1XA7A

Crystal structure of the benzylpenicillin-acylated blar1 sensor domain from staphylococcus aureus
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
248
structure length
242
Chain Sequence
ITDYNYKKPLQILDKSKIFGSNSGSFVMYSMKKDKYYIYNEKESRKRYSPNSTYKIYLAMFGLDRHIINDENSRMSWNHKHYPFDAWNKEQDLNTAMQNSVNWYFERISDQIPKNYTATQLKQLNYGNKNLGSYKSYWMEDSLKISNLEQVIVFKNMMEQNNHFSKKAKNQLSSSLLIKKNEKYELYGKTGTGIGKYNNGWFVGYVITNHDKYYFATHLSDGKPSGKNAELISEKILKEMGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Regulatory protein BlaR1
publication title Crystal structures of the Apo and penicillin-acylated forms of the BlaR1 beta-lactam sensor of Staphylococcus aureus.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 64
structure length 242
sequence length 248
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1xa7A00
3AGDA 5E43A 4ZTKA 5F1FA 4N1HA 1H8ZA 1PIOA 1YLJA 4JF4A 2ZQDA 2R9XA 5FQKA 4IVKA 1ESUA 2HP6A 3VOZA 4U3TA 4ZAMA 4Q8IA 3IF6B 5GLDA 3TG9A 2X02A 1W79A 4OQGA 2QZ6A 4YFMA 5DF7A 4WYYA 5GLCA 4XUXA 2H10A 4DRTA 2Y2IA 2HP9A 2Y2LA 3Q81A 1EROA 2ZC6B 5EECA 3N7WA 3UE3A 4OQ0A 3V50A 4QJGA 3BLMA 1DJAA 1AXBA 4KZ3A 1K6SA 1XKZA 4IEDA 4QD4A 1I2WA 2WUQA 3IF5A 1Y54A 4N9KA 1QMEA 1ERQA 3Q7ZA 4UAAA 3ZG7B 1CI9A 2Y2GA 3OPRA 1MPLA 2IWBA 4X53A 3GMWA 5F82A 5TR7A 2HPBA 5F1GA 4PM8A 4CJNA 1NRFA 3Q1FA 5DF9A 4OP5A 1E4DA 4GN2A 4BL2A 3GSGA 1E3UD 4R3JA 5CHJA 4HBUA 5FASA 3S4XA 3ZG8B 2Y2HA 1BT5A 1WE4A 1CI8A 1EI5A 3E2KA 3IT9A 3W8KA 3MZFA 2X01A 3G4PA 1FCNA 5J8XA 1YLPA 3OPLA 3QNBA 3NBLA 4GD6A 1NYYA 5DTTA 3UDXA 3GQZA 5G18A 5FQMA 1K56D 4HESA 3WS1A 3ZG0A 4S2MA 3TOIA 3W4QA 1PZPA 1YLWA 3TSGA 4E3KA 2ZM8A 4S2NA 4BL3A 1FR1A 3MKFA 1ES3A 4RVAA 2I72A 3OPPA 4R4RA 1PYYA 2WKIA 2XEPA 3V39A 3MZEA 4BJPA 1BLPA 4LENA 1OMEA 4JXSA 4MNRA 5EE8A 3VP4A 1CEGA 1TDGA 1ALQA 4LV3A 4WMCD 1XGJA 3UE0A 1ES2A 3HLEA 4GZBA 3SH9A 4PM5A 3HUNA 3NDGA 1K25A 1L0EA 1MWRA 5M1AA 3W4OA 3OC2A 4OVDA 3G34A 5E2GA 4D2OA 1RGYA 3BFEA 3FV7A 3ZG5A 5FA7A 2EFXA 1K4FA 4OLGA 4R23A 3EQVA 3IXDA 5GLBA 3MBZA 1FCOA 5EPHA 3RXWA 4DDYA 4LV0A 5EOEA 3M6BA 3MXRA 2GDNA 3G32A 3PBOA 1GCEA 1RP5A 2ZQ7A 1DY6A 3G31A 1BZAA 2WZXA 5CHUA 2Y2JA 4X56A 5GLAA 3RXXA 2OLUA 4LV1A 3A3IA 4L0LA 3VSLA 1HTZA 2WADA 4O7DA 1O07A 1TDLA 3WS2A 1IEMA 1NJ4A 2RL3A 1PZOA 2XH9A 2PU4A 2XLNA 4MEZA 3CZDA 2QPNA 1IKGA 3IWIA 4OKPA 4KZ4A 3ZHHA 1IYQA 5CECA 3A3EA 3BEBA 1RCJA 2ZM0A 2Y2NA 4KG2A 4R3BA 2EXAA 4ZDXA 1KDSA 3IWOA 3WWXA 1KGFA 2DRWA 4E3LA 1J9MA 3DW0A 1IYSA 1ZG4A 2CC1A 3VSKA 1JTDA 2VGJA 4Y0UA 1FOFA 2A3UA 4OPQA 4UA9A 5BOHA 4U0XA 4WZ5C 5FAQA 5E2FA 2XGNA 3GRJA 2IWCA 4QY6A 4OH0A 1PWGA 2R9WA 2EX8A 3WS5A 4BD1A 2ZLYA 5CTNA 1XPBA 3HL9A 3BLSA 4ZBEA 2V1ZA 2Y55A 3SH7A 2JCHA 4R4SA 3NC8A 2H0YA 1IYOA 4QY5A 5FSRA 3HLFA 3Q82A 4GD8A 1MKIA 5E2EA 3G2ZA 3NCKA 3UY6A 4E3OA 1XXMA 3FKVA 5A93A 2ZC3B 4M3KA 2ZM2A 2Z2LB 3PAGA 1JTGA 4E3NA 3S1YA 1VM1A 3LY3A 4EBPA 1NYMA 5CGXA 3WS0A 3UE1A 4WELA 1H5XA 1K6RA 1W8QA 3QNCA 5GHYA 4JF6A 3UPPA 4BENA 1SKFA 3ZFZA 3GTCA 3BM6A 5FI6A 3CG5A 3IH8A 1YLTA 3N8LA 4OOYA 3DWKA 3P09A 1K55A 3C5AA 3LCEA 1U60A 1ONHA 3VOYA 1RGZA 3HLDA 1CEFA 1MWSA 2JE5A 4LCMA 2UWXA 2XK1A 3ITAA 2HP5A 4IBRA 4OP8A 5DVAA 4CPKA 3HLWA 4GKUA 4ID4A 2IWDA 2ZMAA 4XUZA 1K54A 1DJCA 3SS3A 4OPZA 1VQQA 2Y2KA 3IHBA 3SS4A 5A92A 1BSGA 4JXGA 4HBTA 3O3VA 2Q9MA 3A3JA 3WRZA 1MWUA 4KZ8A 4U0TA 4KENB 4PM7A 1IELA 4YINA 1KGGA 1YLYA 4X69A 3V3RA 1K57C 1BULA 5JYOA 5EVIA 2FFYA 1KVLA 1XA7A 2WZZA 2ZJ9A 4KZ7A 1Q2PA 3ITBA 1LL5A 4Y0TA 5GHXA 4DE2A 4K91A 3CMZA 1JWZA 2H0TA 5EVLA 4N9LA 3VP2A 5EVIB 2Y4AA 4N92A 3GVBA 2DCFA 3P98A 1M40A 3IF6C 1C3BA 2WGVA 2X71A 1BLCA 1PI4A 1LL9A 3AGEA 4E3MA 4UA7A 1LI0A 1NY0A 3GR2A 4MLLA 5AQAA 5EUAA 4X55A 1HD8A 4FSFA 3IWQA 4C75A 3IQAA 1L0GA 4B4ZA 4JXVA 1L2SA 4DXCA 4GOGA 4UA6A 1KVMA 1MBLA 2EX6A 1IYPA 3PBQA 4FH4A 2HDUA 3LEZA 4E6XA 2V20A 4R0QA 3OCLA 3W4PA 3S22A 3IXHA 3ZG9B 3HREA 4UHUA 4Y0OA 1K38A 1NXYA 5CERA 4QU3A 1WYCA 3QHYA 4S2LA 2ZQ9A 3DWZA 4H8RA 1M6KA 2HDQA 2ZC5B 3C4PA 3DTMA 1N4OA 4WZ4A 2XFTA 1FQGA 1YMSA 5IHVA 3ZVWA 2WYXA 1XGIA 2WGWA 2OLVA 3SH8A 4E3JA 2J9OA 4OOMA 3MFDA 2ZQAA 2XQZA 4LCLA 4WBGA 4P85A 1W8YA 4GDBA 3O88A 1ES4A 4P87A 3VMAA 3ZCZA 1WYBA 2WGWB 1I5QA 4OQIA 3Q07A 4KZAA 4ZJ1A 5FI7A 2PBYA 1PWDA 4S2NC 4B4XA 1ZKJA 3UNWA 2BLSA 4RX2A 1JVJA 4K0WA 2Y91A 4DE3A 3ZNTA 3N8SA 3BFDA 5M18A 5A90A 3ZNYA 5KSCA 4ZJ2A 4S2OA 1S6RA 3G30A 4KZ9A 2XF3A 4KZ5A 4EUZA 1XX2A 3SS5A 2DNSA 4XXRA 5HAQA 3JYIA 4DE1A 5AQBA 4BQMA 3LY4A 1Z6FA 5E2HA 1XA1A 4B88A 2EXBA 3FKWA 3I7JA 2V2FF 3C4OA 5FQJA 3AGFA 3ZVTA 5GHZA 3N4IA 1GA0A 1KGEA 4A5RA 2B5RA 5CRFA 3FWLA 3HUMA 4PM9A 4E6WA 2C6WB 1LLBA 1K4EA 3BFGA 3IHAA 3M2KA 3O87A 5DTKA 3UDFA 2OSUA 3V3SA 3C7UA 4S2KA 1ONGA 3HBRA 4HEFA 5FAOA 3B3XA 4R1GA 1O7EA 2J8YA 4WEJA 5HFOA 4IBXA 5CTMA 4JPMA 2ZQCA 5D3OA 2Y59A 2ZC7A 3CJMA 4FD8A 1FSWA 3ZGAB 5FATA 4JBFA 3OCNA 3VFFA 5CGSA 2P9VA 1MY8A 3UPOA 4BD0A 2RCXA 5U47A 4EQIA 4PM6A 1BTLA 1TVFA 1KE0A 1YLZA 3D4FA 3NIAA 4GB7A 3HUOA 4LV2A 4KZBA 1E25A 4BLMA 3PBSA 5HW3A 5FQ9A 4C6YA 2WKEA 3BYDA 4KZ6A 2P9VB 5CXWA 2XFSA 4OOLA 3FZCA 5EVID 5HX9A 5HL1A 1FCMA 4DKIA 4JKTA 3IXGA 4N1XA 4K0XA 2HDSA 5AQ9A 5TGFA 5KMWA 1GHIA 3ISGA 1E3UA 5FQQA 4JXWA 3G2YA 4PPRA 1ERMA 3FYZA 5TFQA 2FFFB 4EWFA 4IVIA 3UN7A 2J7VA 5L2FA 2Z2MB 4DE0A 1BUEA 4E3IA 1LI9A 3PAEA 2C5WB 2XD1A 1YMXA 3A3FA 1IKIA 3EQUA 4EBLA 1H8YA 2JC7A 2XR0A 2A49A 1G6AA 1KDWA 3BFCA 3G35A 1SCWA 5AQ7A 4RX3A 3N8RA 4KQOA 4WZ5A 1K56A 3HLCA 1GHMA 3A3DA 4FCFA 3NY4A 4WEKA 1FR6A 1CK3A 2G2WA 1YT4A 3BECA 1KE3A 4OONA 1SDNA 3PBNA 4P0MA 4RYEA 5HAIA 4X6TA 5I94A 4DDSA 1PW8A 1L0DA 2XDMA 3LO7A 4NK3A 4OPYA 4MBHA 1L0FA 4JF5A 1BLHA 3BFFA 4Z9QA 1K55C 1W5DA 3UO9A 3O86A 1BLSA 1G68A 5CEBA 5JYPA 1ES5A 3VP3A 1JWPA 3IH9A 4S2IA 4WMCA 2G2UA 2H5SA 5CGWA 1SHVA 1ESIA 3OZHA 3RJUA 4GNUA 3WRTA 1Q2QA 3PBTA 4MBFA 1LHYA 3OPHA 1ZC2A 4ZJ3A 3VP1A 2EFUA 5FQIA 3WS4A 1HZOA 4C3QA 4PMAA 2WAEA 2Y2OA 2Y2QA 1K54C 3E2LA 2WAFA 2WKHA 2WGIA 3Q7VA 4EBNA 1PI5A 1MWTA 3UDIA 2Q9NA 3M2JA 4QB8A 1JWVA 2WK0A 1HVBA 3HVFA 4P6BA 3MKEA 1YM1A 3HLGA 1YQSA 1I2SA 3N6IA 1KE4A 5DF8A 3NDEA 4FH2A 5EVIC 1PW1A 3GV9A 1NZOA 1XP4A 2EX2A 3Q7VB 3C7VA 1EWZA 1S0WA 4Y7PA 3HLBA 4QHCA 2QMIA 5DTSA 2Y2PA 3UPNA 5HARA 1TEMA 1DJBA 2PU2A 2ZD8A 2ZQ8A 2EX9A 3PBRA 4KQRA 5KZHA 1QMFA 2E8IA 5FI2A 4X68A 1NZUA 3VP0A 2HDRA 2P74A 5FAPA 2Y2MA 3PTEA 3NI9A 4MBKA 4S2JA 1ZG6A 4KG5A 4S2PA 5HAPA 4JLFA 5KSHA 5EOOA 2VGKA 4OLDA 5CEDA 1FSYA 5M19A 1SDEA 3BRMA 3SOIA 3ZDJA 4DF6A 3V5MA 4GDNA 3VFHA 4NETA 1K57A 1GA9A 2BG1A 5CHMA 1PWCA 5F83A 3M6HA 4OPRA 4KG6A 3MZDA 2OV5A 2J9PA 5GL9A 4DXBA 5A91A 1GHPA 1MXOA 4F94A 4OQHA 3IXBA 4RA7A 3MXSA 1W7FA 2ZC4B 2XD5A 1N9BA 3IF6A 4WM9A 4KQQA 2JBFA 4EV4A 5FDHA
chains in the Genus database with same CATH superfamily
3AGDA 5F1FA 1YLJA 3QP8A 5FQKA 4IVKA 3VOZA 5HWTA 3TG9A 1W79A 4OQGA 5DF7A 3BW6A 4K08A 2VA0A 2HP9A 3BLMA 1DJAA 3LGOA 3IF5A 1QMEA 3ZG7B 5HDDA 3GMWA 1NRFA 2GZAA 1E4DA 4Y2FA 3VE3A 1E3UD 4R3JA 3LFVA 3MFXA 3IT9A 3E2KA 3MZFA 1FILA 5EVEA 2ZOIA 3QNBA 1K56D 3K3CA 4S2MA 2A24A 2NUTC 2ZM8A 2QWSA 4S2NA 1FR1A 3MKFA 3C30A 3ZQ5A 2XEPA 3BY8A 1CEGA 4LV3A 1XGJA 1GSVA 1MWRA 5M1AA 3OC2A 4OVDA 5E2GA 3IS2B 3QP4A 3T1QB 2VK3A 4R23A 3EQVA 3IXDA 5GLBA 3MBZA 4LV0A 3C2WA 1L3LA 3MXRA 3A0RA 3G32A 1GCEA 1RP5A 2ZQ7A 4I38A 3SZTA 5CHUA 4IJGA 5GLAA 3RXXA 2J3WA 4L0LA 3R7WB 5EM1A 4O7DA 1TDLA 2Z6CA 1NJ4A 3F1NA 1IYQA 3EOIA 3BEBA 3T1RA 1OTBA 2ZM0A 2INWA 3IWOA 1IYSA 1ZG4A 3VSKA 1FOFA 2Z6DA 5BOHA 4WZ5C 5FAQA 5E2FA 1GSWA 4BBTA 4ETZA 2ZLYA 2J3TD 3BLSA 4ZBEA 2Y55A 3JPUA 2JCHA 4R4SA 2H0YA 4QY5A 3Q82A 1W63M 1MKIA 3MJQA 1Y28A 5E2EA 3G2ZA 4E3OA 1XXMA 5C5KA 2O9AA 2Z2LB 1DP9A 3TW8A 2P04A 3WS0A 1H5XA 1K6RA 1T19A 4JF6A 3U4LP 1SKFA 3TRCA 4ZRRA 4BENA 2XROA 5FI6A 4NXFA 3DWKA 3P09A 1K55A 1ONHA 1RGZA 1MWSA 2XK1A 1N9LA 3MF0A 4D60A 3DTKA 4OP8A 4EXOA 4GCZA 3T1XA 2Y8HA 3ZYTA 1DP8A 1P97A 1DJCA 4OPZA 4LRZE 3SS4A 1BSGA 4HBTA 3O3VA 4HH2A 2HJ9C 3V3RA 2PD7A 1K57C 1BULA 3E4QA 5JYOA 5L09A 4LRYC 4X25A 4Y0TA 5GHXA 2H0TA 5EVIB 2W3GA 5F6AA 1MC0A 1C3BA 2X71A 4ARZA 1BLCA 1PI4A 3AGEA 2WKRA 1G5UA 1LI0A 1NY0A 1P9WA 5AQAA 1HLUP 5EUAA 4X55A 3IWQA 5DJTA 2O9CA 5FEFA 1IYPA 4E6XA 4HI4A 3IXHA 5DJUA 2WKPA 2B95A 1N9NA 2V9AA 3DWZA 4WN5A 2HDQA 3C4PA 3DTMA 4H6JA 2ZL1B 3LIFA 2GNXA 3SH8A 3LEQA 4E3JA 4OOMA 2EA9A 5TBMB 3JVUA 3ZCZA 2OAQ1 3VOLA 1TS0A 1SKOA 2BLSA 4KQDA 1JVJA 4RX2A 4K0WA 2HGVA 4DE3A 3ZNTA 3N8SA 4ZJ2A 1S6RA 1ACFA 1S1YA 1VETA 4KZ5A 5F5YA 2KOIA 3SS5A 3DTIA 5HD3A 5HAQA 3UB7A 4PAUA 3EWKA 5GHZA 4A5RA 2ACGA 5CRFA 4UEYA 3FWLA 1LLBA 2VGLM 3IHAA 3TJZC 4CLCB 5F69A 2W3HA 3BQ8A 2IA2A 4JPMA 2O99A 3T4KA 3ZGAB 3D72A 4BD0A 4GB7A 3D4FA 3HUOA 4LV2A 2PT7A 4NKPA 3PBSA 5FQ9A 3BYDA 1K0KA 2P9VB 5CXWA 4UQIM 2XFSA 3FZCA 1LT0A 5HL1A 3OLOA 4DKIA 4K0XA 5AQ9A 3PHYA 3ISGA 1E3UA 1KOUA 3G2YA 2J7VA 2Z2MB 4E3IA 4ME4A 2C5WB 3A0SA 1H8YA 2JC7A 3G35A 4DN0A 4YNRA 1K56A 4FCFA 2G2WA 3BECA 3PXPA 3NHQA 1SDNA 4X6TA 3LO7A 2XDMA 1L0FA 1BLSA 5CEBA 4YOFA 4LRXC 4C3QA 2PYPA 2Y2OA 4GHIA 1K54C 2WKHA 3CHWP 1TS7A 1MWTA 3UDIA 3CUEC 2WK0A 4P6BA 3MKEA 3HLGA 5HWVA 5HZHA 3C38A 3BWLA 3IX4A 4JGPA 1NZOA 3Q7VB 2EX2A 5EVIC 3C7VA 1EWZA 4NXBA 2QMIA 3S7OA 3NECA 2FZ0A 3KSGA 1ODVA 1DJBA 5KZHA 3IBJA 2XA7S 1QMFA 2J80A 5DKLA 4B93A 3NI9A 1YKDA 2PRFA 5KSHA 1H8MA 5EOOA 5CEDA 3SOIA 3ZDJA 3VFHA 3KSFA 1XJ2A 2V8CA 3M6HA 4OPRA 3QP5A 5GL9A 1GHPA 2HZ5A 2V1AA 2XD5A 3D3OA 1H8ZA 1PIOA 2ZQDA 3EEHA 2XSSA 1ESUA 2HP6A 4U3TA 3GDIA 4QPRA 5GLCA 4DRTA 5EECA 2Y2LA 5FDSA 3N7WA 2JKRI 1AXBA 2W1TA 4KZ3A 1XKZA 1I2WA 1Y54A 3LIDA 2L0WA 2IWBA 4R6LA 3FC7A 4X53A 4CJNA 4HP4A 2OWHA 4OP5A 1VEUA 4BL2A 3GSGA 3H82A 3KSHA 4G3KA 2Y2HA 1BT5A 2KX6A 5G4ZA 2G7UA 1WE4A 2GX5A 3G4PA 3KX0X 1FCNA 3LIEA 1YLPA 3U2AA 1Z09A 3WS1A 4BL3A 3E98A 1ES3A 3LR4A 3OPPA 3V39A 2WKIA 3MZEA 2PDRA 2JKGA 4LENA 4JXSA 4FTXA 3UE0A 1ES2A 3HLEA 3DAVA 3HUNA 3NDGA 1L0EA 2V0UA 4XT2B 4HY8A 3RXWA 5EOEA 5DFXA 3M6BA 2GDNA 3PBOA 3CLOA 1JNUA 2V8FA 1T18A 2Y2JA 4X56A 3UB9A 2VEAA 3A3IA 4JGQA 3VSLA 2JHEA 3VV4A 1IEMA 5K5BA 3CZDA 3IWIA 4GLQA 3ZHHA 5CECA 4ESPA 5IS1A 2Y2NA 3DW0A 2CC1A 1JTDA 2VGJA 4UA9A 4U0XA 4EW7A 4MCWA 3UMEA 4OH0A 1PWGA 3WS5A 4BD1A 1XPBA 2L4RA 3HL9A 4IHQA 3NC8A 4EEPA 1IYOA 2WKQA 5FSRA 3NCKA 4X1LA 3UY6A 4F3LB 5A93A 3C8CA 2ZC3B 2ZM2A 3PAGA 4E3NA 3NOPC 1DP6A 3H7WB 3QNCA 1YSPA 3UPPA 4MN6A 3BM6A 3CWFA 1YLTA 3N8LA 5IT5A 5EV0A 3C5AA 2Y79A 1CEFA 4L9GA 2UWXA 4HJ4A 5DVAA 3MS6A 3HLWA 4GKUA 4ID4A 4HJ3A 3EGDC 1VQQA 5FL3A 4NEED 3H9WA 1MWUA 4KZ8A 3RTYA 1KGGA 1X0OA 1XA7A 1OJ5A 2ZJ9A 2QKPA 4KZ7A 1G28A 1Q2PA 1T1CA 5CX7A 4K91A 4FUWA 5EVLA 4N9LA 3VP2A 3P98A 1VB6A 3GR2A 4C75A 1XFQA 3F1PA 3F1OA 1MBLA 2EX6A 3PBQA 3LEZA 4R0QA 1NXYA 5CERA 3FPVA 2ZC5B 3HJIA 5HPIA 2XFTA 1YMSA 1CJFA 2WGWA 5DFYA 3MXQA 4LCLA 3T4TA 4WBGA 5DKKA 4P85A 2GJ3A 3O88A 4P87A 3VMAA 4P6ZS 4OQIA 1OT9A 4ZJ1A 1ZKJA 3UNWA 4EETB 4X1MA 3BFDA 4HNBA 5J7EA 2XF3A 1XX2A 3LY4A 4B88A 2V2FF 3C4OA 3B47A 1XJ6A 2JKFA 4Y13A 3O87A 4MN5A 5DTKA 5G4YA 4NXEA 2OSUA 3MQ0A 3C7UA 4S2KA 3EGXC 1D06A 3LR3A 1H0MA 3B3XA 4R1GA 1O7EA 3NOTC 4WEJA 5HFOA 4IBXA 5CTMA 2Y59A 3CJMA 4FD8A 1YAXA 5FATA 3OCNA 3VFFA 5CGSA 4GS9A 2E8JA 2RCXA 4EQIA 4PM6A 1TVFA 1E25A 5L10A 5HW3A 4C6YA 1D1JA 5EVID 5IU1A 4NG2A 4JKTA 3PYPA 2AVXA 5KMWA 1GHIA 5FQQA 4JXWA 1S1ZA 1ERMA 3K2NA 4IUKA 2XD1A 3A3FA 1IKIA 2XR0A 1G6AA 1KDWA 3BFCA 2VX8A 3N8RA 2PHYA 4WZ5A 2M7UA 3HLCA 3A3DA 3RH8B 4PKYG 4WEKA 1FR6A 1CK3A 1YT4A 3PBNA 4RYEA 2BTFP 3UO9A 1G68A 1JWPA 2G2UA 2H5SA 3NULA 1SHVA 4MN7A 2WAEA 1YPRA 3KYEA 4EBNA 1PI5A 4QB8A 1JWVA 2VV8A 3CPTA 1I2SA 2VKSA 4Y7PA 3KSIA 5DTSA 4QWOA 5HARA 1TEMA 4KQRA 3VP0A 1NZUA 4I3IA 3PTEA 4MBKA 1NLYA 4DMZA 1SDEA 3BRMA 5A8BA 4DF6A 1K57A 3MR0A 2BG1A 5F83A 4KG6A 3MZDA 2J9PA 1WA9A 1MXOA 2ZMVA 1OPXA 1LL8A 4L9EA 4HHDA 1N9BA 3EEAA 5E43A 4ZTKA 4N1HA 4KUOA 1LSWA 3IF6B 5GLDA 3R4KA 2X02A 4WYYA 2H10A 3Q81A 1EROA 2ZC6B 3UE3A 4OQ0A 5AVFA 3V50A 4QJGA 3NOUC 1K6SA 2YKFA 1NWZA 2WUQA 5HDSA 2PAVP 1V9ZA 3Q7ZA 4UAAA 2Y2GA 3OPRA 1MPLA 3MQOA 5F1GA 3SW1A 2PD8A 5DF9A 3LR5A 3CAXA 4GN2A 2W3DA 5HD5A 5CHJA 4HBUA 5AVEA 5FASA 1ZHHB 3S4XA 2CMNA 3W8KA 1EI5A 3OBFA 2X01A 5J8XA 2PR6A 1IOUA 3NBLA 3QP1A 5DTTA 2OAP1 3UDXA 3GQZA 5G18A 4HESA 1PZPA 3JVVA 1GSXA 4RVAA 4R4RA 1PYYA 4BJPA 1BLPA 1OMEA 2A24B 3IS2A 4MNRA 3VP4A 1TDGA 1ALQA 3D9YA 4GZBA 4PM5A 1UGUA 4CLCE 4D2OA 3ZG5A 2EFXA 1FCOA 3R7WA 4DDYA 5MC7A 2HJEA 1DY6A 2LB5A 2OLUA 4Q0JA 5HPFA 2RL3A 1PZOA 2XH9A 2PU4A 2XLNA 4KZ4A 4EESA 3A3EA 1RCJA 4R3BA 2EXAA 4PHTA 1KDSA 3WWXA 1KGFA 2DRWA 2XA7M 4E3LA 1J9MA 3F1NB 2A3UA 2HV1A 4BWIA 2IWCA 4QY6A 2R9WA 2EX8A 1V9YA 2LB9A 5L07A 4G3VA 4R38A 4GD8A 3IBRA 4KUKA 3LY3A 1NYMA 3UE1A 5GHYA 2B02A 3GTCA 3IH8A 4BBUA 3LIBA 3VOYA 1G6OA 2JE5A 3IX3A 3MMHA 4LCMA 2EWWA 4I3AA 1NRJA 2HP5A 4EQ1A 5HDCA 4CPKA 4XUZA 1K54A 2Y2KA 3QP2A 5A92A 2K31A 2Q9MA 3CUEA 3WRZA 2PR5A 1YLYA 1TS6A 5EVIA 2FFYA 1PNEA 2WZZA 4R3AA 1J3WA 3UB5P 3A0VA 1LL5A 4CLCC 2Y4AA 4N92A 2DCFA 3NJAA 3IF6C 2WGVA 2W0NA 4E3MA 4UA7A 1HD8A 1L0GA 1OT6A 4JXVA 4ARZB 1L2SA 5EFWA 4DXCA 1XFNA 3S7NA 1KVMA 4E04A 3W4PA 1T1AA 3OCLA 3S22A 3ZG9B 1FIKA 3HREA 2ZL1A 1Y4OA 1WYCA 2VV6A 3PR6A 3T12B 4S2LA 5TJJA 4G3WA 4NXGA 2JKTI 5TBMA 2WYXA 1XGIA 2BASA 5AJGA 3DTEA 2J9OA 3MFDA 4H6JB 5J3WA 1D7EA 1ES4A 1WYBA 2VJWA 1I5QA 3CITA 1PWDA 4S2NC 4B4XA 2Y91A 3K3DA 3GECA 5M18A 3ZNYA 5KSCA 3G30A 4KZ9A 3E4PA 4HJ6A 1SKOB 2DNSA 2PBDP 4XXRA 3JYIA 2QHKA 4DE1A 5AQBA 2W27A 4BQMA 3BY9A 1Z6FA 5E2HA 1XA1A 1TS8A 2EXBA 4LPZA 3I7JA 5FQJA 3AGFA 1GA0A 1VETB 1KGEA 3L9KA 2B5RA 1F2KA 4CLCA 3ULFA 3HUMA 4E6WA 1P0ZA 2C6WB 3M2KA 3UDFA 3HJKA 1ONGA 3HBRA 2ZQCA 2ZC7A 4O8GA 4JBFA 2P9VA 2ZBBA 5U47A 4EU0A 1XJ3A 4Y5FA 4KZBA 1S4RA 1FCMA 3S7PA 2HDSA 4O01A 2O0YA 4PPRA 3FYZA 5TFQA 4EWFA 2JKRM 4IVIA 5L2FA 4DE0A 1BUEA 3EQUA 2ZMFA 4EBLA 4CQHA 1SCWA 5AQ7A 4RX3A 2YKHA 1PRQA 1GHMA 3NY4A 3MSHA 1CQAA 1N9OA 1KE3A 2M1CA 4RQ9A 4P0MA 1PW8A 3IX8A 3QP6A 3KYQA 4NK3A 2P08A 4Q0HA 4Z9QA 1K55C 4EUVA 1W5DA 3O86A 5JYPA 3IH9A 4IUHA 4S2IA 2JN7A 3RJUA 2K2NA 4GNUA 3WRTA 2QJ7A 3PBTA 4MBFA 1LHYA 3LI9A 4ZJ3A 2EFUA 3WS4A 4PMAA 4GJ4A 2Y2QA 3E2LA 2WAFA 3Q7VA 2Q9NA 2K7SA 3M2JA 4MDZA 1HVBA 3N6IA 4GHIB 5DF8A 4FH2A 3T1SA 4DJ2A 1S0WA 4QHCA 2Y2PA 2Q0OA 3UPNA 1UWNX 2ZQ8A 2EX9A 2E8IA 4P6ZM 2P74A 2MJ6A 1F5MA 4Y3IA 4S2JA 1ZG6A 4KG5A 3BQAA 2VGKA 2OWJA 4OLDA 1FSYA 1UWPX 4GDNA 2JKTM 5CHMA 2OV5A 4DXBA 2ZOHA 2FH5A 4OQHA 4RA7A 1W7FA 2JBFA 4EV4A 3T4OA 4JF4A 2NUPC 2R9XA 4MMNA 4HOIA 4B9OA 4ZAMA 4Q8IA 1OTIA 1H3QA 4I3JA 2H28A 2QZ6A 4M4XA 4YFMA 5FEGA 4XUXA 2Y2IA 1OTDA 4IEDA 4QD4A 4N9KA 1ERQA 4O0PA 1CI9A 5TR7A 5F82A 2HPBA 2W1TB 4PM8A 3Q1FA 3P01A 4DJ3A 3ZG8B 5I5LA 1CI8A 4AFIA 1VEUB 3OPLA 5HWWA 1S66L 1NYYA 4GD6A 3H82B 5FQMA 2V0WA 3ZG0A 3TOIA 3W4QA 1YLWA 3TSGA 4E3KA 4EEUA 3LICA 2W1RA 2I72A 1SZVA 2PYRA 5EE8A 2P7JA 4WF0A 4XT2A 4WMCD 3SH9A 1DRMA 2B18A 3W4OA 1K25A 3G34A 1RGYA 3BFEA 3FV7A 5FA7A 1K4FA 4OLGA 5LBRA 3RFBA 5EPHA 1EW0A 5L8MA 2KDKA 3BJNA 3G31A 1BZAA 2WZXA 1F9IA 4LV1A 1HTZA 2WADA 1O07A 1OJGA 4MEZA 4Y17A 3T4JA 3WS2A 2QPNA 1IKGA 4OKPA 3L7HA 3T4LA 2D02A 4KG2A 4ZDXA 1A0KA 4Y0UA 4OPQA 3LI8A 2XGNA 3GRJA 3T4QA 1IFQA 5CTNA 4F3LA 4Q0IA 2V1ZA 4CLCD 4LFUA 3SH7A 2O9BA 3HLFA 3W2ZA 3H7WA 4II7A 3FKVA 4R70A 4M3KA 1JTGA 1OTAA 2VGLS 3S1YA 1VM1A 4EBPA 5CGXA 4PKYA 4WELA 1W8QA 4WUJA 3ZFZA 2W3FA 2A2LA 3CG5A 4OOYA 3LCEA 1U60A 3HLDA 4ETXA 4I39A 3ITAA 4IBRA 1CF0A 3B33A 1T1BA 2IWDA 2ZMAA 3SS3A 3IHBA 4UQIS 4JXGA 3VE4A 3A3JA 1VHMA 4YINA 4U0TA 4KENB 4PM7A 1IELA 4X69A 1LSVA 4L9FA 1KVLA 1OTEA 2J3TC 3ITBA 4DE2A 3CMZA 1JWZA 1STZA 3B42A 3GVBA 1TD5A 1M40A 1PFLA 1LL9A 2EWVA 4WL9A 4MLLA 4FSFA 3IQAA 4B4ZA 1S4SA 1MZUA 4GOGA 4UA6A 3UB8A 1P9RA 3KYZA 4HQAA 4FH4A 2HDUA 2OOLA 2V20A 3V67A 3F1PB 4UHUA 4Y0OA 1K38A 4QU3A 4BBVA 3F1OB 3QHYA 2ZQ9A 4H8RA 1M6KA 3FG8A 4WZ4A 1N4OA 1ZTUA 1FQGA 5IHVA 1BYWA 3ZVWA 2OLVA 2KLIA 5HSQA 2ZQAA 2XQZA 4BMWA 2QJ5A 1W8YA 4GDBA 4WLAA 1AWIA 2WGWB 5KIZA 3Q07A 4KZAA 5FI7A 1F98A 3T50A 2PBYA 3UB6A 3KO6A 2W3EA 3E4OA 5A90A 4S2OA 3O5YA 3DBAA 4EUZA 3UE6A 4YWZA 3LYXA 2I9VA 1YSQA 3FKWA 3P7NA 4EERA 3ZVTA 2DMWA 4GW9A 3N4IA 4JGRA 1LSXA 5J4EA 4PM9A 3T4SA 1K4EA 3BFGA 3V3SA 2VV7A 4HEFA 5FAOA 4HH3A 2J8YA 1XJ4A 5D3OA 1FSWA 2L1MA 1S67L 1MY8A 3UPOA 1BTLA 1KE0A 1YLZA 3NIAA 3E0YA 2D01A 4BLMA 2WKEA 4KZ6A 4GS9B 4OOLA 5HX9A 3IXGA 4N1XA 5TGFA 2M7VA 3TE8A 4Y15A 2V1BA 3ICYA 4HP9A 2FFFB 3UN7A 2UV0E 1LI9A 3PAEA 4LGWA 1YMXA 2A49A 2XRNA 2VZWA 3HCYA 4KQOA 4OONA 3OOVA 5HAIA 5I94A 4DDSA 1L0DA 4OPYA 4MBHA 4JF5A 1BLHA 1MKMA 3BFFA 2HF6A 3MQQA 3UMDA 1ES5A 3VP3A 4WMCA 5CGWA 1ESIA 3OZHA 1NLZA 1Q2QA 3VP1A 3OPHA 1ZC2A 5FQIA 1HZOA 4Z1WA 2WGIA 3LR0A 4JGOA 3LIAA 2QYBA 1W63Q 3HVFA 3CI6A 1YM1A 5HL6A 1YQSA 3FPWA 1KE4A 3NDEA 1PW1A 3GV9A 1XP4A 3HLBA 3G6OA 5EM0A 4HIAA 4I5SA 2PU2A 2ZD8A 3CPTB 3PBRA 3S7QA 5FI2A 4X68A 3LUQA 2HDRA 5FAPA 2Y2MA 2R78A 4S2PA 5HAPA 4JLFA 2VLGA 5M19A 3V5MA 4LLOB 4NETA 1GA9A 5F68A 1PWCA 1TF1A 5A91A 4F94A 3IXBA 3MXSA 2ZC4B 4FOFA 4WM9A 3IF6A 4KQQA 5FDHA
chains in the Genus database with same CATH topology
3AGDA 5E43A 4ZTKA 5F1FA 4N1HA 1H8ZA 1PIOA 1YLJA 4JF4A 2ZQDA 2R9XA 5FQKA 4IVKA 1ESUA 2HP6A 3VOZA 4U3TA 4ZAMA 4Q8IA 3IF6B 5GLDA 3TG9A 2X02A 1W79A 4OQGA 2QZ6A 4YFMA 5DF7A 4WYYA 5GLCA 4XUXA 2H10A 4DRTA 2Y2IA 2HP9A 2Y2LA 3Q81A 1EROA 2ZC6B 5EECA 3N7WA 3UE3A 4OQ0A 3V50A 4QJGA 3BLMA 1DJAA 1AXBA 4KZ3A 1K6SA 1XKZA 4IEDA 4QD4A 1I2WA 2WUQA 3IF5A 1Y54A 4N9KA 1QMEA 1ERQA 3Q7ZA 4UAAA 3ZG7B 1CI9A 2Y2GA 3OPRA 1MPLA 2IWBA 4X53A 3GMWA 5F82A 5TR7A 2HPBA 5F1GA 4PM8A 4CJNA 1NRFA 3Q1FA 5DF9A 4OP5A 1E4DA 4GN2A 4BL2A 3GSGA 1E3UD 4R3JA 5CHJA 4HBUA 5FASA 3S4XA 3ZG8B 2Y2HA 1BT5A 1WE4A 1CI8A 1EI5A 3E2KA 3IT9A 3W8KA 3MZFA 2X01A 3G4PA 1FCNA 5J8XA 1YLPA 3OPLA 3QNBA 3NBLA 4GD6A 1NYYA 5DTTA 3UDXA 3GQZA 5G18A 5FQMA 1K56D 4HESA 3WS1A 3ZG0A 4S2MA 3TOIA 3W4QA 1PZPA 1YLWA 3TSGA 4E3KA 2ZM8A 4S2NA 4BL3A 1FR1A 3MKFA 1ES3A 4RVAA 2I72A 3OPPA 4R4RA 1PYYA 2WKIA 2XEPA 3V39A 3MZEA 4BJPA 1BLPA 4LENA 1OMEA 4JXSA 4MNRA 5EE8A 3VP4A 1CEGA 1TDGA 1ALQA 4LV3A 4WMCD 1XGJA 3UE0A 1ES2A 3HLEA 4GZBA 3SH9A 4PM5A 3HUNA 3NDGA 1K25A 1L0EA 1MWRA 5M1AA 3W4OA 3OC2A 4OVDA 3G34A 5E2GA 4D2OA 1RGYA 3BFEA 3FV7A 3ZG5A 5FA7A 2EFXA 1K4FA 4OLGA 4R23A 3EQVA 3IXDA 5GLBA 3MBZA 1FCOA 5EPHA 3RXWA 4DDYA 4LV0A 5EOEA 3M6BA 3MXRA 2GDNA 3G32A 3PBOA 1GCEA 1RP5A 2ZQ7A 1DY6A 3G31A 1BZAA 2WZXA 5CHUA 2Y2JA 4X56A 5GLAA 3RXXA 2OLUA 4LV1A 3A3IA 4L0LA 3VSLA 1HTZA 2WADA 4O7DA 1O07A 1TDLA 3WS2A 1IEMA 1NJ4A 2RL3A 1PZOA 2XH9A 2PU4A 2XLNA 4MEZA 3CZDA 2QPNA 1IKGA 3IWIA 4OKPA 4KZ4A 3ZHHA 1IYQA 5CECA 3A3EA 3BEBA 1RCJA 2ZM0A 2Y2NA 4KG2A 4R3BA 2EXAA 4ZDXA 1KDSA 3IWOA 3WWXA 1KGFA 2DRWA 4E3LA 1J9MA 3DW0A 1IYSA 1ZG4A 2CC1A 3VSKA 1JTDA 2VGJA 4Y0UA 1FOFA 2A3UA 4OPQA 4UA9A 5BOHA 4U0XA 4WZ5C 5FAQA 5E2FA 2XGNA 3GRJA 2IWCA 4QY6A 4OH0A 1PWGA 2R9WA 2EX8A 3WS5A 4BD1A 2ZLYA 5CTNA 1XPBA 3HL9A 3BLSA 4ZBEA 2V1ZA 2Y55A 3SH7A 2JCHA 4R4SA 3NC8A 2H0YA 1IYOA 4QY5A 5FSRA 3HLFA 3Q82A 4GD8A 1MKIA 5E2EA 3G2ZA 3NCKA 3UY6A 4E3OA 1XXMA 3FKVA 5A93A 2ZC3B 4M3KA 2ZM2A 2Z2LB 3PAGA 1JTGA 4E3NA 3S1YA 1VM1A 3LY3A 4EBPA 1NYMA 5CGXA 3WS0A 3UE1A 4WELA 1H5XA 1K6RA 1W8QA 3QNCA 5GHYA 4JF6A 3UPPA 4BENA 1SKFA 3ZFZA 3GTCA 3BM6A 5FI6A 3CG5A 3IH8A 1YLTA 3N8LA 4OOYA 3DWKA 3P09A 1K55A 3C5AA 3LCEA 1U60A 1ONHA 3VOYA 1RGZA 3HLDA 1CEFA 1MWSA 2JE5A 4LCMA 2UWXA 2XK1A 3ITAA 2HP5A 4IBRA 4OP8A 5DVAA 4CPKA 3HLWA 4GKUA 4ID4A 2IWDA 2ZMAA 4XUZA 1K54A 1DJCA 3SS3A 4OPZA 1VQQA 2Y2KA 3IHBA 3SS4A 5A92A 1BSGA 4JXGA 4HBTA 3O3VA 2Q9MA 3A3JA 3WRZA 1MWUA 4KZ8A 4U0TA 4KENB 4PM7A 1IELA 4YINA 1KGGA 1YLYA 4X69A 3V3RA 1K57C 1BULA 5JYOA 5EVIA 2FFYA 1KVLA 1XA7A 2WZZA 2ZJ9A 4KZ7A 1Q2PA 3ITBA 1LL5A 4Y0TA 5GHXA 4DE2A 4K91A 3CMZA 1JWZA 2H0TA 5EVLA 4N9LA 3VP2A 5EVIB 2Y4AA 4N92A 3GVBA 2DCFA 3P98A 1M40A 3IF6C 1C3BA 2WGVA 2X71A 1BLCA 1PI4A 1LL9A 3AGEA 4E3MA 4UA7A 1LI0A 1NY0A 3GR2A 4MLLA 5AQAA 5EUAA 4X55A 1HD8A 4FSFA 3IWQA 4C75A 3IQAA 1L0GA 4B4ZA 4JXVA 1L2SA 4DXCA 4GOGA 4UA6A 1KVMA 1MBLA 2EX6A 1IYPA 3PBQA 4FH4A 2HDUA 3LEZA 4E6XA 2V20A 4R0QA 3OCLA 3W4PA 3S22A 3IXHA 3ZG9B 3HREA 4UHUA 4Y0OA 1K38A 1NXYA 5CERA 4QU3A 1WYCA 3QHYA 4S2LA 2ZQ9A 3DWZA 4H8RA 1M6KA 2HDQA 2ZC5B 3C4PA 3DTMA 1N4OA 4WZ4A 2XFTA 1FQGA 1YMSA 5IHVA 3ZVWA 2WYXA 1XGIA 2WGWA 2OLVA 3SH8A 4E3JA 2J9OA 4OOMA 3MFDA 2ZQAA 2XQZA 4LCLA 4WBGA 4P85A 1W8YA 4GDBA 3O88A 1ES4A 4P87A 3VMAA 3ZCZA 1WYBA 2WGWB 1I5QA 4OQIA 3Q07A 4KZAA 4ZJ1A 5FI7A 2PBYA 1PWDA 4S2NC 4B4XA 1ZKJA 3UNWA 2BLSA 4RX2A 1JVJA 4K0WA 2Y91A 4DE3A 3ZNTA 3N8SA 3BFDA 5M18A 5A90A 3ZNYA 5KSCA 4ZJ2A 4S2OA 1S6RA 3G30A 4KZ9A 2XF3A 4KZ5A 4EUZA 1XX2A 3SS5A 2DNSA 4XXRA 5HAQA 3JYIA 4DE1A 5AQBA 4BQMA 3LY4A 1Z6FA 5E2HA 1XA1A 4B88A 2EXBA 3FKWA 3I7JA 2V2FF 3C4OA 5FQJA 3AGFA 3ZVTA 5GHZA 3N4IA 1GA0A 1KGEA 4A5RA 2B5RA 5CRFA 3FWLA 3HUMA 4PM9A 4E6WA 2C6WB 1LLBA 1K4EA 3BFGA 3IHAA 3M2KA 3O87A 5DTKA 3UDFA 2OSUA 3V3SA 3C7UA 4S2KA 1ONGA 3HBRA 4HEFA 5FAOA 3B3XA 4R1GA 1O7EA 2J8YA 4WEJA 5HFOA 4IBXA 5CTMA 4JPMA 2ZQCA 5D3OA 2Y59A 2ZC7A 3CJMA 4FD8A 1FSWA 3ZGAB 5FATA 4JBFA 3OCNA 3VFFA 5CGSA 2P9VA 1MY8A 3UPOA 4BD0A 2RCXA 5U47A 4EQIA 4PM6A 1BTLA 1TVFA 1KE0A 1YLZA 3D4FA 3NIAA 4GB7A 3HUOA 4LV2A 4KZBA 1E25A 4BLMA 3PBSA 5HW3A 5FQ9A 4C6YA 2WKEA 3BYDA 4KZ6A 2P9VB 5CXWA 2XFSA 4OOLA 3FZCA 5EVID 5HX9A 5HL1A 1FCMA 4DKIA 4JKTA 3IXGA 4N1XA 4K0XA 2HDSA 5AQ9A 5TGFA 5KMWA 1GHIA 3ISGA 1E3UA 5FQQA 4JXWA 3G2YA 4PPRA 1ERMA 3FYZA 5TFQA 2FFFB 4EWFA 4IVIA 3UN7A 2J7VA 5L2FA 2Z2MB 4DE0A 1BUEA 4E3IA 1LI9A 3PAEA 2C5WB 2XD1A 1YMXA 3A3FA 1IKIA 3EQUA 4EBLA 1H8YA 2JC7A 2XR0A 2A49A 1G6AA 1KDWA 3BFCA 3G35A 1SCWA 5AQ7A 4RX3A 3N8RA 4KQOA 4WZ5A 1K56A 3HLCA 1GHMA 3A3DA 4FCFA 3NY4A 4WEKA 1FR6A 1CK3A 2G2WA 1YT4A 3BECA 1KE3A 4OONA 1SDNA 3PBNA 4P0MA 4RYEA 5HAIA 4X6TA 5I94A 4DDSA 1PW8A 1L0DA 2XDMA 3LO7A 4NK3A 4OPYA 4MBHA 1L0FA 4JF5A 1BLHA 3BFFA 4Z9QA 1K55C 1W5DA 3UO9A 3O86A 1BLSA 1G68A 5CEBA 5JYPA 1ES5A 3VP3A 1JWPA 3IH9A 4S2IA 4WMCA 2G2UA 2H5SA 5CGWA 1SHVA 1ESIA 3OZHA 3RJUA 4GNUA 3WRTA 1Q2QA 3PBTA 4MBFA 1LHYA 3OPHA 1ZC2A 4ZJ3A 3VP1A 2EFUA 5FQIA 3WS4A 1HZOA 4C3QA 4PMAA 2WAEA 2Y2OA 2Y2QA 1K54C 3E2LA 2WAFA 2WKHA 2WGIA 3Q7VA 4EBNA 1PI5A 1MWTA 3UDIA 2Q9NA 3M2JA 4QB8A 1JWVA 2WK0A 1HVBA 3HVFA 4P6BA 3MKEA 1YM1A 3HLGA 1YQSA 1I2SA 3N6IA 1KE4A 5DF8A 3NDEA 4FH2A 5EVIC 1PW1A 3GV9A 1NZOA 1XP4A 2EX2A 3Q7VB 3C7VA 1EWZA 1S0WA 4Y7PA 3HLBA 4QHCA 2QMIA 5DTSA 2Y2PA 3UPNA 5HARA 1TEMA 1DJBA 2PU2A 2ZD8A 2ZQ8A 2EX9A 3PBRA 4KQRA 5KZHA 1QMFA 2E8IA 5FI2A 4X68A 1NZUA 3VP0A 2HDRA 2P74A 5FAPA 2Y2MA 3PTEA 3NI9A 4MBKA 4S2JA 1ZG6A 4KG5A 4S2PA 5HAPA 4JLFA 5KSHA 5EOOA 2VGKA 4OLDA 5CEDA 1FSYA 5M19A 1SDEA 3BRMA 3SOIA 3ZDJA 4DF6A 3V5MA 4GDNA 3VFHA 4NETA 1K57A 1GA9A 2BG1A 5CHMA 1PWCA 5F83A 3M6HA 4OPRA 4KG6A 3MZDA 2OV5A 2J9PA 5GL9A 4DXBA 5A91A 1GHPA 1MXOA 4F94A 4OQHA 3IXBA 4RA7A 3MXSA 1W7FA 2ZC4B 2XD5A 1N9BA 3IF6A 4WM9A 4KQQA 2JBFA 4EV4A 5FDHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AGD A;  5E43 A;  4ZTK A;  5F1F A;  4N1H A;  1H8Z A;  1PIO A;  1YLJ A;  4JF4 A;  2ZQD A;  2R9X A;  5FQK A;  4IVK A;  1ESU A;  2HP6 A;  3VOZ A;  4U3T A;  4ZAM A;  4Q8I A;  3IF6 B;  5GLD A;  3TG9 A;  2X02 A;  1W79 A;  4OQG A;  2QZ6 A;  4YFM A;  5DF7 A;  4WYY A;  5GLC A;  4XUX A;  2H10 A;  4DRT A;  2Y2I A;  2HP9 A;  2Y2L A;  3Q81 A;  1ERO A;  2ZC6 B;  5EEC A;  3N7W A;  3UE3 A;  4OQ0 A;  3V50 A;  4QJG A;  3BLM A;  1DJA A;  1AXB A;  4KZ3 A;  1K6S A;  1XKZ A;  4IED A;  4QD4 A;  1I2W A;  2WUQ A;  3IF5 A;  1Y54 A;  4N9K A;  1QME A;  1ERQ A;  3Q7Z A;  4UAA A;  3ZG7 B;  1CI9 A;  2Y2G A;  3OPR A;  1MPL A;  2IWB A;  4X53 A;  3GMW A;  5F82 A;  5TR7 A;  2HPB A;  5F1G A;  4PM8 A;  4CJN A;  1NRF A;  3Q1F A;  5DF9 A;  4OP5 A;  1E4D A;  4GN2 A;  4BL2 A;  3GSG A;  1E3U D;  4R3J A;  5CHJ A;  4HBU A;  5FAS A;  3S4X A;  3ZG8 B;  2Y2H A;  1BT5 A;  1WE4 A;  1CI8 A;  1EI5 A;  3E2K A;  3IT9 A;  3W8K A;  3MZF A;  2X01 A;  3G4P A;  1FCN A;  5J8X A;  1YLP A;  3OPL A;  3QNB A;  3NBL A;  4GD6 A;  1NYY A;  5DTT A;  3UDX A;  3GQZ A;  5G18 A;  5FQM A;  1K56 D;  4HES A;  3WS1 A;  3ZG0 A;  4S2M A;  3TOI A;  3W4Q A;  1PZP A;  1YLW A;  3TSG A;  4E3K A;  2ZM8 A;  4S2N A;  4BL3 A;  1FR1 A;  3MKF A;  1ES3 A;  4RVA A;  2I72 A;  3OPP A;  4R4R A;  1PYY A;  2WKI A;  2XEP A;  3V39 A;  3MZE A;  4BJP A;  1BLP A;  4LEN A;  1OME A;  4JXS A;  4MNR A;  5EE8 A;  3VP4 A;  1CEG A;  1TDG A;  1ALQ A;  4LV3 A;  4WMC D;  1XGJ A;  3UE0 A;  1ES2 A;  3HLE A;  4GZB A;  3SH9 A;  4PM5 A;  3HUN A;  3NDG A;  1K25 A;  1L0E A;  1MWR A;  5M1A A;  3W4O A;  3OC2 A;  4OVD A;  3G34 A;  5E2G A;  4D2O A;  1RGY A;  3BFE A;  3FV7 A;  3ZG5 A;  5FA7 A;  2EFX A;  1K4F A;  4OLG A;  4R23 A;  3EQV A;  3IXD A;  5GLB A;  3MBZ A;  1FCO A;  5EPH A;  3RXW A;  4DDY A;  4LV0 A;  5EOE A;  3M6B A;  3MXR A;  2GDN A;  3G32 A;  3PBO A;  1GCE A;  1RP5 A;  2ZQ7 A;  1DY6 A;  3G31 A;  1BZA A;  2WZX A;  5CHU A;  2Y2J A;  4X56 A;  5GLA A;  3RXX A;  2OLU A;  4LV1 A;  3A3I A;  4L0L A;  3VSL A;  1HTZ A;  2WAD A;  4O7D A;  1O07 A;  1TDL A;  3WS2 A;  1IEM A;  1NJ4 A;  2RL3 A;  1PZO A;  2XH9 A;  2PU4 A;  2XLN A;  4MEZ A;  3CZD A;  2QPN A;  1IKG A;  3IWI A;  4OKP A;  4KZ4 A;  3ZHH A;  1IYQ A;  5CEC A;  3A3E A;  3BEB A;  1RCJ A;  2ZM0 A;  2Y2N A;  4KG2 A;  4R3B A;  2EXA A;  4ZDX A;  1KDS A;  3IWO A;  3WWX A;  1KGF A;  2DRW A;  4E3L A;  1J9M A;  3DW0 A;  1IYS A;  1ZG4 A;  2CC1 A;  3VSK A;  1JTD A;  2VGJ A;  4Y0U A;  1FOF A;  2A3U A;  4OPQ A;  4UA9 A;  5BOH A;  4U0X A;  4WZ5 C;  5FAQ A;  5E2F A;  2XGN A;  3GRJ A;  2IWC A;  4QY6 A;  4OH0 A;  1PWG A;  2R9W A;  2EX8 A;  3WS5 A;  4BD1 A;  2ZLY A;  5CTN A;  1XPB A;  3HL9 A;  3BLS A;  4ZBE A;  2V1Z A;  2Y55 A;  3SH7 A;  2JCH A;  4R4S A;  3NC8 A;  2H0Y A;  1IYO A;  4QY5 A;  5FSR A;  3HLF A;  3Q82 A;  4GD8 A;  1MKI A;  5E2E A;  3G2Z A;  3NCK A;  3UY6 A;  4E3O A;  1XXM A;  3FKV A;  5A93 A;  2ZC3 B;  4M3K A;  2ZM2 A;  2Z2L B;  3PAG A;  1JTG A;  4E3N A;  3S1Y A;  1VM1 A;  3LY3 A;  4EBP A;  1NYM A;  5CGX A;  3WS0 A;  3UE1 A;  4WEL A;  1H5X A;  1K6R A;  1W8Q A;  3QNC A;  5GHY A;  4JF6 A;  3UPP A;  4BEN A;  1SKF A;  3ZFZ A;  3GTC A;  3BM6 A;  5FI6 A;  3CG5 A;  3IH8 A;  1YLT A;  3N8L A;  4OOY A;  3DWK A;  3P09 A;  1K55 A;  3C5A A;  3LCE A;  1U60 A;  1ONH A;  3VOY A;  1RGZ A;  3HLD A;  1CEF A;  1MWS A;  2JE5 A;  4LCM A;  2UWX A;  2XK1 A;  3ITA A;  2HP5 A;  4IBR A;  4OP8 A;  5DVA A;  4CPK A;  3HLW A;  4GKU A;  4ID4 A;  2IWD A;  2ZMA A;  4XUZ A;  1K54 A;  1DJC A;  3SS3 A;  4OPZ A;  1VQQ A;  2Y2K A;  3IHB A;  3SS4 A;  5A92 A;  1BSG A;  4JXG A;  4HBT A;  3O3V A;  2Q9M A;  3A3J A;  3WRZ A;  1MWU A;  4KZ8 A;  4U0T A;  4KEN B;  4PM7 A;  1IEL A;  4YIN A;  1KGG A;  1YLY A;  4X69 A;  3V3R A;  1K57 C;  1BUL A;  5JYO A;  5EVI A;  2FFY A;  1KVL A;  1XA7 A;  2WZZ A;  2ZJ9 A;  4KZ7 A;  1Q2P A;  3ITB A;  1LL5 A;  4Y0T A;  5GHX A;  4DE2 A;  4K91 A;  3CMZ A;  1JWZ A;  2H0T A;  5EVL A;  4N9L A;  3VP2 A;  5EVI B;  2Y4A A;  4N92 A;  3GVB A;  2DCF A;  3P98 A;  1M40 A;  3IF6 C;  1C3B A;  2WGV A;  2X71 A;  1BLC A;  1PI4 A;  1LL9 A;  3AGE A;  4E3M A;  4UA7 A;  1LI0 A;  1NY0 A;  3GR2 A;  4MLL A;  5AQA A;  5EUA A;  4X55 A;  1HD8 A;  4FSF A;  3IWQ A;  4C75 A;  3IQA A;  1L0G A;  4B4Z A;  4JXV A;  1L2S A;  4DXC A;  4GOG A;  4UA6 A;  1KVM A;  1MBL A;  2EX6 A;  1IYP A;  3PBQ A;  4FH4 A;  2HDU A;  3LEZ A;  4E6X A;  2V20 A;  4R0Q A;  3OCL A;  3W4P A;  3S22 A;  3IXH A;  3ZG9 B;  3HRE A;  4UHU A;  4Y0O A;  1K38 A;  1NXY A;  5CER A;  4QU3 A;  1WYC A;  3QHY A;  4S2L A;  2ZQ9 A;  3DWZ A;  4H8R A;  1M6K A;  2HDQ A;  2ZC5 B;  3C4P A;  3DTM A;  1N4O A;  4WZ4 A;  2XFT A;  1FQG A;  1YMS A;  5IHV A;  3ZVW A;  2WYX A;  1XGI A;  2WGW A;  2OLV A;  3SH8 A;  4E3J A;  2J9O A;  4OOM A;  3MFD A;  2ZQA A;  2XQZ A;  4LCL A;  4WBG A;  4P85 A;  1W8Y A;  4GDB A;  3O88 A;  1ES4 A;  4P87 A;  3VMA A;  3ZCZ A;  1WYB A;  2WGW B;  1I5Q A;  4OQI A;  3Q07 A;  4KZA A;  4ZJ1 A;  5FI7 A;  2PBY A;  1PWD A;  4S2N C;  4B4X A;  1ZKJ A;  3UNW A;  2BLS A;  4RX2 A;  1JVJ A;  4K0W A;  2Y91 A;  4DE3 A;  3ZNT A;  3N8S A;  3BFD A;  5M18 A;  5A90 A;  3ZNY A;  5KSC A;  4ZJ2 A;  4S2O A;  1S6R A;  3G30 A;  4KZ9 A;  2XF3 A;  4KZ5 A;  4EUZ A;  1XX2 A;  3SS5 A;  2DNS A;  4XXR A;  5HAQ A;  3JYI A;  4DE1 A;  5AQB A;  4BQM A;  3LY4 A;  1Z6F A;  5E2H A;  1XA1 A;  4B88 A;  2EXB A;  3FKW A;  3I7J A;  2V2F F;  3C4O A;  5FQJ A;  3AGF A;  3ZVT A;  5GHZ A;  3N4I A;  1GA0 A;  1KGE A;  4A5R A;  2B5R A;  5CRF A;  3FWL A;  3HUM A;  4PM9 A;  4E6W A;  2C6W B;  1LLB A;  1K4E A;  3BFG A;  3IHA A;  3M2K A;  3O87 A;  5DTK A;  3UDF A;  2OSU A;  3V3S A;  3C7U A;  4S2K A;  1ONG A;  3HBR A;  4HEF A;  5FAO A;  3B3X A;  4R1G A;  1O7E A;  2J8Y A;  4WEJ A;  5HFO A;  4IBX A;  5CTM A;  4JPM A;  2ZQC A;  5D3O A;  2Y59 A;  2ZC7 A;  3CJM A;  4FD8 A;  1FSW A;  3ZGA B;  5FAT A;  4JBF A;  3OCN A;  3VFF A;  5CGS A;  2P9V A;  1MY8 A;  3UPO A;  4BD0 A;  2RCX A;  5U47 A;  4EQI A;  4PM6 A;  1BTL A;  1TVF A;  1KE0 A;  1YLZ A;  3D4F A;  3NIA A;  4GB7 A;  3HUO A;  4LV2 A;  4KZB A;  1E25 A;  4BLM A;  3PBS A;  5HW3 A;  5FQ9 A;  4C6Y A;  2WKE A;  3BYD A;  4KZ6 A;  2P9V B;  5CXW A;  2XFS A;  4OOL A;  3FZC A;  5EVI D;  5HX9 A;  5HL1 A;  1FCM A;  4DKI A;  4JKT A;  3IXG A;  4N1X A;  4K0X A;  2HDS A;  5AQ9 A;  5TGF A;  5KMW A;  1GHI A;  3ISG A;  1E3U A;  5FQQ A;  4JXW A;  3G2Y A;  4PPR A;  1ERM A;  3FYZ A;  5TFQ A;  2FFF B;  4EWF A;  4IVI A;  3UN7 A;  2J7V A;  5L2F A;  2Z2M B;  4DE0 A;  1BUE A;  4E3I A;  1LI9 A;  3PAE A;  2C5W B;  2XD1 A;  1YMX A;  3A3F A;  1IKI A;  3EQU A;  4EBL A;  1H8Y A;  2JC7 A;  2XR0 A;  2A49 A;  1G6A A;  1KDW A;  3BFC A;  3G35 A;  1SCW A;  5AQ7 A;  4RX3 A;  3N8R A;  4KQO A;  4WZ5 A;  1K56 A;  3HLC A;  1GHM A;  3A3D A;  4FCF A;  3NY4 A;  4WEK A;  1FR6 A;  1CK3 A;  2G2W A;  1YT4 A;  3BEC A;  1KE3 A;  4OON A;  1SDN A;  3PBN A;  4P0M A;  4RYE A;  5HAI A;  4X6T A;  5I94 A;  4DDS A;  1PW8 A;  1L0D A;  2XDM A;  3LO7 A;  4NK3 A;  4OPY A;  4MBH A;  1L0F A;  4JF5 A;  1BLH A;  3BFF A;  4Z9Q A;  1K55 C;  1W5D A;  3UO9 A;  3O86 A;  1BLS A;  1G68 A;  5CEB A;  5JYP A;  1ES5 A;  3VP3 A;  1JWP A;  3IH9 A;  4S2I A;  4WMC A;  2G2U A;  2H5S A;  5CGW A;  1SHV A;  1ESI A;  3OZH A;  3RJU A;  4GNU A;  3WRT A;  1Q2Q A;  3PBT A;  4MBF A;  1LHY A;  3OPH A;  1ZC2 A;  4ZJ3 A;  3VP1 A;  2EFU A;  5FQI A;  3WS4 A;  1HZO A;  4C3Q A;  4PMA A;  2WAE A;  2Y2O A;  2Y2Q A;  1K54 C;  3E2L A;  2WAF A;  2WKH A;  2WGI A;  3Q7V A;  4EBN A;  1PI5 A;  1MWT A;  3UDI A;  2Q9N A;  3M2J A;  4QB8 A;  1JWV A;  2WK0 A;  1HVB A;  3HVF A;  4P6B A;  3MKE A;  1YM1 A;  3HLG A;  1YQS A;  1I2S A;  3N6I A;  1KE4 A;  5DF8 A;  3NDE A;  4FH2 A;  5EVI C;  1PW1 A;  3GV9 A;  1NZO A;  1XP4 A;  2EX2 A;  3Q7V B;  3C7V A;  1EWZ A;  1S0W A;  4Y7P A;  3HLB A;  4QHC A;  2QMI A;  5DTS A;  2Y2P A;  3UPN A;  5HAR A;  1TEM A;  1DJB A;  2PU2 A;  2ZD8 A;  2ZQ8 A;  2EX9 A;  3PBR A;  4KQR A;  5KZH A;  1QMF A;  2E8I A;  5FI2 A;  4X68 A;  1NZU A;  3VP0 A;  2HDR A;  2P74 A;  5FAP A;  2Y2M A;  3PTE A;  3NI9 A;  4MBK A;  4S2J A;  1ZG6 A;  4KG5 A;  4S2P A;  5HAP A;  4JLF A;  5KSH A;  5EOO A;  2VGK A;  4OLD A;  5CED A;  1FSY A;  5M19 A;  1SDE A;  3BRM A;  3SOI A;  3ZDJ A;  4DF6 A;  3V5M A;  4GDN A;  3VFH A;  4NET A;  1K57 A;  1GA9 A;  2BG1 A;  5CHM A;  1PWC A;  5F83 A;  3M6H A;  4OPR A;  4KG6 A;  3MZD A;  2OV5 A;  2J9P A;  5GL9 A;  4DXB A;  5A91 A;  1GHP A;  1MXO A;  4F94 A;  4OQH A;  3IXB A;  4RA7 A;  3MXS A;  1W7F A;  2ZC4 B;  2XD5 A;  1N9B A;  3IF6 A;  4WM9 A;  4KQQ A;  2JBF A;  4EV4 A;  5FDH A; 
#chains in the Genus database with same CATH topology
 3AGD A;  5F1F A;  1YLJ A;  3QP8 A;  5FQK A;  4IVK A;  3VOZ A;  5HWT A;  3TG9 A;  1W79 A;  4OQG A;  5DF7 A;  3BW6 A;  4K08 A;  2VA0 A;  2HP9 A;  3BLM A;  1DJA A;  3LGO A;  3IF5 A;  1QME A;  3ZG7 B;  5HDD A;  3GMW A;  1NRF A;  2GZA A;  1E4D A;  4Y2F A;  3VE3 A;  1E3U D;  4R3J A;  3LFV A;  3MFX A;  3IT9 A;  3E2K A;  3MZF A;  1FIL A;  5EVE A;  2ZOI A;  3QNB A;  1K56 D;  3K3C A;  4S2M A;  2A24 A;  2NUT C;  2ZM8 A;  2QWS A;  4S2N A;  1FR1 A;  3MKF A;  3C30 A;  3ZQ5 A;  2XEP A;  3BY8 A;  1CEG A;  4LV3 A;  1XGJ A;  1GSV A;  1MWR A;  5M1A A;  3OC2 A;  4OVD A;  5E2G A;  3IS2 B;  3QP4 A;  3T1Q B;  2VK3 A;  4R23 A;  3EQV A;  3IXD A;  5GLB A;  3MBZ A;  4LV0 A;  3C2W A;  1L3L A;  3MXR A;  3A0R A;  3G32 A;  1GCE A;  1RP5 A;  2ZQ7 A;  4I38 A;  3SZT A;  5CHU A;  4IJG A;  5GLA A;  3RXX A;  2J3W A;  4L0L A;  3R7W B;  5EM1 A;  4O7D A;  1TDL A;  2Z6C A;  1NJ4 A;  3F1N A;  1IYQ A;  3EOI A;  3BEB A;  3T1R A;  1OTB A;  2ZM0 A;  2INW A;  3IWO A;  1IYS A;  1ZG4 A;  3VSK A;  1FOF A;  2Z6D A;  5BOH A;  4WZ5 C;  5FAQ A;  5E2F A;  1GSW A;  4BBT A;  4ETZ A;  2ZLY A;  2J3T D;  3BLS A;  4ZBE A;  2Y55 A;  3JPU A;  2JCH A;  4R4S A;  2H0Y A;  4QY5 A;  3Q82 A;  1W63 M;  1MKI A;  3MJQ A;  1Y28 A;  5E2E A;  3G2Z A;  4E3O A;  1XXM A;  5C5K A;  2O9A A;  2Z2L B;  1DP9 A;  3TW8 A;  2P04 A;  3WS0 A;  1H5X A;  1K6R A;  1T19 A;  4JF6 A;  3U4L P;  1SKF A;  3TRC A;  4ZRR A;  4BEN A;  2XRO A;  5FI6 A;  4NXF A;  3DWK A;  3P09 A;  1K55 A;  1ONH A;  1RGZ A;  1MWS A;  2XK1 A;  1N9L A;  3MF0 A;  4D60 A;  3DTK A;  4OP8 A;  4EXO A;  4GCZ A;  3T1X A;  2Y8H A;  3ZYT A;  1DP8 A;  1P97 A;  1DJC A;  4OPZ A;  4LRZ E;  3SS4 A;  1BSG A;  4HBT A;  3O3V A;  4HH2 A;  2HJ9 C;  3V3R A;  2PD7 A;  1K57 C;  1BUL A;  3E4Q A;  5JYO A;  5L09 A;  4LRY C;  4X25 A;  4Y0T A;  5GHX A;  2H0T A;  5EVI B;  2W3G A;  5F6A A;  1MC0 A;  1C3B A;  2X71 A;  4ARZ A;  1BLC A;  1PI4 A;  3AGE A;  2WKR A;  1G5U A;  1LI0 A;  1NY0 A;  1P9W A;  5AQA A;  1HLU P;  5EUA A;  4X55 A;  3IWQ A;  5DJT A;  2O9C A;  5FEF A;  1IYP A;  4E6X A;  4HI4 A;  3IXH A;  5DJU A;  2WKP A;  2B95 A;  1N9N A;  2V9A A;  3DWZ A;  4WN5 A;  2HDQ A;  3C4P A;  3DTM A;  4H6J A;  2ZL1 B;  3LIF A;  2GNX A;  3SH8 A;  3LEQ A;  4E3J A;  4OOM A;  2EA9 A;  5TBM B;  3JVU A;  3ZCZ A;  2OAQ 1;  3VOL A;  1TS0 A;  1SKO A;  2BLS A;  4KQD A;  1JVJ A;  4RX2 A;  4K0W A;  2HGV A;  4DE3 A;  3ZNT A;  3N8S A;  4ZJ2 A;  1S6R A;  1ACF A;  1S1Y A;  1VET A;  4KZ5 A;  5F5Y A;  2KOI A;  3SS5 A;  3DTI A;  5HD3 A;  5HAQ A;  3UB7 A;  4PAU A;  3EWK A;  5GHZ A;  4A5R A;  2ACG A;  5CRF A;  4UEY A;  3FWL A;  1LLB A;  2VGL M;  3IHA A;  3TJZ C;  4CLC B;  5F69 A;  2W3H A;  3BQ8 A;  2IA2 A;  4JPM A;  2O99 A;  3T4K A;  3ZGA B;  3D72 A;  4BD0 A;  4GB7 A;  3D4F A;  3HUO A;  4LV2 A;  2PT7 A;  4NKP A;  3PBS A;  5FQ9 A;  3BYD A;  1K0K A;  2P9V B;  5CXW A;  4UQI M;  2XFS A;  3FZC A;  1LT0 A;  5HL1 A;  3OLO A;  4DKI A;  4K0X A;  5AQ9 A;  3PHY A;  3ISG A;  1E3U A;  1KOU A;  3G2Y A;  2J7V A;  2Z2M B;  4E3I A;  4ME4 A;  2C5W B;  3A0S A;  1H8Y A;  2JC7 A;  3G35 A;  4DN0 A;  4YNR A;  1K56 A;  4FCF A;  2G2W A;  3BEC A;  3PXP A;  3NHQ A;  1SDN A;  4X6T A;  3LO7 A;  2XDM A;  1L0F A;  1BLS A;  5CEB A;  4YOF A;  4LRX C;  4C3Q A;  2PYP A;  2Y2O A;  4GHI A;  1K54 C;  2WKH A;  3CHW P;  1TS7 A;  1MWT A;  3UDI A;  3CUE C;  2WK0 A;  4P6B A;  3MKE A;  3HLG A;  5HWV A;  5HZH A;  3C38 A;  3BWL A;  3IX4 A;  4JGP A;  1NZO A;  3Q7V B;  2EX2 A;  5EVI C;  3C7V A;  1EWZ A;  4NXB A;  2QMI A;  3S7O A;  3NEC A;  2FZ0 A;  3KSG A;  1ODV A;  1DJB A;  5KZH A;  3IBJ A;  2XA7 S;  1QMF A;  2J80 A;  5DKL A;  4B93 A;  3NI9 A;  1YKD A;  2PRF A;  5KSH A;  1H8M A;  5EOO A;  5CED A;  3SOI A;  3ZDJ A;  3VFH A;  3KSF A;  1XJ2 A;  2V8C A;  3M6H A;  4OPR A;  3QP5 A;  5GL9 A;  1GHP A;  2HZ5 A;  2V1A A;  2XD5 A;  3D3O A;  1H8Z A;  1PIO A;  2ZQD A;  3EEH A;  2XSS A;  1ESU A;  2HP6 A;  4U3T A;  3GDI A;  4QPR A;  5GLC A;  4DRT A;  5EEC A;  2Y2L A;  5FDS A;  3N7W A;  2JKR I;  1AXB A;  2W1T A;  4KZ3 A;  1XKZ A;  1I2W A;  1Y54 A;  3LID A;  2L0W A;  2IWB A;  4R6L A;  3FC7 A;  4X53 A;  4CJN A;  4HP4 A;  2OWH A;  4OP5 A;  1VEU A;  4BL2 A;  3GSG A;  3H82 A;  3KSH A;  4G3K A;  2Y2H A;  1BT5 A;  2KX6 A;  5G4Z A;  2G7U A;  1WE4 A;  2GX5 A;  3G4P A;  3KX0 X;  1FCN A;  3LIE A;  1YLP A;  3U2A A;  1Z09 A;  3WS1 A;  4BL3 A;  3E98 A;  1ES3 A;  3LR4 A;  3OPP A;  3V39 A;  2WKI A;  3MZE A;  2PDR A;  2JKG A;  4LEN A;  4JXS A;  4FTX A;  3UE0 A;  1ES2 A;  3HLE A;  3DAV A;  3HUN A;  3NDG A;  1L0E A;  2V0U A;  4XT2 B;  4HY8 A;  3RXW A;  5EOE A;  5DFX A;  3M6B A;  2GDN A;  3PBO A;  3CLO A;  1JNU A;  2V8F A;  1T18 A;  2Y2J A;  4X56 A;  3UB9 A;  2VEA A;  3A3I A;  4JGQ A;  3VSL A;  2JHE A;  3VV4 A;  1IEM A;  5K5B A;  3CZD A;  3IWI A;  4GLQ A;  3ZHH A;  5CEC A;  4ESP A;  5IS1 A;  2Y2N A;  3DW0 A;  2CC1 A;  1JTD A;  2VGJ A;  4UA9 A;  4U0X A;  4EW7 A;  4MCW A;  3UME A;  4OH0 A;  1PWG A;  3WS5 A;  4BD1 A;  1XPB A;  2L4R A;  3HL9 A;  4IHQ A;  3NC8 A;  4EEP A;  1IYO A;  2WKQ A;  5FSR A;  3NCK A;  4X1L A;  3UY6 A;  4F3L B;  5A93 A;  3C8C A;  2ZC3 B;  2ZM2 A;  3PAG A;  4E3N A;  3NOP C;  1DP6 A;  3H7W B;  3QNC A;  1YSP A;  3UPP A;  4MN6 A;  3BM6 A;  3CWF A;  1YLT A;  3N8L A;  5IT5 A;  5EV0 A;  3C5A A;  2Y79 A;  1CEF A;  4L9G A;  2UWX A;  4HJ4 A;  5DVA A;  3MS6 A;  3HLW A;  4GKU A;  4ID4 A;  4HJ3 A;  3EGD C;  1VQQ A;  5FL3 A;  4NEE D;  3H9W A;  1MWU A;  4KZ8 A;  3RTY A;  1KGG A;  1X0O A;  1XA7 A;  1OJ5 A;  2ZJ9 A;  2QKP A;  4KZ7 A;  1G28 A;  1Q2P A;  1T1C A;  5CX7 A;  4K91 A;  4FUW A;  5EVL A;  4N9L A;  3VP2 A;  3P98 A;  1VB6 A;  3GR2 A;  4C75 A;  1XFQ A;  3F1P A;  3F1O A;  1MBL A;  2EX6 A;  3PBQ A;  3LEZ A;  4R0Q A;  1NXY A;  5CER A;  3FPV A;  2ZC5 B;  3HJI A;  5HPI A;  2XFT A;  1YMS A;  1CJF A;  2WGW A;  5DFY A;  3MXQ A;  4LCL A;  3T4T A;  4WBG A;  5DKK A;  4P85 A;  2GJ3 A;  3O88 A;  4P87 A;  3VMA A;  4P6Z S;  4OQI A;  1OT9 A;  4ZJ1 A;  1ZKJ A;  3UNW A;  4EET B;  4X1M A;  3BFD A;  4HNB A;  5J7E A;  2XF3 A;  1XX2 A;  3LY4 A;  4B88 A;  2V2F F;  3C4O A;  3B47 A;  1XJ6 A;  2JKF A;  4Y13 A;  3O87 A;  4MN5 A;  5DTK A;  5G4Y A;  4NXE A;  2OSU A;  3MQ0 A;  3C7U A;  4S2K A;  3EGX C;  1D06 A;  3LR3 A;  1H0M A;  3B3X A;  4R1G A;  1O7E A;  3NOT C;  4WEJ A;  5HFO A;  4IBX A;  5CTM A;  2Y59 A;  3CJM A;  4FD8 A;  1YAX A;  5FAT A;  3OCN A;  3VFF A;  5CGS A;  4GS9 A;  2E8J A;  2RCX A;  4EQI A;  4PM6 A;  1TVF A;  1E25 A;  5L10 A;  5HW3 A;  4C6Y A;  1D1J A;  5EVI D;  5IU1 A;  4NG2 A;  4JKT A;  3PYP A;  2AVX A;  5KMW A;  1GHI A;  5FQQ A;  4JXW A;  1S1Z A;  1ERM A;  3K2N A;  4IUK A;  2XD1 A;  3A3F A;  1IKI A;  2XR0 A;  1G6A A;  1KDW A;  3BFC A;  2VX8 A;  3N8R A;  2PHY A;  4WZ5 A;  2M7U A;  3HLC A;  3A3D A;  3RH8 B;  4PKY G;  4WEK A;  1FR6 A;  1CK3 A;  1YT4 A;  3PBN A;  4RYE A;  2BTF P;  3UO9 A;  1G68 A;  1JWP A;  2G2U A;  2H5S A;  3NUL A;  1SHV A;  4MN7 A;  2WAE A;  1YPR A;  3KYE A;  4EBN A;  1PI5 A;  4QB8 A;  1JWV A;  2VV8 A;  3CPT A;  1I2S A;  2VKS A;  4Y7P A;  3KSI A;  5DTS A;  4QWO A;  5HAR A;  1TEM A;  4KQR A;  3VP0 A;  1NZU A;  4I3I A;  3PTE A;  4MBK A;  1NLY A;  4DMZ A;  1SDE A;  3BRM A;  5A8B A;  4DF6 A;  1K57 A;  3MR0 A;  2BG1 A;  5F83 A;  4KG6 A;  3MZD A;  2J9P A;  1WA9 A;  1MXO A;  2ZMV A;  1OPX A;  1LL8 A;  4L9E A;  4HHD A;  1N9B A;  3EEA A;  5E43 A;  4ZTK A;  4N1H A;  4KUO A;  1LSW A;  3IF6 B;  5GLD A;  3R4K A;  2X02 A;  4WYY A;  2H10 A;  3Q81 A;  1ERO A;  2ZC6 B;  3UE3 A;  4OQ0 A;  5AVF A;  3V50 A;  4QJG A;  3NOU C;  1K6S A;  2YKF A;  1NWZ A;  2WUQ A;  5HDS A;  2PAV P;  1V9Z A;  3Q7Z A;  4UAA A;  2Y2G A;  3OPR A;  1MPL A;  3MQO A;  5F1G A;  3SW1 A;  2PD8 A;  5DF9 A;  3LR5 A;  3CAX A;  4GN2 A;  2W3D A;  5HD5 A;  5CHJ A;  4HBU A;  5AVE A;  5FAS A;  1ZHH B;  3S4X A;  2CMN A;  3W8K A;  1EI5 A;  3OBF A;  2X01 A;  5J8X A;  2PR6 A;  1IOU A;  3NBL A;  3QP1 A;  5DTT A;  2OAP 1;  3UDX A;  3GQZ A;  5G18 A;  4HES A;  1PZP A;  3JVV A;  1GSX A;  4RVA A;  4R4R A;  1PYY A;  4BJP A;  1BLP A;  1OME A;  2A24 B;  3IS2 A;  4MNR A;  3VP4 A;  1TDG A;  1ALQ A;  3D9Y A;  4GZB A;  4PM5 A;  1UGU A;  4CLC E;  4D2O A;  3ZG5 A;  2EFX A;  1FCO A;  3R7W A;  4DDY A;  5MC7 A;  2HJE A;  1DY6 A;  2LB5 A;  2OLU A;  4Q0J A;  5HPF A;  2RL3 A;  1PZO A;  2XH9 A;  2PU4 A;  2XLN A;  4KZ4 A;  4EES A;  3A3E A;  1RCJ A;  4R3B A;  2EXA A;  4PHT A;  1KDS A;  3WWX A;  1KGF A;  2DRW A;  2XA7 M;  4E3L A;  1J9M A;  3F1N B;  2A3U A;  2HV1 A;  4BWI A;  2IWC A;  4QY6 A;  2R9W A;  2EX8 A;  1V9Y A;  2LB9 A;  5L07 A;  4G3V A;  4R38 A;  4GD8 A;  3IBR A;  4KUK A;  3LY3 A;  1NYM A;  3UE1 A;  5GHY A;  2B02 A;  3GTC A;  3IH8 A;  4BBU A;  3LIB A;  3VOY A;  1G6O A;  2JE5 A;  3IX3 A;  3MMH A;  4LCM A;  2EWW A;  4I3A A;  1NRJ A;  2HP5 A;  4EQ1 A;  5HDC A;  4CPK A;  4XUZ A;  1K54 A;  2Y2K A;  3QP2 A;  5A92 A;  2K31 A;  2Q9M A;  3CUE A;  3WRZ A;  2PR5 A;  1YLY A;  1TS6 A;  5EVI A;  2FFY A;  1PNE A;  2WZZ A;  4R3A A;  1J3W A;  3UB5 P;  3A0V A;  1LL5 A;  4CLC C;  2Y4A A;  4N92 A;  2DCF A;  3NJA A;  3IF6 C;  2WGV A;  2W0N A;  4E3M A;  4UA7 A;  1HD8 A;  1L0G A;  1OT6 A;  4JXV A;  4ARZ B;  1L2S A;  5EFW A;  4DXC A;  1XFN A;  3S7N A;  1KVM A;  4E04 A;  3W4P A;  1T1A A;  3OCL A;  3S22 A;  3ZG9 B;  1FIK A;  3HRE A;  2ZL1 A;  1Y4O A;  1WYC A;  2VV6 A;  3PR6 A;  3T12 B;  4S2L A;  5TJJ A;  4G3W A;  4NXG A;  2JKT I;  5TBM A;  2WYX A;  1XGI A;  2BAS A;  5AJG A;  3DTE A;  2J9O A;  3MFD A;  4H6J B;  5J3W A;  1D7E A;  1ES4 A;  1WYB A;  2VJW A;  1I5Q A;  3CIT A;  1PWD A;  4S2N C;  4B4X A;  2Y91 A;  3K3D A;  3GEC A;  5M18 A;  3ZNY A;  5KSC A;  3G30 A;  4KZ9 A;  3E4P A;  4HJ6 A;  1SKO B;  2DNS A;  2PBD P;  4XXR A;  3JYI A;  2QHK A;  4DE1 A;  5AQB A;  2W27 A;  4BQM A;  3BY9 A;  1Z6F A;  5E2H A;  1XA1 A;  1TS8 A;  2EXB A;  4LPZ A;  3I7J A;  5FQJ A;  3AGF A;  1GA0 A;  1VET B;  1KGE A;  3L9K A;  2B5R A;  1F2K A;  4CLC A;  3ULF A;  3HUM A;  4E6W A;  1P0Z A;  2C6W B;  3M2K A;  3UDF A;  3HJK A;  1ONG A;  3HBR A;  2ZQC A;  2ZC7 A;  4O8G A;  4JBF A;  2P9V A;  2ZBB A;  5U47 A;  4EU0 A;  1XJ3 A;  4Y5F A;  4KZB A;  1S4R A;  1FCM A;  3S7P A;  2HDS A;  4O01 A;  2O0Y A;  4PPR A;  3FYZ A;  5TFQ A;  4EWF A;  2JKR M;  4IVI A;  5L2F A;  4DE0 A;  1BUE A;  3EQU A;  2ZMF A;  4EBL A;  4CQH A;  1SCW A;  5AQ7 A;  4RX3 A;  2YKH A;  1PRQ A;  1GHM A;  3NY4 A;  3MSH A;  1CQA A;  1N9O A;  1KE3 A;  2M1C A;  4RQ9 A;  4P0M A;  1PW8 A;  3IX8 A;  3QP6 A;  3KYQ A;  4NK3 A;  2P08 A;  4Q0H A;  4Z9Q A;  1K55 C;  4EUV A;  1W5D A;  3O86 A;  5JYP A;  3IH9 A;  4IUH A;  4S2I A;  2JN7 A;  3RJU A;  2K2N A;  4GNU A;  3WRT A;  2QJ7 A;  3PBT A;  4MBF A;  1LHY A;  3LI9 A;  4ZJ3 A;  2EFU A;  3WS4 A;  4PMA A;  4GJ4 A;  2Y2Q A;  3E2L A;  2WAF A;  3Q7V A;  2Q9N A;  2K7S A;  3M2J A;  4MDZ A;  1HVB A;  3N6I A;  4GHI B;  5DF8 A;  4FH2 A;  3T1S A;  4DJ2 A;  1S0W A;  4QHC A;  2Y2P A;  2Q0O A;  3UPN A;  1UWN X;  2ZQ8 A;  2EX9 A;  2E8I A;  4P6Z M;  2P74 A;  2MJ6 A;  1F5M A;  4Y3I A;  4S2J A;  1ZG6 A;  4KG5 A;  3BQA A;  2VGK A;  2OWJ A;  4OLD A;  1FSY A;  1UWP X;  4GDN A;  2JKT M;  5CHM A;  2OV5 A;  4DXB A;  2ZOH A;  2FH5 A;  4OQH A;  4RA7 A;  1W7F A;  2JBF A;  4EV4 A;  3T4O A;  4JF4 A;  2NUP C;  2R9X A;  4MMN A;  4HOI A;  4B9O A;  4ZAM A;  4Q8I A;  1OTI A;  1H3Q A;  4I3J A;  2H28 A;  2QZ6 A;  4M4X A;  4YFM A;  5FEG A;  4XUX A;  2Y2I A;  1OTD A;  4IED A;  4QD4 A;  4N9K A;  1ERQ A;  4O0P A;  1CI9 A;  5TR7 A;  5F82 A;  2HPB A;  2W1T B;  4PM8 A;  3Q1F A;  3P01 A;  4DJ3 A;  3ZG8 B;  5I5L A;  1CI8 A;  4AFI A;  1VEU B;  3OPL A;  5HWW A;  1S66 L;  1NYY A;  4GD6 A;  3H82 B;  5FQM A;  2V0W A;  3ZG0 A;  3TOI A;  3W4Q A;  1YLW A;  3TSG A;  4E3K A;  4EEU A;  3LIC A;  2W1R A;  2I72 A;  1SZV A;  2PYR A;  5EE8 A;  2P7J A;  4WF0 A;  4XT2 A;  4WMC D;  3SH9 A;  1DRM A;  2B18 A;  3W4O A;  1K25 A;  3G34 A;  1RGY A;  3BFE A;  3FV7 A;  5FA7 A;  1K4F A;  4OLG A;  5LBR A;  3RFB A;  5EPH A;  1EW0 A;  5L8M A;  2KDK A;  3BJN A;  3G31 A;  1BZA A;  2WZX A;  1F9I A;  4LV1 A;  1HTZ A;  2WAD A;  1O07 A;  1OJG A;  4MEZ A;  4Y17 A;  3T4J A;  3WS2 A;  2QPN A;  1IKG A;  4OKP A;  3L7H A;  3T4L A;  2D02 A;  4KG2 A;  4ZDX A;  1A0K A;  4Y0U A;  4OPQ A;  3LI8 A;  2XGN A;  3GRJ A;  3T4Q A;  1IFQ A;  5CTN A;  4F3L A;  4Q0I A;  2V1Z A;  4CLC D;  4LFU A;  3SH7 A;  2O9B A;  3HLF A;  3W2Z A;  3H7W A;  4II7 A;  3FKV A;  4R70 A;  4M3K A;  1JTG A;  1OTA A;  2VGL S;  3S1Y A;  1VM1 A;  4EBP A;  5CGX A;  4PKY A;  4WEL A;  1W8Q A;  4WUJ A;  3ZFZ A;  2W3F A;  2A2L A;  3CG5 A;  4OOY A;  3LCE A;  1U60 A;  3HLD A;  4ETX A;  4I39 A;  3ITA A;  4IBR A;  1CF0 A;  3B33 A;  1T1B A;  2IWD A;  2ZMA A;  3SS3 A;  3IHB A;  4UQI S;  4JXG A;  3VE4 A;  3A3J A;  1VHM A;  4YIN A;  4U0T A;  4KEN B;  4PM7 A;  1IEL A;  4X69 A;  1LSV A;  4L9F A;  1KVL A;  1OTE A;  2J3T C;  3ITB A;  4DE2 A;  3CMZ A;  1JWZ A;  1STZ A;  3B42 A;  3GVB A;  1TD5 A;  1M40 A;  1PFL A;  1LL9 A;  2EWV A;  4WL9 A;  4MLL A;  4FSF A;  3IQA A;  4B4Z A;  1S4S A;  1MZU A;  4GOG A;  4UA6 A;  3UB8 A;  1P9R A;  3KYZ A;  4HQA A;  4FH4 A;  2HDU A;  2OOL A;  2V20 A;  3V67 A;  3F1P B;  4UHU A;  4Y0O A;  1K38 A;  4QU3 A;  4BBV A;  3F1O B;  3QHY A;  2ZQ9 A;  4H8R A;  1M6K A;  3FG8 A;  4WZ4 A;  1N4O A;  1ZTU A;  1FQG A;  5IHV A;  1BYW A;  3ZVW A;  2OLV A;  2KLI A;  5HSQ A;  2ZQA A;  2XQZ A;  4BMW A;  2QJ5 A;  1W8Y A;  4GDB A;  4WLA A;  1AWI A;  2WGW B;  5KIZ A;  3Q07 A;  4KZA A;  5FI7 A;  1F98 A;  3T50 A;  2PBY A;  3UB6 A;  3KO6 A;  2W3E A;  3E4O A;  5A90 A;  4S2O A;  3O5Y A;  3DBA A;  4EUZ A;  3UE6 A;  4YWZ A;  3LYX A;  2I9V A;  1YSQ A;  3FKW A;  3P7N A;  4EER A;  3ZVT A;  2DMW A;  4GW9 A;  3N4I A;  4JGR A;  1LSX A;  5J4E A;  4PM9 A;  3T4S A;  1K4E A;  3BFG A;  3V3S A;  2VV7 A;  4HEF A;  5FAO A;  4HH3 A;  2J8Y A;  1XJ4 A;  5D3O A;  1FSW A;  2L1M A;  1S67 L;  1MY8 A;  3UPO A;  1BTL A;  1KE0 A;  1YLZ A;  3NIA A;  3E0Y A;  2D01 A;  4BLM A;  2WKE A;  4KZ6 A;  4GS9 B;  4OOL A;  5HX9 A;  3IXG A;  4N1X A;  5TGF A;  2M7V A;  3TE8 A;  4Y15 A;  2V1B A;  3ICY A;  4HP9 A;  2FFF B;  3UN7 A;  2UV0 E;  1LI9 A;  3PAE A;  4LGW A;  1YMX A;  2A49 A;  2XRN A;  2VZW A;  3HCY A;  4KQO A;  4OON A;  3OOV A;  5HAI A;  5I94 A;  4DDS A;  1L0D A;  4OPY A;  4MBH A;  4JF5 A;  1BLH A;  1MKM A;  3BFF A;  2HF6 A;  3MQQ A;  3UMD A;  1ES5 A;  3VP3 A;  4WMC A;  5CGW A;  1ESI A;  3OZH A;  1NLZ A;  1Q2Q A;  3VP1 A;  3OPH A;  1ZC2 A;  5FQI A;  1HZO A;  4Z1W A;  2WGI A;  3LR0 A;  4JGO A;  3LIA A;  2QYB A;  1W63 Q;  3HVF A;  3CI6 A;  1YM1 A;  5HL6 A;  1YQS A;  3FPW A;  1KE4 A;  3NDE A;  1PW1 A;  3GV9 A;  1XP4 A;  3HLB A;  3G6O A;  5EM0 A;  4HIA A;  4I5S A;  2PU2 A;  2ZD8 A;  3CPT B;  3PBR A;  3S7Q A;  5FI2 A;  4X68 A;  3LUQ A;  2HDR A;  5FAP A;  2Y2M A;  2R78 A;  4S2P A;  5HAP A;  4JLF A;  2VLG A;  5M19 A;  3V5M A;  4LLO B;  4NET A;  1GA9 A;  5F68 A;  1PWC A;  1TF1 A;  5A91 A;  4F94 A;  3IXB A;  3MXS A;  2ZC4 B;  4FOF A;  4WM9 A;  3IF6 A;  4KQQ A;  5FDH A; 
#chains in the Genus database with same CATH homology
 3AGD A;  5E43 A;  4ZTK A;  5F1F A;  4N1H A;  1H8Z A;  1PIO A;  1YLJ A;  4JF4 A;  2ZQD A;  2R9X A;  5FQK A;  4IVK A;  1ESU A;  2HP6 A;  3VOZ A;  4U3T A;  4ZAM A;  4Q8I A;  3IF6 B;  5GLD A;  3TG9 A;  2X02 A;  1W79 A;  4OQG A;  2QZ6 A;  4YFM A;  5DF7 A;  4WYY A;  5GLC A;  4XUX A;  2H10 A;  4DRT A;  2Y2I A;  2HP9 A;  2Y2L A;  3Q81 A;  1ERO A;  2ZC6 B;  5EEC A;  3N7W A;  3UE3 A;  4OQ0 A;  3V50 A;  4QJG A;  3BLM A;  1DJA A;  1AXB A;  4KZ3 A;  1K6S A;  1XKZ A;  4IED A;  4QD4 A;  1I2W A;  2WUQ A;  3IF5 A;  1Y54 A;  4N9K A;  1QME A;  1ERQ A;  3Q7Z A;  4UAA A;  3ZG7 B;  1CI9 A;  2Y2G A;  3OPR A;  1MPL A;  2IWB A;  4X53 A;  3GMW A;  5F82 A;  5TR7 A;  2HPB A;  5F1G A;  4PM8 A;  4CJN A;  1NRF A;  3Q1F A;  5DF9 A;  4OP5 A;  1E4D A;  4GN2 A;  4BL2 A;  3GSG A;  1E3U D;  4R3J A;  5CHJ A;  4HBU A;  5FAS A;  3S4X A;  3ZG8 B;  2Y2H A;  1BT5 A;  1WE4 A;  1CI8 A;  1EI5 A;  3E2K A;  3IT9 A;  3W8K A;  3MZF A;  2X01 A;  3G4P A;  1FCN A;  5J8X A;  1YLP A;  3OPL A;  3QNB A;  3NBL A;  4GD6 A;  1NYY A;  5DTT A;  3UDX A;  3GQZ A;  5G18 A;  5FQM A;  1K56 D;  4HES A;  3WS1 A;  3ZG0 A;  4S2M A;  3TOI A;  3W4Q A;  1PZP A;  1YLW A;  3TSG A;  4E3K A;  2ZM8 A;  4S2N A;  4BL3 A;  1FR1 A;  3MKF A;  1ES3 A;  4RVA A;  2I72 A;  3OPP A;  4R4R A;  1PYY A;  2WKI A;  2XEP A;  3V39 A;  3MZE A;  4BJP A;  1BLP A;  4LEN A;  1OME A;  4JXS A;  4MNR A;  5EE8 A;  3VP4 A;  1CEG A;  1TDG A;  1ALQ A;  4LV3 A;  4WMC D;  1XGJ A;  3UE0 A;  1ES2 A;  3HLE A;  4GZB A;  3SH9 A;  4PM5 A;  3HUN A;  3NDG A;  1K25 A;  1L0E A;  1MWR A;  5M1A A;  3W4O A;  3OC2 A;  4OVD A;  3G34 A;  5E2G A;  4D2O A;  1RGY A;  3BFE A;  3FV7 A;  3ZG5 A;  5FA7 A;  2EFX A;  1K4F A;  4OLG A;  4R23 A;  3EQV A;  3IXD A;  5GLB A;  3MBZ A;  1FCO A;  5EPH A;  3RXW A;  4DDY A;  4LV0 A;  5EOE A;  3M6B A;  3MXR A;  2GDN A;  3G32 A;  3PBO A;  1GCE A;  1RP5 A;  2ZQ7 A;  1DY6 A;  3G31 A;  1BZA A;  2WZX A;  5CHU A;  2Y2J A;  4X56 A;  5GLA A;  3RXX A;  2OLU A;  4LV1 A;  3A3I A;  4L0L A;  3VSL A;  1HTZ A;  2WAD A;  4O7D A;  1O07 A;  1TDL A;  3WS2 A;  1IEM A;  1NJ4 A;  2RL3 A;  1PZO A;  2XH9 A;  2PU4 A;  2XLN A;  4MEZ A;  3CZD A;  2QPN A;  1IKG A;  3IWI A;  4OKP A;  4KZ4 A;  3ZHH A;  1IYQ A;  5CEC A;  3A3E A;  3BEB A;  1RCJ A;  2ZM0 A;  2Y2N A;  4KG2 A;  4R3B A;  2EXA A;  4ZDX A;  1KDS A;  3IWO A;  3WWX A;  1KGF A;  2DRW A;  4E3L A;  1J9M A;  3DW0 A;  1IYS A;  1ZG4 A;  2CC1 A;  3VSK A;  1JTD A;  2VGJ A;  4Y0U A;  1FOF A;  2A3U A;  4OPQ A;  4UA9 A;  5BOH A;  4U0X A;  4WZ5 C;  5FAQ A;  5E2F A;  2XGN A;  3GRJ A;  2IWC A;  4QY6 A;  4OH0 A;  1PWG A;  2R9W A;  2EX8 A;  3WS5 A;  4BD1 A;  2ZLY A;  5CTN A;  1XPB A;  3HL9 A;  3BLS A;  4ZBE A;  2V1Z A;  2Y55 A;  3SH7 A;  2JCH A;  4R4S A;  3NC8 A;  2H0Y A;  1IYO A;  4QY5 A;  5FSR A;  3HLF A;  3Q82 A;  4GD8 A;  1MKI A;  5E2E A;  3G2Z A;  3NCK A;  3UY6 A;  4E3O A;  1XXM A;  3FKV A;  5A93 A;  2ZC3 B;  4M3K A;  2ZM2 A;  2Z2L B;  3PAG A;  1JTG A;  4E3N A;  3S1Y A;  1VM1 A;  3LY3 A;  4EBP A;  1NYM A;  5CGX A;  3WS0 A;  3UE1 A;  4WEL A;  1H5X A;  1K6R A;  1W8Q A;  3QNC A;  5GHY A;  4JF6 A;  3UPP A;  4BEN A;  1SKF A;  3ZFZ A;  3GTC A;  3BM6 A;  5FI6 A;  3CG5 A;  3IH8 A;  1YLT A;  3N8L A;  4OOY A;  3DWK A;  3P09 A;  1K55 A;  3C5A A;  3LCE A;  1U60 A;  1ONH A;  3VOY A;  1RGZ A;  3HLD A;  1CEF A;  1MWS A;  2JE5 A;  4LCM A;  2UWX A;  2XK1 A;  3ITA A;  2HP5 A;  4IBR A;  4OP8 A;  5DVA A;  4CPK A;  3HLW A;  4GKU A;  4ID4 A;  2IWD A;  2ZMA A;  4XUZ A;  1K54 A;  1DJC A;  3SS3 A;  4OPZ A;  1VQQ A;  2Y2K A;  3IHB A;  3SS4 A;  5A92 A;  1BSG A;  4JXG A;  4HBT A;  3O3V A;  2Q9M A;  3A3J A;  3WRZ A;  1MWU A;  4KZ8 A;  4U0T A;  4KEN B;  4PM7 A;  1IEL A;  4YIN A;  1KGG A;  1YLY A;  4X69 A;  3V3R A;  1K57 C;  1BUL A;  5JYO A;  5EVI A;  2FFY A;  1KVL A;  1XA7 A;  2WZZ A;  2ZJ9 A;  4KZ7 A;  1Q2P A;  3ITB A;  1LL5 A;  4Y0T A;  5GHX A;  4DE2 A;  4K91 A;  3CMZ A;  1JWZ A;  2H0T A;  5EVL A;  4N9L A;  3VP2 A;  5EVI B;  2Y4A A;  4N92 A;  3GVB A;  2DCF A;  3P98 A;  1M40 A;  3IF6 C;  1C3B A;  2WGV A;  2X71 A;  1BLC A;  1PI4 A;  1LL9 A;  3AGE A;  4E3M A;  4UA7 A;  1LI0 A;  1NY0 A;  3GR2 A;  4MLL A;  5AQA A;  5EUA A;  4X55 A;  1HD8 A;  4FSF A;  3IWQ A;  4C75 A;  3IQA A;  1L0G A;  4B4Z A;  4JXV A;  1L2S A;  4DXC A;  4GOG A;  4UA6 A;  1KVM A;  1MBL A;  2EX6 A;  1IYP A;  3PBQ A;  4FH4 A;  2HDU A;  3LEZ A;  4E6X A;  2V20 A;  4R0Q A;  3OCL A;  3W4P A;  3S22 A;  3IXH A;  3ZG9 B;  3HRE A;  4UHU A;  4Y0O A;  1K38 A;  1NXY A;  5CER A;  4QU3 A;  1WYC A;  3QHY A;  4S2L A;  2ZQ9 A;  3DWZ A;  4H8R A;  1M6K A;  2HDQ A;  2ZC5 B;  3C4P A;  3DTM A;  1N4O A;  4WZ4 A;  2XFT A;  1FQG A;  1YMS A;  5IHV A;  3ZVW A;  2WYX A;  1XGI A;  2WGW A;  2OLV A;  3SH8 A;  4E3J A;  2J9O A;  4OOM A;  3MFD A;  2ZQA A;  2XQZ A;  4LCL A;  4WBG A;  4P85 A;  1W8Y A;  4GDB A;  3O88 A;  1ES4 A;  4P87 A;  3VMA A;  3ZCZ A;  1WYB A;  2WGW B;  1I5Q A;  4OQI A;  3Q07 A;  4KZA A;  4ZJ1 A;  5FI7 A;  2PBY A;  1PWD A;  4S2N C;  4B4X A;  1ZKJ A;  3UNW A;  2BLS A;  4RX2 A;  1JVJ A;  4K0W A;  2Y91 A;  4DE3 A;  3ZNT A;  3N8S A;  3BFD A;  5M18 A;  5A90 A;  3ZNY A;  5KSC A;  4ZJ2 A;  4S2O A;  1S6R A;  3G30 A;  4KZ9 A;  2XF3 A;  4KZ5 A;  4EUZ A;  1XX2 A;  3SS5 A;  2DNS A;  4XXR A;  5HAQ A;  3JYI A;  4DE1 A;  5AQB A;  4BQM A;  3LY4 A;  1Z6F A;  5E2H A;  1XA1 A;  4B88 A;  2EXB A;  3FKW A;  3I7J A;  2V2F F;  3C4O A;  5FQJ A;  3AGF A;  3ZVT A;  5GHZ A;  3N4I A;  1GA0 A;  1KGE A;  4A5R A;  2B5R A;  5CRF A;  3FWL A;  3HUM A;  4PM9 A;  4E6W A;  2C6W B;  1LLB A;  1K4E A;  3BFG A;  3IHA A;  3M2K A;  3O87 A;  5DTK A;  3UDF A;  2OSU A;  3V3S A;  3C7U A;  4S2K A;  1ONG A;  3HBR A;  4HEF A;  5FAO A;  3B3X A;  4R1G A;  1O7E A;  2J8Y A;  4WEJ A;  5HFO A;  4IBX A;  5CTM A;  4JPM A;  2ZQC A;  5D3O A;  2Y59 A;  2ZC7 A;  3CJM A;  4FD8 A;  1FSW A;  3ZGA B;  5FAT A;  4JBF A;  3OCN A;  3VFF A;  5CGS A;  2P9V A;  1MY8 A;  3UPO A;  4BD0 A;  2RCX A;  5U47 A;  4EQI A;  4PM6 A;  1BTL A;  1TVF A;  1KE0 A;  1YLZ A;  3D4F A;  3NIA A;  4GB7 A;  3HUO A;  4LV2 A;  4KZB A;  1E25 A;  4BLM A;  3PBS A;  5HW3 A;  5FQ9 A;  4C6Y A;  2WKE A;  3BYD A;  4KZ6 A;  2P9V B;  5CXW A;  2XFS A;  4OOL A;  3FZC A;  5EVI D;  5HX9 A;  5HL1 A;  1FCM A;  4DKI A;  4JKT A;  3IXG A;  4N1X A;  4K0X A;  2HDS A;  5AQ9 A;  5TGF A;  5KMW A;  1GHI A;  3ISG A;  1E3U A;  5FQQ A;  4JXW A;  3G2Y A;  4PPR A;  1ERM A;  3FYZ A;  5TFQ A;  2FFF B;  4EWF A;  4IVI A;  3UN7 A;  2J7V A;  5L2F A;  2Z2M B;  4DE0 A;  1BUE A;  4E3I A;  1LI9 A;  3PAE A;  2C5W B;  2XD1 A;  1YMX A;  3A3F A;  1IKI A;  3EQU A;  4EBL A;  1H8Y A;  2JC7 A;  2XR0 A;  2A49 A;  1G6A A;  1KDW A;  3BFC A;  3G35 A;  1SCW A;  5AQ7 A;  4RX3 A;  3N8R A;  4KQO A;  4WZ5 A;  1K56 A;  3HLC A;  1GHM A;  3A3D A;  4FCF A;  3NY4 A;  4WEK A;  1FR6 A;  1CK3 A;  2G2W A;  1YT4 A;  3BEC A;  1KE3 A;  4OON A;  1SDN A;  3PBN A;  4P0M A;  4RYE A;  5HAI A;  4X6T A;  5I94 A;  4DDS A;  1PW8 A;  1L0D A;  2XDM A;  3LO7 A;  4NK3 A;  4OPY A;  4MBH A;  1L0F A;  4JF5 A;  1BLH A;  3BFF A;  4Z9Q A;  1K55 C;  1W5D A;  3UO9 A;  3O86 A;  1BLS A;  1G68 A;  5CEB A;  5JYP A;  1ES5 A;  3VP3 A;  1JWP A;  3IH9 A;  4S2I A;  4WMC A;  2G2U A;  2H5S A;  5CGW A;  1SHV A;  1ESI A;  3OZH A;  3RJU A;  4GNU A;  3WRT A;  1Q2Q A;  3PBT A;  4MBF A;  1LHY A;  3OPH A;  1ZC2 A;  4ZJ3 A;  3VP1 A;  2EFU A;  5FQI A;  3WS4 A;  1HZO A;  4C3Q A;  4PMA A;  2WAE A;  2Y2O A;  2Y2Q A;  1K54 C;  3E2L A;  2WAF A;  2WKH A;  2WGI A;  3Q7V A;  4EBN A;  1PI5 A;  1MWT A;  3UDI A;  2Q9N A;  3M2J A;  4QB8 A;  1JWV A;  2WK0 A;  1HVB A;  3HVF A;  4P6B A;  3MKE A;  1YM1 A;  3HLG A;  1YQS A;  1I2S A;  3N6I A;  1KE4 A;  5DF8 A;  3NDE A;  4FH2 A;  5EVI C;  1PW1 A;  3GV9 A;  1NZO A;  1XP4 A;  2EX2 A;  3Q7V B;  3C7V A;  1EWZ A;  1S0W A;  4Y7P A;  3HLB A;  4QHC A;  2QMI A;  5DTS A;  2Y2P A;  3UPN A;  5HAR A;  1TEM A;  1DJB A;  2PU2 A;  2ZD8 A;  2ZQ8 A;  2EX9 A;  3PBR A;  4KQR A;  5KZH A;  1QMF A;  2E8I A;  5FI2 A;  4X68 A;  1NZU A;  3VP0 A;  2HDR A;  2P74 A;  5FAP A;  2Y2M A;  3PTE A;  3NI9 A;  4MBK A;  4S2J A;  1ZG6 A;  4KG5 A;  4S2P A;  5HAP A;  4JLF A;  5KSH A;  5EOO A;  2VGK A;  4OLD A;  5CED A;  1FSY A;  5M19 A;  1SDE A;  3BRM A;  3SOI A;  3ZDJ A;  4DF6 A;  3V5M A;  4GDN A;  3VFH A;  4NET A;  1K57 A;  1GA9 A;  2BG1 A;  5CHM A;  1PWC A;  5F83 A;  3M6H A;  4OPR A;  4KG6 A;  3MZD A;  2OV5 A;  2J9P A;  5GL9 A;  4DXB A;  5A91 A;  1GHP A;  1MXO A;  4F94 A;  4OQH A;  3IXB A;  4RA7 A;  3MXS A;  1W7F A;  2ZC4 B;  2XD5 A;  1N9B A;  3IF6 A;  4WM9 A;  4KQQ A;  2JBF A;  4EV4 A;  5FDH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...