH2 A;  1JTG A;  1VEU B;  1BT5 A;  1F2K A;  4I3I A;  3UB6 A;  3HVF A;  3R4K A;  3NOP C;  2DCF A;  4R70 A;  1LI0 A;  2W1T A;  3VP2 A;  2VX8 A;  3WS5 A;  4K91 A;  3E98 A;  3NJA A;  4II7 A;  5M1A A;  2VJW A;  3BQA A;  3T4L A;  3VFH A;  1G6O A;  3QP2 A;  1K54 A;  3E4Q A;  2HF6 A;  2XLN A;  3ZCZ A;  5A92 A;  3PBQ A;  5HFO A;  1Y28 A;  2WK0 A;  2D02 A;  3RTY A;  1ALQ A;  2H0T A;  1FSW A;  1SHV A;  2RCX A;  2HDS A;  3EWK A;  3K3D A;  3FKV A;  1PWD A;  2Y91 A;  3LCE A;  3TG9 A;  4GLQ A;  5CHU A;  1H3Q A;  1GA0 A;  4HBU A;  3QP1 A;  4U0T A;  3LR3 A;  2HDQ A;  3T1Q B;  3LYX A;  2HP9 A;  3IS2 B;  4R38 A;  3LO7 A;  2XSS A;  3C7V A;  3MQQ A;  3IF6 C;  2W27 A;  5HW3 A;  2WKE A;  1RGZ A;  2XD5 A;  3BFC A;  1S66 L;  5HPF A;  2WKR A;  4DF6 A;  4WZ5 A;  2J3W A;  3G34 A;  3LY4 A;  4RVA A;  3BFE A;  4QJG A;  4Y0T A;  3UPP A;  2XFT A;  2ZJ9 A;  5FQK A;  2OLU A;  1GHM A;  1NJ4 A;  3VOZ A;  4KZ6 A;  4R4R A;  4LRY C;  3LEZ A;  1PNE A;  3S1Y A;  2V0W A;  4N9K A;  2AVX A;  2ZC3 B;  2XF3 A;  3OCN A;  4GW9 A;  4YOF A;  3EGD C;  5HWV A;  1K57 C;  1XJ6 A;  3UE0 A;  3KYQ A;  2BG1 A;  2FFF B;  1PI4 A;  2KLI A;  1F9I A;  3BFG A;  1CJF A;  3DWZ A;  3WWX A;  1YT4 A;  3IF5 A;  4JXG A;  2YKF A;  5DFY A;  1W79 A;  1ZC2 A;  3T4Q A;  1YSP A;  2HGV A;  2G2U A;  4B9O A;  4O01 A;  2JKF A;  1CF0 A;  2GZA A;  5GLB A;  4U3T A;  4FCF A;  4JBF A;  4I3A A;  3P01 A;  5GLD A;  4JGO A;  3LI8 A;  2UWX A;  2OAP 1;  5CEC A;  3OPH A;  4S2N A;  4OKP A;  4Z1W A;  3Q7Z A;  5AJG A;  4GB7 A;  3VSK A;  2J3T C;  2VGL S;  3H7W B;  4X69 A;  3DTE A;  3SH9 A;  2JKT M;  3E2K A;  4GS9 A;  2M7V A;  4G3W A;  3B3X A;  1PWC A;  4Q0I A;  1KVM A;  3UE3 A;  2PR5 A;  4Q0J A;  4I3J A;  2FZ0 A;  4MMN A;  3MQ0 A;  3IBJ A;  1DP8 A;  3WRT A;  5J3W A;  3HJK A;  2ZOI A;  2V8C A;  1TS6 A;  5GHX A;  4QHC A;  4R23 A;  3Q7V A;  4DDY A;  4R0Q A;  1W8Y A;  4I5S A;  4FSF A;  2V0U A;  1V9Y A;  4GD8 A;  4JGP A;  3C30 A;  1S67 L;  1TEM A;  3T50 A; 
#chains in the Genus database with same CATH homology
 2QYB A;  1XFN A;  2QWS A;  3B42 A;  4YWZ A;  3PBO A;  2WKQ A;  5HZH A;  4EXO A;  2O9B A;  4OOM A;  4H6J A;  2INW A;  2VGL M;  5HSQ A;  2VKS A;  2A24 A;  2W1R A;  2KDK A;  4F3L B;  3F1N B;  1ODV A;  1OPX A;  4EU0 A;  3VE3 A;  3PBN A;  2VLG A;  2M7U A;  1DP9 A;  3GEC A;  2QJ5 A;  4HHD A;  1LL8 A;  4NKP A;  4NXB A;  4CLC A;  3CI6 A;  3PXP A;  4PHT A;  3KSG A;  3UB9 A;  1GSW A;  1LSW A;  2R78 A;  3CLO A;  4CQH A;  4UQI M;  2VEA A;  2W1T B;  3OBF A;  1VB6 A;  3S7N A;  2MJ6 A;  3MXQ A;  2GNX A;  1OTD A;  1EW0 A;  4CLC D;  1LSX A;  3H82 B;  1S4S A;  1OT6 A;  1KOU A;  4P6Z M;  3C8C A;  4HJ3 A;  2NUP C;  2XRN A;  3H9W A;  1D7E A;  4PKY A;  5HD3 A;  2Z6C A;  3PBS A;  5EFW A;  2Y79 A;  4IUK A;  4PKY G;  3C2W A;  3EGX C;  2JKR I;  4IUH A;  3T4O A;  3OC2 A;  3NHQ A;  3T4K A;  1DRM A;  4UEY A;  4O0P A;  3BJN A;  1TF1 A;  4DJ2 A;  1V9Z A;  1X0O A;  4HH3 A;  2JN7 A;  3NOT C;  3JVU A;  4MN6 A;  1YAX A;  2CMN A;  3LR5 A;  3O5Y A;  1UGU A;  5IT5 A;  2GJ3 A;  3EOI A;  4XT2 B;  3VOL A;  3ZQ5 A;  5A8B A;  4ETZ A;  5IS1 A;  3MF0 A;  2NUT C;  3UB7 A;  3H82 A;  5C5K A;  1F5M A;  2P08 A;  3TJZ C;  4EQ1 A;  3UE6 A;  1OTA A;  2O9C A;  3R7W B;  3SW1 A;  1YSQ A;  1XJ3 A;  1MC0 A;  2OAQ 1;  1JNU A;  3FPW A;  5HDD A;  5J7E A;  2J80 A;  3LR4 A;  2K31 A;  2K7S A;  2JKT I;  3LIB A;  2QJ7 A;  3C38 A;  3NOU C;  3MFX A;  4M4X A;  1GSV A;  1T18 A;  2W3G A;  3PYP A;  5L8M A;  2PT7 A;  4QPR A;  3CWF A;  4WF0 A;  4MDZ A;  1T19 A;  1OTE A;  1MZU A;  1DP6 A;  2ZMF A;  3T4T A;  2OWJ A;  1P97 A;  3BW6 A;  5LBR A;  1BYW A;  3E4P A;  2V1B A;  1XJ4 A;  1NLZ A;  2KX6 A;  4IHQ A;  1IOU A;  4EES A;  3JVV A;  4ME4 A;  2XRO A;  3H7W A;  3LIE A;  3CAX A;  4GHI B;  1LSV A;  3PR6 A;  2B02 A;  2PR6 A;  3ICY A;  1UWN X;  2PD8 A;  5TBM B;  1NRJ A;  3IBR A;  4ARZ B;  1IFQ A;  3R7W A;  3LI9 A;  5F68 A;  2EWV A;  2YKH A;  5HPI A;  2QHK A;  5DF9 A;  5HWT A;  3KSI A;  1D06 A;  2QKP A;  4HNB A;  3TW8 A;  4NXG A;  3D72 A;  1T1A A;  3KYZ A;  4HJ4 A;  1TS0 A;  2HV1 A;  4GCZ A;  4B93 A;  5F5Y A;  1P9W A;  2L1M A;  3V67 A;  2ZOH A;  1LT0 A;  3U2A A;  4NXF A;  4EET B;  3W2Z A;  5DJT A;  4LRX C;  4I38 A;  3FC7 A;  4FOF A;  4BMW A;  4O8G A;  4HP9 A;  5KSH A;  1YKD A;  3E4O A;  3KX0 X;  3EEA A;  2HJ9 C;  3LIF A;  2K2N A;  1P0Z A;  4GHI A;  2L4R A;  4Y2F A;  1T1C A;  3VV4 A;  1WA9 A;  5DKK A;  5TBM A;  3E0Y A;  4R3A A;  2O0Y A;  2VA0 A;  5CX7 A;  1MKM A;  2LB9 A;  3PBR A;  2W3E A;  4WN5 A;  3B47 A;  1S1Z A;  1GSX A;  4F3L A;  3F1N A;  5F6A A;  2GX5 A;  3MR0 A;  5KIZ A;  4G3V A;  3K2N A;  5G4Y A;  2I9V A;  1VHM A;  1NLY A;  4LLO B;  1N9O A;  4LPZ A;  4AFI A;  4HH2 A;  3KSH A;  4I3I A;  2V1A A;  3CUE C;  2JHE A;  2HJE A;  3MJQ A;  3UB6 A;  3R4K A;  4Q0H A;  1T1B A;  3NOP C;  4R70 A;  3UME A;  4HP4 A;  4DN0 A;  4EER A;  2W1T A;  2ZBB A;  1P9R A;  2XA7 S;  4EEP A;  2VX8 A;  2M1C A;  3ZYT A;  3LFV A;  2FH5 A;  3E98 A;  3NJA A;  2PDR A;  4PAU A;  4ETX A;  4II7 A;  5FL3 A;  2VJW A;  3D3O A;  3BQA A;  3T4L A;  1G6O A;  4BBV A;  3OOV A;  2D01 A;  2PYR A;  3K3C A;  2P7J A;  3E4Q A;  2HF6 A;  3RFB A;  3OCL A;  5DJU A;  4WEK A;  2OOL A;  3PBQ A;  2W3H A;  4WL9 A;  4EW7 A;  1Y28 A;  2D02 A;  3A0V A;  5MC7 A;  3RTY A;  3PBT A;  1ZHH B;  5K5B A;  3LIA A;  3B33 A;  3EWK A;  3K3D A;  3S7O A;  2VV8 A;  4WUJ A;  4I39 A;  2PHY A;  5HWW A;  3EEH A;  4KQD A;  2ZMV A;  4GLQ A;  3VE4 A;  1H3Q A;  2PD7 A;  2DMW A;  4XT2 A;  4L9G A;  5HDS A;  4HIA A;  3F1P B;  4Y5F A;  4HOI A;  3LR3 A;  1W63 Q;  3LYX A;  4K08 A;  4KUO A;  1NWZ A;  3IS2 B;  4R38 A;  4NEE D;  1OTB A;  3GDI A;  2XSS A;  4WEL A;  3KO6 A;  5TJJ A;  3EQU A;  3MQQ A;  3RH8 B;  2W27 A;  4KQO A;  2Y8H A;  1STZ A;  3T4J A;  3BQ8 A;  4IJG A;  3CIT A;  5AVE A;  3EQV A;  1OTI A;  5AVF A;  2XA7 M;  2VZW A;  1S66 L;  5HPF A;  3G6O A;  1UWP X;  2WKR A;  4HJ6 A;  2J3W A;  4BBU A;  2LB5 A;  3LID A;  3BY9 A;  5F69 A;  4WEJ A;  4NXE A;  5HL6 A;  4Y3I A;  3TE8 A;  3F1O B;  4LRY C;  3MQO A;  4JGQ A;  2V0W A;  4BBT A;  4MN7 A;  3OCN A;  4CLC C;  4L0L A;  5G4Z A;  2IA2 A;  4GW9 A;  4YOF A;  4KUK A;  2O99 A;  5HDC A;  3EGD C;  5HWV A;  1XJ6 A;  3F1P A;  3DBA A;  3A0S A;  3KYQ A;  4R6L A;  1G28 A;  1S1Y A;  4ARZ A;  1W63 M;  4L9F A;  3BY8 A;  3IS2 A;  2KLI A;  1F9I A;  3HCY A;  2W0N A;  1TS7 A;  4E04 A;  2EWW A;  3BWL A;  2W3F A;  3HJI A;  2P04 A;  3S7Q A;  1XJ2 A;  4OOL A;  2A2L A;  2YKF A;  5DFY A;  2V9A A;  4GS9 B;  4GJ4 A;  4LRZ E;  3FPV A;  4MN5 A;  4DMZ A;  3T4Q A;  2JKR M;  4EUV A;  4HQA A;  1TD5 A;  3T4S A;  3F1O A;  5DKL A;  2VV7 A;  5IU1 A;  1YSP A;  2HGV A;  4DJ3 A;  2W3D A;  4B9O A;  4G3K A;  1S4R A;  4WLA A;  3A0R A;  3FG8 A;  4JGR A;  4O01 A;  4BWI A;  3PHY A;  2PYP A;  1H8M A;  3CUE A;  2GZA A;  4I3A A;  3P01 A;  1N9L A;  2H28 A;  5DFX A;  4HI4 A;  3TRC A;  4JGO A;  3LI8 A;  2VV6 A;  2OAP 1;  4BJP A;  3UMD A;  1OJG A;  4Z1W A;  5J4E A;  4RQ9 A;  5AJG A;  2J3T C;  2VGL S;  3H7W B;  2Z6D A;  3UB8 A;  3P7N A;  1ZTU A;  3LR0 A;  3OLO A;  4L9E A;  4ZRR A;  2JKT M;  2KOI A;  1TS8 A;  4GS9 A;  2M7V A;  4G3W A;  4H6J B;  1XFQ A;  2B18 A;  3LUQ A;  4Q0I A;  2A24 B;  1N9N A;  3UE3 A;  2PR5 A;  5I5L A;  4Q0J A;  2WKP A;  4I3J A;  2FZ0 A;  2EA9 A;  3MQ0 A;  2O9A A;  4MMN A;  3IBJ A;  4EEU A;  1DP8 A;  4UQI S;  5J3W A;  5HD5 A;  3HJK A;  2J3T D;  4HY8 A;  2L0W A;  2ZOI A;  1OT9 A;  1OJ5 A;  3S7P A;  1TS6 A;  4CLC B;  2G7U A;  4YNR A;  4MCW A;  3LIC A;  4I5S A;  4FSF A;  3KSF A;  2V0U A;  1V9Y A;  4P6Z S;  3MMH A;  2BAS A;  1F98 A;  3ULF A;  4JGP A;  2OWH A;  4CLC E;  3C30 A;  1S67 L;  3T50 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...