2P08A

Structure of the n-terminally truncated pas domain of signal transduction histidine kinase from nostoc punctiforme pcc 73102 with homology to the h-noxa/h-noba domain of the soluble guanylyl cyclase
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
107
structure length
107
Chain Sequence
MLSPELLAKAFPFHFAFSRNREIVQTGEVLERISPEPLVGKLIEQHFQINRPKILIDFDAISKQPRALFILEFLHNGMQLKGQMMYQPEEEVIFFLGSPWITDTTSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords signal transduction histidine kinase
publication title PAS-mediated dimerization of soluble guanylyl cyclase revealed by signal transduction histidine kinase domain crystal structure.
pubmed doi rcsb
source organism Nostoc punctiforme
total genus 23
structure length 107
sequence length 107
chains with identical sequence B
ec nomenclature ec 2.7.3.-:
pdb deposition date 2007-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07701 HNOBA Heme NO binding associated
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.260 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2p08A00
4GJ4A 2P08A 2P04A
chains in the Genus database with same CATH superfamily
4GS9B 2OAP1 4KENB 3N8LA 5F5YA 2OSUA 5FSRA 1PYYA 4U0XA 4KZ7A 3B33A 4UA9A 4JGPA 3LR3A 3U2AA 1LT0A 4HJ3A 1G5UA 4OPYA 3SS3A 4JXGA 4Y2FA 5BOHA 3C38A 3DAVA 4RVAA 3AGDA 3LIDA 3T12B 4K0WA 2WAFA 3IX8A 2VGLS 2XLNA 5E2EA 4BBUA 2DMWA 3S7NA 3KYEA 4Y5FA 1VETA 3LFVA 1YSPA 1KOUA 3JPUA 3TRCA 4D2OA 4RX3A 3N7WA 3L7HA 5CEDA 2ZBBA 5HDDA 3N6IA 1L0DA 2V8CA 4JF4A 2Y2QA 4KG6A 4LV0A 2Y59A 4XT2B 3UNWA 3QP4A 2R9XA 1JTGA 2PT7A 1W7FA 3EEAA 4HEFA 1XA7A 3JYIA 1DP9A 4OP5A 1WYCA 3NBLA 3VSKA 3IWIA 2RL3A 4IHQA 4ME4A 3IF6A 1FQGA 4I38A 4WF0A 2H0TA 1RCJA 2P08A 4JGOA 3HVFA 4JPMA 4MCWA 3C5AA 3WS5A 5CX7A 1L2SA 4UA7A 3SOIA 5MC7A 5DJTA 1VQQA 2QWSA 4OLDA 4HBTA 2XA7M 3HLDA 4KZBA 2GDNA 2O9CA 3UPOA 2FFFB 1E3UD 1YT4A 1J3WA 5FI2A 3A3IA 4DDSA 3MZFA 4BBVA 2CC1A 3LIFA 2Y2GA 3VP1A 4OOMA 3PBSA 5HDCA 3IF6C 2QKPA 4X1MA 1IKGA 4KQOA 1N9LA 3DTEA 3MKFA 1AXBA 5GHYA 3VFFA 3GR2A 1I2WA 3OC2A 3SH7A 4H8RA 4YOFA 4RX2A 5GL9A 2XFTA 2VZWA 2K31A 3NOPC 4GD6A 2WGWB 3HUMA 1FR1A 3G2ZA 3T50A 5I94A 1K57A 5EVID 1TVFA 1LI0A 3DTKA 2QMIA 4Z9QA 1U60A 2JKTM 3FG8A 1GA0A 3EGDC 3KX0X 4MDZA 3K3DA 3JVVA 3C8CA 3HREA 2R9WA 4Y3IA 1K54C 2Z2MB 4NXGA 3VP3A 4CLCB 3GVBA 4KG5A 2EX8A 4GDNA 4OVDA 3IH9A 3UN7A 3W8KA 3Q7VB 5HZHA 4Z1WA 4Y15A 4ARZA 2WUQA 1CEFA 3BFGA 3RJUA 1HLUP 1PFLA 2ZM8A 3ITBA 3CAXA 3LEQA 2HP6A 2G7UA 4EXOA 5CXWA 3UMDA 3M6HA 5CEBA 1MY8A 1BULA 2XDMA 2XQZA 4OQ0A 5GHXA 5HWWA 1ERQA 4I3JA 4E3IA 5FAPA 4HP9A 4I5SA 4LV2A 4EV4A 4LENA 4QB8A 4LRXC 1ONGA 1BZAA 1N9OA 4N1HA 1KDWA 2WKQA 4E6WA 1LSWA 1SCWA 5L10A 3EQUA 2VX8A 3LUQA 2ZQCA 4PM6A 5M18A 5DTKA 3HUOA 4OKPA 1W63Q 4JGRA 4S2LA 4S2MA 1ZKJA 4NEED 3HUNA 5CHUA 3JVUA 1FILA 1E25A 3CJMA 2Y55A 1PWCA 2KOIA 1L0EA 3F1OB 1T18A 2DCFA 1P9WA 3UPPA 2BASA 4DF6A 3IX3A 3S7OA 1UWNX 2O0YA 3QNBA 2HJ9C 4X55A 3CMZA 3LIBA 3Q7ZA 1YMXA 3GDIA 2W1TA 2JE5A 2PU4A 1IFQA 1DRMA 2V20A 4CLCA 2E8IA 2J3WA 1OTEA 2HP5A 3BYDA 1S0WA 1JNUA 3UB5P 1N9NA 3FWLA 3V67A 1XJ3A 3NOUC 3DTIA 1G6OA 3QP6A 2K2NA 3MQ0A 2Z6DA 1KGEA 2B18A 3VV4A 5HAQA 1TS8A 4MBFA 1OT6A 1N4OA 1T1BA 2JBFA 3GRJA 4JBFA 4WZ4A 3G2YA 2HDUA 5EOEA 1DP8A 5DJUA 5LBRA 5GLBA 4R4RA 3VFHA 3PBOA 4I3AA 4KQQA 4WEJA 4CLCC 5A93A 2B5RA 4IBXA 3ZHHA 4LGWA 3UO9A 1GSXA 2HZ5A 4R3JA 3VOYA 3VOLA 4PPRA 1MZUA 5G18A 5HD5A 3WRZA 4KZ6A 3CPTA 5HD3A 1K25A 3EGXC 3PBNA 3BW6A 3PBTA 2VEAA 4EUVA 4E3JA 2EWVA 5KSCA 4GCZA 2XD5A 3ZG5A 5HFOA 3NULA 3R7WA 1Y54A 4FH2A 3ZNYA 5HARA 4E3MA 3PHYA 4C75A 5EPHA 1GSWA 4PHTA 3BFCA 5G4ZA 5GLCA 2VV6A 4NKPA 4UQIM 3ISGA 4G3KA 1K4FA 2I72A 5J3WA 2QJ5A 5J7EA 2HP9A 4ZDXA 5GHZA 3OPRA 4QU3A 3AGFA 1XA1A 1S67L 2W3HA 3F1PB 3DWZA 2VJWA 4DJ2A 4L9GA 1SDNA 3M2KA 1FIKA 1K4EA 4E3KA 4YFMA 3PAEA 3A3EA 4JF5A 3NC8A 1YM1A 1IYPA 4DKIA 1KVMA 1H5XA 3O87A 4ESPA 2OAQ1 5HAPA 2VK3A 5JYOA 4GKUA 3BY8A 3VSLA 1EWZA 5FDHA 4EETB 5FQKA 1VEUA 3E98A 2VA0A 3ZYTA 4D60A 2HJEA 3MR0A 1ALQA 1GHMA 5CTMA 4NETA 3KYQA 4MLLA 2EXAA 1MBLA 5CHMA 2J9OA 1MWRA 5F1GA 4K08A 4HY8A 1LL9A 2E8JA 2PD8A 5M1AA 2Y2HA 4HI4A 1HD8A 1DP6A 1TF1A 2FFYA 3R4KA 4EW7A 2IWDA 1CEGA 3ZG7B 2JKRM 1GHIA 4MBKA 1O7EA 4DE1A 5IT5A 3IWOA 2ZOIA 3RFBA 3B47A 3IF6B 1E4DA 1FCNA 4KZ4A 4G3WA 3TE8A 3MS6A 1FCMA 3UB7A 2OV5A 4UAAA 3T4KA 2JKGA 5DF9A 5CGXA 2M7UA 2B02A 2PR5A 1DJAA 2PBDP 2JCHA 5F6AA 3FV7A 2Q9MA 3HJIA 5DTTA 4WMCD 1XGIA 3SS5A 3EEHA 1IYQA 4QY6A 3IXDA 1CI9A 4ZRRA 4LLOB 1OPXA 2DRWA 2IWCA 3RXWA 3D72A 3LICA 2Y91A 4LRZE 4N92A 3DW0A 4UA6A 4KZ9A 4Q0IA 4OONA 2YKFA 3S4XA 3H7WA 1KGFA 4GNUA 1XJ4A 4LRYC 3ZG0A 5TFQA 1OJ5A 1BSGA 4GD8A 4P6BA 4YWZA 2A24B 2KLIA 3N4IA 3ZGAB 4YINA 1XX2A 2FH5A 5EVLA 3EOIA 1YLWA 5F69A 2P7JA 4EWFA 4JXSA 5FATA 2Y8HA 3MXRA 2WKEA 1YLTA 4BENA 4EEPA 1IELA 4ID4A 1BLHA 4DE2A 3B3XA 1DY6A 3IH8A 4X53A 1XXMA 5J8XA 4EBPA 4PMAA 3F1NA 3UY6A 2WAEA 4BD1A 1ZHHB 3UDIA 2ZC3B 2ZQ7A 4LCMA 5DKLA 3V5MA 1SDEA 1H8MA 2Q0OA 3ULFA 2ZQDA 3T4LA 1MWUA 4IUHA 2WKPA 3OOVA 5EOOA 4NG2A 3GTCA 1KVLA 4I39A 1Z09A 3HL9A 1HZOA 4R0QA 2GZAA 5M19A 4ARZB 4G3VA 3MMHA 4MN6A 2V8FA 3UB9A 3A3FA 5FL3A 5GLDA 3U4LP 2P04A 4Y7PA 5K5BA 3BECA 3IS2A 4O7DA 3LO7A 4PM8A 3SZTA 3MZDA 1GHPA 2D01A 5FAQA 2Y2MA 1M6KA 3ZVWA 1LSVA 2WZXA 3LCEA 1ESIA 4M4XA 3Q82A 1ONHA 2Y2NA 2LB5A 2YKHA 5FEGA 4GJ4A 1HVBA 1L0GA 4AFIA 4KZ3A 2J8YA 2W1RA 2A24A 2J3TD 4FOFA 3ZCZA 3ZQ5A 3OCNA 3MKEA 1LLBA 4K91A 3ZG8B 1STZA 3S7QA 1OTIA 2I9VA 3CITA 1ODVA 4F3LA 2V9AA 1MWTA 5AVFA 4ZBEA 4CPKA 1NYMA 4K0XA 3RXXA 3ITAA 4GHIA 1GCEA 1XJ2A 4II7A 3HLFA 1PWGA 1LL5A 1XFQA 5F68A 2OWHA 1OT9A 5AQBA 1PIOA 2W1TB 1BLCA 3OBFA 3G31A 4ETZA 2OLUA 3RH8B 2Y2LA 1JVJA 4LV3A 2EXBA 3NY4A 3SH9A 4QY5A 3G35A 1E3UA 5HPFA 2JKTI 4FTXA 5GLAA 4YNRA 3UE1A 2XA7S 2X02A 1Y4OA 1K57C 3V3RA 1MPLA 5FA7A 2ZL1A 2M7VA 2WGIA 4I3IA 3CG5A 3QP2A 2D02A 5DFYA 2P74A 1KDSA 1OMEA 3G6OA 3FYZA 4R1GA 4OPRA 4LFUA 2Q9NA 3UB6A 4FSFA 1C3BA 4IBRA 3MXQA 3BM6A 2GNXA 4X25A 2LB9A 4X69A 4EU0A 1EW0A 3K3CA 4PM7A 2V1ZA 1OTBA 5EUAA 5DF8A 5TJJA 4BD0A 5EVIA 3CPTB 3IX4A 3PXPA 4DN0A 4HESA 1W8QA 3ZNTA 2Y4AA 3LGOA 1KGGA 4HQAA 3L9KA 5DVAA 3IHBA 1S66L 3R7WB 5HX9A 3W4OA 2HDQA 3K2NA 4FCFA 1J9MA 1YPRA 3IXBA 3B42A 5IS1A 3CHWP 5F1FA 4Y13A 3C7UA 5FQQA 1MKMA 3T1QB 1ZTUA 3PBQA 1YAXA 3CZDA 5EM1A 4P6ZM 3LI8A 4PM5A 1WE4A 2WADA 4OQHA 3BWLA 3VMAA 4FH4A 1K55A 2WGVA 1PNEA 3PR6A 4S2IA 3M2JA 1T19A 1VM1A 4S2PA 3BFEA 1I2SA 3O3VA 3UPNA 2ZC6B 1TDGA 3V39A 4KQDA 2ZM0A 2A3UA 1V9YA 4NXEA 2PYRA 3GV9A 3H82A 4QHCA 4XUXA 2H10A 5FI6A 4WL9A 2QPNA 2EA9A 1W8YA 1RP5A 3V3SA 3UE3A 1BLSA 2Y2PA 5IU1A 1FSWA 3W4QA 5A92A 1PW8A 2XRNA 4EBLA 1X0OA 3T1SA 1G6AA 1VEUB 1K55C 2JN7A 4S2NA 1MXOA 4Y17A 2Y79A 3DTMA 4Y0OA 1GSVA 4E3OA 1QMFA 1DJBA 2XD1A 3QHYA 2M1CA 2VV8A 3VOZA 1O07A 5HW3A 2G2WA 1ES3A 2DNSA 2PBYA 1VHMA 4HNBA 5TR7A 3VE3A 1JTDA 1F98A 3LY3A 4E3LA 4F94A 3HBRA 4ZTKA 3OLOA 2K7SA 4U0TA 5EVEA 1ES5A 4JGQA 1GA9A 5CTNA 5F82A 3GECA 2NUTC 1BT5A 3UB8A 3KSIA 5HSQA 1ERMA 3I7JA 3S1YA 5U47A 3GMWA 3UDFA 2VLGA 5E2GA 4IEDA 2NUPC 1YLYA 3IHAA 3VP2A 4A5RA 3OPHA 4S2KA 1CK3A 4N9KA 3BLSA 4JLFA 1Y28A 4CQHA 1FSYA 1XJ6A 1M40A 1BLPA 1PI5A 4OPZA 4KUKA 1JWPA 3TG9A 1D1JA 4OOYA 4Y0UA 3A0SA 3EWKA 1S4RA 1T1AA 3IT9A 3C30A 1ZC2A 3A0RA 4ZJ3A 3H7WB 3T4JA 1BTLA 3IXHA 5E2HA 3MFDA 4IJGA 1YLZA 1F2KA 4S2OA 3QP5A 1IYSA 5CRFA 2ZLYA 1TD5A 4IVIA 2XH9A 4FD8A 3PBRA 5DFXA 2V1AA 2GJ3A 4ETXA 3MBZA 3O5YA 1FOFA 1W79A 3MF0A 4DJ3A 3PAGA 1T1CA 4HP4A 2EFUA 3CWFA 1NRFA 4MN5A 2ZMFA 2Z2LB 2QJ7A 4O01A 4MBHA 2IA2A 2EFXA 2VGLM 4RYEA 2ZQ8A 3OPPA 3F1NB 2O99A 4BLMA 1XFNA 2PAVP 3A0VA 2AVXA 2QHKA 3GQZA 4UQIS 3NHQA 2H28A 4M3KA 5FQIA 2W27A 5KZHA 4KUOA 1NYYA 2J9PA 1ACFA 2W3EA 2VGKA 3UE6A 3V50A 4R3BA 4GDBA 2UV0E 4E04A 4HIAA 2WKRA 4EQ1A 4QD4A 3E2LA 3TSGA 3BJNA 4DXCA 1CI8A 2ZD8A 4O0PA 2P9VB 2O9BA 3WS2A 2WYXA 4EEUA 2HDSA 5E2FA 1N9BA 3WS4A 4GOGA 3IS2B 2JKRI 5L8MA 2UWXA 3IXGA 5FQJA 5DF7A 2IWBA 2V0WA 1PZOA 3FZCA 4GN2A 2ZMVA 5A8BA 3E4OA 1HTZA 4PKYA 1UGUA 3E4QA 2W3DA 4EBNA 1K0KA 1JWVA 3T4OA 4OLGA 3TJZC 5EE8A 3W4PA 3D3OA 1YKDA 4PM9A 4JF6A 3IF5A 4R6LA 1YMSA 1PI4A 2L4RA 4OOLA 3T1XA 3C4PA 3N8RA 1YLJA 3ZDJA 2V2FF 4L9FA 2FZ0A 2V0UA 1I5QA 3T4SA 2BLSA 1TDLA 3BFFA 3SW1A 2O9AA 4ZAMA 4F3LB 4BQMA 3FC7A 1IKIA 1CQAA 1WA9A 3NECA 1S1ZA 1KE4A 3MJQA 4GHIB 5HAIA 5G4YA 4E6XA 1LL8A 4KG2A 2A2LA 4OQGA 1PWDA 1SKOA 4BL2A 3MSHA 3T4TA 4DRTA 2HPBA 3C2WA 1ZG4A 2EX9A 3A3JA 1W5DA 1OJGA 2OLVA 4KZ5A 2Y2OA 2WK0A 4Q0HA 1TS0A 3BFDA 4WUJA 4R4SA 5FQMA 4H6JA 2XF3A 1H3QA 4P0MA 2H0YA 4KQRA 4WMCA 4HOIA 2ACGA 1XGJA 2P9VA 3OPLA 1W63M 4JXVA 4WYYA 4WLAA 1KE0A 5HWTA 3P09A 2ZL1B 3VP0A 1NY0A 1S4SA 3O88A 4R70A 4RA7A 4MN7A 1Q2QA 4BBTA 1SZVA 4BJPA 1NWZA 3NOTC 2JHEA 3LIEA 4S2JA 4L0LA 2A49A 4GS9A 3M6BA 3HLCA 4ZJ2A 2XK1A 1NLZA 2G2UA 2PDRA 4EQIA 4FUWA 3Q1FA 5EVIB 1ES4A 3BQ8A 4IVKA 4R3AA 1XKZA 3HLWA 1EI5A 1LSXA 3LI9A 5CGSA 3SS4A 2WKIA 5I5LA 1IOUA 1K54A 1PRQA 1NRJA 4HJ6A 3D9YA 4OPQA 3HLEA 1RGYA 3A3DA 1IYOA 4QPRA 3P7NA 3QNCA 4HJ4A 3DWKA 3MZEA 2PD7A 1MKIA 1UWPX 4X6TA 2INWA 5L2FA 2Z6CA 3KSFA 1D7EA 4XT2A 3G32A 1YLPA 1ESUA 5E43A 3LEZA 3C4OA 1A0KA 1NZOA 3TW8A 3LR0A 4EERA 4GZBA 4R23A 3H82B 4JXWA 4Q8IA 1NJ4A 2L1MA 5TGFA 2W0NA 4DE3A 3VE4A 1FCOA 5HL1A 2OWJA 4X1LA 3ZVTA 4B93A 5A90A 4DDYA 2J7VA 1OTDA 4WZ5A 3C7VA 1OTAA 4P85A 5DKKA 2HV1A 1L0FA 4CLCD 1P0ZA 2VGJA 4P87A 5CHJA 3Q81A 2HGVA 1LI9A 3NDEA 5TBMB 2KX6A 3IQAA 4N9LA 4CJNA 1PZPA 3G4PA 4WEKA 1MWSA 3LR5A 2ZC7A 2VKSA 1NZUA 3E0YA 4Y0TA 3CI6A 2PU2A 2XGNA 2ZM2A 3LIAA 2EWWA 2EX6A 3HJKA 4X68A 3ICYA 3WS0A 4NXFA 1ZG6A 3UDXA 4GB7A 4WZ5C 2HF6A 2PYPA 4JKTA 1LHYA 2QYBA 2J3TC 5FEFA 5EV0A 5KIZA 1K56D 3P01A 3NJAA 5HL6A 1DJCA 2ZQ9A 2WGWA 4IUKA 1ES2A 3BEBA 5IHVA 4EUZA 5FAOA 1SHVA 4NXBA 5EVIC 4BL3A 1YSQA 1S1YA 1VB6A 2EX2A 1XP4A 1QMEA 4DMZA 5FQ9A 3FPVA 3NI9A 4Q0JA 4DE0A 2JKFA 4L9EA 1H0MA 3D4FA 4DXBA 1KE3A 5KMWA 2HDRA 3UMEA 3LR4A 5C5KA 4B4ZA 1L3LA 3MXSA 4MMNA 3HLGA 5F83A 4LV1A 3Q7VA 3PTEA 2R78A 3BRMA 3LYXA 1K38A 4QWOA 2ZMAA 5CECA 4KZ8A 3WWXA 2XEPA 3UE0A 3T4QA 2XR0A 4HH3A 3PYPA 4WELA 5CGWA 3OCLA 4LPZA 4GW9A 1H8YA 3FKVA 5TBMA 3S7PA 2CMNA 3T1RA 2MJ6A 3VP4A 2XROA 5HWVA 5EFWA 2RCXA 1K56A 2PHYA 2V1BA 1XPBA 3LY4A 2ZC4B 3EQVA 4EESA 3FKWA 3RTYA 4P6ZS 4CLCE 4B88A 1AWIA 2Y2KA 4OQIA 2OOLA 1BUEA 4S2NC 4R38A 4XUZA 5AQAA 2ZOHA 2XSSA 4UHUA 4OH0A 3HLBA 5HDSA 2B95A 3P98A 5L09A 1Q2PA 3IBRA 3F1OA 4WM9A 1CJFA 3GSGA 1TS7A 3IBJA 3SH8A 4X56A 1Z6FA 3BLMA 4WBGA 4QJGA 3O86A 4U3TA 5JYPA 1IEMA 2C5WB 1K6RA 2ZQAA 2WKHA 3S22A 3MFXA 2ZJ9A 4C3QA 2KDKA 3H9WA 2VV7A 5CERA 3KO6A 5KSHA 4HHDA 4OP8A 4B9OA 1V9ZA 2WZZA 3G34A 1EROA 1K6SA 3CUEA 2C6WB 1SKFA 5EECA 3NCKA 4E3NA 5FASA 2QZ6A 5EM0A 4NK3A 4WN5A 5HPIA 4GLQA 1NXYA 2W3FA 2BTFP 5AQ7A 3BY9A 1F5MA 3KSHA 1TEMA 3HCYA 4C6YA 3FPWA 5AJGA 3NDGA 5AVEA 2GX5A 1FR6A 3OZHA 2X01A 3WRTA 4KZAA 3N8SA 1VETB 2ZC5B 3KSGA 2W3GA 4BMWA 3G30A 4HBUA 4BWIA 1CF0A 1JWZA 1SKOB 4O8GA 5FDSA 1WYBA 2PRFA 5AQ9A 2BG1A 3Q07A 1S6RA 1P9RA 4XXRA 2J80A 1H8ZA 4PKYG 1TS6A 3ZG9B 1D06A 3CUEC 3IWQA 2PR6A 3WS1A 3E4PA 5A91A 4ZJ1A 2JC7A 3DBAA 4H6JB 3KYZA 3MQOA 3ZFZA 5DTSA 4B4XA 3MQQA 1G68A 5FI7A 2XFSA 2Y2IA 1P97A 4MNRA 3CLOA 1PW1A 4N1XA 5L07A 1G28A 2L0WA 4UEYA 3BQAA 1YQSA 1MC0A 4RQ9A 5J4EA 3QP1A 4PAUA 4MEZA 3W2ZA 2H5SA 3NIAA 2X71A 2Y2JA 3QP8A 4HH2A 4LCLA 1BYWA 5D3OA 1RGZA 3E2KA 1NLYA 3F1PA 3AGEA 3TOIA 1F9IA
chains in the Genus database with same CATH topology
4GS9B 2OAP1 2QJ5A 3B42A 4R3AA 5IS1A 5J7EA 1LSXA 5F5YA 3LI9A 3B33A 4JGPA 1MKMA 1ZTUA 1S67L 3LR3A 3PBQA 1YAXA 5I5LA 1IOUA 4P6ZM 3LI8A 3U2AA 1LT0A 1NRJA 4HJ3A 2W3HA 4HJ6A 3F1PB 3BWLA 2VJWA 4DJ2A 4L9GA 3PR6A 4Y2FA 3C38A 1T19A 3LIDA 4QPRA 3P7NA 4HJ4A 2OAQ1 2VGLS 4BBUA 2DMWA 2PD7A 4KQDA 3S7NA 4Y5FA 1UWPX 3LFVA 1V9YA 2INWA 4NXEA 2PYRA 2Z6CA 1YSPA 3BY8A 3KSFA 1KOUA 3H82A 1D7EA 3TRCA 4XT2A 4EETB 4WL9A 3E98A 2ZBBA 5HDDA 2EA9A 2VA0A 3UE3A 3ZYTA 3TW8A 5IU1A 2HJEA 3LR0A 2XRNA 4EERA 3MR0A 3H82B 4XT2B 1X0OA 2L1MA 2PT7A 3KYQA 2JN7A 3EEAA 2W0NA 2Y79A 1DP9A 3VE4A 2OWJA 1GSVA 4K08A 4HY8A 4B93A 2PD8A 1OTDA 5DKKA 1OTAA 2HV1A 2M1CA 4HI4A 4IHQA 2VV8A 4CLCD 4ME4A 1DP6A 1TF1A 3R4KA 1P0ZA 4EW7A 2HGVA 4I38A 4WF0A 2JKRM 1VHMA 4HNBA 3VE3A 2P08A 4JGOA 1F98A 5IT5A 4MCWA 2ZOIA 5TBMB 2KX6A 3RFBA 3B47A 3OLOA 5CX7A 4WEKA 2K7SA 3LR5A 2VKSA 3E0YA 5MC7A 4JGQA 5DJTA 2QWSA 4G3WA 3GECA 3TE8A 2NUTC 2XA7M 3CI6A 3UB7A 3UB8A 3KSIA 3T4KA 3LIAA 2EWWA 3HJKA 2O9CA 5DF9A 2M7UA 2B02A 3ICYA 2PR5A 5HSQA 4NXFA 4BBVA 5F6AA 2VLGA 3LIFA 2HF6A 2PYPA 3HJIA 2QYBA 4OOMA 3PBSA 3EEHA 2NUPC 5HDCA 2QKPA 2J3TC 4ZRRA 4KQOA 4LLOB 1OPXA 5KIZA 3P01A 1N9LA 3NJAA 3D72A 5HL6A 3LICA 4LRZE 1Y28A 4CQHA 1XJ6A 3OC2A 4IUKA 4Q0IA 2YKFA 4YOFA 3H7WA 4NXBA 4KUKA 1XJ4A 1YSQA 1S1YA 1VB6A 2K31A 2VZWA 3NOPC 1OJ5A 3A0SA 3EWKA 4LRYC 1S4RA 4YWZA 4DMZA 1T1AA 2A24B 2KLIA 3FPVA 3T50A 2FH5A 3C30A 3EOIA 4Q0JA 3A0RA 4L9EA 3H7WB 5F69A 3T4JA 2P7JA 3UMEA 2JKTM 3LR4A 4IJGA 5C5KA 2Y8HA 3FG8A 3EGDC 4MMNA 3KX0X 4MDZA 3K3DA 3JVVA 3C8CA 4EEPA 2R78A 3LYXA 1TD5A 4Y3IA 4NXGA 4CLCB 3PBRA 5DFXA 2V1AA 2GJ3A 4ETXA 3T4QA 4HH3A 3O5YA 3F1NA 3PYPA 3MF0A 4DJ3A 4WELA 1T1CA 1ZHHB 4HP4A 3CWFA 4MN5A 5DKLA 2ZMFA 2QJ7A 4O01A 5HZHA 3OCLA 4Z1WA 4LPZA 4GW9A 4ARZA 1H8MA 3ULFA 2IA2A 2VGLM 5TBMA 3S7PA 3T4LA 4IUHA 3F1NB 2WKPA 3OOVA 2O99A 1XFNA 2CMNA 3A0VA 4I39A 2QHKA 2MJ6A 3CAXA 4UQIS 3NHQA 2XROA 2GZAA 2H28A 5EFWA 2G7UA 4EXOA 5HWVA 2W27A 3UMDA 4G3VA 4KUOA 4ARZB 3MMHA 4MN6A 2PHYA 2V1BA 2W3EA 3UE6A 3UB9A 5FL3A 2P04A 3EQVA 4E04A 4EESA 5HWWA 4HIAA 5K5BA 2WKRA 4I3JA 3RTYA 4EQ1A 3IS2A 4P6ZS 4HP9A 3BJNA 4CLCE 4I5SA 4O0PA 2O9BA 2OOLA 4R38A 4LRXC 4EEUA 2D01A 1N9OA 2ZOHA 2WKQA 2XSSA 3IS2B 2JKRI 1LSVA 5L8MA 4M4XA 1LSWA 5HDSA 5J3WA 3IBRA 3F1OA 3EQUA 2V0WA 2LB5A 2YKHA 2VX8A 4GJ4A 3LUQA 5A8BA 2ZMVA 1TS7A 3E4OA 3IBJA 4PKYA 1UGUA 4AFIA 3E4QA 1W63Q 2W3DA 4JGRA 4NEED 2W1RA 3JVUA 2A24A 2J3TD 4FOFA 3ZQ5A 2KOIA 3F1OB 3OCNA 1T18A 3T4OA 1P9WA 3MFXA 3TJZC 2BASA 3S7OA 3D3OA 1YKDA 1UWNX 2O0YA 2HJ9C 1STZA 3S7QA 1OTIA 2I9VA 2KDKA 3CITA 3H9WA 2VV7A 1ODVA 4R6LA 4F3LA 3KO6A 2V9AA 3LIBA 5AVFA 2L4RA 3GDIA 4OOLA 5KSHA 2W1TA 4HHDA 4B9OA 1V9ZA 4L9FA 4GHIA 1IFQA 1DRMA 2FZ0A 2V0UA 1XJ2A 4II7A 4CLCA 2J3WA 3T4SA 1OTEA 1XFQA 3CUEA 5F68A 2OWHA 3SW1A 2O9AA 4F3LB 1OT9A 3FC7A 1JNUA 2W1TB 1WA9A 4WN5A 3OBFA 1N9NA 3V67A 1S1ZA 3MJQA 4GHIB 5HPIA 1XJ3A 4GLQA 3NOUC 2W3FA 1G6OA 5G4YA 2K2NA 3BY9A 1F5MA 3KSHA 4ETZA 1LL8A 3HCYA 3MQ0A 2A2LA 3RH8B 3FPWA 5AJGA 2Z6DA 5AVEA 3T4TA 2GX5A 2B18A 3VV4A 1TS8A 3C2WA 1OT6A 1T1BA 1OJGA 3KSGA 2W3GA 4BMWA 4BWIA 5HPFA 2JKTI 1DP8A 4O8GA 4YNRA 4Q0HA 5DJUA 5LBRA 1TS0A 4WUJA 2XA7S 4H6JA 1H3QA 3PBOA 4I3AA 1P9RA 4WEJA 2J80A 4PKYG 2M7VA 4CLCC 1TS6A 1D06A 4I3IA 4HOIA 3CUEC 2D02A 5DFYA 2PR6A 3E4PA 1W63M 3G6OA 1GSXA 3DBAA 3VOLA 4WLAA 4H6JB 3KYZA 1MZUA 5HWTA 3UB6A 4FSFA 5HD5A 3MQOA 5HD3A 3EGXC 1S4SA 3PBNA 3MXQA 3BW6A 3PBTA 2GNXA 2LB9A 2VEAA 4R70A 4EUVA 3MQQA 4MN7A 1EW0A 4EU0A 2EWVA 3K3CA 4BBTA 4BJPA 1NWZA 4GCZA 1OTBA 3NOTC 3R7WA 2JHEA 3LIEA 4L0LA 1P97A 5TJJA 3CLOA 3PHYA 4DN0A 3PXPA 1GSWA 4PHTA 1G28A 2L0WA 4GS9A 4UEYA 5G4ZA 3BQAA 1MC0A 4RQ9A 4HQAA 5J4EA 4PAUA 1NLZA 2VV6A 2PDRA 3W2ZA 4HH2A 1S66L 3R7WB 1BYWA 3K2NA 4NKPA 4UQIM 3BQ8A 1NLYA 3F1PA 4G3KA 1F9IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GJ4 A;  2P08 A;  2P04 A; 
#chains in the Genus database with same CATH topology
 4GS9 B;  2OAP 1;  4KEN B;  3N8L A;  5F5Y A;  2OSU A;  5FSR A;  1PYY A;  4U0X A;  4KZ7 A;  3B33 A;  4UA9 A;  4JGP A;  3LR3 A;  3U2A A;  1LT0 A;  4HJ3 A;  1G5U A;  4OPY A;  3SS3 A;  4JXG A;  4Y2F A;  5BOH A;  3C38 A;  3DAV A;  4RVA A;  3AGD A;  3LID A;  3T12 B;  4K0W A;  2WAF A;  3IX8 A;  2VGL S;  2XLN A;  5E2E A;  4BBU A;  2DMW A;  3S7N A;  3KYE A;  4Y5F A;  1VET A;  3LFV A;  1YSP A;  1KOU A;  3JPU A;  3TRC A;  4D2O A;  4RX3 A;  3N7W A;  3L7H A;  5CED A;  2ZBB A;  5HDD A;  3N6I A;  1L0D A;  2V8C A;  4JF4 A;  2Y2Q A;  4KG6 A;  4LV0 A;  2Y59 A;  4XT2 B;  3UNW A;  3QP4 A;  2R9X A;  1JTG A;  2PT7 A;  1W7F A;  3EEA A;  4HEF A;  1XA7 A;  3JYI A;  1DP9 A;  4OP5 A;  1WYC A;  3NBL A;  3VSK A;  3IWI A;  2RL3 A;  4IHQ A;  4ME4 A;  3IF6 A;  1FQG A;  4I38 A;  4WF0 A;  2H0T A;  1RCJ A;  2P08 A;  4JGO A;  3HVF A;  4JPM A;  4MCW A;  3C5A A;  3WS5 A;  5CX7 A;  1L2S A;  4UA7 A;  3SOI A;  5MC7 A;  5DJT A;  1VQQ A;  2QWS A;  4OLD A;  4HBT A;  2XA7 M;  3HLD A;  4KZB A;  2GDN A;  2O9C A;  3UPO A;  2FFF B;  1E3U D;  1YT4 A;  1J3W A;  5FI2 A;  3A3I A;  4DDS A;  3MZF A;  4BBV A;  2CC1 A;  3LIF A;  2Y2G A;  3VP1 A;  4OOM A;  3PBS A;  5HDC A;  3IF6 C;  2QKP A;  4X1M A;  1IKG A;  4KQO A;  1N9L A;  3DTE A;  3MKF A;  1AXB A;  5GHY A;  3VFF A;  3GR2 A;  1I2W A;  3OC2 A;  3SH7 A;  4H8R A;  4YOF A;  4RX2 A;  5GL9 A;  2XFT A;  2VZW A;  2K31 A;  3NOP C;  4GD6 A;  2WGW B;  3HUM A;  1FR1 A;  3G2Z A;  3T50 A;  5I94 A;  1K57 A;  5EVI D;  1TVF A;  1LI0 A;  3DTK A;  2QMI A;  4Z9Q A;  1U60 A;  2JKT M;  3FG8 A;  1GA0 A;  3EGD C;  3KX0 X;  4MDZ A;  3K3D A;  3JVV A;  3C8C A;  3HRE A;  2R9W A;  4Y3I A;  1K54 C;  2Z2M B;  4NXG A;  3VP3 A;  4CLC B;  3GVB A;  4KG5 A;  2EX8 A;  4GDN A;  4OVD A;  3IH9 A;  3UN7 A;  3W8K A;  3Q7V B;  5HZH A;  4Z1W A;  4Y15 A;  4ARZ A;  2WUQ A;  1CEF A;  3BFG A;  3RJU A;  1HLU P;  1PFL A;  2ZM8 A;  3ITB A;  3CAX A;  3LEQ A;  2HP6 A;  2G7U A;  4EXO A;  5CXW A;  3UMD A;  3M6H A;  5CEB A;  1MY8 A;  1BUL A;  2XDM A;  2XQZ A;  4OQ0 A;  5GHX A;  5HWW A;  1ERQ A;  4I3J A;  4E3I A;  5FAP A;  4HP9 A;  4I5S A;  4LV2 A;  4EV4 A;  4LEN A;  4QB8 A;  4LRX C;  1ONG A;  1BZA A;  1N9O A;  4N1H A;  1KDW A;  2WKQ A;  4E6W A;  1LSW A;  1SCW A;  5L10 A;  3EQU A;  2VX8 A;  3LUQ A;  2ZQC A;  4PM6 A;  5M18 A;  5DTK A;  3HUO A;  4OKP A;  1W63 Q;  4JGR A;  4S2L A;  4S2M A;  1ZKJ A;  4NEE D;  3HUN A;  5CHU A;  3JVU A;  1FIL A;  1E25 A;  3CJM A;  2Y55 A;  1PWC A;  2KOI A;  1L0E A;  3F1O B;  1T18 A;  2DCF A;  1P9W A;  3UPP A;  2BAS A;  4DF6 A;  3IX3 A;  3S7O A;  1UWN X;  2O0Y A;  3QNB A;  2HJ9 C;  4X55 A;  3CMZ A;  3LIB A;  3Q7Z A;  1YMX A;  3GDI A;  2W1T A;  2JE5 A;  2PU4 A;  1IFQ A;  1DRM A;  2V20 A;  4CLC A;  2E8I A;  2J3W A;  1OTE A;  2HP5 A;  3BYD A;  1S0W A;  1JNU A;  3UB5 P;  1N9N A;  3FWL A;  3V67 A;  1XJ3 A;  3NOU C;  3DTI A;  1G6O A;  3QP6 A;  2K2N A;  3MQ0 A;  2Z6D A;  1KGE A;  2B18 A;  3VV4 A;  5HAQ A;  1TS8 A;  4MBF A;  1OT6 A;  1N4O A;  1T1B A;  2JBF A;  3GRJ A;  4JBF A;  4WZ4 A;  3G2Y A;  2HDU A;  5EOE A;  1DP8 A;  5DJU A;  5LBR A;  5GLB A;  4R4R A;  3VFH A;  3PBO A;  4I3A A;  4KQQ A;  4WEJ A;  4CLC C;  5A93 A;  2B5R A;  4IBX A;  3ZHH A;  4LGW A;  3UO9 A;  1GSX A;  2HZ5 A;  4R3J A;  3VOY A;  3VOL A;  4PPR A;  1MZU A;  5G18 A;  5HD5 A;  3WRZ A;  4KZ6 A;  3CPT A;  5HD3 A;  1K25 A;  3EGX C;  3PBN A;  3BW6 A;  3PBT A;  2VEA A;  4EUV A;  4E3J A;  2EWV A;  5KSC A;  4GCZ A;  2XD5 A;  3ZG5 A;  5HFO A;  3NUL A;  3R7W A;  1Y54 A;  4FH2 A;  3ZNY A;  5HAR A;  4E3M A;  3PHY A;  4C75 A;  5EPH A;  1GSW A;  4PHT A;  3BFC A;  5G4Z A;  5GLC A;  2VV6 A;  4NKP A;  4UQI M;  3ISG A;  4G3K A;  1K4F A;  2I72 A;  5J3W A;  2QJ5 A;  5J7E A;  2HP9 A;  4ZDX A;  5GHZ A;  3OPR A;  4QU3 A;  3AGF A;  1XA1 A;  1S67 L;  2W3H A;  3F1P B;  3DWZ A;  2VJW A;  4DJ2 A;  4L9G A;  1SDN A;  3M2K A;  1FIK A;  1K4E A;  4E3K A;  4YFM A;  3PAE A;  3A3E A;  4JF5 A;  3NC8 A;  1YM1 A;  1IYP A;  4DKI A;  1KVM A;  1H5X A;  3O87 A;  4ESP A;  2OAQ 1;  5HAP A;  2VK3 A;  5JYO A;  4GKU A;  3BY8 A;  3VSL A;  1EWZ A;  5FDH A;  4EET B;  5FQK A;  1VEU A;  3E98 A;  2VA0 A;  3ZYT A;  4D60 A;  2HJE A;  3MR0 A;  1ALQ A;  1GHM A;  5CTM A;  4NET A;  3KYQ A;  4MLL A;  2EXA A;  1MBL A;  5CHM A;  2J9O A;  1MWR A;  5F1G A;  4K08 A;  4HY8 A;  1LL9 A;  2E8J A;  2PD8 A;  5M1A A;  2Y2H A;  4HI4 A;  1HD8 A;  1DP6 A;  1TF1 A;  2FFY A;  3R4K A;  4EW7 A;  2IWD A;  1CEG A;  3ZG7 B;  2JKR M;  1GHI A;  4MBK A;  1O7E A;  4DE1 A;  5IT5 A;  3IWO A;  2ZOI A;  3RFB A;  3B47 A;  3IF6 B;  1E4D A;  1FCN A;  4KZ4 A;  4G3W A;  3TE8 A;  3MS6 A;  1FCM A;  3UB7 A;  2OV5 A;  4UAA A;  3T4K A;  2JKG A;  5DF9 A;  5CGX A;  2M7U A;  2B02 A;  2PR5 A;  1DJA A;  2PBD P;  2JCH A;  5F6A A;  3FV7 A;  2Q9M A;  3HJI A;  5DTT A;  4WMC D;  1XGI A;  3SS5 A;  3EEH A;  1IYQ A;  4QY6 A;  3IXD A;  1CI9 A;  4ZRR A;  4LLO B;  1OPX A;  2DRW A;  2IWC A;  3RXW A;  3D72 A;  3LIC A;  2Y91 A;  4LRZ E;  4N92 A;  3DW0 A;  4UA6 A;  4KZ9 A;  4Q0I A;  4OON A;  2YKF A;  3S4X A;  3H7W A;  1KGF A;  4GNU A;  1XJ4 A;  4LRY C;  3ZG0 A;  5TFQ A;  1OJ5 A;  1BSG A;  4GD8 A;  4P6B A;  4YWZ A;  2A24 B;  2KLI A;  3N4I A;  3ZGA B;  4YIN A;  1XX2 A;  2FH5 A;  5EVL A;  3EOI A;  1YLW A;  5F69 A;  2P7J A;  4EWF A;  4JXS A;  5FAT A;  2Y8H A;  3MXR A;  2WKE A;  1YLT A;  4BEN A;  4EEP A;  1IEL A;  4ID4 A;  1BLH A;  4DE2 A;  3B3X A;  1DY6 A;  3IH8 A;  4X53 A;  1XXM A;  5J8X A;  4EBP A;  4PMA A;  3F1N A;  3UY6 A;  2WAE A;  4BD1 A;  1ZHH B;  3UDI A;  2ZC3 B;  2ZQ7 A;  4LCM A;  5DKL A;  3V5M A;  1SDE A;  1H8M A;  2Q0O A;  3ULF A;  2ZQD A;  3T4L A;  1MWU A;  4IUH A;  2WKP A;  3OOV A;  5EOO A;  4NG2 A;  3GTC A;  1KVL A;  4I39 A;  1Z09 A;  3HL9 A;  1HZO A;  4R0Q A;  2GZA A;  5M19 A;  4ARZ B;  4G3V A;  3MMH A;  4MN6 A;  2V8F A;  3UB9 A;  3A3F A;  5FL3 A;  5GLD A;  3U4L P;  2P04 A;  4Y7P A;  5K5B A;  3BEC A;  3IS2 A;  4O7D A;  3LO7 A;  4PM8 A;  3SZT A;  3MZD A;  1GHP A;  2D01 A;  5FAQ A;  2Y2M A;  1M6K A;  3ZVW A;  1LSV A;  2WZX A;  3LCE A;  1ESI A;  4M4X A;  3Q82 A;  1ONH A;  2Y2N A;  2LB5 A;  2YKH A;  5FEG A;  4GJ4 A;  1HVB A;  1L0G A;  4AFI A;  4KZ3 A;  2J8Y A;  2W1R A;  2A24 A;  2J3T D;  4FOF A;  3ZCZ A;  3ZQ5 A;  3OCN A;  3MKE A;  1LLB A;  4K91 A;  3ZG8 B;  1STZ A;  3S7Q A;  1OTI A;  2I9V A;  3CIT A;  1ODV A;  4F3L A;  2V9A A;  1MWT A;  5AVF A;  4ZBE A;  4CPK A;  1NYM A;  4K0X A;  3RXX A;  3ITA A;  4GHI A;  1GCE A;  1XJ2 A;  4II7 A;  3HLF A;  1PWG A;  1LL5 A;  1XFQ A;  5F68 A;  2OWH A;  1OT9 A;  5AQB A;  1PIO A;  2W1T B;  1BLC A;  3OBF A;  3G31 A;  4ETZ A;  2OLU A;  3RH8 B;  2Y2L A;  1JVJ A;  4LV3 A;  2EXB A;  3NY4 A;  3SH9 A;  4QY5 A;  3G35 A;  1E3U A;  5HPF A;  2JKT I;  4FTX A;  5GLA A;  4YNR A;  3UE1 A;  2XA7 S;  2X02 A;  1Y4O A;  1K57 C;  3V3R A;  1MPL A;  5FA7 A;  2ZL1 A;  2M7V A;  2WGI A;  4I3I A;  3CG5 A;  3QP2 A;  2D02 A;  5DFY A;  2P74 A;  1KDS A;  1OME A;  3G6O A;  3FYZ A;  4R1G A;  4OPR A;  4LFU A;  2Q9N A;  3UB6 A;  4FSF A;  1C3B A;  4IBR A;  3MXQ A;  3BM6 A;  2GNX A;  4X25 A;  2LB9 A;  4X69 A;  4EU0 A;  1EW0 A;  3K3C A;  4PM7 A;  2V1Z A;  1OTB A;  5EUA A;  5DF8 A;  5TJJ A;  4BD0 A;  5EVI A;  3CPT B;  3IX4 A;  3PXP A;  4DN0 A;  4HES A;  1W8Q A;  3ZNT A;  2Y4A A;  3LGO A;  1KGG A;  4HQA A;  3L9K A;  5DVA A;  3IHB A;  1S66 L;  3R7W B;  5HX9 A;  3W4O A;  2HDQ A;  3K2N A;  4FCF A;  1J9M A;  1YPR A;  3IXB A;  3B42 A;  5IS1 A;  3CHW P;  5F1F A;  4Y13 A;  3C7U A;  5FQQ A;  1MKM A;  3T1Q B;  1ZTU A;  3PBQ A;  1YAX A;  3CZD A;  5EM1 A;  4P6Z M;  3LI8 A;  4PM5 A;  1WE4 A;  2WAD A;  4OQH A;  3BWL A;  3VMA A;  4FH4 A;  1K55 A;  2WGV A;  1PNE A;  3PR6 A;  4S2I A;  3M2J A;  1T19 A;  1VM1 A;  4S2P A;  3BFE A;  1I2S A;  3O3V A;  3UPN A;  2ZC6 B;  1TDG A;  3V39 A;  4KQD A;  2ZM0 A;  2A3U A;  1V9Y A;  4NXE A;  2PYR A;  3GV9 A;  3H82 A;  4QHC A;  4XUX A;  2H10 A;  5FI6 A;  4WL9 A;  2QPN A;  2EA9 A;  1W8Y A;  1RP5 A;  3V3S A;  3UE3 A;  1BLS A;  2Y2P A;  5IU1 A;  1FSW A;  3W4Q A;  5A92 A;  1PW8 A;  2XRN A;  4EBL A;  1X0O A;  3T1S A;  1G6A A;  1VEU B;  1K55 C;  2JN7 A;  4S2N A;  1MXO A;  4Y17 A;  2Y79 A;  3DTM A;  4Y0O A;  1GSV A;  4E3O A;  1QMF A;  1DJB A;  2XD1 A;  3QHY A;  2M1C A;  2VV8 A;  3VOZ A;  1O07 A;  5HW3 A;  2G2W A;  1ES3 A;  2DNS A;  2PBY A;  1VHM A;  4HNB A;  5TR7 A;  3VE3 A;  1JTD A;  1F98 A;  3LY3 A;  4E3L A;  4F94 A;  3HBR A;  4ZTK A;  3OLO A;  2K7S A;  4U0T A;  5EVE A;  1ES5 A;  4JGQ A;  1GA9 A;  5CTN A;  5F82 A;  3GEC A;  2NUT C;  1BT5 A;  3UB8 A;  3KSI A;  5HSQ A;  1ERM A;  3I7J A;  3S1Y A;  5U47 A;  3GMW A;  3UDF A;  2VLG A;  5E2G A;  4IED A;  2NUP C;  1YLY A;  3IHA A;  3VP2 A;  4A5R A;  3OPH A;  4S2K A;  1CK3 A;  4N9K A;  3BLS A;  4JLF A;  1Y28 A;  4CQH A;  1FSY A;  1XJ6 A;  1M40 A;  1BLP A;  1PI5 A;  4OPZ A;  4KUK A;  1JWP A;  3TG9 A;  1D1J A;  4OOY A;  4Y0U A;  3A0S A;  3EWK A;  1S4R A;  1T1A A;  3IT9 A;  3C30 A;  1ZC2 A;  3A0R A;  4ZJ3 A;  3H7W B;  3T4J A;  1BTL A;  3IXH A;  5E2H A;  3MFD A;  4IJG A;  1YLZ A;  1F2K A;  4S2O A;  3QP5 A;  1IYS A;  5CRF A;  2ZLY A;  1TD5 A;  4IVI A;  2XH9 A;  4FD8 A;  3PBR A;  5DFX A;  2V1A A;  2GJ3 A;  4ETX A;  3MBZ A;  3O5Y A;  1FOF A;  1W79 A;  3MF0 A;  4DJ3 A;  3PAG A;  1T1C A;  4HP4 A;  2EFU A;  3CWF A;  1NRF A;  4MN5 A;  2ZMF A;  2Z2L B;  2QJ7 A;  4O01 A;  4MBH A;  2IA2 A;  2EFX A;  2VGL M;  4RYE A;  2ZQ8 A;  3OPP A;  3F1N B;  2O99 A;  4BLM A;  1XFN A;  2PAV P;  3A0V A;  2AVX A;  2QHK A;  3GQZ A;  4UQI S;  3NHQ A;  2H28 A;  4M3K A;  5FQI A;  2W27 A;  5KZH A;  4KUO A;  1NYY A;  2J9P A;  1ACF A;  2W3E A;  2VGK A;  3UE6 A;  3V50 A;  4R3B A;  4GDB A;  2UV0 E;  4E04 A;  4HIA A;  2WKR A;  4EQ1 A;  4QD4 A;  3E2L A;  3TSG A;  3BJN A;  4DXC A;  1CI8 A;  2ZD8 A;  4O0P A;  2P9V B;  2O9B A;  3WS2 A;  2WYX A;  4EEU A;  2HDS A;  5E2F A;  1N9B A;  3WS4 A;  4GOG A;  3IS2 B;  2JKR I;  5L8M A;  2UWX A;  3IXG A;  5FQJ A;  5DF7 A;  2IWB A;  2V0W A;  1PZO A;  3FZC A;  4GN2 A;  2ZMV A;  5A8B A;  3E4O A;  1HTZ A;  4PKY A;  1UGU A;  3E4Q A;  2W3D A;  4EBN A;  1K0K A;  1JWV A;  3T4O A;  4OLG A;  3TJZ C;  5EE8 A;  3W4P A;  3D3O A;  1YKD A;  4PM9 A;  4JF6 A;  3IF5 A;  4R6L A;  1YMS A;  1PI4 A;  2L4R A;  4OOL A;  3T1X A;  3C4P A;  3N8R A;  1YLJ A;  3ZDJ A;  2V2F F;  4L9F A;  2FZ0 A;  2V0U A;  1I5Q A;  3T4S A;  2BLS A;  1TDL A;  3BFF A;  3SW1 A;  2O9A A;  4ZAM A;  4F3L B;  4BQM A;  3FC7 A;  1IKI A;  1CQA A;  1WA9 A;  3NEC A;  1S1Z A;  1KE4 A;  3MJQ A;  4GHI B;  5HAI A;  5G4Y A;  4E6X A;  1LL8 A;  4KG2 A;  2A2L A;  4OQG A;  1PWD A;  1SKO A;  4BL2 A;  3MSH A;  3T4T A;  4DRT A;  2HPB A;  3C2W A;  1ZG4 A;  2EX9 A;  3A3J A;  1W5D A;  1OJG A;  2OLV A;  4KZ5 A;  2Y2O A;  2WK0 A;  4Q0H A;  1TS0 A;  3BFD A;  4WUJ A;  4R4S A;  5FQM A;  4H6J A;  2XF3 A;  1H3Q A;  4P0M A;  2H0Y A;  4KQR A;  4WMC A;  4HOI A;  2ACG A;  1XGJ A;  2P9V A;  3OPL A;  1W63 M;  4JXV A;  4WYY A;  4WLA A;  1KE0 A;  5HWT A;  3P09 A;  2ZL1 B;  3VP0 A;  1NY0 A;  1S4S A;  3O88 A;  4R70 A;  4RA7 A;  4MN7 A;  1Q2Q A;  4BBT A;  1SZV A;  4BJP A;  1NWZ A;  3NOT C;  2JHE A;  3LIE A;  4S2J A;  4L0L A;  2A49 A;  4GS9 A;  3M6B A;  3HLC A;  4ZJ2 A;  2XK1 A;  1NLZ A;  2G2U A;  2PDR A;  4EQI A;  4FUW A;  3Q1F A;  5EVI B;  1ES4 A;  3BQ8 A;  4IVK A;  4R3A A;  1XKZ A;  3HLW A;  1EI5 A;  1LSX A;  3LI9 A;  5CGS A;  3SS4 A;  2WKI A;  5I5L A;  1IOU A;  1K54 A;  1PRQ A;  1NRJ A;  4HJ6 A;  3D9Y A;  4OPQ A;  3HLE A;  1RGY A;  3A3D A;  1IYO A;  4QPR A;  3P7N A;  3QNC A;  4HJ4 A;  3DWK A;  3MZE A;  2PD7 A;  1MKI A;  1UWP X;  4X6T A;  2INW A;  5L2F A;  2Z6C A;  3KSF A;  1D7E A;  4XT2 A;  3G32 A;  1YLP A;  1ESU A;  5E43 A;  3LEZ A;  3C4O A;  1A0K A;  1NZO A;  3TW8 A;  3LR0 A;  4EER A;  4GZB A;  4R23 A;  3H82 B;  4JXW A;  4Q8I A;  1NJ4 A;  2L1M A;  5TGF A;  2W0N A;  4DE3 A;  3VE4 A;  1FCO A;  5HL1 A;  2OWJ A;  4X1L A;  3ZVT A;  4B93 A;  5A90 A;  4DDY A;  2J7V A;  1OTD A;  4WZ5 A;  3C7V A;  1OTA A;  4P85 A;  5DKK A;  2HV1 A;  1L0F A;  4CLC D;  1P0Z A;  2VGJ A;  4P87 A;  5CHJ A;  3Q81 A;  2HGV A;  1LI9 A;  3NDE A;  5TBM B;  2KX6 A;  3IQA A;  4N9L A;  4CJN A;  1PZP A;  3G4P A;  4WEK A;  1MWS A;  3LR5 A;  2ZC7 A;  2VKS A;  1NZU A;  3E0Y A;  4Y0T A;  3CI6 A;  2PU2 A;  2XGN A;  2ZM2 A;  3LIA A;  2EWW A;  2EX6 A;  3HJK A;  4X68 A;  3ICY A;  3WS0 A;  4NXF A;  1ZG6 A;  3UDX A;  4GB7 A;  4WZ5 C;  2HF6 A;  2PYP A;  4JKT A;  1LHY A;  2QYB A;  2J3T C;  5FEF A;  5EV0 A;  5KIZ A;  1K56 D;  3P01 A;  3NJA A;  5HL6 A;  1DJC A;  2ZQ9 A;  2WGW A;  4IUK A;  1ES2 A;  3BEB A;  5IHV A;  4EUZ A;  5FAO A;  1SHV A;  4NXB A;  5EVI C;  4BL3 A;  1YSQ A;  1S1Y A;  1VB6 A;  2EX2 A;  1XP4 A;  1QME A;  4DMZ A;  5FQ9 A;  3FPV A;  3NI9 A;  4Q0J A;  4DE0 A;  2JKF A;  4L9E A;  1H0M A;  3D4F A;  4DXB A;  1KE3 A;  5KMW A;  2HDR A;  3UME A;  3LR4 A;  5C5K A;  4B4Z A;  1L3L A;  3MXS A;  4MMN A;  3HLG A;  5F83 A;  4LV1 A;  3Q7V A;  3PTE A;  2R78 A;  3BRM A;  3LYX A;  1K38 A;  4QWO A;  2ZMA A;  5CEC A;  4KZ8 A;  3WWX A;  2XEP A;  3UE0 A;  3T4Q A;  2XR0 A;  4HH3 A;  3PYP A;  4WEL A;  5CGW A;  3OCL A;  4LPZ A;  4GW9 A;  1H8Y A;  3FKV A;  5TBM A;  3S7P A;  2CMN A;  3T1R A;  2MJ6 A;  3VP4 A;  2XRO A;  5HWV A;  5EFW A;  2RCX A;  1K56 A;  2PHY A;  2V1B A;  1XPB A;  3LY4 A;  2ZC4 B;  3EQV A;  4EES A;  3FKW A;  3RTY A;  4P6Z S;  4CLC E;  4B88 A;  1AWI A;  2Y2K A;  4OQI A;  2OOL A;  1BUE A;  4S2N C;  4R38 A;  4XUZ A;  5AQA A;  2ZOH A;  2XSS A;  4UHU A;  4OH0 A;  3HLB A;  5HDS A;  2B95 A;  3P98 A;  5L09 A;  1Q2P A;  3IBR A;  3F1O A;  4WM9 A;  1CJF A;  3GSG A;  1TS7 A;  3IBJ A;  3SH8 A;  4X56 A;  1Z6F A;  3BLM A;  4WBG A;  4QJG A;  3O86 A;  4U3T A;  5JYP A;  1IEM A;  2C5W B;  1K6R A;  2ZQA A;  2WKH A;  3S22 A;  3MFX A;  2ZJ9 A;  4C3Q A;  2KDK A;  3H9W A;  2VV7 A;  5CER A;  3KO6 A;  5KSH A;  4HHD A;  4OP8 A;  4B9O A;  1V9Z A;  2WZZ A;  3G34 A;  1ERO A;  1K6S A;  3CUE A;  2C6W B;  1SKF A;  5EEC A;  3NCK A;  4E3N A;  5FAS A;  2QZ6 A;  5EM0 A;  4NK3 A;  4WN5 A;  5HPI A;  4GLQ A;  1NXY A;  2W3F A;  2BTF P;  5AQ7 A;  3BY9 A;  1F5M A;  3KSH A;  1TEM A;  3HCY A;  4C6Y A;  3FPW A;  5AJG A;  3NDG A;  5AVE A;  2GX5 A;  1FR6 A;  3OZH A;  2X01 A;  3WRT A;  4KZA A;  3N8S A;  1VET B;  2ZC5 B;  3KSG A;  2W3G A;  4BMW A;  3G30 A;  4HBU A;  4BWI A;  1CF0 A;  1JWZ A;  1SKO B;  4O8G A;  5FDS A;  1WYB A;  2PRF A;  5AQ9 A;  2BG1 A;  3Q07 A;  1S6R A;  1P9R A;  4XXR A;  2J80 A;  1H8Z A;  4PKY G;  1TS6 A;  3ZG9 B;  1D06 A;  3CUE C;  3IWQ A;  2PR6 A;  3WS1 A;  3E4P A;  5A91 A;  4ZJ1 A;  2JC7 A;  3DBA A;  4H6J B;  3KYZ A;  3MQO A;  3ZFZ A;  5DTS A;  4B4X A;  3MQQ A;  1G68 A;  5FI7 A;  2XFS A;  2Y2I A;  1P97 A;  4MNR A;  3CLO A;  1PW1 A;  4N1X A;  5L07 A;  1G28 A;  2L0W A;  4UEY A;  3BQA A;  1YQS A;  1MC0 A;  4RQ9 A;  5J4E A;  3QP1 A;  4PAU A;  4MEZ A;  3W2Z A;  2H5S A;  3NIA A;  2X71 A;  2Y2J A;  3QP8 A;  4HH2 A;  4LCL A;  1BYW A;  5D3O A;  1RGZ A;  3E2K A;  1NLY A;  3F1P A;  3AGE A;  3TOI A;  1F9I A; 
#chains in the Genus database with same CATH homology
 4GS9 B;  2OAP 1;  2QJ5 A;  3B42 A;  4R3A A;  5IS1 A;  5J7E A;  1LSX A;  5F5Y A;  3LI9 A;  3B33 A;  4JGP A;  1MKM A;  1ZTU A;  1S67 L;  3LR3 A;  3PBQ A;  1YAX A;  5I5L A;  1IOU A;  4P6Z M;  3LI8 A;  3U2A A;  1LT0 A;  1NRJ A;  4HJ3 A;  2W3H A;  4HJ6 A;  3F1P B;  3BWL A;  2VJW A;  4DJ2 A;  4L9G A;  3PR6 A;  4Y2F A;  3C38 A;  1T19 A;  3LID A;  4QPR A;  3P7N A;  4HJ4 A;  2OAQ 1;  2VGL S;  4BBU A;  2DMW A;  2PD7 A;  4KQD A;  3S7N A;  4Y5F A;  1UWP X;  3LFV A;  1V9Y A;  2INW A;  4NXE A;  2PYR A;  2Z6C A;  1YSP A;  3BY8 A;  3KSF A;  1KOU A;  3H82 A;  1D7E A;  3TRC A;  4XT2 A;  4EET B;  4WL9 A;  3E98 A;  2ZBB A;  5HDD A;  2EA9 A;  2VA0 A;  3UE3 A;  3ZYT A;  3TW8 A;  5IU1 A;  2HJE A;  3LR0 A;  2XRN A;  4EER A;  3MR0 A;  3H82 B;  4XT2 B;  1X0O A;  2L1M A;  2PT7 A;  3KYQ A;  2JN7 A;  3EEA A;  2W0N A;  2Y79 A;  1DP9 A;  3VE4 A;  2OWJ A;  1GSV A;  4K08 A;  4HY8 A;  4B93 A;  2PD8 A;  1OTD A;  5DKK A;  1OTA A;  2HV1 A;  2M1C A;  4HI4 A;  4IHQ A;  2VV8 A;  4CLC D;  4ME4 A;  1DP6 A;  1TF1 A;  3R4K A;  1P0Z A;  4EW7 A;  2HGV A;  4I38 A;  4WF0 A;  2JKR M;  1VHM A;  4HNB A;  3VE3 A;  2P08 A;  4JGO A;  1F98 A;  5IT5 A;  4MCW A;  2ZOI A;  5TBM B;  2KX6 A;  3RFB A;  3B47 A;  3OLO A;  5CX7 A;  4WEK A;  2K7S A;  3LR5 A;  2VKS A;  3E0Y A;  5MC7 A;  4JGQ A;  5DJT A;  2QWS A;  4G3W A;  3GEC A;  3TE8 A;  2NUT C;  2XA7 M;  3CI6 A;  3UB7 A;  3UB8 A;  3KSI A;  3T4K A;  3LIA A;  2EWW A;  3HJK A;  2O9C A;  5DF9 A;  2M7U A;  2B02 A;  3ICY A;  2PR5 A;  5HSQ A;  4NXF A;  4BBV A;  5F6A A;  2VLG A;  3LIF A;  2HF6 A;  2PYP A;  3HJI A;  2QYB A;  4OOM A;  3PBS A;  3EEH A;  2NUP C;  5HDC A;  2QKP A;  2J3T C;  4ZRR A;  4KQO A;  4LLO B;  1OPX A;  5KIZ A;  3P01 A;  1N9L A;  3NJA A;  3D72 A;  5HL6 A;  3LIC A;  4LRZ E;  1Y28 A;  4CQH A;  1XJ6 A;  3OC2 A;  4IUK A;  4Q0I A;  2YKF A;  4YOF A;  3H7W A;  4NXB A;  4KUK A;  1XJ4 A;  1YSQ A;  1S1Y A;  1VB6 A;  2K31 A;  2VZW A;  3NOP C;  1OJ5 A;  3A0S A;  3EWK A;  4LRY C;  1S4R A;  4YWZ A;  4DMZ A;  1T1A A;  2A24 B;  2KLI A;  3FPV A;  3T50 A;  2FH5 A;  3C30 A;  3EOI A;  4Q0J A;  3A0R A;  4L9E A;  3H7W B;  5F69 A;  3T4J A;  2P7J A;  3UME A;  2JKT M;  3LR4 A;  4IJG A;  5C5K A;  2Y8H A;  3FG8 A;  3EGD C;  4MMN A;  3KX0 X;  4MDZ A;  3K3D A;  3JVV A;  3C8C A;  4EEP A;  2R78 A;  3LYX A;  1TD5 A;  4Y3I A;  4NXG A;  4CLC B;  3PBR A;  5DFX A;  2V1A A;  2GJ3 A;  4ETX A;  3T4Q A;  4HH3 A;  3O5Y A;  3F1N A;  3PYP A;  3MF0 A;  4DJ3 A;  4WEL A;  1T1C A;  1ZHH B;  4HP4 A;  3CWF A;  4MN5 A;  5DKL A;  2ZMF A;  2QJ7 A;  4O01 A;  5HZH A;  3OCL A;  4Z1W A;  4LPZ A;  4GW9 A;  4ARZ A;  1H8M A;  3ULF A;  2IA2 A;  2VGL M;  5TBM A;  3S7P A;  3T4L A;  4IUH A;  3F1N B;  2WKP A;  3OOV A;  2O99 A;  1XFN A;  2CMN A;  3A0V A;  4I39 A;  2QHK A;  2MJ6 A;  3CAX A;  4UQI S;  3NHQ A;  2XRO A;  2GZA A;  2H28 A;  5EFW A;  2G7U A;  4EXO A;  5HWV A;  2W27 A;  3UMD A;  4G3V A;  4KUO A;  4ARZ B;  3MMH A;  4MN6 A;  2PHY A;  2V1B A;  2W3E A;  3UE6 A;  3UB9 A;  5FL3 A;  2P04 A;  3EQV A;  4E04 A;  4EES A;  5HWW A;  4HIA A;  5K5B A;  2WKR A;  4I3J A;  3RTY A;  4EQ1 A;  3IS2 A;  4P6Z S;  4HP9 A;  3BJN A;  4CLC E;  4I5S A;  4O0P A;  2O9B A;  2OOL A;  4R38 A;  4LRX C;  4EEU A;  2D01 A;  1N9O A;  2ZOH A;  2WKQ A;  2XSS A;  3IS2 B;  2JKR I;  1LSV A;  5L8M A;  4M4X A;  1LSW A;  5HDS A;  5J3W A;  3IBR A;  3F1O A;  3EQU A;  2V0W A;  2LB5 A;  2YKH A;  2VX8 A;  4GJ4 A;  3LUQ A;  5A8B A;  2ZMV A;  1TS7 A;  3E4O A;  3IBJ A;  4PKY A;  1UGU A;  4AFI A;  3E4Q A;  1W63 Q;  2W3D A;  4JGR A;  4NEE D;  2W1R A;  3JVU A;  2A24 A;  2J3T D;  4FOF A;  3ZQ5 A;  2KOI A;  3F1O B;  3OCN A;  1T18 A;  3T4O A;  1P9W A;  3MFX A;  3TJZ C;  2BAS A;  3S7O A;  3D3O A;  1YKD A;  1UWN X;  2O0Y A;  2HJ9 C;  1STZ A;  3S7Q A;  1OTI A;  2I9V A;  2KDK A;  3CIT A;  3H9W A;  2VV7 A;  1ODV A;  4R6L A;  4F3L A;  3KO6 A;  2V9A A;  3LIB A;  5AVF A;  2L4R A;  3GDI A;  4OOL A;  5KSH A;  2W1T A;  4HHD A;  4B9O A;  1V9Z A;  4L9F A;  4GHI A;  1IFQ A;  1DRM A;  2FZ0 A;  2V0U A;  1XJ2 A;  4II7 A;  4CLC A;  2J3W A;  3T4S A;  1OTE A;  1XFQ A;  3CUE A;  5F68 A;  2OWH A;  3SW1 A;  2O9A A;  4F3L B;  1OT9 A;  3FC7 A;  1JNU A;  2W1T B;  1WA9 A;  4WN5 A;  3OBF A;  1N9N A;  3V67 A;  1S1Z A;  3MJQ A;  4GHI B;  5HPI A;  1XJ3 A;  4GLQ A;  3NOU C;  2W3F A;  1G6O A;  5G4Y A;  2K2N A;  3BY9 A;  1F5M A;  3KSH A;  4ETZ A;  1LL8 A;  3HCY A;  3MQ0 A;  2A2L A;  3RH8 B;  3FPW A;  5AJG A;  2Z6D A;  5AVE A;  3T4T A;  2GX5 A;  2B18 A;  3VV4 A;  1TS8 A;  3C2W A;  1OT6 A;  1T1B A;  1OJG A;  3KSG A;  2W3G A;  4BMW A;  4BWI A;  5HPF A;  2JKT I;  1DP8 A;  4O8G A;  4YNR A;  4Q0H A;  5DJU A;  5LBR A;  1TS0 A;  4WUJ A;  2XA7 S;  4H6J A;  1H3Q A;  3PBO A;  4I3A A;  1P9R A;  4WEJ A;  2J80 A;  4PKY G;  2M7V A;  4CLC C;  1TS6 A;  1D06 A;  4I3I A;  4HOI A;  3CUE C;  2D02 A;  5DFY A;  2PR6 A;  3E4P A;  1W63 M;  3G6O A;  1GSX A;  3DBA A;  3VOL A;  4WLA A;  4H6J B;  3KYZ A;  1MZU A;  5HWT A;  3UB6 A;  4FSF A;  5HD5 A;  3MQO A;  5HD3 A;  3EGX C;  1S4S A;  3PBN A;  3MXQ A;  3BW6 A;  3PBT A;  2GNX A;  2LB9 A;  2VEA A;  4R70 A;  4EUV A;  3MQQ A;  4MN7 A;  1EW0 A;  4EU0 A;  2EWV A;  3K3C A;  4BBT A;  4BJP A;  1NWZ A;  4GCZ A;  1OTB A;  3NOT C;  3R7W A;  2JHE A;  3LIE A;  4L0L A;  1P97 A;  5TJJ A;  3CLO A;  3PHY A;  4DN0 A;  3PXP A;  1GSW A;  4PHT A;  1G28 A;  2L0W A;  4GS9 A;  4UEY A;  5G4Z A;  3BQA A;  1MC0 A;  4RQ9 A;  4HQA A;  5J4E A;  4PAU A;  1NLZ A;  2VV6 A;  2PDR A;  3W2Z A;  4HH2 A;  1S66 L;  3R7W B;  1BYW A;  3K2N A;  4NKP A;  4UQI M;  3BQ8 A;  1NLY A;  3F1P A;  4G3K A;  1F9I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...