2HF6A

Solution structure of human zeta-cop
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
149
structure length
149
Chain Sequence
MEALILEPSLYTVKAILILDNDGDRLFAKYYDDTYPSVKEQKAFEKNIFNKTHRTDSEIALLEGLTVVYKSSIDLYFYVIGSSYENELMLMAVLNCLFDSLSQMLRKNVEKRALLENMEGLFLAVDEIVDGGVILESDPQQVVHRVALR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Coatomer subunit zeta-1
publication title Solution structure of human zeta-COP: direct evidences for structural similarity between COP I and clathrin-adaptor coats
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 42
structure length 149
sequence length 149
ec nomenclature
pdb deposition date 2006-06-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.60 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2hf6A00
5MC7A 2JKRI 2VGLM 4UQIS 2JKTI 2XA7M 1W63M 2HF6A 4P6ZM 1W63Q 4UQIM 1NRJA 4NEED 2FH5A 2VGLS 2JKRM 3TJZC 2JKTM 2XA7S 4P6ZS
chains in the Genus database with same CATH superfamily
1PI5A 1RP5A 3VP4A 3P09A 3VOYA 5KZHA 4OQ0A 4ESPA 5FEFA 3ZG0A 1CK3A 1FCNA 1PRQA 4Y0UA 4R38A 3KYEA 2OWJA 2Z6DA 4QB8A 2XA7S 1LHYA 2WGWB 3OBFA 1VQQA 4JGQA 2JKTI 2HDSA 1DJBA 3P7NA 3GMWA 1PW1A 3FG8A 4GS9A 4UHUA 1L0EA 4WZ5C 5CGXA 2WZZA 4N1HA 3JVVA 2R9XA 3HLFA 4MDZA 2ZQ7A 1FQGA 1JWPA 2EWWA 1L3LA 4P85A 2JKTM 3LIDA 4Y17A 3GVBA 1LSVA 3HUMA 4I3IA 2C5WB 5HSQA 3C8CA 3HUNA 1G6OA 5MC7A 1TVFA 1YLTA 1DP8A 4XUZA 4IUKA 3T50A 4BLMA 4GHIB 2EFXA 3OPHA 5J3WA 4XT2A 4U0XA 1I2WA 4MBHA 4NEED 4N1XA 4OOLA 3RH8B 3BFFA 4DXBA 2HF6A 1MZUA 4S2LA 3T4OA 4WN5A 4OOMA 1HTZA 3NHQA 1FR1A 1MPLA 3F1OB 3IWQA 5HZHA 4WELA 1G68A 5HW3A 4ETZA 2BG1A 4KG5A 3A3EA 3ISGA 5EVIB 1E3UD 2EXBA 5TFQA 5F1GA 4F3LB 5DF7A 4PAUA 1FOFA 4I5SA 1OTDA 4X53A 5HPFA 4DE2A 5A93A 5I94A 5JYOA 3OZHA 3SS4A 4LGWA 3V50A 4X1LA 4IVIA 2Y2KA 5K5BA 1MWUA 2Y2GA 4ZAMA 2O99A 4OLGA 2EX8A 2WYXA 3IQAA 5EE8A 3ZHHA 4QY5A 4X55A 3E2KA 2ZQ8A 4BBUA 1KGFA 1OJ5A 5A8BA 3IT9A 4ZBEA 3DBAA 3MQOA 4MNRA 3M2KA 1QMFA 4LV3A 3TG9A 2QHKA 5L8MA 2H10A 2H5SA 3TSGA 1XGJA 2UWXA 2HZ5A 2JKRI 3C4PA 5HL1A 1OTEA 3MSHA 3Q7VB 3BRMA 4EU0A 4ZDXA 2O9CA 4BJPA 2JHEA 4WBGA 2ZMAA 3UMDA 2HP5A 2J9OA 3N6IA 1T1BA 4HJ6A 1K4EA 1T19A 4ZTKA 4BD0A 1TDLA 2HJEA 2JKRM 2D02A 3UDXA 5FASA 2W3HA 4OP5A 2J7VA 3LI9A 1WE4A 3UNWA 1V9ZA 3IBJA 1LI9A 2BLSA 4GNUA 4PM7A 3B33A 2ZL1A 4JXSA 2V0WA 2Z2LB 3HLEA 5EPHA 1KGGA 5CGWA 3O5YA 5IT5A 2FH5A 2Y2IA 1LI0A 1CI9A 4OKPA 2WKQA 5CTMA 1W8YA 3E98A 2K31A 1YLPA 5E2GA 5AQAA 1G28A 3K3CA 1L0GA 4MBKA 5JYPA 4PM5A 3LIBA 3R4KA 1L2SA 1ZG6A 3BFCA 1OMEA 4S2PA 4Q8IA 5F1FA 2GDNA 2O9AA 4ZJ2A 2PR6A 3TW8A 3K3DA 3UY6A 2X01A 4LRXC 4L9FA 2D01A 3LR4A 1XXMA 1P9RA 5EV0A 5HPIA 3C7VA 4C3QA 3IS2B 4H6JA 4YFMA 2KX6A 2Y2HA 2PYRA 1H8ZA 5HWTA 4IVKA 2NUPC 1KVMA 1DRMA 4S2NC 4EWFA 4Y13A 2EWVA 1GA0A 2LB9A 2VGLM 3KO6A 5FAPA 2Q9MA 2VEAA 4XXRA 3B47A 4Q0HA 4HI4A 4WZ5A 3UE3A 2PU2A 3M2JA 4LV0A 3LR3A 5FL3A 1CEGA 3B3XA 3PHYA 4BD1A 1AWIA 3B42A 2ZM0A 3N4IA 4P6ZS 3V3RA 1K56A 3T1RA 4P87A 5A92A 4HNBA 4CLCA 2W1TA 3LO7A 1YSQA 4DKIA 3UB7A 2P9VB 3E4PA 1JVJA 5L07A 4CJNA 1PYYA 3BECA 3R7WB 1NYMA 3A0VA 5HAIA 4R6LA 2X71A 5FAOA 4KUKA 1CEFA 3VE4A 4OQGA 2V9AA 1YQSA 2HDUA 3NC8A 5DJTA 5GLCA 4KZ4A 1DJAA 2R78A 4Q0IA 3E4QA 3IF6A 5L10A 1N9NA 3CI6A 3IHAA 1XJ3A 3H9WA 1W63Q 3IH9A 2JE5A 3FYZA 5KMWA 3HCYA 3CPTA 4IHQA 3PBRA 4Y0TA 2A2LA 3JYIA 3T1XA 1ES5A 2QPNA 3ZGAB 3T1QB 1ODVA 3WS5A 1HVBA 4PM6A 1YLWA 1DP6A 4MCWA 5HAQA 4K0WA 2XRNA 3NBLA 1HLUP 3MJQA 5EUAA 3KX0X 3G2ZA 3HVFA 1A0KA 4OH0A 2Y2OA 3NY4A 4EESA 5TR7A 3H7WA 4GDBA 3HBRA 3MFDA 5AQBA 4LFUA 5CHJA 3T4TA 4H8RA 1LSXA 3VV4A 3E2LA 4X56A 2WKHA 3PR6A 5F82A 4EBPA 5HX9A 4OQIA 1S67L 3D72A 2OOLA 4KG2A 4YWZA 4RX3A 3LI8A 3IWOA 1KDSA 2VJWA 3VP3A 2PAVP 1MKMA 3IHBA 5DTSA 4B4ZA 1K6RA 1BLHA 1KGEA 4KUOA 1P97A 2PR5A 5FA7A 4DDYA 1RGZA 2W3EA 1SKFA 2V20A 2HV1A 2J3TD 5FQQA 2CMNA 1E4DA 2VV8A 3NULA 3F1PB 1W8QA 2HP6A 2WKIA 3UB5P 5J4EA 2XGNA 1I5QA 1N9LA 3PXPA 2WZXA 3OLOA 5CGSA 2XH9A 4S2JA 3EQUA 4DXCA 5E2FA 3CWFA 4DE3A 2XSSA 4E3NA 2ZQ9A 4LPZA 4KENB 1TS7A 4OPQA 5EVIC 1NYYA 3IH8A 3N8RA 4HBUA 1SKOA 2BASA 5J7EA 4LCMA 4GCZA 1YLJA 3WS2A 4I3AA 2RL3A 5HWWA 3ZYTA 3IXDA 5HD5A 1IEMA 1G6AA 4KZ5A 4OPYA 4S2NA 4JXWA 4IBXA 2PT7A 4ARZB 4U0TA 3FKVA 2IWBA 2VLGA 1NJ4A 1KE3A 1BLPA 4JBFA 5D3OA 2W3GA 3MZFA 3HLBA 1XA1A 3KYZA 4N92A 2A49A 4GLQA 4LV2A 5FI7A 3Q07A 5IS1A 4CQHA 1YKDA 1K4FA 3VSKA 5DTTA 5AVFA 1ACFA 3BLSA 4R0QA 4Y15A 4BL2A 3BEBA 4Z9QA 3DWZA 5AJGA 2XEPA 1Q2QA 2Y8HA 1K54A 5LBRA 2GX5A 1PWCA 2XA7M 3S1YA 3HJKA 4E3OA 1WYCA 4O0PA 3ZNYA 3Q81A 5F68A 3SH7A 4AFIA 3MMHA 4PPRA 3NIAA 3F1NB 2GZAA 1ES4A 5HAPA 3IXGA 3ZG5A 1P9WA 4UAAA 1ONHA 1K56D 4GN2A 4JGRA 3FPVA 1JTGA 3UN7A 3HUOA 3W2ZA 1T18A 3MBZA 5CRFA 4CLCD 3L7HA 2H28A 2UV0E 5DFYA 4XUXA 1MKIA 2PYPA 3ZVWA 4KZBA 3IX4A 2XFSA 1TS0A 5GLBA 3PBTA 2JN7A 4KZ7A 3KSFA 4ZJ3A 3KSHA 1F5MA 3NECA 4DE0A 3NOUC 2YKFA 1H3QA 1RGYA 1S0WA 2PRFA 1M6KA 5M19A 1K0KA 2FFFB 4OVDA 3VMAA 2WGWA 2ZBBA 3FKWA 3FV7A 3C5AA 4GD8A 1PZOA 4M3KA 3BLMA 3QP1A 1D06A 3MKEA 4WM9A 3CG5A 3T4QA 5EVLA 5KSHA 1YT4A 5CERA 2L0WA 3ITBA 1FCOA 3SOIA 3EWKA 1OT6A 4Y0OA 5AQ9A 2H0YA 3OC2A 2JC7A 5GHXA 3BY9A 3S22A 4GHIA 2A24B 2HP9A 3O3VA 2PU4A 2EX9A 4PKYG 4MN5A 1Z09A 2ZC4B 4R3BA 4CPKA 3ZVTA 3IXBA 2JCHA 1ESIA 1YSPA 2YKHA 4LRYC 1Y54A 5EFWA 1E25A 4R1GA 2WGIA 4MLLA 3F1OA 4MBFA 3G34A 4RQ9A 3OPPA 3WRTA 2J3WA 2ZL1B 1S6RA 3PBQA 2ZC6B 3NDEA 2VKSA 3MZEA 3A3DA 3M6BA 3V5MA 1VHMA 5L09A 4N9KA 4QPRA 2G2WA 4F3LA 1NZUA 3CZDA 4E3LA 4HQAA 3UO9A 1K25A 5I5LA 4DN0A 5CHUA 2XK1A 1I2SA 1ZC2A 4ME4A 4LV1A 1BULA 2OLVA 5J8XA 4PHTA 4R23A 4R4RA 4QJGA 1BZAA 5TBMA 2B95A 4X68A 3VOLA 3CUEA 1Q2PA 3D4FA 1CF0A 4WYYA 3BY8A 1D7EA 1LL5A 1YMXA 3LICA 5AVEA 2XF3A 2ZM2A 1LT0A 3T4KA 1S66L 4A5RA 4BL3A 2V0UA 3Q7VA 1NRJA 1QMEA 5FDHA 2Y4AA 1TF1A 3G30A 1XFNA 2JKGA 3MS6A 3PYPA 1TS8A 1YLZA 5FDSA 3CJMA 2X02A 4WEKA 3LEZA 2ZJ9A 1FILA 3WS0A 1WYBA 4L9EA 3EEAA 4DF6A 3KSGA 4ETXA 5M1AA 2NUTC 3LR5A 1K6SA 3RJUA 3UB8A 3W4OA 4P6BA 5FEGA 1OT9A 1KOUA 1GSVA 1OJGA 4LENA 5F83A 1K55C 1GSWA 3SS5A 2IWCA 4BQMA 4HP4A 4QHCA 3AGFA 1V9YA 5U47A 4CLCB 4X25A 1N4OA 3UPOA 5CX7A 4JF5A 1ES2A 3G32A 3E4OA 4RX2A 2HDRA 4QD4A 1Z6FA 2ZMFA 3LIAA 3OPRA 4EBNA 4BMWA 4Z1WA 1GHMA 1IKIA 2PD8A 3ULFA 1C3BA 1LLBA 2RCXA 1N9BA 1ERMA 4ID4A 3BM6A 3A3FA 5FSRA 1MXOA 1J9MA 3UE1A 4EW7A 5DJUA 2Y55A 5TGFA 3MF0A 2VX8A 4FUWA 4GKUA 3S4XA 3SZTA 4QY6A 3SW1A 3LUQA 2QKPA 3Q1FA 3WWXA 2WKEA 3MXRA 4PM9A 4CLCE 4O01A 2FZ0A 3DAVA 1PIOA 4O7DA 2DCFA 3IXHA 4EV4A 3C30A 3H82B 1YMSA 2XDMA 3CAXA 2XFTA 2ZC3B 4E3IA 1TS6A 1JNUA 3IX3A 4RA7A 4HH2A 1OTIA 2J80A 3N8LA 3UE6A 1XJ2A 5IHVA 3PBOA 3VFFA 3PAGA 3V67A 1KDWA 2O0YA 3C4OA 3W8KA 3MXQA 2I9VA 4E04A 1SCWA 4X6TA 1UWPX 4BBTA 2Y2NA 4K91A 2P9VA 3HJIA 4S2MA 2OV5A 1XGIA 1S1YA 4S2IA 1PWGA 1TD5A 3FWLA 2QJ7A 5EOOA 1JTDA 3GECA 3R7WA 2XD1A 5F6AA 4OPZA 1SZVA 3G35A 4KZAA 1MC0A 5EM0A 3A3JA 5HL6A 3EEHA 2M7UA 4IJGA 2L1MA 2ZQDA 3PBNA 2ZC7A 4EUVA 3ZDJA 4NXBA 4E3JA 4WL9A 4YOFA 3OOVA 2A3UA 3MKFA 3UE0A 1NY0A 5CHMA 1S4RA 3VE3A 1VB6A 3BYDA 5FAQA 4UA6A 2Y91A 4HP9A 3HLWA 3QHYA 3ZQ5A 2QJ5A 2W0NA 3CMZA 3P98A 5GLDA 5FQJA 3ZG8B 3P01A 3C7UA 4FH4A 4R3JA 4OOYA 2KLIA 5G4ZA 4LRZE 4B9OA 3BFGA 3S7NA 3DTMA 1JWVA 4X1MA 1W7FA 1VEUA 4S2KA 1IELA 2GJ3A 1PFLA 4D60A 3IX8A 3G31A 3HLDA 2VV6A 3LCEA 5DKLA 3DTIA 4FSFA 1NZOA 3T4JA 2XLNA 4II7A 3QNCA 2W1RA 2Z6CA 1ZTUA 3S7QA 5EVEA 2J3TC 4EERA 5HARA 5IU1A 3RTYA 1ZHHB 3LY3A 4KQRA 4E3KA 2VK3A 2QZ6A 4GW9A 4YINA 1VETB 1BSGA 3TJZC 1YM1A 2ZC5B 4NG2A 3BQ8A 2J9PA 2I72A 2Y2LA 3S7OA 3F1PA 4KZ3A 5EECA 2WGVA 3QP5A 1H8MA 1F9IA 3MFXA 2ZOHA 1O7EA 2XQZA 4U3TA 3V39A 3OCNA 4HH3A 2V1ZA 2OAQ1 2WAFA 2HGVA 2WK0A 1L0DA 4FD8A 4LCLA 5HFOA 3ZG7B 4DMZA 3VP2A 1SHVA 5EM1A 4KZ8A 2WUQA 3QP6A 3EGDC 2KDKA 3CITA 3BFDA 1KE4A 4GS9B 4WUJA 3Q7ZA 1GSXA 3NDGA 4UQIS 3AGDA 4JXVA 1NLZA 3RXWA 3K2NA 4PMAA 1P0ZA 3DTEA 2XROA 5CEDA 2K2NA 2Z2MB 3V3SA 4UA7A 4ARZA 3ICYA 1XP4A 4EEUA 3EQVA 3BW6A 4JXGA 3KYQA 2JBFA 1MY8A 2B02A 1LL8A 3A0RA 4HIAA 4JPMA 3BQAA 4BWIA 2VGJA 3T1SA 4XT2B 3NOPC 3OCLA 4NETA 1STZA 1NRFA 4HESA 3HREA 3LY4A 4MN6A 5DF8A 3UDFA 4MN7A 2GNXA 2J8YA 1LL9A 2Q9NA 4BBVA 2ZM8A 2V2FF 4HOIA 5C5KA 4Y3IA 1J3WA 2ZD8A 2KOIA 3O88A 1XJ6A 2O9BA 4ZJ1A 3JVUA 1FR6A 2PHYA 4R3AA 3TRCA 1XA7A 1OTAA 3MZDA 3ZCZA 2VV7A 1IYSA 3F1NA 5TJJA 1K57C 1YLYA 4CLCC 2QWSA 4ZRRA 3HL9A 2K7SA 3DWKA 4L0LA 2W3FA 4I38A 4NK3A 4UEYA 4WMCA 2Y2QA 2QYBA 3DW0A 5CECA 3NJAA 2OLUA 3SH9A 3GQZA 1W5DA 1MWRA 1TDGA 3O86A 3W4PA 4GZBA 3IF6C 4EBLA 2IA2A 4LLOB 3HLCA 2Y79A 2P74A 1UGUA 3N8SA 5FI2A 4GJ4A 5A91A 1S4SA 1EI5A 2MJ6A 2E8JA 1UWNX 2OSUA 3G4PA 3LGOA 1L0FA 2L4RA 3N7WA 2DNSA 3PAEA 3GSGA 1H8YA 2EFUA 3PTEA 3GR2A 5L2FA 5HWVA 4DE1A 5G18A 2V8FA 2E8IA 3D3OA 3VP0A 4WF0A 1N9OA 3A3IA 1XFQA 1AXBA 5TBMB 5GHYA 5FQMA 1EROA 5E2EA 5EVIA 1ESUA 2LB5A 1IYOA 2PBDP 4HBTA 4MEZA 2PD7A 1OPXA 2Q0OA 5A90A 4KZ9A 3C2WA 3UDIA 1CQAA 4P0MA 1NLYA 5HDSA 1XPBA 5DF9A 5CEBA 4Y2FA 1DP9A 1NXYA 2A24A 4G3VA 1BTLA 4B93A 1DJCA 2OAP1 2ZQAA 5F5YA 3O87A 4O8GA 3QP4A 2EX2A 2OWHA 4NXFA 3MR0A 4KG6A 1O07A 1T1AA 2C6WB 4L9GA 3WRZA 4KQOA 2B5RA 3IBRA 4H6JB 1EW0A 3T12B 2WKRA 3D9YA 2DMWA 1ERQA 2G7UA 4X69A 3MQ0A 3VFHA 4EUZA 5F69A 3LYXA 3MXSA 3A0SA 4JF6A 5EOEA 4E6WA 1RCJA 3GV9A 4HJ3A 3SS3A 5HDDA 1SDNA 5FQ9A 4JF4A 4EQIA 5E2HA 1XKZA 3BWLA 3G2YA 1WA9A 5AQ7A 3M6HA 1BT5A 1NWZA 1ES3A 2ZOIA 1BLCA 5M18A 2G2UA 2W1TB 4P6ZM 1KVLA 1IOUA 1IKGA 3QP2A 1GHPA 4RYEA 4HHDA 3I7JA 1IYQA 2PDRA 4GDNA 3NI9A 2M7VA 4G3KA 2DRWA 3LEQA 2ZLYA 3EGXC 4OLDA 1DY6A 2Y2PA 1JWZA 3HLGA 3UB6A 4B88A 1Y28A 4FCFA 3ZNTA 5DFXA 3KSIA 4GB7A 2V1AA 2P7JA 2WKPA 3IF6B 4I3JA 3SH8A 4Y5FA 1FIKA 2VGLS 3IS2A 3T4SA 1BUEA 4IBRA 1SDEA 1EWZA 1MWSA 2VGKA 3CPTB 1LSWA 1PWDA 5GL9A 1K57A 3GTCA 2EXAA 1BLSA 3MQQA 1YPRA 1PW8A 1GHIA 1TEMA 1K54C 3L9KA 1BYWA 5FQIA 4EEPA 3DTKA 3VOZA 3ITAA 1H5XA 2ACGA 4QU3A 2EA9A 1XJ4A 1W63M 4RVAA 4IUHA 3H7WB 4DRTA 3LIEA 2P04A 4DJ3A 1U60A 5GHZA 3GRJA 4IEDA 2WAEA 4FH2A 2HPBA 4PM8A 2INWA 4M4XA 5DVAA 3VSLA 3ZG9B 5E43A 2WADA 3Q82A 3QNBA 4K0XA 3TOIA 4WLAA 1H0MA 4C6YA 4QWOA 3EOIA 4NKPA 3OPLA 4WMCD 4BENA 2QMIA 3QP8A 1E3UA 5KSCA 1W79A 3PBSA 2Y2JA 1MWTA 4G3WA 4JGPA 1PNEA 1XX2A 5GLAA 3AGEA 3H82A 4HJ4A 1MBLA 2P08A 3LFVA 3U4LP 3WS1A 1PI4A 4NXGA 1S1ZA 1VEUB 4FOFA 3FZCA 2AVXA 1G5UA 5FI6A 3GDIA 2V8CA 2HJ9C 2VZWA 4F94A 4E3MA 4E6XA 3IF5A 4OQHA 3LIFA 1CJFA 2XD5A 4DDSA 3LR0A 4C75A 2Y2MA 4EETB 2W27A 4D2OA 4B4XA 1SKOB 2EX6A 3C38A 3VP1A 4WEJA 2W3DA 4MMNA 2B18A 3NCKA 5CXWA 2PBYA 3FC7A 5EVID 4EQ1A 2R9WA 2JKFA 1IFQA 4R4SA 1ALQA 4JGOA 1FSYA 1CI8A 1F2KA 3BJNA 2ZMVA 3W4QA 5FATA 4KQDA 3RFBA 3IWIA 5HDCA 4JKTA 1ONGA 3G6OA 4N9LA 1IYPA 4HY8A 4GD6A 4Y7PA 4NXEA 3CHWP 2Y59A 3E0YA 5CTNA 3JPUA 1PZPA 1GA9A 3UB9A 5FQKA 1K38A 2V1BA 1K55A 2BTFP 2IWDA 2XR0A 1VM1A 3NOTC 4PKYA 1FCMA 1HD8A 2H0TA 4KZ6A 5HD3A 3S7PA 1ZG4A 4R70A 3FPWA 3UMEA 4I39A 4OPRA 1Y4OA 1OTBA 2FFYA 1M40A 5DTKA 2CC1A 5G4YA 2VA0A 4FTXA 4S2OA 4OP8A 1KE0A 3UPNA 5DKKA 2ZQCA 4WZ4A 4DJ2A 4UQIM 3ZFZA 4HEFA 3CUEC 2M1CA 4UA9A 3WS4A 4Q0JA 3CLOA 4GOGA 1T1CA 3U2AA 3T4LA 1VETA 4OONA 3BFEA 1HZOA 1F98A 5BOHA 4KQQA 2HDQA 5KIZA 1YAXA 1FSWA 3UPPA 4EXOA 4K08A 3RXXA 1GCEA 4YNRA 4JLFA 3TE8A 1X0OA 1ZKJA 1D1JA
chains in the Genus database with same CATH topology
3D3OA 4WF0A 1N9OA 1XFQA 2W3EA 5TBMB 2HV1A 2J3TD 2LB5A 4EW7A 5DJUA 2CMNA 2PD7A 4R38A 1OPXA 2OWJA 2VV8A 3MF0A 2VX8A 3F1PB 2Z6DA 2XA7S 3C2WA 3SW1A 5J4EA 3LUQA 3OBFA 2QKPA 1NLYA 4JGQA 5HDSA 2JKTI 5DF9A 3P7NA 4Y2FA 1N9LA 3FG8A 3PXPA 4GS9A 4CLCE 1DP9A 2A24A 3OLOA 4G3VA 4O01A 4B93A 3JVVA 2FZ0A 2OAP1 5F5YA 3EQUA 4O8GA 4MDZA 3CWFA 2XSSA 2OWHA 2EWWA 4NXFA 3MR0A 4LPZA 3C30A 1T1AA 3H82B 2JKTM 3LIDA 1TS7A 3CAXA 1LSVA 4I3IA 4L9GA 4KQOA 1TS6A 5HSQA 3C8CA 1G6OA 5MC7A 1JNUA 3IBRA 4H6JB 1EW0A 4HH2A 1OTIA 2J80A 2WKRA 3UE6A 1DP8A 2BASA 5J7EA 1XJ2A 2DMWA 3PBOA 4IUKA 4GCZA 2G7UA 3T50A 3V67A 3MQ0A 2O0YA 4GHIB 5F69A 5J3WA 4XT2A 3MXQA 3LYXA 4I3AA 4NEED 5HWWA 2I9VA 3A0SA 4E04A 3ZYTA 4OOLA 1UWPX 5HD5A 4BBTA 3RH8B 3HJIA 1S1YA 1MZUA 2HF6A 4HJ3A 1TD5A 2PT7A 4ARZB 3T4OA 2QJ7A 5HDDA 4WN5A 3GECA 4OOMA 2VLGA 3NHQA 3R7WA 3F1OB 5HZHA 5F6AA 4WELA 2W3GA 3BWLA 4ETZA 1WA9A 1MC0A 1NWZA 3KYZA 5HL6A 3EEHA 2M7UA 4GLQA 2ZOIA 4IJGA 4F3LB 2L1MA 2W1TB 4PAUA 4P6ZM 5IS1A 4I5SA 1IOUA 1OTDA 3PBNA 5HPFA 4CQHA 4EUVA 1YKDA 4HHDA 4NXBA 4WL9A 4YOFA 5AVFA 2PDRA 3OOVA 2M7VA 5AJGA 4G3KA 1S4RA 3VE3A 1VB6A 5K5BA 2Y8HA 3EGXC 5LBRA 4HP9A 3UB6A 2O99A 1Y28A 2GX5A 2XA7M 3ZQ5A 2QJ5A 3HJKA 4O0PA 2W0NA 5DFXA 4BBUA 3KSIA 1OJ5A 5A8BA 3P01A 2V1AA 5F68A 3DBAA 2P7JA 3MQOA 2WKPA 4AFIA 4I3JA 3MMHA 4Y5FA 3F1NB 2KLIA 2GZAA 2QHKA 5G4ZA 5L8MA 4LRZE 2VGLS 3IS2A 4B9OA 1P9WA 3S7NA 3T4SA 2JKRI 1OTEA 4EU0A 1LSWA 2O9CA 4JGRA 4BJPA 2JHEA 3FPVA 3W2ZA 3UMDA 2GJ3A 1T18A 1T1BA 4HJ6A 1T19A 2VV6A 4CLCD 3MQQA 5DKLA 2H28A 4FSFA 2HJEA 5DFYA 3T4JA 1BYWA 2JKRM 2PYPA 4II7A 4EEPA 2D02A 2W1RA 2Z6CA 1ZTUA 2W3HA 3S7QA 3LI9A 2EA9A 2J3TC 4EERA 1V9ZA 1XJ4A 1W63M 3IBJA 4IUHA 3H7WB 5IU1A 1TS0A 3RTYA 1ZHHB 3LIEA 2P04A 3B33A 3PBTA 4DJ3A 2JN7A 2V0WA 3KSFA 3O5YA 4GW9A 5IT5A 3KSHA 2FH5A 1F5MA 3TJZC 2WKQA 3BQ8A 3NOUC 2INWA 2YKFA 1H3QA 4M4XA 3E98A 2K31A 3S7OA 3F1PA 1G28A 3K3CA 1H8MA 2ZBBA 3LIBA 3R4KA 1F9IA 4WLAA 3MFXA 2ZOHA 3EOIA 4NKPA 3OCNA 4HH3A 1D06A 3T4QA 2O9AA 2OAQ1 2PR6A 3TW8A 3K3DA 3PBSA 4G3WA 5KSHA 4JGPA 2HGVA 4L9FA 4LRXC 2L0WA 2D01A 3EWKA 3LR4A 3H82A 1OT6A 1P9RA 5HPIA 4DMZA 3IS2B 4HJ4A 4H6JA 2P08A 3LFVA 3OC2A 2KX6A 2PYRA 3EGDC 5HWTA 4NXGA 3BY9A 2KDKA 3CITA 2NUPC 1S1ZA 4GS9B 4GHIA 4WUJA 4FOFA 1DRMA 2A24B 1GSXA 2EWVA 2LB9A 2VGLM 3GDIA 3KO6A 2VEAA 4UQIS 3B47A 2HJ9C 4PKYG 2VZWA 4MN5A 1NLZA 3K2NA 3LIFA 1P0ZA 4Q0HA 4HI4A 3UE3A 2XROA 3LR3A 1YSPA 2K2NA 5FL3A 3LR0A 2YKHA 4ARZA 4LRYC 5EFWA 3ICYA 3PHYA 4EETB 4EEUA 3EQVA 3B42A 2W27A 3F1OA 3BW6A 3KYQA 4RQ9A 4P6ZS 2J3WA 3C38A 4WEJA 2B02A 3A0RA 1LL8A 3PBQA 4HIAA 3BQAA 2W3DA 4MMNA 2B18A 4BWIA 2VKSA 4XT2B 3FC7A 3NOPC 1VHMA 3OCLA 1STZA 4QPRA 4EQ1A 4F3LA 4HNBA 1IFQA 4CLCA 2W1TA 1YSQA 4JGOA 3BJNA 3UB7A 3E4PA 4HQAA 2ZMVA 4MN6A 5I5LA 4DN0A 4MN7A 2GNXA 4BBVA 4KQDA 3RFBA 5HDCA 3R7WB 3G6OA 4ME4A 4HOIA 4HY8A 5C5KA 3A0VA 4Y3IA 4R6LA 4NXEA 4PHTA 4KUKA 2KOIA 3VE4A 2V9AA 1XJ6A 2O9BA 5TBMA 3JVUA 5DJTA 3E0YA 3VOLA 2PHYA 4R3AA 3TRCA 3CUEA 1OTAA 2R78A 4Q0IA 3E4QA 3UB9A 1N9NA 2VV7A 3F1NA 2V1BA 3CI6A 5TJJA 3BY8A 1D7EA 1XJ3A 3H9WA 1W63Q 3NOTC 4PKYA 3LICA 5AVEA 4CLCC 3T4KA 1LT0A 2QWSA 1S66L 4ZRRA 2K7SA 2V0UA 4L0LA 3HCYA 2W3FA 5HD3A 1NRJA 4I38A 4IHQA 3S7PA 1TF1A 1XFNA 3PBRA 4UEYA 3PYPA 1TS8A 4R70A 2A2LA 3FPWA 3UMEA 4I39A 1OTBA 5G4YA 2QYBA 2VA0A 1ODVA 4WEKA 1DP6A 4MCWA 2XRNA 4L9EA 3EEAA 3NJAA 5DKKA 4DJ2A 3MJQA 4UQIM 3KSGA 3KX0X 4ETXA 4EESA 2NUTC 3LR5A 3H7WA 3CUEC 3UB8A 1OT9A 2IA2A 1KOUA 2M1CA 4LLOB 3T4TA 1GSVA 4Q0JA 1OJGA 3CLOA 2Y79A 1LSXA 3VV4A 1UGUA 1T1CA 3U2AA 1GSWA 3PR6A 4GJ4A 4HP4A 3T4LA 1V9YA 1S4SA 4CLCB 1S67L 3D72A 2MJ6A 2OOLA 1UWNX 1F98A 5CX7A 4YWZA 3E4OA 2L4RA 5KIZA 1YAXA 4EXOA 3LI8A 2ZMFA 2VJWA 3LIAA 4BMWA 4K08A 4Z1WA 1MKMA 5HWVA 4YNRA 3TE8A 1X0OA 2PD8A 4KUOA 1P97A 3ULFA 2PR5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5MC7 A;  2JKR I;  2VGL M;  4UQI S;  2JKT I;  2XA7 M;  1W63 M;  2HF6 A;  4P6Z M;  1W63 Q;  4UQI M;  1NRJ A;  4NEE D;  2FH5 A;  2VGL S;  2JKR M;  3TJZ C;  2JKT M;  2XA7 S;  4P6Z S; 
#chains in the Genus database with same CATH topology
 1PI5 A;  1RP5 A;  3VP4 A;  3P09 A;  3VOY A;  5KZH A;  4OQ0 A;  4ESP A;  5FEF A;  3ZG0 A;  1CK3 A;  1FCN A;  1PRQ A;  4Y0U A;  4R38 A;  3KYE A;  2OWJ A;  2Z6D A;  4QB8 A;  2XA7 S;  1LHY A;  2WGW B;  3OBF A;  1VQQ A;  4JGQ A;  2JKT I;  2HDS A;  1DJB A;  3P7N A;  3GMW A;  1PW1 A;  3FG8 A;  4GS9 A;  4UHU A;  1L0E A;  4WZ5 C;  5CGX A;  2WZZ A;  4N1H A;  3JVV A;  2R9X A;  3HLF A;  4MDZ A;  2ZQ7 A;  1FQG A;  1JWP A;  2EWW A;  1L3L A;  4P85 A;  2JKT M;  3LID A;  4Y17 A;  3GVB A;  1LSV A;  3HUM A;  4I3I A;  2C5W B;  5HSQ A;  3C8C A;  3HUN A;  1G6O A;  5MC7 A;  1TVF A;  1YLT A;  1DP8 A;  4XUZ A;  4IUK A;  3T50 A;  4BLM A;  4GHI B;  2EFX A;  3OPH A;  5J3W A;  4XT2 A;  4U0X A;  1I2W A;  4MBH A;  4NEE D;  4N1X A;  4OOL A;  3RH8 B;  3BFF A;  4DXB A;  2HF6 A;  1MZU A;  4S2L A;  3T4O A;  4WN5 A;  4OOM A;  1HTZ A;  3NHQ A;  1FR1 A;  1MPL A;  3F1O B;  3IWQ A;  5HZH A;  4WEL A;  1G68 A;  5HW3 A;  4ETZ A;  2BG1 A;  4KG5 A;  3A3E A;  3ISG A;  5EVI B;  1E3U D;  2EXB A;  5TFQ A;  5F1G A;  4F3L B;  5DF7 A;  4PAU A;  1FOF A;  4I5S A;  1OTD A;  4X53 A;  5HPF A;  4DE2 A;  5A93 A;  5I94 A;  5JYO A;  3OZH A;  3SS4 A;  4LGW A;  3V50 A;  4X1L A;  4IVI A;  2Y2K A;  5K5B A;  1MWU A;  2Y2G A;  4ZAM A;  2O99 A;  4OLG A;  2EX8 A;  2WYX A;  3IQA A;  5EE8 A;  3ZHH A;  4QY5 A;  4X55 A;  3E2K A;  2ZQ8 A;  4BBU A;  1KGF A;  1OJ5 A;  5A8B A;  3IT9 A;  4ZBE A;  3DBA A;  3MQO A;  4MNR A;  3M2K A;  1QMF A;  4LV3 A;  3TG9 A;  2QHK A;  5L8M A;  2H10 A;  2H5S A;  3TSG A;  1XGJ A;  2UWX A;  2HZ5 A;  2JKR I;  3C4P A;  5HL1 A;  1OTE A;  3MSH A;  3Q7V B;  3BRM A;  4EU0 A;  4ZDX A;  2O9C A;  4BJP A;  2JHE A;  4WBG A;  2ZMA A;  3UMD A;  2HP5 A;  2J9O A;  3N6I A;  1T1B A;  4HJ6 A;  1K4E A;  1T19 A;  4ZTK A;  4BD0 A;  1TDL A;  2HJE A;  2JKR M;  2D02 A;  3UDX A;  5FAS A;  2W3H A;  4OP5 A;  2J7V A;  3LI9 A;  1WE4 A;  3UNW A;  1V9Z A;  3IBJ A;  1LI9 A;  2BLS A;  4GNU A;  4PM7 A;  3B33 A;  2ZL1 A;  4JXS A;  2V0W A;  2Z2L B;  3HLE A;  5EPH A;  1KGG A;  5CGW A;  3O5Y A;  5IT5 A;  2FH5 A;  2Y2I A;  1LI0 A;  1CI9 A;  4OKP A;  2WKQ A;  5CTM A;  1W8Y A;  3E98 A;  2K31 A;  1YLP A;  5E2G A;  5AQA A;  1G28 A;  3K3C A;  1L0G A;  4MBK A;  5JYP A;  4PM5 A;  3LIB A;  3R4K A;  1L2S A;  1ZG6 A;  3BFC A;  1OME A;  4S2P A;  4Q8I A;  5F1F A;  2GDN A;  2O9A A;  4ZJ2 A;  2PR6 A;  3TW8 A;  3K3D A;  3UY6 A;  2X01 A;  4LRX C;  4L9F A;  2D01 A;  3LR4 A;  1XXM A;  1P9R A;  5EV0 A;  5HPI A;  3C7V A;  4C3Q A;  3IS2 B;  4H6J A;  4YFM A;  2KX6 A;  2Y2H A;  2PYR A;  1H8Z A;  5HWT A;  4IVK A;  2NUP C;  1KVM A;  1DRM A;  4S2N C;  4EWF A;  4Y13 A;  2EWV A;  1GA0 A;  2LB9 A;  2VGL M;  3KO6 A;  5FAP A;  2Q9M A;  2VEA A;  4XXR A;  3B47 A;  4Q0H A;  4HI4 A;  4WZ5 A;  3UE3 A;  2PU2 A;  3M2J A;  4LV0 A;  3LR3 A;  5FL3 A;  1CEG A;  3B3X A;  3PHY A;  4BD1 A;  1AWI A;  3B42 A;  2ZM0 A;  3N4I A;  4P6Z S;  3V3R A;  1K56 A;  3T1R A;  4P87 A;  5A92 A;  4HNB A;  4CLC A;  2W1T A;  3LO7 A;  1YSQ A;  4DKI A;  3UB7 A;  2P9V B;  3E4P A;  1JVJ A;  5L07 A;  4CJN A;  1PYY A;  3BEC A;  3R7W B;  1NYM A;  3A0V A;  5HAI A;  4R6L A;  2X71 A;  5FAO A;  4KUK A;  1CEF A;  3VE4 A;  4OQG A;  2V9A A;  1YQS A;  2HDU A;  3NC8 A;  5DJT A;  5GLC A;  4KZ4 A;  1DJA A;  2R78 A;  4Q0I A;  3E4Q A;  3IF6 A;  5L10 A;  1N9N A;  3CI6 A;  3IHA A;  1XJ3 A;  3H9W A;  1W63 Q;  3IH9 A;  2JE5 A;  3FYZ A;  5KMW A;  3HCY A;  3CPT A;  4IHQ A;  3PBR A;  4Y0T A;  2A2L A;  3JYI A;  3T1X A;  1ES5 A;  2QPN A;  3ZGA B;  3T1Q B;  1ODV A;  3WS5 A;  1HVB A;  4PM6 A;  1YLW A;  1DP6 A;  4MCW A;  5HAQ A;  4K0W A;  2XRN A;  3NBL A;  1HLU P;  3MJQ A;  5EUA A;  3KX0 X;  3G2Z A;  3HVF A;  1A0K A;  4OH0 A;  2Y2O A;  3NY4 A;  4EES A;  5TR7 A;  3H7W A;  4GDB A;  3HBR A;  3MFD A;  5AQB A;  4LFU A;  5CHJ A;  3T4T A;  4H8R A;  1LSX A;  3VV4 A;  3E2L A;  4X56 A;  2WKH A;  3PR6 A;  5F82 A;  4EBP A;  5HX9 A;  4OQI A;  1S67 L;  3D72 A;  2OOL A;  4KG2 A;  4YWZ A;  4RX3 A;  3LI8 A;  3IWO A;  1KDS A;  2VJW A;  3VP3 A;  2PAV P;  1MKM A;  3IHB A;  5DTS A;  4B4Z A;  1K6R A;  1BLH A;  1KGE A;  4KUO A;  1P97 A;  2PR5 A;  5FA7 A;  4DDY A;  1RGZ A;  2W3E A;  1SKF A;  2V20 A;  2HV1 A;  2J3T D;  5FQQ A;  2CMN A;  1E4D A;  2VV8 A;  3NUL A;  3F1P B;  1W8Q A;  2HP6 A;  2WKI A;  3UB5 P;  5J4E A;  2XGN A;  1I5Q A;  1N9L A;  3PXP A;  2WZX A;  3OLO A;  5CGS A;  2XH9 A;  4S2J A;  3EQU A;  4DXC A;  5E2F A;  3CWF A;  4DE3 A;  2XSS A;  4E3N A;  2ZQ9 A;  4LPZ A;  4KEN B;  1TS7 A;  4OPQ A;  5EVI C;  1NYY A;  3IH8 A;  3N8R A;  4HBU A;  1SKO A;  2BAS A;  5J7E A;  4LCM A;  4GCZ A;  1YLJ A;  3WS2 A;  4I3A A;  2RL3 A;  5HWW A;  3ZYT A;  3IXD A;  5HD5 A;  1IEM A;  1G6A A;  4KZ5 A;  4OPY A;  4S2N A;  4JXW A;  4IBX A;  2PT7 A;  4ARZ B;  4U0T A;  3FKV A;  2IWB A;  2VLG A;  1NJ4 A;  1KE3 A;  1BLP A;  4JBF A;  5D3O A;  2W3G A;  3MZF A;  3HLB A;  1XA1 A;  3KYZ A;  4N92 A;  2A49 A;  4GLQ A;  4LV2 A;  5FI7 A;  3Q07 A;  5IS1 A;  4CQH A;  1YKD A;  1K4F A;  3VSK A;  5DTT A;  5AVF A;  1ACF A;  3BLS A;  4R0Q A;  4Y15 A;  4BL2 A;  3BEB A;  4Z9Q A;  3DWZ A;  5AJG A;  2XEP A;  1Q2Q A;  2Y8H A;  1K54 A;  5LBR A;  2GX5 A;  1PWC A;  2XA7 M;  3S1Y A;  3HJK A;  4E3O A;  1WYC A;  4O0P A;  3ZNY A;  3Q81 A;  5F68 A;  3SH7 A;  4AFI A;  3MMH A;  4PPR A;  3NIA A;  3F1N B;  2GZA A;  1ES4 A;  5HAP A;  3IXG A;  3ZG5 A;  1P9W A;  4UAA A;  1ONH A;  1K56 D;  4GN2 A;  4JGR A;  3FPV A;  1JTG A;  3UN7 A;  3HUO A;  3W2Z A;  1T18 A;  3MBZ A;  5CRF A;  4CLC D;  3L7H A;  2H28 A;  2UV0 E;  5DFY A;  4XUX A;  1MKI A;  2PYP A;  3ZVW A;  4KZB A;  3IX4 A;  2XFS A;  1TS0 A;  5GLB A;  3PBT A;  2JN7 A;  4KZ7 A;  3KSF A;  4ZJ3 A;  3KSH A;  1F5M A;  3NEC A;  4DE0 A;  3NOU C;  2YKF A;  1H3Q A;  1RGY A;  1S0W A;  2PRF A;  1M6K A;  5M19 A;  1K0K A;  2FFF B;  4OVD A;  3VMA A;  2WGW A;  2ZBB A;  3FKW A;  3FV7 A;  3C5A A;  4GD8 A;  1PZO A;  4M3K A;  3BLM A;  3QP1 A;  1D06 A;  3MKE A;  4WM9 A;  3CG5 A;  3T4Q A;  5EVL A;  5KSH A;  1YT4 A;  5CER A;  2L0W A;  3ITB A;  1FCO A;  3SOI A;  3EWK A;  1OT6 A;  4Y0O A;  5AQ9 A;  2H0Y A;  3OC2 A;  2JC7 A;  5GHX A;  3BY9 A;  3S22 A;  4GHI A;  2A24 B;  2HP9 A;  3O3V A;  2PU4 A;  2EX9 A;  4PKY G;  4MN5 A;  1Z09 A;  2ZC4 B;  4R3B A;  4CPK A;  3ZVT A;  3IXB A;  2JCH A;  1ESI A;  1YSP A;  2YKH A;  4LRY C;  1Y54 A;  5EFW A;  1E25 A;  4R1G A;  2WGI A;  4MLL A;  3F1O A;  4MBF A;  3G34 A;  4RQ9 A;  3OPP A;  3WRT A;  2J3W A;  2ZL1 B;  1S6R A;  3PBQ A;  2ZC6 B;  3NDE A;  2VKS A;  3MZE A;  3A3D A;  3M6B A;  3V5M A;  1VHM A;  5L09 A;  4N9K A;  4QPR A;  2G2W A;  4F3L A;  1NZU A;  3CZD A;  4E3L A;  4HQA A;  3UO9 A;  1K25 A;  5I5L A;  4DN0 A;  5CHU A;  2XK1 A;  1I2S A;  1ZC2 A;  4ME4 A;  4LV1 A;  1BUL A;  2OLV A;  5J8X A;  4PHT A;  4R23 A;  4R4R A;  4QJG A;  1BZA A;  5TBM A;  2B95 A;  4X68 A;  3VOL A;  3CUE A;  1Q2P A;  3D4F A;  1CF0 A;  4WYY A;  3BY8 A;  1D7E A;  1LL5 A;  1YMX A;  3LIC A;  5AVE A;  2XF3 A;  2ZM2 A;  1LT0 A;  3T4K A;  1S66 L;  4A5R A;  4BL3 A;  2V0U A;  3Q7V A;  1NRJ A;  1QME A;  5FDH A;  2Y4A A;  1TF1 A;  3G30 A;  1XFN A;  2JKG A;  3MS6 A;  3PYP A;  1TS8 A;  1YLZ A;  5FDS A;  3CJM A;  2X02 A;  4WEK A;  3LEZ A;  2ZJ9 A;  1FIL A;  3WS0 A;  1WYB A;  4L9E A;  3EEA A;  4DF6 A;  3KSG A;  4ETX A;  5M1A A;  2NUT C;  3LR5 A;  1K6S A;  3RJU A;  3UB8 A;  3W4O A;  4P6B A;  5FEG A;  1OT9 A;  1KOU A;  1GSV A;  1OJG A;  4LEN A;  5F83 A;  1K55 C;  1GSW A;  3SS5 A;  2IWC A;  4BQM A;  4HP4 A;  4QHC A;  3AGF A;  1V9Y A;  5U47 A;  4CLC B;  4X25 A;  1N4O A;  3UPO A;  5CX7 A;  4JF5 A;  1ES2 A;  3G32 A;  3E4O A;  4RX2 A;  2HDR A;  4QD4 A;  1Z6F A;  2ZMF A;  3LIA A;  3OPR A;  4EBN A;  4BMW A;  4Z1W A;  1GHM A;  1IKI A;  2PD8 A;  3ULF A;  1C3B A;  1LLB A;  2RCX A;  1N9B A;  1ERM A;  4ID4 A;  3BM6 A;  3A3F A;  5FSR A;  1MXO A;  1J9M A;  3UE1 A;  4EW7 A;  5DJU A;  2Y55 A;  5TGF A;  3MF0 A;  2VX8 A;  4FUW A;  4GKU A;  3S4X A;  3SZT A;  4QY6 A;  3SW1 A;  3LUQ A;  2QKP A;  3Q1F A;  3WWX A;  2WKE A;  3MXR A;  4PM9 A;  4CLC E;  4O01 A;  2FZ0 A;  3DAV A;  1PIO A;  4O7D A;  2DCF A;  3IXH A;  4EV4 A;  3C30 A;  3H82 B;  1YMS A;  2XDM A;  3CAX A;  2XFT A;  2ZC3 B;  4E3I A;  1TS6 A;  1JNU A;  3IX3 A;  4RA7 A;  4HH2 A;  1OTI A;  2J80 A;  3N8L A;  3UE6 A;  1XJ2 A;  5IHV A;  3PBO A;  3VFF A;  3PAG A;  3V67 A;  1KDW A;  2O0Y A;  3C4O A;  3W8K A;  3MXQ A;  2I9V A;  4E04 A;  1SCW A;  4X6T A;  1UWP X;  4BBT A;  2Y2N A;  4K91 A;  2P9V A;  3HJI A;  4S2M A;  2OV5 A;  1XGI A;  1S1Y A;  4S2I A;  1PWG A;  1TD5 A;  3FWL A;  2QJ7 A;  5EOO A;  1JTD A;  3GEC A;  3R7W A;  2XD1 A;  5F6A A;  4OPZ A;  1SZV A;  3G35 A;  4KZA A;  1MC0 A;  5EM0 A;  3A3J A;  5HL6 A;  3EEH A;  2M7U A;  4IJG A;  2L1M A;  2ZQD A;  3PBN A;  2ZC7 A;  4EUV A;  3ZDJ A;  4NXB A;  4E3J A;  4WL9 A;  4YOF A;  3OOV A;  2A3U A;  3MKF A;  3UE0 A;  1NY0 A;  5CHM A;  1S4R A;  3VE3 A;  1VB6 A;  3BYD A;  5FAQ A;  4UA6 A;  2Y91 A;  4HP9 A;  3HLW A;  3QHY A;  3ZQ5 A;  2QJ5 A;  2W0N A;  3CMZ A;  3P98 A;  5GLD A;  5FQJ A;  3ZG8 B;  3P01 A;  3C7U A;  4FH4 A;  4R3J A;  4OOY A;  2KLI A;  5G4Z A;  4LRZ E;  4B9O A;  3BFG A;  3S7N A;  3DTM A;  1JWV A;  4X1M A;  1W7F A;  1VEU A;  4S2K A;  1IEL A;  2GJ3 A;  1PFL A;  4D60 A;  3IX8 A;  3G31 A;  3HLD A;  2VV6 A;  3LCE A;  5DKL A;  3DTI A;  4FSF A;  1NZO A;  3T4J A;  2XLN A;  4II7 A;  3QNC A;  2W1R A;  2Z6C A;  1ZTU A;  3S7Q A;  5EVE A;  2J3T C;  4EER A;  5HAR A;  5IU1 A;  3RTY A;  1ZHH B;  3LY3 A;  4KQR A;  4E3K A;  2VK3 A;  2QZ6 A;  4GW9 A;  4YIN A;  1VET B;  1BSG A;  3TJZ C;  1YM1 A;  2ZC5 B;  4NG2 A;  3BQ8 A;  2J9P A;  2I72 A;  2Y2L A;  3S7O A;  3F1P A;  4KZ3 A;  5EEC A;  2WGV A;  3QP5 A;  1H8M A;  1F9I A;  3MFX A;  2ZOH A;  1O7E A;  2XQZ A;  4U3T A;  3V39 A;  3OCN A;  4HH3 A;  2V1Z A;  2OAQ 1;  2WAF A;  2HGV A;  2WK0 A;  1L0D A;  4FD8 A;  4LCL A;  5HFO A;  3ZG7 B;  4DMZ A;  3VP2 A;  1SHV A;  5EM1 A;  4KZ8 A;  2WUQ A;  3QP6 A;  3EGD C;  2KDK A;  3CIT A;  3BFD A;  1KE4 A;  4GS9 B;  4WUJ A;  3Q7Z A;  1GSX A;  3NDG A;  4UQI S;  3AGD A;  4JXV A;  1NLZ A;  3RXW A;  3K2N A;  4PMA A;  1P0Z A;  3DTE A;  2XRO A;  5CED A;  2K2N A;  2Z2M B;  3V3S A;  4UA7 A;  4ARZ A;  3ICY A;  1XP4 A;  4EEU A;  3EQV A;  3BW6 A;  4JXG A;  3KYQ A;  2JBF A;  1MY8 A;  2B02 A;  1LL8 A;  3A0R A;  4HIA A;  4JPM A;  3BQA A;  4BWI A;  2VGJ A;  3T1S A;  4XT2 B;  3NOP C;  3OCL A;  4NET A;  1STZ A;  1NRF A;  4HES A;  3HRE A;  3LY4 A;  4MN6 A;  5DF8 A;  3UDF A;  4MN7 A;  2GNX A;  2J8Y A;  1LL9 A;  2Q9N A;  4BBV A;  2ZM8 A;  2V2F F;  4HOI A;  5C5K A;  4Y3I A;  1J3W A;  2ZD8 A;  2KOI A;  3O88 A;  1XJ6 A;  2O9B A;  4ZJ1 A;  3JVU A;  1FR6 A;  2PHY A;  4R3A A;  3TRC A;  1XA7 A;  1OTA A;  3MZD A;  3ZCZ A;  2VV7 A;  1IYS A;  3F1N A;  5TJJ A;  1K57 C;  1YLY A;  4CLC C;  2QWS A;  4ZRR A;  3HL9 A;  2K7S A;  3DWK A;  4L0L A;  2W3F A;  4I38 A;  4NK3 A;  4UEY A;  4WMC A;  2Y2Q A;  2QYB A;  3DW0 A;  5CEC A;  3NJA A;  2OLU A;  3SH9 A;  3GQZ A;  1W5D A;  1MWR A;  1TDG A;  3O86 A;  3W4P A;  4GZB A;  3IF6 C;  4EBL A;  2IA2 A;  4LLO B;  3HLC A;  2Y79 A;  2P74 A;  1UGU A;  3N8S A;  5FI2 A;  4GJ4 A;  5A91 A;  1S4S A;  1EI5 A;  2MJ6 A;  2E8J A;  1UWN X;  2OSU A;  3G4P A;  3LGO A;  1L0F A;  2L4R A;  3N7W A;  2DNS A;  3PAE A;  3GSG A;  1H8Y A;  2EFU A;  3PTE A;  3GR2 A;  5L2F A;  5HWV A;  4DE1 A;  5G18 A;  2V8F A;  2E8I A;  3D3O A;  3VP0 A;  4WF0 A;  1N9O A;  3A3I A;  1XFQ A;  1AXB A;  5TBM B;  5GHY A;  5FQM A;  1ERO A;  5E2E A;  5EVI A;  1ESU A;  2LB5 A;  1IYO A;  2PBD P;  4HBT A;  4MEZ A;  2PD7 A;  1OPX A;  2Q0O A;  5A90 A;  4KZ9 A;  3C2W A;  3UDI A;  1CQA A;  4P0M A;  1NLY A;  5HDS A;  1XPB A;  5DF9 A;  5CEB A;  4Y2F A;  1DP9 A;  1NXY A;  2A24 A;  4G3V A;  1BTL A;  4B93 A;  1DJC A;  2OAP 1;  2ZQA A;  5F5Y A;  3O87 A;  4O8G A;  3QP4 A;  2EX2 A;  2OWH A;  4NXF A;  3MR0 A;  4KG6 A;  1O07 A;  1T1A A;  2C6W B;  4L9G A;  3WRZ A;  4KQO A;  2B5R A;  3IBR A;  4H6J B;  1EW0 A;  3T12 B;  2WKR A;  3D9Y A;  2DMW A;  1ERQ A;  2G7U A;  4X69 A;  3MQ0 A;  3VFH A;  4EUZ A;  5F69 A;  3LYX A;  3MXS A;  3A0S A;  4JF6 A;  5EOE A;  4E6W A;  1RCJ A;  3GV9 A;  4HJ3 A;  3SS3 A;  5HDD A;  1SDN A;  5FQ9 A;  4JF4 A;  4EQI A;  5E2H A;  1XKZ A;  3BWL A;  3G2Y A;  1WA9 A;  5AQ7 A;  3M6H A;  1BT5 A;  1NWZ A;  1ES3 A;  2ZOI A;  1BLC A;  5M18 A;  2G2U A;  2W1T B;  4P6Z M;  1KVL A;  1IOU A;  1IKG A;  3QP2 A;  1GHP A;  4RYE A;  4HHD A;  3I7J A;  1IYQ A;  2PDR A;  4GDN A;  3NI9 A;  2M7V A;  4G3K A;  2DRW A;  3LEQ A;  2ZLY A;  3EGX C;  4OLD A;  1DY6 A;  2Y2P A;  1JWZ A;  3HLG A;  3UB6 A;  4B88 A;  1Y28 A;  4FCF A;  3ZNT A;  5DFX A;  3KSI A;  4GB7 A;  2V1A A;  2P7J A;  2WKP A;  3IF6 B;  4I3J A;  3SH8 A;  4Y5F A;  1FIK A;  2VGL S;  3IS2 A;  3T4S A;  1BUE A;  4IBR A;  1SDE A;  1EWZ A;  1MWS A;  2VGK A;  3CPT B;  1LSW A;  1PWD A;  5GL9 A;  1K57 A;  3GTC A;  2EXA A;  1BLS A;  3MQQ A;  1YPR A;  1PW8 A;  1GHI A;  1TEM A;  1K54 C;  3L9K A;  1BYW A;  5FQI A;  4EEP A;  3DTK A;  3VOZ A;  3ITA A;  1H5X A;  2ACG A;  4QU3 A;  2EA9 A;  1XJ4 A;  1W63 M;  4RVA A;  4IUH A;  3H7W B;  4DRT A;  3LIE A;  2P04 A;  4DJ3 A;  1U60 A;  5GHZ A;  3GRJ A;  4IED A;  2WAE A;  4FH2 A;  2HPB A;  4PM8 A;  2INW A;  4M4X A;  5DVA A;  3VSL A;  3ZG9 B;  5E43 A;  2WAD A;  3Q82 A;  3QNB A;  4K0X A;  3TOI A;  4WLA A;  1H0M A;  4C6Y A;  4QWO A;  3EOI A;  4NKP A;  3OPL A;  4WMC D;  4BEN A;  2QMI A;  3QP8 A;  1E3U A;  5KSC A;  1W79 A;  3PBS A;  2Y2J A;  1MWT A;  4G3W A;  4JGP A;  1PNE A;  1XX2 A;  5GLA A;  3AGE A;  3H82 A;  4HJ4 A;  1MBL A;  2P08 A;  3LFV A;  3U4L P;  3WS1 A;  1PI4 A;  4NXG A;  1S1Z A;  1VEU B;  4FOF A;  3FZC A;  2AVX A;  1G5U A;  5FI6 A;  3GDI A;  2V8C A;  2HJ9 C;  2VZW A;  4F94 A;  4E3M A;  4E6X A;  3IF5 A;  4OQH A;  3LIF A;  1CJF A;  2XD5 A;  4DDS A;  3LR0 A;  4C75 A;  2Y2M A;  4EET B;  2W27 A;  4D2O A;  4B4X A;  1SKO B;  2EX6 A;  3C38 A;  3VP1 A;  4WEJ A;  2W3D A;  4MMN A;  2B18 A;  3NCK A;  5CXW A;  2PBY A;  3FC7 A;  5EVI D;  4EQ1 A;  2R9W A;  2JKF A;  1IFQ A;  4R4S A;  1ALQ A;  4JGO A;  1FSY A;  1CI8 A;  1F2K A;  3BJN A;  2ZMV A;  3W4Q A;  5FAT A;  4KQD A;  3RFB A;  3IWI A;  5HDC A;  4JKT A;  1ONG A;  3G6O A;  4N9L A;  1IYP A;  4HY8 A;  4GD6 A;  4Y7P A;  4NXE A;  3CHW P;  2Y59 A;  3E0Y A;  5CTN A;  3JPU A;  1PZP A;  1GA9 A;  3UB9 A;  5FQK A;  1K38 A;  2V1B A;  1K55 A;  2BTF P;  2IWD A;  2XR0 A;  1VM1 A;  3NOT C;  4PKY A;  1FCM A;  1HD8 A;  2H0T A;  4KZ6 A;  5HD3 A;  3S7P A;  1ZG4 A;  4R70 A;  3FPW A;  3UME A;  4I39 A;  4OPR A;  1Y4O A;  1OTB A;  2FFY A;  1M40 A;  5DTK A;  2CC1 A;  5G4Y A;  2VA0 A;  4FTX A;  4S2O A;  4OP8 A;  1KE0 A;  3UPN A;  5DKK A;  2ZQC A;  4WZ4 A;  4DJ2 A;  4UQI M;  3ZFZ A;  4HEF A;  3CUE C;  2M1C A;  4UA9 A;  3WS4 A;  4Q0J A;  3CLO A;  4GOG A;  1T1C A;  3U2A A;  3T4L A;  1VET A;  4OON A;  3BFE A;  1HZO A;  1F98 A;  5BOH A;  4KQQ A;  2HDQ A;  5KIZ A;  1YAX A;  1FSW A;  3UPP A;  4EXO A;  4K08 A;  3RXX A;  1GCE A;  4YNR A;  4JLF A;  3TE8 A;  1X0O A;  1ZKJ A;  1D1J A; 
#chains in the Genus database with same CATH homology
 3D3O A;  4WF0 A;  1N9O A;  1XFQ A;  2W3E A;  5TBM B;  2HV1 A;  2J3T D;  2LB5 A;  4EW7 A;  5DJU A;  2CMN A;  2PD7 A;  4R38 A;  1OPX A;  2OWJ A;  2VV8 A;  3MF0 A;  2VX8 A;  3F1P B;  2Z6D A;  2XA7 S;  3C2W A;  3SW1 A;  5J4E A;  3LUQ A;  3OBF A;  2QKP A;  1NLY A;  4JGQ A;  5HDS A;  2JKT I;  5DF9 A;  3P7N A;  4Y2F A;  1N9L A;  3FG8 A;  3PXP A;  4GS9 A;  4CLC E;  1DP9 A;  2A24 A;  3OLO A;  4G3V A;  4O01 A;  4B93 A;  3JVV A;  2FZ0 A;  2OAP 1;  5F5Y A;  3EQU A;  4O8G A;  4MDZ A;  3CWF A;  2XSS A;  2OWH A;  2EWW A;  4NXF A;  3MR0 A;  4LPZ A;  3C30 A;  1T1A A;  3H82 B;  2JKT M;  3LID A;  1TS7 A;  3CAX A;  1LSV A;  4I3I A;  4L9G A;  4KQO A;  1TS6 A;  5HSQ A;  3C8C A;  1G6O A;  5MC7 A;  1JNU A;  3IBR A;  4H6J B;  1EW0 A;  4HH2 A;  1OTI A;  2J80 A;  2WKR A;  3UE6 A;  1DP8 A;  2BAS A;  5J7E A;  1XJ2 A;  2DMW A;  3PBO A;  4IUK A;  4GCZ A;  2G7U A;  3T50 A;  3V67 A;  3MQ0 A;  2O0Y A;  4GHI B;  5F69 A;  5J3W A;  4XT2 A;  3MXQ A;  3LYX A;  4I3A A;  4NEE D;  5HWW A;  2I9V A;  3A0S A;  4E04 A;  3ZYT A;  4OOL A;  1UWP X;  5HD5 A;  4BBT A;  3RH8 B;  3HJI A;  1S1Y A;  1MZU A;  2HF6 A;  4HJ3 A;  1TD5 A;  2PT7 A;  4ARZ B;  3T4O A;  2QJ7 A;  5HDD A;  4WN5 A;  3GEC A;  4OOM A;  2VLG A;  3NHQ A;  3R7W A;  3F1O B;  5HZH A;  5F6A A;  4WEL A;  2W3G A;  3BWL A;  4ETZ A;  1WA9 A;  1MC0 A;  1NWZ A;  3KYZ A;  5HL6 A;  3EEH A;  2M7U A;  4GLQ A;  2ZOI A;  4IJG A;  4F3L B;  2L1M A;  2W1T B;  4PAU A;  4P6Z M;  5IS1 A;  4I5S A;  1IOU A;  1OTD A;  3PBN A;  5HPF A;  4CQH A;  4EUV A;  1YKD A;  4HHD A;  4NXB A;  4WL9 A;  4YOF A;  5AVF A;  2PDR A;  3OOV A;  2M7V A;  5AJG A;  4G3K A;  1S4R A;  3VE3 A;  1VB6 A;  5K5B A;  2Y8H A;  3EGX C;  5LBR A;  4HP9 A;  3UB6 A;  2O99 A;  1Y28 A;  2GX5 A;  2XA7 M;  3ZQ5 A;  2QJ5 A;  3HJK A;  4O0P A;  2W0N A;  5DFX A;  4BBU A;  3KSI A;  1OJ5 A;  5A8B A;  3P01 A;  2V1A A;  5F68 A;  3DBA A;  2P7J A;  3MQO A;  2WKP A;  4AFI A;  4I3J A;  3MMH A;  4Y5F A;  3F1N B;  2KLI A;  2GZA A;  2QHK A;  5G4Z A;  5L8M A;  4LRZ E;  2VGL S;  3IS2 A;  4B9O A;  1P9W A;  3S7N A;  3T4S A;  2JKR I;  1OTE A;  4EU0 A;  1LSW A;  2O9C A;  4JGR A;  4BJP A;  2JHE A;  3FPV A;  3W2Z A;  3UMD A;  2GJ3 A;  1T18 A;  1T1B A;  4HJ6 A;  1T19 A;  2VV6 A;  4CLC D;  3MQQ A;  5DKL A;  2H28 A;  4FSF A;  2HJE A;  5DFY A;  3T4J A;  1BYW A;  2JKR M;  2PYP A;  4II7 A;  4EEP A;  2D02 A;  2W1R A;  2Z6C A;  1ZTU A;  2W3H A;  3S7Q A;  3LI9 A;  2EA9 A;  2J3T C;  4EER A;  1V9Z A;  1XJ4 A;  1W63 M;  3IBJ A;  4IUH A;  3H7W B;  5IU1 A;  1TS0 A;  3RTY A;  1ZHH B;  3LIE A;  2P04 A;  3B33 A;  3PBT A;  4DJ3 A;  2JN7 A;  2V0W A;  3KSF A;  3O5Y A;  4GW9 A;  5IT5 A;  3KSH A;  2FH5 A;  1F5M A;  3TJZ C;  2WKQ A;  3BQ8 A;  3NOU C;  2INW A;  2YKF A;  1H3Q A;  4M4X A;  3E98 A;  2K31 A;  3S7O A;  3F1P A;  1G28 A;  3K3C A;  1H8M A;  2ZBB A;  3LIB A;  3R4K A;  1F9I A;  4WLA A;  3MFX A;  2ZOH A;  3EOI A;  4NKP A;  3OCN A;  4HH3 A;  1D06 A;  3T4Q A;  2O9A A;  2OAQ 1;  2PR6 A;  3TW8 A;  3K3D A;  3PBS A;  4G3W A;  5KSH A;  4JGP A;  2HGV A;  4L9F A;  4LRX C;  2L0W A;  2D01 A;  3EWK A;  3LR4 A;  3H82 A;  1OT6 A;  1P9R A;  5HPI A;  4DMZ A;  3IS2 B;  4HJ4 A;  4H6J A;  2P08 A;  3LFV A;  3OC2 A;  2KX6 A;  2PYR A;  3EGD C;  5HWT A;  4NXG A;  3BY9 A;  2KDK A;  3CIT A;  2NUP C;  1S1Z A;  4GS9 B;  4GHI A;  4WUJ A;  4FOF A;  1DRM A;  2A24 B;  1GSX A;  2EWV A;  2LB9 A;  2VGL M;  3GDI A;  3KO6 A;  2VEA A;  4UQI S;  3B47 A;  2HJ9 C;  4PKY G;  2VZW A;  4MN5 A;  1NLZ A;  3K2N A;  3LIF A;  1P0Z A;  4Q0H A;  4HI4 A;  3UE3 A;  2XRO A;  3LR3 A;  1YSP A;  2K2N A;  5FL3 A;  3LR0 A;  2YKH A;  4ARZ A;  4LRY C;  5EFW A;  3ICY A;  3PHY A;  4EET B;  4EEU A;  3EQV A;  3B42 A;  2W27 A;  3F1O A;  3BW6 A;  3KYQ A;  4RQ9 A;  4P6Z S;  2J3W A;  3C38 A;  4WEJ A;  2B02 A;  3A0R A;  1LL8 A;  3PBQ A;  4HIA A;  3BQA A;  2W3D A;  4MMN A;  2B18 A;  4BWI A;  2VKS A;  4XT2 B;  3FC7 A;  3NOP C;  1VHM A;  3OCL A;  1STZ A;  4QPR A;  4EQ1 A;  4F3L A;  4HNB A;  1IFQ A;  4CLC A;  2W1T A;  1YSQ A;  4JGO A;  3BJN A;  3UB7 A;  3E4P A;  4HQA A;  2ZMV A;  4MN6 A;  5I5L A;  4DN0 A;  4MN7 A;  2GNX A;  4BBV A;  4KQD A;  3RFB A;  5HDC A;  3R7W B;  3G6O A;  4ME4 A;  4HOI A;  4HY8 A;  5C5K A;  3A0V A;  4Y3I A;  4R6L A;  4NXE A;  4PHT A;  4KUK A;  2KOI A;  3VE4 A;  2V9A A;  1XJ6 A;  2O9B A;  5TBM A;  3JVU A;  5DJT A;  3E0Y A;  3VOL A;  2PHY A;  4R3A A;  3TRC A;  3CUE A;  1OTA A;  2R78 A;  4Q0I A;  3E4Q A;  3UB9 A;  1N9N A;  2VV7 A;  3F1N A;  2V1B A;  3CI6 A;  5TJJ A;  3BY8 A;  1D7E A;  1XJ3 A;  3H9W A;  1W63 Q;  3NOT C;  4PKY A;  3LIC A;  5AVE A;  4CLC C;  3T4K A;  1LT0 A;  2QWS A;  1S66 L;  4ZRR A;  2K7S A;  2V0U A;  4L0L A;  3HCY A;  2W3F A;  5HD3 A;  1NRJ A;  4I38 A;  4IHQ A;  3S7P A;  1TF1 A;  1XFN A;  3PBR A;  4UEY A;  3PYP A;  1TS8 A;  4R70 A;  2A2L A;  3FPW A;  3UME A;  4I39 A;  1OTB A;  5G4Y A;  2QYB A;  2VA0 A;  1ODV A;  4WEK A;  1DP6 A;  4MCW A;  2XRN A;  4L9E A;  3EEA A;  3NJA A;  5DKK A;  4DJ2 A;  3MJQ A;  4UQI M;  3KSG A;  3KX0 X;  4ETX A;  4EES A;  2NUT C;  3LR5 A;  3H7W A;  3CUE C;  3UB8 A;  1OT9 A;  2IA2 A;  1KOU A;  2M1C A;  4LLO B;  3T4T A;  1GSV A;  4Q0J A;  1OJG A;  3CLO A;  2Y79 A;  1LSX A;  3VV4 A;  1UGU A;  1T1C A;  3U2A A;  1GSW A;  3PR6 A;  4GJ4 A;  4HP4 A;  3T4L A;  1V9Y A;  1S4S A;  4CLC B;  1S67 L;  3D72 A;  2MJ6 A;  2OOL A;  1UWN X;  1F98 A;  5CX7 A;  4YWZ A;  3E4O A;  2L4R A;  5KIZ A;  1YAX A;  4EXO A;  3LI8 A;  2ZMF A;  2VJW A;  3LIA A;  4BMW A;  4K08 A;  4Z1W A;  1MKM A;  5HWV A;  4YNR A;  3TE8 A;  1X0O A;  2PD8 A;  4KUO A;  1P97 A;  3ULF A;  2PR5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...