2P08A

Structure of the n-terminally truncated pas domain of signal transduction histidine kinase from nostoc punctiforme pcc 73102 with homology to the h-noxa/h-noba domain of the soluble guanylyl cyclase
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
107
structure length
107
Chain Sequence
MLSPELLAKAFPFHFAFSRNREIVQTGEVLERISPEPLVGKLIEQHFQINRPKILIDFDAISKQPRALFILEFLHNGMQLKGQMMYQPEEEVIFFLGSPWITDTTSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title PAS-mediated dimerization of soluble guanylyl cyclase revealed by signal transduction histidine kinase domain crystal structure.
pubmed doi rcsb
source organism Nostoc punctiforme
molecule tags Transferase
molecule keywords signal transduction histidine kinase
total genus 23
structure length 107
sequence length 107
chains with identical sequence B
ec nomenclature ec 2.7.3.-:
pdb deposition date 2007-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07701 HNOBA Heme NO binding associated
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.260 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2p08A00
2P04A 2P08A 4GJ4A
chains in the Genus database with same CATH superfamily
4NEED 1CJFA 5FA7A 3ZG7B 4K0XA 4OP8A 1BUEA 3ICYA 3T1QB 1LL8A 3CG5A 1V9YA 1NXYA 1PNEA 4R4RA 3SH8A 3EGXC 5DTTA 3SS4A 2P08A 1WYCA 4GDNA 2WK0A 5HWWA 5CEBA 2B18A 1P0ZA 2V0UA 5HX9A 5DTKA 4BENA 2E8JA 2DMWA 1NLZA 2H0TA 1EI5A 4QY5A 5FQ9A 2ZM8A 3JYIA 4I3JA 2OWJA 3HCYA 2IWBA 2YKHA 4BBVA 1K25A 3IXBA 3P01A 3PAGA 1W63M 1YLWA 1KE0A 5JYPA 3HLDA 2ZC4B 3G2ZA 2ZQ8A 3W4QA 5TJJA 4EWFA 1MPLA 2XFSA 4HOIA 3ISGA 4NKPA 1W63Q 4E04A 4UAAA 4Y3IA 3LO7A 1DJCA 4II7A 4P0MA 1I2SA 5CECA 3KSIA 4ZRRA 2P7JA 2V9AA 4E3JA 2Z6CA 1ZTUA 1YQSA 5F83A 1KVMA 4I39A 2HP5A 2XD5A 2HPBA 3R4KA 1LHYA 5DJUA 3IX8A 1DJAA 2C5WB 1D06A 3T4SA 3A3DA 4JLFA 3PR6A 3T4LA 4HQAA 1FQGA 2ZLYA 4GOGA 2J9PA 4OPRA 3LEQA 3H7WB 1XGIA 2M7UA 1PI5A 3MF0A 2FZ0A 3I7JA 5FQIA 1GA0A 3VOYA 3ZQ5A 4HH3A 4CLCA 4EBNA 5E2EA 4H6JB 5GLAA 2K7SA 2DCFA 3OCNA 3DTEA 2V1AA 1Q2QA 3MKFA 4JKTA 5F1GA 5M18A 4KUOA 2I9VA 1M40A 1M6KA 1OT9A 5HWVA 4GHIA 4WMCD 2VV6A 2XRNA 5L09A 3LUQA 4KQQA 2JC7A 4R70A 2XA7S 4ETZA 3RXXA 3IH9A 3T1XA 2ZL1B 3HUNA 4DF6A 3V39A 4IEDA 3VOZA 4PHTA 4IVIA 5HW3A 3KSFA 2QZ6A 1K56A 3IQAA 2W3HA 2Y2KA 4F3LA 4A5RA 1FILA 2IA2A 2WZZA 4GHIB 4B4ZA 3A3EA 1BT5A 4UQIM 5DF9A 5FSRA 5HL6A 4HIAA 1KE3A 2DNSA 2OOLA 1HVBA 1DRMA 1IELA 4C3QA 3UB8A 3AGDA 4Q0JA 1HLUP 1XPBA 4PMAA 1KVLA 2OWHA 2Y2OA 3T4TA 3Q7VB 3HL9A 3B42A 3IHBA 1E4DA 5HAQA 1BLPA 1TDLA 5J8XA 2PU2A 3O5YA 1D7EA 5C5KA 3UE3A 1QMEA 1JTDA 4YNRA 5EVLA 3ZCZA 5CEDA 3HLCA 3JPUA 5EFWA 2J80A 4JGQA 1EROA 1XA7A 4LRZE 2XDMA 4DE3A 4YINA 1OT6A 4OQIA 1OTIA 3LI9A 1J3WA 2BG1A 5EV0A 1EWZA 2A24B 2VLGA 3IF6A 4B9OA 1XJ3A 2V2FF 1L3LA 3NC8A 4JF6A 5I94A 4R6LA 5G18A 1L2SA 3GMWA 2P9VA 5EVEA 1SHVA 1XFNA 4ZDXA 1MWUA 4F94A 4UEYA 3BFFA 2ZD8A 1GA9A 3W4PA 2PR5A 2QKPA 2H0YA 5A93A 2P04A 4Z9QA 2WKQA 3IWOA 5KMWA 3GR2A 2ACGA 2WADA 1O07A 3GDIA 3UMEA 5D3OA 4BMWA 3GV9A 3UB6A 3HUOA 3BQAA 4UHUA 3PBSA 2OV5A 4EBPA 5GLDA 4R3BA 2Y59A 3M2JA 1MWRA 5FI6A 3CITA 4QU3A 4X68A 3W4OA 5F5YA 5FQKA 4I3IA 3N8SA 3H9WA 4LLOB 4C6YA 4HBUA 1SKOB 3WS4A 4GD8A 2XQZA 3Q81A 3HJIA 4OOYA 5AQ7A 3OLOA 1XFQA 2Y2LA 1GHMA 4IBRA 3V50A 3QP8A 1BYWA 1TS7A 1MKMA 3DTKA 4PPRA 3HLFA 4HP4A 2PD7A 4JF5A 4RX3A 4WM9A 2ZQDA 4MBHA 3HREA 3KYQA 2VV7A 3MMHA 2ZQ9A 1WYBA 4WEJA 1G6AA 3NOPC 4ZJ1A 4PM5A 2ZC6B 3N6IA 4HP9A 4GW9A 2K2NA 3VSLA 2C6WB 3WS1A 5AQ9A 3NOTC 3Q82A 1PZPA 4KZAA 1YKDA 3UPPA 3E2LA 2ZMVA 4MCWA 3D4FA 3LCEA 5GLCA 2INWA 2JKTM 5K5BA 2ZC3B 3CHWP 1NLYA 2Z2LB 5CXWA 1SCWA 2EFXA 4KQDA 3RTYA 4EXOA 3VMAA 2PRFA 3FKWA 4X53A 1VETA 3E4QA 3IF6C 2VGKA 4PAUA 4CLCC 2L0WA 3NCKA 4OP5A 3ZGAB 4KUKA 3VOLA 3KYZA 3TRCA 1JVJA 3DTMA 5M1AA 4DDSA 1NY0A 1S6RA 2IWDA 2H10A 1CQAA 1MC0A 5AQAA 3CI6A 5E2FA 4XXRA 3D9YA 4UA6A 3ZG0A 4Y7PA 3WRTA 5TFQA 3G35A 4HY8A 4PM9A 1IKIA 2OLUA 3VFHA 1K4EA 4FUWA 2DRWA 2V8FA 4OKPA 2ZM2A 4HJ6A 1IYSA 3D72A 5FDHA 3PTEA 4Q0HA 4LV0A 1OJ5A 4KZ9A 3V5MA 3MZFA 1CF0A 1GSVA 3NOUC 4AFIA 3UE0A 4DKIA 4KZ3A 4OPYA 1E3UD 1LL9A 1P97A 4ETXA 3OPRA 5CGSA 2YKFA 1SKFA 3LYXA 4DN0A 2GJ3A 4FH2A 3NDEA 3BFEA 2W27A 1ERQA 4E3IA 1UWNX 1NRFA 3C2WA 1K38A 4MN7A 4NXFA 2QPNA 4WELA 4RYEA 3IXHA 1N9OA 2JHEA 1V9ZA 5EECA 2D01A 2ZBBA 3HLEA 2Y2JA 4H6JA 4C75A 3KX0X 1KOUA 3OOVA 1Y54A 3TW8A 4N92A 4EESA 4NK3A 5AJGA 1F2KA 1Y4OA 1Z09A 3F1OA 4IUHA 3QP2A 2ZMAA 3ZG8B 1XA1A 2B95A 1FSYA 4GKUA 3HBRA 1T18A 4M4XA 2VJWA 1L0GA 1BZAA 3S7OA 3BM6A 2ZM0A 2ZQ7A 4X1LA 2VGJA 1FIKA 3QP6A 5CGXA 3PAEA 2Y55A 3PXPA 5GHYA 3MQ0A 4O01A 3Q7ZA 3IF6B 1YLJA 3BFCA 3TOIA 1KE4A 3A0RA 2PR6A 1DY6A 3MJQA 1P9WA 3H82A 4PM6A 3FPWA 3ULFA 1TS8A 3IX3A 4Y0UA 2G2UA 1DJBA 4QWOA 4WZ4A 1O7EA 3IWIA 3LR4A 3IHAA 1NZOA 1E3UA 4DE1A 4WEKA 4RVAA 3LR0A 1XXMA 3SW1A 3N8RA 4JF4A 4R3AA 2Q9MA 4P6ZM 1K6SA 5HZHA 1I5QA 3NECA 5IU1A 3E2KA 2GZAA 1SKOA 3G31A 1YM1A 3IX4A 4RA7A 3UDIA 4ESPA 3SS3A 3M6HA 4NXGA 5EUAA 1W8QA 2HP6A 1NZUA 4OOMA 4GS9A 4S2PA 1MKIA 5F68A 4K0WA 1JNUA 4EERA 1VB6A 1IYQA 2EWWA 4NXEA 3EQUA 1XX2A 2O99A 3MXRA 2UV0E 5DTSA 3MS6A 1I2WA 2JKGA 3DBAA 3NJAA 1JTGA 2V1ZA 5FI7A 1PYYA 4Y0TA 3DWZA 4LRYC 4HESA 4WUJA 1ONGA 3ZYTA 1PW8A 3HVFA 3MFXA 2O9CA 3E4OA 3T4QA 2G2WA 4EEPA 3PBNA 4LCMA 1N9LA 1P9RA 3QP5A 1ESUA 3NY4A 5M19A 2R78A 3IXDA 2JKRI 2ZC7A 3LY4A 4IHQA 3NBLA 3CZDA 4RX2A 2J3TD 4P6BA 4S2IA 2LB5A 4BL2A 5GHZA 1LSXA 3B33A 3NDGA 1OJGA 5CGWA 4DXBA 4H8RA 3VV4A 3BYDA 4OOLA 2QMIA 4KZ7A 3T1RA 2W3EA 4UA7A 1GHPA 1H8ZA 3RXWA 3BW6A 4S2KA 3PBTA 3GTCA 4I38A 4ME4A 5FAPA 4WF0A 1JWPA 1YLPA 4S2OA 3O87A 1TF1A 1S66L 3CLOA 5L2FA 3FC7A 3EEAA 3MQQA 5DFXA 2PBDP 3SH7A 5DKLA 4Y5FA 3DTIA 1VETB 4MNRA 1GCEA 1ZC2A 4R0QA 2JN7A 4EUZA 2CMNA 3WRZA 3T4OA 2BASA 3U4LP 3G34A 3CUEA 2ZC5B 4ZBEA 4HI4A 1PFLA 3PBQA 3LY3A 3GQZA 3MKEA 1YSQA 3L9KA 5A90A 1SDNA 5HDCA 5TGFA 3A3IA 3GRJA 1WA9A 3HLGA 4G3VA 3IBJA 1VHMA 1LSVA 5TBMB 5L8MA 1UWPX 1PW1A 1E25A 4XT2B 3O86A 1EW0A 4O7DA 4DDYA 5JYOA 5KSCA 2GDNA 4R1GA 5EVIB 2O0YA 4PKYA 5EVIA 5EE8A 2QYBA 4S2NC 2VA0A 3E4PA 3LEZA 4HJ4A 2KOIA 4N9KA 5DJTA 2EWVA 4O0PA 4BJPA 1Z6FA 2GX5A 4MLLA 1XJ2A 4S2JA 4N1XA 3OBFA 4Y2FA 4D2OA 2X71A 3T50A 4WYYA 5FL3A 5IHVA 4BBTA 4IBXA 1CEFA 2A24A 4GS9B 4CLCD 1T1AA 3MZDA 2WGVA 3IWQA 1LI9A 3WS0A 1HTZA 2O9BA 5HAPA 1F5MA 2PU4A 4YWZA 4DE2A 5FATA 1ES4A 4LFUA 2CC1A 2PYPA 2HF6A 2JKTI 1KDSA 2K31A 1GSXA 4P6ZS 4KQOA 3AGEA 5HPFA 5F1FA 4WZ5C 2FFFB 5DF8A 3S4XA 1PI4A 1ZG4A 1ALQA 4MBFA 3BEBA 4WBGA 3HJKA 3P98A 4DXCA 5EPHA 3G4PA 4JBFA 4PM7A 3LGOA 4HHDA 3OPHA 1BSGA 3CJMA 3NIAA 5HL1A 5A91A 3QNCA 4FTXA 1TD5A 3MSHA 5A8BA 1BTLA 1PRQA 4R4SA 3S1YA 5HARA 4JGOA 3TSGA 5F6AA 4QPRA 4OLGA 4IVKA 3CPTA 4ZJ2A 4FSFA 3FZCA 1YLZA 4KZBA 1G68A 4P85A 3T12B 1FCNA 3EEHA 3S22A 1KGEA 4I5SA 2VK3A 4B93A 3OPPA 4ZJ3A 4CPKA 4OPQA 3M2KA 5FI2A 2EFUA 4HBTA 2E8IA 4JXGA 3T4JA 4K08A 3ZFZA 2Y2MA 4GLQA 1ZG6A 4MBKA 1T1BA 5MC7A 4L0LA 2HDQA 4Q0IA 3EQVA 3IS2A 5CRFA 2RCXA 2Y2IA 3LR5A 1TVFA 4MMNA 4MN6A 3LICA 4KZ4A 3D3OA 1C3BA 2MJ6A 5HAIA 5HDSA 3CMZA 1SZVA 1T19A 3MR0A 4N9LA 3A3JA 4EU0A 3GVBA 1CK3A 1ES5A 1LLBA 4S2LA 3CPTB 2B5RA 2H5SA 2QWSA 3ZVTA 1ACFA 2M7VA 2FFYA 3BECA 3IF5A 4YOFA 4U0XA 5GHXA 2R9XA 2Q9NA 1MZUA 3V67A 4HH2A 1W5DA 1G5UA 2XFTA 1Y28A 1YAXA 1IEMA 3EOIA 3FWLA 4WZ5A 3ITAA 2PYRA 2W3FA 4EQIA 5FEFA 2J8YA 2JBFA 1YMXA 3F1NB 2R9WA 4JXWA 3EGDC 1F9IA 3A0VA 3G2YA 3BQ8A 4GDBA 3LR3A 2HZ5A 1S0WA 2Y2NA 4L9GA 3BY9A 1G6OA 4QJGA 1PWCA 4LV3A 3BFDA 3OPLA 2Z6DA 1L0EA 2QJ5A 3R7WB 1PWGA 1NYYA 4LGWA 5HDDA 3GSGA 4PM8A 4I3AA 3F1NA 4CQHA 3ZVWA 4FOFA 5IT5A 1S4SA 1XJ6A 3CWFA 1NWZA 4Y0OA 3UB9A 3F1OB 3ZG5A 1K57A 5TR7A 5EM1A 2M1CA 2XEPA 5HSQA 4DJ3A 3IBRA 2XGNA 3K3DA 4MEZA 4DE0A 2J7VA 5FASA 2PAVP 4XUZA 3MFDA 2WAFA 2KLIA 4Y13A 3UDFA 5E2GA 3KO6A 3IT9A 2W1TA 1OTBA 5GLBA 1YMSA 1STZA 4UQIS 4E3KA 2EX8A 5FDSA 3BLSA 5A92A 2WUQA 3G32A 3K3CA 4GJ4A 4BWIA 3LI8A 4G3KA 5LBRA 3R7WA 3S7NA 3BY8A 3Q07A 1OPXA 1KGFA 2A2LA 1RP5A 3CAXA 4L9FA 2Z2MB 4OVDA 3LIBA 3JVVA 4LRXC 1XGJA 4GNUA 3A0SA 2Y8HA 3BFGA 2VGLM 4EUVA 2ZQCA 5J7EA 1VQQA 5FQQA 4QHCA 3MBZA 2JKRM 3MXSA 4S2NA 3QNBA 3F1PB 5U47A 1NRJA 2PD8A 5EVID 5DVAA 1DP9A 4E3NA 3DAVA 2AVXA 5F69A 3DW0A 4R23A 4OQ0A 3H7WA 4WLAA 1LL5A 2QJ7A 1D1JA 2JCHA 1NYMA 3VSKA 4OPZA 1RGZA 4XUXA 4NG2A 4BBUA 3BWLA 3Q1FA 5L07A 3UPOA 3RJUA 1SDEA 1BLHA 1MXOA 2B02A 2XA7M 1PZOA 4WMCA 2BTFP 3RFBA 3LIEA 3B3XA 1L0FA 2ZQAA 3LIAA 1ES3A 3QHYA 4E3LA 2ZOIA 3H82B 2EX6A 4IUKA 4KG2A 1K57C 2HJ9C 3ITBA 4Q8IA 1ERMA 3V3SA 2KX6A 5DF7A 1IYPA 5EM0A 1WE4A 5E2HA 1OTDA 5HPIA 1N9NA 4JXVA 1TEMA 2Y2HA 1GSWA 2Y79A 3FG8A 1H5XA 4ZAMA 2EA9A 1FCMA 2Y2QA 3P09A 4P87A 1JWVA 2NUTC 2VX8A 1ODVA 5CHUA 1OTEA 2WKHA 5CERA 2KDKA 3FPVA 2PT7A 5FEGA 3VP4A 3C30A 4BQMA 3L7HA 1K6RA 1K54C 3UE6A 2VEAA 4DJ2A 1IKGA 4ARZB 3MZEA 1T1CA 1K4FA 3BRMA 4RQ9A 4IJGA 4S2MA 1LI0A 3PYPA 3KSGA 4QB8A 2A3UA 2XH9A 3HLWA 3HLBA 3KSHA 3TE8A 4D60A 5FAQA 4CLCB 4PKYG 3T1SA 2X02A 1KGGA 1YLYA 4EETB 4LV1A 3EWKA 2JE5A 4GB7A 4ARZA 4KG5A 2WGWA 3ZHHA 3C5AA 4OQGA 5FQJA 1TDGA 3LIFA 4X55A 4UA9A 1N9BA 4JXSA 1PWDA 2X01A 1CEGA 1K55A 4NXBA 3LFVA 4FH4A 1XKZA 5AVEA 5CX7A 1W8YA 3V3RA 1MY8A 1BLSA 5KSHA 1FR6A 4CJNA 4EQ1A 5J4EA 1YSPA 2WGWB 1ZHHB 4KQRA 1ES2A 2HDUA 4X69A 3WWXA 2WKPA 5DFYA 4HNBA 3SZTA 1K0KA 5CTNA 4N1HA 4CLCE 2O9AA 3W8KA 3P7NA 4BL3A 2WAEA 2Y2GA 2OSUA 1FOFA 4QD4A 1NJ4A 1AWIA 2HV1A 3TJZC 1S1YA 4JPMA 4K91A 1MBLA 1DP6A 4DMZA 2W3DA 3PHYA 2WKIA 2WZXA 4BLMA 3C4OA 2W0NA 3IXGA 1W79A 4FD8A 2J3TC 1RCJA 4HJ3A 2GNXA 4LENA 1IFQA 4KZ6A 3QP1A 4QY6A 4OLDA 5E43A 3MQOA 3UPNA 3BLMA 2XF3A 3VE3A 1ESIA 3DWKA 1BULA 4E6XA 1YT4A 3E0YA 1F98A 5GL9A 1QMFA 3VFFA 5BOHA 1RGYA 4U3TA 3SOIA 2V20A 3OCLA 3LIDA 2Q0OA 2HDRA 2HGVA 2QHKA 3NI9A 3ZNYA 3HUMA 2OLVA 4B88A 4LPZA 3G6OA 1XP4A 3OC2A 5KIZA 4YFMA 3FV7A 2OAQ1 2J9OA 3N7WA 4OONA 4WN5A 2EXBA 4ID4A 3B47A 4FCFA 4XT2A 1Q2PA 1GHIA 2ZL1A 1IOUA 2WKEA 3C8CA 1TS0A 2OAP1 1U60A 3VP1A 1MWTA 2L1MA 1FCOA 4GN2A 2V0WA 3W2ZA 2EXAA 3UE1A 5J3WA 1LSWA 1AXBA 3M6BA 3S7PA 1VEUA 3A3FA 3BJNA 1HD8A 2HP9A 1S4RA 3G30A 4E3MA 3UB7A 2WKRA 2PHYA 3N8LA 4M3KA 2W1RA 3PBRA 5HFOA 5AVFA 2XSSA 2WYXA 3N4IA 3PBOA 2XR0A 2VKSA 2P9VB 5CHJA 1DP8A 2HJEA 2ZOHA 2JKFA 1KDWA 3F1PA 2NUPC 3IH8A 4O8GA 2PDRA 3MXQA 5FAOA 1CI8A 2G7UA 5AQBA 2UWXA 2L4RA 4OQHA 3C7UA 3UN7A 1LT0A 4Y17A 4EEUA 2Y4AA 3AGFA 2HDSA 4MN5A 2WGIA 3VP3A 5G4ZA 3VE4A 4JGPA 2FH5A 3VP0A 3CUEC 3WS5A 1K54A 4L9EA 1L0DA 3C4PA 3ZDJA 1CI9A 2V8CA 4GD6A 2ZJ9A 2A49A 1FSWA 3GECA 1W7FA 3TG9A 3S7QA 4KG6A 3ZG9B 1H8MA 1YLTA 4X25A 4OH0A 5CTMA 2D02A 3U2AA 2RL3A 1UGUA 3C38A 1S1ZA 5EVIC 1S67L 2VV8A 4X56A 1ZKJA 1N4OA 1J9MA 3O88A 1H3QA 4G3WA 5HD5A 2P74A 4GZBA 3SH9A 4B4XA 1PIOA 2Y2PA 3QP4A 1X0OA 3UDXA 4LV2A 2VZWA 4DRTA 3FYZA 3NULA 5TBMA 2J3WA 1H0MA 3OZHA 1MWSA 2W3GA 3UMDA 3IS2B 4F3LB 4BD0A 4EV4A 4KZ8A 5F82A 3UNWA 5DKKA 4GCZA 4EBLA 1OTAA 3NHQA 5IS1A 2VGLS 1H8YA 3KYEA 2LB9A 2XROA 4KZ5A 4E3OA 3WS2A 2W1TB 1HZOA 4MDZA 4U0TA 3Q7VA 4BD1A 5HWTA 4Y15A 4EW7A 4ZTKA 5HD3A 1K56D 1TS6A 2XLNA 1FR1A 1ONHA 3JVUA 3UO9A 1G28A 2PBYA 1VEUB 2XK1A 2BLSA 5CHMA 1XJ4A 2Y91A 5KZHA 5L10A 5G4YA 2I72A 4R3JA 3SS5A 4LCLA 3E98A 5I5LA 4E6WA 3K2NA 4KENB 5EOOA 2V1BA 1K55C 2H28A 5FQMA 3T4KA 4X6TA 3ZNTA 3UY6A 3C7VA 1A0KA 1JWZA 3RH8B 1IYOA 4WL9A 4NETA 1VM1A 2EX2A 3FKVA 3VP2A 2EX9A 4X1MA 1OMEA 5EOEA 4Z1WA 4JGRA 1YPRA 3UB5P 1BLCA 2ZMFA 4HEFA 2IWCA 3O3VA 4R38A 2XD1A
chains in the Genus database with same CATH topology
4YWZA 4KUKA 4NEED 3VOLA 3KYZA 3KSHA 3TRCA 3TE8A 4CLCB 2PYPA 4PKYG 2HF6A 2JKTI 4EETB 2K31A 3EWKA 1MC0A 3ICYA 1GSXA 3CI6A 4P6ZS 4ARZA 4KQOA 1LL8A 5HPFA 1V9YA 3EGXC 3LIFA 2P08A 3HJKA 4HY8A 5HWWA 2B18A 1P0ZA 2V0UA 4HHDA 4HJ6A 4NXBA 3LFVA 2DMWA 3D72A 1NLZA 5AVEA 1TD5A 4Q0HA 5A8BA 5CX7A 4I3JA 4JGOA 2OWJA 3HCYA 5KSHA 5F6AA 4EQ1A 2YKHA 5J4EA 4QPRA 1OJ5A 1YSPA 4BBVA 1ZHHB 4FSFA 1GSVA 3NOUC 3P01A 1W63M 4AFIA 2WKPA 5DFYA 4HNBA 3EEHA 4I5SA 4B93A 5TJJA 4CLCE 1P97A 2O9AA 4ETXA 3P7NA 4HOIA 4NKPA 1W63Q 4E04A 2YKFA 3LYXA 4Y3IA 4DN0A 2GJ3A 2HV1A 4II7A 3TJZC 1S1YA 3KSIA 3T4JA 1DP6A 2W27A 4K08A 4ZRRA 4DMZA 2W3DA 3PHYA 2P7JA 4GLQA 2V9AA 1UWNX 2Z6CA 1ZTUA 3C2WA 1T1BA 2W0NA 4MN7A 5MC7A 4NXFA 4WELA 4L0LA 4Q0IA 4I39A 1N9OA 2JHEA 2J3TC 3EQVA 3IS2A 1V9ZA 3LR5A 3R4KA 4HJ3A 4MMNA 4MN6A 2GNXA 3LICA 2D01A 2ZBBA 2MJ6A 3D3OA 4H6JA 5DJUA 5HDSA 3KX0X 1IFQA 1KOUA 1T19A 1D06A 3OOVA 3T4SA 3MR0A 3MQOA 3TW8A 3PR6A 4EESA 4EU0A 3T4LA 4HQAA 3VE3A 5AJGA 3E0YA 3F1OA 4IUHA 1F98A 3H7WB 2M7UA 2QWSA 3MF0A 2FZ0A 2M7VA 3ZQ5A 4HH3A 4CLCA 1T18A 4M4XA 2VJWA 4YOFA 3S7OA 4H6JB 2K7SA 3OCLA 3LIDA 3PXPA 3OCNA 3MQ0A 4O01A 1MZUA 2HGVA 2QHKA 3V67A 4HH2A 2V1AA 3A0RA 4LPZA 3G6OA 4KUOA 3OC2A 2I9VA 2PR6A 5KIZA 1Y28A 1OT9A 1YAXA 5HWVA 3EOIA 3MJQA 4GHIA 2PYRA 2W3FA 2VV6A 2XRNA 2OAQ1 1P9WA 3H82A 3LUQA 3FPWA 4R70A 4WN5A 2XA7S 4ETZA 3ULFA 3B47A 4XT2A 1TS8A 1IOUA 3C8CA 1TS0A 2OAP1 3F1NB 4PHTA 3EGDC 1F9IA 3A0VA 3LR4A 3BQ8A 3KSFA 3LR3A 2L1MA 4L9GA 4WEKA 3BY9A 3LR0A 1G6OA 2W3HA 3SW1A 4F3LA 2V0WA 3W2ZA 4R3AA 2IA2A 4P6ZM 5J3WA 4GHIB 2Z6DA 1LSWA 5HZHA 3S7PA 5IU1A 3BJNA 4UQIM 2QJ5A 2GZAA 3R7WB 1S4RA 5DF9A 5HDDA 3UB7A 4I3AA 4NXGA 3F1NA 4CQHA 2WKRA 4HIAA 2PHYA 5HL6A 4FOFA 5IT5A 4OOMA 4GS9A 2OOLA 1S4SA 2W1RA 3PBRA 1DRMA 5F68A 3UB8A 1JNUA 1XJ6A 3CWFA 1NWZA 5AVFA 3UB9A 3F1OB 4Q0JA 4EERA 1VB6A 2XSSA 2EWWA 2OWHA 4NXEA 3T4TA 3EQUA 3PBOA 2M1CA 2VKSA 5HSQA 4DJ3A 1DP8A 2HJEA 2ZOHA 3IBRA 2O99A 3B42A 3K3DA 3F1PA 2NUPC 4O8GA 3DBAA 2PDRA 3MXQA 3NJAA 3O5YA 1D7EA 5C5KA 3UE3A 2G7UA 2KLIA 4YNRA 4LRYC 2L4RA 3KO6A 4WUJA 5EFWA 2W1TA 3ZYTA 1LT0A 4EEUA 1OTBA 2J80A 3MFXA 1STZA 2O9CA 3E4OA 4MN5A 4JGQA 4UQIS 3T4QA 4EEPA 3PBNA 5G4ZA 1N9LA 4LRZE 1P9RA 3VE4A 4JGPA 2FH5A 3CUEC 2R78A 4L9EA 1OT6A 3K3CA 4GJ4A 2JKRI 4BWIA 1OTIA 3LI9A 4IHQA 3LI8A 4G3KA 5LBRA 3R7WA 3S7NA 2J3TD 2LB5A 2A24B 2VLGA 3BY8A 1OPXA 1LSXA 3GECA 4B9OA 1XJ3A 2A2LA 3S7QA 3B33A 1OJGA 3CAXA 4L9FA 3VV4A 3LIBA 4OOLA 3JVVA 4LRXC 4R6LA 1H8MA 2W3EA 3BW6A 3PBTA 2D02A 3U2AA 1XFNA 2Y8HA 3A0SA 2VGLM 4I38A 4ME4A 4EUVA 5J7EA 4WF0A 1UGUA 4UEYA 3C38A 1S1ZA 2JKRM 2PR5A 1TF1A 2QKPA 1S66L 2P04A 3CLOA 1S67L 2VV8A 2WKQA 3FC7A 3EEAA 3MQQA 3GDIA 5DFXA 3UMEA 3F1PB 4BMWA 1NRJA 1H3QA 4G3WA 5HD5A 2PD8A 3UB6A 3BQAA 5DKLA 4Y5FA 1X0OA 3PBSA 2VZWA 1DP9A 5TBMA 2J3WA 5F69A 2W3GA 3UMDA 2JN7A 3H7WA 3IS2B 3CITA 4WLAA 4F3LB 2QJ7A 2CMNA 4BBUA 5F5YA 4I3IA 3T4OA 3BWLA 2BASA 3H9WA 4LLOB 5DKKA 3CUEA 4GCZA 4HI4A 2B02A 2XA7M 3PBQA 1OTAA 3NHQA 5IS1A 3HJIA 2VGLS 1YSQA 3RFBA 3LIEA 5HDCA 3OLOA 1XFQA 2LB9A 3LIAA 2XROA 1WA9A 2W1TB 1BYWA 1TS7A 4G3VA 2ZOIA 4MDZA 1MKMA 3IBJA 1VHMA 3H82B 1LSVA 4HP4A 5TBMB 5HWTA 5L8MA 2PD7A 1UWPX 4EW7A 5HD3A 4IUKA 1TS6A 4XT2B 2HJ9C 1EW0A 3JVUA 1G28A 3KYQA 2VV7A 2KX6A 2O0YA 4PKYA 1XJ4A 3MMHA 2QYBA 5G4YA 1OTDA 5HPIA 1N9NA 2VA0A 3E4PA 4HJ4A 4WEJA 2KOIA 3NOPC 1GSWA 5DJTA 2EWVA 3E98A 5I5LA 2Y79A 3FG8A 3K2NA 4HP9A 2V1BA 2K2NA 4GW9A 4O0PA 4BJPA 2EA9A 2NUTC 2VX8A 1ODVA 2H28A 1OTEA 2GX5A 3NOTC 3T4KA 2KDKA 3FPVA 1XJ2A 1YKDA 2PT7A 2ZMVA 4MCWA 3RH8B 3C30A 4WL9A 3OBFA 2INWA 4Y2FA 2JKTM 3UE6A 5K5BA 2VEAA 3T50A 1NLYA 4DJ2A 5FL3A 4ARZB 3RTYA 4KQDA 4BBTA 1T1CA 4CLCD 2A24A 4GS9B 4EXOA 1T1AA 4RQ9A 4IJGA 3PYPA 3KSGA 4Z1WA 4JGRA 3E4QA 2ZMFA 4PAUA 4CLCC 4R38A 2O9BA 2L0WA 1F5MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P04 A;  2P08 A;  4GJ4 A; 
#chains in the Genus database with same CATH topology
 4NEE D;  1CJF A;  5FA7 A;  3ZG7 B;  4K0X A;  4OP8 A;  1BUE A;  3ICY A;  3T1Q B;  1LL8 A;  3CG5 A;  1V9Y A;  1NXY A;  1PNE A;  4R4R A;  3SH8 A;  3EGX C;  5DTT A;  3SS4 A;  2P08 A;  1WYC A;  4GDN A;  2WK0 A;  5HWW A;  5CEB A;  2B18 A;  1P0Z A;  2V0U A;  5HX9 A;  5DTK A;  4BEN A;  2E8J A;  2DMW A;  1NLZ A;  2H0T A;  1EI5 A;  4QY5 A;  5FQ9 A;  2ZM8 A;  3JYI A;  4I3J A;  2OWJ A;  3HCY A;  2IWB A;  2YKH A;  4BBV A;  1K25 A;  3IXB A;  3P01 A;  3PAG A;  1W63 M;  1YLW A;  1KE0 A;  5JYP A;  3HLD A;  2ZC4 B;  3G2Z A;  2ZQ8 A;  3W4Q A;  5TJJ A;  4EWF A;  1MPL A;  2XFS A;  4HOI A;  3ISG A;  4NKP A;  1W63 Q;  4E04 A;  4UAA A;  4Y3I A;  3LO7 A;  1DJC A;  4II7 A;  4P0M A;  1I2S A;  5CEC A;  3KSI A;  4ZRR A;  2P7J A;  2V9A A;  4E3J A;  2Z6C A;  1ZTU A;  1YQS A;  5F83 A;  1KVM A;  4I39 A;  2HP5 A;  2XD5 A;  2HPB A;  3R4K A;  1LHY A;  5DJU A;  3IX8 A;  1DJA A;  2C5W B;  1D06 A;  3T4S A;  3A3D A;  4JLF A;  3PR6 A;  3T4L A;  4HQA A;  1FQG A;  2ZLY A;  4GOG A;  2J9P A;  4OPR A;  3LEQ A;  3H7W B;  1XGI A;  2M7U A;  1PI5 A;  3MF0 A;  2FZ0 A;  3I7J A;  5FQI A;  1GA0 A;  3VOY A;  3ZQ5 A;  4HH3 A;  4CLC A;  4EBN A;  5E2E A;  4H6J B;  5GLA A;  2K7S A;  2DCF A;  3OCN A;  3DTE A;  2V1A A;  1Q2Q A;  3MKF A;  4JKT A;  5F1G A;  5M18 A;  4KUO A;  2I9V A;  1M40 A;  1M6K A;  1OT9 A;  5HWV A;  4GHI A;  4WMC D;  2VV6 A;  2XRN A;  5L09 A;  3LUQ A;  4KQQ A;  2JC7 A;  4R70 A;  2XA7 S;  4ETZ A;  3RXX A;  3IH9 A;  3T1X A;  2ZL1 B;  3HUN A;  4DF6 A;  3V39 A;  4IED A;  3VOZ A;  4PHT A;  4IVI A;  5HW3 A;  3KSF A;  2QZ6 A;  1K56 A;  3IQA A;  2W3H A;  2Y2K A;  4F3L A;  4A5R A;  1FIL A;  2IA2 A;  2WZZ A;  4GHI B;  4B4Z A;  3A3E A;  1BT5 A;  4UQI M;  5DF9 A;  5FSR A;  5HL6 A;  4HIA A;  1KE3 A;  2DNS A;  2OOL A;  1HVB A;  1DRM A;  1IEL A;  4C3Q A;  3UB8 A;  3AGD A;  4Q0J A;  1HLU P;  1XPB A;  4PMA A;  1KVL A;  2OWH A;  2Y2O A;  3T4T A;  3Q7V B;  3HL9 A;  3B42 A;  3IHB A;  1E4D A;  5HAQ A;  1BLP A;  1TDL A;  5J8X A;  2PU2 A;  3O5Y A;  1D7E A;  5C5K A;  3UE3 A;  1QME A;  1JTD A;  4YNR A;  5EVL A;  3ZCZ A;  5CED A;  3HLC A;  3JPU A;  5EFW A;  2J80 A;  4JGQ A;  1ERO A;  1XA7 A;  4LRZ E;  2XDM A;  4DE3 A;  4YIN A;  1OT6 A;  4OQI A;  1OTI A;  3LI9 A;  1J3W A;  2BG1 A;  5EV0 A;  1EWZ A;  2A24 B;  2VLG A;  3IF6 A;  4B9O A;  1XJ3 A;  2V2F F;  1L3L A;  3NC8 A;  4JF6 A;  5I94 A;  4R6L A;  5G18 A;  1L2S A;  3GMW A;  2P9V A;  5EVE A;  1SHV A;  1XFN A;  4ZDX A;  1MWU A;  4F94 A;  4UEY A;  3BFF A;  2ZD8 A;  1GA9 A;  3W4P A;  2PR5 A;  2QKP A;  2H0Y A;  5A93 A;  2P04 A;  4Z9Q A;  2WKQ A;  3IWO A;  5KMW A;  3GR2 A;  2ACG A;  2WAD A;  1O07 A;  3GDI A;  3UME A;  5D3O A;  4BMW A;  3GV9 A;  3UB6 A;  3HUO A;  3BQA A;  4UHU A;  3PBS A;  2OV5 A;  4EBP A;  5GLD A;  4R3B A;  2Y59 A;  3M2J A;  1MWR A;  5FI6 A;  3CIT A;  4QU3 A;  4X68 A;  3W4O A;  5F5Y A;  5FQK A;  4I3I A;  3N8S A;  3H9W A;  4LLO B;  4C6Y A;  4HBU A;  1SKO B;  3WS4 A;  4GD8 A;  2XQZ A;  3Q81 A;  3HJI A;  4OOY A;  5AQ7 A;  3OLO A;  1XFQ A;  2Y2L A;  1GHM A;  4IBR A;  3V50 A;  3QP8 A;  1BYW A;  1TS7 A;  1MKM A;  3DTK A;  4PPR A;  3HLF A;  4HP4 A;  2PD7 A;  4JF5 A;  4RX3 A;  4WM9 A;  2ZQD A;  4MBH A;  3HRE A;  3KYQ A;  2VV7 A;  3MMH A;  2ZQ9 A;  1WYB A;  4WEJ A;  1G6A A;  3NOP C;  4ZJ1 A;  4PM5 A;  2ZC6 B;  3N6I A;  4HP9 A;  4GW9 A;  2K2N A;  3VSL A;  2C6W B;  3WS1 A;  5AQ9 A;  3NOT C;  3Q82 A;  1PZP A;  4KZA A;  1YKD A;  3UPP A;  3E2L A;  2ZMV A;  4MCW A;  3D4F A;  3LCE A;  5GLC A;  2INW A;  2JKT M;  5K5B A;  2ZC3 B;  3CHW P;  1NLY A;  2Z2L B;  5CXW A;  1SCW A;  2EFX A;  4KQD A;  3RTY A;  4EXO A;  3VMA A;  2PRF A;  3FKW A;  4X53 A;  1VET A;  3E4Q A;  3IF6 C;  2VGK A;  4PAU A;  4CLC C;  2L0W A;  3NCK A;  4OP5 A;  3ZGA B;  4KUK A;  3VOL A;  3KYZ A;  3TRC A;  1JVJ A;  3DTM A;  5M1A A;  4DDS A;  1NY0 A;  1S6R A;  2IWD A;  2H10 A;  1CQA A;  1MC0 A;  5AQA A;  3CI6 A;  5E2F A;  4XXR A;  3D9Y A;  4UA6 A;  3ZG0 A;  4Y7P A;  3WRT A;  5TFQ A;  3G35 A;  4HY8 A;  4PM9 A;  1IKI A;  2OLU A;  3VFH A;  1K4E A;  4FUW A;  2DRW A;  2V8F A;  4OKP A;  2ZM2 A;  4HJ6 A;  1IYS A;  3D72 A;  5FDH A;  3PTE A;  4Q0H A;  4LV0 A;  1OJ5 A;  4KZ9 A;  3V5M A;  3MZF A;  1CF0 A;  1GSV A;  3NOU C;  4AFI A;  3UE0 A;  4DKI A;  4KZ3 A;  4OPY A;  1E3U D;  1LL9 A;  1P97 A;  4ETX A;  3OPR A;  5CGS A;  2YKF A;  1SKF A;  3LYX A;  4DN0 A;  2GJ3 A;  4FH2 A;  3NDE A;  3BFE A;  2W27 A;  1ERQ A;  4E3I A;  1UWN X;  1NRF A;  3C2W A;  1K38 A;  4MN7 A;  4NXF A;  2QPN A;  4WEL A;  4RYE A;  3IXH A;  1N9O A;  2JHE A;  1V9Z A;  5EEC A;  2D01 A;  2ZBB A;  3HLE A;  2Y2J A;  4H6J A;  4C75 A;  3KX0 X;  1KOU A;  3OOV A;  1Y54 A;  3TW8 A;  4N92 A;  4EES A;  4NK3 A;  5AJG A;  1F2K A;  1Y4O A;  1Z09 A;  3F1O A;  4IUH A;  3QP2 A;  2ZMA A;  3ZG8 B;  1XA1 A;  2B95 A;  1FSY A;  4GKU A;  3HBR A;  1T18 A;  4M4X A;  2VJW A;  1L0G A;  1BZA A;  3S7O A;  3BM6 A;  2ZM0 A;  2ZQ7 A;  4X1L A;  2VGJ A;  1FIK A;  3QP6 A;  5CGX A;  3PAE A;  2Y55 A;  3PXP A;  5GHY A;  3MQ0 A;  4O01 A;  3Q7Z A;  3IF6 B;  1YLJ A;  3BFC A;  3TOI A;  1KE4 A;  3A0R A;  2PR6 A;  1DY6 A;  3MJQ A;  1P9W A;  3H82 A;  4PM6 A;  3FPW A;  3ULF A;  1TS8 A;  3IX3 A;  4Y0U A;  2G2U A;  1DJB A;  4QWO A;  4WZ4 A;  1O7E A;  3IWI A;  3LR4 A;  3IHA A;  1NZO A;  1E3U A;  4DE1 A;  4WEK A;  4RVA A;  3LR0 A;  1XXM A;  3SW1 A;  3N8R A;  4JF4 A;  4R3A A;  2Q9M A;  4P6Z M;  1K6S A;  5HZH A;  1I5Q A;  3NEC A;  5IU1 A;  3E2K A;  2GZA A;  1SKO A;  3G31 A;  1YM1 A;  3IX4 A;  4RA7 A;  3UDI A;  4ESP A;  3SS3 A;  3M6H A;  4NXG A;  5EUA A;  1W8Q A;  2HP6 A;  1NZU A;  4OOM A;  4GS9 A;  4S2P A;  1MKI A;  5F68 A;  4K0W A;  1JNU A;  4EER A;  1VB6 A;  1IYQ A;  2EWW A;  4NXE A;  3EQU A;  1XX2 A;  2O99 A;  3MXR A;  2UV0 E;  5DTS A;  3MS6 A;  1I2W A;  2JKG A;  3DBA A;  3NJA A;  1JTG A;  2V1Z A;  5FI7 A;  1PYY A;  4Y0T A;  3DWZ A;  4LRY C;  4HES A;  4WUJ A;  1ONG A;  3ZYT A;  1PW8 A;  3HVF A;  3MFX A;  2O9C A;  3E4O A;  3T4Q A;  2G2W A;  4EEP A;  3PBN A;  4LCM A;  1N9L A;  1P9R A;  3QP5 A;  1ESU A;  3NY4 A;  5M19 A;  2R78 A;  3IXD A;  2JKR I;  2ZC7 A;  3LY4 A;  4IHQ A;  3NBL A;  3CZD A;  4RX2 A;  2J3T D;  4P6B A;  4S2I A;  2LB5 A;  4BL2 A;  5GHZ A;  1LSX A;  3B33 A;  3NDG A;  1OJG A;  5CGW A;  4DXB A;  4H8R A;  3VV4 A;  3BYD A;  4OOL A;  2QMI A;  4KZ7 A;  3T1R A;  2W3E A;  4UA7 A;  1GHP A;  1H8Z A;  3RXW A;  3BW6 A;  4S2K A;  3PBT A;  3GTC A;  4I38 A;  4ME4 A;  5FAP A;  4WF0 A;  1JWP A;  1YLP A;  4S2O A;  3O87 A;  1TF1 A;  1S66 L;  3CLO A;  5L2F A;  3FC7 A;  3EEA A;  3MQQ A;  5DFX A;  2PBD P;  3SH7 A;  5DKL A;  4Y5F A;  3DTI A;  1VET B;  4MNR A;  1GCE A;  1ZC2 A;  4R0Q A;  2JN7 A;  4EUZ A;  2CMN A;  3WRZ A;  3T4O A;  2BAS A;  3U4L P;  3G34 A;  3CUE A;  2ZC5 B;  4ZBE A;  4HI4 A;  1PFL A;  3PBQ A;  3LY3 A;  3GQZ A;  3MKE A;  1YSQ A;  3L9K A;  5A90 A;  1SDN A;  5HDC A;  5TGF A;  3A3I A;  3GRJ A;  1WA9 A;  3HLG A;  4G3V A;  3IBJ A;  1VHM A;  1LSV A;  5TBM B;  5L8M A;  1UWP X;  1PW1 A;  1E25 A;  4XT2 B;  3O86 A;  1EW0 A;  4O7D A;  4DDY A;  5JYO A;  5KSC A;  2GDN A;  4R1G A;  5EVI B;  2O0Y A;  4PKY A;  5EVI A;  5EE8 A;  2QYB A;  4S2N C;  2VA0 A;  3E4P A;  3LEZ A;  4HJ4 A;  2KOI A;  4N9K A;  5DJT A;  2EWV A;  4O0P A;  4BJP A;  1Z6F A;  2GX5 A;  4MLL A;  1XJ2 A;  4S2J A;  4N1X A;  3OBF A;  4Y2F A;  4D2O A;  2X71 A;  3T50 A;  4WYY A;  5FL3 A;  5IHV A;  4BBT A;  4IBX A;  1CEF A;  2A24 A;  4GS9 B;  4CLC D;  1T1A A;  3MZD A;  2WGV A;  3IWQ A;  1LI9 A;  3WS0 A;  1HTZ A;  2O9B A;  5HAP A;  1F5M A;  2PU4 A;  4YWZ A;  4DE2 A;  5FAT A;  1ES4 A;  4LFU A;  2CC1 A;  2PYP A;  2HF6 A;  2JKT I;  1KDS A;  2K31 A;  1GSX A;  4P6Z S;  4KQO A;  3AGE A;  5HPF A;  5F1F A;  4WZ5 C;  2FFF B;  5DF8 A;  3S4X A;  1PI4 A;  1ZG4 A;  1ALQ A;  4MBF A;  3BEB A;  4WBG A;  3HJK A;  3P98 A;  4DXC A;  5EPH A;  3G4P A;  4JBF A;  4PM7 A;  3LGO A;  4HHD A;  3OPH A;  1BSG A;  3CJM A;  3NIA A;  5HL1 A;  5A91 A;  3QNC A;  4FTX A;  1TD5 A;  3MSH A;  5A8B A;  1BTL A;  1PRQ A;  4R4S A;  3S1Y A;  5HAR A;  4JGO A;  3TSG A;  5F6A A;  4QPR A;  4OLG A;  4IVK A;  3CPT A;  4ZJ2 A;  4FSF A;  3FZC A;  1YLZ A;  4KZB A;  1G68 A;  4P85 A;  3T12 B;  1FCN A;  3EEH A;  3S22 A;  1KGE A;  4I5S A;  2VK3 A;  4B93 A;  3OPP A;  4ZJ3 A;  4CPK A;  4OPQ A;  3M2K A;  5FI2 A;  2EFU A;  4HBT A;  2E8I A;  4JXG A;  3T4J A;  4K08 A;  3ZFZ A;  2Y2M A;  4GLQ A;  1ZG6 A;  4MBK A;  1T1B A;  5MC7 A;  4L0L A;  2HDQ A;  4Q0I A;  3EQV A;  3IS2 A;  5CRF A;  2RCX A;  2Y2I A;  3LR5 A;  1TVF A;  4MMN A;  4MN6 A;  3LIC A;  4KZ4 A;  3D3O A;  1C3B A;  2MJ6 A;  5HAI A;  5HDS A;  3CMZ A;  1SZV A;  1T19 A;  3MR0 A;  4N9L A;  3A3J A;  4EU0 A;  3GVB A;  1CK3 A;  1ES5 A;  1LLB A;  4S2L A;  3CPT B;  2B5R A;  2H5S A;  2QWS A;  3ZVT A;  1ACF A;  2M7V A;  2FFY A;  3BEC A;  3IF5 A;  4YOF A;  4U0X A;  5GHX A;  2R9X A;  2Q9N A;  1MZU A;  3V67 A;  4HH2 A;  1W5D A;  1G5U A;  2XFT A;  1Y28 A;  1YAX A;  1IEM A;  3EOI A;  3FWL A;  4WZ5 A;  3ITA A;  2PYR A;  2W3F A;  4EQI A;  5FEF A;  2J8Y A;  2JBF A;  1YMX A;  3F1N B;  2R9W A;  4JXW A;  3EGD C;  1F9I A;  3A0V A;  3G2Y A;  3BQ8 A;  4GDB A;  3LR3 A;  2HZ5 A;  1S0W A;  2Y2N A;  4L9G A;  3BY9 A;  1G6O A;  4QJG A;  1PWC A;  4LV3 A;  3BFD A;  3OPL A;  2Z6D A;  1L0E A;  2QJ5 A;  3R7W B;  1PWG A;  1NYY A;  4LGW A;  5HDD A;  3GSG A;  4PM8 A;  4I3A A;  3F1N A;  4CQH A;  3ZVW A;  4FOF A;  5IT5 A;  1S4S A;  1XJ6 A;  3CWF A;  1NWZ A;  4Y0O A;  3UB9 A;  3F1O B;  3ZG5 A;  1K57 A;  5TR7 A;  5EM1 A;  2M1C A;  2XEP A;  5HSQ A;  4DJ3 A;  3IBR A;  2XGN A;  3K3D A;  4MEZ A;  4DE0 A;  2J7V A;  5FAS A;  2PAV P;  4XUZ A;  3MFD A;  2WAF A;  2KLI A;  4Y13 A;  3UDF A;  5E2G A;  3KO6 A;  3IT9 A;  2W1T A;  1OTB A;  5GLB A;  1YMS A;  1STZ A;  4UQI S;  4E3K A;  2EX8 A;  5FDS A;  3BLS A;  5A92 A;  2WUQ A;  3G32 A;  3K3C A;  4GJ4 A;  4BWI A;  3LI8 A;  4G3K A;  5LBR A;  3R7W A;  3S7N A;  3BY8 A;  3Q07 A;  1OPX A;  1KGF A;  2A2L A;  1RP5 A;  3CAX A;  4L9F A;  2Z2M B;  4OVD A;  3LIB A;  3JVV A;  4LRX C;  1XGJ A;  4GNU A;  3A0S A;  2Y8H A;  3BFG A;  2VGL M;  4EUV A;  2ZQC A;  5J7E A;  1VQQ A;  5FQQ A;  4QHC A;  3MBZ A;  2JKR M;  3MXS A;  4S2N A;  3QNB A;  3F1P B;  5U47 A;  1NRJ A;  2PD8 A;  5EVI D;  5DVA A;  1DP9 A;  4E3N A;  3DAV A;  2AVX A;  5F69 A;  3DW0 A;  4R23 A;  4OQ0 A;  3H7W A;  4WLA A;  1LL5 A;  2QJ7 A;  1D1J A;  2JCH A;  1NYM A;  3VSK A;  4OPZ A;  1RGZ A;  4XUX A;  4NG2 A;  4BBU A;  3BWL A;  3Q1F A;  5L07 A;  3UPO A;  3RJU A;  1SDE A;  1BLH A;  1MXO A;  2B02 A;  2XA7 M;  1PZO A;  4WMC A;  2BTF P;  3RFB A;  3LIE A;  3B3X A;  1L0F A;  2ZQA A;  3LIA A;  1ES3 A;  3QHY A;  4E3L A;  2ZOI A;  3H82 B;  2EX6 A;  4IUK A;  4KG2 A;  1K57 C;  2HJ9 C;  3ITB A;  4Q8I A;  1ERM A;  3V3S A;  2KX6 A;  5DF7 A;  1IYP A;  5EM0 A;  1WE4 A;  5E2H A;  1OTD A;  5HPI A;  1N9N A;  4JXV A;  1TEM A;  2Y2H A;  1GSW A;  2Y79 A;  3FG8 A;  1H5X A;  4ZAM A;  2EA9 A;  1FCM A;  2Y2Q A;  3P09 A;  4P87 A;  1JWV A;  2NUT C;  2VX8 A;  1ODV A;  5CHU A;  1OTE A;  2WKH A;  5CER A;  2KDK A;  3FPV A;  2PT7 A;  5FEG A;  3VP4 A;  3C30 A;  4BQM A;  3L7H A;  1K6R A;  1K54 C;  3UE6 A;  2VEA A;  4DJ2 A;  1IKG A;  4ARZ B;  3MZE A;  1T1C A;  1K4F A;  3BRM A;  4RQ9 A;  4IJG A;  4S2M A;  1LI0 A;  3PYP A;  3KSG A;  4QB8 A;  2A3U A;  2XH9 A;  3HLW A;  3HLB A;  3KSH A;  3TE8 A;  4D60 A;  5FAQ A;  4CLC B;  4PKY G;  3T1S A;  2X02 A;  1KGG A;  1YLY A;  4EET B;  4LV1 A;  3EWK A;  2JE5 A;  4GB7 A;  4ARZ A;  4KG5 A;  2WGW A;  3ZHH A;  3C5A A;  4OQG A;  5FQJ A;  1TDG A;  3LIF A;  4X55 A;  4UA9 A;  1N9B A;  4JXS A;  1PWD A;  2X01 A;  1CEG A;  1K55 A;  4NXB A;  3LFV A;  4FH4 A;  1XKZ A;  5AVE A;  5CX7 A;  1W8Y A;  3V3R A;  1MY8 A;  1BLS A;  5KSH A;  1FR6 A;  4CJN A;  4EQ1 A;  5J4E A;  1YSP A;  2WGW B;  1ZHH B;  4KQR A;  1ES2 A;  2HDU A;  4X69 A;  3WWX A;  2WKP A;  5DFY A;  4HNB A;  3SZT A;  1K0K A;  5CTN A;  4N1H A;  4CLC E;  2O9A A;  3W8K A;  3P7N A;  4BL3 A;  2WAE A;  2Y2G A;  2OSU A;  1FOF A;  4QD4 A;  1NJ4 A;  1AWI A;  2HV1 A;  3TJZ C;  1S1Y A;  4JPM A;  4K91 A;  1MBL A;  1DP6 A;  4DMZ A;  2W3D A;  3PHY A;  2WKI A;  2WZX A;  4BLM A;  3C4O A;  2W0N A;  3IXG A;  1W79 A;  4FD8 A;  2J3T C;  1RCJ A;  4HJ3 A;  2GNX A;  4LEN A;  1IFQ A;  4KZ6 A;  3QP1 A;  4QY6 A;  4OLD A;  5E43 A;  3MQO A;  3UPN A;  3BLM A;  2XF3 A;  3VE3 A;  1ESI A;  3DWK A;  1BUL A;  4E6X A;  1YT4 A;  3E0Y A;  1F98 A;  5GL9 A;  1QMF A;  3VFF A;  5BOH A;  1RGY A;  4U3T A;  3SOI A;  2V20 A;  3OCL A;  3LID A;  2Q0O A;  2HDR A;  2HGV A;  2QHK A;  3NI9 A;  3ZNY A;  3HUM A;  2OLV A;  4B88 A;  4LPZ A;  3G6O A;  1XP4 A;  3OC2 A;  5KIZ A;  4YFM A;  3FV7 A;  2OAQ 1;  2J9O A;  3N7W A;  4OON A;  4WN5 A;  2EXB A;  4ID4 A;  3B47 A;  4FCF A;  4XT2 A;  1Q2P A;  1GHI A;  2ZL1 A;  1IOU A;  2WKE A;  3C8C A;  1TS0 A;  2OAP 1;  1U60 A;  3VP1 A;  1MWT A;  2L1M A;  1FCO A;  4GN2 A;  2V0W A;  3W2Z A;  2EXA A;  3UE1 A;  5J3W A;  1LSW A;  1AXB A;  3M6B A;  3S7P A;  1VEU A;  3A3F A;  3BJN A;  1HD8 A;  2HP9 A;  1S4R A;  3G30 A;  4E3M A;  3UB7 A;  2WKR A;  2PHY A;  3N8L A;  4M3K A;  2W1R A;  3PBR A;  5HFO A;  5AVF A;  2XSS A;  2WYX A;  3N4I A;  3PBO A;  2XR0 A;  2VKS A;  2P9V B;  5CHJ A;  1DP8 A;  2HJE A;  2ZOH A;  2JKF A;  1KDW A;  3F1P A;  2NUP C;  3IH8 A;  4O8G A;  2PDR A;  3MXQ A;  5FAO A;  1CI8 A;  2G7U A;  5AQB A;  2UWX A;  2L4R A;  4OQH A;  3C7U A;  3UN7 A;  1LT0 A;  4Y17 A;  4EEU A;  2Y4A A;  3AGF A;  2HDS A;  4MN5 A;  2WGI A;  3VP3 A;  5G4Z A;  3VE4 A;  4JGP A;  2FH5 A;  3VP0 A;  3CUE C;  3WS5 A;  1K54 A;  4L9E A;  1L0D A;  3C4P A;  3ZDJ A;  1CI9 A;  2V8C A;  4GD6 A;  2ZJ9 A;  2A49 A;  1FSW A;  3GEC A;  1W7F A;  3TG9 A;  3S7Q A;  4KG6 A;  3ZG9 B;  1H8M A;  1YLT A;  4X25 A;  4OH0 A;  5CTM A;  2D02 A;  3U2A A;  2RL3 A;  1UGU A;  3C38 A;  1S1Z A;  5EVI C;  1S67 L;  2VV8 A;  4X56 A;  1ZKJ A;  1N4O A;  1J9M A;  3O88 A;  1H3Q A;  4G3W A;  5HD5 A;  2P74 A;  4GZB A;  3SH9 A;  4B4X A;  1PIO A;  2Y2P A;  3QP4 A;  1X0O A;  3UDX A;  4LV2 A;  2VZW A;  4DRT A;  3FYZ A;  3NUL A;  5TBM A;  2J3W A;  1H0M A;  3OZH A;  1MWS A;  2W3G A;  3UMD A;  3IS2 B;  4F3L B;  4BD0 A;  4EV4 A;  4KZ8 A;  5F82 A;  3UNW A;  5DKK A;  4GCZ A;  4EBL A;  1OTA A;  3NHQ A;  5IS1 A;  2VGL S;  1H8Y A;  3KYE A;  2LB9 A;  2XRO A;  4KZ5 A;  4E3O A;  3WS2 A;  2W1T B;  1HZO A;  4MDZ A;  4U0T A;  3Q7V A;  4BD1 A;  5HWT A;  4Y15 A;  4EW7 A;  4ZTK A;  5HD3 A;  1K56 D;  1TS6 A;  2XLN A;  1FR1 A;  1ONH A;  3JVU A;  3UO9 A;  1G28 A;  2PBY A;  1VEU B;  2XK1 A;  2BLS A;  5CHM A;  1XJ4 A;  2Y91 A;  5KZH A;  5L10 A;  5G4Y A;  2I72 A;  4R3J A;  3SS5 A;  4LCL A;  3E98 A;  5I5L A;  4E6W A;  3K2N A;  4KEN B;  5EOO A;  2V1B A;  1K55 C;  2H28 A;  5FQM A;  3T4K A;  4X6T A;  3ZNT A;  3UY6 A;  3C7V A;  1A0K A;  1JWZ A;  3RH8 B;  1IYO A;  4WL9 A;  4NET A;  1VM1 A;  2EX2 A;  3FKV A;  3VP2 A;  2EX9 A;  4X1M A;  1OME A;  5EOE A;  4Z1W A;  4JGR A;  1YPR A;  3UB5 P;  1BLC A;  2ZMF A;  4HEF A;  2IWC A;  3O3V A;  4R38 A;  2XD1 A; 
#chains in the Genus database with same CATH homology
 4YWZ A;  4KUK A;  4NEE D;  3VOL A;  3KYZ A;  3KSH A;  3TRC A;  3TE8 A;  4CLC B;  2PYP A;  4PKY G;  2HF6 A;  2JKT I;  4EET B;  2K31 A;  3EWK A;  1MC0 A;  3ICY A;  1GSX A;  3CI6 A;  4P6Z S;  4ARZ A;  4KQO A;  1LL8 A;  5HPF A;  1V9Y A;  3EGX C;  3LIF A;  2P08 A;  3HJK A;  4HY8 A;  5HWW A;  2B18 A;  1P0Z A;  2V0U A;  4HHD A;  4HJ6 A;  4NXB A;  3LFV A;  2DMW A;  3D72 A;  1NLZ A;  5AVE A;  1TD5 A;  4Q0H A;  5A8B A;  5CX7 A;  4I3J A;  4JGO A;  2OWJ A;  3HCY A;  5KSH A;  5F6A A;  4EQ1 A;  2YKH A;  5J4E A;  4QPR A;  1OJ5 A;  1YSP A;  4BBV A;  1ZHH B;  4FSF A;  1GSV A;  3NOU C;  3P01 A;  1W63 M;  4AFI A;  2WKP A;  5DFY A;  4HNB A;  3EEH A;  4I5S A;  4B93 A;  5TJJ A;  4CLC E;  1P97 A;  2O9A A;  4ETX A;  3P7N A;  4HOI A;  4NKP A;  1W63 Q;  4E04 A;  2YKF A;  3LYX A;  4Y3I A;  4DN0 A;  2GJ3 A;  2HV1 A;  4II7 A;  3TJZ C;  1S1Y A;  3KSI A;  3T4J A;  1DP6 A;  2W27 A;  4K08 A;  4ZRR A;  4DMZ A;  2W3D A;  3PHY A;  2P7J A;  4GLQ A;  2V9A A;  1UWN X;  2Z6C A;  1ZTU A;  3C2W A;  1T1B A;  2W0N A;  4MN7 A;  5MC7 A;  4NXF A;  4WEL A;  4L0L A;  4Q0I A;  4I39 A;  1N9O A;  2JHE A;  2J3T C;  3EQV A;  3IS2 A;  1V9Z A;  3LR5 A;  3R4K A;  4HJ3 A;  4MMN A;  4MN6 A;  2GNX A;  3LIC A;  2D01 A;  2ZBB A;  2MJ6 A;  3D3O A;  4H6J A;  5DJU A;  5HDS A;  3KX0 X;  1IFQ A;  1KOU A;  1T19 A;  1D06 A;  3OOV A;  3T4S A;  3MR0 A;  3MQO A;  3TW8 A;  3PR6 A;  4EES A;  4EU0 A;  3T4L A;  4HQA A;  3VE3 A;  5AJG A;  3E0Y A;  3F1O A;  4IUH A;  1F98 A;  3H7W B;  2M7U A;  2QWS A;  3MF0 A;  2FZ0 A;  2M7V A;  3ZQ5 A;  4HH3 A;  4CLC A;  1T18 A;  4M4X A;  2VJW A;  4YOF A;  3S7O A;  4H6J B;  2K7S A;  3OCL A;  3LID A;  3PXP A;  3OCN A;  3MQ0 A;  4O01 A;  1MZU A;  2HGV A;  2QHK A;  3V67 A;  4HH2 A;  2V1A A;  3A0R A;  4LPZ A;  3G6O A;  4KUO A;  3OC2 A;  2I9V A;  2PR6 A;  5KIZ A;  1Y28 A;  1OT9 A;  1YAX A;  5HWV A;  3EOI A;  3MJQ A;  4GHI A;  2PYR A;  2W3F A;  2VV6 A;  2XRN A;  2OAQ 1;  1P9W A;  3H82 A;  3LUQ A;  3FPW A;  4R70 A;  4WN5 A;  2XA7 S;  4ETZ A;  3ULF A;  3B47 A;  4XT2 A;  1TS8 A;  1IOU A;  3C8C A;  1TS0 A;  2OAP 1;  3F1N B;  4PHT A;  3EGD C;  1F9I A;  3A0V A;  3LR4 A;  3BQ8 A;  3KSF A;  3LR3 A;  2L1M A;  4L9G A;  4WEK A;  3BY9 A;  3LR0 A;  1G6O A;  2W3H A;  3SW1 A;  4F3L A;  2V0W A;  3W2Z A;  4R3A A;  2IA2 A;  4P6Z M;  5J3W A;  4GHI B;  2Z6D A;  1LSW A;  5HZH A;  3S7P A;  5IU1 A;  3BJN A;  4UQI M;  2QJ5 A;  2GZA A;  3R7W B;  1S4R A;  5DF9 A;  5HDD A;  3UB7 A;  4I3A A;  4NXG A;  3F1N A;  4CQH A;  2WKR A;  4HIA A;  2PHY A;  5HL6 A;  4FOF A;  5IT5 A;  4OOM A;  4GS9 A;  2OOL A;  1S4S A;  2W1R A;  3PBR A;  1DRM A;  5F68 A;  3UB8 A;  1JNU A;  1XJ6 A;  3CWF A;  1NWZ A;  5AVF A;  3UB9 A;  3F1O B;  4Q0J A;  4EER A;  1VB6 A;  2XSS A;  2EWW A;  2OWH A;  4NXE A;  3T4T A;  3EQU A;  3PBO A;  2M1C A;  2VKS A;  5HSQ A;  4DJ3 A;  1DP8 A;  2HJE A;  2ZOH A;  3IBR A;  2O99 A;  3B42 A;  3K3D A;  3F1P A;  2NUP C;  4O8G A;  3DBA A;  2PDR A;  3MXQ A;  3NJA A;  3O5Y A;  1D7E A;  5C5K A;  3UE3 A;  2G7U A;  2KLI A;  4YNR A;  4LRY C;  2L4R A;  3KO6 A;  4WUJ A;  5EFW A;  2W1T A;  3ZYT A;  1LT0 A;  4EEU A;  1OTB A;  2J80 A;  3MFX A;  1STZ A;  2O9C A;  3E4O A;  4MN5 A;  4JGQ A;  4UQI S;  3T4Q A;  4EEP A;  3PBN A;  5G4Z A;  1N9L A;  4LRZ E;  1P9R A;  3VE4 A;  4JGP A;  2FH5 A;  3CUE C;  2R78 A;  4L9E A;  1OT6 A;  3K3C A;  4GJ4 A;  2JKR I;  4BWI A;  1OTI A;  3LI9 A;  4IHQ A;  3LI8 A;  4G3K A;  5LBR A;  3R7W A;  3S7N A;  2J3T D;  2LB5 A;  2A24 B;  2VLG A;  3BY8 A;  1OPX A;  1LSX A;  3GEC A;  4B9O A;  1XJ3 A;  2A2L A;  3S7Q A;  3B33 A;  1OJG A;  3CAX A;  4L9F A;  3VV4 A;  3LIB A;  4OOL A;  3JVV A;  4LRX C;  4R6L A;  1H8M A;  2W3E A;  3BW6 A;  3PBT A;  2D02 A;  3U2A A;  1XFN A;  2Y8H A;  3A0S A;  2VGL M;  4I38 A;  4ME4 A;  4EUV A;  5J7E A;  4WF0 A;  1UGU A;  4UEY A;  3C38 A;  1S1Z A;  2JKR M;  2PR5 A;  1TF1 A;  2QKP A;  1S66 L;  2P04 A;  3CLO A;  1S67 L;  2VV8 A;  2WKQ A;  3FC7 A;  3EEA A;  3MQQ A;  3GDI A;  5DFX A;  3UME A;  3F1P B;  4BMW A;  1NRJ A;  1H3Q A;  4G3W A;  5HD5 A;  2PD8 A;  3UB6 A;  3BQA A;  5DKL A;  4Y5F A;  1X0O A;  3PBS A;  2VZW A;  1DP9 A;  5TBM A;  2J3W A;  5F69 A;  2W3G A;  3UMD A;  2JN7 A;  3H7W A;  3IS2 B;  3CIT A;  4WLA A;  4F3L B;  2QJ7 A;  2CMN A;  4BBU A;  5F5Y A;  4I3I A;  3T4O A;  3BWL A;  2BAS A;  3H9W A;  4LLO B;  5DKK A;  3CUE A;  4GCZ A;  4HI4 A;  2B02 A;  2XA7 M;  3PBQ A;  1OTA A;  3NHQ A;  5IS1 A;  3HJI A;  2VGL S;  1YSQ A;  3RFB A;  3LIE A;  5HDC A;  3OLO A;  1XFQ A;  2LB9 A;  3LIA A;  2XRO A;  1WA9 A;  2W1T B;  1BYW A;  1TS7 A;  4G3V A;  2ZOI A;  4MDZ A;  1MKM A;  3IBJ A;  1VHM A;  3H82 B;  1LSV A;  4HP4 A;  5TBM B;  5HWT A;  5L8M A;  2PD7 A;  1UWP X;  4EW7 A;  5HD3 A;  4IUK A;  1TS6 A;  4XT2 B;  2HJ9 C;  1EW0 A;  3JVU A;  1G28 A;  3KYQ A;  2VV7 A;  2KX6 A;  2O0Y A;  4PKY A;  1XJ4 A;  3MMH A;  2QYB A;  5G4Y A;  1OTD A;  5HPI A;  1N9N A;  2VA0 A;  3E4P A;  4HJ4 A;  4WEJ A;  2KOI A;  3NOP C;  1GSW A;  5DJT A;  2EWV A;  3E98 A;  5I5L A;  2Y79 A;  3FG8 A;  3K2N A;  4HP9 A;  2V1B A;  2K2N A;  4GW9 A;  4O0P A;  4BJP A;  2EA9 A;  2NUT C;  2VX8 A;  1ODV A;  2H28 A;  1OTE A;  2GX5 A;  3NOT C;  3T4K A;  2KDK A;  3FPV A;  1XJ2 A;  1YKD A;  2PT7 A;  2ZMV A;  4MCW A;  3RH8 B;  3C30 A;  4WL9 A;  3OBF A;  2INW A;  4Y2F A;  2JKT M;  3UE6 A;  5K5B A;  2VEA A;  3T50 A;  1NLY A;  4DJ2 A;  5FL3 A;  4ARZ B;  3RTY A;  4KQD A;  4BBT A;  1T1C A;  4CLC D;  2A24 A;  4GS9 B;  4EXO A;  1T1A A;  4RQ9 A;  4IJG A;  3PYP A;  3KSG A;  4Z1W A;  4JGR A;  3E4Q A;  2ZMF A;  4PAU A;  4CLC C;  4R38 A;  2O9B A;  2L0W A;  1F5M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...