2P08A

Structure of the n-terminally truncated pas domain of signal transduction histidine kinase from nostoc punctiforme pcc 73102 with homology to the h-noxa/h-noba domain of the soluble guanylyl cyclase
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
107
structure length
107
Chain Sequence
b'MLSPELLAKAFPFHFAFSRNREIVQTGEVLERISPEPLVGKLIEQHFQINRPKILIDFDAISKQPRALFILEFLHNGMQLKGQMMYQPEEEVIFFLGSPWITDTTSL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords signal transduction histidine kinase
molecule tags Transferase
source organism Nostoc punctiforme
publication title PAS-mediated dimerization of soluble guanylyl cyclase revealed by signal transduction histidine kinase domain crystal structure.
pubmed doi rcsb
total genus 23
structure length 107
sequence length 107
chains with identical sequence B
ec nomenclature ec 2.7.3.-:
pdb deposition date 2007-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07701 HNOBA Heme NO binding associated
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.260 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2p08A00
4GJ4A 2P08A 2P04A
chains in the Genus database with same CATH superfamily
1ZKJA 1OTEA 3C4PA 5AJGA 4WUJA 5CERA 3EGXC 3F1NA 2XFSA 3S7QA 4BL2A 1TF1A 4K91A 2XROA 2IA2A 2WKQA 1JWZA 4PKYG 1TS6A 1FCNA 3TJZC 3VV4A 2P74A 1LL9A 1SDEA 3UPNA 1NZOA 2ZOIA 4DE3A 4HH3A 3ZG7B 5HL1A 1NY0A 2ACGA 5HWWA 4Y0OA 5CGWA 1IEMA 1ONGA 3JYIA 3LI9A 3T50A 2CMNA 3OC2A 4JXVA 3HLCA 1TS8A 3T4JA 4X1MA 4I39A 2V1AA 1K0KA 3F1NB 2ZQDA 5DKKA 4MN6A 1CI8A 3MF0A 2RL3A 3BQ8A 4GB7A 2ZC4B 3NY4A 3OPPA 4DF6A 4HP4A 3JPUA 5HD3A 1G6OA 3SS5A 2FFYA 3F1OA 3UO9A 3F1PB 1JWPA 2DCFA 1FOFA 1IYOA 2PBDP 2H0TA 2Y2IA 4RX3A 4EW7A 2DMWA 4N1HA 4U0XA 3CPTA 5L10A 1T19A 1K38A 4O8GA 3Q81A 5EE8A 1MWRA 4EESA 1G5UA 5HW3A 2P7JA 4B88A 2NUTC 3BYDA 2PU4A 1L3LA 3KSIA 4AFIA 1NLZA 4ZDXA 4U0TA 1F98A 1GHIA 1JTDA 3T4QA 5G18A 2W3EA 3R7WB 2X02A 1N4OA 2G2WA 1XPBA 2P9VB 2QYBA 5GHZA 4FOFA 3A0VA 3LIFA 2Z6DA 3QP8A 4KZ6A 1HVBA 3UMEA 3HLFA 4Y3IA 4R3JA 2VX8A 5DJTA 4ZRRA 4FTXA 3EGDC 2PT7A 1L0EA 4CPKA 4JLFA 3VE4A 5A93A 5GHXA 1VQQA 3NOPC 2ZQ7A 4F3LB 4GW9A 5A8BA 2HJEA 2Y55A 3CMZA 5J8XA 4LCLA 4OQHA 2P9VA 3D72A 4MBHA 2Y2NA 4IBRA 1K56A 2OSUA 3UB7A 2VV7A 4X68A 2V8FA 4H6JA 1LT0A 1CI9A 3M2JA 4GKUA 3E2LA 1YQSA 3PHYA 5TJJA 4LRYC 3HLGA 3BLMA 4JBFA 1FR1A 1MBLA 5M19A 3HCYA 4EV4A 1RGZA 3QHYA 3GR2A 4MLLA 1EI5A 5JYOA 1BULA 1MWTA 5TFQA 3D4FA 2K7SA 4N92A 4IBXA 4GHIB 1LSVA 1XA1A 4I3JA 3LI8A 4EUZA 1KGEA 3B42A 2X01A 2VKSA 1ESUA 5AVEA 2O9BA 2JN7A 1S0WA 1KDSA 1CEFA 1ES3A 1P97A 3T4KA 1SKOA 3M6BA 1DP8A 3MJQA 5F83A 2XLNA 5GL9A 1P9WA 1ES4A 4CLCD 1STZA 1K25A 1F9IA 4IVIA 3IH8A 4HEFA 1AWIA 2FFFB 3IHAA 2OWJA 2PD8A 1L0DA 1WYCA 4S2PA 3I7JA 1NZUA 4CQHA 4EEUA 1PWGA 3MR0A 3HJIA 4OLGA 3W4QA 4DDYA 3IBJA 1BYWA 3DTIA 1DP9A 2P08A 4WL9A 3Q7VB 4WF0A 1CF0A 3IXDA 5FAOA 2C5WB 4X69A 3DBAA 3C7VA 3LR4A 3ICYA 3KYZA 1SKOB 3LYXA 3TRCA 3WS5A 1VETA 4KZBA 3CI6A 2E8IA 3NC8A 3SS4A 5EUAA 3UDIA 2B5RA 4OP5A 3H7WB 1H0MA 1AXBA 4ARZA 3WS2A 2H28A 4R6LA 1UWNX 2A24A 5CECA 4RA7A 4YNRA 3SZTA 1KE3A 1YSQA 1ES2A 4ID4A 5CRFA 2ZQCA 2QJ7A 4GNUA 5AQAA 4PPRA 3DTMA 5FA7A 3FC7A 2J80A 3LIDA 2VEAA 3GV9A 3CUEC 4MBFA 3MXSA 5DFYA 2GJ3A 2I72A 1K54C 4KQDA 3LEZA 3VOYA 2HP9A 4QWOA 1S66L 3W8KA 2W1TB 2Y2JA 3MXQA 3ZG8B 3MFDA 1D06A 4E3LA 4ESPA 4QHCA 2WGVA 5EVIA 5F82A 1DJBA 3A3EA 3HVFA 3N8RA 5CEDA 1RP5A 3BLSA 3U2AA 3UY6A 1FIKA 4FSFA 4O01A 3A3DA 2ZMVA 3VSKA 1UGUA 4HP9A 4P6BA 5U47A 2DRWA 1MWSA 1I2WA 3C38A 4OOMA 4GS9A 4P87A 2H0YA 2GX5A 2K2NA 5M1AA 2LB9A 5TR7A 4E3NA 3C5AA 3BY8A 3ZG9B 2VLGA 3BRMA 1H8YA 1S4SA 2WZXA 3UNWA 2Z6CA 2Y2QA 1WA9A 4BD0A 1GCEA 3LFVA 1KDWA 4JGOA 2Z2LB 3L9KA 3KO6A 2H5SA 1JWVA 1Z6FA 4Q8IA 3HLWA 4UQIS 4XUZA 4EEPA 4LPZA 3CLOA 5IHVA 3BY9A 4CLCC 1XA7A 3IF6C 4D60A 3FG8A 4ARZB 1Y28A 3U4LP 3SH9A 1XFQA 5L8MA 3TE8A 4ETZA 3W4OA 1DJAA 1K57C 4CLCB 2JKRM 3S22A 3QP5A 2C6WB 4LGWA 4B4XA 3LGOA 4YINA 3K3CA 3F1OB 4Y7PA 5EV0A 4F94A 3EEHA 1MY8A 1Q2QA 3MQOA 4UAAA 4R23A 4I38A 2OWHA 1E3UA 2W1TA 3QP4A 2A3UA 3BFDA 1VHMA 4MBKA 3V5MA 2XSSA 1TDGA 2KLIA 2Q9NA 1GSXA 4JF6A 1MXOA 1YM1A 3PBRA 1LLBA 2Y4AA 3T4LA 2JKTI 5EOOA 5FATA 3E0YA 1PIOA 4RYEA 3LIAA 2XF3A 2EWVA 3O87A 1ZG4A 4R3AA 4OPRA 2LB5A 2FZ0A 3N8LA 3LIEA 3G2YA 4JXGA 1A0KA 4JXWA 1OPXA 4GD8A 2BLSA 3LR3A 2V20A 3BECA 4OQ0A 2JHEA 3PTEA 2Y2GA 4NETA 5CHMA 3B3XA 5HD5A 2L0WA 3V67A 3H82B 2VGKA 3TOIA 2ZJ9A 1SZVA 4HJ6A 4NXBA 3T1QB 3AGFA 1O7EA 1ACFA 2RCXA 1K55C 1MC0A 1W7FA 2UWXA 3FKWA 3OOVA 4PMAA 1EROA 1K56D 3BFGA 5EPHA 5CHJA 3ITBA 4P85A 4DXCA 2EX2A 2XFTA 5HX9A 4H8RA 2VK3A 4FH2A 1IELA 4JGRA 1CEGA 4BENA 3TW8A 2Y2PA 3QNCA 1PFLA 2XD5A 3VSLA 5F69A 4GDBA 4WBGA 1YPRA 2O0YA 4IVKA 1I5QA 1FR6A 3E4OA 3FYZA 3GRJA 1NJ4A 2WAFA 4PM8A 5CHUA 2W27A 4IEDA 3DAVA 4UA9A 3G4PA 1XFNA 1XJ6A 1XP4A 5FSRA 4DN0A 3IF6B 3N7WA 2HP6A 3C7UA 2UV0E 2Y8HA 5L09A 1DY6A 1O07A 3V3RA 5FEGA 3GTCA 2WK0A 5EVID 2WYXA 3WWXA 4JGQA 4BL3A 2HV1A 3QP2A 4DE2A 1W79A 2ZBBA 3SH8A 5L2FA 2CC1A 4NG2A 3DWKA 2PAVP 1IYPA 4DXBA 4KUKA 2Y2KA 3VMAA 4UA7A 5DTSA 1H8ZA 2D02A 3NECA 4UA6A 4KZ3A 3DTEA 1PYYA 3MXRA 1GHMA 3CWFA 4XT2B 3UB6A 3RFBA 1X0OA 1K55A 3OCLA 4MMNA 4QB8A 4BMWA 1BLPA 3JVVA 2XA7S 3KYEA 5HFOA 4IJGA 1TVFA 3MBZA 2A24B 3B47A 3EQUA 4S2MA 4WEJA 3Q82A 5HDDA 4KG2A 1WE4A 3BW6A 3NOTC 5FQJA 3SS3A 2VGLM 1NXYA 2J3WA 4PKYA 2ZM0A 5FL3A 1V9YA 2OAQ1 2O99A 4OLDA 1XGIA 3L7HA 3FZCA 4QPRA 4JF4A 5HWTA 4Y0UA 3T4SA 1BSGA 3AGEA 4S2JA 4EBNA 1N9OA 3ZNYA 4R0QA 3GECA 5EOEA 3FPWA 1MWUA 3IQAA 3IF6A 3NOUC 2HP5A 2ZC6B 2WAEA 5F1GA 1JVJA 1U60A 3LR0A 3G32A 2XD1A 3PAEA 4D2OA 1SCWA 2Y79A 1IYSA 1ZHHB 4GCZA 5DTKA 4YOFA 4Y0TA 2XH9A 4N1XA 1OJGA 4LLOB 4II7A 2WGWB 4WN5A 4Q0HA 1KVMA 4MNRA 1NRJA 2VZWA 5TBMA 2PYPA 3PBQA 5HPFA 1QMEA 3VP3A 5K5BA 3ZHHA 3E4PA 3VOLA 3A3IA 3T4OA 3ZDJA 4HNBA 2WUQA 5DJUA 1YKDA 4Q0IA 1YMXA 3A0SA 3PBOA 3V50A 1OTBA 3G34A 4YWZA 4BJPA 4M4XA 1GA0A 1JNUA 1L0FA 4WMCA 1TEMA 4X25A 3RTYA 4X6TA 1YT4A 5G4YA 1OTDA 1CJFA 4OKPA 5A90A 1E4DA 5CTNA 1YMSA 5AQ7A 4X55A 3BJNA 2GDNA 2J8YA 3PXPA 3T1RA 1Q2PA 3HUNA 5CGXA 3KSHA 2ZD8A 1WYBA 1HD8A 5FI2A 5FQMA 5DF9A 3HBRA 4OPYA 5GHYA 4PM5A 3UE1A 4NXEA 1BUEA 2XQZA 2PYRA 2ZC5B 5TGFA 3DTKA 2D01A 2KOIA 5FI7A 4KZ4A 3HUMA 4N9LA 1L2SA 4QY5A 4NXGA 4QY6A 1L0GA 4KQRA 2ZQAA 3W4PA 5F1FA 2WGIA 2HDUA 4LV0A 2XEPA 4E6WA 1FCOA 1S6RA 4BBVA 3LR5A 5TBMB 4JXSA 4EETB 5E43A 1DRMA 1T18A 3IS2B 4Z1WA 2HGVA 4UQIM 1K54A 3F1PA 4X1LA 4MDZA 1MKMA 1MKIA 2ZL1A 2PRFA 3PR6A 5HDSA 4S2KA 4WZ4A 1LL8A 2PU2A 4BLMA 3NIAA 2EWWA 4WZ5C 3FPVA 3VP4A 3MQ0A 3CAXA 4OPZA 3VP1A 1NYMA 3LY3A 3G31A 2QPNA 4KZ9A 1PZPA 2Y91A 1N9BA 1FQGA 5M18A 2EXBA 1YLTA 1W63Q 3TG9A 3SOIA 3DWZA 4KG5A 4E04A 2OOLA 2VA0A 3T4TA 3N6IA 3MFXA 5FDSA 2XK1A 4FD8A 4ZJ2A 3FV7A 4BWIA 5EECA 1T1CA 4GN2A 1J9MA 4P6ZM 2ZC7A 3NI9A 3UE0A 1J3WA 2V0WA 2ZQ8A 1NYYA 5HAPA 4S2IA 3IWQA 1HTZA 4L9EA 3UE6A 5MC7A 3MKFA 3VP0A 4NK3A 3P09A 3WRZA 1K4FA 2JKFA 2ZQ9A 1S1ZA 3CPTB 1H5XA 4GZBA 2OLVA 3E98A 4MCWA 3WS1A 4HH2A 4EQ1A 4GJ4A 4DKIA 2WADA 4PM7A 5CGSA 1TS0A 4EWFA 4LFUA 2V9AA 5GLDA 3LEQA 3ZNTA 2EA9A 4L9GA 3HLDA 1D7EA 3ZG0A 2GZAA 1ALQA 4KQQA 3R7WA 4MEZA 1MPLA 2J3TC 5E2HA 2M1CA 4E3OA 4LRXC 2WZZA 1JTGA 1VETB 4L9FA 2G2UA 3CITA 3S4XA 2V8CA 1ZC2A 3GMWA 1LSXA 4DJ2A 3P01A 2M7UA 3AGDA 2Q9MA 3IXHA 3ULFA 5HL6A 5HZHA 3BM6A 2NUPC 3MQQA 5E2GA 3ZG5A 4QU3A 3WS0A 4B93A 4Y2FA 3EWKA 2JKGA 2P04A 2VGLS 3JVUA 1TDLA 4DJ3A 4LV3A 1FILA 5KMWA 3MMHA 4K08A 5HARA 3ZQ5A 1SHVA 1EWZA 1LL5A 2O9AA 2HDRA 3QNBA 1EW0A 3G35A 2L1MA 4I3IA 2R9WA 2E8JA 3O88A 3IHBA 4Y5FA 2QHKA 4RVAA 1YAXA 2QZ6A 4RX2A 3HUOA 3ZYTA 3UDXA 3BFEA 3KSGA 4KUOA 3IS2A 1BTLA 3VOZA 4S2LA 5D3OA 3HLBA 5DFXA 2ZC3B 3Q1FA 4GHIA 3CG5A 3GQZA 1W8QA 3UE3A 1M40A 3OZHA 4P0MA 4RQ9A 1HZOA 4GDNA 5GLAA 3IWOA 3IX3A 1SDNA 4OOLA 1OJ5A 2WGWA 1ONHA 1W63M 4KQOA 1NWZA 1OTAA 5CX7A 4WLAA 1ODVA 2EX9A 3IF5A 3EOIA 4KZAA 4PM9A 1LSWA 4XXRA 2KDKA 4EU0A 5EVLA 3PBTA 3OPRA 2PR6A 1DJCA 4QJGA 5KZHA 4ME4A 3PBSA 1S67L 2JC7A 3GVBA 3LUQA 4EUVA 3P7NA 2JE5A 1TS7A 5EVIB 4QD4A 1YLJA 1MZUA 3HREA 3N4IA 2ZM8A 2V0UA 4E3JA 4JF5A 3CZDA 5FEFA 1Y54A 3UB9A 1OMEA 3RXWA 1XJ4A 3MZFA 5IS1A 1M6KA 3C4OA 4BBUA 1XXMA 3BEBA 4ETXA 2XDMA 1W8YA 2BG1A 2B02A 2M7VA 5IT5A 1K6SA 3E2KA 1K4EA 3KX0X 1N9LA 4OQGA 1ES5A 3SH7A 1PZOA 1RCJA 4FUWA 2O9CA 2R78A 5GLCA 1PNEA 1T1AA 2HPBA 3BFCA 3CJMA 1KGGA 5I94A 3UPOA 2DNSA 2V1BA 3O5YA 5EM1A 1KOUA 4I5SA 3D9YA 4O0PA 2W0NA 2PD7A 3NULA 3CUEA 4BBTA 4HBUA 1UWPX 2W3HA 5E2EA 3B33A 5FQKA 1PWCA 3RH8B 1BT5A 4N9KA 4EBPA 3H82A 3LO7A 5KSHA 2QMIA 1XGJA 5J7EA 2YKHA 5EVIC 1PWDA 3BFFA 1ESIA 5FI6A 2PDRA 3PBNA 2QJ5A 4NXFA 3Q7VA 3V3SA 2Y2OA 4WZ5A 4EBLA 3GDIA 4R1GA 4GS9B 2IWDA 4P6ZS 4HBTA 4HQAA 1LHYA 4Y17A 3MZDA 4ZJ3A 1XJ2A 1I2SA 4S2NA 2W3GA 2PHYA 4DE0A 4PAUA 2R9XA 3A0RA 4GD6A 5EFWA 1H8MA 3IXGA 2JKTM 4E6XA 1OTIA 5KIZA 4HOIA 2VV8A 5FASA 5A91A 1YLPA 1PI4A 1Z09A 5BOHA 3EEAA 2ZL1B 4KZ7A 2V1ZA 2I9VA 3O3VA 1V9ZA 3MZEA 4R38A 3MKEA 1OT9A 1ERMA 3HL9A 3BQAA 2QKPA 4LRZE 2J7VA 1LI9A 5L07A 4CLCA 1W5DA 4S2OA 5J3WA 5FAQA 1YLYA 4EERA 2Z2MB 2AVXA 3E4QA 3QP1A 2PR5A 2JCHA 4OONA 2FH5A 1C3BA 1PW8A 2J9OA 1IFQA 2JBFA 4MN5A 3IXBA 3ISGA 1GA9A 4G3KA 4BQMA 3Q7ZA 3OLOA 4OPQA 3LY4A 1ZTUA 4Y13A 4G3VA 1DP6A 1SKFA 4XUXA 3LICA 4DRTA 1YLWA 2WKEA 3HJKA 3S7NA 3VFFA 4HJ3A 4NEED 2HDSA 5HWVA 2Q0OA 5HAQA 2Y2MA 1IOUA 5AQ9A 2EFXA 3V39A 3GSGA 2IWCA 4R4SA 2OAP1 4Z9QA 2G7UA 1K6RA 1IKIA 2K31A 3M2KA 4ZBEA 4E3IA 3QP6A 3UDFA 1BLSA 3FWLA 4OVDA 1ZG6A 5G4ZA 3PYPA 2V2FF 3K2NA 2J9PA 3IX8A 4ZAMA 3M6HA 4KENB 4IUHA 5AQBA 2ZLYA 2WKRA 2XRNA 3VFHA 4R70A 5J4EA 3G6OA 4C75A 3UB5P 1VB6A 1CQAA 5E2FA 5CTMA 4K0XA 3W2ZA 4M3KA 2KX6A 3S7PA 1ERQA 2W3FA 5AVFA 5CEBA 1IYQA 4B4ZA 3KYQA 3ZVWA 5IU1A 3IH9A 1GSWA 3ZCZA 4G3WA 4LV2A 4E3KA 3C2WA 1S4RA 1P0ZA 3UN7A 2WKHA 3NJAA 1KVLA 2Y2HA 2B95A 4KG6A 1Y4OA 4CJNA 2A2LA 3KSFA 3RXXA 3UMDA 4LCMA 2JKRI 3RJUA 2X71A 3VE3A 4C3QA 4R4RA 5HSQA 3PAGA 1FSWA 5DF7A 1D1JA 4R3BA 4XT2A 3G2ZA 3ZGAB 4LENA 3ZVTA 4PHTA 1VM1A 3VP2A 1NRFA 5C5KA 3K3DA 4WELA 2Y2LA 3OBFA 5I5LA 4F3LA 5DF8A 1FCMA 2ZOHA 4HY8A 2VV6A 5GLBA 3FKVA 2EX6A 2VJWA 4UHUA 4B9OA 2HZ5A 3MS6A 5FQQA 2HJ9C 3CHWP 1E25A 5LBRA 4JGPA 3D3OA 4BD1A 2BASA 3OPLA 4C6YA 4H6JB 5DVAA 1RGYA 3Q07A 1BLHA 5EM0A 3IBRA 4I3AA 2WKIA 2GNXA 1G6AA 2A49A 1PI5A 2INWA 3BWLA 4Q0JA 1S1YA 1CK3A 2ZMFA 2W1RA 1P9RA 4OH0A 4OP8A 1N9NA 2L4RA 2IWBA 3NBLA 4WM9A 2EX8A 1YLZA 2W3DA 4DMZA 2ZM2A 3DW0A 3NCKA 2EFUA 3SW1A 4X53A 4EQIA 2OV5A 4HIAA 1QMFA 3ZFZA 2Y59A 5HAIA 5F68A 5KSCA 3S7OA 3H9WA 5DTTA 2XA7M 3IT9A 3WS4A 3OCNA 5HPIA 2EXAA 1LI0A 2HDQA 4Y15A 2BTFP 4L0LA 2WKPA 1E3UD 1GSVA 1H3QA 3T12B 3MSHA 3HLEA 5F6AA 5FQ9A 4O7DA 5FDHA 1KE4A 3NDGA 5JYPA 4ZTKA 1KE0A 1XX2A 5EVEA 1BLCA 3NDEA 2YKFA 1TD5A 4UEYA 4FH4A 3EQVA 4K0WA 4PM6A 1PW1A 4OQIA 3H7WA 5F5YA 4IHQA 3A3FA 4U3TA 2H10A 3TSGA 2MJ6A 2XGNA 4KZ5A 1GHPA 4JPMA 5FAPA 3A3JA 1K57A 4WMCD 3UB8A 3LIBA 4JKTA 4YFMA 1T1BA 4KZ8A 4IUKA 2VGJA 5DKLA 1IKGA 4HI4A 4DE1A 3NHQA 3P98A 3O86A 4GOGA 2XR0A 4HJ4A 5A92A 4S2NC 1BZAA 1F5MA 1F2KA 4HHDA 3IWIA 4MN7A 3C30A 3ITAA 3T1SA 3OPHA 5CXWA 4OOYA 4EXOA 3S1YA 3C8CA 4A5RA 2OLUA 5HDCA 1KGFA 2B18A 1VEUA 1YSPA 4X56A 2ZMAA 1XJ3A 4NKPA 3T1XA 2HF6A 1FSYA 2PBYA 3G30A 1OT6A 1G28A 4WYYA 4GLQA 2QWSA 3UPPA 4CLCE 1XKZA 4ZJ1A 1G68A 5FQIA 3WRTA 3LCEA 1HLUP 4DDSA 1NLYA 1PRQA 4WEKA 3R4KA 4FCFA 2J3TD 4E3MA 3IX4A 4LV1A 1VEUB 4HESA 3N8SA
chains in the Genus database with same CATH topology
5L8MA 1XJ2A 2D01A 2KOIA 3TE8A 2W3GA 4ETZA 2PHYA 1OTEA 4PAUA 3A0RA 5EFWA 5AJGA 1H8MA 4CLCB 4WUJA 4NXGA 2JKRM 3EGXC 2JKTM 1OTIA 3K3CA 3F1NA 3F1OB 5KIZA 3S7QA 1TF1A 4HOIA 2VV8A 3EEHA 2XROA 2IA2A 2WKQA 4PKYG 4BBVA 3EEAA 1TS6A 3MQOA 3LR5A 4I38A 3TJZC 3VV4A 2OWHA 2I9VA 2W1TA 1V9ZA 5TBMB 4EETB 4R38A 2ZOIA 1DRMA 1OT9A 1VHMA 4HH3A 3BQAA 2QKPA 1T18A 3IS2B 4Z1WA 2HGVA 5HWWA 2XSSA 4LRZE 4UQIM 3F1PA 4CLCA 4MDZA 2KLIA 1MKMA 3LI9A 3T50A 2CMNA 3OC2A 1GSXA 3PR6A 1TS8A 5HDSA 3T4JA 1LL8A 5J3WA 2EWWA 3FPVA 3MQ0A 3PBRA 3T4LA 4I39A 2V1AA 3CAXA 4EERA 3E4QA 2JKTI 3F1NB 5DKKA 2PR5A 3E0YA 4MN6A 3LIAA 3MF0A 2EWVA 2FH5A 4R3AA 3BQ8A 2LB5A 1IFQA 1W63Q 4MN5A 4HP4A 5HD3A 1G6OA 2FZ0A 3F1OA 3LIEA 4E04A 2OOLA 2VA0A 4G3KA 3T4TA 3F1PB 1OPXA 3MFXA 3OLOA 3LR3A 4EW7A 2DMWA 1ZTUA 4BWIA 4G3VA 1DP6A 1T1CA 2JHEA 3LICA 1T19A 4O8GA 5HD5A 2L0WA 4P6ZM 3V67A 3H82B 4HJ6A 2V0WA 4NXBA 3HJKA 3S7NA 4HJ3A 4NEED 4EESA 5HWVA 4L9EA 2P7JA 3UE6A 2NUTC 5MC7A 1IOUA 1MC0A 3KSIA 4AFIA 3OOVA 1NLZA 1F98A 3T4QA 2W3EA 3R7WB 2OAP1 2G7UA 1S1ZA 2QYBA 2K31A 4FOFA 3A0VA 3LIFA 2Z6DA 3E98A 4MCWA 4HH2A 4EQ1A 5G4ZA 3UMEA 3PYPA 4GJ4A 1TS0A 3K2NA 4Y3IA 4JGRA 2VX8A 2V9AA 5DJTA 4ZRRA 4IUHA 3TW8A 3EGDC 2WKRA 2PT7A 2XRNA 2EA9A 4R70A 4L9GA 3G6OA 5J4EA 3VE4A 1VB6A 1D7EA 5F69A 2GZAA 3R7WA 3NOPC 3W2ZA 4F3LB 2KX6A 2O0YA 4GW9A 3S7PA 5A8BA 2W3FA 5AVFA 2J3TC 3KYQA 3E4OA 2M1CA 5IU1A 2HJEA 4LRXC 1GSWA 4G3WA 3D72A 4L9FA 3C2WA 3UB7A 1S4RA 2W27A 1P0ZA 2VV7A 3NJAA 3CITA 1XFNA 1XJ6A 4H6JA 1LT0A 1LSXA 4DN0A 4DJ2A 3P01A 2A2LA 3KSFA 3UMDA 2M7UA 2JKRI 2Y8HA 3ULFA 5HL6A 3VE3A 5HSQA 3PHYA 5TJJA 5HZHA 2NUPC 4XT2A 4JGQA 3MQQA 4LRYC 2HV1A 2ZBBA 4B93A 4Y2FA 3EWKA 4PHTA 2P04A 2VGLS 3JVUA 3HCYA 5C5KA 4DJ3A 3K3DA 4WELA 3MMHA 3OBFA 4K08A 5I5LA 4F3LA 4KUKA 3ZQ5A 2ZOHA 2O9AA 2K7SA 4HY8A 4GHIB 2VV6A 2D02A 1LSVA 2VJWA 1EW0A 4B9OA 4I3JA 3LI8A 2L1MA 4I3IA 2HJ9C 3B42A 4Y5FA 2QHKA 5LBRA 1YAXA 2VKSA 4JGPA 3D3OA 3CWFA 5AVEA 4XT2B 2BASA 2O9BA 2JN7A 3ZYTA 3UB6A 3RFBA 1P97A 3T4KA 3KSGA 1X0OA 3MJQA 1DP8A 3OCLA 4H6JB 4KUOA 4MMNA 4BMWA 3IS2A 1P9WA 3JVVA 2XA7S 4CLCD 3IBRA 4I3AA 4IJGA 1STZA 5DFXA 1F9IA 2GNXA 2A24B 3B47A 3EQUA 4WEJA 2INWA 3BWLA 4Q0JA 1S1YA 4GHIA 2ZMFA 2W1RA 1P9RA 5HDDA 3UE3A 1N9NA 2L4RA 2OWJA 3BW6A 2PD8A 3NOTC 4RQ9A 2VGLM 2J3WA 4PKYA 2W3DA 4CQHA 4DMZA 4EEUA 5FL3A 1V9YA 3MR0A 4OOLA 3SW1A 3HJIA 1OJ5A 2OAQ1 2O99A 3IBJA 1BYWA 4HIAA 1DP9A 1W63M 4KQOA 1NWZA 1OTAA 2P08A 4QPRA 5CX7A 5F68A 3S7OA 5HWTA 4WL9A 3H9WA 4WF0A 2XA7M 3DBAA 3LR4A 3ICYA 3KYZA 4WLAA 1ODVA 3OCNA 3T4SA 5HPIA 3LYXA 3TRCA 1N9OA 3EOIA 3GECA 3FPWA 4L0LA 2WKPA 1LSWA 3CI6A 1GSVA 1H3QA 2KDKA 4EU0A 3NOUC 5F6AA 3PBTA 3H7WB 2PR6A 4ARZA 2YKFA 1TD5A 4ME4A 3PBSA 3LR0A 2H28A 4UEYA 3EQVA 4R6LA 1UWNX 1S67L 2A24A 3LUQA 4YNRA 4EUVA 3P7NA 1YSQA 2Y79A 1TS7A 1MZUA 2QJ7A 3FC7A 1ZHHB 2J80A 3H7WA 3LIDA 4GCZA 4IHQA 5F5YA 2V0UA 4YOFA 2VEAA 3UB9A 3CUEC 5DFYA 1XJ4A 2GJ3A 2MJ6A 5IS1A 1OJGA 4LLOB 4II7A 4KQDA 4BBUA 4WN5A 4Q0HA 4ETXA 1S66L 1NRJA 2VZWA 2W1TB 5TBMA 3UB8A 2PYPA 2B02A 2M7VA 3LIBA 3MXQA 3PBQA 5HPFA 5IT5A 1T1BA 1D06A 4IUKA 5DKLA 5K5BA 3E4PA 3KX0X 4HI4A 3VOLA 1N9LA 3T4OA 3NHQA 4HNBA 5DJUA 1YKDA 4Q0IA 4HJ4A 2O9CA 3A0SA 2R78A 3PBOA 1F5MA 3U2AA 1OTBA 4HHDA 1T1AA 4MN7A 3C30A 4YWZA 4BJPA 4FSFA 4O01A 4M4XA 3O5YA 2V1BA 4EXOA 1JNUA 2ZMVA 1UGUA 1KOUA 4HP9A 4I5SA 3C8CA 4O0PA 2W0NA 5HDCA 2PD7A 3CUEA 2B18A 4BBTA 1YSPA 3C38A 4OOMA 4GS9A 1UWPX 2GX5A 2K2NA 3RTYA 2W3HA 2LB9A 1XJ3A 3B33A 3BY8A 4NKPA 2VLGA 5G4YA 2HF6A 1OTDA 3RH8B 1S4SA 2Z6CA 1WA9A 3H82A 3BJNA 1OT6A 1G28A 5KSHA 3PXPA 3LFVA 4GLQA 2QWSA 4CLCE 5J7EA 2YKHA 4JGOA 2PDRA 3KSHA 3PBNA 2QJ5A 3KO6A 4NXFA 1NLYA 4UQIS 4EEPA 3GDIA 5DF9A 4LPZA 3CLOA 3BY9A 4CLCC 4GS9B 4P6ZS 4WEKA 3R4KA 2J3TD 4HQAA 4NXEA 3FG8A 4ARZB 1Y28A 2PYRA 1XFQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GJ4 A;  2P08 A;  2P04 A; 
#chains in the Genus database with same CATH topology
 1ZKJ A;  1OTE A;  3C4P A;  5AJG A;  4WUJ A;  5CER A;  3EGX C;  3F1N A;  2XFS A;  3S7Q A;  4BL2 A;  1TF1 A;  4K91 A;  2XRO A;  2IA2 A;  2WKQ A;  1JWZ A;  4PKY G;  1TS6 A;  1FCN A;  3TJZ C;  3VV4 A;  2P74 A;  1LL9 A;  1SDE A;  3UPN A;  1NZO A;  2ZOI A;  4DE3 A;  4HH3 A;  3ZG7 B;  5HL1 A;  1NY0 A;  2ACG A;  5HWW A;  4Y0O A;  5CGW A;  1IEM A;  1ONG A;  3JYI A;  3LI9 A;  3T50 A;  2CMN A;  3OC2 A;  4JXV A;  3HLC A;  1TS8 A;  3T4J A;  4X1M A;  4I39 A;  2V1A A;  1K0K A;  3F1N B;  2ZQD A;  5DKK A;  4MN6 A;  1CI8 A;  3MF0 A;  2RL3 A;  3BQ8 A;  4GB7 A;  2ZC4 B;  3NY4 A;  3OPP A;  4DF6 A;  4HP4 A;  3JPU A;  5HD3 A;  1G6O A;  3SS5 A;  2FFY A;  3F1O A;  3UO9 A;  3F1P B;  1JWP A;  2DCF A;  1FOF A;  1IYO A;  2PBD P;  2H0T A;  2Y2I A;  4RX3 A;  4EW7 A;  2DMW A;  4N1H A;  4U0X A;  3CPT A;  5L10 A;  1T19 A;  1K38 A;  4O8G A;  3Q81 A;  5EE8 A;  1MWR A;  4EES A;  1G5U A;  5HW3 A;  2P7J A;  4B88 A;  2NUT C;  3BYD A;  2PU4 A;  1L3L A;  3KSI A;  4AFI A;  1NLZ A;  4ZDX A;  4U0T A;  1F98 A;  1GHI A;  1JTD A;  3T4Q A;  5G18 A;  2W3E A;  3R7W B;  2X02 A;  1N4O A;  2G2W A;  1XPB A;  2P9V B;  2QYB A;  5GHZ A;  4FOF A;  3A0V A;  3LIF A;  2Z6D A;  3QP8 A;  4KZ6 A;  1HVB A;  3UME A;  3HLF A;  4Y3I A;  4R3J A;  2VX8 A;  5DJT A;  4ZRR A;  4FTX A;  3EGD C;  2PT7 A;  1L0E A;  4CPK A;  4JLF A;  3VE4 A;  5A93 A;  5GHX A;  1VQQ A;  3NOP C;  2ZQ7 A;  4F3L B;  4GW9 A;  5A8B A;  2HJE A;  2Y55 A;  3CMZ A;  5J8X A;  4LCL A;  4OQH A;  2P9V A;  3D72 A;  4MBH A;  2Y2N A;  4IBR A;  1K56 A;  2OSU A;  3UB7 A;  2VV7 A;  4X68 A;  2V8F A;  4H6J A;  1LT0 A;  1CI9 A;  3M2J A;  4GKU A;  3E2L A;  1YQS A;  3PHY A;  5TJJ A;  4LRY C;  3HLG A;  3BLM A;  4JBF A;  1FR1 A;  1MBL A;  5M19 A;  3HCY A;  4EV4 A;  1RGZ A;  3QHY A;  3GR2 A;  4MLL A;  1EI5 A;  5JYO A;  1BUL A;  1MWT A;  5TFQ A;  3D4F A;  2K7S A;  4N92 A;  4IBX A;  4GHI B;  1LSV A;  1XA1 A;  4I3J A;  3LI8 A;  4EUZ A;  1KGE A;  3B42 A;  2X01 A;  2VKS A;  1ESU A;  5AVE A;  2O9B A;  2JN7 A;  1S0W A;  1KDS A;  1CEF A;  1ES3 A;  1P97 A;  3T4K A;  1SKO A;  3M6B A;  1DP8 A;  3MJQ A;  5F83 A;  2XLN A;  5GL9 A;  1P9W A;  1ES4 A;  4CLC D;  1STZ A;  1K25 A;  1F9I A;  4IVI A;  3IH8 A;  4HEF A;  1AWI A;  2FFF B;  3IHA A;  2OWJ A;  2PD8 A;  1L0D A;  1WYC A;  4S2P A;  3I7J A;  1NZU A;  4CQH A;  4EEU A;  1PWG A;  3MR0 A;  3HJI A;  4OLG A;  3W4Q A;  4DDY A;  3IBJ A;  1BYW A;  3DTI A;  1DP9 A;  2P08 A;  4WL9 A;  3Q7V B;  4WF0 A;  1CF0 A;  3IXD A;  5FAO A;  2C5W B;  4X69 A;  3DBA A;  3C7V A;  3LR4 A;  3ICY A;  3KYZ A;  1SKO B;  3LYX A;  3TRC A;  3WS5 A;  1VET A;  4KZB A;  3CI6 A;  2E8I A;  3NC8 A;  3SS4 A;  5EUA A;  3UDI A;  2B5R A;  4OP5 A;  3H7W B;  1H0M A;  1AXB A;  4ARZ A;  3WS2 A;  2H28 A;  4R6L A;  1UWN X;  2A24 A;  5CEC A;  4RA7 A;  4YNR A;  3SZT A;  1KE3 A;  1YSQ A;  1ES2 A;  4ID4 A;  5CRF A;  2ZQC A;  2QJ7 A;  4GNU A;  5AQA A;  4PPR A;  3DTM A;  5FA7 A;  3FC7 A;  2J80 A;  3LID A;  2VEA A;  3GV9 A;  3CUE C;  4MBF A;  3MXS A;  5DFY A;  2GJ3 A;  2I72 A;  1K54 C;  4KQD A;  3LEZ A;  3VOY A;  2HP9 A;  4QWO A;  1S66 L;  3W8K A;  2W1T B;  2Y2J A;  3MXQ A;  3ZG8 B;  3MFD A;  1D06 A;  4E3L A;  4ESP A;  4QHC A;  2WGV A;  5EVI A;  5F82 A;  1DJB A;  3A3E A;  3HVF A;  3N8R A;  5CED A;  1RP5 A;  3BLS A;  3U2A A;  3UY6 A;  1FIK A;  4FSF A;  4O01 A;  3A3D A;  2ZMV A;  3VSK A;  1UGU A;  4HP9 A;  4P6B A;  5U47 A;  2DRW A;  1MWS A;  1I2W A;  3C38 A;  4OOM A;  4GS9 A;  4P87 A;  2H0Y A;  2GX5 A;  2K2N A;  5M1A A;  2LB9 A;  5TR7 A;  4E3N A;  3C5A A;  3BY8 A;  3ZG9 B;  2VLG A;  3BRM A;  1H8Y A;  1S4S A;  2WZX A;  3UNW A;  2Z6C A;  2Y2Q A;  1WA9 A;  4BD0 A;  1GCE A;  3LFV A;  1KDW A;  4JGO A;  2Z2L B;  3L9K A;  3KO6 A;  2H5S A;  1JWV A;  1Z6F A;  4Q8I A;  3HLW A;  4UQI S;  4XUZ A;  4EEP A;  4LPZ A;  3CLO A;  5IHV A;  3BY9 A;  4CLC C;  1XA7 A;  3IF6 C;  4D60 A;  3FG8 A;  4ARZ B;  1Y28 A;  3U4L P;  3SH9 A;  1XFQ A;  5L8M A;  3TE8 A;  4ETZ A;  3W4O A;  1DJA A;  1K57 C;  4CLC B;  2JKR M;  3S22 A;  3QP5 A;  2C6W B;  4LGW A;  4B4X A;  3LGO A;  4YIN A;  3K3C A;  3F1O B;  4Y7P A;  5EV0 A;  4F94 A;  3EEH A;  1MY8 A;  1Q2Q A;  3MQO A;  4UAA A;  4R23 A;  4I38 A;  2OWH A;  1E3U A;  2W1T A;  3QP4 A;  2A3U A;  3BFD A;  1VHM A;  4MBK A;  3V5M A;  2XSS A;  1TDG A;  2KLI A;  2Q9N A;  1GSX A;  4JF6 A;  1MXO A;  1YM1 A;  3PBR A;  1LLB A;  2Y4A A;  3T4L A;  2JKT I;  5EOO A;  5FAT A;  3E0Y A;  1PIO A;  4RYE A;  3LIA A;  2XF3 A;  2EWV A;  3O87 A;  1ZG4 A;  4R3A A;  4OPR A;  2LB5 A;  2FZ0 A;  3N8L A;  3LIE A;  3G2Y A;  4JXG A;  1A0K A;  4JXW A;  1OPX A;  4GD8 A;  2BLS A;  3LR3 A;  2V20 A;  3BEC A;  4OQ0 A;  2JHE A;  3PTE A;  2Y2G A;  4NET A;  5CHM A;  3B3X A;  5HD5 A;  2L0W A;  3V67 A;  3H82 B;  2VGK A;  3TOI A;  2ZJ9 A;  1SZV A;  4HJ6 A;  4NXB A;  3T1Q B;  3AGF A;  1O7E A;  1ACF A;  2RCX A;  1K55 C;  1MC0 A;  1W7F A;  2UWX A;  3FKW A;  3OOV A;  4PMA A;  1ERO A;  1K56 D;  3BFG A;  5EPH A;  5CHJ A;  3ITB A;  4P85 A;  4DXC A;  2EX2 A;  2XFT A;  5HX9 A;  4H8R A;  2VK3 A;  4FH2 A;  1IEL A;  4JGR A;  1CEG A;  4BEN A;  3TW8 A;  2Y2P A;  3QNC A;  1PFL A;  2XD5 A;  3VSL A;  5F69 A;  4GDB A;  4WBG A;  1YPR A;  2O0Y A;  4IVK A;  1I5Q A;  1FR6 A;  3E4O A;  3FYZ A;  3GRJ A;  1NJ4 A;  2WAF A;  4PM8 A;  5CHU A;  2W27 A;  4IED A;  3DAV A;  4UA9 A;  3G4P A;  1XFN A;  1XJ6 A;  1XP4 A;  5FSR A;  4DN0 A;  3IF6 B;  3N7W A;  2HP6 A;  3C7U A;  2UV0 E;  2Y8H A;  5L09 A;  1DY6 A;  1O07 A;  3V3R A;  5FEG A;  3GTC A;  2WK0 A;  5EVI D;  2WYX A;  3WWX A;  4JGQ A;  4BL3 A;  2HV1 A;  3QP2 A;  4DE2 A;  1W79 A;  2ZBB A;  3SH8 A;  5L2F A;  2CC1 A;  4NG2 A;  3DWK A;  2PAV P;  1IYP A;  4DXB A;  4KUK A;  2Y2K A;  3VMA A;  4UA7 A;  5DTS A;  1H8Z A;  2D02 A;  3NEC A;  4UA6 A;  4KZ3 A;  3DTE A;  1PYY A;  3MXR A;  1GHM A;  3CWF A;  4XT2 B;  3UB6 A;  3RFB A;  1X0O A;  1K55 A;  3OCL A;  4MMN A;  4QB8 A;  4BMW A;  1BLP A;  3JVV A;  2XA7 S;  3KYE A;  5HFO A;  4IJG A;  1TVF A;  3MBZ A;  2A24 B;  3B47 A;  3EQU A;  4S2M A;  4WEJ A;  3Q82 A;  5HDD A;  4KG2 A;  1WE4 A;  3BW6 A;  3NOT C;  5FQJ A;  3SS3 A;  2VGL M;  1NXY A;  2J3W A;  4PKY A;  2ZM0 A;  5FL3 A;  1V9Y A;  2OAQ 1;  2O99 A;  4OLD A;  1XGI A;  3L7H A;  3FZC A;  4QPR A;  4JF4 A;  5HWT A;  4Y0U A;  3T4S A;  1BSG A;  3AGE A;  4S2J A;  4EBN A;  1N9O A;  3ZNY A;  4R0Q A;  3GEC A;  5EOE A;  3FPW A;  1MWU A;  3IQA A;  3IF6 A;  3NOU C;  2HP5 A;  2ZC6 B;  2WAE A;  5F1G A;  1JVJ A;  1U60 A;  3LR0 A;  3G32 A;  2XD1 A;  3PAE A;  4D2O A;  1SCW A;  2Y79 A;  1IYS A;  1ZHH B;  4GCZ A;  5DTK A;  4YOF A;  4Y0T A;  2XH9 A;  4N1X A;  1OJG A;  4LLO B;  4II7 A;  2WGW B;  4WN5 A;  4Q0H A;  1KVM A;  4MNR A;  1NRJ A;  2VZW A;  5TBM A;  2PYP A;  3PBQ A;  5HPF A;  1QME A;  3VP3 A;  5K5B A;  3ZHH A;  3E4P A;  3VOL A;  3A3I A;  3T4O A;  3ZDJ A;  4HNB A;  2WUQ A;  5DJU A;  1YKD A;  4Q0I A;  1YMX A;  3A0S A;  3PBO A;  3V50 A;  1OTB A;  3G34 A;  4YWZ A;  4BJP A;  4M4X A;  1GA0 A;  1JNU A;  1L0F A;  4WMC A;  1TEM A;  4X25 A;  3RTY A;  4X6T A;  1YT4 A;  5G4Y A;  1OTD A;  1CJF A;  4OKP A;  5A90 A;  1E4D A;  5CTN A;  1YMS A;  5AQ7 A;  4X55 A;  3BJN A;  2GDN A;  2J8Y A;  3PXP A;  3T1R A;  1Q2P A;  3HUN A;  5CGX A;  3KSH A;  2ZD8 A;  1WYB A;  1HD8 A;  5FI2 A;  5FQM A;  5DF9 A;  3HBR A;  4OPY A;  5GHY A;  4PM5 A;  3UE1 A;  4NXE A;  1BUE A;  2XQZ A;  2PYR A;  2ZC5 B;  5TGF A;  3DTK A;  2D01 A;  2KOI A;  5FI7 A;  4KZ4 A;  3HUM A;  4N9L A;  1L2S A;  4QY5 A;  4NXG A;  4QY6 A;  1L0G A;  4KQR A;  2ZQA A;  3W4P A;  5F1F A;  2WGI A;  2HDU A;  4LV0 A;  2XEP A;  4E6W A;  1FCO A;  1S6R A;  4BBV A;  3LR5 A;  5TBM B;  4JXS A;  4EET B;  5E43 A;  1DRM A;  1T18 A;  3IS2 B;  4Z1W A;  2HGV A;  4UQI M;  1K54 A;  3F1P A;  4X1L A;  4MDZ A;  1MKM A;  1MKI A;  2ZL1 A;  2PRF A;  3PR6 A;  5HDS A;  4S2K A;  4WZ4 A;  1LL8 A;  2PU2 A;  4BLM A;  3NIA A;  2EWW A;  4WZ5 C;  3FPV A;  3VP4 A;  3MQ0 A;  3CAX A;  4OPZ A;  3VP1 A;  1NYM A;  3LY3 A;  3G31 A;  2QPN A;  4KZ9 A;  1PZP A;  2Y91 A;  1N9B A;  1FQG A;  5M18 A;  2EXB A;  1YLT A;  1W63 Q;  3TG9 A;  3SOI A;  3DWZ A;  4KG5 A;  4E04 A;  2OOL A;  2VA0 A;  3T4T A;  3N6I A;  3MFX A;  5FDS A;  2XK1 A;  4FD8 A;  4ZJ2 A;  3FV7 A;  4BWI A;  5EEC A;  1T1C A;  4GN2 A;  1J9M A;  4P6Z M;  2ZC7 A;  3NI9 A;  3UE0 A;  1J3W A;  2V0W A;  2ZQ8 A;  1NYY A;  5HAP A;  4S2I A;  3IWQ A;  1HTZ A;  4L9E A;  3UE6 A;  5MC7 A;  3MKF A;  3VP0 A;  4NK3 A;  3P09 A;  3WRZ A;  1K4F A;  2JKF A;  2ZQ9 A;  1S1Z A;  3CPT B;  1H5X A;  4GZB A;  2OLV A;  3E98 A;  4MCW A;  3WS1 A;  4HH2 A;  4EQ1 A;  4GJ4 A;  4DKI A;  2WAD A;  4PM7 A;  5CGS A;  1TS0 A;  4EWF A;  4LFU A;  2V9A A;  5GLD A;  3LEQ A;  3ZNT A;  2EA9 A;  4L9G A;  3HLD A;  1D7E A;  3ZG0 A;  2GZA A;  1ALQ A;  4KQQ A;  3R7W A;  4MEZ A;  1MPL A;  2J3T C;  5E2H A;  2M1C A;  4E3O A;  4LRX C;  2WZZ A;  1JTG A;  1VET B;  4L9F A;  2G2U A;  3CIT A;  3S4X A;  2V8C A;  1ZC2 A;  3GMW A;  1LSX A;  4DJ2 A;  3P01 A;  2M7U A;  3AGD A;  2Q9M A;  3IXH A;  3ULF A;  5HL6 A;  5HZH A;  3BM6 A;  2NUP C;  3MQQ A;  5E2G A;  3ZG5 A;  4QU3 A;  3WS0 A;  4B93 A;  4Y2F A;  3EWK A;  2JKG A;  2P04 A;  2VGL S;  3JVU A;  1TDL A;  4DJ3 A;  4LV3 A;  1FIL A;  5KMW A;  3MMH A;  4K08 A;  5HAR A;  3ZQ5 A;  1SHV A;  1EWZ A;  1LL5 A;  2O9A A;  2HDR A;  3QNB A;  1EW0 A;  3G35 A;  2L1M A;  4I3I A;  2R9W A;  2E8J A;  3O88 A;  3IHB A;  4Y5F A;  2QHK A;  4RVA A;  1YAX A;  2QZ6 A;  4RX2 A;  3HUO A;  3ZYT A;  3UDX A;  3BFE A;  3KSG A;  4KUO A;  3IS2 A;  1BTL A;  3VOZ A;  4S2L A;  5D3O A;  3HLB A;  5DFX A;  2ZC3 B;  3Q1F A;  4GHI A;  3CG5 A;  3GQZ A;  1W8Q A;  3UE3 A;  1M40 A;  3OZH A;  4P0M A;  4RQ9 A;  1HZO A;  4GDN A;  5GLA A;  3IWO A;  3IX3 A;  1SDN A;  4OOL A;  1OJ5 A;  2WGW A;  1ONH A;  1W63 M;  4KQO A;  1NWZ A;  1OTA A;  5CX7 A;  4WLA A;  1ODV A;  2EX9 A;  3IF5 A;  3EOI A;  4KZA A;  4PM9 A;  1LSW A;  4XXR A;  2KDK A;  4EU0 A;  5EVL A;  3PBT A;  3OPR A;  2PR6 A;  1DJC A;  4QJG A;  5KZH A;  4ME4 A;  3PBS A;  1S67 L;  2JC7 A;  3GVB A;  3LUQ A;  4EUV A;  3P7N A;  2JE5 A;  1TS7 A;  5EVI B;  4QD4 A;  1YLJ A;  1MZU A;  3HRE A;  3N4I A;  2ZM8 A;  2V0U A;  4E3J A;  4JF5 A;  3CZD A;  5FEF A;  1Y54 A;  3UB9 A;  1OME A;  3RXW A;  1XJ4 A;  3MZF A;  5IS1 A;  1M6K A;  3C4O A;  4BBU A;  1XXM A;  3BEB A;  4ETX A;  2XDM A;  1W8Y A;  2BG1 A;  2B02 A;  2M7V A;  5IT5 A;  1K6S A;  3E2K A;  1K4E A;  3KX0 X;  1N9L A;  4OQG A;  1ES5 A;  3SH7 A;  1PZO A;  1RCJ A;  4FUW A;  2O9C A;  2R78 A;  5GLC A;  1PNE A;  1T1A A;  2HPB A;  3BFC A;  3CJM A;  1KGG A;  5I94 A;  3UPO A;  2DNS A;  2V1B A;  3O5Y A;  5EM1 A;  1KOU A;  4I5S A;  3D9Y A;  4O0P A;  2W0N A;  2PD7 A;  3NUL A;  3CUE A;  4BBT A;  4HBU A;  1UWP X;  2W3H A;  5E2E A;  3B33 A;  5FQK A;  1PWC A;  3RH8 B;  1BT5 A;  4N9K A;  4EBP A;  3H82 A;  3LO7 A;  5KSH A;  2QMI A;  1XGJ A;  5J7E A;  2YKH A;  5EVI C;  1PWD A;  3BFF A;  1ESI A;  5FI6 A;  2PDR A;  3PBN A;  2QJ5 A;  4NXF A;  3Q7V A;  3V3S A;  2Y2O A;  4WZ5 A;  4EBL A;  3GDI A;  4R1G A;  4GS9 B;  2IWD A;  4P6Z S;  4HBT A;  4HQA A;  1LHY A;  4Y17 A;  3MZD A;  4ZJ3 A;  1XJ2 A;  1I2S A;  4S2N A;  2W3G A;  2PHY A;  4DE0 A;  4PAU A;  2R9X A;  3A0R A;  4GD6 A;  5EFW A;  1H8M A;  3IXG A;  2JKT M;  4E6X A;  1OTI A;  5KIZ A;  4HOI A;  2VV8 A;  5FAS A;  5A91 A;  1YLP A;  1PI4 A;  1Z09 A;  5BOH A;  3EEA A;  2ZL1 B;  4KZ7 A;  2V1Z A;  2I9V A;  3O3V A;  1V9Z A;  3MZE A;  4R38 A;  3MKE A;  1OT9 A;  1ERM A;  3HL9 A;  3BQA A;  2QKP A;  4LRZ E;  2J7V A;  1LI9 A;  5L07 A;  4CLC A;  1W5D A;  4S2O A;  5J3W A;  5FAQ A;  1YLY A;  4EER A;  2Z2M B;  2AVX A;  3E4Q A;  3QP1 A;  2PR5 A;  2JCH A;  4OON A;  2FH5 A;  1C3B A;  1PW8 A;  2J9O A;  1IFQ A;  2JBF A;  4MN5 A;  3IXB A;  3ISG A;  1GA9 A;  4G3K A;  4BQM A;  3Q7Z A;  3OLO A;  4OPQ A;  3LY4 A;  1ZTU A;  4Y13 A;  4G3V A;  1DP6 A;  1SKF A;  4XUX A;  3LIC A;  4DRT A;  1YLW A;  2WKE A;  3HJK A;  3S7N A;  3VFF A;  4HJ3 A;  4NEE D;  2HDS A;  5HWV A;  2Q0O A;  5HAQ A;  2Y2M A;  1IOU A;  5AQ9 A;  2EFX A;  3V39 A;  3GSG A;  2IWC A;  4R4S A;  2OAP 1;  4Z9Q A;  2G7U A;  1K6R A;  1IKI A;  2K31 A;  3M2K A;  4ZBE A;  4E3I A;  3QP6 A;  3UDF A;  1BLS A;  3FWL A;  4OVD A;  1ZG6 A;  5G4Z A;  3PYP A;  2V2F F;  3K2N A;  2J9P A;  3IX8 A;  4ZAM A;  3M6H A;  4KEN B;  4IUH A;  5AQB A;  2ZLY A;  2WKR A;  2XRN A;  3VFH A;  4R70 A;  5J4E A;  3G6O A;  4C75 A;  3UB5 P;  1VB6 A;  1CQA A;  5E2F A;  5CTM A;  4K0X A;  3W2Z A;  4M3K A;  2KX6 A;  3S7P A;  1ERQ A;  2W3F A;  5AVF A;  5CEB A;  1IYQ A;  4B4Z A;  3KYQ A;  3ZVW A;  5IU1 A;  3IH9 A;  1GSW A;  3ZCZ A;  4G3W A;  4LV2 A;  4E3K A;  3C2W A;  1S4R A;  1P0Z A;  3UN7 A;  2WKH A;  3NJA A;  1KVL A;  2Y2H A;  2B95 A;  4KG6 A;  1Y4O A;  4CJN A;  2A2L A;  3KSF A;  3RXX A;  3UMD A;  4LCM A;  2JKR I;  3RJU A;  2X71 A;  3VE3 A;  4C3Q A;  4R4R A;  5HSQ A;  3PAG A;  1FSW A;  5DF7 A;  1D1J A;  4R3B A;  4XT2 A;  3G2Z A;  3ZGA B;  4LEN A;  3ZVT A;  4PHT A;  1VM1 A;  3VP2 A;  1NRF A;  5C5K A;  3K3D A;  4WEL A;  2Y2L A;  3OBF A;  5I5L A;  4F3L A;  5DF8 A;  1FCM A;  2ZOH A;  4HY8 A;  2VV6 A;  5GLB A;  3FKV A;  2EX6 A;  2VJW A;  4UHU A;  4B9O A;  2HZ5 A;  3MS6 A;  5FQQ A;  2HJ9 C;  3CHW P;  1E25 A;  5LBR A;  4JGP A;  3D3O A;  4BD1 A;  2BAS A;  3OPL A;  4C6Y A;  4H6J B;  5DVA A;  1RGY A;  3Q07 A;  1BLH A;  5EM0 A;  3IBR A;  4I3A A;  2WKI A;  2GNX A;  1G6A A;  2A49 A;  1PI5 A;  2INW A;  3BWL A;  4Q0J A;  1S1Y A;  1CK3 A;  2ZMF A;  2W1R A;  1P9R A;  4OH0 A;  4OP8 A;  1N9N A;  2L4R A;  2IWB A;  3NBL A;  4WM9 A;  2EX8 A;  1YLZ A;  2W3D A;  4DMZ A;  2ZM2 A;  3DW0 A;  3NCK A;  2EFU A;  3SW1 A;  4X53 A;  4EQI A;  2OV5 A;  4HIA A;  1QMF A;  3ZFZ A;  2Y59 A;  5HAI A;  5F68 A;  5KSC A;  3S7O A;  3H9W A;  5DTT A;  2XA7 M;  3IT9 A;  3WS4 A;  3OCN A;  5HPI A;  2EXA A;  1LI0 A;  2HDQ A;  4Y15 A;  2BTF P;  4L0L A;  2WKP A;  1E3U D;  1GSV A;  1H3Q A;  3T12 B;  3MSH A;  3HLE A;  5F6A A;  5FQ9 A;  4O7D A;  5FDH A;  1KE4 A;  3NDG A;  5JYP A;  4ZTK A;  1KE0 A;  1XX2 A;  5EVE A;  1BLC A;  3NDE A;  2YKF A;  1TD5 A;  4UEY A;  4FH4 A;  3EQV A;  4K0W A;  4PM6 A;  1PW1 A;  4OQI A;  3H7W A;  5F5Y A;  4IHQ A;  3A3F A;  4U3T A;  2H10 A;  3TSG A;  2MJ6 A;  2XGN A;  4KZ5 A;  1GHP A;  4JPM A;  5FAP A;  3A3J A;  1K57 A;  4WMC D;  3UB8 A;  3LIB A;  4JKT A;  4YFM A;  1T1B A;  4KZ8 A;  4IUK A;  2VGJ A;  5DKL A;  1IKG A;  4HI4 A;  4DE1 A;  3NHQ A;  3P98 A;  3O86 A;  4GOG A;  2XR0 A;  4HJ4 A;  5A92 A;  4S2N C;  1BZA A;  1F5M A;  1F2K A;  4HHD A;  3IWI A;  4MN7 A;  3C30 A;  3ITA A;  3T1S A;  3OPH A;  5CXW A;  4OOY A;  4EXO A;  3S1Y A;  3C8C A;  4A5R A;  2OLU A;  5HDC A;  1KGF A;  2B18 A;  1VEU A;  1YSP A;  4X56 A;  2ZMA A;  1XJ3 A;  4NKP A;  3T1X A;  2HF6 A;  1FSY A;  2PBY A;  3G30 A;  1OT6 A;  1G28 A;  4WYY A;  4GLQ A;  2QWS A;  3UPP A;  4CLC E;  1XKZ A;  4ZJ1 A;  1G68 A;  5FQI A;  3WRT A;  3LCE A;  1HLU P;  4DDS A;  1NLY A;  1PRQ A;  4WEK A;  3R4K A;  4FCF A;  2J3T D;  4E3M A;  3IX4 A;  4LV1 A;  1VEU B;  4HES A;  3N8S A; 
#chains in the Genus database with same CATH homology
 5L8M A;  1XJ2 A;  2D01 A;  2KOI A;  3TE8 A;  2W3G A;  4ETZ A;  2PHY A;  1OTE A;  4PAU A;  3A0R A;  5EFW A;  5AJG A;  1H8M A;  4CLC B;  4WUJ A;  4NXG A;  2JKR M;  3EGX C;  2JKT M;  1OTI A;  3K3C A;  3F1N A;  3F1O B;  5KIZ A;  3S7Q A;  1TF1 A;  4HOI A;  2VV8 A;  3EEH A;  2XRO A;  2IA2 A;  2WKQ A;  4PKY G;  4BBV A;  3EEA A;  1TS6 A;  3MQO A;  3LR5 A;  4I38 A;  3TJZ C;  3VV4 A;  2OWH A;  2I9V A;  2W1T A;  1V9Z A;  5TBM B;  4EET B;  4R38 A;  2ZOI A;  1DRM A;  1OT9 A;  1VHM A;  4HH3 A;  3BQA A;  2QKP A;  1T18 A;  3IS2 B;  4Z1W A;  2HGV A;  5HWW A;  2XSS A;  4LRZ E;  4UQI M;  3F1P A;  4CLC A;  4MDZ A;  2KLI A;  1MKM A;  3LI9 A;  3T50 A;  2CMN A;  3OC2 A;  1GSX A;  3PR6 A;  1TS8 A;  5HDS A;  3T4J A;  1LL8 A;  5J3W A;  2EWW A;  3FPV A;  3MQ0 A;  3PBR A;  3T4L A;  4I39 A;  2V1A A;  3CAX A;  4EER A;  3E4Q A;  2JKT I;  3F1N B;  5DKK A;  2PR5 A;  3E0Y A;  4MN6 A;  3LIA A;  3MF0 A;  2EWV A;  2FH5 A;  4R3A A;  3BQ8 A;  2LB5 A;  1IFQ A;  1W63 Q;  4MN5 A;  4HP4 A;  5HD3 A;  1G6O A;  2FZ0 A;  3F1O A;  3LIE A;  4E04 A;  2OOL A;  2VA0 A;  4G3K A;  3T4T A;  3F1P B;  1OPX A;  3MFX A;  3OLO A;  3LR3 A;  4EW7 A;  2DMW A;  1ZTU A;  4BWI A;  4G3V A;  1DP6 A;  1T1C A;  2JHE A;  3LIC A;  1T19 A;  4O8G A;  5HD5 A;  2L0W A;  4P6Z M;  3V67 A;  3H82 B;  4HJ6 A;  2V0W A;  4NXB A;  3HJK A;  3S7N A;  4HJ3 A;  4NEE D;  4EES A;  5HWV A;  4L9E A;  2P7J A;  3UE6 A;  2NUT C;  5MC7 A;  1IOU A;  1MC0 A;  3KSI A;  4AFI A;  3OOV A;  1NLZ A;  1F98 A;  3T4Q A;  2W3E A;  3R7W B;  2OAP 1;  2G7U A;  1S1Z A;  2QYB A;  2K31 A;  4FOF A;  3A0V A;  3LIF A;  2Z6D A;  3E98 A;  4MCW A;  4HH2 A;  4EQ1 A;  5G4Z A;  3UME A;  3PYP A;  4GJ4 A;  1TS0 A;  3K2N A;  4Y3I A;  4JGR A;  2VX8 A;  2V9A A;  5DJT A;  4ZRR A;  4IUH A;  3TW8 A;  3EGD C;  2WKR A;  2PT7 A;  2XRN A;  2EA9 A;  4R70 A;  4L9G A;  3G6O A;  5J4E A;  3VE4 A;  1VB6 A;  1D7E A;  5F69 A;  2GZA A;  3R7W A;  3NOP C;  3W2Z A;  4F3L B;  2KX6 A;  2O0Y A;  4GW9 A;  3S7P A;  5A8B A;  2W3F A;  5AVF A;  2J3T C;  3KYQ A;  3E4O A;  2M1C A;  5IU1 A;  2HJE A;  4LRX C;  1GSW A;  4G3W A;  3D72 A;  4L9F A;  3C2W A;  3UB7 A;  1S4R A;  2W27 A;  1P0Z A;  2VV7 A;  3NJA A;  3CIT A;  1XFN A;  1XJ6 A;  4H6J A;  1LT0 A;  1LSX A;  4DN0 A;  4DJ2 A;  3P01 A;  2A2L A;  3KSF A;  3UMD A;  2M7U A;  2JKR I;  2Y8H A;  3ULF A;  5HL6 A;  3VE3 A;  5HSQ A;  3PHY A;  5TJJ A;  5HZH A;  2NUP C;  4XT2 A;  4JGQ A;  3MQQ A;  4LRY C;  2HV1 A;  2ZBB A;  4B93 A;  4Y2F A;  3EWK A;  4PHT A;  2P04 A;  2VGL S;  3JVU A;  3HCY A;  5C5K A;  4DJ3 A;  3K3D A;  4WEL A;  3MMH A;  3OBF A;  4K08 A;  5I5L A;  4F3L A;  4KUK A;  3ZQ5 A;  2ZOH A;  2O9A A;  2K7S A;  4HY8 A;  4GHI B;  2VV6 A;  2D02 A;  1LSV A;  2VJW A;  1EW0 A;  4B9O A;  4I3J A;  3LI8 A;  2L1M A;  4I3I A;  2HJ9 C;  3B42 A;  4Y5F A;  2QHK A;  5LBR A;  1YAX A;  2VKS A;  4JGP A;  3D3O A;  3CWF A;  5AVE A;  4XT2 B;  2BAS A;  2O9B A;  2JN7 A;  3ZYT A;  3UB6 A;  3RFB A;  1P97 A;  3T4K A;  3KSG A;  1X0O A;  3MJQ A;  1DP8 A;  3OCL A;  4H6J B;  4KUO A;  4MMN A;  4BMW A;  3IS2 A;  1P9W A;  3JVV A;  2XA7 S;  4CLC D;  3IBR A;  4I3A A;  4IJG A;  1STZ A;  5DFX A;  1F9I A;  2GNX A;  2A24 B;  3B47 A;  3EQU A;  4WEJ A;  2INW A;  3BWL A;  4Q0J A;  1S1Y A;  4GHI A;  2ZMF A;  2W1R A;  1P9R A;  5HDD A;  3UE3 A;  1N9N A;  2L4R A;  2OWJ A;  3BW6 A;  2PD8 A;  3NOT C;  4RQ9 A;  2VGL M;  2J3W A;  4PKY A;  2W3D A;  4CQH A;  4DMZ A;  4EEU A;  5FL3 A;  1V9Y A;  3MR0 A;  4OOL A;  3SW1 A;  3HJI A;  1OJ5 A;  2OAQ 1;  2O99 A;  3IBJ A;  1BYW A;  4HIA A;  1DP9 A;  1W63 M;  4KQO A;  1NWZ A;  1OTA A;  2P08 A;  4QPR A;  5CX7 A;  5F68 A;  3S7O A;  5HWT A;  4WL9 A;  3H9W A;  4WF0 A;  2XA7 M;  3DBA A;  3LR4 A;  3ICY A;  3KYZ A;  4WLA A;  1ODV A;  3OCN A;  3T4S A;  5HPI A;  3LYX A;  3TRC A;  1N9O A;  3EOI A;  3GEC A;  3FPW A;  4L0L A;  2WKP A;  1LSW A;  3CI6 A;  1GSV A;  1H3Q A;  2KDK A;  4EU0 A;  3NOU C;  5F6A A;  3PBT A;  3H7W B;  2PR6 A;  4ARZ A;  2YKF A;  1TD5 A;  4ME4 A;  3PBS A;  3LR0 A;  2H28 A;  4UEY A;  3EQV A;  4R6L A;  1UWN X;  1S67 L;  2A24 A;  3LUQ A;  4YNR A;  4EUV A;  3P7N A;  1YSQ A;  2Y79 A;  1TS7 A;  1MZU A;  2QJ7 A;  3FC7 A;  1ZHH B;  2J80 A;  3H7W A;  3LID A;  4GCZ A;  4IHQ A;  5F5Y A;  2V0U A;  4YOF A;  2VEA A;  3UB9 A;  3CUE C;  5DFY A;  1XJ4 A;  2GJ3 A;  2MJ6 A;  5IS1 A;  1OJG A;  4LLO B;  4II7 A;  4KQD A;  4BBU A;  4WN5 A;  4Q0H A;  4ETX A;  1S66 L;  1NRJ A;  2VZW A;  2W1T B;  5TBM A;  3UB8 A;  2PYP A;  2B02 A;  2M7V A;  3LIB A;  3MXQ A;  3PBQ A;  5HPF A;  5IT5 A;  1T1B A;  1D06 A;  4IUK A;  5DKL A;  5K5B A;  3E4P A;  3KX0 X;  4HI4 A;  3VOL A;  1N9L A;  3T4O A;  3NHQ A;  4HNB A;  5DJU A;  1YKD A;  4Q0I A;  4HJ4 A;  2O9C A;  3A0S A;  2R78 A;  3PBO A;  1F5M A;  3U2A A;  1OTB A;  4HHD A;  1T1A A;  4MN7 A;  3C30 A;  4YWZ A;  4BJP A;  4FSF A;  4O01 A;  4M4X A;  3O5Y A;  2V1B A;  4EXO A;  1JNU A;  2ZMV A;  1UGU A;  1KOU A;  4HP9 A;  4I5S A;  3C8C A;  4O0P A;  2W0N A;  5HDC A;  2PD7 A;  3CUE A;  2B18 A;  4BBT A;  1YSP A;  3C38 A;  4OOM A;  4GS9 A;  1UWP X;  2GX5 A;  2K2N A;  3RTY A;  2W3H A;  2LB9 A;  1XJ3 A;  3B33 A;  3BY8 A;  4NKP A;  2VLG A;  5G4Y A;  2HF6 A;  1OTD A;  3RH8 B;  1S4S A;  2Z6C A;  1WA9 A;  3H82 A;  3BJN A;  1OT6 A;  1G28 A;  5KSH A;  3PXP A;  3LFV A;  4GLQ A;  2QWS A;  4CLC E;  5J7E A;  2YKH A;  4JGO A;  2PDR A;  3KSH A;  3PBN A;  2QJ5 A;  3KO6 A;  4NXF A;  1NLY A;  4UQI S;  4EEP A;  3GDI A;  5DF9 A;  4LPZ A;  3CLO A;  3BY9 A;  4CLC C;  4GS9 B;  4P6Z S;  4WEK A;  3R4K A;  2J3T D;  4HQA A;  4NXE A;  3FG8 A;  4ARZ B;  1Y28 A;  2PYR A;  1XFQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...