1XA7A

Crystal structure of the benzylpenicillin-acylated blar1 sensor domain from staphylococcus aureus
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
248
structure length
242
Chain Sequence
ITDYNYKKPLQILDKSKIFGSNSGSFVMYSMKKDKYYIYNEKESRKRYSPNSTYKIYLAMFGLDRHIINDENSRMSWNHKHYPFDAWNKEQDLNTAMQNSVNWYFERISDQIPKNYTATQLKQLNYGNKNLGSYKSYWMEDSLKISNLEQVIVFKNMMEQNNHFSKKAKNQLSSSLLIKKNEKYELYGKTGTGIGKYNNGWFVGYVITNHDKYYFATHLSDGKPSGKNAELISEKILKEMGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Regulatory protein BlaR1
publication title Crystal structures of the Apo and penicillin-acylated forms of the BlaR1 beta-lactam sensor of Staphylococcus aureus.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Signaling protein
total genus 64
structure length 242
sequence length 248
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1xa7A00
1U60A 2ZQ8A 4K91A 1WYBA 3CG5A 3WRZA 3Q7VA 1K55C 2WZXA 4KENB 5GLDA 5JYPA 1YLWA 4JXWA 5HAPA 4QD4A 2HDUA 3UPOA 4C6YA 3ZVWA 4X55A 1E3UD 1E4DA 4JBFA 4WZ5C 3HLFA 3IXHA 4N9KA 3V50A 4FCFA 3UNWA 4R1GA 4ZTKA 1H5XA 2Y4AA 2OLUA 2ZQ9A 5FI2A 3CZDA 4QY5A 4OPYA 2XD5A 3PBOA 4PPRA 1MWSA 4QHCA 1AXBA 2Y2JA 3LCEA 3MZDA 4OPZA 4BL2A 1SDNA 4MNRA 3MBZA 5TFQA 1FR6A 4E6XA 5GHZA 1Y54A 3PBSA 1ES5A 4GKUA 3B3XA 3A3IA 1NYMA 3BFFA 1LHYA 2EX9A 3IF6C 1K38A 3IF6B 2BG1A 2WADA 4N1XA 5A92A 2H5SA 1ESIA 3A3EA 1YLPA 3G35A 4GDBA 4OP5A 4ZJ2A 2Y2HA 4UA7A 1ERQA 4N9LA 3SOIA 5KSHA 5FI7A 2C6WB 3BFEA 4LV2A 3WS1A 3EQVA 1XP4A 3ZNYA 2ZM2A 5M1AA 3WWXA 3N7WA 5CERA 1TDGA 4LCMA 3S1YA 3VOZA 1K54A 1K6SA 1NXYA 1YMSA 3C7VA 3Q07A 3I7JA 5HL1A 3WS0A 3OC2A 4BD1A 1PWDA 2XD1A 4JPMA 1TEMA 1SDEA 4E3LA 1FSYA 4QB8A 1PI5A 5GLAA 3FV7A 3IWOA 5AQBA 3MKEA 1N9BA 1CEFA 1ES4A 1FQGA 2J9OA 1M6KA 4R0QA 4O7DA 4KQOA 3QNBA 2H10A 1K56D 1FCMA 3M6HA 1MBLA 1XA7A 5E2GA 1Q2PA 3SH9A 1SHVA 2I72A 1XXMA 4KZ3A 1HTZA 4ZJ3A 1FCNA 1GHMA 2A49A 5HX9A 4P85A 4Q8IA 3HLGA 3DWZA 3DTMA 3GR2A 5KMWA 1IYQA 3NC8A 5EOOA 1S6RA 1YLYA 2HP6A 5E2EA 3BM6A 4F94A 2XR0A 4WEKA 3D4FA 4PM5A 4KG5A 3O86A 4PM7A 1K6RA 5F82A 3BRMA 1WYCA 1L2SA 3PBNA 3ZNTA 4UA9A 4ID4A 2RL3A 3N8LA 5EVID 3N8RA 3VP3A 4ZAMA 4X68A 1YLZA 2QPNA 4GB7A 3Q7ZA 4KZ8A 3SS4A 1LL5A 4P87A 3WS2A 1PWGA 1NYYA 3MZEA 3IH8A 3IWIA 1WE4A 4QY6A 4WMCA 2ZQAA 5E43A 3A3JA 2J9PA 4N92A 3BFGA 5EECA 1TDLA 3CJMA 1HD8A 1KVMA 3UE0A 1ZC2A 4OOYA 4EQIA 1I2WA 3HLWA 1N4OA 2Y2KA 1QMEA 1XX2A 3HLCA 3HUMA 1IYPA 2X02A 3VP4A 3C5AA 1DJCA 2ZJ9A 2ZQDA 1E25A 3Q81A 4E6WA 3FZCA 3VOYA 2EFXA 1NY0A 1YMXA 5CGWA 1FOFA 2QZ6A 3VFHA 4P0MA 2XQZA 3UDXA 1KDWA 2EX6A 1K57A 2HP9A 1MWUA 2A3UA 2XH9A 4KZ9A 2Y2IA 1LI9A 5FAQA 1CK3A 2WGWB 1G68A 2P9VB 1PYYA 3DW0A 4E3JA 1NJ4A 3HREA 5GL9A 3VSLA 4S2OA 2P74A 4UAAA 5FATA 4DF6A 4OH0A 5GHYA 3NBLA 4E3IA 5DTSA 4X69A 3SS5A 3QNCA 3OCNA 5CGXA 3WS4A 5HFOA 4R4RA 4R4SA 4P6BA 3ZG8B 1BLCA 4IVKA 3ZG5A 4OQIA 2WZZA 2ZQCA 4KZ6A 1K25A 5FQKA 3UDIA 4B4XA 3E2KA 1DY6A 2JCHA 4PMAA 3WS5A 3Q7VB 4FSFA 4JF5A 5CHMA 1DJAA 4KZ4A 3NDEA 3VMAA 2JE5A 5EUAA 1KDSA 4JXVA 3BFCA 4OKPA 2XGNA 1NZOA 1KE0A 5GLBA 3TOIA 2PU4A 1JVJA 3O3VA 3UPPA 4QU3A 3A3DA 3GMWA 1J9MA 3NCKA 4KZAA 2EXBA 2XEPA 4MBHA 1CEGA 2ZC7A 4LV0A 2JBFA 1K55A 3PTEA 2OV5A 5CGSA 3GV9A 1O07A 4OLDA 2ZMAA 4UA6A 4DE3A 2Y2PA 5FQQA 3UPNA 5M19A 1ONGA 4E3OA 4KZBA 3LEZA 4XUXA 4OOMA 3UE3A 1FCOA 3NDGA 2Y91A 4IVIA 3UN7A 3FKWA 4H8RA 2ZQ7A 4K0WA 2XLNA 2Q9NA 1RP5A 1BLHA 3V5MA 2X71A 2G2UA 1OMEA 2WKEA 4WM9A 1BLSA 1KVLA 3O87A 4GD8A 1YT4A 1W5DA 3SH7A 1H8ZA 1YLTA 5CRFA 2Z2LB 5AQAA 2GDNA 4GN2A 3GQZA 1FR1A 3VSKA 3BFDA 5E2HA 2H0YA 1K54C 3W8KA 1GHIA 2EX2A 2WGIA 4KG2A 3P09A 2Y55A 3GSGA 4S2NC 3S22A 5M18A 5HAQA 1L0DA 1Z6FA 3RJUA 3G34A 3W4QA 4PM6A 1IKGA 1RCJA 3NIAA 4S2MA 4N1HA 2WYXA 4U3TA 3C7UA 3G4PA 1H8YA 1XGIA 3A3FA 2DRWA 3HBRA 1LL9A 1ALQA 3AGDA 4B4ZA 4BD0A 5A90A 3FKVA 3IXBA 1K4FA 4KQQA 4EBNA 3MKFA 1HZOA 3HL9A 2HP5A 4MEZA 3NY4A 1XA1A 4WEJA 4JXGA 5JYOA 2WAEA 4M3KA 4KZ7A 4R3JA 4WMCD 3M2JA 1IEMA 4GZBA 4LV3A 5CTMA 5FSRA 5G18A 3ZVTA 3GRJA 4NK3A 4WZ4A 4PM9A 1PZOA 2E8IA 4JXSA 4RX3A 4S2IA 5FI6A 4DE1A 3BEBA 2Y2QA 4GD6A 3Q82A 4UHUA 5A93A 2UWXA 4EUZA 4S2PA 1ES3A 2DNSA 5DTTA 2Y2OA 4JLFA 1VQQA 4R3BA 2Y2LA 3N4IA 1IELA 5BOHA 1W8QA 1YM1A 4R23A 3FYZA 3VFFA 2EX8A 3ZDJA 5EVIC 4HESA 4XUZA 5EVIB 4Y0UA 4OLGA 5IHVA 1GCEA 1O7EA 2OSUA 1HVBA 5A91A 4KZ5A 1LI0A 5CHJA 2B5RA 3N8SA 3S4XA 3ZHHA 4CPKA 3HUOA 3OPRA 2BLSA 5F1FA 1CI9A 1GA0A 4IBRA 4U0TA 4U0XA 4BL3A 3PBQA 2XDMA 4JF6A 5E2FA 1FSWA 2ZC5B 4DDSA 1RGYA 4ZDXA 1TVFA 2WKHA 4XXRA 2WGVA 3MXSA 4OONA 1JWZA 4BENA 3CMZA 2WKIA 5DF9A 5EOEA 4RYEA 4EBPA 4ZJ1A 1ONHA 4JKTA 5GLCA 5GHXA 3UO9A 5FASA 1RGZA 1IYOA 1NRFA 4JF4A 3VP0A 4RVAA 1MPLA 2VGJA 4C75A 3RXXA 4LENA 1JWPA 2J8YA 3IHBA 2V20A 1PIOA 2WGWA 2XK1A 2P9VA 1PW8A 3Q1FA 4DDYA 1DJBA 4MBFA 5TGFA 1VM1A 4IBXA 1C3BA 4E3NA 1IKIA 3BECA 5HW3A 3LY3A 3G32A 1BSGA 1M40A 1KE3A 3VP2A 1EWZA 4OOLA 1PI4A 1QMFA 1ZKJA 3NI9A 3ZFZA 1GHPA 5FQJA 3SH8A 2HDRA 3IXGA 5L2FA 2V1ZA 3IF5A 1XPBA 2VGKA 4S2KA 4L0LA 3V39A 1BUEA 1MWRA 1PW1A 4PM8A 4DE2A 2PBYA 2Y2MA 5CEDA 4GOGA 4WZ5A 3BLMA 1CI8A 3ISGA 3ITAA 3PBRA 4E3MA 2HPBA 2WAFA 2ZM0A 2PU2A 4OPQA 2EFUA 2EXAA 3PBTA 5CEBA 2FFYA 3TSGA 5KSCA 3G2YA 1SKFA 5FQMA 4Y0OA 3RXWA 4QJGA 5CHUA 4D2OA 4NETA 4S2LA 4HBTA 5FAOA 2ZC6B 1S0WA 4EBLA 2IWBA 1JTGA 2ZLYA 3PAEA 1E3UA 1YQSA 3IF6A 1XKZA 4RX2A 3ZG9B 5J8XA 3OPHA 4FH2A 3OCLA 1ES2A 3PAGA 2H0TA 4BLMA 2ZC3B 2HDQA 2Z2MB 3G31A 3IQAA 2WK0A 4MBKA 4CJNA 3OPLA 4OVDA 4E3KA 2Y2NA 1MY8A 2XFTA 2RCXA 3HLDA 5FAPA 3QHYA 3UDFA 3OZHA 4EWFA 4X6TA 3MFDA 3BYDA 5F83A 3EQUA 1NZUA 3HVFA 1G6AA 3HLEA 5FA7A 3SS3A 3O88A 1SCWA 1Q2QA 4BQMA 3FWLA 3W4OA 5F1GA 5EVLA 3E2LA 4KQRA 1BULA 2ZC4B 3HLBA 1EROA 1ESUA 4K0XA 4S2NA 3VP1A 1BT5A 5EE8A 1BZAA 1L0FA 2Y59A 5U47A 2R9XA 1L0EA 1KGGA 2V2FF 4FD8A 5FQIA 4DXBA 2QMIA 3MXRA 4Y7PA 2ZD8A 3C4PA 5FDHA 1MKIA 3LO7A 3IHAA 4HBUA 4OQHA 5HAIA 4Y0TA 5FQ9A 3ZGAB 2HDSA 2X01A 5I94A 3IXDA 5HARA 4DKIA 5CTNA 5D3OA 1W8YA 1I2SA 3C4OA 4ZBEA 3MZFA 4X53A 5AQ9A 3UE1A 3GVBA 4OPRA 1K4EA 2Q9MA 1EI5A 4BJPA 1ZG6A 1JWVA 4RA7A 1BTLA 3GTCA 5DF8A 5TR7A 3G30A 3ZG7B 1IYSA 1K56A 3WRTA 4EV4A 5DTKA 3ITBA 1I5QA 4MLLA 1GA9A 5CECA 1KGEA 2CC1A 2ZM8A 2J7VA 4WBGA 4DRTA 2IWDA 3ZG0A 1W79A 1ZG4A 3W4PA 4FH4A 1LLBA 1PZPA 5CXWA 1L0GA 2R9WA 1BLPA 1K57C 3P98A 3DWKA 4KG6A 4X56A 5EVIA 4HEFA 3JYIA 3UY6A 4C3QA 5DVAA 4LCLA 4OQGA 4B88A 4OQ0A 1MWTA 3N6IA 3G2ZA 4DXCA 1JTDA 1YLJA 4LV1A 4A5RA 4WYYA 4YINA 2G2WA 4DE0A 4GNUA 2C5WB 3LY4A 4YFMA 4Z9QA 2XFSA 3V3RA 3V3SA 2Y2GA 4GDNA 2OLVA 4S2JA 1ERMA 2WUQA 3BLSA 3IT9A 3M6BA 3IWQA 1PWCA 3TG9A 3M2KA 2IWCA 3AGFA 3AGEA 5EPHA 2FFFB 2JC7A 1W7FA 3ZCZA 4OP8A 1KGFA 1XGJA 1KE4A 4IEDA 4WELA 5AQ7A 3IH9A 2DCFA 5KZHA 3HUNA 3OPPA 1MXOA 2XF3A 5DF7A
chains in the Genus database with same CATH superfamily
1U60A 1K55C 5GLDA 3LICA 3RH8B 4JXWA 3IS2A 2V0UA 3BQ8A 5L10A 1E4DA 2P04A 4JBFA 3UNWA 1SZVA 1LL8A 4Y13A 4R1GA 4ZTKA 4HNBA 4QHCA 4BL2A 3PBSA 4GKUA 3BFFA 1HLUP 2J3TC 3UMDA 1A0KA 2K2NA 1YLPA 4GDBA 4OP5A 2D02A 4N9LA 4UA7A 4I3AA 2O0YA 3K3CA 3BFEA 3WS1A 4UQIM 3G6OA 2WKRA 5CERA 3S1YA 1K6SA 3C7VA 3TJZC 2OAQ1 5HL1A 3OC2A 2BASA 3E98A 4BD1A 3IX3A 2XD1A 1TEMA 4E3LA 4R38A 5HPFA 4QB8A 1PI5A 3L7HA 1S67L 3QNBA 1K56D 2H10A 1XA7A 2PD8A 3SH9A 4KZ3A 4I38A 1HTZA 1GHMA 4HI4A 4P85A 5KMWA 1IYQA 3NC8A 5E2EA 4WEKA 3PBNA 3N8LA 5HPIA 2EWWA 3Q7ZA 4KZ8A 3WS2A 1UGUA 3IH8A 5E43A 2J9PA 3HLWA 3E4OA 4FOFA 3Q81A 3FZCA 2GZAA 1G6OA 1FOFA 3NHQA 3LR4A 2XQZA 3UDXA 2M1CA 3PR6A 1N9NA 4CLCD 1LT0A 2A3UA 5TBMA 4HHDA 1LI9A 1V9ZA 1CK3A 2WGWB 1PYYA 4JGQA 1CF0A 1NJ4A 3HREA 2XSSA 4X69A 3QNCA 5K5BA 5HL6A 1GSWA 4R4RA 4R4SA 4P6BA 1YSQA 1F9IA 4BWIA 4OQIA 3VOLA 5CHMA 4KZ4A 4IUHA 1KE0A 2LB5A 3KSFA 2PD7A 3O3VA 2JKRM 2VGLS 4IHQA 3A3DA 3GMWA 5HWTA 2OWJA 3NCKA 1YKDA 4KZAA 1CEGA 4LV0A 1K55A 1OTIA 4WL9A 5CGSA 4I5SA 1O07A 4UA6A 1DRMA 3UPNA 3BWLA 1ONGA 2HV1A 2QKPA 3NDGA 1JNUA 3E4QA 3FKWA 3LIDA 3U2AA 4K0WA 1LSXA 1F98A 1YAXA 2G2UA 1BLSA 1W5DA 3SH7A 1YLTA 5CRFA 2GDNA 1FR1A 3BFDA 3CHWP 3W8KA 3MMHA 4KG2A 3GSGA 3S22A 4B9OA 3RJUA 3G34A 2JKTM 4HH3A 1XGIA 2V1BA 3A3FA 1LL9A 4B4ZA 4LRZE 3MS6A 1K4FA 4LRYC 4KQQA 3IBRA 4MEZA 2HP5A 4WEJA 5FSRA 3M2JA 3ZVTA 4NK3A 3C30A 2E8IA 4RX3A 4Y5FA 5FI6A 2O99A 1ACFA 5A93A 4EUZA 3W2ZA 3LIAA 4PKYA 1W8QA 3T4TA 4FTXA 3MR0A 5EVIC 5EVIB 3KO6A 5TJJA 4Y0UA 3O5YA 3QP1A 2B5RA 4WUJA 3ICYA 3HUOA 4CPKA 4IBRA 4U0XA 2XDMA 1FSWA 3MXSA 5DF9A 2WKIA 2INWA 1TS6A 4I3IA 4JKTA 5GHXA 1RGZA 4RVAA 1MPLA 1JWPA 2J8YA 5G4ZA 2WGWA 4UEYA 4DDYA 4G3WA 5HDSA 3LGOA 1ZHHB 3VP2A 3RTYA 1PI4A 4EETB 1GHPA 2B18A 5FQJA 3SH8A 1OT9A 2V8FA 2V1ZA 3IF5A 1TS8A 3V39A 2FZ0A 2Y2MA 4GOGA 4WZ5A 3BY8A 1CI8A 3ISGA 3SW1A 3ITAA 1NLZA 2J3TD 3G2YA 5CHUA 4LRXC 4D2OA 4S2LA 3RFBA 5FAOA 2OWHA 1XJ4A 3ZG9B 3PAEA 3EEAA 1ES2A 2H0TA 2HJ9C 2VK3A 3HCYA 4OVDA 3HLDA 3OZHA 3MQOA 3QP2A 5F1GA 3E2LA 1EROA 2LB9A 4K0XA 3R4KA 3DBAA 3F1OB 3CPTB 1L0FA 2R9XA 5FQIA 2W0NA 5FDHA 3IXDA 1WA9A 5D3OA 4DJ2A 3GVBA 1FILA 4OPRA 1K4EA 1N9LA 4BJPA 4RA7A 5DF8A 3S7QA 3GTCA 3KYQA 4EV4A 3ITBA 1I5QA 2ZM8A 2J7VA 4WBGA 3LEQA 1OTEA 2IWDA 4HJ6A 3B47A 4FH4A 2R9WA 1BLPA 1K57C 2Y8HA 5EVIA 1OTDA 4NXEA 1MWTA 1JTDA 1YLJA 3VV4A 4A5RA 4YINA 2G2WA 3V3RA 5M18A 4S2JA 1S1ZA 2OLVA 5FEGA 3TG9A 3D3OA 2FFFB 2JC7A 3ZCZA 4OP8A 4WELA 5AQ7A 5KZHA 5FAPA 1WYBA 3CG5A 3WRZA 3Q7VA 3UB9A 2WZXA 5JYPA 3UPOA 3T1QB 4PKYG 3EGXC 5FI2A 2Y4AA 2OLUA 3CZDA 4OPYA 2O9BA 3PBOA 4PPRA 3LCEA 2Y2JA 1SDNA 3MBZA 5TFQA 5GHZA 3T1XA 2MJ6A 2EX9A 5A92A 2H5SA 3A3EA 5IU1A 4GW9A 3LI9A 1ERQA 3SOIA 3KYZA 5FI7A 2ZM2A 3WWXA 1NXYA 3Q07A 1H8MA 3WS0A 1PWDA 2ZMVA 2H28A 1FSYA 3T4SA 1ES4A 3T50A 4DJ3A 4O7DA 3FPWA 3BW6A 4ZJ3A 4EXOA 2A49A 5HX9A 4NG2A 3F1OA 3CPTA 3GR2A 5I5LA 4DMZA 5EOOA 2O9AA 4F94A 2HP6A 2XR0A 2QJ5A 2VX8A 3O86A 4PM7A 1K6RA 3QP6A 1WYCA 1L2SA 1T18A 2BTFP 5EVID 3C38A 3C8CA 4Q0HA 4X68A 1YLZA 4HH2A 3SS4A 3MZEA 4WMCA 1TF1A 3A3JA 1L3LA 4N92A 3U4LP 3UE0A 4OOYA 4EQIA 1I2WA 2Y2KA 1QMEA 5CX7A 1IYPA 2X02A 3VP4A 1DJCA 2ZQDA 1E25A 1GSXA 1NY0A 5CGWA 2QZ6A 4P0MA 2Z6CA 1XFNA 1K57A 4KZ9A 2Y2IA 1DP9A 2P9VB 5GL9A 4S2OA 4DF6A 3JVUA 4OH0A 4E3IA 1PFLA 3OCNA 3LYXA 2W3DA 4IVKA 2ZQCA 4KZ6A 1DY6A 1XFQA 2JCHA 4PMAA 1VEUA 3B42A 4JF5A 4HOIA 2JE5A 1KDSA 4JXVA 2XGNA 3UB5P 1NZOA 3MSHA 3TOIA 3NOTC 2XRNA 5HDCA 2OV5A 4DE3A 4KZBA 3CAXA 3UE3A 1FCOA 2YKHA 2Y91A 3NULA 4BBUA 2XLNA 4WF0A 1RP5A 3V5MA 1OMEA 1KOUA 1YT4A 3NOUC 4GN2A 3GQZA 1P97A 2H0YA 1K54C 2EX2A 4EESA 2WGIA 2Y55A 3F1NB 5EVEA 1L0DA 4KUKA 4PM6A 1RCJA 4S2MA 2Y79A 3B33A 3C7UA 3G4PA 1H8YA 2QJ7A 2DRWA 3HBRA 1SKOB 3AGDA 2HZ5A 3IXBA 3MKFA 1HZOA 3UMEA 3HL9A 4JXGA 4M3KA 2PRFA 4WMCD 4R70A 3GRJA 4PM9A 1PZOA 4JXSA 3BEBA 4CQHA 2GNXA 4EEPA 4UHUA 2UWXA 4JGPA 2ZL1B 1ES3A 2DNSA 4JLFA 4BMWA 1IELA 4R23A 2WKQA 4NEED 1OTBA 4HESA 1O7EA 5IT5A 5F1FA 4K08A 1CI9A 3PYPA 4U0TA 4BL3A 4KQDA 3VE3A 4EQ1A 1RGYA 5HWVA 4OONA 1T1CA 4BENA 3LUQA 4RYEA 4ETXA 5GLCA 4C75A 4YWZA 3IHBA 1W63Q 2P9VA 2XA7M 1PW8A 4ETZA 4MBFA 5TGFA 1W63M 4E3NA 3MJQA 4L9FA 4GS9B 3FC7A 1OT6A 1QMFA 5F69A 3IXGA 5L2FA 5HDDA 1XPBA 1MWRA 4DE2A 5F6AA 3BLMA 3LIEA 4E3MA 2K7SA 2EXAA 1CQAA 3TSGA 4ESPA 5KSCA 3RXWA 5HD3A 1E3UA 2A24B 3OCLA 2ZC3B 2J80A 2HDQA 2Z2MB 4CJNA 4E3KA 2Y2NA 2XFTA 3QHYA 4L9GA 3UDFA 3BYDA 4LPZA 3HVFA 2KDKA 1SCWA 4BQMA 3W4OA 3HLBA 2W3FA 4D60A 1VETB 1T1BA 3JVVA 4DXBA 2V2FF 1KGGA 3OOVA 1TD5A 1MKIA 3LO7A 4Y0TA 5FQ9A 3ZGAB 5I94A 5CTNA 4X53A 3FPVA 2Q9MA 1Y4OA 1X0OA 5DKKA 5TR7A 3ZG7B 3WRTA 2HGVA 1GA9A 5A8BA 1OTAA 2ACGA 2ZL1A 4L9EA 3P01A 1W79A 2PAVP 3H9WA 4GLQA 3UB6A 3MXQA 2OAP1 4OQGA 5J7EA 4B88A 4OQ0A 3G2ZA 4LV1A 3LFVA 1MKMA 4DE0A 4YFMA 3V3SA 5L07A 2Y2GA 3BLSA 3M6BA 4QPRA 3M2KA 2IWCA 3AGFA 1NLYA 4HQAA 1KGFA 3F1PB 4IEDA 2L4RA 1GSVA 1TS0A 4K91A 2ZQ8A 3E0YA 3VE4A 4GS9A 5FDSA 1E3UD 2KLIA 3HLFA 3IXHA 4N9KA 3V50A 4FCFA 5F68A 2Q0OA 1D06A 4QY5A 2XD5A 4DRTA 1MWSA 3MZDA 4MNRA 5DFXA 5EFWA 4E6XA 2R78A 1ES5A 3A3IA 3IF6C 3IF6B 3MQ0A 5AJGA 4X25A 3G35A 4ZJ2A 1P0ZA 2Y2HA 3JPUA 2W3GA 1VB6A 2C6WB 3CLOA 3BY9A 1XP4A 2K31A 5M1AA 3NOPC 4LCMA 2A24A 3VOZA 3H82B 1YMSA 3EEHA 3I7JA 3TRCA 4PAUA 4DN0A 4R6LA 4JPMA 1SDEA 2VA0A 2KX6A 5GLAA 5AQBA 4EEUA 5EV0A 1N9BA 1ODVA 3T12B 1FQGA 3IX4A 2P7JA 4R0QA 4KQOA 3K3DA 1FCMA 4NXFA 5E2GA 2VJWA 1SHVA 2QWSA 1FCNA 4GHIB 4HJ4A 3BM6A 4KG5A 4KUOA 1NRJA 3BRMA 3ZNTA 4G3VA 4UA9A 4ID4A 2RL3A 4LLOB 3TW8A 2VV8A 3A0SA 4P87A 3S7OA 3CUEC 1WE4A 2ZQAA 3S7NA 3BFGA 5EECA 3ZQ5A 1TDLA 3CJMA 4HY8A 1KVMA 1N4OA 5HD5A 1XX2A 3HLCA 3HUMA 2ZJ9A 3EOIA 2EFXA 3K2NA 1YMXA 2JN7A 4O8GA 1KDWA 2EX6A 5FAQA 1G68A 4YNRA 3DW0A 4Z1WA 3VSLA 2P74A 5DTSA 3SS5A 1EW0A 5CGXA 3DTIA 4CLCC 3ZG8B 4CLCB 4YOFA 1BLCA 2I9VA 3ZG5A 5AVFA 2WZZA 2JKGA 5FQKA 3UDIA 4P6ZS 3WS5A 4FSFA 3NDEA 5L8MA 1P9WA 4ZRRA 3BFCA 4OKPA 5GLBA 3F1PA 4XT2B 2PU4A 4HP9A 4M4XA 1J9MA 2XEPA 1XJ6A 3GV9A 4OLDA 2Y2PA 5FQQA 5M19A 4H8RA 2Q9NA 2X71A 2WKEA 1S1YA 2B95A 1K0KA 1H8ZA 2Z2LB 1D7EA 3VSKA 5E2HA 4QWOA 1STZA 4UQIS 3P09A 4S2NC 5HAQA 3HJIA 1IKGA 3H7WB 3NIAA 4N1HA 4U3TA 3KX0X 3H82A 1DP6A 1ALQA 3OBFA 4Y15A 3NY4A 2WAEA 4KZ7A 4GZBA 4LV3A 1OJGA 4X1MA 2B02A 1FIKA 4CLCE 4S2IA 2J3WA 4DE1A 2Y2QA 3Q82A 2PYPA 4S2PA 4ME4A 2Y2OA 1VQQA 2Y2LA 3OLOA 4GHIA 5FL3A 3N4IA 5BOHA 3FYZA 3VFFA 4HP4A 4XUZA 1GCEA 2OSUA 1HVBA 1F2KA 4KZ5A 1LI0A 3LIFA 3S4XA 3CUEA 2KOIA 3PBQA 2W3HA 4JF6A 3QP8A 4H6JB 5E2FA 1Z09A 2YKFA 3FG8A 4ZDXA 3LIBA 3LR5A 3T4LA 3CMZA 5EOEA 1S4SA 1ONHA 4G3KA 5FASA 3UO9A 1NRFA 2P08A 2VGJA 5HSQA 4LENA 3DTEA 5AVEA 2V20A 2XK1A 3P7NA 4IBXA 3PHYA 1MC0A 3BECA 3LY3A 3G32A 1M40A 2M7VA 1KE3A 4OOLA 1ZKJA 2W3EA 3NI9A 3T4KA 3ZFZA 2G7UA 2HF6A 3D72A 4L0LA 2PR6A 1CJFA 1BUEA 4PM8A 3KSGA 3CI6A 5CEDA 2ZM0A 4XT2A 2EFUA 4MDZA 3GDIA 3PBTA 5CEBA 4Y0OA 1S0WA 4EBLA 2IWBA 1JTGA 2ZLYA 1YQSA 1XKZA 4EU0A 5J8XA 3OPHA 3IQAA 2WK0A 4MBKA 3OPLA 1MY8A 2V8CA 4EWFA 4X6TA 3MFDA 5F83A 4GCZA 1G6AA 3HLEA 3SS3A 3O88A 1Q2QA 3FWLA 5EVLA 4KQRA 1BULA 2ZC4B 3T4OA 1ESUA 4S2NA 3VP1A 1BZAA 3H7WA 2Y59A 4FD8A 1L0EA 2PDRA 4Y7PA 2PR5A 2ZD8A 3C4PA 5DJTA 5HAIA 4HBUA 2X01A 5HARA 3NECA 1W8YA 1I2SA 5J3WA 3C4OA 3UE1A 5KIZA 1EI5A 3LI8A 1J3WA 2IA2A 1JWVA 1IYSA 1LSWA 2ZMFA 4MLLA 3MF0A 5CECA 3V67A 5IS1A 1TS7A 1ZG4A 5CXWA 3P98A 1P9RA 1DP8A 2JHEA 4HEFA 3UY6A 5DVAA 4LCLA 2V9AA 5MC7A 4DXCA 2PYRA 1IOUA 4Y2FA 1MZUA 4GNUA 4H6JA 4Z9QA 2XFSA 4GDNA 3GECA 3BJNA 1PWCA 2EA9A 5EPHA 4Y17A 4AFIA 1W7FA 1G28A 1XGJA 3IH9A 2AVXA 3R7WB 5DF7A 3IBJA 4KENB 1YLWA 5HAPA 4QD4A 2HDUA 3T1RA 1UWPX 4C6YA 3ZVWA 4X55A 2EWVA 4F3LB 2VV6A 4WZ5C 1H5XA 2ZQ9A 3ZYTA 2V0WA 3ULFA 1AXBA 4OPZA 5LBRA 4RQ9A 1FR6A 1Y54A 2ZBBA 3C2WA 3B3XA 1H3QA 1NYMA 1LHYA 1K38A 2BG1A 2WADA 4N1XA 4Y3IA 1ESIA 4PHTA 2QYBA 4WN5A 5KSHA 1T19A 3DAVA 2DMWA 1D1JA 4LV2A 3EQVA 3ZNYA 4MMNA 3N7WA 1TDGA 1K54A 5DJUA 3MFXA 2NUTC 4IJGA 3F1NA 3UE6A 4B93A 3FV7A 3IWOA 3E4PA 2PT7A 3MKEA 2UV0E 1G5UA 1CEFA 2O9CA 1S4RA 2W27A 2J9OA 1M6KA 3T1SA 1SKOA 3M6HA 1MBLA 1Q2PA 2V1AA 2I72A 5FEFA 1XXMA 3EWKA 4Q8IA 3HLGA 3DWZA 3DTMA 1S6RA 1YLYA 4PM5A 3D4FA 5F82A 5DKLA 2W1TB 3N8RA 3VP3A 4ZAMA 2QPNA 4GB7A 3QP5A 1LL5A 1PWGA 2L1MA 1NYYA 4I39A 3IWIA 4QY6A 3A0RA 1HD8A 1ZC2A 1XJ3A 2ZOIA 3C5AA 4E6WA 3VOYA 2WKPA 4NXBA 3T4QA 3VFHA 2HP9A 1MWUA 2XH9A 4FUWA 3UB7A 5HWWA 4E3JA 2A2LA 5FATA 4UAAA 5GHYA 3NBLA 2L0WA 1AWIA 3HJKA 3WS4A 5HFOA 1K25A 1XJ2A 1VHMA 4B4XA 3E2KA 3Q7VB 2VGLM 3LR3A 1DJAA 3VMAA 5EUAA 1JVJA 2VLGA 3UPPA 4QU3A 3R7WA 4WLAA 1YSPA 4NXGA 2EXBA 2VZWA 4MBHA 2ZC7A 2JBFA 4LGWA 3PTEA 2VKSA 2ZMAA 3KSHA 4Q0JA 4E3OA 4F3LA 3LEZA 4XUXA 4OOMA 2OOLA 4IVIA 3UN7A 2ZQ7A 3CITA 3SZTA 1BLHA 2JKRI 4WM9A 1KVLA 3O87A 4GD8A 2E8JA 4NKPA 5AQAA 4R3AA 3MQQA 1GHIA 5EM0A 1Z6FA 1IFQA 1UWNX 3W4QA 2M7UA 5C5KA 2WYXA 4MN5A 1T1AA 2W1RA 1LSVA 2HJEA 4BD0A 5A90A 1Y28A 3FKVA 1VETA 4EBNA 5JYOA 1XA1A 4R3JA 1IEMA 1V9YA 5CTMA 5G18A 4EERA 4WZ4A 2JKTI 4ARZB 4GD6A 3CWFA 5DTTA 4JGRA 2FH5A 4EW7A 4R3BA 5L09A 3TE8A 1YM1A 2EX8A 3ZDJA 4E04A 2W1TA 4OLGA 2VEAA 4IUKA 5IHVA 3S7PA 5A91A 5CHJA 3N8SA 3ZHHA 3OPRA 2BLSA 5DFYA 4HJ3A 1GA0A 3UB8A 4DDSA 2ZC5B 1TVFA 2WKHA 4XXRA 2WGVA 1JWZA 4EBPA 4ZJ1A 1IYOA 4JF4A 3VP0A 3RXXA 1PIOA 3PXPA 3D9YA 3Q1FA 4II7A 1DJBA 1VM1A 1C3BA 1IKIA 5HW3A 1VEUB 3IS2B 1BSGA 1H0MA 1EWZA 5F5YA 2HDRA 2D01A 2VGKA 4HIAA 4S2KA 1PW1A 1PNEA 2PHYA 3A0VA 2PBYA 3PBRA 2HPBA 2WAFA 2PU2A 2NUPC 4OPQA 3IX8A 2FFYA 1SKFA 5FQMA 4QJGA 4NETA 4HBTA 2ZC6B 3IF6A 4RX2A 2CMNA 4X1LA 3QP4A 4FH2A 2VV7A 1YPRA 2JKFA 3PAGA 4BLMA 3G31A 2RCXA 3EQUA 4EUVA 1NZUA 4JGOA 5FA7A 4MCWA 2PBDP 4O0PA 5J4EA 1N9OA 3DTKA 1BT5A 1F5MA 5EE8A 3NJAA 5U47A 2QMIA 3MXRA 4BBTA 3T4JA 2Z6DA 1NWZA 3IHAA 4OQHA 2HDSA 4DKIA 2GX5A 4ZBEA 3MZFA 5AQ9A 3L9KA 3KYEA 1ZG6A 1BTLA 4I3JA 1PRQA 3G30A 1K56A 3EGDC 4ARZA 2XROA 4MN6A 5DTKA 1OJ5A 2GJ3A 1KGEA 2CC1A 4MN7A 5EM1A 3ZG0A 3KSIA 3W4PA 1LLBA 1PZPA 4Q0IA 1L0GA 5TBMB 3DWKA 1OPXA 4KG6A 4O01A 2ZOHA 4X56A 3JYIA 4C3QA 4GJ4A 3N6IA 1BYWA 2QHKA 4WYYA 5G4YA 2C5WB 3LY4A 1ERMA 2WUQA 3IT9A 3IWQA 4BBVA 5HZHA 1ZTUA 3AGEA 3BQAA 2XA7S 4LFUA 4CLCA 3LR0A 1KE4A 4P6ZM 1S66L 2DCFA 3HUNA 3OPPA 1MXOA 2XF3A
chains in the Genus database with same CATH topology
1U60A 2ZQ8A 4K91A 1WYBA 3CG5A 3WRZA 3Q7VA 1K55C 2WZXA 4KENB 5GLDA 5JYPA 1YLWA 4JXWA 5HAPA 4QD4A 2HDUA 3UPOA 4C6YA 3ZVWA 4X55A 1E3UD 1E4DA 4JBFA 4WZ5C 3HLFA 3IXHA 4N9KA 3V50A 4FCFA 3UNWA 4R1GA 4ZTKA 1H5XA 2Y4AA 2OLUA 2ZQ9A 5FI2A 3CZDA 4QY5A 4OPYA 2XD5A 3PBOA 4PPRA 1MWSA 4QHCA 1AXBA 2Y2JA 3LCEA 3MZDA 4OPZA 4BL2A 1SDNA 4MNRA 3MBZA 5TFQA 1FR6A 4E6XA 5GHZA 1Y54A 3PBSA 1ES5A 4GKUA 3B3XA 3A3IA 1NYMA 3BFFA 1LHYA 2EX9A 3IF6C 1K38A 3IF6B 2BG1A 2WADA 4N1XA 5A92A 2H5SA 1ESIA 3A3EA 1YLPA 3G35A 4GDBA 4OP5A 4ZJ2A 2Y2HA 4UA7A 1ERQA 4N9LA 3SOIA 5KSHA 5FI7A 2C6WB 3BFEA 4LV2A 3WS1A 3EQVA 1XP4A 3ZNYA 2ZM2A 5M1AA 3WWXA 3N7WA 5CERA 1TDGA 4LCMA 3S1YA 3VOZA 1K54A 1K6SA 1NXYA 1YMSA 3C7VA 3Q07A 3I7JA 5HL1A 3WS0A 3OC2A 4BD1A 1PWDA 2XD1A 4JPMA 1TEMA 1SDEA 4E3LA 1FSYA 4QB8A 1PI5A 5GLAA 3FV7A 3IWOA 5AQBA 3MKEA 1N9BA 1CEFA 1ES4A 1FQGA 2J9OA 1M6KA 4R0QA 4O7DA 4KQOA 3QNBA 2H10A 1K56D 1FCMA 3M6HA 1MBLA 1XA7A 5E2GA 1Q2PA 3SH9A 1SHVA 2I72A 1XXMA 4KZ3A 1HTZA 4ZJ3A 1FCNA 1GHMA 2A49A 5HX9A 4P85A 4Q8IA 3HLGA 3DWZA 3DTMA 3GR2A 5KMWA 1IYQA 3NC8A 5EOOA 1S6RA 1YLYA 2HP6A 5E2EA 3BM6A 4F94A 2XR0A 4WEKA 3D4FA 4PM5A 4KG5A 3O86A 4PM7A 1K6RA 5F82A 3BRMA 1WYCA 1L2SA 3PBNA 3ZNTA 4UA9A 4ID4A 2RL3A 3N8LA 5EVID 3N8RA 3VP3A 4ZAMA 4X68A 1YLZA 2QPNA 4GB7A 3Q7ZA 4KZ8A 3SS4A 1LL5A 4P87A 3WS2A 1PWGA 1NYYA 3MZEA 3IH8A 3IWIA 1WE4A 4QY6A 4WMCA 2ZQAA 5E43A 3A3JA 2J9PA 4N92A 3BFGA 5EECA 1TDLA 3CJMA 1HD8A 1KVMA 3UE0A 1ZC2A 4OOYA 4EQIA 1I2WA 3HLWA 1N4OA 2Y2KA 1QMEA 1XX2A 3HLCA 3HUMA 1IYPA 2X02A 3VP4A 3C5AA 1DJCA 2ZJ9A 2ZQDA 1E25A 3Q81A 4E6WA 3FZCA 3VOYA 2EFXA 1NY0A 1YMXA 5CGWA 1FOFA 2QZ6A 3VFHA 4P0MA 2XQZA 3UDXA 1KDWA 2EX6A 1K57A 2HP9A 1MWUA 2A3UA 2XH9A 4KZ9A 2Y2IA 1LI9A 5FAQA 1CK3A 2WGWB 1G68A 2P9VB 1PYYA 3DW0A 4E3JA 1NJ4A 3HREA 5GL9A 3VSLA 4S2OA 2P74A 4UAAA 5FATA 4DF6A 4OH0A 5GHYA 3NBLA 4E3IA 5DTSA 4X69A 3SS5A 3QNCA 3OCNA 5CGXA 3WS4A 5HFOA 4R4RA 4R4SA 4P6BA 3ZG8B 1BLCA 4IVKA 3ZG5A 4OQIA 2WZZA 2ZQCA 4KZ6A 1K25A 5FQKA 3UDIA 4B4XA 3E2KA 1DY6A 2JCHA 4PMAA 3WS5A 3Q7VB 4FSFA 4JF5A 5CHMA 1DJAA 4KZ4A 3NDEA 3VMAA 2JE5A 5EUAA 1KDSA 4JXVA 3BFCA 4OKPA 2XGNA 1NZOA 1KE0A 5GLBA 3TOIA 2PU4A 1JVJA 3O3VA 3UPPA 4QU3A 3A3DA 3GMWA 1J9MA 3NCKA 4KZAA 2EXBA 2XEPA 4MBHA 1CEGA 2ZC7A 4LV0A 2JBFA 1K55A 3PTEA 2OV5A 5CGSA 3GV9A 1O07A 4OLDA 2ZMAA 4UA6A 4DE3A 2Y2PA 5FQQA 3UPNA 5M19A 1ONGA 4E3OA 4KZBA 3LEZA 4XUXA 4OOMA 3UE3A 1FCOA 3NDGA 2Y91A 4IVIA 3UN7A 3FKWA 4H8RA 2ZQ7A 4K0WA 2XLNA 2Q9NA 1RP5A 1BLHA 3V5MA 2X71A 2G2UA 1OMEA 2WKEA 4WM9A 1BLSA 1KVLA 3O87A 4GD8A 1YT4A 1W5DA 3SH7A 1H8ZA 1YLTA 5CRFA 2Z2LB 5AQAA 2GDNA 4GN2A 3GQZA 1FR1A 3VSKA 3BFDA 5E2HA 2H0YA 1K54C 3W8KA 1GHIA 2EX2A 2WGIA 4KG2A 3P09A 2Y55A 3GSGA 4S2NC 3S22A 5M18A 5HAQA 1L0DA 1Z6FA 3RJUA 3G34A 3W4QA 4PM6A 1IKGA 1RCJA 3NIAA 4S2MA 4N1HA 2WYXA 4U3TA 3C7UA 3G4PA 1H8YA 1XGIA 3A3FA 2DRWA 3HBRA 1LL9A 1ALQA 3AGDA 4B4ZA 4BD0A 5A90A 3FKVA 3IXBA 1K4FA 4KQQA 4EBNA 3MKFA 1HZOA 3HL9A 2HP5A 4MEZA 3NY4A 1XA1A 4WEJA 4JXGA 5JYOA 2WAEA 4M3KA 4KZ7A 4R3JA 4WMCD 3M2JA 1IEMA 4GZBA 4LV3A 5CTMA 5FSRA 5G18A 3ZVTA 3GRJA 4NK3A 4WZ4A 4PM9A 1PZOA 2E8IA 4JXSA 4RX3A 4S2IA 5FI6A 4DE1A 3BEBA 2Y2QA 4GD6A 3Q82A 4UHUA 5A93A 2UWXA 4EUZA 4S2PA 1ES3A 2DNSA 5DTTA 2Y2OA 4JLFA 1VQQA 4R3BA 2Y2LA 3N4IA 1IELA 5BOHA 1W8QA 1YM1A 4R23A 3FYZA 3VFFA 2EX8A 3ZDJA 5EVIC 4HESA 4XUZA 5EVIB 4Y0UA 4OLGA 5IHVA 1GCEA 1O7EA 2OSUA 1HVBA 5A91A 4KZ5A 1LI0A 5CHJA 2B5RA 3N8SA 3S4XA 3ZHHA 4CPKA 3HUOA 3OPRA 2BLSA 5F1FA 1CI9A 1GA0A 4IBRA 4U0TA 4U0XA 4BL3A 3PBQA 2XDMA 4JF6A 5E2FA 1FSWA 2ZC5B 4DDSA 1RGYA 4ZDXA 1TVFA 2WKHA 4XXRA 2WGVA 3MXSA 4OONA 1JWZA 4BENA 3CMZA 2WKIA 5DF9A 5EOEA 4RYEA 4EBPA 4ZJ1A 1ONHA 4JKTA 5GLCA 5GHXA 3UO9A 5FASA 1RGZA 1IYOA 1NRFA 4JF4A 3VP0A 4RVAA 1MPLA 2VGJA 4C75A 3RXXA 4LENA 1JWPA 2J8YA 3IHBA 2V20A 1PIOA 2WGWA 2XK1A 2P9VA 1PW8A 3Q1FA 4DDYA 1DJBA 4MBFA 5TGFA 1VM1A 4IBXA 1C3BA 4E3NA 1IKIA 3BECA 5HW3A 3LY3A 3G32A 1BSGA 1M40A 1KE3A 3VP2A 1EWZA 4OOLA 1PI4A 1QMFA 1ZKJA 3NI9A 3ZFZA 1GHPA 5FQJA 3SH8A 2HDRA 3IXGA 5L2FA 2V1ZA 3IF5A 1XPBA 2VGKA 4S2KA 4L0LA 3V39A 1BUEA 1MWRA 1PW1A 4PM8A 4DE2A 2PBYA 2Y2MA 5CEDA 4GOGA 4WZ5A 3BLMA 1CI8A 3ISGA 3ITAA 3PBRA 4E3MA 2HPBA 2WAFA 2ZM0A 2PU2A 4OPQA 2EFUA 2EXAA 3PBTA 5CEBA 2FFYA 3TSGA 5KSCA 3G2YA 1SKFA 5FQMA 4Y0OA 3RXWA 4QJGA 5CHUA 4D2OA 4NETA 4S2LA 4HBTA 5FAOA 2ZC6B 1S0WA 4EBLA 2IWBA 1JTGA 2ZLYA 3PAEA 1E3UA 1YQSA 3IF6A 1XKZA 4RX2A 3ZG9B 5J8XA 3OPHA 4FH2A 3OCLA 1ES2A 3PAGA 2H0TA 4BLMA 2ZC3B 2HDQA 2Z2MB 3G31A 3IQAA 2WK0A 4MBKA 4CJNA 3OPLA 4OVDA 4E3KA 2Y2NA 1MY8A 2XFTA 2RCXA 3HLDA 5FAPA 3QHYA 3UDFA 3OZHA 4EWFA 4X6TA 3MFDA 3BYDA 5F83A 3EQUA 1NZUA 3HVFA 1G6AA 3HLEA 5FA7A 3SS3A 3O88A 1SCWA 1Q2QA 4BQMA 3FWLA 3W4OA 5F1GA 5EVLA 3E2LA 4KQRA 1BULA 2ZC4B 3HLBA 1EROA 1ESUA 4K0XA 4S2NA 3VP1A 1BT5A 5EE8A 1BZAA 1L0FA 2Y59A 5U47A 2R9XA 1L0EA 1KGGA 2V2FF 4FD8A 5FQIA 4DXBA 2QMIA 3MXRA 4Y7PA 2ZD8A 3C4PA 5FDHA 1MKIA 3LO7A 3IHAA 4HBUA 4OQHA 5HAIA 4Y0TA 5FQ9A 3ZGAB 2HDSA 2X01A 5I94A 3IXDA 5HARA 4DKIA 5CTNA 5D3OA 1W8YA 1I2SA 3C4OA 4ZBEA 3MZFA 4X53A 5AQ9A 3UE1A 3GVBA 4OPRA 1K4EA 2Q9MA 1EI5A 4BJPA 1ZG6A 1JWVA 4RA7A 1BTLA 3GTCA 5DF8A 5TR7A 3G30A 3ZG7B 1IYSA 1K56A 3WRTA 4EV4A 5DTKA 3ITBA 1I5QA 4MLLA 1GA9A 5CECA 1KGEA 2CC1A 2ZM8A 2J7VA 4WBGA 4DRTA 2IWDA 3ZG0A 1W79A 1ZG4A 3W4PA 4FH4A 1LLBA 1PZPA 5CXWA 1L0GA 2R9WA 1BLPA 1K57C 3P98A 3DWKA 4KG6A 4X56A 5EVIA 4HEFA 3JYIA 3UY6A 4C3QA 5DVAA 4LCLA 4OQGA 4B88A 4OQ0A 1MWTA 3N6IA 3G2ZA 4DXCA 1JTDA 1YLJA 4LV1A 4A5RA 4WYYA 4YINA 2G2WA 4DE0A 4GNUA 2C5WB 3LY4A 4YFMA 4Z9QA 2XFSA 3V3RA 3V3SA 2Y2GA 4GDNA 2OLVA 4S2JA 1ERMA 2WUQA 3BLSA 3IT9A 3M6BA 3IWQA 1PWCA 3TG9A 3M2KA 2IWCA 3AGFA 3AGEA 5EPHA 2FFFB 2JC7A 1W7FA 3ZCZA 4OP8A 1KGFA 1XGJA 1KE4A 4IEDA 4WELA 5AQ7A 3IH9A 2DCFA 5KZHA 3HUNA 3OPPA 1MXOA 2XF3A 5DF7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U60 A;  2ZQ8 A;  4K91 A;  1WYB A;  3CG5 A;  3WRZ A;  3Q7V A;  1K55 C;  2WZX A;  4KEN B;  5GLD A;  5JYP A;  1YLW A;  4JXW A;  5HAP A;  4QD4 A;  2HDU A;  3UPO A;  4C6Y A;  3ZVW A;  4X55 A;  1E3U D;  1E4D A;  4JBF A;  4WZ5 C;  3HLF A;  3IXH A;  4N9K A;  3V50 A;  4FCF A;  3UNW A;  4R1G A;  4ZTK A;  1H5X A;  2Y4A A;  2OLU A;  2ZQ9 A;  5FI2 A;  3CZD A;  4QY5 A;  4OPY A;  2XD5 A;  3PBO A;  4PPR A;  1MWS A;  4QHC A;  1AXB A;  2Y2J A;  3LCE A;  3MZD A;  4OPZ A;  4BL2 A;  1SDN A;  4MNR A;  3MBZ A;  5TFQ A;  1FR6 A;  4E6X A;  5GHZ A;  1Y54 A;  3PBS A;  1ES5 A;  4GKU A;  3B3X A;  3A3I A;  1NYM A;  3BFF A;  1LHY A;  2EX9 A;  3IF6 C;  1K38 A;  3IF6 B;  2BG1 A;  2WAD A;  4N1X A;  5A92 A;  2H5S A;  1ESI A;  3A3E A;  1YLP A;  3G35 A;  4GDB A;  4OP5 A;  4ZJ2 A;  2Y2H A;  4UA7 A;  1ERQ A;  4N9L A;  3SOI A;  5KSH A;  5FI7 A;  2C6W B;  3BFE A;  4LV2 A;  3WS1 A;  3EQV A;  1XP4 A;  3ZNY A;  2ZM2 A;  5M1A A;  3WWX A;  3N7W A;  5CER A;  1TDG A;  4LCM A;  3S1Y A;  3VOZ A;  1K54 A;  1K6S A;  1NXY A;  1YMS A;  3C7V A;  3Q07 A;  3I7J A;  5HL1 A;  3WS0 A;  3OC2 A;  4BD1 A;  1PWD A;  2XD1 A;  4JPM A;  1TEM A;  1SDE A;  4E3L A;  1FSY A;  4QB8 A;  1PI5 A;  5GLA A;  3FV7 A;  3IWO A;  5AQB A;  3MKE A;  1N9B A;  1CEF A;  1ES4 A;  1FQG A;  2J9O A;  1M6K A;  4R0Q A;  4O7D A;  4KQO A;  3QNB A;  2H10 A;  1K56 D;  1FCM A;  3M6H A;  1MBL A;  1XA7 A;  5E2G A;  1Q2P A;  3SH9 A;  1SHV A;  2I72 A;  1XXM A;  4KZ3 A;  1HTZ A;  4ZJ3 A;  1FCN A;  1GHM A;  2A49 A;  5HX9 A;  4P85 A;  4Q8I A;  3HLG A;  3DWZ A;  3DTM A;  3GR2 A;  5KMW A;  1IYQ A;  3NC8 A;  5EOO A;  1S6R A;  1YLY A;  2HP6 A;  5E2E A;  3BM6 A;  4F94 A;  2XR0 A;  4WEK A;  3D4F A;  4PM5 A;  4KG5 A;  3O86 A;  4PM7 A;  1K6R A;  5F82 A;  3BRM A;  1WYC A;  1L2S A;  3PBN A;  3ZNT A;  4UA9 A;  4ID4 A;  2RL3 A;  3N8L A;  5EVI D;  3N8R A;  3VP3 A;  4ZAM A;  4X68 A;  1YLZ A;  2QPN A;  4GB7 A;  3Q7Z A;  4KZ8 A;  3SS4 A;  1LL5 A;  4P87 A;  3WS2 A;  1PWG A;  1NYY A;  3MZE A;  3IH8 A;  3IWI A;  1WE4 A;  4QY6 A;  4WMC A;  2ZQA A;  5E43 A;  3A3J A;  2J9P A;  4N92 A;  3BFG A;  5EEC A;  1TDL A;  3CJM A;  1HD8 A;  1KVM A;  3UE0 A;  1ZC2 A;  4OOY A;  4EQI A;  1I2W A;  3HLW A;  1N4O A;  2Y2K A;  1QME A;  1XX2 A;  3HLC A;  3HUM A;  1IYP A;  2X02 A;  3VP4 A;  3C5A A;  1DJC A;  2ZJ9 A;  2ZQD A;  1E25 A;  3Q81 A;  4E6W A;  3FZC A;  3VOY A;  2EFX A;  1NY0 A;  1YMX A;  5CGW A;  1FOF A;  2QZ6 A;  3VFH A;  4P0M A;  2XQZ A;  3UDX A;  1KDW A;  2EX6 A;  1K57 A;  2HP9 A;  1MWU A;  2A3U A;  2XH9 A;  4KZ9 A;  2Y2I A;  1LI9 A;  5FAQ A;  1CK3 A;  2WGW B;  1G68 A;  2P9V B;  1PYY A;  3DW0 A;  4E3J A;  1NJ4 A;  3HRE A;  5GL9 A;  3VSL A;  4S2O A;  2P74 A;  4UAA A;  5FAT A;  4DF6 A;  4OH0 A;  5GHY A;  3NBL A;  4E3I A;  5DTS A;  4X69 A;  3SS5 A;  3QNC A;  3OCN A;  5CGX A;  3WS4 A;  5HFO A;  4R4R A;  4R4S A;  4P6B A;  3ZG8 B;  1BLC A;  4IVK A;  3ZG5 A;  4OQI A;  2WZZ A;  2ZQC A;  4KZ6 A;  1K25 A;  5FQK A;  3UDI A;  4B4X A;  3E2K A;  1DY6 A;  2JCH A;  4PMA A;  3WS5 A;  3Q7V B;  4FSF A;  4JF5 A;  5CHM A;  1DJA A;  4KZ4 A;  3NDE A;  3VMA A;  2JE5 A;  5EUA A;  1KDS A;  4JXV A;  3BFC A;  4OKP A;  2XGN A;  1NZO A;  1KE0 A;  5GLB A;  3TOI A;  2PU4 A;  1JVJ A;  3O3V A;  3UPP A;  4QU3 A;  3A3D A;  3GMW A;  1J9M A;  3NCK A;  4KZA A;  2EXB A;  2XEP A;  4MBH A;  1CEG A;  2ZC7 A;  4LV0 A;  2JBF A;  1K55 A;  3PTE A;  2OV5 A;  5CGS A;  3GV9 A;  1O07 A;  4OLD A;  2ZMA A;  4UA6 A;  4DE3 A;  2Y2P A;  5FQQ A;  3UPN A;  5M19 A;  1ONG A;  4E3O A;  4KZB A;  3LEZ A;  4XUX A;  4OOM A;  3UE3 A;  1FCO A;  3NDG A;  2Y91 A;  4IVI A;  3UN7 A;  3FKW A;  4H8R A;  2ZQ7 A;  4K0W A;  2XLN A;  2Q9N A;  1RP5 A;  1BLH A;  3V5M A;  2X71 A;  2G2U A;  1OME A;  2WKE A;  4WM9 A;  1BLS A;  1KVL A;  3O87 A;  4GD8 A;  1YT4 A;  1W5D A;  3SH7 A;  1H8Z A;  1YLT A;  5CRF A;  2Z2L B;  5AQA A;  2GDN A;  4GN2 A;  3GQZ A;  1FR1 A;  3VSK A;  3BFD A;  5E2H A;  2H0Y A;  1K54 C;  3W8K A;  1GHI A;  2EX2 A;  2WGI A;  4KG2 A;  3P09 A;  2Y55 A;  3GSG A;  4S2N C;  3S22 A;  5M18 A;  5HAQ A;  1L0D A;  1Z6F A;  3RJU A;  3G34 A;  3W4Q A;  4PM6 A;  1IKG A;  1RCJ A;  3NIA A;  4S2M A;  4N1H A;  2WYX A;  4U3T A;  3C7U A;  3G4P A;  1H8Y A;  1XGI A;  3A3F A;  2DRW A;  3HBR A;  1LL9 A;  1ALQ A;  3AGD A;  4B4Z A;  4BD0 A;  5A90 A;  3FKV A;  3IXB A;  1K4F A;  4KQQ A;  4EBN A;  3MKF A;  1HZO A;  3HL9 A;  2HP5 A;  4MEZ A;  3NY4 A;  1XA1 A;  4WEJ A;  4JXG A;  5JYO A;  2WAE A;  4M3K A;  4KZ7 A;  4R3J A;  4WMC D;  3M2J A;  1IEM A;  4GZB A;  4LV3 A;  5CTM A;  5FSR A;  5G18 A;  3ZVT A;  3GRJ A;  4NK3 A;  4WZ4 A;  4PM9 A;  1PZO A;  2E8I A;  4JXS A;  4RX3 A;  4S2I A;  5FI6 A;  4DE1 A;  3BEB A;  2Y2Q A;  4GD6 A;  3Q82 A;  4UHU A;  5A93 A;  2UWX A;  4EUZ A;  4S2P A;  1ES3 A;  2DNS A;  5DTT A;  2Y2O A;  4JLF A;  1VQQ A;  4R3B A;  2Y2L A;  3N4I A;  1IEL A;  5BOH A;  1W8Q A;  1YM1 A;  4R23 A;  3FYZ A;  3VFF A;  2EX8 A;  3ZDJ A;  5EVI C;  4HES A;  4XUZ A;  5EVI B;  4Y0U A;  4OLG A;  5IHV A;  1GCE A;  1O7E A;  2OSU A;  1HVB A;  5A91 A;  4KZ5 A;  1LI0 A;  5CHJ A;  2B5R A;  3N8S A;  3S4X A;  3ZHH A;  4CPK A;  3HUO A;  3OPR A;  2BLS A;  5F1F A;  1CI9 A;  1GA0 A;  4IBR A;  4U0T A;  4U0X A;  4BL3 A;  3PBQ A;  2XDM A;  4JF6 A;  5E2F A;  1FSW A;  2ZC5 B;  4DDS A;  1RGY A;  4ZDX A;  1TVF A;  2WKH A;  4XXR A;  2WGV A;  3MXS A;  4OON A;  1JWZ A;  4BEN A;  3CMZ A;  2WKI A;  5DF9 A;  5EOE A;  4RYE A;  4EBP A;  4ZJ1 A;  1ONH A;  4JKT A;  5GLC A;  5GHX A;  3UO9 A;  5FAS A;  1RGZ A;  1IYO A;  1NRF A;  4JF4 A;  3VP0 A;  4RVA A;  1MPL A;  2VGJ A;  4C75 A;  3RXX A;  4LEN A;  1JWP A;  2J8Y A;  3IHB A;  2V20 A;  1PIO A;  2WGW A;  2XK1 A;  2P9V A;  1PW8 A;  3Q1F A;  4DDY A;  1DJB A;  4MBF A;  5TGF A;  1VM1 A;  4IBX A;  1C3B A;  4E3N A;  1IKI A;  3BEC A;  5HW3 A;  3LY3 A;  3G32 A;  1BSG A;  1M40 A;  1KE3 A;  3VP2 A;  1EWZ A;  4OOL A;  1PI4 A;  1QMF A;  1ZKJ A;  3NI9 A;  3ZFZ A;  1GHP A;  5FQJ A;  3SH8 A;  2HDR A;  3IXG A;  5L2F A;  2V1Z A;  3IF5 A;  1XPB A;  2VGK A;  4S2K A;  4L0L A;  3V39 A;  1BUE A;  1MWR A;  1PW1 A;  4PM8 A;  4DE2 A;  2PBY A;  2Y2M A;  5CED A;  4GOG A;  4WZ5 A;  3BLM A;  1CI8 A;  3ISG A;  3ITA A;  3PBR A;  4E3M A;  2HPB A;  2WAF A;  2ZM0 A;  2PU2 A;  4OPQ A;  2EFU A;  2EXA A;  3PBT A;  5CEB A;  2FFY A;  3TSG A;  5KSC A;  3G2Y A;  1SKF A;  5FQM A;  4Y0O A;  3RXW A;  4QJG A;  5CHU A;  4D2O A;  4NET A;  4S2L A;  4HBT A;  5FAO A;  2ZC6 B;  1S0W A;  4EBL A;  2IWB A;  1JTG A;  2ZLY A;  3PAE A;  1E3U A;  1YQS A;  3IF6 A;  1XKZ A;  4RX2 A;  3ZG9 B;  5J8X A;  3OPH A;  4FH2 A;  3OCL A;  1ES2 A;  3PAG A;  2H0T A;  4BLM A;  2ZC3 B;  2HDQ A;  2Z2M B;  3G31 A;  3IQA A;  2WK0 A;  4MBK A;  4CJN A;  3OPL A;  4OVD A;  4E3K A;  2Y2N A;  1MY8 A;  2XFT A;  2RCX A;  3HLD A;  5FAP A;  3QHY A;  3UDF A;  3OZH A;  4EWF A;  4X6T A;  3MFD A;  3BYD A;  5F83 A;  3EQU A;  1NZU A;  3HVF A;  1G6A A;  3HLE A;  5FA7 A;  3SS3 A;  3O88 A;  1SCW A;  1Q2Q A;  4BQM A;  3FWL A;  3W4O A;  5F1G A;  5EVL A;  3E2L A;  4KQR A;  1BUL A;  2ZC4 B;  3HLB A;  1ERO A;  1ESU A;  4K0X A;  4S2N A;  3VP1 A;  1BT5 A;  5EE8 A;  1BZA A;  1L0F A;  2Y59 A;  5U47 A;  2R9X A;  1L0E A;  1KGG A;  2V2F F;  4FD8 A;  5FQI A;  4DXB A;  2QMI A;  3MXR A;  4Y7P A;  2ZD8 A;  3C4P A;  5FDH A;  1MKI A;  3LO7 A;  3IHA A;  4HBU A;  4OQH A;  5HAI A;  4Y0T A;  5FQ9 A;  3ZGA B;  2HDS A;  2X01 A;  5I94 A;  3IXD A;  5HAR A;  4DKI A;  5CTN A;  5D3O A;  1W8Y A;  1I2S A;  3C4O A;  4ZBE A;  3MZF A;  4X53 A;  5AQ9 A;  3UE1 A;  3GVB A;  4OPR A;  1K4E A;  2Q9M A;  1EI5 A;  4BJP A;  1ZG6 A;  1JWV A;  4RA7 A;  1BTL A;  3GTC A;  5DF8 A;  5TR7 A;  3G30 A;  3ZG7 B;  1IYS A;  1K56 A;  3WRT A;  4EV4 A;  5DTK A;  3ITB A;  1I5Q A;  4MLL A;  1GA9 A;  5CEC A;  1KGE A;  2CC1 A;  2ZM8 A;  2J7V A;  4WBG A;  4DRT A;  2IWD A;  3ZG0 A;  1W79 A;  1ZG4 A;  3W4P A;  4FH4 A;  1LLB A;  1PZP A;  5CXW A;  1L0G A;  2R9W A;  1BLP A;  1K57 C;  3P98 A;  3DWK A;  4KG6 A;  4X56 A;  5EVI A;  4HEF A;  3JYI A;  3UY6 A;  4C3Q A;  5DVA A;  4LCL A;  4OQG A;  4B88 A;  4OQ0 A;  1MWT A;  3N6I A;  3G2Z A;  4DXC A;  1JTD A;  1YLJ A;  4LV1 A;  4A5R A;  4WYY A;  4YIN A;  2G2W A;  4DE0 A;  4GNU A;  2C5W B;  3LY4 A;  4YFM A;  4Z9Q A;  2XFS A;  3V3R A;  3V3S A;  2Y2G A;  4GDN A;  2OLV A;  4S2J A;  1ERM A;  2WUQ A;  3BLS A;  3IT9 A;  3M6B A;  3IWQ A;  1PWC A;  3TG9 A;  3M2K A;  2IWC A;  3AGF A;  3AGE A;  5EPH A;  2FFF B;  2JC7 A;  1W7F A;  3ZCZ A;  4OP8 A;  1KGF A;  1XGJ A;  1KE4 A;  4IED A;  4WEL A;  5AQ7 A;  3IH9 A;  2DCF A;  5KZH A;  3HUN A;  3OPP A;  1MXO A;  2XF3 A;  5DF7 A; 
#chains in the Genus database with same CATH topology
 1U60 A;  1K55 C;  5GLD A;  3LIC A;  3RH8 B;  4JXW A;  3IS2 A;  2V0U A;  3BQ8 A;  5L10 A;  1E4D A;  2P04 A;  4JBF A;  3UNW A;  1SZV A;  1LL8 A;  4Y13 A;  4R1G A;  4ZTK A;  4HNB A;  4QHC A;  4BL2 A;  3PBS A;  4GKU A;  3BFF A;  1HLU P;  2J3T C;  3UMD A;  1A0K A;  2K2N A;  1YLP A;  4GDB A;  4OP5 A;  2D02 A;  4N9L A;  4UA7 A;  4I3A A;  2O0Y A;  3K3C A;  3BFE A;  3WS1 A;  4UQI M;  3G6O A;  2WKR A;  5CER A;  3S1Y A;  1K6S A;  3C7V A;  3TJZ C;  2OAQ 1;  5HL1 A;  3OC2 A;  2BAS A;  3E98 A;  4BD1 A;  3IX3 A;  2XD1 A;  1TEM A;  4E3L A;  4R38 A;  5HPF A;  4QB8 A;  1PI5 A;  3L7H A;  1S67 L;  3QNB A;  1K56 D;  2H10 A;  1XA7 A;  2PD8 A;  3SH9 A;  4KZ3 A;  4I38 A;  1HTZ A;  1GHM A;  4HI4 A;  4P85 A;  5KMW A;  1IYQ A;  3NC8 A;  5E2E A;  4WEK A;  3PBN A;  3N8L A;  5HPI A;  2EWW A;  3Q7Z A;  4KZ8 A;  3WS2 A;  1UGU A;  3IH8 A;  5E43 A;  2J9P A;  3HLW A;  3E4O A;  4FOF A;  3Q81 A;  3FZC A;  2GZA A;  1G6O A;  1FOF A;  3NHQ A;  3LR4 A;  2XQZ A;  3UDX A;  2M1C A;  3PR6 A;  1N9N A;  4CLC D;  1LT0 A;  2A3U A;  5TBM A;  4HHD A;  1LI9 A;  1V9Z A;  1CK3 A;  2WGW B;  1PYY A;  4JGQ A;  1CF0 A;  1NJ4 A;  3HRE A;  2XSS A;  4X69 A;  3QNC A;  5K5B A;  5HL6 A;  1GSW A;  4R4R A;  4R4S A;  4P6B A;  1YSQ A;  1F9I A;  4BWI A;  4OQI A;  3VOL A;  5CHM A;  4KZ4 A;  4IUH A;  1KE0 A;  2LB5 A;  3KSF A;  2PD7 A;  3O3V A;  2JKR M;  2VGL S;  4IHQ A;  3A3D A;  3GMW A;  5HWT A;  2OWJ A;  3NCK A;  1YKD A;  4KZA A;  1CEG A;  4LV0 A;  1K55 A;  1OTI A;  4WL9 A;  5CGS A;  4I5S A;  1O07 A;  4UA6 A;  1DRM A;  3UPN A;  3BWL A;  1ONG A;  2HV1 A;  2QKP A;  3NDG A;  1JNU A;  3E4Q A;  3FKW A;  3LID A;  3U2A A;  4K0W A;  1LSX A;  1F98 A;  1YAX A;  2G2U A;  1BLS A;  1W5D A;  3SH7 A;  1YLT A;  5CRF A;  2GDN A;  1FR1 A;  3BFD A;  3CHW P;  3W8K A;  3MMH A;  4KG2 A;  3GSG A;  3S22 A;  4B9O A;  3RJU A;  3G34 A;  2JKT M;  4HH3 A;  1XGI A;  2V1B A;  3A3F A;  1LL9 A;  4B4Z A;  4LRZ E;  3MS6 A;  1K4F A;  4LRY C;  4KQQ A;  3IBR A;  4MEZ A;  2HP5 A;  4WEJ A;  5FSR A;  3M2J A;  3ZVT A;  4NK3 A;  3C30 A;  2E8I A;  4RX3 A;  4Y5F A;  5FI6 A;  2O99 A;  1ACF A;  5A93 A;  4EUZ A;  3W2Z A;  3LIA A;  4PKY A;  1W8Q A;  3T4T A;  4FTX A;  3MR0 A;  5EVI C;  5EVI B;  3KO6 A;  5TJJ A;  4Y0U A;  3O5Y A;  3QP1 A;  2B5R A;  4WUJ A;  3ICY A;  3HUO A;  4CPK A;  4IBR A;  4U0X A;  2XDM A;  1FSW A;  3MXS A;  5DF9 A;  2WKI A;  2INW A;  1TS6 A;  4I3I A;  4JKT A;  5GHX A;  1RGZ A;  4RVA A;  1MPL A;  1JWP A;  2J8Y A;  5G4Z A;  2WGW A;  4UEY A;  4DDY A;  4G3W A;  5HDS A;  3LGO A;  1ZHH B;  3VP2 A;  3RTY A;  1PI4 A;  4EET B;  1GHP A;  2B18 A;  5FQJ A;  3SH8 A;  1OT9 A;  2V8F A;  2V1Z A;  3IF5 A;  1TS8 A;  3V39 A;  2FZ0 A;  2Y2M A;  4GOG A;  4WZ5 A;  3BY8 A;  1CI8 A;  3ISG A;  3SW1 A;  3ITA A;  1NLZ A;  2J3T D;  3G2Y A;  5CHU A;  4LRX C;  4D2O A;  4S2L A;  3RFB A;  5FAO A;  2OWH A;  1XJ4 A;  3ZG9 B;  3PAE A;  3EEA A;  1ES2 A;  2H0T A;  2HJ9 C;  2VK3 A;  3HCY A;  4OVD A;  3HLD A;  3OZH A;  3MQO A;  3QP2 A;  5F1G A;  3E2L A;  1ERO A;  2LB9 A;  4K0X A;  3R4K A;  3DBA A;  3F1O B;  3CPT B;  1L0F A;  2R9X A;  5FQI A;  2W0N A;  5FDH A;  3IXD A;  1WA9 A;  5D3O A;  4DJ2 A;  3GVB A;  1FIL A;  4OPR A;  1K4E A;  1N9L A;  4BJP A;  4RA7 A;  5DF8 A;  3S7Q A;  3GTC A;  3KYQ A;  4EV4 A;  3ITB A;  1I5Q A;  2ZM8 A;  2J7V A;  4WBG A;  3LEQ A;  1OTE A;  2IWD A;  4HJ6 A;  3B47 A;  4FH4 A;  2R9W A;  1BLP A;  1K57 C;  2Y8H A;  5EVI A;  1OTD A;  4NXE A;  1MWT A;  1JTD A;  1YLJ A;  3VV4 A;  4A5R A;  4YIN A;  2G2W A;  3V3R A;  5M18 A;  4S2J A;  1S1Z A;  2OLV A;  5FEG A;  3TG9 A;  3D3O A;  2FFF B;  2JC7 A;  3ZCZ A;  4OP8 A;  4WEL A;  5AQ7 A;  5KZH A;  5FAP A;  1WYB A;  3CG5 A;  3WRZ A;  3Q7V A;  3UB9 A;  2WZX A;  5JYP A;  3UPO A;  3T1Q B;  4PKY G;  3EGX C;  5FI2 A;  2Y4A A;  2OLU A;  3CZD A;  4OPY A;  2O9B A;  3PBO A;  4PPR A;  3LCE A;  2Y2J A;  1SDN A;  3MBZ A;  5TFQ A;  5GHZ A;  3T1X A;  2MJ6 A;  2EX9 A;  5A92 A;  2H5S A;  3A3E A;  5IU1 A;  4GW9 A;  3LI9 A;  1ERQ A;  3SOI A;  3KYZ A;  5FI7 A;  2ZM2 A;  3WWX A;  1NXY A;  3Q07 A;  1H8M A;  3WS0 A;  1PWD A;  2ZMV A;  2H28 A;  1FSY A;  3T4S A;  1ES4 A;  3T50 A;  4DJ3 A;  4O7D A;  3FPW A;  3BW6 A;  4ZJ3 A;  4EXO A;  2A49 A;  5HX9 A;  4NG2 A;  3F1O A;  3CPT A;  3GR2 A;  5I5L A;  4DMZ A;  5EOO A;  2O9A A;  4F94 A;  2HP6 A;  2XR0 A;  2QJ5 A;  2VX8 A;  3O86 A;  4PM7 A;  1K6R A;  3QP6 A;  1WYC A;  1L2S A;  1T18 A;  2BTF P;  5EVI D;  3C38 A;  3C8C A;  4Q0H A;  4X68 A;  1YLZ A;  4HH2 A;  3SS4 A;  3MZE A;  4WMC A;  1TF1 A;  3A3J A;  1L3L A;  4N92 A;  3U4L P;  3UE0 A;  4OOY A;  4EQI A;  1I2W A;  2Y2K A;  1QME A;  5CX7 A;  1IYP A;  2X02 A;  3VP4 A;  1DJC A;  2ZQD A;  1E25 A;  1GSX A;  1NY0 A;  5CGW A;  2QZ6 A;  4P0M A;  2Z6C A;  1XFN A;  1K57 A;  4KZ9 A;  2Y2I A;  1DP9 A;  2P9V B;  5GL9 A;  4S2O A;  4DF6 A;  3JVU A;  4OH0 A;  4E3I A;  1PFL A;  3OCN A;  3LYX A;  2W3D A;  4IVK A;  2ZQC A;  4KZ6 A;  1DY6 A;  1XFQ A;  2JCH A;  4PMA A;  1VEU A;  3B42 A;  4JF5 A;  4HOI A;  2JE5 A;  1KDS A;  4JXV A;  2XGN A;  3UB5 P;  1NZO A;  3MSH A;  3TOI A;  3NOT C;  2XRN A;  5HDC A;  2OV5 A;  4DE3 A;  4KZB A;  3CAX A;  3UE3 A;  1FCO A;  2YKH A;  2Y91 A;  3NUL A;  4BBU A;  2XLN A;  4WF0 A;  1RP5 A;  3V5M A;  1OME A;  1KOU A;  1YT4 A;  3NOU C;  4GN2 A;  3GQZ A;  1P97 A;  2H0Y A;  1K54 C;  2EX2 A;  4EES A;  2WGI A;  2Y55 A;  3F1N B;  5EVE A;  1L0D A;  4KUK A;  4PM6 A;  1RCJ A;  4S2M A;  2Y79 A;  3B33 A;  3C7U A;  3G4P A;  1H8Y A;  2QJ7 A;  2DRW A;  3HBR A;  1SKO B;  3AGD A;  2HZ5 A;  3IXB A;  3MKF A;  1HZO A;  3UME A;  3HL9 A;  4JXG A;  4M3K A;  2PRF A;  4WMC D;  4R70 A;  3GRJ A;  4PM9 A;  1PZO A;  4JXS A;  3BEB A;  4CQH A;  2GNX A;  4EEP A;  4UHU A;  2UWX A;  4JGP A;  2ZL1 B;  1ES3 A;  2DNS A;  4JLF A;  4BMW A;  1IEL A;  4R23 A;  2WKQ A;  4NEE D;  1OTB A;  4HES A;  1O7E A;  5IT5 A;  5F1F A;  4K08 A;  1CI9 A;  3PYP A;  4U0T A;  4BL3 A;  4KQD A;  3VE3 A;  4EQ1 A;  1RGY A;  5HWV A;  4OON A;  1T1C A;  4BEN A;  3LUQ A;  4RYE A;  4ETX A;  5GLC A;  4C75 A;  4YWZ A;  3IHB A;  1W63 Q;  2P9V A;  2XA7 M;  1PW8 A;  4ETZ A;  4MBF A;  5TGF A;  1W63 M;  4E3N A;  3MJQ A;  4L9F A;  4GS9 B;  3FC7 A;  1OT6 A;  1QMF A;  5F69 A;  3IXG A;  5L2F A;  5HDD A;  1XPB A;  1MWR A;  4DE2 A;  5F6A A;  3BLM A;  3LIE A;  4E3M A;  2K7S A;  2EXA A;  1CQA A;  3TSG A;  4ESP A;  5KSC A;  3RXW A;  5HD3 A;  1E3U A;  2A24 B;  3OCL A;  2ZC3 B;  2J80 A;  2HDQ A;  2Z2M B;  4CJN A;  4E3K A;  2Y2N A;  2XFT A;  3QHY A;  4L9G A;  3UDF A;  3BYD A;  4LPZ A;  3HVF A;  2KDK A;  1SCW A;  4BQM A;  3W4O A;  3HLB A;  2W3F A;  4D60 A;  1VET B;  1T1B A;  3JVV A;  4DXB A;  2V2F F;  1KGG A;  3OOV A;  1TD5 A;  1MKI A;  3LO7 A;  4Y0T A;  5FQ9 A;  3ZGA B;  5I94 A;  5CTN A;  4X53 A;  3FPV A;  2Q9M A;  1Y4O A;  1X0O A;  5DKK A;  5TR7 A;  3ZG7 B;  3WRT A;  2HGV A;  1GA9 A;  5A8B A;  1OTA A;  2ACG A;  2ZL1 A;  4L9E A;  3P01 A;  1W79 A;  2PAV P;  3H9W A;  4GLQ A;  3UB6 A;  3MXQ A;  2OAP 1;  4OQG A;  5J7E A;  4B88 A;  4OQ0 A;  3G2Z A;  4LV1 A;  3LFV A;  1MKM A;  4DE0 A;  4YFM A;  3V3S A;  5L07 A;  2Y2G A;  3BLS A;  3M6B A;  4QPR A;  3M2K A;  2IWC A;  3AGF A;  1NLY A;  4HQA A;  1KGF A;  3F1P B;  4IED A;  2L4R A;  1GSV A;  1TS0 A;  4K91 A;  2ZQ8 A;  3E0Y A;  3VE4 A;  4GS9 A;  5FDS A;  1E3U D;  2KLI A;  3HLF A;  3IXH A;  4N9K A;  3V50 A;  4FCF A;  5F68 A;  2Q0O A;  1D06 A;  4QY5 A;  2XD5 A;  4DRT A;  1MWS A;  3MZD A;  4MNR A;  5DFX A;  5EFW A;  4E6X A;  2R78 A;  1ES5 A;  3A3I A;  3IF6 C;  3IF6 B;  3MQ0 A;  5AJG A;  4X25 A;  3G35 A;  4ZJ2 A;  1P0Z A;  2Y2H A;  3JPU A;  2W3G A;  1VB6 A;  2C6W B;  3CLO A;  3BY9 A;  1XP4 A;  2K31 A;  5M1A A;  3NOP C;  4LCM A;  2A24 A;  3VOZ A;  3H82 B;  1YMS A;  3EEH A;  3I7J A;  3TRC A;  4PAU A;  4DN0 A;  4R6L A;  4JPM A;  1SDE A;  2VA0 A;  2KX6 A;  5GLA A;  5AQB A;  4EEU A;  5EV0 A;  1N9B A;  1ODV A;  3T12 B;  1FQG A;  3IX4 A;  2P7J A;  4R0Q A;  4KQO A;  3K3D A;  1FCM A;  4NXF A;  5E2G A;  2VJW A;  1SHV A;  2QWS A;  1FCN A;  4GHI B;  4HJ4 A;  3BM6 A;  4KG5 A;  4KUO A;  1NRJ A;  3BRM A;  3ZNT A;  4G3V A;  4UA9 A;  4ID4 A;  2RL3 A;  4LLO B;  3TW8 A;  2VV8 A;  3A0S A;  4P87 A;  3S7O A;  3CUE C;  1WE4 A;  2ZQA A;  3S7N A;  3BFG A;  5EEC A;  3ZQ5 A;  1TDL A;  3CJM A;  4HY8 A;  1KVM A;  1N4O A;  5HD5 A;  1XX2 A;  3HLC A;  3HUM A;  2ZJ9 A;  3EOI A;  2EFX A;  3K2N A;  1YMX A;  2JN7 A;  4O8G A;  1KDW A;  2EX6 A;  5FAQ A;  1G68 A;  4YNR A;  3DW0 A;  4Z1W A;  3VSL A;  2P74 A;  5DTS A;  3SS5 A;  1EW0 A;  5CGX A;  3DTI A;  4CLC C;  3ZG8 B;  4CLC B;  4YOF A;  1BLC A;  2I9V A;  3ZG5 A;  5AVF A;  2WZZ A;  2JKG A;  5FQK A;  3UDI A;  4P6Z S;  3WS5 A;  4FSF A;  3NDE A;  5L8M A;  1P9W A;  4ZRR A;  3BFC A;  4OKP A;  5GLB A;  3F1P A;  4XT2 B;  2PU4 A;  4HP9 A;  4M4X A;  1J9M A;  2XEP A;  1XJ6 A;  3GV9 A;  4OLD A;  2Y2P A;  5FQQ A;  5M19 A;  4H8R A;  2Q9N A;  2X71 A;  2WKE A;  1S1Y A;  2B95 A;  1K0K A;  1H8Z A;  2Z2L B;  1D7E A;  3VSK A;  5E2H A;  4QWO A;  1STZ A;  4UQI S;  3P09 A;  4S2N C;  5HAQ A;  3HJI A;  1IKG A;  3H7W B;  3NIA A;  4N1H A;  4U3T A;  3KX0 X;  3H82 A;  1DP6 A;  1ALQ A;  3OBF A;  4Y15 A;  3NY4 A;  2WAE A;  4KZ7 A;  4GZB A;  4LV3 A;  1OJG A;  4X1M A;  2B02 A;  1FIK A;  4CLC E;  4S2I A;  2J3W A;  4DE1 A;  2Y2Q A;  3Q82 A;  2PYP A;  4S2P A;  4ME4 A;  2Y2O A;  1VQQ A;  2Y2L A;  3OLO A;  4GHI A;  5FL3 A;  3N4I A;  5BOH A;  3FYZ A;  3VFF A;  4HP4 A;  4XUZ A;  1GCE A;  2OSU A;  1HVB A;  1F2K A;  4KZ5 A;  1LI0 A;  3LIF A;  3S4X A;  3CUE A;  2KOI A;  3PBQ A;  2W3H A;  4JF6 A;  3QP8 A;  4H6J B;  5E2F A;  1Z09 A;  2YKF A;  3FG8 A;  4ZDX A;  3LIB A;  3LR5 A;  3T4L A;  3CMZ A;  5EOE A;  1S4S A;  1ONH A;  4G3K A;  5FAS A;  3UO9 A;  1NRF A;  2P08 A;  2VGJ A;  5HSQ A;  4LEN A;  3DTE A;  5AVE A;  2V20 A;  2XK1 A;  3P7N A;  4IBX A;  3PHY A;  1MC0 A;  3BEC A;  3LY3 A;  3G32 A;  1M40 A;  2M7V A;  1KE3 A;  4OOL A;  1ZKJ A;  2W3E A;  3NI9 A;  3T4K A;  3ZFZ A;  2G7U A;  2HF6 A;  3D72 A;  4L0L A;  2PR6 A;  1CJF A;  1BUE A;  4PM8 A;  3KSG A;  3CI6 A;  5CED A;  2ZM0 A;  4XT2 A;  2EFU A;  4MDZ A;  3GDI A;  3PBT A;  5CEB A;  4Y0O A;  1S0W A;  4EBL A;  2IWB A;  1JTG A;  2ZLY A;  1YQS A;  1XKZ A;  4EU0 A;  5J8X A;  3OPH A;  3IQA A;  2WK0 A;  4MBK A;  3OPL A;  1MY8 A;  2V8C A;  4EWF A;  4X6T A;  3MFD A;  5F83 A;  4GCZ A;  1G6A A;  3HLE A;  3SS3 A;  3O88 A;  1Q2Q A;  3FWL A;  5EVL A;  4KQR A;  1BUL A;  2ZC4 B;  3T4O A;  1ESU A;  4S2N A;  3VP1 A;  1BZA A;  3H7W A;  2Y59 A;  4FD8 A;  1L0E A;  2PDR A;  4Y7P A;  2PR5 A;  2ZD8 A;  3C4P A;  5DJT A;  5HAI A;  4HBU A;  2X01 A;  5HAR A;  3NEC A;  1W8Y A;  1I2S A;  5J3W A;  3C4O A;  3UE1 A;  5KIZ A;  1EI5 A;  3LI8 A;  1J3W A;  2IA2 A;  1JWV A;  1IYS A;  1LSW A;  2ZMF A;  4MLL A;  3MF0 A;  5CEC A;  3V67 A;  5IS1 A;  1TS7 A;  1ZG4 A;  5CXW A;  3P98 A;  1P9R A;  1DP8 A;  2JHE A;  4HEF A;  3UY6 A;  5DVA A;  4LCL A;  2V9A A;  5MC7 A;  4DXC A;  2PYR A;  1IOU A;  4Y2F A;  1MZU A;  4GNU A;  4H6J A;  4Z9Q A;  2XFS A;  4GDN A;  3GEC A;  3BJN A;  1PWC A;  2EA9 A;  5EPH A;  4Y17 A;  4AFI A;  1W7F A;  1G28 A;  1XGJ A;  3IH9 A;  2AVX A;  3R7W B;  5DF7 A;  3IBJ A;  4KEN B;  1YLW A;  5HAP A;  4QD4 A;  2HDU A;  3T1R A;  1UWP X;  4C6Y A;  3ZVW A;  4X55 A;  2EWV A;  4F3L B;  2VV6 A;  4WZ5 C;  1H5X A;  2ZQ9 A;  3ZYT A;  2V0W A;  3ULF A;  1AXB A;  4OPZ A;  5LBR A;  4RQ9 A;  1FR6 A;  1Y54 A;  2ZBB A;  3C2W A;  3B3X A;  1H3Q A;  1NYM A;  1LHY A;  1K38 A;  2BG1 A;  2WAD A;  4N1X A;  4Y3I A;  1ESI A;  4PHT A;  2QYB A;  4WN5 A;  5KSH A;  1T19 A;  3DAV A;  2DMW A;  1D1J A;  4LV2 A;  3EQV A;  3ZNY A;  4MMN A;  3N7W A;  1TDG A;  1K54 A;  5DJU A;  3MFX A;  2NUT C;  4IJG A;  3F1N A;  3UE6 A;  4B93 A;  3FV7 A;  3IWO A;  3E4P A;  2PT7 A;  3MKE A;  2UV0 E;  1G5U A;  1CEF A;  2O9C A;  1S4R A;  2W27 A;  2J9O A;  1M6K A;  3T1S A;  1SKO A;  3M6H A;  1MBL A;  1Q2P A;  2V1A A;  2I72 A;  5FEF A;  1XXM A;  3EWK A;  4Q8I A;  3HLG A;  3DWZ A;  3DTM A;  1S6R A;  1YLY A;  4PM5 A;  3D4F A;  5F82 A;  5DKL A;  2W1T B;  3N8R A;  3VP3 A;  4ZAM A;  2QPN A;  4GB7 A;  3QP5 A;  1LL5 A;  1PWG A;  2L1M A;  1NYY A;  4I39 A;  3IWI A;  4QY6 A;  3A0R A;  1HD8 A;  1ZC2 A;  1XJ3 A;  2ZOI A;  3C5A A;  4E6W A;  3VOY A;  2WKP A;  4NXB A;  3T4Q A;  3VFH A;  2HP9 A;  1MWU A;  2XH9 A;  4FUW A;  3UB7 A;  5HWW A;  4E3J A;  2A2L A;  5FAT A;  4UAA A;  5GHY A;  3NBL A;  2L0W A;  1AWI A;  3HJK A;  3WS4 A;  5HFO A;  1K25 A;  1XJ2 A;  1VHM A;  4B4X A;  3E2K A;  3Q7V B;  2VGL M;  3LR3 A;  1DJA A;  3VMA A;  5EUA A;  1JVJ A;  2VLG A;  3UPP A;  4QU3 A;  3R7W A;  4WLA A;  1YSP A;  4NXG A;  2EXB A;  2VZW A;  4MBH A;  2ZC7 A;  2JBF A;  4LGW A;  3PTE A;  2VKS A;  2ZMA A;  3KSH A;  4Q0J A;  4E3O A;  4F3L A;  3LEZ A;  4XUX A;  4OOM A;  2OOL A;  4IVI A;  3UN7 A;  2ZQ7 A;  3CIT A;  3SZT A;  1BLH A;  2JKR I;  4WM9 A;  1KVL A;  3O87 A;  4GD8 A;  2E8J A;  4NKP A;  5AQA A;  4R3A A;  3MQQ A;  1GHI A;  5EM0 A;  1Z6F A;  1IFQ A;  1UWN X;  3W4Q A;  2M7U A;  5C5K A;  2WYX A;  4MN5 A;  1T1A A;  2W1R A;  1LSV A;  2HJE A;  4BD0 A;  5A90 A;  1Y28 A;  3FKV A;  1VET A;  4EBN A;  5JYO A;  1XA1 A;  4R3J A;  1IEM A;  1V9Y A;  5CTM A;  5G18 A;  4EER A;  4WZ4 A;  2JKT I;  4ARZ B;  4GD6 A;  3CWF A;  5DTT A;  4JGR A;  2FH5 A;  4EW7 A;  4R3B A;  5L09 A;  3TE8 A;  1YM1 A;  2EX8 A;  3ZDJ A;  4E04 A;  2W1T A;  4OLG A;  2VEA A;  4IUK A;  5IHV A;  3S7P A;  5A91 A;  5CHJ A;  3N8S A;  3ZHH A;  3OPR A;  2BLS A;  5DFY A;  4HJ3 A;  1GA0 A;  3UB8 A;  4DDS A;  2ZC5 B;  1TVF A;  2WKH A;  4XXR A;  2WGV A;  1JWZ A;  4EBP A;  4ZJ1 A;  1IYO A;  4JF4 A;  3VP0 A;  3RXX A;  1PIO A;  3PXP A;  3D9Y A;  3Q1F A;  4II7 A;  1DJB A;  1VM1 A;  1C3B A;  1IKI A;  5HW3 A;  1VEU B;  3IS2 B;  1BSG A;  1H0M A;  1EWZ A;  5F5Y A;  2HDR A;  2D01 A;  2VGK A;  4HIA A;  4S2K A;  1PW1 A;  1PNE A;  2PHY A;  3A0V A;  2PBY A;  3PBR A;  2HPB A;  2WAF A;  2PU2 A;  2NUP C;  4OPQ A;  3IX8 A;  2FFY A;  1SKF A;  5FQM A;  4QJG A;  4NET A;  4HBT A;  2ZC6 B;  3IF6 A;  4RX2 A;  2CMN A;  4X1L A;  3QP4 A;  4FH2 A;  2VV7 A;  1YPR A;  2JKF A;  3PAG A;  4BLM A;  3G31 A;  2RCX A;  3EQU A;  4EUV A;  1NZU A;  4JGO A;  5FA7 A;  4MCW A;  2PBD P;  4O0P A;  5J4E A;  1N9O A;  3DTK A;  1BT5 A;  1F5M A;  5EE8 A;  3NJA A;  5U47 A;  2QMI A;  3MXR A;  4BBT A;  3T4J A;  2Z6D A;  1NWZ A;  3IHA A;  4OQH A;  2HDS A;  4DKI A;  2GX5 A;  4ZBE A;  3MZF A;  5AQ9 A;  3L9K A;  3KYE A;  1ZG6 A;  1BTL A;  4I3J A;  1PRQ A;  3G30 A;  1K56 A;  3EGD C;  4ARZ A;  2XRO A;  4MN6 A;  5DTK A;  1OJ5 A;  2GJ3 A;  1KGE A;  2CC1 A;  4MN7 A;  5EM1 A;  3ZG0 A;  3KSI A;  3W4P A;  1LLB A;  1PZP A;  4Q0I A;  1L0G A;  5TBM B;  3DWK A;  1OPX A;  4KG6 A;  4O01 A;  2ZOH A;  4X56 A;  3JYI A;  4C3Q A;  4GJ4 A;  3N6I A;  1BYW A;  2QHK A;  4WYY A;  5G4Y A;  2C5W B;  3LY4 A;  1ERM A;  2WUQ A;  3IT9 A;  3IWQ A;  4BBV A;  5HZH A;  1ZTU A;  3AGE A;  3BQA A;  2XA7 S;  4LFU A;  4CLC A;  3LR0 A;  1KE4 A;  4P6Z M;  1S66 L;  2DCF A;  3HUN A;  3OPP A;  1MXO A;  2XF3 A; 
#chains in the Genus database with same CATH homology
 1U60 A;  2ZQ8 A;  4K91 A;  1WYB A;  3CG5 A;  3WRZ A;  3Q7V A;  1K55 C;  2WZX A;  4KEN B;  5GLD A;  5JYP A;  1YLW A;  4JXW A;  5HAP A;  4QD4 A;  2HDU A;  3UPO A;  4C6Y A;  3ZVW A;  4X55 A;  1E3U D;  1E4D A;  4JBF A;  4WZ5 C;  3HLF A;  3IXH A;  4N9K A;  3V50 A;  4FCF A;  3UNW A;  4R1G A;  4ZTK A;  1H5X A;  2Y4A A;  2OLU A;  2ZQ9 A;  5FI2 A;  3CZD A;  4QY5 A;  4OPY A;  2XD5 A;  3PBO A;  4PPR A;  1MWS A;  4QHC A;  1AXB A;  2Y2J A;  3LCE A;  3MZD A;  4OPZ A;  4BL2 A;  1SDN A;  4MNR A;  3MBZ A;  5TFQ A;  1FR6 A;  4E6X A;  5GHZ A;  1Y54 A;  3PBS A;  1ES5 A;  4GKU A;  3B3X A;  3A3I A;  1NYM A;  3BFF A;  1LHY A;  2EX9 A;  3IF6 C;  1K38 A;  3IF6 B;  2BG1 A;  2WAD A;  4N1X A;  5A92 A;  2H5S A;  1ESI A;  3A3E A;  1YLP A;  3G35 A;  4GDB A;  4OP5 A;  4ZJ2 A;  2Y2H A;  4UA7 A;  1ERQ A;  4N9L A;  3SOI A;  5KSH A;  5FI7 A;  2C6W B;  3BFE A;  4LV2 A;  3WS1 A;  3EQV A;  1XP4 A;  3ZNY A;  2ZM2 A;  5M1A A;  3WWX A;  3N7W A;  5CER A;  1TDG A;  4LCM A;  3S1Y A;  3VOZ A;  1K54 A;  1K6S A;  1NXY A;  1YMS A;  3C7V A;  3Q07 A;  3I7J A;  5HL1 A;  3WS0 A;  3OC2 A;  4BD1 A;  1PWD A;  2XD1 A;  4JPM A;  1TEM A;  1SDE A;  4E3L A;  1FSY A;  4QB8 A;  1PI5 A;  5GLA A;  3FV7 A;  3IWO A;  5AQB A;  3MKE A;  1N9B A;  1CEF A;  1ES4 A;  1FQG A;  2J9O A;  1M6K A;  4R0Q A;  4O7D A;  4KQO A;  3QNB A;  2H10 A;  1K56 D;  1FCM A;  3M6H A;  1MBL A;  1XA7 A;  5E2G A;  1Q2P A;  3SH9 A;  1SHV A;  2I72 A;  1XXM A;  4KZ3 A;  1HTZ A;  4ZJ3 A;  1FCN A;  1GHM A;  2A49 A;  5HX9 A;  4P85 A;  4Q8I A;  3HLG A;  3DWZ A;  3DTM A;  3GR2 A;  5KMW A;  1IYQ A;  3NC8 A;  5EOO A;  1S6R A;  1YLY A;  2HP6 A;  5E2E A;  3BM6 A;  4F94 A;  2XR0 A;  4WEK A;  3D4F A;  4PM5 A;  4KG5 A;  3O86 A;  4PM7 A;  1K6R A;  5F82 A;  3BRM A;  1WYC A;  1L2S A;  3PBN A;  3ZNT A;  4UA9 A;  4ID4 A;  2RL3 A;  3N8L A;  5EVI D;  3N8R A;  3VP3 A;  4ZAM A;  4X68 A;  1YLZ A;  2QPN A;  4GB7 A;  3Q7Z A;  4KZ8 A;  3SS4 A;  1LL5 A;  4P87 A;  3WS2 A;  1PWG A;  1NYY A;  3MZE A;  3IH8 A;  3IWI A;  1WE4 A;  4QY6 A;  4WMC A;  2ZQA A;  5E43 A;  3A3J A;  2J9P A;  4N92 A;  3BFG A;  5EEC A;  1TDL A;  3CJM A;  1HD8 A;  1KVM A;  3UE0 A;  1ZC2 A;  4OOY A;  4EQI A;  1I2W A;  3HLW A;  1N4O A;  2Y2K A;  1QME A;  1XX2 A;  3HLC A;  3HUM A;  1IYP A;  2X02 A;  3VP4 A;  3C5A A;  1DJC A;  2ZJ9 A;  2ZQD A;  1E25 A;  3Q81 A;  4E6W A;  3FZC A;  3VOY A;  2EFX A;  1NY0 A;  1YMX A;  5CGW A;  1FOF A;  2QZ6 A;  3VFH A;  4P0M A;  2XQZ A;  3UDX A;  1KDW A;  2EX6 A;  1K57 A;  2HP9 A;  1MWU A;  2A3U A;  2XH9 A;  4KZ9 A;  2Y2I A;  1LI9 A;  5FAQ A;  1CK3 A;  2WGW B;  1G68 A;  2P9V B;  1PYY A;  3DW0 A;  4E3J A;  1NJ4 A;  3HRE A;  5GL9 A;  3VSL A;  4S2O A;  2P74 A;  4UAA A;  5FAT A;  4DF6 A;  4OH0 A;  5GHY A;  3NBL A;  4E3I A;  5DTS A;  4X69 A;  3SS5 A;  3QNC A;  3OCN A;  5CGX A;  3WS4 A;  5HFO A;  4R4R A;  4R4S A;  4P6B A;  3ZG8 B;  1BLC A;  4IVK A;  3ZG5 A;  4OQI A;  2WZZ A;  2ZQC A;  4KZ6 A;  1K25 A;  5FQK A;  3UDI A;  4B4X A;  3E2K A;  1DY6 A;  2JCH A;  4PMA A;  3WS5 A;  3Q7V B;  4FSF A;  4JF5 A;  5CHM A;  1DJA A;  4KZ4 A;  3NDE A;  3VMA A;  2JE5 A;  5EUA A;  1KDS A;  4JXV A;  3BFC A;  4OKP A;  2XGN A;  1NZO A;  1KE0 A;  5GLB A;  3TOI A;  2PU4 A;  1JVJ A;  3O3V A;  3UPP A;  4QU3 A;  3A3D A;  3GMW A;  1J9M A;  3NCK A;  4KZA A;  2EXB A;  2XEP A;  4MBH A;  1CEG A;  2ZC7 A;  4LV0 A;  2JBF A;  1K55 A;  3PTE A;  2OV5 A;  5CGS A;  3GV9 A;  1O07 A;  4OLD A;  2ZMA A;  4UA6 A;  4DE3 A;  2Y2P A;  5FQQ A;  3UPN A;  5M19 A;  1ONG A;  4E3O A;  4KZB A;  3LEZ A;  4XUX A;  4OOM A;  3UE3 A;  1FCO A;  3NDG A;  2Y91 A;  4IVI A;  3UN7 A;  3FKW A;  4H8R A;  2ZQ7 A;  4K0W A;  2XLN A;  2Q9N A;  1RP5 A;  1BLH A;  3V5M A;  2X71 A;  2G2U A;  1OME A;  2WKE A;  4WM9 A;  1BLS A;  1KVL A;  3O87 A;  4GD8 A;  1YT4 A;  1W5D A;  3SH7 A;  1H8Z A;  1YLT A;  5CRF A;  2Z2L B;  5AQA A;  2GDN A;  4GN2 A;  3GQZ A;  1FR1 A;  3VSK A;  3BFD A;  5E2H A;  2H0Y A;  1K54 C;  3W8K A;  1GHI A;  2EX2 A;  2WGI A;  4KG2 A;  3P09 A;  2Y55 A;  3GSG A;  4S2N C;  3S22 A;  5M18 A;  5HAQ A;  1L0D A;  1Z6F A;  3RJU A;  3G34 A;  3W4Q A;  4PM6 A;  1IKG A;  1RCJ A;  3NIA A;  4S2M A;  4N1H A;  2WYX A;  4U3T A;  3C7U A;  3G4P A;  1H8Y A;  1XGI A;  3A3F A;  2DRW A;  3HBR A;  1LL9 A;  1ALQ A;  3AGD A;  4B4Z A;  4BD0 A;  5A90 A;  3FKV A;  3IXB A;  1K4F A;  4KQQ A;  4EBN A;  3MKF A;  1HZO A;  3HL9 A;  2HP5 A;  4MEZ A;  3NY4 A;  1XA1 A;  4WEJ A;  4JXG A;  5JYO A;  2WAE A;  4M3K A;  4KZ7 A;  4R3J A;  4WMC D;  3M2J A;  1IEM A;  4GZB A;  4LV3 A;  5CTM A;  5FSR A;  5G18 A;  3ZVT A;  3GRJ A;  4NK3 A;  4WZ4 A;  4PM9 A;  1PZO A;  2E8I A;  4JXS A;  4RX3 A;  4S2I A;  5FI6 A;  4DE1 A;  3BEB A;  2Y2Q A;  4GD6 A;  3Q82 A;  4UHU A;  5A93 A;  2UWX A;  4EUZ A;  4S2P A;  1ES3 A;  2DNS A;  5DTT A;  2Y2O A;  4JLF A;  1VQQ A;  4R3B A;  2Y2L A;  3N4I A;  1IEL A;  5BOH A;  1W8Q A;  1YM1 A;  4R23 A;  3FYZ A;  3VFF A;  2EX8 A;  3ZDJ A;  5EVI C;  4HES A;  4XUZ A;  5EVI B;  4Y0U A;  4OLG A;  5IHV A;  1GCE A;  1O7E A;  2OSU A;  1HVB A;  5A91 A;  4KZ5 A;  1LI0 A;  5CHJ A;  2B5R A;  3N8S A;  3S4X A;  3ZHH A;  4CPK A;  3HUO A;  3OPR A;  2BLS A;  5F1F A;  1CI9 A;  1GA0 A;  4IBR A;  4U0T A;  4U0X A;  4BL3 A;  3PBQ A;  2XDM A;  4JF6 A;  5E2F A;  1FSW A;  2ZC5 B;  4DDS A;  1RGY A;  4ZDX A;  1TVF A;  2WKH A;  4XXR A;  2WGV A;  3MXS A;  4OON A;  1JWZ A;  4BEN A;  3CMZ A;  2WKI A;  5DF9 A;  5EOE A;  4RYE A;  4EBP A;  4ZJ1 A;  1ONH A;  4JKT A;  5GLC A;  5GHX A;  3UO9 A;  5FAS A;  1RGZ A;  1IYO A;  1NRF A;  4JF4 A;  3VP0 A;  4RVA A;  1MPL A;  2VGJ A;  4C75 A;  3RXX A;  4LEN A;  1JWP A;  2J8Y A;  3IHB A;  2V20 A;  1PIO A;  2WGW A;  2XK1 A;  2P9V A;  1PW8 A;  3Q1F A;  4DDY A;  1DJB A;  4MBF A;  5TGF A;  1VM1 A;  4IBX A;  1C3B A;  4E3N A;  1IKI A;  3BEC A;  5HW3 A;  3LY3 A;  3G32 A;  1BSG A;  1M40 A;  1KE3 A;  3VP2 A;  1EWZ A;  4OOL A;  1PI4 A;  1QMF A;  1ZKJ A;  3NI9 A;  3ZFZ A;  1GHP A;  5FQJ A;  3SH8 A;  2HDR A;  3IXG A;  5L2F A;  2V1Z A;  3IF5 A;  1XPB A;  2VGK A;  4S2K A;  4L0L A;  3V39 A;  1BUE A;  1MWR A;  1PW1 A;  4PM8 A;  4DE2 A;  2PBY A;  2Y2M A;  5CED A;  4GOG A;  4WZ5 A;  3BLM A;  1CI8 A;  3ISG A;  3ITA A;  3PBR A;  4E3M A;  2HPB A;  2WAF A;  2ZM0 A;  2PU2 A;  4OPQ A;  2EFU A;  2EXA A;  3PBT A;  5CEB A;  2FFY A;  3TSG A;  5KSC A;  3G2Y A;  1SKF A;  5FQM A;  4Y0O A;  3RXW A;  4QJG A;  5CHU A;  4D2O A;  4NET A;  4S2L A;  4HBT A;  5FAO A;  2ZC6 B;  1S0W A;  4EBL A;  2IWB A;  1JTG A;  2ZLY A;  3PAE A;  1E3U A;  1YQS A;  3IF6 A;  1XKZ A;  4RX2 A;  3ZG9 B;  5J8X A;  3OPH A;  4FH2 A;  3OCL A;  1ES2 A;  3PAG A;  2H0T A;  4BLM A;  2ZC3 B;  2HDQ A;  2Z2M B;  3G31 A;  3IQA A;  2WK0 A;  4MBK A;  4CJN A;  3OPL A;  4OVD A;  4E3K A;  2Y2N A;  1MY8 A;  2XFT A;  2RCX A;  3HLD A;  5FAP A;  3QHY A;  3UDF A;  3OZH A;  4EWF A;  4X6T A;  3MFD A;  3BYD A;  5F83 A;  3EQU A;  1NZU A;  3HVF A;  1G6A A;  3HLE A;  5FA7 A;  3SS3 A;  3O88 A;  1SCW A;  1Q2Q A;  4BQM A;  3FWL A;  3W4O A;  5F1G A;  5EVL A;  3E2L A;  4KQR A;  1BUL A;  2ZC4 B;  3HLB A;  1ERO A;  1ESU A;  4K0X A;  4S2N A;  3VP1 A;  1BT5 A;  5EE8 A;  1BZA A;  1L0F A;  2Y59 A;  5U47 A;  2R9X A;  1L0E A;  1KGG A;  2V2F F;  4FD8 A;  5FQI A;  4DXB A;  2QMI A;  3MXR A;  4Y7P A;  2ZD8 A;  3C4P A;  5FDH A;  1MKI A;  3LO7 A;  3IHA A;  4HBU A;  4OQH A;  5HAI A;  4Y0T A;  5FQ9 A;  3ZGA B;  2HDS A;  2X01 A;  5I94 A;  3IXD A;  5HAR A;  4DKI A;  5CTN A;  5D3O A;  1W8Y A;  1I2S A;  3C4O A;  4ZBE A;  3MZF A;  4X53 A;  5AQ9 A;  3UE1 A;  3GVB A;  4OPR A;  1K4E A;  2Q9M A;  1EI5 A;  4BJP A;  1ZG6 A;  1JWV A;  4RA7 A;  1BTL A;  3GTC A;  5DF8 A;  5TR7 A;  3G30 A;  3ZG7 B;  1IYS A;  1K56 A;  3WRT A;  4EV4 A;  5DTK A;  3ITB A;  1I5Q A;  4MLL A;  1GA9 A;  5CEC A;  1KGE A;  2CC1 A;  2ZM8 A;  2J7V A;  4WBG A;  4DRT A;  2IWD A;  3ZG0 A;  1W79 A;  1ZG4 A;  3W4P A;  4FH4 A;  1LLB A;  1PZP A;  5CXW A;  1L0G A;  2R9W A;  1BLP A;  1K57 C;  3P98 A;  3DWK A;  4KG6 A;  4X56 A;  5EVI A;  4HEF A;  3JYI A;  3UY6 A;  4C3Q A;  5DVA A;  4LCL A;  4OQG A;  4B88 A;  4OQ0 A;  1MWT A;  3N6I A;  3G2Z A;  4DXC A;  1JTD A;  1YLJ A;  4LV1 A;  4A5R A;  4WYY A;  4YIN A;  2G2W A;  4DE0 A;  4GNU A;  2C5W B;  3LY4 A;  4YFM A;  4Z9Q A;  2XFS A;  3V3R A;  3V3S A;  2Y2G A;  4GDN A;  2OLV A;  4S2J A;  1ERM A;  2WUQ A;  3BLS A;  3IT9 A;  3M6B A;  3IWQ A;  1PWC A;  3TG9 A;  3M2K A;  2IWC A;  3AGF A;  3AGE A;  5EPH A;  2FFF B;  2JC7 A;  1W7F A;  3ZCZ A;  4OP8 A;  1KGF A;  1XGJ A;  1KE4 A;  4IED A;  4WEL A;  5AQ7 A;  3IH9 A;  2DCF A;  5KZH A;  3HUN A;  3OPP A;  1MXO A;  2XF3 A;  5DF7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...