2P08A

Structure of the n-terminally truncated pas domain of signal transduction histidine kinase from nostoc punctiforme pcc 73102 with homology to the h-noxa/h-noba domain of the soluble guanylyl cyclase
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
107
structure length
107
Chain Sequence
MLSPELLAKAFPFHFAFSRNREIVQTGEVLERISPEPLVGKLIEQHFQINRPKILIDFDAISKQPRALFILEFLHNGMQLKGQMMYQPEEEVIFFLGSPWITDTTSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords signal transduction histidine kinase
publication title PAS-mediated dimerization of soluble guanylyl cyclase revealed by signal transduction histidine kinase domain crystal structure.
pubmed doi rcsb
source organism Nostoc punctiforme
molecule tags Transferase
total genus 23
structure length 107
sequence length 107
chains with identical sequence B
ec nomenclature ec 2.7.3.-:
pdb deposition date 2007-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07701 HNOBA Heme NO binding associated
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.260 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2p08A00
2P04A 4GJ4A 2P08A
chains in the Genus database with same CATH superfamily
2GNXA 3IHBA 5EVIC 3IBJA 4LPZA 1ES3A 1BT5A 4X68A 1BLHA 3SH7A 4MNRA 4CLCE 1GHPA 2ZOHA 5J8XA 1FIKA 5FI2A 1FQGA 1K57A 1S67L 3R7WA 1S1YA 2IWDA 1K25A 5L07A 1DP6A 2W0NA 1MWRA 3NCKA 3UY6A 3G30A 3CI6A 3LIBA 1YAXA 5CTMA 4Y3IA 1V9ZA 3UB8A 3ZG5A 2HDSA 3SH8A 4X1LA 4ZDXA 2BTFP 3BYDA 1I2WA 3ZHHA 1CEFA 3FPWA 3LY3A 1OMEA 3CPTA 1K6RA 3PAEA 2OWJA 3B42A 1G28A 3TSGA 3UE6A 2OOLA 3K3DA 3OPPA 4E3KA 4XT2B 1PW8A 3LEZA 1IOUA 2BLSA 2Z6DA 4G3KA 2ZL1B 2DRWA 4Y5FA 1L0DA 5FSRA 1FOFA 4EEPA 4PM5A 3QP6A 1D1JA 4EUVA 3FC7A 5TBMB 1K54A 4MBHA 3WRTA 1LT0A 1VHMA 1KOUA 2HGVA 2KDKA 2W1TB 4FH2A 3HL9A 2Y59A 4DXCA 3F1OA 4BLMA 5TR7A 4GB7A 5GHZA 4GHIB 5DJUA 2WKRA 3I7JA 3HBRA 1ERMA 1LSWA 4MBKA 1SDNA 4WMCD 5HDSA 5K5BA 2ZQ9A 2PRFA 1LL9A 2PYRA 3W4QA 4A5RA 2C5WB 5CTNA 4HP4A 2XFSA 3IWQA 3H82A 2J9OA 3H9WA 3V50A 1YM1A 3F1NA 1G6OA 2B95A 3VP1A 3BWLA 1K6SA 3CMZA 2JKRI 2A3UA 3O86A 1S1ZA 4NXEA 2WGVA 5EECA 2R9WA 3VP2A 1LI0A 2ZQCA 5DTKA 5D3OA 5BOHA 4WL9A 2WGWB 3DTIA 4PKYA 3V39A 1K55A 4L0LA 3VFFA 4EBLA 5FEGA 4KG6A 3IH9A 4EQ1A 4RVAA 1MBLA 1YMSA 2ZC6B 3A3JA 4GD8A 1PWCA 4R4RA 4JXVA 4OQIA 3TJZC 3VV4A 1W63M 4BL2A 1CJFA 2W3DA 2B18A 1XP4A 5L09A 2W3HA 1ERQA 1JWZA 5EFWA 3QP5A 4GCZA 4LV1A 3R7WB 1ZG4A 4IBRA 1OTAA 1N9LA 3MKFA 2XF3A 5J3WA 2JKTM 4Y0TA 4CQHA 2PU2A 4OOLA 3SH9A 5M19A 4S2JA 2VLGA 3OLOA 2BG1A 4LFUA 3M2KA 1DP9A 4DN0A 3CPTB 3KO6A 2EX6A 4OH0A 4UA7A 2V1ZA 1GSXA 2EFUA 4IBXA 4FH4A 3ISGA 3CJMA 3TE8A 2V8FA 3O3VA 4OQ0A 3MR0A 4GDBA 5E2HA 3T4JA 1P0ZA 1PWDA 3WS2A 2PR6A 3TW8A 2WAFA 3WRZA 3NJAA 5A92A 3CUEC 2ZMAA 4OP8A 5AQBA 2FZ0A 4OLGA 5LBRA 1ALQA 1L2SA 1NJ4A 4P87A 2ZMFA 2Y2QA 5CGXA 5DJTA 1GA0A 4HESA 5HAPA 5CEDA 3CWFA 4KG2A 2JHEA 1G5UA 4GKUA 3CLOA 3Q7VA 1TD5A 3F1OB 5IU1A 5DVAA 2WKIA 2O9CA 5A93A 2Z6CA 1MZUA 3VP3A 1LL8A 3LEQA 2K2NA 5FQMA 5EUAA 4L9EA 1ESIA 3PYPA 1YT4A 2ZLYA 5EM0A 1T18A 4OVDA 3PBRA 1ZC2A 3Q81A 3W4OA 3PBSA 5HPFA 5F6AA 1DJCA 3H82B 3TRCA 3NHQA 3SS4A 4E3OA 3UDXA 3IWIA 3F1NB 1YSQA 2V8CA 4WMCA 5E2EA 3T4KA 4NK3A 4JKTA 5A91A 3MQ0A 1K57C 4HQAA 4QPRA 3FV7A 2X02A 4KQRA 3CITA 2G2UA 4PM7A 1T1CA 4HIAA 2XA7M 3UB6A 2VGLM 5GLAA 1MY8A 2P9VA 2M7UA 3LYXA 2AVXA 3FYZA 3MXRA 4S2LA 3UDFA 4WUJA 3V3RA 1PNEA 3T50A 2ACGA 2VV6A 3F1PA 3G35A 4E3JA 4EQIA 3MJQA 4ETZA 3LUQA 1K4FA 2HF6A 1W7FA 4MCWA 3FG8A 1YSPA 3LIAA 4QB8A 5TFQA 3C5AA 1QMEA 3BLMA 4JPMA 2PBDP 5CHJA 3UPNA 5HWVA 1L3LA 3S7QA 2L4RA 3IQAA 3H7WA 1PYYA 2ZC5B 1KGEA 2V0UA 4OQHA 1E25A 4BD1A 3LI9A 1L0GA 2B02A 1FSWA 5DFYA 2XA7S 4S2IA 5AQ9A 2L0WA 4KZ9A 4B9OA 2PBYA 4JBFA 4WYYA 2VGLS 2PD7A 5FQIA 5KSHA 2KX6A 2ZC3B 3BFCA 1YKDA 2WK0A 2IA2A 1BUEA 2ZQAA 1EI5A 4S2MA 1BTLA 1ES5A 3ZNYA 4JLFA 4PM6A 3GVBA 3ZDJA 4GZBA 3KX0X 2JC7A 2WKQA 4ZAMA 3UB5P 3S7OA 3RJUA 5DTSA 1PZOA 4S2KA 3T4LA 1MKIA 5FATA 1VETA 5HW3A 5IS1A 1F98A 1DY6A 1BZAA 3AGEA 2QWSA 4UA9A 5G4YA 1HZOA 4FOFA 1KVLA 3Q7VB 1JWVA 2Y4AA 3ZG8B 3HVFA 1W63Q 4O01A 4LV2A 1K55C 1JWPA 4WELA 2VK3A 4Q0HA 1VB6A 4N92A 1NRFA 4RYEA 1VM1A 4OKPA 2M1CA 2B5RA 1PZPA 3LO7A 3L7HA 4HNBA 3IS2A 1NY0A 3UE0A 1ONGA 2O0YA 3UPOA 4BBUA 2Y79A 4X56A 3A0SA 3VOYA 2WKEA 3C7VA 1UGUA 3MFXA 4MN6A 3KSFA 2HDUA 1JTDA 3S22A 3A0RA 1STZA 1Y54A 1KE3A 5F1GA 4K0XA 3ZQ5A 1H5XA 1XA7A 4DDSA 2Y2KA 3GRJA 1HVBA 4OOMA 1H8YA 2H5SA 4KUOA 4ZRRA 4DE3A 3FPVA 3WWXA 2XGNA 1LHYA 2J3TC 5HDDA 2PYPA 3ZVWA 4R0QA 2V20A 3P09A 1YQSA 2P9VB 2HDQA 4JXGA 5AVEA 1NXYA 3GMWA 1ODVA 3F1PB 3VOZA 4ESPA 3SS3A 2H0YA 3VP4A 4UHUA 5I5LA 3A3IA 1G6AA 5L2FA 4JGOA 5DFXA 2PR5A 4I5SA 2X01A 3NDGA 1KGFA 4U3TA 1BULA 2J3TD 3H7WB 4ZTKA 2L1MA 3IWOA 2Y2IA 5HWWA 1NLZA 4XUZA 3WS4A 1SKFA 4C75A 5AQAA 5CGSA 2FFYA 3DAVA 2VX8A 2QPNA 4DDYA 5E2FA 3TOIA 2WADA 4F3LA 4E6WA 3N4IA 5CGWA 2ZJ9A 3M6HA 2V1BA 4YNRA 1MXOA 5G4ZA 4IUHA 2W3EA 3QP1A 3S1YA 3Q82A 3BFFA 1CI9A 1CK3A 4EESA 5KZHA 3AGFA 4H6JA 5FAQA 1YLTA 1LL5A 4Q0JA 3FWLA 1NZUA 4HJ6A 3NIAA 3NDEA 3QHYA 4NG2A 1WA9A 2P04A 2D02A 2D01A 4IUKA 4RQ9A 1VETB 5HZHA 3VP0A 3HLEA 5U47A 3O88A 4HP9A 5A90A 2QHKA 1OTEA 3PBOA 4IJGA 5EPHA 3RXWA 5GLBA 2EWVA 1JVJA 3E2KA 4GS9A 4LRZE 3IXBA 4N9KA 4ID4A 3QNCA 5F83A 4JF4A 2FFFB 4PMAA 4BBVA 2A24A 3K2NA 3CZDA 1ES2A 1V9YA 4IVKA 4KQDA 1K0KA 3VE3A 3BY9A 1DP8A 3IS2B 1MWUA 4Z9QA 2ZBBA 1OJGA 3LIEA 3AGDA 5CERA 1IKIA 5EOOA 3W2ZA 3T4OA 3IHAA 3ZGAB 1RGZA 1S66L 4O7DA 2XH9A 4GJ4A 3C38A 4JGPA 3SS5A 1TEMA 5HX9A 3SZTA 3ZG0A 3OZHA 1ONHA 1TS8A 4XUXA 4RX3A 2HJ9C 5DF8A 2V1AA 4LV0A 3A0VA 1N9NA 3EGDC 2BASA 3PTEA 2KOIA 3K3CA 2UWXA 1JNUA 3BFDA 3V3SA 3OBFA 3MQOA 3E4OA 3NC8A 4N9LA 3LICA 1VEUA 4MBFA 3EEHA 1S4RA 1G68A 3C30A 1Z09A 5HWTA 4OOYA 4R3AA 1RP5A 3QP4A 3DWZA 3EEAA 5FI6A 4WN5A 5F82A 4IHQA 3E0YA 4HJ4A 2J3WA 4GD6A 3GTCA 5GL9A 4S2NA 1YLWA 3G6OA 1CEGA 4ME4A 3OPRA 4OPYA 4LCMA 3D4FA 1E3UD 1TF1A 4B4ZA 3ITBA 3T4QA 4BWIA 4PM8A 3KYQA 2ZMVA 4EW7A 4PPRA 3N8SA 3UNWA 5EOEA 1P97A 4YOFA 1AWIA 5HD3A 2W3FA 3G4PA 3HLFA 5FAOA 1XPBA 5KMWA 4F3LB 2OV5A 4Z1WA 2OAP1 2FH5A 3B47A 1IYPA 2Y2NA 2G7UA 2JKRM 1BYWA 5HSQA 1BLPA 4KUKA 2W3GA 4NKPA 3MXSA 2J7VA 2C6WB 2A2LA 4YFMA 2ZQDA 4L9GA 4H6JB 2YKHA 2H0TA 3OOVA 4B4XA 1DJBA 5FA7A 2VKSA 2OAQ1 3LIDA 3KSGA 1U60A 1F2KA 3UB9A 1NWZA 3LCEA 4HEFA 3EQVA 3WS0A 3HUMA 1S4SA 2VZWA 3ZG7B 1WYBA 3OCNA 4GS9B 4E3MA 5FDSA 4MN5A 5FQQA 2ZC7A 4EUZA 2PD8A 4BJPA 1NRJA 2A24B 3CAXA 2VGJA 3QNBA 2Y2GA 2Y91A 4S2OA 1HD8A 2O9BA 1GHIA 2XR0A 3C4PA 2PAVP 3WS5A 2DCFA 4Y2FA 3VSLA 1MC0A 3NI9A 3GR2A 3T12B 3VOLA 1K4EA 4E04A 2OSUA 2X71A 1L0EA 1XJ2A 1D06A 2R9XA 3IXGA 2Y2HA 2KLIA 2VV7A 5F1FA 1N9OA 3C2WA 1CI8A 4OPZA 1Z6FA 3IXDA 4I39A 4IVIA 2JBFA 1H0MA 4B88A 2RL3A 5HAIA 5E2GA 5KIZA 1YMXA 3ZVTA 2HPBA 4NXBA 1VEUB 4OLDA 4R4SA 1E4DA 2G2WA 1SKOA 5DTTA 3D72A 4PAUA 3ULFA 3MFDA 4G3WA 3OCLA 4WZ5A 1IYSA 3E4PA 4OP5A 4EEUA 5JYPA 4EV4A 1XX2A 4QY5A 5HARA 4K08A 4G3VA 4LLOB 4X6TA 3M6BA 4X53A 3ZNTA 4JXWA 2H28A 4RA7A 2XEPA 3HLGA 3QP8A 4BBTA 3EQUA 1W8YA 4HJ3A 4MMNA 2EXAA 4FTXA 2VA0A 2J8YA 4E3LA 1M40A 2OLUA 2WZZA 1GSVA 5IHVA 4H8RA 3HJIA 3GQZA 4E3IA 4P0MA 5HDCA 1E3UA 4GNUA 3GDIA 5TGFA 5DKLA 1DRMA 1HTZA 4WLAA 4HH3A 3FKWA 2A49A 3KSIA 3IX4A 4KZ6A 1IELA 3NULA 5AJGA 4LRXC 5GHXA 3IH8A 4GDNA 4C6YA 4BD0A 2ZM8A 3DBAA 4PHTA 3TG9A 4DRTA 5A8BA 2Q9MA 1FCOA 4I3IA 3PXPA 4QHCA 1OTBA 4EU0A 3VSKA 4DJ2A 3LGOA 4CJNA 1BLCA 3Q07A 3PBQA 5F5YA 3IF5A 3CHWP 2GZAA 4P6ZM 3A3EA 1KDWA 2OWHA 4M3KA 1W8QA 4CLCD 1YLPA 3MXQA 1MKMA 5AQ7A 1AXBA 1ZG6A 3UO9A 1TDGA 4LENA 5FDHA 4Y15A 1GA9A 2ZQ8A 4R38A 1S6RA 3EWKA 3HLBA 2Y2MA 2E8IA 2Y55A 3HUOA 4M4XA 3E2LA 4FCFA 4S2NC 3DTKA 3JYIA 3PR6A 4DF6A 5I94A 2WGIA 2V9AA 3NY4A 3S7NA 3BLSA 2EFXA 4UA6A 3IX3A 3N7WA 4GN2A 3B33A 4PM9A 2VEAA 2IWBA 3DW0A 4YWZA 1W5DA 1T19A 3NOUC 4P6ZS 2INWA 4GLQA 3BQ8A 4ARZA 3IBRA 1IFQA 1XGJA 1S0WA 4EWFA 5DF7A 2IWCA 1CF0A 3ZFZA 1TS6A 2ZM2A 3UE1A 3MZDA 4XXRA 3Q7ZA 4BQMA 1SKOB 2UV0E 1K56A 3BM6A 2XDMA 4X1MA 1KVMA 4KZ3A 4NXGA 3ZYTA 3FKVA 3ZCZA 3UN7A 4F94A 3UMEA 3W4PA 3HCYA 4Y13A 2E8JA 2YKFA 2XLNA 2Y2OA 2GDNA 2HP5A 2I9VA 4UQIM 3HUNA 2P74A 1F5MA 1PFLA 1RCJA 1H8ZA 3BFGA 2WUQA 1T1AA 4EXOA 4R70A 3D3OA 4UEYA 3BFEA 3SOIA 1TS0A 2EX9A 5HFOA 2RCXA 1IYOA 4QJGA 4BENA 3T1SA 3KYEA 3UMDA 3IF6A 3O5YA 3SW1A 3E98A 4HOIA 2VV8A 1Q2PA 5EVEA 3L9KA 5EVID 1XXMA 1H3QA 2XK1A 2I72A 3M2JA 2M7VA 3OC2A 3UB7A 2EXBA 4JGQA 1PI5A 4UQIS 5CECA 3BEBA 1TDLA 1NYYA 1TS7A 1BSGA 4N1XA 4HBTA 1PRQA 2VGKA 4N1HA 2HP6A 1XJ3A 3S7PA 4E3NA 5L10A 1NYMA 1N9BA 4QY6A 3BW6A 2WYXA 4O8GA 3UE3A 2ZOIA 1IYQA 1XGIA 2Y2PA 3NBLA 3LY4A 4MLLA 4FSFA 4Q8IA 1UWNX 2DNSA 3NOPC 4BMWA 2XD5A 4DE2A 3IXHA 4WZ5C 1Q2QA 2EX2A 5CX7A 5EVLA 5FAPA 4CLCA 5HD5A 3CG5A 4D60A 3BY8A 4MEZA 1W79A 4YINA 3V67A 2PHYA 2JKTI 2QYBA 2O9AA 1ZTUA 3MS6A 1PWGA 2K31A 4HI4A 3G32A 2NUTC 2OLVA 2EX8A 5HPIA 3LR4A 1LSVA 1EWZA 4X55A 4ETXA 5KSCA 4U0TA 5CHUA 5G18A 4E6XA 5CXWA 4KG5A 5HL6A 4ARZB 4NETA 2Y2JA 5M18A 3MF0A 3O87A 3T4TA 4GW9A 1FILA 1D7EA 1KDSA 3VE4A 1JTGA 2P7JA 3KSHA 2MJ6A 1EW0A 1N4OA 4AFIA 1OTIA 1FSYA 1XKZA 1XFQA 2ZD8A 3RH8B 5FASA 3G34A 3A3DA 5M1AA 1Y4OA 4DKIA 5JYOA 3DWKA 4LCLA 3EGXC 4JF6A 2J80A 1SCWA 4R6LA 2P08A 2ZM0A 1NLYA 1SDEA 1KE0A 3RXXA 1OJ5A 1IEMA 3DTEA 4QWOA 4RX2A 1MWSA 2CMNA 2J9PA 3C8CA 5FQJA 1A0KA 4QU3A 4OONA 4DXBA 5HL1A 3IF6B 3MQQA 5CHMA 3QP2A 1VQQA 1OT9A 2ZQ7A 4I3JA 3MKEA 3EOIA 3G31A 3LR5A 5FL3A 1ESUA 4II7A 4JF5A 5EM1A 1PIOA 4DE1A 5CEBA 3GSGA 3P01A 1J9MA 3ITAA 3C7UA 1OTDA 3NOTC 4HHDA 1KE4A 1SHVA 5EE8A 5J7EA 2V2FF 1O07A 2QZ6A 5EVIA 2HJEA 1OPXA 3U2AA 4GOGA 3LIFA 1K38A 4WEJA 4EERA 1ZHHB 3N8LA 4Q0IA 3JPUA 1DJAA 4LV3A 5MC7A 1WYCA 2JCHA 2QKPA 4K0WA 4L9FA 4WBGA 4ZBEA 3HLDA 1T1BA 2K7SA 2NUPC 2R78A 2Q0OA 1MWTA 2PU4A 1P9WA 5EV0A 3G2ZA 4MDZA 4JGRA 2H10A 3RFBA 1PW1A 3BRMA 4P85A 4LRYC 1L0FA 1Y28A 1GCEA 4CLCB 3KYZA 1XA1A 4FUWA 2Z2MB 4I38A 5GLCA 4OPRA 1CQAA 1SZVA 4KZBA 2HZ5A 1I2SA 5FEFA 1XFNA 1MPLA 2HDRA 5J4EA 1K56D 4NEED 3PBTA 4P6BA 4LGWA 3U4LP 3JVUA 3PAGA 3HREA 2Y2LA 3IF6C 4I3AA 4R1GA 4UAAA 3N6IA 2QMIA 1HLUP 2WKPA 4B93A 5FQKA 4KENB 1FCNA 4X69A 2WZXA 4DMZA 3GV9A 3E4QA 5F69A 3R4KA 2JN7A 3V5MA 3VMAA 1J3WA 2V0WA 4BL3A 2W1RA 3PBNA 4ZJ3A 1YLZA 4DJ3A 2HP9A 3RTYA 1XJ4A 1ZKJA 3BQAA 5F68A 5DF9A 1GHMA 3LR3A 4WZ4A 1PI4A 4NXFA 2Z2LB 5FQ9A 2CC1A 1WE4A 3JVVA 5E43A 4QD4A 3UPPA 3UDIA 5FI7A 4HBUA 1YLJA 2LB5A 2VJWA 2DMWA 1X0OA 3PHYA 1ES4A 1K54C 3LFVA 1I5QA 3C4OA 3B3XA 1LLBA 2JKFA 2JKGA 5C5KA 3ICYA 3HLWA 1LSXA 4EBNA 1KGGA 2W27A 3T1XA 4U0XA 3MZEA 3N8RA 3W8KA 1H8MA 4IEDA 2XFTA 5TJJA 2PT7A 3IT9A 4WM9A 5IT5A 2XSSA 2GJ3A 1LI9A 4CLCC 1UWPX 4R23A 4Y17A 1EROA 3IX8A 3T1QB 2Q9NA 3Q1FA 5EVIB 4XT2A 3HLCA 5AVFA 4FD8A 3LI8A 4EETB 1O7EA 5DKKA 4OPQA 4EBPA 2O99A 4WF0A 1GSWA 2ZL1A 1IKGA 5GLDA 4ZJ1A 2QJ7A 4KQOA 2XRNA 4KZ5A 4D2OA 3S4XA 3BJNA 1FR6A 2Y8HA 2JE5A 1NZOA 5TBMA 4Y0UA 3ZG9B 4JXSA 2QJ5A 4MN7A 3MBZA 4R3JA 2W1TA 4S2PA 3MZFA 1YLYA 3WS1A 3NECA 4Y0OA 3OPLA 2HV1A 3D9YA 4GHIA 2EWWA 2ZC4B 3T4SA 1OT6A 3OPHA 1FCMA 3A3FA 5CRFA 1ACFA 3MSHA 1XJ6A 1BLSA 4KZAA 2XD1A 2GX5A 4HH2A 2LB9A 4Y7PA 3T1RA 5GHYA 3GECA 3P98A 2XROA 4PKYG 2WAEA 5L8MA 3CUEA 3MMHA 4R3BA 2PDRA 3LR0A 1C3BA 3DTMA 4ZJ2A 2EA9A 1F9IA 1RGYA 4O0PA 4KZ8A 4KZ4A 3BECA 4X25A 2WGWA 1YPRA 3FZCA 4KQQA 4K91A 4DE0A 3G2YA 4HY8A 4C3QA 4CPKA 3VFHA 2WKHA 5HAQA 4OQGA 1FR1A 3HJKA 1M6KA 3P7NA 1TVFA 4KZ7A 2XQZA 1P9RA 4WEKA 1QMFA
chains in the Genus database with same CATH topology
2GNXA 5HPIA 3LR4A 3IBJA 1LSVA 4LPZA 4ETXA 2O9BA 4CLCE 5HL6A 4Y2FA 4ARZB 3KX0X 2ZOHA 3MF0A 2WKQA 1MC0A 3S7OA 1S67L 3R7WA 1S1YA 3T4TA 4GW9A 3VOLA 3T4LA 1D7EA 3VE4A 1DP6A 2W0NA 4E04A 2P7JA 3KSHA 5IS1A 2MJ6A 3CI6A 3LIBA 1YAXA 1F98A 1EW0A 1XJ2A 4Y3IA 1V9ZA 3UB8A 4AFIA 1OTIA 2QWSA 5G4YA 1D06A 2KLIA 2VV7A 1XFQA 3FPWA 1N9OA 4FOFA 3RH8B 3C2WA 1W63Q 4O01A 4I39A 2OWJA 3B42A 1G28A 4WELA 3UE6A 2OOLA 3K3DA 3EGXC 4Q0HA 1VB6A 2J80A 4R6LA 2M1CA 4XT2B 2P08A 4HNBA 5KIZA 3IS2A 1NLYA 1IOUA 2Z6DA 4G3KA 4NXBA 1OJ5A 2O0YA 4BBUA 2CMNA 2Y79A 3C8CA 4Y5FA 3A0SA 3D72A 4PAUA 3MQQA 3ULFA 4EEPA 4G3WA 1UGUA 3OCLA 3MFXA 1OT9A 4MN6A 3KSFA 4EUVA 4I3JA 3E4PA 4EEUA 5FL3A 3EOIA 3FC7A 3LR5A 5TBMB 4II7A 3A0RA 1LT0A 3P01A 1VHMA 1STZA 1KOUA 4K08A 2HGVA 4G3VA 4LLOB 2KDKA 2W1TB 3ZQ5A 1OTDA 3NOTC 4HHDA 2H28A 3F1OA 5J7EA 4OOMA 4BBTA 4KUOA 4ZRRA 3EQUA 4GHIB 5DJUA 2WKRA 3FPVA 1LSWA 4HJ3A 4MMNA 2J3TC 5HDDA 2PYPA 2VA0A 2HJEA 1OPXA 3U2AA 3LIFA 5HDSA 5K5BA 4WEJA 1GSVA 4EERA 1ZHHB 5AVEA 2PYRA 4Q0IA 3HJIA 1ODVA 3F1PB 5HDCA 5MC7A 3GDIA 4HP4A 2QKPA 4L9FA 3H82A 5DKLA 3H9WA 1DRMA 4WLAA 5I5LA 4HH3A 1T1BA 2K7SA 2NUPC 3F1NA 2R78A 1G6OA 3BWLA 3KSIA 4JGOA 5DFXA 2JKRI 2PR5A 4I5SA 1P9WA 1S1ZA 4NXEA 4MDZA 4JGRA 2J3TD 5AJGA 3H7WB 4LRXC 3RFBA 2L1MA 5HWWA 1NLZA 4WL9A 4PKYA 4LRYC 3DBAA 4PHTA 1Y28A 4L0LA 4CLCB 5A8BA 3KYZA 4I3IA 4I38A 2VX8A 3PXPA 4EQ1A 1OTBA 4F3LA 4EU0A 2V1BA 4YNRA 1XFNA 4DJ2A 5G4ZA 4IUHA 3PBQA 3TJZC 2W3EA 5F5YA 5J4EA 3VV4A 1W63M 2W3DA 2GZAA 4P6ZM 2B18A 4EESA 4H6JA 2OWHA 2W3HA 4Q0JA 4CLCD 5EFWA 3MXQA 1MKMA 4HJ6A 4NEED 4GCZA 1WA9A 3PBTA 2P04A 2D02A 2D01A 3R7WB 4IUKA 3JVUA 4RQ9A 1OTAA 1N9LA 4R38A 5HZHA 4I3AA 3EWKA 2WKPA 5J3WA 2JKTM 4HP9A 4B93A 2QHKA 4CQHA 4M4XA 1OTEA 4OOLA 3PBOA 4IJGA 4DMZA 3E4QA 2VLGA 3OLOA 5F69A 2EWVA 3R4KA 2JN7A 4GS9A 4LRZE 3PR6A 2V0WA 1DP9A 2V9AA 4DN0A 3S7NA 2W1RA 3PBNA 4BBVA 3KO6A 4DJ3A 2A24A 3K2NA 3B33A 3RTYA 1XJ4A 2VEAA 1GSXA 3BQAA 4YWZA 5F68A 5DF9A 1T19A 3LR3A 1V9YA 4NXFA 3NOUC 4KQDA 3TE8A 4P6ZS 2INWA 3VE3A 4GLQA 3BY9A 3MR0A 1DP8A 3BQ8A 3IS2B 4ARZA 3IBRA 1IFQA 3T4JA 1P0ZA 3JVVA 2PR6A 2ZBBA 3TW8A 1TS6A 3NJAA 1OJGA 3LIEA 3CUEC 2LB5A 2VJWA 2DMWA 1X0OA 2FZ0A 3PHYA 5LBRA 3W2ZA 3T4OA 2ZMFA 1S66L 3LFVA 4GJ4A 5DJTA 3C38A 4JGPA 4NXGA 3ZYTA 3CWFA 5C5KA 2JHEA 3ICYA 3UMEA 1LSXA 1TS8A 3HCYA 2HJ9C 2YKFA 2V1AA 2W27A 3CLOA 3A0VA 1H8MA 5TJJA 1N9NA 2PT7A 1TD5A 3EGDC 5IT5A 2XSSA 3F1OB 2GJ3A 5IU1A 2I9VA 2BASA 4CLCC 2O9CA 4UQIM 1UWPX 2KOIA 2Z6CA 1F5MA 1MZUA 3K3CA 1LL8A 1JNUA 1T1AA 4EXOA 3OBFA 4R70A 3D3OA 2K2NA 3MQOA 4XT2A 4UEYA 3E4OA 4L9EA 3LICA 5AVFA 3PYPA 3LI8A 4EETB 5DKKA 3EEHA 1T18A 1S4RA 1TS0A 3PBRA 3C30A 2O99A 3PBSA 4WF0A 1GSWA 5HPFA 5F6AA 5HWTA 3H82B 4R3AA 3TRCA 3NHQA 2QJ7A 4KQOA 2XRNA 3EEAA 3UMDA 3BJNA 3F1NB 1YSQA 2Y8HA 3O5YA 4WN5A 3SW1A 3E98A 4HOIA 2VV8A 3T4KA 4IHQA 5TBMA 3E0YA 3MQ0A 4HQAA 2QJ5A 4MN7A 4QPRA 4HJ4A 2J3WA 1H3QA 3G6OA 2W1TA 4ME4A 3CITA 2M7VA 3OC2A 3UB7A 1T1CA 4HIAA 1TF1A 2XA7M 3T4QA 2HV1A 4BWIA 4GHIA 4JGQA 2EWWA 4UQIS 3KYQA 3T4SA 1OT6A 2ZMVA 4EW7A 3UB6A 2VGLM 1P97A 4YOFA 1XJ6A 1TS7A 5HD3A 2W3FA 2M7UA 3LYXA 4WUJA 4F3LB 3T50A 2GX5A 2VV6A 4HH2A 3F1PA 2LB9A 4Z1WA 2OAP1 3MJQA 4ETZA 2FH5A 3LUQA 3B47A 3GECA 2XROA 2HF6A 4PKYG 1XJ3A 2G7UA 2JKRM 4MCWA 1BYWA 5HSQA 5L8MA 3CUEA 3FG8A 4KUKA 1YSPA 2W3GA 3LIAA 3MMHA 2PDRA 3S7PA 4NKPA 2A2LA 4L9GA 3LR0A 4H6JB 2YKHA 3BW6A 4O8GA 3UE3A 2ZOIA 3OOVA 5HWVA 4FSFA 3S7QA 2EA9A 2L4RA 1F9IA 3H7WA 4O0PA 1UWNX 2VKSA 3NOPC 4BMWA 2OAQ1 2V0UA 3LIDA 3KSGA 3UB9A 3LI9A 2B02A 1NWZA 5DFYA 2XA7S 5CX7A 4CLCA 2L0WA 3EQVA 5HD5A 3BY8A 4B9OA 4HY8A 1S4SA 2VZWA 2VGLS 3V67A 2PD7A 3OCNA 2PHYA 5KSHA 4GS9B 2JKTI 2QYBA 2KX6A 2O9AA 1ZTUA 3HJKA 4MN5A 3P7NA 1YKDA 2IA2A 2PD8A 1P9RA 4BJPA 4WEKA 2K31A 1NRJA 4HI4A 2A24B 2NUTC 3CAXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P04 A;  4GJ4 A;  2P08 A; 
#chains in the Genus database with same CATH topology
 2GNX A;  3IHB A;  5EVI C;  3IBJ A;  4LPZ A;  1ES3 A;  1BT5 A;  4X68 A;  1BLH A;  3SH7 A;  4MNR A;  4CLC E;  1GHP A;  2ZOH A;  5J8X A;  1FIK A;  5FI2 A;  1FQG A;  1K57 A;  1S67 L;  3R7W A;  1S1Y A;  2IWD A;  1K25 A;  5L07 A;  1DP6 A;  2W0N A;  1MWR A;  3NCK A;  3UY6 A;  3G30 A;  3CI6 A;  3LIB A;  1YAX A;  5CTM A;  4Y3I A;  1V9Z A;  3UB8 A;  3ZG5 A;  2HDS A;  3SH8 A;  4X1L A;  4ZDX A;  2BTF P;  3BYD A;  1I2W A;  3ZHH A;  1CEF A;  3FPW A;  3LY3 A;  1OME A;  3CPT A;  1K6R A;  3PAE A;  2OWJ A;  3B42 A;  1G28 A;  3TSG A;  3UE6 A;  2OOL A;  3K3D A;  3OPP A;  4E3K A;  4XT2 B;  1PW8 A;  3LEZ A;  1IOU A;  2BLS A;  2Z6D A;  4G3K A;  2ZL1 B;  2DRW A;  4Y5F A;  1L0D A;  5FSR A;  1FOF A;  4EEP A;  4PM5 A;  3QP6 A;  1D1J A;  4EUV A;  3FC7 A;  5TBM B;  1K54 A;  4MBH A;  3WRT A;  1LT0 A;  1VHM A;  1KOU A;  2HGV A;  2KDK A;  2W1T B;  4FH2 A;  3HL9 A;  2Y59 A;  4DXC A;  3F1O A;  4BLM A;  5TR7 A;  4GB7 A;  5GHZ A;  4GHI B;  5DJU A;  2WKR A;  3I7J A;  3HBR A;  1ERM A;  1LSW A;  4MBK A;  1SDN A;  4WMC D;  5HDS A;  5K5B A;  2ZQ9 A;  2PRF A;  1LL9 A;  2PYR A;  3W4Q A;  4A5R A;  2C5W B;  5CTN A;  4HP4 A;  2XFS A;  3IWQ A;  3H82 A;  2J9O A;  3H9W A;  3V50 A;  1YM1 A;  3F1N A;  1G6O A;  2B95 A;  3VP1 A;  3BWL A;  1K6S A;  3CMZ A;  2JKR I;  2A3U A;  3O86 A;  1S1Z A;  4NXE A;  2WGV A;  5EEC A;  2R9W A;  3VP2 A;  1LI0 A;  2ZQC A;  5DTK A;  5D3O A;  5BOH A;  4WL9 A;  2WGW B;  3DTI A;  4PKY A;  3V39 A;  1K55 A;  4L0L A;  3VFF A;  4EBL A;  5FEG A;  4KG6 A;  3IH9 A;  4EQ1 A;  4RVA A;  1MBL A;  1YMS A;  2ZC6 B;  3A3J A;  4GD8 A;  1PWC A;  4R4R A;  4JXV A;  4OQI A;  3TJZ C;  3VV4 A;  1W63 M;  4BL2 A;  1CJF A;  2W3D A;  2B18 A;  1XP4 A;  5L09 A;  2W3H A;  1ERQ A;  1JWZ A;  5EFW A;  3QP5 A;  4GCZ A;  4LV1 A;  3R7W B;  1ZG4 A;  4IBR A;  1OTA A;  1N9L A;  3MKF A;  2XF3 A;  5J3W A;  2JKT M;  4Y0T A;  4CQH A;  2PU2 A;  4OOL A;  3SH9 A;  5M19 A;  4S2J A;  2VLG A;  3OLO A;  2BG1 A;  4LFU A;  3M2K A;  1DP9 A;  4DN0 A;  3CPT B;  3KO6 A;  2EX6 A;  4OH0 A;  4UA7 A;  2V1Z A;  1GSX A;  2EFU A;  4IBX A;  4FH4 A;  3ISG A;  3CJM A;  3TE8 A;  2V8F A;  3O3V A;  4OQ0 A;  3MR0 A;  4GDB A;  5E2H A;  3T4J A;  1P0Z A;  1PWD A;  3WS2 A;  2PR6 A;  3TW8 A;  2WAF A;  3WRZ A;  3NJA A;  5A92 A;  3CUE C;  2ZMA A;  4OP8 A;  5AQB A;  2FZ0 A;  4OLG A;  5LBR A;  1ALQ A;  1L2S A;  1NJ4 A;  4P87 A;  2ZMF A;  2Y2Q A;  5CGX A;  5DJT A;  1GA0 A;  4HES A;  5HAP A;  5CED A;  3CWF A;  4KG2 A;  2JHE A;  1G5U A;  4GKU A;  3CLO A;  3Q7V A;  1TD5 A;  3F1O B;  5IU1 A;  5DVA A;  2WKI A;  2O9C A;  5A93 A;  2Z6C A;  1MZU A;  3VP3 A;  1LL8 A;  3LEQ A;  2K2N A;  5FQM A;  5EUA A;  4L9E A;  1ESI A;  3PYP A;  1YT4 A;  2ZLY A;  5EM0 A;  1T18 A;  4OVD A;  3PBR A;  1ZC2 A;  3Q81 A;  3W4O A;  3PBS A;  5HPF A;  5F6A A;  1DJC A;  3H82 B;  3TRC A;  3NHQ A;  3SS4 A;  4E3O A;  3UDX A;  3IWI A;  3F1N B;  1YSQ A;  2V8C A;  4WMC A;  5E2E A;  3T4K A;  4NK3 A;  4JKT A;  5A91 A;  3MQ0 A;  1K57 C;  4HQA A;  4QPR A;  3FV7 A;  2X02 A;  4KQR A;  3CIT A;  2G2U A;  4PM7 A;  1T1C A;  4HIA A;  2XA7 M;  3UB6 A;  2VGL M;  5GLA A;  1MY8 A;  2P9V A;  2M7U A;  3LYX A;  2AVX A;  3FYZ A;  3MXR A;  4S2L A;  3UDF A;  4WUJ A;  3V3R A;  1PNE A;  3T50 A;  2ACG A;  2VV6 A;  3F1P A;  3G35 A;  4E3J A;  4EQI A;  3MJQ A;  4ETZ A;  3LUQ A;  1K4F A;  2HF6 A;  1W7F A;  4MCW A;  3FG8 A;  1YSP A;  3LIA A;  4QB8 A;  5TFQ A;  3C5A A;  1QME A;  3BLM A;  4JPM A;  2PBD P;  5CHJ A;  3UPN A;  5HWV A;  1L3L A;  3S7Q A;  2L4R A;  3IQA A;  3H7W A;  1PYY A;  2ZC5 B;  1KGE A;  2V0U A;  4OQH A;  1E25 A;  4BD1 A;  3LI9 A;  1L0G A;  2B02 A;  1FSW A;  5DFY A;  2XA7 S;  4S2I A;  5AQ9 A;  2L0W A;  4KZ9 A;  4B9O A;  2PBY A;  4JBF A;  4WYY A;  2VGL S;  2PD7 A;  5FQI A;  5KSH A;  2KX6 A;  2ZC3 B;  3BFC A;  1YKD A;  2WK0 A;  2IA2 A;  1BUE A;  2ZQA A;  1EI5 A;  4S2M A;  1BTL A;  1ES5 A;  3ZNY A;  4JLF A;  4PM6 A;  3GVB A;  3ZDJ A;  4GZB A;  3KX0 X;  2JC7 A;  2WKQ A;  4ZAM A;  3UB5 P;  3S7O A;  3RJU A;  5DTS A;  1PZO A;  4S2K A;  3T4L A;  1MKI A;  5FAT A;  1VET A;  5HW3 A;  5IS1 A;  1F98 A;  1DY6 A;  1BZA A;  3AGE A;  2QWS A;  4UA9 A;  5G4Y A;  1HZO A;  4FOF A;  1KVL A;  3Q7V B;  1JWV A;  2Y4A A;  3ZG8 B;  3HVF A;  1W63 Q;  4O01 A;  4LV2 A;  1K55 C;  1JWP A;  4WEL A;  2VK3 A;  4Q0H A;  1VB6 A;  4N92 A;  1NRF A;  4RYE A;  1VM1 A;  4OKP A;  2M1C A;  2B5R A;  1PZP A;  3LO7 A;  3L7H A;  4HNB A;  3IS2 A;  1NY0 A;  3UE0 A;  1ONG A;  2O0Y A;  3UPO A;  4BBU A;  2Y79 A;  4X56 A;  3A0S A;  3VOY A;  2WKE A;  3C7V A;  1UGU A;  3MFX A;  4MN6 A;  3KSF A;  2HDU A;  1JTD A;  3S22 A;  3A0R A;  1STZ A;  1Y54 A;  1KE3 A;  5F1G A;  4K0X A;  3ZQ5 A;  1H5X A;  1XA7 A;  4DDS A;  2Y2K A;  3GRJ A;  1HVB A;  4OOM A;  1H8Y A;  2H5S A;  4KUO A;  4ZRR A;  4DE3 A;  3FPV A;  3WWX A;  2XGN A;  1LHY A;  2J3T C;  5HDD A;  2PYP A;  3ZVW A;  4R0Q A;  2V20 A;  3P09 A;  1YQS A;  2P9V B;  2HDQ A;  4JXG A;  5AVE A;  1NXY A;  3GMW A;  1ODV A;  3F1P B;  3VOZ A;  4ESP A;  3SS3 A;  2H0Y A;  3VP4 A;  4UHU A;  5I5L A;  3A3I A;  1G6A A;  5L2F A;  4JGO A;  5DFX A;  2PR5 A;  4I5S A;  2X01 A;  3NDG A;  1KGF A;  4U3T A;  1BUL A;  2J3T D;  3H7W B;  4ZTK A;  2L1M A;  3IWO A;  2Y2I A;  5HWW A;  1NLZ A;  4XUZ A;  3WS4 A;  1SKF A;  4C75 A;  5AQA A;  5CGS A;  2FFY A;  3DAV A;  2VX8 A;  2QPN A;  4DDY A;  5E2F A;  3TOI A;  2WAD A;  4F3L A;  4E6W A;  3N4I A;  5CGW A;  2ZJ9 A;  3M6H A;  2V1B A;  4YNR A;  1MXO A;  5G4Z A;  4IUH A;  2W3E A;  3QP1 A;  3S1Y A;  3Q82 A;  3BFF A;  1CI9 A;  1CK3 A;  4EES A;  5KZH A;  3AGF A;  4H6J A;  5FAQ A;  1YLT A;  1LL5 A;  4Q0J A;  3FWL A;  1NZU A;  4HJ6 A;  3NIA A;  3NDE A;  3QHY A;  4NG2 A;  1WA9 A;  2P04 A;  2D02 A;  2D01 A;  4IUK A;  4RQ9 A;  1VET B;  5HZH A;  3VP0 A;  3HLE A;  5U47 A;  3O88 A;  4HP9 A;  5A90 A;  2QHK A;  1OTE A;  3PBO A;  4IJG A;  5EPH A;  3RXW A;  5GLB A;  2EWV A;  1JVJ A;  3E2K A;  4GS9 A;  4LRZ E;  3IXB A;  4N9K A;  4ID4 A;  3QNC A;  5F83 A;  4JF4 A;  2FFF B;  4PMA A;  4BBV A;  2A24 A;  3K2N A;  3CZD A;  1ES2 A;  1V9Y A;  4IVK A;  4KQD A;  1K0K A;  3VE3 A;  3BY9 A;  1DP8 A;  3IS2 B;  1MWU A;  4Z9Q A;  2ZBB A;  1OJG A;  3LIE A;  3AGD A;  5CER A;  1IKI A;  5EOO A;  3W2Z A;  3T4O A;  3IHA A;  3ZGA B;  1RGZ A;  1S66 L;  4O7D A;  2XH9 A;  4GJ4 A;  3C38 A;  4JGP A;  3SS5 A;  1TEM A;  5HX9 A;  3SZT A;  3ZG0 A;  3OZH A;  1ONH A;  1TS8 A;  4XUX A;  4RX3 A;  2HJ9 C;  5DF8 A;  2V1A A;  4LV0 A;  3A0V A;  1N9N A;  3EGD C;  2BAS A;  3PTE A;  2KOI A;  3K3C A;  2UWX A;  1JNU A;  3BFD A;  3V3S A;  3OBF A;  3MQO A;  3E4O A;  3NC8 A;  4N9L A;  3LIC A;  1VEU A;  4MBF A;  3EEH A;  1S4R A;  1G68 A;  3C30 A;  1Z09 A;  5HWT A;  4OOY A;  4R3A A;  1RP5 A;  3QP4 A;  3DWZ A;  3EEA A;  5FI6 A;  4WN5 A;  5F82 A;  4IHQ A;  3E0Y A;  4HJ4 A;  2J3W A;  4GD6 A;  3GTC A;  5GL9 A;  4S2N A;  1YLW A;  3G6O A;  1CEG A;  4ME4 A;  3OPR A;  4OPY A;  4LCM A;  3D4F A;  1E3U D;  1TF1 A;  4B4Z A;  3ITB A;  3T4Q A;  4BWI A;  4PM8 A;  3KYQ A;  2ZMV A;  4EW7 A;  4PPR A;  3N8S A;  3UNW A;  5EOE A;  1P97 A;  4YOF A;  1AWI A;  5HD3 A;  2W3F A;  3G4P A;  3HLF A;  5FAO A;  1XPB A;  5KMW A;  4F3L B;  2OV5 A;  4Z1W A;  2OAP 1;  2FH5 A;  3B47 A;  1IYP A;  2Y2N A;  2G7U A;  2JKR M;  1BYW A;  5HSQ A;  1BLP A;  4KUK A;  2W3G A;  4NKP A;  3MXS A;  2J7V A;  2C6W B;  2A2L A;  4YFM A;  2ZQD A;  4L9G A;  4H6J B;  2YKH A;  2H0T A;  3OOV A;  4B4X A;  1DJB A;  5FA7 A;  2VKS A;  2OAQ 1;  3LID A;  3KSG A;  1U60 A;  1F2K A;  3UB9 A;  1NWZ A;  3LCE A;  4HEF A;  3EQV A;  3WS0 A;  3HUM A;  1S4S A;  2VZW A;  3ZG7 B;  1WYB A;  3OCN A;  4GS9 B;  4E3M A;  5FDS A;  4MN5 A;  5FQQ A;  2ZC7 A;  4EUZ A;  2PD8 A;  4BJP A;  1NRJ A;  2A24 B;  3CAX A;  2VGJ A;  3QNB A;  2Y2G A;  2Y91 A;  4S2O A;  1HD8 A;  2O9B A;  1GHI A;  2XR0 A;  3C4P A;  2PAV P;  3WS5 A;  2DCF A;  4Y2F A;  3VSL A;  1MC0 A;  3NI9 A;  3GR2 A;  3T12 B;  3VOL A;  1K4E A;  4E04 A;  2OSU A;  2X71 A;  1L0E A;  1XJ2 A;  1D06 A;  2R9X A;  3IXG A;  2Y2H A;  2KLI A;  2VV7 A;  5F1F A;  1N9O A;  3C2W A;  1CI8 A;  4OPZ A;  1Z6F A;  3IXD A;  4I39 A;  4IVI A;  2JBF A;  1H0M A;  4B88 A;  2RL3 A;  5HAI A;  5E2G A;  5KIZ A;  1YMX A;  3ZVT A;  2HPB A;  4NXB A;  1VEU B;  4OLD A;  4R4S A;  1E4D A;  2G2W A;  1SKO A;  5DTT A;  3D72 A;  4PAU A;  3ULF A;  3MFD A;  4G3W A;  3OCL A;  4WZ5 A;  1IYS A;  3E4P A;  4OP5 A;  4EEU A;  5JYP A;  4EV4 A;  1XX2 A;  4QY5 A;  5HAR A;  4K08 A;  4G3V A;  4LLO B;  4X6T A;  3M6B A;  4X53 A;  3ZNT A;  4JXW A;  2H28 A;  4RA7 A;  2XEP A;  3HLG A;  3QP8 A;  4BBT A;  3EQU A;  1W8Y A;  4HJ3 A;  4MMN A;  2EXA A;  4FTX A;  2VA0 A;  2J8Y A;  4E3L A;  1M40 A;  2OLU A;  2WZZ A;  1GSV A;  5IHV A;  4H8R A;  3HJI A;  3GQZ A;  4E3I A;  4P0M A;  5HDC A;  1E3U A;  4GNU A;  3GDI A;  5TGF A;  5DKL A;  1DRM A;  1HTZ A;  4WLA A;  4HH3 A;  3FKW A;  2A49 A;  3KSI A;  3IX4 A;  4KZ6 A;  1IEL A;  3NUL A;  5AJG A;  4LRX C;  5GHX A;  3IH8 A;  4GDN A;  4C6Y A;  4BD0 A;  2ZM8 A;  3DBA A;  4PHT A;  3TG9 A;  4DRT A;  5A8B A;  2Q9M A;  1FCO A;  4I3I A;  3PXP A;  4QHC A;  1OTB A;  4EU0 A;  3VSK A;  4DJ2 A;  3LGO A;  4CJN A;  1BLC A;  3Q07 A;  3PBQ A;  5F5Y A;  3IF5 A;  3CHW P;  2GZA A;  4P6Z M;  3A3E A;  1KDW A;  2OWH A;  4M3K A;  1W8Q A;  4CLC D;  1YLP A;  3MXQ A;  1MKM A;  5AQ7 A;  1AXB A;  1ZG6 A;  3UO9 A;  1TDG A;  4LEN A;  5FDH A;  4Y15 A;  1GA9 A;  2ZQ8 A;  4R38 A;  1S6R A;  3EWK A;  3HLB A;  2Y2M A;  2E8I A;  2Y55 A;  3HUO A;  4M4X A;  3E2L A;  4FCF A;  4S2N C;  3DTK A;  3JYI A;  3PR6 A;  4DF6 A;  5I94 A;  2WGI A;  2V9A A;  3NY4 A;  3S7N A;  3BLS A;  2EFX A;  4UA6 A;  3IX3 A;  3N7W A;  4GN2 A;  3B33 A;  4PM9 A;  2VEA A;  2IWB A;  3DW0 A;  4YWZ A;  1W5D A;  1T19 A;  3NOU C;  4P6Z S;  2INW A;  4GLQ A;  3BQ8 A;  4ARZ A;  3IBR A;  1IFQ A;  1XGJ A;  1S0W A;  4EWF A;  5DF7 A;  2IWC A;  1CF0 A;  3ZFZ A;  1TS6 A;  2ZM2 A;  3UE1 A;  3MZD A;  4XXR A;  3Q7Z A;  4BQM A;  1SKO B;  2UV0 E;  1K56 A;  3BM6 A;  2XDM A;  4X1M A;  1KVM A;  4KZ3 A;  4NXG A;  3ZYT A;  3FKV A;  3ZCZ A;  3UN7 A;  4F94 A;  3UME A;  3W4P A;  3HCY A;  4Y13 A;  2E8J A;  2YKF A;  2XLN A;  2Y2O A;  2GDN A;  2HP5 A;  2I9V A;  4UQI M;  3HUN A;  2P74 A;  1F5M A;  1PFL A;  1RCJ A;  1H8Z A;  3BFG A;  2WUQ A;  1T1A A;  4EXO A;  4R70 A;  3D3O A;  4UEY A;  3BFE A;  3SOI A;  1TS0 A;  2EX9 A;  5HFO A;  2RCX A;  1IYO A;  4QJG A;  4BEN A;  3T1S A;  3KYE A;  3UMD A;  3IF6 A;  3O5Y A;  3SW1 A;  3E98 A;  4HOI A;  2VV8 A;  1Q2P A;  5EVE A;  3L9K A;  5EVI D;  1XXM A;  1H3Q A;  2XK1 A;  2I72 A;  3M2J A;  2M7V A;  3OC2 A;  3UB7 A;  2EXB A;  4JGQ A;  1PI5 A;  4UQI S;  5CEC A;  3BEB A;  1TDL A;  1NYY A;  1TS7 A;  1BSG A;  4N1X A;  4HBT A;  1PRQ A;  2VGK A;  4N1H A;  2HP6 A;  1XJ3 A;  3S7P A;  4E3N A;  5L10 A;  1NYM A;  1N9B A;  4QY6 A;  3BW6 A;  2WYX A;  4O8G A;  3UE3 A;  2ZOI A;  1IYQ A;  1XGI A;  2Y2P A;  3NBL A;  3LY4 A;  4MLL A;  4FSF A;  4Q8I A;  1UWN X;  2DNS A;  3NOP C;  4BMW A;  2XD5 A;  4DE2 A;  3IXH A;  4WZ5 C;  1Q2Q A;  2EX2 A;  5CX7 A;  5EVL A;  5FAP A;  4CLC A;  5HD5 A;  3CG5 A;  4D60 A;  3BY8 A;  4MEZ A;  1W79 A;  4YIN A;  3V67 A;  2PHY A;  2JKT I;  2QYB A;  2O9A A;  1ZTU A;  3MS6 A;  1PWG A;  2K31 A;  4HI4 A;  3G32 A;  2NUT C;  2OLV A;  2EX8 A;  5HPI A;  3LR4 A;  1LSV A;  1EWZ A;  4X55 A;  4ETX A;  5KSC A;  4U0T A;  5CHU A;  5G18 A;  4E6X A;  5CXW A;  4KG5 A;  5HL6 A;  4ARZ B;  4NET A;  2Y2J A;  5M18 A;  3MF0 A;  3O87 A;  3T4T A;  4GW9 A;  1FIL A;  1D7E A;  1KDS A;  3VE4 A;  1JTG A;  2P7J A;  3KSH A;  2MJ6 A;  1EW0 A;  1N4O A;  4AFI A;  1OTI A;  1FSY A;  1XKZ A;  1XFQ A;  2ZD8 A;  3RH8 B;  5FAS A;  3G34 A;  3A3D A;  5M1A A;  1Y4O A;  4DKI A;  5JYO A;  3DWK A;  4LCL A;  3EGX C;  4JF6 A;  2J80 A;  1SCW A;  4R6L A;  2P08 A;  2ZM0 A;  1NLY A;  1SDE A;  1KE0 A;  3RXX A;  1OJ5 A;  1IEM A;  3DTE A;  4QWO A;  4RX2 A;  1MWS A;  2CMN A;  2J9P A;  3C8C A;  5FQJ A;  1A0K A;  4QU3 A;  4OON A;  4DXB A;  5HL1 A;  3IF6 B;  3MQQ A;  5CHM A;  3QP2 A;  1VQQ A;  1OT9 A;  2ZQ7 A;  4I3J A;  3MKE A;  3EOI A;  3G31 A;  3LR5 A;  5FL3 A;  1ESU A;  4II7 A;  4JF5 A;  5EM1 A;  1PIO A;  4DE1 A;  5CEB A;  3GSG A;  3P01 A;  1J9M A;  3ITA A;  3C7U A;  1OTD A;  3NOT C;  4HHD A;  1KE4 A;  1SHV A;  5EE8 A;  5J7E A;  2V2F F;  1O07 A;  2QZ6 A;  5EVI A;  2HJE A;  1OPX A;  3U2A A;  4GOG A;  3LIF A;  1K38 A;  4WEJ A;  4EER A;  1ZHH B;  3N8L A;  4Q0I A;  3JPU A;  1DJA A;  4LV3 A;  5MC7 A;  1WYC A;  2JCH A;  2QKP A;  4K0W A;  4L9F A;  4WBG A;  4ZBE A;  3HLD A;  1T1B A;  2K7S A;  2NUP C;  2R78 A;  2Q0O A;  1MWT A;  2PU4 A;  1P9W A;  5EV0 A;  3G2Z A;  4MDZ A;  4JGR A;  2H10 A;  3RFB A;  1PW1 A;  3BRM A;  4P85 A;  4LRY C;  1L0F A;  1Y28 A;  1GCE A;  4CLC B;  3KYZ A;  1XA1 A;  4FUW A;  2Z2M B;  4I38 A;  5GLC A;  4OPR A;  1CQA A;  1SZV A;  4KZB A;  2HZ5 A;  1I2S A;  5FEF A;  1XFN A;  1MPL A;  2HDR A;  5J4E A;  1K56 D;  4NEE D;  3PBT A;  4P6B A;  4LGW A;  3U4L P;  3JVU A;  3PAG A;  3HRE A;  2Y2L A;  3IF6 C;  4I3A A;  4R1G A;  4UAA A;  3N6I A;  2QMI A;  1HLU P;  2WKP A;  4B93 A;  5FQK A;  4KEN B;  1FCN A;  4X69 A;  2WZX A;  4DMZ A;  3GV9 A;  3E4Q A;  5F69 A;  3R4K A;  2JN7 A;  3V5M A;  3VMA A;  1J3W A;  2V0W A;  4BL3 A;  2W1R A;  3PBN A;  4ZJ3 A;  1YLZ A;  4DJ3 A;  2HP9 A;  3RTY A;  1XJ4 A;  1ZKJ A;  3BQA A;  5F68 A;  5DF9 A;  1GHM A;  3LR3 A;  4WZ4 A;  1PI4 A;  4NXF A;  2Z2L B;  5FQ9 A;  2CC1 A;  1WE4 A;  3JVV A;  5E43 A;  4QD4 A;  3UPP A;  3UDI A;  5FI7 A;  4HBU A;  1YLJ A;  2LB5 A;  2VJW A;  2DMW A;  1X0O A;  3PHY A;  1ES4 A;  1K54 C;  3LFV A;  1I5Q A;  3C4O A;  3B3X A;  1LLB A;  2JKF A;  2JKG A;  5C5K A;  3ICY A;  3HLW A;  1LSX A;  4EBN A;  1KGG A;  2W27 A;  3T1X A;  4U0X A;  3MZE A;  3N8R A;  3W8K A;  1H8M A;  4IED A;  2XFT A;  5TJJ A;  2PT7 A;  3IT9 A;  4WM9 A;  5IT5 A;  2XSS A;  2GJ3 A;  1LI9 A;  4CLC C;  1UWP X;  4R23 A;  4Y17 A;  1ERO A;  3IX8 A;  3T1Q B;  2Q9N A;  3Q1F A;  5EVI B;  4XT2 A;  3HLC A;  5AVF A;  4FD8 A;  3LI8 A;  4EET B;  1O7E A;  5DKK A;  4OPQ A;  4EBP A;  2O99 A;  4WF0 A;  1GSW A;  2ZL1 A;  1IKG A;  5GLD A;  4ZJ1 A;  2QJ7 A;  4KQO A;  2XRN A;  4KZ5 A;  4D2O A;  3S4X A;  3BJN A;  1FR6 A;  2Y8H A;  2JE5 A;  1NZO A;  5TBM A;  4Y0U A;  3ZG9 B;  4JXS A;  2QJ5 A;  4MN7 A;  3MBZ A;  4R3J A;  2W1T A;  4S2P A;  3MZF A;  1YLY A;  3WS1 A;  3NEC A;  4Y0O A;  3OPL A;  2HV1 A;  3D9Y A;  4GHI A;  2EWW A;  2ZC4 B;  3T4S A;  1OT6 A;  3OPH A;  1FCM A;  3A3F A;  5CRF A;  1ACF A;  3MSH A;  1XJ6 A;  1BLS A;  4KZA A;  2XD1 A;  2GX5 A;  4HH2 A;  2LB9 A;  4Y7P A;  3T1R A;  5GHY A;  3GEC A;  3P98 A;  2XRO A;  4PKY G;  2WAE A;  5L8M A;  3CUE A;  3MMH A;  4R3B A;  2PDR A;  3LR0 A;  1C3B A;  3DTM A;  4ZJ2 A;  2EA9 A;  1F9I A;  1RGY A;  4O0P A;  4KZ8 A;  4KZ4 A;  3BEC A;  4X25 A;  2WGW A;  1YPR A;  3FZC A;  4KQQ A;  4K91 A;  4DE0 A;  3G2Y A;  4HY8 A;  4C3Q A;  4CPK A;  3VFH A;  2WKH A;  5HAQ A;  4OQG A;  1FR1 A;  3HJK A;  1M6K A;  3P7N A;  1TVF A;  4KZ7 A;  2XQZ A;  1P9R A;  4WEK A;  1QMF A; 
#chains in the Genus database with same CATH homology
 2GNX A;  5HPI A;  3LR4 A;  3IBJ A;  1LSV A;  4LPZ A;  4ETX A;  2O9B A;  4CLC E;  5HL6 A;  4Y2F A;  4ARZ B;  3KX0 X;  2ZOH A;  3MF0 A;  2WKQ A;  1MC0 A;  3S7O A;  1S67 L;  3R7W A;  1S1Y A;  3T4T A;  4GW9 A;  3VOL A;  3T4L A;  1D7E A;  3VE4 A;  1DP6 A;  2W0N A;  4E04 A;  2P7J A;  3KSH A;  5IS1 A;  2MJ6 A;  3CI6 A;  3LIB A;  1YAX A;  1F98 A;  1EW0 A;  1XJ2 A;  4Y3I A;  1V9Z A;  3UB8 A;  4AFI A;  1OTI A;  2QWS A;  5G4Y A;  1D06 A;  2KLI A;  2VV7 A;  1XFQ A;  3FPW A;  1N9O A;  4FOF A;  3RH8 B;  3C2W A;  1W63 Q;  4O01 A;  4I39 A;  2OWJ A;  3B42 A;  1G28 A;  4WEL A;  3UE6 A;  2OOL A;  3K3D A;  3EGX C;  4Q0H A;  1VB6 A;  2J80 A;  4R6L A;  2M1C A;  4XT2 B;  2P08 A;  4HNB A;  5KIZ A;  3IS2 A;  1NLY A;  1IOU A;  2Z6D A;  4G3K A;  4NXB A;  1OJ5 A;  2O0Y A;  4BBU A;  2CMN A;  2Y79 A;  3C8C A;  4Y5F A;  3A0S A;  3D72 A;  4PAU A;  3MQQ A;  3ULF A;  4EEP A;  4G3W A;  1UGU A;  3OCL A;  3MFX A;  1OT9 A;  4MN6 A;  3KSF A;  4EUV A;  4I3J A;  3E4P A;  4EEU A;  5FL3 A;  3EOI A;  3FC7 A;  3LR5 A;  5TBM B;  4II7 A;  3A0R A;  1LT0 A;  3P01 A;  1VHM A;  1STZ A;  1KOU A;  4K08 A;  2HGV A;  4G3V A;  4LLO B;  2KDK A;  2W1T B;  3ZQ5 A;  1OTD A;  3NOT C;  4HHD A;  2H28 A;  3F1O A;  5J7E A;  4OOM A;  4BBT A;  4KUO A;  4ZRR A;  3EQU A;  4GHI B;  5DJU A;  2WKR A;  3FPV A;  1LSW A;  4HJ3 A;  4MMN A;  2J3T C;  5HDD A;  2PYP A;  2VA0 A;  2HJE A;  1OPX A;  3U2A A;  3LIF A;  5HDS A;  5K5B A;  4WEJ A;  1GSV A;  4EER A;  1ZHH B;  5AVE A;  2PYR A;  4Q0I A;  3HJI A;  1ODV A;  3F1P B;  5HDC A;  5MC7 A;  3GDI A;  4HP4 A;  2QKP A;  4L9F A;  3H82 A;  5DKL A;  3H9W A;  1DRM A;  4WLA A;  5I5L A;  4HH3 A;  1T1B A;  2K7S A;  2NUP C;  3F1N A;  2R78 A;  1G6O A;  3BWL A;  3KSI A;  4JGO A;  5DFX A;  2JKR I;  2PR5 A;  4I5S A;  1P9W A;  1S1Z A;  4NXE A;  4MDZ A;  4JGR A;  2J3T D;  5AJG A;  3H7W B;  4LRX C;  3RFB A;  2L1M A;  5HWW A;  1NLZ A;  4WL9 A;  4PKY A;  4LRY C;  3DBA A;  4PHT A;  1Y28 A;  4L0L A;  4CLC B;  5A8B A;  3KYZ A;  4I3I A;  4I38 A;  2VX8 A;  3PXP A;  4EQ1 A;  1OTB A;  4F3L A;  4EU0 A;  2V1B A;  4YNR A;  1XFN A;  4DJ2 A;  5G4Z A;  4IUH A;  3PBQ A;  3TJZ C;  2W3E A;  5F5Y A;  5J4E A;  3VV4 A;  1W63 M;  2W3D A;  2GZA A;  4P6Z M;  2B18 A;  4EES A;  4H6J A;  2OWH A;  2W3H A;  4Q0J A;  4CLC D;  5EFW A;  3MXQ A;  1MKM A;  4HJ6 A;  4NEE D;  4GCZ A;  1WA9 A;  3PBT A;  2P04 A;  2D02 A;  2D01 A;  3R7W B;  4IUK A;  3JVU A;  4RQ9 A;  1OTA A;  1N9L A;  4R38 A;  5HZH A;  4I3A A;  3EWK A;  2WKP A;  5J3W A;  2JKT M;  4HP9 A;  4B93 A;  2QHK A;  4CQH A;  4M4X A;  1OTE A;  4OOL A;  3PBO A;  4IJG A;  4DMZ A;  3E4Q A;  2VLG A;  3OLO A;  5F69 A;  2EWV A;  3R4K A;  2JN7 A;  4GS9 A;  4LRZ E;  3PR6 A;  2V0W A;  1DP9 A;  2V9A A;  4DN0 A;  3S7N A;  2W1R A;  3PBN A;  4BBV A;  3KO6 A;  4DJ3 A;  2A24 A;  3K2N A;  3B33 A;  3RTY A;  1XJ4 A;  2VEA A;  1GSX A;  3BQA A;  4YWZ A;  5F68 A;  5DF9 A;  1T19 A;  3LR3 A;  1V9Y A;  4NXF A;  3NOU C;  4KQD A;  3TE8 A;  4P6Z S;  2INW A;  3VE3 A;  4GLQ A;  3BY9 A;  3MR0 A;  1DP8 A;  3BQ8 A;  3IS2 B;  4ARZ A;  3IBR A;  1IFQ A;  3T4J A;  1P0Z A;  3JVV A;  2PR6 A;  2ZBB A;  3TW8 A;  1TS6 A;  3NJA A;  1OJG A;  3LIE A;  3CUE C;  2LB5 A;  2VJW A;  2DMW A;  1X0O A;  2FZ0 A;  3PHY A;  5LBR A;  3W2Z A;  3T4O A;  2ZMF A;  1S66 L;  3LFV A;  4GJ4 A;  5DJT A;  3C38 A;  4JGP A;  4NXG A;  3ZYT A;  3CWF A;  5C5K A;  2JHE A;  3ICY A;  3UME A;  1LSX A;  1TS8 A;  3HCY A;  2HJ9 C;  2YKF A;  2V1A A;  2W27 A;  3CLO A;  3A0V A;  1H8M A;  5TJJ A;  1N9N A;  2PT7 A;  1TD5 A;  3EGD C;  5IT5 A;  2XSS A;  3F1O B;  2GJ3 A;  5IU1 A;  2I9V A;  2BAS A;  4CLC C;  2O9C A;  4UQI M;  1UWP X;  2KOI A;  2Z6C A;  1F5M A;  1MZU A;  3K3C A;  1LL8 A;  1JNU A;  1T1A A;  4EXO A;  3OBF A;  4R70 A;  3D3O A;  2K2N A;  3MQO A;  4XT2 A;  4UEY A;  3E4O A;  4L9E A;  3LIC A;  5AVF A;  3PYP A;  3LI8 A;  4EET B;  5DKK A;  3EEH A;  1T18 A;  1S4R A;  1TS0 A;  3PBR A;  3C30 A;  2O99 A;  3PBS A;  4WF0 A;  1GSW A;  5HPF A;  5F6A A;  5HWT A;  3H82 B;  4R3A A;  3TRC A;  3NHQ A;  2QJ7 A;  4KQO A;  2XRN A;  3EEA A;  3UMD A;  3BJN A;  3F1N B;  1YSQ A;  2Y8H A;  3O5Y A;  4WN5 A;  3SW1 A;  3E98 A;  4HOI A;  2VV8 A;  3T4K A;  4IHQ A;  5TBM A;  3E0Y A;  3MQ0 A;  4HQA A;  2QJ5 A;  4MN7 A;  4QPR A;  4HJ4 A;  2J3W A;  1H3Q A;  3G6O A;  2W1T A;  4ME4 A;  3CIT A;  2M7V A;  3OC2 A;  3UB7 A;  1T1C A;  4HIA A;  1TF1 A;  2XA7 M;  3T4Q A;  2HV1 A;  4BWI A;  4GHI A;  4JGQ A;  2EWW A;  4UQI S;  3KYQ A;  3T4S A;  1OT6 A;  2ZMV A;  4EW7 A;  3UB6 A;  2VGL M;  1P97 A;  4YOF A;  1XJ6 A;  1TS7 A;  5HD3 A;  2W3F A;  2M7U A;  3LYX A;  4WUJ A;  4F3L B;  3T50 A;  2GX5 A;  2VV6 A;  4HH2 A;  3F1P A;  2LB9 A;  4Z1W A;  2OAP 1;  3MJQ A;  4ETZ A;  2FH5 A;  3LUQ A;  3B47 A;  3GEC A;  2XRO A;  2HF6 A;  4PKY G;  1XJ3 A;  2G7U A;  2JKR M;  4MCW A;  1BYW A;  5HSQ A;  5L8M A;  3CUE A;  3FG8 A;  4KUK A;  1YSP A;  2W3G A;  3LIA A;  3MMH A;  2PDR A;  3S7P A;  4NKP A;  2A2L A;  4L9G A;  3LR0 A;  4H6J B;  2YKH A;  3BW6 A;  4O8G A;  3UE3 A;  2ZOI A;  3OOV A;  5HWV A;  4FSF A;  3S7Q A;  2EA9 A;  2L4R A;  1F9I A;  3H7W A;  4O0P A;  1UWN X;  2VKS A;  3NOP C;  4BMW A;  2OAQ 1;  2V0U A;  3LID A;  3KSG A;  3UB9 A;  3LI9 A;  2B02 A;  1NWZ A;  5DFY A;  2XA7 S;  5CX7 A;  4CLC A;  2L0W A;  3EQV A;  5HD5 A;  3BY8 A;  4B9O A;  4HY8 A;  1S4S A;  2VZW A;  2VGL S;  3V67 A;  2PD7 A;  3OCN A;  2PHY A;  5KSH A;  4GS9 B;  2JKT I;  2QYB A;  2KX6 A;  2O9A A;  1ZTU A;  3HJK A;  4MN5 A;  3P7N A;  1YKD A;  2IA2 A;  2PD8 A;  1P9R A;  4BJP A;  4WEK A;  2K31 A;  1NRJ A;  4HI4 A;  2A24 B;  2NUT C;  3CAX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...