2HF6A

Solution structure of human zeta-cop
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
149
structure length
149
Chain Sequence
MEALILEPSLYTVKAILILDNDGDRLFAKYYDDTYPSVKEQKAFEKNIFNKTHRTDSEIALLEGLTVVYKSSIDLYFYVIGSSYENELMLMAVLNCLFDSLSQMLRKNVEKRALLENMEGLFLAVDEIVDGGVILESDPQQVVHRVALR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport
molecule keywords Coatomer subunit zeta-1
publication title Solution structure of human zeta-COP: direct evidences for structural similarity between COP I and clathrin-adaptor coats
pubmed doi rcsb
source organism Homo sapiens
total genus 42
structure length 149
sequence length 149
ec nomenclature
pdb deposition date 2006-06-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.60 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2hf6A00
4NEED 2VGLM 2FH5A 2VGLS 4UQIM 2JKTI 1W63Q 4UQIS 3TJZC 5MC7A 4P6ZM 2HF6A 2JKRI 1NRJA 2JKTM 4P6ZS 2XA7M 2JKRM 2XA7S 1W63M
chains in the Genus database with same CATH superfamily
4YFMA 4EBPA 1P97A 1JNUA 3IF6C 5G4YA 5HAIA 1NYMA 1SDNA 2Z2MB 5AQ9A 2ZMVA 4K0WA 1S4RA 4WN5A 5FAQA 1YLJA 2IWDA 1IFQA 3VFHA 4Q0HA 1JTDA 3HUMA 5KMWA 4Q0IA 1WA9A 4ESPA 5L09A 3UDXA 5F5YA 2ACGA 4GS9B 1L0EA 3VP4A 1FOFA 4WZ5A 3SS4A 3CHWP 3KYQA 4BQMA 1XJ4A 4HHDA 1OTBA 3MZEA 1XXMA 2WKPA 1I2WA 3IH9A 3GSGA 4R6LA 1TVFA 2G7UA 3PBQA 4ETZA 4EETB 1VETA 1YAXA 1XX2A 4P0MA 1MWTA 3D3OA 4DRTA 2WKEA 2P9VA 4MN7A 1GCEA 4HJ4A 1H3QA 3V50A 1T19A 4LLOB 1Y28A 3ZQ5A 2I9VA 5EE8A 4CLCE 4QU3A 5TBMB 2ZM0A 2PHYA 3KSHA 3BW6A 1S1YA 3NOPC 3FZCA 5FA7A 5HDCA 2GX5A 4DXCA 3LY4A 2VLGA 2OOLA 1G68A 4P87A 4EU0A 2XK1A 2W3FA 4WF0A 2QJ5A 4WEJA 5G18A 3LY3A 3IWIA 3G2YA 3VFFA 1KE4A 4Y7PA 5HL1A 4ARZB 4KENB 4NETA 3VOYA 4Y3IA 2XLNA 1VEUB 3EQUA 2HDRA 5EOOA 3PAGA 3BFEA 2J80A 2B95A 2Q9MA 2G2UA 1ZC2A 3E4OA 1M6KA 3IX8A 2P9VB 4C3QA 3ZG7B 3DBAA 5HZHA 4HOIA 2QJ7A 4OQHA 4ETXA 4IUHA 4LV0A 1S66L 3SW1A 2WGIA 4I38A 3BLMA 4HBTA 4HIAA 1O7EA 1TEMA 5HD5A 3E98A 4X53A 5E43A 4IHQA 1XFNA 4GDBA 1CEFA 4S2PA 3E0YA 3QP5A 5A90A 4X25A 2EA9A 4MLLA 5GLCA 1GSWA 1LSXA 5F1GA 3PBTA 4QY5A 2VGKA 2FH5A 3OCNA 4PAUA 5E2HA 1PFLA 5BOHA 3VOLA 4D60A 4S2MA 2ZC7A 2C5WB 1W8YA 2V8CA 3Q82A 4FUWA 4QB8A 1KVLA 4LCLA 1ESUA 4R4SA 3HUNA 4UEYA 3NIAA 5KIZA 4KUKA 4OQGA 3DW0A 3UE3A 5FAOA 3GVBA 5AQAA 4WLAA 4WMCA 2JKGA 5EV0A 3IBJA 3NCKA 2WKRA 1ONGA 3EQVA 2Y59A 2R9WA 4R70A 1SDEA 4LFUA 4IVIA 3MSHA 2V1ZA 4EBLA 4Y0TA 5HSQA 2VGLM 5HFOA 3HL9A 3S1YA 2FFYA 2ZM2A 1NZOA 4GNUA 3SS5A 2ZC6B 2XD5A 1T1BA 4NXEA 4E3NA 3KSGA 3PTEA 4DE2A 2PBDP 3M2JA 1H8MA 4JLFA 1K4FA 2RCXA 2JE5A 2LB9A 3OCLA 4FOFA 4QD4A 4UQIS 4ZAMA 1DJCA 2V0UA 1MWUA 4N1XA 2JKRM 3QNBA 1YT4A 3LR0A 3G35A 3CUEA 1PZOA 1GA9A 5TJJA 5EECA 1NY0A 3WS1A 2JBFA 4X68A 5J3WA 1D7EA 4L9EA 2W1RA 5CGSA 1HLUP 3GV9A 4JF4A 1XA1A 4HQAA 2VEAA 4FSFA 3MFDA 4KZAA 3FYZA 4P6BA 5FSRA 4ME4A 3LEZA 3C7UA 1GSVA 2OSUA 2Y2QA 1L0FA 1P9WA 3GECA 3FV7A 4OKPA 4CJNA 3UY6A 3CPTA 3KYEA 5A8BA 2QMIA 3UPOA 4XUXA 5C5KA 3UB6A 3QHYA 1EI5A 5JYOA 2VKSA 1NLZA 3EOIA 2OWJA 1L0DA 2HV1A 3PBNA 5AQ7A 4RX3A 2BLSA 3B3XA 3ZFZA 2VGJA 1WYBA 4OQIA 4Y5FA 5CGXA 3C4OA 3MXSA 4GD8A 2K2NA 5EVEA 1YPRA 2QKPA 4OH0A 1EW0A 5DVAA 3UDIA 1XP4A 4BBUA 1YMXA 4HP4A 3DAVA 4LRXC 2GDNA 2EFUA 1N9LA 5HPFA 1NWZA 4OVDA 2VX8A 2INWA 3VMAA 1FCMA 4GJ4A 3JVUA 3U2AA 1K55C 4I3AA 3UMDA 2QYBA 1I5QA 4S2NA 3C7VA 3IWOA 3T4QA 5CEBA 2ZC4B 1KOUA 3GQZA 4YOFA 4KG6A 3H82A 2WKIA 1NRFA 4UA7A 3ZCZA 1LLBA 3LR5A 3V5MA 2K31A 4O0PA 1TF1A 5F83A 4FTXA 3H7WA 1KGFA 3T50A 2ZMFA 3S7QA 3I7JA 3RJUA 5CHJA 4LGWA 3IQAA 4JKTA 1MKIA 4H8RA 3DTIA 3A0RA 2IWBA 4U3TA 5FEGA 1MPLA 1W63Q 4O7DA 1ESIA 4KQDA 3ZNTA 3BQ8A 3N8LA 2JN7A 3T4TA 1DP6A 4JXGA 5EVID 4I3JA 3HJKA 3UB7A 3BFFA 5K5BA 4FCFA 5TGFA 4XT2A 2V2FF 3TSGA 3BECA 3RH8B 2XFTA 1BTLA 2HPBA 3A3EA 3T4JA 4KZ8A 5G4ZA 1XJ2A 5DKLA 4M4XA 2HDUA 2H10A 3ZG5A 3IHBA 2XGNA 2ZC3B 1HZOA 3T4SA 1DJAA 3F1PB 4R23A 2ZL1A 4NK3A 1K54C 3UPPA 4QPRA 1IKGA 3BY9A 3LIBA 3PYPA 1LL5A 3SOIA 3VV4A 4OPQA 3OPHA 4JPMA 2H28A 4N1HA 1MC0A 3IWQA 5L07A 4XT2B 2HP9A 4HEFA 3N8RA 1LT0A 4Z1WA 1W79A 2H5SA 3AGDA 2Y2OA 3HLWA 5AVFA 3P01A 4S2NC 2KLIA 3UB9A 3LYXA 1S6RA 2Y91A 4E3MA 1PI4A 3A0VA 5GHYA 1W5DA 4E3KA 1YMSA 4MNRA 2VA0A 4Y17A 3UN7A 3G32A 2X02A 5HWVA 5GLDA 2WUQA 4MN6A 4II7A 5EPHA 5DF8A 5EVIC 4OOMA 2G2WA 4N9KA 4EUZA 3E2LA 1RGYA 4GHIB 2PU4A 1K56D 5HAQA 1C3BA 2O9BA 4WYYA 3KSIA 1G6AA 1E4DA 1ZKJA 4Q0JA 3ZG0A 2GNXA 3CG5A 4DE3A 1T18A 4B9OA 5DF7A 1VM1A 1TDGA 5L2FA 3JVVA 5A92A 4UQIM 2WGWA 3KX0X 4WUJA 2L0WA 4N9LA 4ZJ3A 3BWLA 1SZVA 4KQQA 2E8JA 3WRTA 2P7JA 5HL6A 3BRMA 5U47A 3K3CA 3EEHA 3IBRA 5FQ9A 3HLGA 4L9GA 4B4ZA 1S4SA 2HF6A 3B47A 1PW8A 4R3JA 2X71A 4BMWA 2KDKA 5FI2A 3UB5P 4JBFA 3WS0A 1S1ZA 4EWFA 1IYPA 4IVKA 3IX3A 4WEKA 2ZD8A 3LIEA 1LSWA 1TS7A 4UA6A 3N6IA 4RVAA 1MKMA 3M6HA 4OLGA 4S2OA 3VP0A 2O9CA 1ACFA 5GLAA 2XDMA 4OP5A 3BFDA 1UWNX 3GMWA 4PM9A 2Z2LB 5CHUA 4ZJ2A 3W4PA 4Y15A 2Y2KA 5F82A 3RFBA 1JWPA 2PAVP 2VK3A 3RTYA 3ZNYA 1KDWA 3EWKA 2UV0E 1NYYA 3WS4A 2WAFA 2L4RA 1YM1A 4RA7A 1K57C 1VETB 1XGJA 3O5YA 3UB8A 1IYOA 5M1AA 4Y2FA 1PRQA 4KQRA 1GSXA 1S67L 2W3DA 1FR6A 5DFXA 4HP9A 5HWTA 3SH9A 3TE8A 1DP9A 3MZDA 5HX9A 3CAXA 2ZQDA 3CITA 3C2WA 3DWKA 4JXVA 4MMNA 3O88A 5I5LA 1W7FA 2B18A 3ULFA 1H8ZA 4IEDA 4JXWA 4WELA 2HP6A 3BFGA 5FI7A 3HJIA 1YLYA 3OLOA 2Y8HA 4GD6A 4DF6A 4P6ZS 1BLHA 3A0SA 1BLCA 4S2KA 2A24A 2QHKA 3ZDJA 1KDSA 3N8SA 3VP2A 3G6OA 2PD7A 2CMNA 2WZXA 1RP5A 4OOLA 5JYPA 5DTKA 1L2SA 4WZ5C 2DMWA 3VE3A 2B02A 3OZHA 4E3IA 3D9YA 4HI4A 3L7HA 1JVJA 4EEUA 1K4EA 2GJ3A 1VQQA 3WS5A 3AGFA 2ZJ9A 2Q0OA 3W4QA 1PWDA 2KOIA 4R3BA 1H5XA 2PRFA 3TG9A 2OV5A 5L8MA 1BYWA 1ZG4A 3E4PA 2EXBA 3BM6A 3MFXA 3NOUC 2P04A 4GW9A 3ITAA 4WMCD 2EX6A 3FG8A 3LGOA 2B5RA 1OPXA 4R3AA 2WAEA 4YINA 3ZG8B 5DTTA 4HH3A 2LB5A 4OQ0A 1GHMA 2VV7A 5HWWA 4X69A 4Y0UA 2EX2A 2V1AA 4X1LA 3RXXA 3S4XA 4MBKA 1TDLA 2J3TC 1D1JA 1IELA 3IXDA 3ZVWA 4GOGA 5F6AA 1O07A 2DNSA 2WYXA 5A93A 1F5MA 3W4OA 4KZ9A 3JPUA 3PBSA 1XFQA 4OPYA 2HZ5A 4GKUA 1FCNA 1K0KA 3B33A 2JKTM 4HJ6A 2RL3A 4AFIA 1YKDA 4B4XA 2EWWA 2PR5A 1E3UA 4EUVA 2R78A 2GZAA 1Z6FA 1IOUA 3IX4A 2IA2A 1TS8A 4IBRA 4UA9A 3MJQA 5IU1A 4BD0A 4LRZE 3QNCA 4GB7A 3BY8A 3UMEA 4CLCA 3Q7VA 1UGUA 1S0WA 2PD8A 2O9AA 3FPVA 3G34A 4K08A 4ZBEA 1PZPA 2PDRA 4B93A 1SCWA 3QP6A 1STZA 1FILA 4IBXA 3T1QB 3V3SA 2XROA 4CQHA 4GN2A 4G3KA 3HCYA 4YNRA 1G28A 1PIOA 2Y2IA 2Q9NA 4NKPA 4WZ4A 4DN0A 2Y55A 1GHPA 4DE1A 3VOZA 3FWLA 3UE6A 5FEFA 4OPRA 4PMAA 3UE0A 3NHQA 2ZQ7A 3MR0A 2Y2PA 3MMHA 4BBVA 4L0LA 4G3VA 4R38A 1OT9A 2JKRI 4S2IA 1VB6A 3N7WA 1YLTA 5A91A 1ALQA 3CPTB 2JKFA 4E3JA 1MXOA 3CLOA 5E2FA 4HY8A 1AXBA 5CRFA 4NEED 3OPRA 2ZM8A 3IS2A 3O87A 4JXSA 3F1NA 4IJGA 1PWCA 4HJ3A 4L9FA 3TOIA 3HLEA 3NULA 2OLVA 1PW1A 2W27A 3CMZA 1BLSA 3VSLA 2XA7S 4NXGA 5EUAA 3NY4A 4R1GA 3BYDA 1SKOA 4DDSA 3A3DA 1HVBA 4XUZA 3T4OA 4KZ6A 3O3VA 3RXWA 1YLPA 3C5AA 2ZBBA 2WKHA 3W2ZA 3CUEC 3MXRA 5AJGA 5L10A 1PWGA 3MQQA 3T4KA 4HNBA 4PHTA 4MCWA 3PHYA 4EESA 1P9RA 1ES2A 1BLPA 4X55A 1CK3A 5AQBA 1KE0A 3IF6A 2M7UA 4HESA 4UHUA 3CI6A 4LV3A 3C4PA 2FZ0A 3G31A 2AVXA 3F1NB 3V3RA 3FPWA 5GHXA 2CC1A 2Y2LA 4H6JA 4E3LA 3M6BA 1HD8A 4F3LA 1OTAA 1FIKA 3T12B 3LCEA 3GR2A 4LCMA 1D06A 3NJAA 4JGPA 3H82B 5FQKA 1YSQA 3TW8A 1G6OA 4NXFA 1K25A 5IT5A 1FR1A 5HPIA 3NOTC 4HBUA 2WK0A 3H7WB 3IF5A 1QMFA 3P98A 3MBZA 4KUOA 5DJUA 4LV1A 2K7SA 4KZBA 4QJGA 1ZHHB 1VHMA 4MBHA 4ZJ1A 4R4RA 3R7WA 5FDHA 3T4LA 4QWOA 5GL9A 1ERMA 4EV4A 3LIAA 1FSYA 4Q8IA 2W3HA 2J9PA 1K6RA 1M40A 2XF3A 3DTEA 2J9OA 2QZ6A 3MXQA 3NI9A 4KG2A 1Z09A 4P6ZM 4GZBA 4RQ9A 5CTNA 4BL3A 2W3GA 1X0OA 3ICYA 3OC2A 2Y2HA 2HJ9C 4QY6A 3S7OA 5F1FA 3A3FA 3S7PA 1U60A 1K56A 4EEPA 3PAEA 2DRWA 4ID4A 1SKFA 4PM7A 3R7WB 4PM6A 2ZL1B 3Q81A 5CERA 4D2OA 1ES4A 3QP8A 5DTSA 5CGWA 2W3EA 4MEZA 1PI5A 2J3WA 4OP8A 3DTMA 4X1MA 4GS9A 2YKHA 2MJ6A 4ZTKA 5D3OA 1IYQA 3KYZA 1PNEA 1WYCA 5CTMA 5M18A 2H0TA 1CJFA 3QP4A 1BULA 1N9OA 2FFFB 4MDZA 2Z6CA 1NJ4A 3W8KA 3Q7ZA 3UDFA 4PPRA 4A5RA 3T1SA 1XJ6A 3PXPA 4EBNA 1MWRA 4HH2A 3BEBA 4BL2A 4C6YA 4PM5A 3G4PA 1OTIA 5MC7A 3HLBA 2I72A 5TBMA 1EROA 2NUTC 3SH7A 3T1RA 4I39A 2PU2A 5FL3A 4QHCA 1W63M 4GCZA 1QMEA 4EQIA 2ZQ8A 5CHMA 1MZUA 3DTKA 3R4KA 3LIFA 3B42A 3M2KA 4X6TA 1JTGA 4DJ2A 4Y0OA 4WL9A 3KO6A 3WRZA 3WS2A 3ISGA 2VZWA 1DJBA 1ES3A 1HTZA 3IH8A 5EM1A 2WZZA 4M3KA 4ARZA 1Q2QA 3MKFA 1VEUA 1Y4OA 2P08A 1V9YA 2ZQCA 2HP5A 2ZOHA 3SH8A 4OOYA 2PBYA 3GRJA 2WGWB 1BUEA 1ERQA 1V9ZA 4LRYC 5M19A 2O0YA 1OTEA 5LBRA 2OAP1 3FKVA 3LR3A 1OTDA 1ES5A 3EEAA 4RX2A 4E3OA 2BG1A 1J3WA 4OPZA 1OT6A 3IT9A 4Z9QA 1P0ZA 3G2ZA 3HBRA 4LENA 1LL8A 5HDDA 2A2LA 1N9NA 2ZOIA 1LHYA 3PBOA 4DE0A 4EQ1A 1IKIA 5F69A 4NG2A 1J9MA 2JHEA 1YSPA 4FH2A 3LEQA 3OPPA 1LI9A 4ZDXA 2A3UA 2OWHA 1MBLA 5KZHA 3ZVTA 3EGXC 5CECA 1ODVA 4IUKA 3VE4A 1TS6A 5E2EA 3MKEA 4E6WA 1CI8A 2J3TD 4WM9A 5J7EA 1XGIA 5HW3A 3C8CA 2O99A 1EWZA 2HDQA 2PT7A 3A3JA 3BFCA 1YQSA 2XA7M 3C30A 5I94A 1A0KA 3LUQA 1Q2PA 2NUPC 5AVEA 1NLYA 3V67A 3IHAA 3ZGAB 2XQZA 2YKFA 2QWSA 3L9KA 4U0XA 2ZQAA 3OPLA 5HD3A 3U4LP 2C6WB 5CX7A 2D01A 3P09A 2V0WA 1F2KA 1NZUA 2XR0A 4DMZA 1MWSA 1XKZA 3VSKA 3V39A 3T1XA 4EXOA 3NDEA 5DF9A 2XH9A 1DY6A 5FQMA 2WGVA 5KSCA 4PM8A 3Q07A 1MY8A 2ZC5B 4BENA 3VP3A 5J4EA 3FC7A 5EOEA 3Q1FA 5HAPA 3HLFA 2R9XA 2ZQ9A 1GA0A 1K55A 1RGZA 1ZTUA 4P85A 1T1CA 3KSFA 3CWFA 2A24B 3NC8A 3SS3A 1XPBA 1FSWA 4S2LA 2M7VA 3MQOA 1OJGA 3K3DA 1LI0A 3HVFA 4I3IA 2A49A 4LV2A 5F68A 1RCJA 5IS1A 1DRMA 1LSVA 2XD1A 1GHIA 4B88A 1W8QA 2Z6DA 2WKQA 4CPKA 4YWZA 4K0XA 2PYRA 1KGEA 2Y4AA 1BZAA 3ZHHA 4KQOA 4NXBA 4WBGA 4O01A 3VP1A 3D72A 3TJZC 1IEMA 4K91A 1L3LA 4S2JA 2XRNA 3G30A 3OOVA 3MF0A 1TD5A 3LICA 3HUOA 3IXBA 2EWVA 5DKKA 4JGRA 4GLQA 3BQAA 2E8IA 5HARA 1CQAA 2PR6A 3UPNA 1FQGA 1L0GA 3HLDA 1CI9A 4XXRA 3CZDA 1E3UD 5CEDA 5FQJA 2EXAA 4E6XA 2UWXA 3LIDA 1G5UA 1OMEA 4RYEA 4F94A 5TR7A 3PBRA 4R0QA 4E04A 2J7VA 4CLCD 3E4QA 5EVLA 4O8GA 3GDIA 3C38A 1YLWA 3H9WA 2D02A 1ZG6A 5HDSA 3EGDC 3BLSA 2JC7A 1K54A 5GHZA 4CLCB 3LI9A 3Q7VB 5J8XA 4KG5A 3QP1A 4Y13A 2HGVA 4EW7A 2IWCA 4UAAA 2VV6A 4U0TA 2JKTI 5TFQA 2DCFA 3ITBA 2XSSA 3A3IA 1DP8A 3ZYTA 2M1CA 1Y54A 5FQQA 2JCHA 2W1TA 1IYSA 5FI6A 4BWIA 3PR6A 4MN5A 1NXYA 2W0NA 4BJPA 5FATA 1JWZA 2XEPA 2H0YA 2X01A 1CEGA 2QPNA 4BBTA 2V1BA 4OLDA 1K38A 3ZG9B 3MZFA 3AGEA 2Y79A 4FH4A 2Y2JA 3LFVA 1KVMA 2Y2MA 3CJMA 5EVIA 4PKYG 3O86A 4ZRRA 1N4OA 4EERA 2OLUA 5EFWA 1FCOA 3IS2B 4JF5A 3HREA 5FQIA 1ONHA 1LL9A 3DWZA 4JGOA 5CXWA 4KZ7A 1TS0A 2BTFP 3F1PA 4DKIA 2OAQ1 2W1TB 3SZTA 1F9IA 3UO9A 3MS6A 3D4FA 1YLZA 3N4IA 2EX8A 2V8FA 2VGLS 4CLCC 1UWPX 1XJ3A 4X56A 1SKOB 4KZ5A 1KGGA 3GTCA 4FD8A 1N9BA 1I2SA 5FASA 1XA7A 4DDYA 1T1AA 5GLBA 5FAPA 2PYPA 1SHVA 5FDSA 5DFYA 5EVIB 1WE4A 1BT5A 1H0MA 5DJTA 5IHVA 3UE1A 4LPZA 2XFSA 4PKYA 3F1OA 3IF6B 1NRJA 3UNWA 3P7NA 3HLCA 1E25A 3K2NA 3S22A 2J8YA 4DJ3A 2VJWA 1AWIA 4BD1A 2EFXA 4H6JB 2KX6A 4C75A 1H8YA 4I5SA 4F3LB 2BASA 2P74A 2V20A 5E2GA 1K6SA 2HDSA 3NBLA 4N92A 1OJ5A 3NECA 3IXGA 4DXBA 2Y2NA 4GHIA 4MBFA 1KE3A 3S7NA 3QP2A 4GDNA 3OBFA 3LI8A 3BJNA 4G3WA 3WWXA 4JGQA 2ZMAA 1BSGA 1CF0A 3NDGA 2EX9A 2Y2GA 4JF6A 2WADA 1K57A 3F1OB 1PYYA 2L1MA 3E2KA 4KZ4A 1JWVA 2VV8A 1F98A 4BLMA 3JYIA 3IXHA 2V9AA 5EM0A 3TRCA 3LR4A 2ZLYA 2HJEA 3LO7A 4OONA 3FKWA 3MQ0A 5KSHA 4KZ3A
chains in the Genus database with same CATH topology
2IA2A 1P97A 2J3TD 1JNUA 5G4YA 1TS8A 3A0RA 3MJQA 5IU1A 5J7EA 2ZMVA 4LRZE 3C8CA 3BY8A 1W63Q 3UMEA 4CLCA 2O99A 4KQDA 1UGUA 1S4RA 2PD8A 2PT7A 4WN5A 2O9AA 3FPVA 4K08A 3BQ8A 2PDRA 2XA7M 3C30A 4B93A 3LUQA 2JN7A 1IFQA 4Q0HA 3T4TA 1DP6A 2NUPC 1STZA 4I3JA 3HJKA 1NLYA 5AVEA 3UB7A 3V67A 5K5BA 4XT2A 2XROA 4Q0IA 2YKFA 3RH8B 1WA9A 2QWSA 5HD3A 4CQHA 4G3KA 5CX7A 2D01A 3HCYA 2V0WA 5F5YA 4GS9B 4DMZA 4YNRA 1G28A 3T4JA 3KYQA 1XJ4A 4NKPA 5G4ZA 4EXOA 4DN0A 1XJ2A 4HHDA 5DKLA 4M4XA 1OTBA 2WKPA 3UE6A 5DF9A 3NHQA 4R6LA 3MR0A 2G7UA 3PBQA 3T4SA 4ETZA 3F1PB 4EETB 1YAXA 3MMHA 4BBVA 4L0LA 3D3OA 4MN7A 4G3VA 4R38A 1OT9A 2JKRI 4HJ4A 5J4EA 1H3QA 1T19A 4QPRA 1VB6A 4LLOB 3FC7A 1Y28A 3ZQ5A 3BY9A 3LIBA 2I9VA 3PYPA 4CLCE 3CLOA 3VV4A 5TBMB 1ZTUA 2PHYA 3KSHA 3BW6A 4HY8A 1T1CA 1S1YA 3KSFA 2H28A 3NOPC 4NEED 3IS2A 3CWFA 3F1NA 4IJGA 1MC0A 2A24B 5HDCA 4XT2B 4HJ3A 2M7VA 4L9FA 2GX5A 3MQOA 4Z1WA 1LT0A 1OJGA 3K3DA 2W27A 2VLGA 2OOLA 4I3IA 2XA7S 5F68A 4NXGA 4EU0A 5IS1A 1DRMA 2W3FA 4WF0A 2QJ5A 4WEJA 5AVFA 3P01A 2KLIA 3UB9A 1LSVA 4ARZB 3T4OA 3LYXA 4Y3IA 3A0VA 2Z6DA 3EQUA 2WKQA 2VA0A 2ZBBA 2J80A 4YWZA 2PYRA 3W2ZA 5HWVA 3E4OA 3CUEC 4MN6A 5AJGA 3MQQA 4II7A 3T4KA 4HNBA 4PHTA 4MCWA 3PHYA 4OOMA 4EESA 3DBAA 5HZHA 4HOIA 1P9RA 2QJ7A 4ETXA 4IUHA 4KQOA 4NXBA 1S66L 4GHIB 4O01A 2M7UA 3SW1A 4I38A 3CI6A 3D72A 4HIAA 3TJZC 2FZ0A 3F1NB 5HD5A 2O9BA 3E98A 3FPWA 4IHQA 2XRNA 1XFNA 3OOVA 4H6JA 3KSIA 3MF0A 1TD5A 3E0YA 3LICA 4Q0JA 2GNXA 4F3LA 1OTAA 2EA9A 1T18A 4B9OA 2EWVA 5DKKA 1D06A 4JGRA 3NJAA 4JGPA 3H82B 1GSWA 1LSXA 1YSQA 3PBTA 3JVVA 4GLQA 3TW8A 1G6OA 4NXFA 2FH5A 3OCNA 3BQAA 4PAUA 5IT5A 4UQIM 3KX0X 2PR6A 4WUJA 2L0WA 5HPIA 3VOLA 3NOTC 3BWLA 3H7WB 2P7JA 3LIDA 4UEYA 4KUOA 5KIZA 4KUKA 5DJUA 3UE3A 2K7SA 5HL6A 4WLAA 1ZHHB 3K3CA 3PBRA 1VHMA 3EEHA 3IBRA 3IBJA 4E04A 4L9GA 2WKRA 3R7WA 4CLCD 3T4LA 3EQVA 3E4QA 1S4SA 4O8GA 3GDIA 2HF6A 3B47A 3C38A 3H9WA 2D02A 5HDSA 3EGDC 3LIAA 4CLCB 3LI9A 2W3HA 4R70A 4BMWA 2KDKA 1S1ZA 4WEKA 2HGVA 3LIEA 5HSQA 2VGLM 1LSWA 1TS7A 4EW7A 2VV6A 1MKMA 2JKTI 3MXQA 2O9CA 4P6ZM 2XSSA 4RQ9A 1DP8A 3ZYTA 2M1CA 1T1BA 1UWNX 4NXEA 2W1TA 2W3GA 1X0OA 4BWIA 3ICYA 3RFBA 3KSGA 3PR6A 3OC2A 4MN5A 3RTYA 2W0NA 2HJ9C 3S7OA 4BJPA 1H8MA 3EWKA 3S7PA 2LB9A 3OCLA 4BBTA 4EEPA 4FOFA 4UQIS 2V1BA 2L4RA 2V0UA 3R7WB 3O5YA 3UB8A 2JKRM 3LR0A 3CUEA 2Y79A 4Y2FA 5TJJA 3LFVA 2W3EA 2J3WA 4PKYG 5J3WA 4GS9A 4ZRRA 1D7EA 2YKHA 4L9EA 2MJ6A 1GSXA 1S67L 2W3DA 2W1RA 3KYZA 5DFXA 4HP9A 4EERA 5EFWA 5HWTA 3TE8A 1DP9A 3IS2B 3CAXA 4HQAA 3CITA 4JGOA 2VEAA 4FSFA 3C2WA 1N9OA 1TS0A 4MMNA 4ME4A 3F1PA 4MDZA 2OAQ1 2Z6CA 1GSVA 2W1TB 5I5LA 1F9IA 2B18A 3ULFA 1P9WA 2VGLS 3GECA 1XJ6A 3PXPA 4WELA 4CLCC 1UWPX 1XJ3A 4HH2A 3HJIA 1OTIA 3OLOA 5MC7A 5A8BA 2Y8HA 4P6ZS 5TBMA 5C5KA 3UB6A 2NUTC 3A0SA 4I39A 1T1AA 2VKSA 5FL3A 1NLZA 3EOIA 1W63M 2A24A 2OWJA 4GCZA 2PYPA 2QHKA 2HV1A 3PBNA 1MZUA 3G6OA 2PD7A 2CMNA 5DFYA 3R4KA 3LIFA 3B42A 4OOLA 5DJTA 4LPZA 4Y5FA 4PKYA 3F1OA 2DMWA 4DJ2A 1NRJA 3KO6A 4WL9A 3VE3A 3P7NA 2B02A 2VZWA 3K2NA 2K2NA 4DJ3A 2VJWA 4ARZA 4HI4A 2QKPA 1EW0A 4H6JB 4BBUA 4EEUA 4HP4A 2KX6A 2GJ3A 4I5SA 4F3LB 4LRXC 2P08A 2BASA 2KOIA 1OJ5A 1V9YA 1N9LA 5HPFA 2ZOHA 1NWZA 2VX8A 2INWA 4GJ4A 5L8MA 3JVUA 1BYWA 1V9ZA 4LRYC 3E4PA 3U2AA 2O0YA 1OTEA 5LBRA 4GHIA 3S7NA 3MFXA 2OAP1 3LR3A 3NOUC 2P04A 4GW9A 1OTDA 4I3AA 3FG8A 3UMDA 3EEAA 3OBFA 1OPXA 2QYBA 3LI8A 4R3AA 3BJNA 4G3WA 1OT6A 4HH3A 4JGQA 3T4QA 1P0ZA 2LB5A 1LL8A 5HDDA 2A2LA 2VV7A 1KOUA 1N9NA 5HWWA 2ZOIA 4YOFA 3PBOA 3H82A 3F1OB 2V1AA 4EQ1A 5F69A 2L1MA 2J3TC 2VV8A 3LR5A 2JHEA 1F98A 2K31A 5F6AA 4O0PA 1YSPA 1F5MA 1TF1A 2V9AA 3PBSA 1XFQA 3LR4A 3TRCA 3H7WA 2OWHA 3T50A 2ZMFA 3S7QA 3B33A 2HJEA 2JKTM 4HJ6A 4AFIA 3EGXC 1ODVA 1YKDA 4IUKA 2EWWA 2PR5A 4EUVA 3VE4A 2R78A 1TS6A 2GZAA 3MQ0A 1IOUA 5KSHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NEE D;  2VGL M;  2FH5 A;  2VGL S;  4UQI M;  2JKT I;  1W63 Q;  4UQI S;  3TJZ C;  5MC7 A;  4P6Z M;  2HF6 A;  2JKR I;  1NRJ A;  2JKT M;  4P6Z S;  2XA7 M;  2JKR M;  2XA7 S;  1W63 M; 
#chains in the Genus database with same CATH topology
 4YFM A;  4EBP A;  1P97 A;  1JNU A;  3IF6 C;  5G4Y A;  5HAI A;  1NYM A;  1SDN A;  2Z2M B;  5AQ9 A;  2ZMV A;  4K0W A;  1S4R A;  4WN5 A;  5FAQ A;  1YLJ A;  2IWD A;  1IFQ A;  3VFH A;  4Q0H A;  1JTD A;  3HUM A;  5KMW A;  4Q0I A;  1WA9 A;  4ESP A;  5L09 A;  3UDX A;  5F5Y A;  2ACG A;  4GS9 B;  1L0E A;  3VP4 A;  1FOF A;  4WZ5 A;  3SS4 A;  3CHW P;  3KYQ A;  4BQM A;  1XJ4 A;  4HHD A;  1OTB A;  3MZE A;  1XXM A;  2WKP A;  1I2W A;  3IH9 A;  3GSG A;  4R6L A;  1TVF A;  2G7U A;  3PBQ A;  4ETZ A;  4EET B;  1VET A;  1YAX A;  1XX2 A;  4P0M A;  1MWT A;  3D3O A;  4DRT A;  2WKE A;  2P9V A;  4MN7 A;  1GCE A;  4HJ4 A;  1H3Q A;  3V50 A;  1T19 A;  4LLO B;  1Y28 A;  3ZQ5 A;  2I9V A;  5EE8 A;  4CLC E;  4QU3 A;  5TBM B;  2ZM0 A;  2PHY A;  3KSH A;  3BW6 A;  1S1Y A;  3NOP C;  3FZC A;  5FA7 A;  5HDC A;  2GX5 A;  4DXC A;  3LY4 A;  2VLG A;  2OOL A;  1G68 A;  4P87 A;  4EU0 A;  2XK1 A;  2W3F A;  4WF0 A;  2QJ5 A;  4WEJ A;  5G18 A;  3LY3 A;  3IWI A;  3G2Y A;  3VFF A;  1KE4 A;  4Y7P A;  5HL1 A;  4ARZ B;  4KEN B;  4NET A;  3VOY A;  4Y3I A;  2XLN A;  1VEU B;  3EQU A;  2HDR A;  5EOO A;  3PAG A;  3BFE A;  2J80 A;  2B95 A;  2Q9M A;  2G2U A;  1ZC2 A;  3E4O A;  1M6K A;  3IX8 A;  2P9V B;  4C3Q A;  3ZG7 B;  3DBA A;  5HZH A;  4HOI A;  2QJ7 A;  4OQH A;  4ETX A;  4IUH A;  4LV0 A;  1S66 L;  3SW1 A;  2WGI A;  4I38 A;  3BLM A;  4HBT A;  4HIA A;  1O7E A;  1TEM A;  5HD5 A;  3E98 A;  4X53 A;  5E43 A;  4IHQ A;  1XFN A;  4GDB A;  1CEF A;  4S2P A;  3E0Y A;  3QP5 A;  5A90 A;  4X25 A;  2EA9 A;  4MLL A;  5GLC A;  1GSW A;  1LSX A;  5F1G A;  3PBT A;  4QY5 A;  2VGK A;  2FH5 A;  3OCN A;  4PAU A;  5E2H A;  1PFL A;  5BOH A;  3VOL A;  4D60 A;  4S2M A;  2ZC7 A;  2C5W B;  1W8Y A;  2V8C A;  3Q82 A;  4FUW A;  4QB8 A;  1KVL A;  4LCL A;  1ESU A;  4R4S A;  3HUN A;  4UEY A;  3NIA A;  5KIZ A;  4KUK A;  4OQG A;  3DW0 A;  3UE3 A;  5FAO A;  3GVB A;  5AQA A;  4WLA A;  4WMC A;  2JKG A;  5EV0 A;  3IBJ A;  3NCK A;  2WKR A;  1ONG A;  3EQV A;  2Y59 A;  2R9W A;  4R70 A;  1SDE A;  4LFU A;  4IVI A;  3MSH A;  2V1Z A;  4EBL A;  4Y0T A;  5HSQ A;  2VGL M;  5HFO A;  3HL9 A;  3S1Y A;  2FFY A;  2ZM2 A;  1NZO A;  4GNU A;  3SS5 A;  2ZC6 B;  2XD5 A;  1T1B A;  4NXE A;  4E3N A;  3KSG A;  3PTE A;  4DE2 A;  2PBD P;  3M2J A;  1H8M A;  4JLF A;  1K4F A;  2RCX A;  2JE5 A;  2LB9 A;  3OCL A;  4FOF A;  4QD4 A;  4UQI S;  4ZAM A;  1DJC A;  2V0U A;  1MWU A;  4N1X A;  2JKR M;  3QNB A;  1YT4 A;  3LR0 A;  3G35 A;  3CUE A;  1PZO A;  1GA9 A;  5TJJ A;  5EEC A;  1NY0 A;  3WS1 A;  2JBF A;  4X68 A;  5J3W A;  1D7E A;  4L9E A;  2W1R A;  5CGS A;  1HLU P;  3GV9 A;  4JF4 A;  1XA1 A;  4HQA A;  2VEA A;  4FSF A;  3MFD A;  4KZA A;  3FYZ A;  4P6B A;  5FSR A;  4ME4 A;  3LEZ A;  3C7U A;  1GSV A;  2OSU A;  2Y2Q A;  1L0F A;  1P9W A;  3GEC A;  3FV7 A;  4OKP A;  4CJN A;  3UY6 A;  3CPT A;  3KYE A;  5A8B A;  2QMI A;  3UPO A;  4XUX A;  5C5K A;  3UB6 A;  3QHY A;  1EI5 A;  5JYO A;  2VKS A;  1NLZ A;  3EOI A;  2OWJ A;  1L0D A;  2HV1 A;  3PBN A;  5AQ7 A;  4RX3 A;  2BLS A;  3B3X A;  3ZFZ A;  2VGJ A;  1WYB A;  4OQI A;  4Y5F A;  5CGX A;  3C4O A;  3MXS A;  4GD8 A;  2K2N A;  5EVE A;  1YPR A;  2QKP A;  4OH0 A;  1EW0 A;  5DVA A;  3UDI A;  1XP4 A;  4BBU A;  1YMX A;  4HP4 A;  3DAV A;  4LRX C;  2GDN A;  2EFU A;  1N9L A;  5HPF A;  1NWZ A;  4OVD A;  2VX8 A;  2INW A;  3VMA A;  1FCM A;  4GJ4 A;  3JVU A;  3U2A A;  1K55 C;  4I3A A;  3UMD A;  2QYB A;  1I5Q A;  4S2N A;  3C7V A;  3IWO A;  3T4Q A;  5CEB A;  2ZC4 B;  1KOU A;  3GQZ A;  4YOF A;  4KG6 A;  3H82 A;  2WKI A;  1NRF A;  4UA7 A;  3ZCZ A;  1LLB A;  3LR5 A;  3V5M A;  2K31 A;  4O0P A;  1TF1 A;  5F83 A;  4FTX A;  3H7W A;  1KGF A;  3T50 A;  2ZMF A;  3S7Q A;  3I7J A;  3RJU A;  5CHJ A;  4LGW A;  3IQA A;  4JKT A;  1MKI A;  4H8R A;  3DTI A;  3A0R A;  2IWB A;  4U3T A;  5FEG A;  1MPL A;  1W63 Q;  4O7D A;  1ESI A;  4KQD A;  3ZNT A;  3BQ8 A;  3N8L A;  2JN7 A;  3T4T A;  1DP6 A;  4JXG A;  5EVI D;  4I3J A;  3HJK A;  3UB7 A;  3BFF A;  5K5B A;  4FCF A;  5TGF A;  4XT2 A;  2V2F F;  3TSG A;  3BEC A;  3RH8 B;  2XFT A;  1BTL A;  2HPB A;  3A3E A;  3T4J A;  4KZ8 A;  5G4Z A;  1XJ2 A;  5DKL A;  4M4X A;  2HDU A;  2H10 A;  3ZG5 A;  3IHB A;  2XGN A;  2ZC3 B;  1HZO A;  3T4S A;  1DJA A;  3F1P B;  4R23 A;  2ZL1 A;  4NK3 A;  1K54 C;  3UPP A;  4QPR A;  1IKG A;  3BY9 A;  3LIB A;  3PYP A;  1LL5 A;  3SOI A;  3VV4 A;  4OPQ A;  3OPH A;  4JPM A;  2H28 A;  4N1H A;  1MC0 A;  3IWQ A;  5L07 A;  4XT2 B;  2HP9 A;  4HEF A;  3N8R A;  1LT0 A;  4Z1W A;  1W79 A;  2H5S A;  3AGD A;  2Y2O A;  3HLW A;  5AVF A;  3P01 A;  4S2N C;  2KLI A;  3UB9 A;  3LYX A;  1S6R A;  2Y91 A;  4E3M A;  1PI4 A;  3A0V A;  5GHY A;  1W5D A;  4E3K A;  1YMS A;  4MNR A;  2VA0 A;  4Y17 A;  3UN7 A;  3G32 A;  2X02 A;  5HWV A;  5GLD A;  2WUQ A;  4MN6 A;  4II7 A;  5EPH A;  5DF8 A;  5EVI C;  4OOM A;  2G2W A;  4N9K A;  4EUZ A;  3E2L A;  1RGY A;  4GHI B;  2PU4 A;  1K56 D;  5HAQ A;  1C3B A;  2O9B A;  4WYY A;  3KSI A;  1G6A A;  1E4D A;  1ZKJ A;  4Q0J A;  3ZG0 A;  2GNX A;  3CG5 A;  4DE3 A;  1T18 A;  4B9O A;  5DF7 A;  1VM1 A;  1TDG A;  5L2F A;  3JVV A;  5A92 A;  4UQI M;  2WGW A;  3KX0 X;  4WUJ A;  2L0W A;  4N9L A;  4ZJ3 A;  3BWL A;  1SZV A;  4KQQ A;  2E8J A;  3WRT A;  2P7J A;  5HL6 A;  3BRM A;  5U47 A;  3K3C A;  3EEH A;  3IBR A;  5FQ9 A;  3HLG A;  4L9G A;  4B4Z A;  1S4S A;  2HF6 A;  3B47 A;  1PW8 A;  4R3J A;  2X71 A;  4BMW A;  2KDK A;  5FI2 A;  3UB5 P;  4JBF A;  3WS0 A;  1S1Z A;  4EWF A;  1IYP A;  4IVK A;  3IX3 A;  4WEK A;  2ZD8 A;  3LIE A;  1LSW A;  1TS7 A;  4UA6 A;  3N6I A;  4RVA A;  1MKM A;  3M6H A;  4OLG A;  4S2O A;  3VP0 A;  2O9C A;  1ACF A;  5GLA A;  2XDM A;  4OP5 A;  3BFD A;  1UWN X;  3GMW A;  4PM9 A;  2Z2L B;  5CHU A;  4ZJ2 A;  3W4P A;  4Y15 A;  2Y2K A;  5F82 A;  3RFB A;  1JWP A;  2PAV P;  2VK3 A;  3RTY A;  3ZNY A;  1KDW A;  3EWK A;  2UV0 E;  1NYY A;  3WS4 A;  2WAF A;  2L4R A;  1YM1 A;  4RA7 A;  1K57 C;  1VET B;  1XGJ A;  3O5Y A;  3UB8 A;  1IYO A;  5M1A A;  4Y2F A;  1PRQ A;  4KQR A;  1GSX A;  1S67 L;  2W3D A;  1FR6 A;  5DFX A;  4HP9 A;  5HWT A;  3SH9 A;  3TE8 A;  1DP9 A;  3MZD A;  5HX9 A;  3CAX A;  2ZQD A;  3CIT A;  3C2W A;  3DWK A;  4JXV A;  4MMN A;  3O88 A;  5I5L A;  1W7F A;  2B18 A;  3ULF A;  1H8Z A;  4IED A;  4JXW A;  4WEL A;  2HP6 A;  3BFG A;  5FI7 A;  3HJI A;  1YLY A;  3OLO A;  2Y8H A;  4GD6 A;  4DF6 A;  4P6Z S;  1BLH A;  3A0S A;  1BLC A;  4S2K A;  2A24 A;  2QHK A;  3ZDJ A;  1KDS A;  3N8S A;  3VP2 A;  3G6O A;  2PD7 A;  2CMN A;  2WZX A;  1RP5 A;  4OOL A;  5JYP A;  5DTK A;  1L2S A;  4WZ5 C;  2DMW A;  3VE3 A;  2B02 A;  3OZH A;  4E3I A;  3D9Y A;  4HI4 A;  3L7H A;  1JVJ A;  4EEU A;  1K4E A;  2GJ3 A;  1VQQ A;  3WS5 A;  3AGF A;  2ZJ9 A;  2Q0O A;  3W4Q A;  1PWD A;  2KOI A;  4R3B A;  1H5X A;  2PRF A;  3TG9 A;  2OV5 A;  5L8M A;  1BYW A;  1ZG4 A;  3E4P A;  2EXB A;  3BM6 A;  3MFX A;  3NOU C;  2P04 A;  4GW9 A;  3ITA A;  4WMC D;  2EX6 A;  3FG8 A;  3LGO A;  2B5R A;  1OPX A;  4R3A A;  2WAE A;  4YIN A;  3ZG8 B;  5DTT A;  4HH3 A;  2LB5 A;  4OQ0 A;  1GHM A;  2VV7 A;  5HWW A;  4X69 A;  4Y0U A;  2EX2 A;  2V1A A;  4X1L A;  3RXX A;  3S4X A;  4MBK A;  1TDL A;  2J3T C;  1D1J A;  1IEL A;  3IXD A;  3ZVW A;  4GOG A;  5F6A A;  1O07 A;  2DNS A;  2WYX A;  5A93 A;  1F5M A;  3W4O A;  4KZ9 A;  3JPU A;  3PBS A;  1XFQ A;  4OPY A;  2HZ5 A;  4GKU A;  1FCN A;  1K0K A;  3B33 A;  2JKT M;  4HJ6 A;  2RL3 A;  4AFI A;  1YKD A;  4B4X A;  2EWW A;  2PR5 A;  1E3U A;  4EUV A;  2R78 A;  2GZA A;  1Z6F A;  1IOU A;  3IX4 A;  2IA2 A;  1TS8 A;  4IBR A;  4UA9 A;  3MJQ A;  5IU1 A;  4BD0 A;  4LRZ E;  3QNC A;  4GB7 A;  3BY8 A;  3UME A;  4CLC A;  3Q7V A;  1UGU A;  1S0W A;  2PD8 A;  2O9A A;  3FPV A;  3G34 A;  4K08 A;  4ZBE A;  1PZP A;  2PDR A;  4B93 A;  1SCW A;  3QP6 A;  1STZ A;  1FIL A;  4IBX A;  3T1Q B;  3V3S A;  2XRO A;  4CQH A;  4GN2 A;  4G3K A;  3HCY A;  4YNR A;  1G28 A;  1PIO A;  2Y2I A;  2Q9N A;  4NKP A;  4WZ4 A;  4DN0 A;  2Y55 A;  1GHP A;  4DE1 A;  3VOZ A;  3FWL A;  3UE6 A;  5FEF A;  4OPR A;  4PMA A;  3UE0 A;  3NHQ A;  2ZQ7 A;  3MR0 A;  2Y2P A;  3MMH A;  4BBV A;  4L0L A;  4G3V A;  4R38 A;  1OT9 A;  2JKR I;  4S2I A;  1VB6 A;  3N7W A;  1YLT A;  5A91 A;  1ALQ A;  3CPT B;  2JKF A;  4E3J A;  1MXO A;  3CLO A;  5E2F A;  4HY8 A;  1AXB A;  5CRF A;  4NEE D;  3OPR A;  2ZM8 A;  3IS2 A;  3O87 A;  4JXS A;  3F1N A;  4IJG A;  1PWC A;  4HJ3 A;  4L9F A;  3TOI A;  3HLE A;  3NUL A;  2OLV A;  1PW1 A;  2W27 A;  3CMZ A;  1BLS A;  3VSL A;  2XA7 S;  4NXG A;  5EUA A;  3NY4 A;  4R1G A;  3BYD A;  1SKO A;  4DDS A;  3A3D A;  1HVB A;  4XUZ A;  3T4O A;  4KZ6 A;  3O3V A;  3RXW A;  1YLP A;  3C5A A;  2ZBB A;  2WKH A;  3W2Z A;  3CUE C;  3MXR A;  5AJG A;  5L10 A;  1PWG A;  3MQQ A;  3T4K A;  4HNB A;  4PHT A;  4MCW A;  3PHY A;  4EES A;  1P9R A;  1ES2 A;  1BLP A;  4X55 A;  1CK3 A;  5AQB A;  1KE0 A;  3IF6 A;  2M7U A;  4HES A;  4UHU A;  3CI6 A;  4LV3 A;  3C4P A;  2FZ0 A;  3G31 A;  2AVX A;  3F1N B;  3V3R A;  3FPW A;  5GHX A;  2CC1 A;  2Y2L A;  4H6J A;  4E3L A;  3M6B A;  1HD8 A;  4F3L A;  1OTA A;  1FIK A;  3T12 B;  3LCE A;  3GR2 A;  4LCM A;  1D06 A;  3NJA A;  4JGP A;  3H82 B;  5FQK A;  1YSQ A;  3TW8 A;  1G6O A;  4NXF A;  1K25 A;  5IT5 A;  1FR1 A;  5HPI A;  3NOT C;  4HBU A;  2WK0 A;  3H7W B;  3IF5 A;  1QMF A;  3P98 A;  3MBZ A;  4KUO A;  5DJU A;  4LV1 A;  2K7S A;  4KZB A;  4QJG A;  1ZHH B;  1VHM A;  4MBH A;  4ZJ1 A;  4R4R A;  3R7W A;  5FDH A;  3T4L A;  4QWO A;  5GL9 A;  1ERM A;  4EV4 A;  3LIA A;  1FSY A;  4Q8I A;  2W3H A;  2J9P A;  1K6R A;  1M40 A;  2XF3 A;  3DTE A;  2J9O A;  2QZ6 A;  3MXQ A;  3NI9 A;  4KG2 A;  1Z09 A;  4P6Z M;  4GZB A;  4RQ9 A;  5CTN A;  4BL3 A;  2W3G A;  1X0O A;  3ICY A;  3OC2 A;  2Y2H A;  2HJ9 C;  4QY6 A;  3S7O A;  5F1F A;  3A3F A;  3S7P A;  1U60 A;  1K56 A;  4EEP A;  3PAE A;  2DRW A;  4ID4 A;  1SKF A;  4PM7 A;  3R7W B;  4PM6 A;  2ZL1 B;  3Q81 A;  5CER A;  4D2O A;  1ES4 A;  3QP8 A;  5DTS A;  5CGW A;  2W3E A;  4MEZ A;  1PI5 A;  2J3W A;  4OP8 A;  3DTM A;  4X1M A;  4GS9 A;  2YKH A;  2MJ6 A;  4ZTK A;  5D3O A;  1IYQ A;  3KYZ A;  1PNE A;  1WYC A;  5CTM A;  5M18 A;  2H0T A;  1CJF A;  3QP4 A;  1BUL A;  1N9O A;  2FFF B;  4MDZ A;  2Z6C A;  1NJ4 A;  3W8K A;  3Q7Z A;  3UDF A;  4PPR A;  4A5R A;  3T1S A;  1XJ6 A;  3PXP A;  4EBN A;  1MWR A;  4HH2 A;  3BEB A;  4BL2 A;  4C6Y A;  4PM5 A;  3G4P A;  1OTI A;  5MC7 A;  3HLB A;  2I72 A;  5TBM A;  1ERO A;  2NUT C;  3SH7 A;  3T1R A;  4I39 A;  2PU2 A;  5FL3 A;  4QHC A;  1W63 M;  4GCZ A;  1QME A;  4EQI A;  2ZQ8 A;  5CHM A;  1MZU A;  3DTK A;  3R4K A;  3LIF A;  3B42 A;  3M2K A;  4X6T A;  1JTG A;  4DJ2 A;  4Y0O A;  4WL9 A;  3KO6 A;  3WRZ A;  3WS2 A;  3ISG A;  2VZW A;  1DJB A;  1ES3 A;  1HTZ A;  3IH8 A;  5EM1 A;  2WZZ A;  4M3K A;  4ARZ A;  1Q2Q A;  3MKF A;  1VEU A;  1Y4O A;  2P08 A;  1V9Y A;  2ZQC A;  2HP5 A;  2ZOH A;  3SH8 A;  4OOY A;  2PBY A;  3GRJ A;  2WGW B;  1BUE A;  1ERQ A;  1V9Z A;  4LRY C;  5M19 A;  2O0Y A;  1OTE A;  5LBR A;  2OAP 1;  3FKV A;  3LR3 A;  1OTD A;  1ES5 A;  3EEA A;  4RX2 A;  4E3O A;  2BG1 A;  1J3W A;  4OPZ A;  1OT6 A;  3IT9 A;  4Z9Q A;  1P0Z A;  3G2Z A;  3HBR A;  4LEN A;  1LL8 A;  5HDD A;  2A2L A;  1N9N A;  2ZOI A;  1LHY A;  3PBO A;  4DE0 A;  4EQ1 A;  1IKI A;  5F69 A;  4NG2 A;  1J9M A;  2JHE A;  1YSP A;  4FH2 A;  3LEQ A;  3OPP A;  1LI9 A;  4ZDX A;  2A3U A;  2OWH A;  1MBL A;  5KZH A;  3ZVT A;  3EGX C;  5CEC A;  1ODV A;  4IUK A;  3VE4 A;  1TS6 A;  5E2E A;  3MKE A;  4E6W A;  1CI8 A;  2J3T D;  4WM9 A;  5J7E A;  1XGI A;  5HW3 A;  3C8C A;  2O99 A;  1EWZ A;  2HDQ A;  2PT7 A;  3A3J A;  3BFC A;  1YQS A;  2XA7 M;  3C30 A;  5I94 A;  1A0K A;  3LUQ A;  1Q2P A;  2NUP C;  5AVE A;  1NLY A;  3V67 A;  3IHA A;  3ZGA B;  2XQZ A;  2YKF A;  2QWS A;  3L9K A;  4U0X A;  2ZQA A;  3OPL A;  5HD3 A;  3U4L P;  2C6W B;  5CX7 A;  2D01 A;  3P09 A;  2V0W A;  1F2K A;  1NZU A;  2XR0 A;  4DMZ A;  1MWS A;  1XKZ A;  3VSK A;  3V39 A;  3T1X A;  4EXO A;  3NDE A;  5DF9 A;  2XH9 A;  1DY6 A;  5FQM A;  2WGV A;  5KSC A;  4PM8 A;  3Q07 A;  1MY8 A;  2ZC5 B;  4BEN A;  3VP3 A;  5J4E A;  3FC7 A;  5EOE A;  3Q1F A;  5HAP A;  3HLF A;  2R9X A;  2ZQ9 A;  1GA0 A;  1K55 A;  1RGZ A;  1ZTU A;  4P85 A;  1T1C A;  3KSF A;  3CWF A;  2A24 B;  3NC8 A;  3SS3 A;  1XPB A;  1FSW A;  4S2L A;  2M7V A;  3MQO A;  1OJG A;  3K3D A;  1LI0 A;  3HVF A;  4I3I A;  2A49 A;  4LV2 A;  5F68 A;  1RCJ A;  5IS1 A;  1DRM A;  1LSV A;  2XD1 A;  1GHI A;  4B88 A;  1W8Q A;  2Z6D A;  2WKQ A;  4CPK A;  4YWZ A;  4K0X A;  2PYR A;  1KGE A;  2Y4A A;  1BZA A;  3ZHH A;  4KQO A;  4NXB A;  4WBG A;  4O01 A;  3VP1 A;  3D72 A;  3TJZ C;  1IEM A;  4K91 A;  1L3L A;  4S2J A;  2XRN A;  3G30 A;  3OOV A;  3MF0 A;  1TD5 A;  3LIC A;  3HUO A;  3IXB A;  2EWV A;  5DKK A;  4JGR A;  4GLQ A;  3BQA A;  2E8I A;  5HAR A;  1CQA A;  2PR6 A;  3UPN A;  1FQG A;  1L0G A;  3HLD A;  1CI9 A;  4XXR A;  3CZD A;  1E3U D;  5CED A;  5FQJ A;  2EXA A;  4E6X A;  2UWX A;  3LID A;  1G5U A;  1OME A;  4RYE A;  4F94 A;  5TR7 A;  3PBR A;  4R0Q A;  4E04 A;  2J7V A;  4CLC D;  3E4Q A;  5EVL A;  4O8G A;  3GDI A;  3C38 A;  1YLW A;  3H9W A;  2D02 A;  1ZG6 A;  5HDS A;  3EGD C;  3BLS A;  2JC7 A;  1K54 A;  5GHZ A;  4CLC B;  3LI9 A;  3Q7V B;  5J8X A;  4KG5 A;  3QP1 A;  4Y13 A;  2HGV A;  4EW7 A;  2IWC A;  4UAA A;  2VV6 A;  4U0T A;  2JKT I;  5TFQ A;  2DCF A;  3ITB A;  2XSS A;  3A3I A;  1DP8 A;  3ZYT A;  2M1C A;  1Y54 A;  5FQQ A;  2JCH A;  2W1T A;  1IYS A;  5FI6 A;  4BWI A;  3PR6 A;  4MN5 A;  1NXY A;  2W0N A;  4BJP A;  5FAT A;  1JWZ A;  2XEP A;  2H0Y A;  2X01 A;  1CEG A;  2QPN A;  4BBT A;  2V1B A;  4OLD A;  1K38 A;  3ZG9 B;  3MZF A;  3AGE A;  2Y79 A;  4FH4 A;  2Y2J A;  3LFV A;  1KVM A;  2Y2M A;  3CJM A;  5EVI A;  4PKY G;  3O86 A;  4ZRR A;  1N4O A;  4EER A;  2OLU A;  5EFW A;  1FCO A;  3IS2 B;  4JF5 A;  3HRE A;  5FQI A;  1ONH A;  1LL9 A;  3DWZ A;  4JGO A;  5CXW A;  4KZ7 A;  1TS0 A;  2BTF P;  3F1P A;  4DKI A;  2OAQ 1;  2W1T B;  3SZT A;  1F9I A;  3UO9 A;  3MS6 A;  3D4F A;  1YLZ A;  3N4I A;  2EX8 A;  2V8F A;  2VGL S;  4CLC C;  1UWP X;  1XJ3 A;  4X56 A;  1SKO B;  4KZ5 A;  1KGG A;  3GTC A;  4FD8 A;  1N9B A;  1I2S A;  5FAS A;  1XA7 A;  4DDY A;  1T1A A;  5GLB A;  5FAP A;  2PYP A;  1SHV A;  5FDS A;  5DFY A;  5EVI B;  1WE4 A;  1BT5 A;  1H0M A;  5DJT A;  5IHV A;  3UE1 A;  4LPZ A;  2XFS A;  4PKY A;  3F1O A;  3IF6 B;  1NRJ A;  3UNW A;  3P7N A;  3HLC A;  1E25 A;  3K2N A;  3S22 A;  2J8Y A;  4DJ3 A;  2VJW A;  1AWI A;  4BD1 A;  2EFX A;  4H6J B;  2KX6 A;  4C75 A;  1H8Y A;  4I5S A;  4F3L B;  2BAS A;  2P74 A;  2V20 A;  5E2G A;  1K6S A;  2HDS A;  3NBL A;  4N92 A;  1OJ5 A;  3NEC A;  3IXG A;  4DXB A;  2Y2N A;  4GHI A;  4MBF A;  1KE3 A;  3S7N A;  3QP2 A;  4GDN A;  3OBF A;  3LI8 A;  3BJN A;  4G3W A;  3WWX A;  4JGQ A;  2ZMA A;  1BSG A;  1CF0 A;  3NDG A;  2EX9 A;  2Y2G A;  4JF6 A;  2WAD A;  1K57 A;  3F1O B;  1PYY A;  2L1M A;  3E2K A;  4KZ4 A;  1JWV A;  2VV8 A;  1F98 A;  4BLM A;  3JYI A;  3IXH A;  2V9A A;  5EM0 A;  3TRC A;  3LR4 A;  2ZLY A;  2HJE A;  3LO7 A;  4OON A;  3FKW A;  3MQ0 A;  5KSH A;  4KZ3 A; 
#chains in the Genus database with same CATH homology
 2IA2 A;  1P97 A;  2J3T D;  1JNU A;  5G4Y A;  1TS8 A;  3A0R A;  3MJQ A;  5IU1 A;  5J7E A;  2ZMV A;  4LRZ E;  3C8C A;  3BY8 A;  1W63 Q;  3UME A;  4CLC A;  2O99 A;  4KQD A;  1UGU A;  1S4R A;  2PD8 A;  2PT7 A;  4WN5 A;  2O9A A;  3FPV A;  4K08 A;  3BQ8 A;  2PDR A;  2XA7 M;  3C30 A;  4B93 A;  3LUQ A;  2JN7 A;  1IFQ A;  4Q0H A;  3T4T A;  1DP6 A;  2NUP C;  1STZ A;  4I3J A;  3HJK A;  1NLY A;  5AVE A;  3UB7 A;  3V67 A;  5K5B A;  4XT2 A;  2XRO A;  4Q0I A;  2YKF A;  3RH8 B;  1WA9 A;  2QWS A;  5HD3 A;  4CQH A;  4G3K A;  5CX7 A;  2D01 A;  3HCY A;  2V0W A;  5F5Y A;  4GS9 B;  4DMZ A;  4YNR A;  1G28 A;  3T4J A;  3KYQ A;  1XJ4 A;  4NKP A;  5G4Z A;  4EXO A;  4DN0 A;  1XJ2 A;  4HHD A;  5DKL A;  4M4X A;  1OTB A;  2WKP A;  3UE6 A;  5DF9 A;  3NHQ A;  4R6L A;  3MR0 A;  2G7U A;  3PBQ A;  3T4S A;  4ETZ A;  3F1P B;  4EET B;  1YAX A;  3MMH A;  4BBV A;  4L0L A;  3D3O A;  4MN7 A;  4G3V A;  4R38 A;  1OT9 A;  2JKR I;  4HJ4 A;  5J4E A;  1H3Q A;  1T19 A;  4QPR A;  1VB6 A;  4LLO B;  3FC7 A;  1Y28 A;  3ZQ5 A;  3BY9 A;  3LIB A;  2I9V A;  3PYP A;  4CLC E;  3CLO A;  3VV4 A;  5TBM B;  1ZTU A;  2PHY A;  3KSH A;  3BW6 A;  4HY8 A;  1T1C A;  1S1Y A;  3KSF A;  2H28 A;  3NOP C;  4NEE D;  3IS2 A;  3CWF A;  3F1N A;  4IJG A;  1MC0 A;  2A24 B;  5HDC A;  4XT2 B;  4HJ3 A;  2M7V A;  4L9F A;  2GX5 A;  3MQO A;  4Z1W A;  1LT0 A;  1OJG A;  3K3D A;  2W27 A;  2VLG A;  2OOL A;  4I3I A;  2XA7 S;  5F68 A;  4NXG A;  4EU0 A;  5IS1 A;  1DRM A;  2W3F A;  4WF0 A;  2QJ5 A;  4WEJ A;  5AVF A;  3P01 A;  2KLI A;  3UB9 A;  1LSV A;  4ARZ B;  3T4O A;  3LYX A;  4Y3I A;  3A0V A;  2Z6D A;  3EQU A;  2WKQ A;  2VA0 A;  2ZBB A;  2J80 A;  4YWZ A;  2PYR A;  3W2Z A;  5HWV A;  3E4O A;  3CUE C;  4MN6 A;  5AJG A;  3MQQ A;  4II7 A;  3T4K A;  4HNB A;  4PHT A;  4MCW A;  3PHY A;  4OOM A;  4EES A;  3DBA A;  5HZH A;  4HOI A;  1P9R A;  2QJ7 A;  4ETX A;  4IUH A;  4KQO A;  4NXB A;  1S66 L;  4GHI B;  4O01 A;  2M7U A;  3SW1 A;  4I38 A;  3CI6 A;  3D72 A;  4HIA A;  3TJZ C;  2FZ0 A;  3F1N B;  5HD5 A;  2O9B A;  3E98 A;  3FPW A;  4IHQ A;  2XRN A;  1XFN A;  3OOV A;  4H6J A;  3KSI A;  3MF0 A;  1TD5 A;  3E0Y A;  3LIC A;  4Q0J A;  2GNX A;  4F3L A;  1OTA A;  2EA9 A;  1T18 A;  4B9O A;  2EWV A;  5DKK A;  1D06 A;  4JGR A;  3NJA A;  4JGP A;  3H82 B;  1GSW A;  1LSX A;  1YSQ A;  3PBT A;  3JVV A;  4GLQ A;  3TW8 A;  1G6O A;  4NXF A;  2FH5 A;  3OCN A;  3BQA A;  4PAU A;  5IT5 A;  4UQI M;  3KX0 X;  2PR6 A;  4WUJ A;  2L0W A;  5HPI A;  3VOL A;  3NOT C;  3BWL A;  3H7W B;  2P7J A;  3LID A;  4UEY A;  4KUO A;  5KIZ A;  4KUK A;  5DJU A;  3UE3 A;  2K7S A;  5HL6 A;  4WLA A;  1ZHH B;  3K3C A;  3PBR A;  1VHM A;  3EEH A;  3IBR A;  3IBJ A;  4E04 A;  4L9G A;  2WKR A;  3R7W A;  4CLC D;  3T4L A;  3EQV A;  3E4Q A;  1S4S A;  4O8G A;  3GDI A;  2HF6 A;  3B47 A;  3C38 A;  3H9W A;  2D02 A;  5HDS A;  3EGD C;  3LIA A;  4CLC B;  3LI9 A;  2W3H A;  4R70 A;  4BMW A;  2KDK A;  1S1Z A;  4WEK A;  2HGV A;  3LIE A;  5HSQ A;  2VGL M;  1LSW A;  1TS7 A;  4EW7 A;  2VV6 A;  1MKM A;  2JKT I;  3MXQ A;  2O9C A;  4P6Z M;  2XSS A;  4RQ9 A;  1DP8 A;  3ZYT A;  2M1C A;  1T1B A;  1UWN X;  4NXE A;  2W1T A;  2W3G A;  1X0O A;  4BWI A;  3ICY A;  3RFB A;  3KSG A;  3PR6 A;  3OC2 A;  4MN5 A;  3RTY A;  2W0N A;  2HJ9 C;  3S7O A;  4BJP A;  1H8M A;  3EWK A;  3S7P A;  2LB9 A;  3OCL A;  4BBT A;  4EEP A;  4FOF A;  4UQI S;  2V1B A;  2L4R A;  2V0U A;  3R7W B;  3O5Y A;  3UB8 A;  2JKR M;  3LR0 A;  3CUE A;  2Y79 A;  4Y2F A;  5TJJ A;  3LFV A;  2W3E A;  2J3W A;  4PKY G;  5J3W A;  4GS9 A;  4ZRR A;  1D7E A;  2YKH A;  4L9E A;  2MJ6 A;  1GSX A;  1S67 L;  2W3D A;  2W1R A;  3KYZ A;  5DFX A;  4HP9 A;  4EER A;  5EFW A;  5HWT A;  3TE8 A;  1DP9 A;  3IS2 B;  3CAX A;  4HQA A;  3CIT A;  4JGO A;  2VEA A;  4FSF A;  3C2W A;  1N9O A;  1TS0 A;  4MMN A;  4ME4 A;  3F1P A;  4MDZ A;  2OAQ 1;  2Z6C A;  1GSV A;  2W1T B;  5I5L A;  1F9I A;  2B18 A;  3ULF A;  1P9W A;  2VGL S;  3GEC A;  1XJ6 A;  3PXP A;  4WEL A;  4CLC C;  1UWP X;  1XJ3 A;  4HH2 A;  3HJI A;  1OTI A;  3OLO A;  5MC7 A;  5A8B A;  2Y8H A;  4P6Z S;  5TBM A;  5C5K A;  3UB6 A;  2NUT C;  3A0S A;  4I39 A;  1T1A A;  2VKS A;  5FL3 A;  1NLZ A;  3EOI A;  1W63 M;  2A24 A;  2OWJ A;  4GCZ A;  2PYP A;  2QHK A;  2HV1 A;  3PBN A;  1MZU A;  3G6O A;  2PD7 A;  2CMN A;  5DFY A;  3R4K A;  3LIF A;  3B42 A;  4OOL A;  5DJT A;  4LPZ A;  4Y5F A;  4PKY A;  3F1O A;  2DMW A;  4DJ2 A;  1NRJ A;  3KO6 A;  4WL9 A;  3VE3 A;  3P7N A;  2B02 A;  2VZW A;  3K2N A;  2K2N A;  4DJ3 A;  2VJW A;  4ARZ A;  4HI4 A;  2QKP A;  1EW0 A;  4H6J B;  4BBU A;  4EEU A;  4HP4 A;  2KX6 A;  2GJ3 A;  4I5S A;  4F3L B;  4LRX C;  2P08 A;  2BAS A;  2KOI A;  1OJ5 A;  1V9Y A;  1N9L A;  5HPF A;  2ZOH A;  1NWZ A;  2VX8 A;  2INW A;  4GJ4 A;  5L8M A;  3JVU A;  1BYW A;  1V9Z A;  4LRY C;  3E4P A;  3U2A A;  2O0Y A;  1OTE A;  5LBR A;  4GHI A;  3S7N A;  3MFX A;  2OAP 1;  3LR3 A;  3NOU C;  2P04 A;  4GW9 A;  1OTD A;  4I3A A;  3FG8 A;  3UMD A;  3EEA A;  3OBF A;  1OPX A;  2QYB A;  3LI8 A;  4R3A A;  3BJN A;  4G3W A;  1OT6 A;  4HH3 A;  4JGQ A;  3T4Q A;  1P0Z A;  2LB5 A;  1LL8 A;  5HDD A;  2A2L A;  2VV7 A;  1KOU A;  1N9N A;  5HWW A;  2ZOI A;  4YOF A;  3PBO A;  3H82 A;  3F1O B;  2V1A A;  4EQ1 A;  5F69 A;  2L1M A;  2J3T C;  2VV8 A;  3LR5 A;  2JHE A;  1F98 A;  2K31 A;  5F6A A;  4O0P A;  1YSP A;  1F5M A;  1TF1 A;  2V9A A;  3PBS A;  1XFQ A;  3LR4 A;  3TRC A;  3H7W A;  2OWH A;  3T50 A;  2ZMF A;  3S7Q A;  3B33 A;  2HJE A;  2JKT M;  4HJ6 A;  4AFI A;  3EGX C;  1ODV A;  1YKD A;  4IUK A;  2EWW A;  2PR5 A;  4EUV A;  3VE4 A;  2R78 A;  1TS6 A;  2GZA A;  3MQ0 A;  1IOU A;  5KSH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...