5J4EA

Crystal structures reveal signaling states of a short blue light photoreceptor protein ppsb1-lov (photoexcited state)
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
133
structure length
133
Chain Sequence
b'MINAQLLQSMVDASNDGIVVAEKEGDDTILIYVNAAFEYLTGYSRDEILYQDCRFLQGDDRDQLGRARIRKAMAEGRPCREVLRNYRKDGSAFWNELSITPVKSDFDQRTYFIGIQKDVSRQVELERELAELR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sensory box protein
publication title Signaling States of a Short Blue-Light Photoreceptor Protein PpSB1-LOV Revealed from Crystal Structures and Solution NMR Spectroscopy.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Signaling protein
total genus 35
structure length 133
sequence length 133
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 5j4eA00
3OLOA 5TBMA 3EWKA 1JNUA 4B9OA 3E4PA 4HI4A 3P7NA 2QHKA 1OTDA 3F1NB 5HD3A 3SW1A 1TS8A 4GS9A 4GCZA 1F9IA 4H6JB 3LICA 4GHIB 1LL8A 1OTBA 1T18A 4BBUA 4HJ4A 4HP9A 4GW9A 5AVEA 5I5LA 5HDCA 2PD7A 2YKFA 4KUOA 4EEPA 2JHEA 3IBRA 3D72A 4I3AA 5KIZA 3E4QA 4HNBA 4EESA 4EETB 4L9GA 3UE6A 5A8BA 5J4EA 5DKLA 3K3DA 1P97A 3HJKA 3ICYA 4EXOA 3PYPA 1GSVA 1TS6A 1WA9A 2GJ3A 3MFXA 4HH2A 4XT2B 3GDIA 4LRXC 4I38A 3G6OA 2VLGA 4XT2A 1NWZA 4HJ3A 4NXBA 1N9LA 2OWJA 3NHQA 4EERA 2D02A 1TS0A 2V0WA 3H82A 1XJ2A 3A0SA 4EQ1A 1V9ZA 5HD5A 5IU1A 1X0OA 1EW0A 3RTYA 1OTEA 4WLAA 2V1AA 4WN5A 3CWFA 3LYXA 2QWSA 5HWVA 5HZHA 3H7WA 2OWHA 4WL9A 3BY9A 2QJ5A 4HIAA 4I5SA 4GS9B 5HSQA 3PHYA 4DJ3A 2H28A 4LPZA 2JN7A 2V9AA 3UMEA 3C8CA 2OOLA 3UB8A 3LIFA 4NXGA 5DJTA 5G4YA 4YWZA 4HH3A 1UWPX 5HWWA 2VV6A 4L9FA 2QJ7A 5IS1A 3LIEA 4R6LA 4I39A 4R70A 3UMDA 1XJ3A 3UB9A 4HOIA 5DKKA 2L0WA 5EFWA 1UGUA 5F5YA 3T50A 2L4RA 1XJ4A 4R3AA 1OT6A 1T1AA 2VEAA 5G4ZA 3MQQA 2EA9A 4WUJA 2PHYA 4K08A 2KDKA 4HQAA 1DP8A 3ULFA 2K7SA 1T19A 2B02A 2YKHA 1D06A 2WKQA 1LSWA 3LIDA 3IS2A 3E4OA 4R38A 5F69A 1S1YA 4HP4A 3F1PB 4NXFA 3F1PA 3H9WA 3A0RA 1S66L 3H82B 3CAXA 2VV7A 2V1BA 4F3LB 2VV8A 3MJQA 3F1OA 5HWTA 4F3LA 2PR6A 1N9NA 1S4RA 3MXQA 1D7EA 3NOPC 1LSXA 1TS7A 3FC7A 1F98A 4DJ2A 1OJ5A 3LI8A 3H7WB 4I3IA 4RQ9A 2Z6CA 1GSWA 1DP6A 4BBTA 2PYRA 1S4SA 1P0ZA 4NXEA 4HY8A 1DP9A 2A24B 4WF0A 2A24A 4LLOB 3LIAA 2BASA 2I9VA 1OT9A 2PD8A 4HHDA 3BY8A 2ZBBA 5HDDA 3FG8A 4KQDA 3VE4A 3NOUC 1ODVA 3F1NA 1LT0A 2INWA 1XJ6A 2P7JA 1VB6A 1S1ZA 3MQOA 2R78A 4BBVA 4H6JA 4PKYG 3LI9A 3CLOA 4PKYA 4GHIA 3RH8B 3A0VA 3B33A 4JGOA 5F68A 2J80A 3HJIA 5AVFA 4EEUA 4KUKA 1LSVA 5J7EA 4JGQA 1S67L 3LUQA 2PDRA 1OTAA 2CMNA 1MZUA 2QKPA 4E04A 4HJ6A 1T1BA 3IS2B 2W0NA 3KX0X 2M1CA 3LIBA 2V0UA 3NJAA 1XFNA 4M4XA 2ZOIA 4LRZE 1V9YA 2PR5A 3GECA 1OTIA 3ZQ5A 1Y28A 2HV1A 2PYPA 5F6AA 2KX6A 1KOUA 5J3WA 4L9EA 5HDSA 2WKRA 2W27A 1BYWA 4JGRA 5DJUA 2D01A 3F1OB 3C2WA 1N9OA 1UWNX 3VE3A 3UB7A 4I3JA 1T1CA 4MN6A 3MR0A 1DRMA 2Z6DA 4LRYC 3EEHA 3NOTC 1XFQA 1G28A 4EW7A 3BWLA 3K3CA 1OJGA 2ZOHA 4MN5A 1GSXA 3UB6A 2WKPA 4JGPA 2L1MA 3VOLA 5TBMB
chains in the Genus database with same CATH superfamily
3T4TA 2RCXA 1L0EA 4U3TA 3OLOA 4KQOA 3EWKA 1ZTUA 4GN2A 3G2YA 3C7VA 3E4PA 2J9OA 3G31A 4HI4A 5E2HA 3MFDA 4KG6A 4S2PA 1O7EA 1K6SA 5HX9A 4ID4A 5HD3A 3PTEA 3SW1A 3OCLA 4JF4A 4GS9A 1KE4A 1F5MA 4D2OA 5TR7A 2HDSA 3IX4A 5KSHA 2W1TB 2Y4AA 1CEFA 1CQAA 2W1TA 4R4SA 4X55A 1BTLA 1I5QA 3HUOA 1FOFA 4Y5FA 5JYPA 1GHPA 3TW8A 1FCNA 2V8FA 4GW9A 4IVIA 5AVEA 4E3NA 4C75A 1BSGA 1EWZA 5CEDA 4BL3A 4ZAMA 1Y4OA 3EEAA 4IHQA 3VFHA 4N1HA 3V3RA 3N6IA 3D72A 5KIZA 4Y0OA 2OLUA 3GMWA 2XQZA 1G6AA 4LCLA 5A8BA 4CLCE 3ICYA 1WA9A 4Y0TA 3PAEA 2J8YA 3TG9A 2Y2HA 1BLSA 3GDIA 4LRXC 4I38A 4RX3A 3ZNTA 3V67A 1N9LA 4XUXA 1U60A 2V20A 4DMZA 2W3FA 1NXYA 2HP9A 2V0WA 2HP6A 3A0SA 3ZGAB 4KZ9A 5HD5A 3LCEA 4P6ZM 4P6BA 1EW0A 5DF8A 3IHBA 3CG5A 4KG2A 4BQMA 3PBRA 4CJNA 1HD8A 4WN5A 2Y2LA 1NLZA 3GVBA 1YMXA 3BRMA 3T1QB 4BWIA 2H10A 3Q7VB 3NC8A 3Q7VA 3T4QA 5FASA 2Y2NA 4WL9A 2VX8A 5L2FA 2QJ5A 3O5YA 2ZD8A 1KGGA 3DTMA 4E3LA 1YLYA 3C8CA 4FUWA 5HFOA 3NBLA 5DJTA 1I2WA 1EROA 4HH3A 4YWZA 1MY8A 4PPRA 2WAEA 2J7VA 4R6LA 1JWZA 4MNRA 4ZTKA 2PU2A 4ZJ3A 4Y0UA 1LHYA 5FSRA 1BULA 1H8ZA 4Y17A 4B4XA 2DMWA 5E43A 1MKIA 3GRJA 3U4LP 4RA7A 2PRFA 1OT6A 2HP5A 3C7UA 3QP2A 4LGWA 4WUJA 2Y2IA 4K08A 3OPLA 5CGWA 1LI0A 1NYYA 3DWZA 1MWUA 2YKHA 3C4OA 2WKQA 5LBRA 4QPRA 3IS2A 3LR3A 3S4XA 5DF7A 2EX6A 4R38A 2IWCA 4ME4A 3F1PB 1RP5A 1PZPA 5CHUA 4E3MA 2ZM2A 3F1PA 1H8YA 4ETXA 2Y79A 1NY0A 2WZZA 2W1RA 3B42A 4OQ0A 1TEMA 4MBKA 3F1OA 5A90A 3GQZA 2PR6A 4E6WA 4OPZA 3MXQA 3IWIA 5FAPA 1IYQA 1MC0A 4P0MA 2OSUA 4U0XA 1HVBA 5GLDA 2V1ZA 1BLHA 1XA1A 4I3IA 2O9CA 3HREA 4JF5A 2Z6CA 1DP6A 2A3UA 2J9PA 4E3IA 4BBTA 1CI9A 3QHYA 1DP9A 1YQSA 1CEGA 3IQAA 4LLOB 3LIAA 5D3OA 1HZOA 3NCKA 1K55A 2ZBBA 4HESA 5HDDA 4B4ZA 3FG8A 3G4PA 4PAUA 3ISGA 1K56D 3VE4A 1ES3A 1FILA 2ZM8A 3B3XA 4ARZA 5F82A 1E4DA 1LL9A 1J9MA 2O99A 1G5UA 4Q0HA 5M19A 1CF0A 4BBVA 3S7OA 4UHUA 2XFSA 3PBNA 4H6JA 3LI9A 3CLOA 1ACFA 3P01A 3D9YA 3B47A 3IT9A 2C6WB 4KUKA 4YFMA 1OTAA 1GHMA 2WYXA 1MZUA 3T4JA 2QKPA 4Y7PA 1ES2A 1ESIA 2XEPA 1T1BA 4CQHA 3BYDA 1NRFA 2WGWB 4O7DA 1NZUA 4L0LA 3BQAA 1N4OA 2EXAA 4EUZA 2FH5A 3IF6A 4M4XA 1PFLA 1V9YA 3MS6A 1ZKJA 1OTIA 4HBUA 2W3DA 5FQKA 2PYPA 3Q7ZA 3DTIA 5FA7A 5J3WA 5FQQA 1J3WA 3E0YA 2J3TC 3W4QA 4IBXA 3FPWA 3NULA 1S0WA 3IXGA 1T1CA 2ZL1B 4MN6A 1IOUA 3DTKA 2ZL1A 3OPPA 5CEBA 3N7WA 4LRYC 1L0DA 1SKFA 3NOTC 5DF9A 5EE8A 3A3EA 1A0KA 2M7VA 1GSXA 2AVXA 2WKPA 4N1XA 3UB6A 1LLBA 5EVEA 5HARA 5G18A 4R23A 4YOFA 1JTGA 1ONHA 4GD6A 4X53A 2PAVP 3FYZA 1K57A 2JBFA 1TDGA 2XK1A 1VHMA 4B93A 3BEBA 4JKTA 1ES5A 3MZEA 4E3KA 3MKFA 1DY6A 4EWFA 3I7JA 4GCZA 1CJFA 2XF3A 3IWQA 3S22A 3ZYTA 4X1MA 3JYIA 1QMEA 1LL8A 1W8YA 4BBUA 4HJ4A 4R1GA 2VJWA 2UWXA 4HP9A 5IT5A 3G2ZA 5I5LA 2DRWA 3BLSA 2PU4A 2PD7A 4KUOA 5EM1A 4EEPA 3BFDA 5J8XA 1G68A 2JHEA 4PM9A 5CTNA 2HF6A 3T4SA 5DFXA 3IWOA 3SH9A 2VA0A 4MDZA 4G3WA 1CK3A 3S7NA 4EETB 3UE3A 2O9AA 4GZBA 1PW8A 4JPMA 4L9GA 4YINA 2HGVA 4R4RA 1YSQA 1XPBA 5DKLA 5A92A 2WKIA 1W5DA 3ZVWA 2P9VB 3EGXC 4C6YA 3UPPA 4EXOA 3UN7A 3W4PA 1TS6A 2P9VA 3VFFA 4NKPA 3PBQA 4FH4A 4HH2A 3G6OA 4KZ7A 1NWZA 2WGIA 3QNBA 4HJ3A 1K56A 2VGKA 4IVKA 2GX5A 5DTSA 3SS5A 2UV0E 3E98A 1SKOB 3WS2A 1TS0A 1PZOA 3H82A 1XJ2A 1SKOA 2DNSA 4LV0A 3CZDA 5GHZA 5IU1A 4BD0A 1X0OA 3MXSA 3RTYA 4OQIA 2EFXA 2Z2MB 2ZQ9A 1VEUA 4WLAA 4CLCD 2A2LA 3TRCA 1XKZA 1IYOA 1SCWA 3IH8A 3ZVTA 3LYXA 3NIAA 4UQIM 5EVID 4IUHA 2WKHA 4DRTA 4S2OA 5FI7A 3EGDC 2LB5A 4E3JA 2M7UA 5A93A 1BZAA 1IFQA 4HIAA 4GS9B 4JXWA 5HSQA 1VQQA 4OQGA 3ZFZA 3RJUA 2X02A 4KZBA 5GLBA 3UB8A 3GV9A 3LIFA 4NXGA 3WS4A 2FFYA 5G4YA 5EOEA 1UWPX 5HWWA 2VV6A 2QJ7A 5IS1A 3WS5A 4B88A 3UMDA 3O3VA 4OPRA 3UB9A 3W2ZA 4PM7A 3MMHA 4GLQA 4IJGA 4JF6A 4N9LA 1UGUA 3AGEA 3IHAA 5F5YA 3UB5P 2L4RA 5AQAA 4OPYA 3CITA 2VEAA 1L0FA 2XDMA 2EA9A 2PHYA 3MZFA 3ZG8B 3PR6A 1PYYA 3QP4A 5F1FA 2K7SA 3VP3A 2B02A 3T4OA 1W79A 3OPHA 3N8LA 5FATA 3N8RA 3NY4A 4II7A 2R9WA 2CC1A 4QB8A 2VGLS 5F69A 1S1YA 3A3FA 4RX2A 4KZ6A 3UDIA 3H9WA 4GOGA 3KYEA 3VV4A 3A0RA 2WGVA 3JVVA 4KZ3A 3CUEA 2VV7A 2GZAA 2V2FF 4ZBEA 3VOYA 1H3QA 3G32A 2EX8A 2VV8A 3CMZA 2Y59A 2X71A 2Y2MA 3LGOA 3LO7A 3NOPC 4PMAA 5E2FA 1TS7A 3FC7A 1YKDA 1ZHHB 4D60A 2ZMFA 1GA9A 4DJ2A 3NI9A 1BLPA 1OJ5A 3LI8A 5FQJA 5CECA 4RQ9A 5M18A 3OZHA 4GD8A 4X69A 1GSWA 2VZWA 4O8GA 4OQHA 1Y54A 4E3OA 4HY8A 2A24B 2A24A 2HPBA 2XA7S 2I9VA 3UPOA 1FR1A 1OT9A 4HHDA 2XSSA 3KSHA 3BY8A 2ZJ9A 3R4KA 3L9KA 4DXBA 2Y55A 3UO9A 1IYSA 2KOIA 1H8MA 2WAFA 4OLDA 1PWDA 3D4FA 4QU3A 3MXRA 3F1NA 1LT0A 2JE5A 1K4FA 1VB6A 5E2GA 5HAPA 3ITBA 1TF1A 3BW6A 2JKGA 4WZ5A 5EVLA 1S1ZA 2R78A 1KDSA 3MSHA 1L0GA 1IKIA 4PKYG 3HLDA 3LEQA 4KZ4A 4GHIA 3PAGA 3PXPA 4JGOA 1P9RA 5KZHA 2J80A 4G3KA 5J7EA 4JGQA 2R9XA 2P74A 3LUQA 4AFIA 5DFYA 4EBLA 4CLCB 4QWOA 1Z09A 4CLCA 2XLNA 4OP5A 2ZQ8A 4HJ6A 3IS2B 5U47A 2Z2LB 4KQRA 3KX0X 1XX2A 2M1CA 5EVIA 3NJAA 1O07A 1RGYA 1K55C 2X01A 3ZG5A 5I94A 2ZOIA 1IELA 3E2KA 3Q07A 1DJCA 1LI9A 5AQ7A 4FH2A 2HJEA 1Y28A 2HV1A 4OKPA 2KX6A 1KOUA 2Y2GA 4L9EA 5HDSA 3SH8A 1W8QA 2W27A 4GNUA 4EU0A 5FEFA 3N8SA 3F1OB 3T4KA 3C2WA 1N9OA 3DTEA 3V5MA 3UB7A 4I3JA 4DDSA 2I72A 4JBFA 1DRMA 2Z6DA 1KVLA 2Q0OA 5CHMA 2W3HA 3LEZA 4NEED 2G2UA 1G28A 3VOZA 3BFGA 4Q0IA 5FL3A 1F2KA 2VGJA 1OJGA 2Y2KA 5A91A 4PM6A 1YLTA 3ZHHA 3EOIA 3MF0A 3FWLA 4OONA 2ZC7A 2B5RA 3VOLA 3LFVA 4FOFA 3P98A 5GHYA 3IF6C 3GSGA 5TBMB 3IBJA 4X68A 3WRTA 5TFQA 5TBMA 1XGIA 3VP1A 5EM0A 3P7NA 2HDRA 4ESPA 3Q1FA 4WM9A 1XXMA 4Q8IA 4IBRA 4ARZB 1AXBA 1TS8A 3KYQA 3RXWA 4XUZA 1YSPA 1E25A 3SH7A 1F9IA 4UA9A 3QNCA 4H6JB 5L07A 3LICA 1T18A 3MKEA 2B18A 3RFBA 4BL2A 1L3LA 2E8JA 3VP4A 3W8KA 2JKFA 2FFFB 3UDFA 5CERA 5HDCA 5HL6A 3O87A 1WE4A 1PNEA 3V50A 2XD1A 4KG5A 4UA7A 1XP4A 3IF5A 1K57C 3FKVA 3IF6B 4FTXA 4I3AA 3KO6A 5AJGA 3CHWP 4OOYA 1NZOA 2ZC3B 4MCWA 5HPFA 3K3DA 5GLCA 1LL5A 3HJKA 3BLMA 3PYPA 1GSVA 2J3WA 2GJ3A 2OAQ1 3S7PA 4PM8A 1FSWA 4XT2B 3HUNA 2JCHA 3HLEA 1SDNA 4XT2A 3QP1A 1KGFA 1STZA 3DAVA 1K54C 1MXOA 3DWKA 3IH9A 3R7WA 2D02A 4DXCA 4ZJ2A 1V9ZA 1FCMA 3ITAA 3G30A 2W3EA 3UDXA 3JPUA 4WZ4A 1Q2QA 3TOIA 3DBAA 3HLCA 2OV5A 2Y8HA 3PBTA 2V1AA 4BLMA 1DJAA 4Q0JA 3CWFA 5FQIA 4JXGA 2ACGA 4R0QA 1G6OA 5CGSA 2BTFP 5HWVA 5HZHA 3H7WA 1WYCA 1HLUP 5GHXA 3N4IA 3RXXA 2EXBA 4BMWA 4P85A 1FIKA 3A3DA 3M6HA 1NLYA 1Q2PA 4DJ3A 4WEJA 2EX2A 2JN7A 4WBGA 2V9AA 3SS4A 1XA7A 5FQ9A 3MZDA 4E6XA 2Q9NA 3TE8A 4H8RA 1YLPA 4RYEA 4U0TA 1K54A 4GKUA 4Y15A 1GCEA 1M6KA 4EBNA 2Y2OA 4I39A 4R70A 2EX9A 2RL3A 1XJ3A 3BECA 3IXBA 4HOIA 1ZC2A 4S2NA 3NDEA 4RVAA 5DKKA 2L0WA 5EFWA 2IWDA 1XJ4A 2Y2QA 2B95A 3MQQA 2PBYA 2KDKA 4WEKA 1DP8A 3DW0A 1BT5A 1ALQA 4LENA 3CPTB 2XFTA 1JWVA 3CPTA 5MC7A 3QP6A 4UEYA 3E4OA 5BOHA 1EI5A 4HP4A 3NDGA 5F1GA 4NXFA 5FDHA 1AWIA 2XGNA 4KZ5A 3HUMA 3H82B 2ZMVA 5TGFA 4DDYA 5JYOA 4UA6A 2VKSA 1GA0A 5L8MA 1YM1A 4S2LA 3E2LA 5HWTA 1KE3A 3LY3A 1VEUB 2WUQA 5FAOA 1S4RA 4UAAA 2PBDP 2BG1A 4OVDA 5C5KA 4CPKA 2WKEA 4QJGA 4MMNA 5CGXA 1HTZA 1BLCA 5M1AA 4QD4A 1PRQA 3KSIA 2KLIA 1S4SA 3G34A 4NXEA 3OCNA 4WF0A 3FV7A 4BENA 1MKMA 1MBLA 1IEMA 4K0XA 3A3JA 3V39A 3IXDA 2ZQDA 1H5XA 3CUEC 1VM1A 1ODVA 2K31A 1C3BA 2HZ5A 1XJ6A 3HL9A 2E8IA 2QZ6A 4DN0A 4BJPA 3MQOA 3VP2A 1E3UA 5CTMA 3RH8B 3A0VA 3B33A 5F68A 3HJIA 3HLWA 5AVFA 4EEUA 3CJMA 4ZDXA 1S67L 5FDSA 2PDRA 2QMIA 2CMNA 1RCJA 4G3VA 5EPHA 1FCOA 3LR4A 5DTKA 3ZG7B 2W0NA 3UE0A 4GDNA 1N9BA 3LIBA 4DE2A 2IA2A 4N92A 4GDBA 4P6ZS 1K38A 1JVJA 2PR5A 3GECA 5L09A 1KE0A 3ZQ5A 2K2NA 4QHCA 1RGZA 4LV3A 4A5RA 2EWWA 3A3IA 3HBRA 5CRFA 1BYWA 4JGRA 2Y2JA 3UNWA 3WWXA 3M2KA 3T1XA 2FZ0A 3VE3A 3SS3A 4WZ5C 3MR0A 2OLVA 4M3KA 3S1YA 4F94A 3HCYA 2ZC5B 2VGLM 1CI8A 4EW7A 4S2KA 3BWLA 3K3CA 3BFCA 2XR0A 2VK3A 4CLCC 3ZG9B 3S7QA 4JGPA 3HVFA 1SZVA 3Q82A 1D1JA 2P04A 1FR6A 5EVIC 3OC2A 2GNXA 5L10A 1JNUA 4B9OA 1M40A 5HL1A 1PI4A 3LY4A 2H0TA 2QHKA 1OTDA 5FAQA 4HBTA 4X56A 3F1NB 3T1RA 4QY5A 2JKTI 2V8CA 4S2JA 4Z9QA 3FPVA 5F83A 3UPNA 5DVAA 4EUVA 3BFFA 3WS1A 4PHTA 2JKRI 2XA7M 4GHIB 1OTBA 4LV1A 1MWRA 1ONGA 4O0PA 3FZCA 1NYMA 3EQVA 1ES4A 5HAQA 1YAXA 3PBSA 2H5SA 2NUTC 3BM6A 2XD5A 3QP5A 2YKFA 3JVUA 4NETA 3IXHA 1NJ4A 3IX3A 1W63Q 1P9WA 1TDLA 2EFUA 3BJNA 5EVIB 3IBRA 4OP8A 1ZG6A 5GL9A 3E4QA 4HNBA 4EESA 5AQ9A 4NK3A 1PIOA 2PT7A 4OOMA 3V3SA 1K0KA 3UE6A 5J4EA 2ZLYA 1XGJA 3NECA 1P97A 2EWVA 4S2IA 3BFEA 4EBPA 3MFXA 5DTTA 2J3TD 2DCFA 4FCFA 1VETB 2XRNA 4Y13A 2VLGA 3D3OA 4P87A 2WADA 4NXBA 1VETA 2W3GA 2OWJA 3NHQA 5IHVA 3C30A 4EERA 4WMCD 3ZCZA 4EQ1A 5CX7A 1QMFA 5FEGA 1OTEA 2HDQA 4JLFA 4OH0A 3Q81A 4LFUA 4MBFA 4YNRA 5EV0A 3M6BA 3K2NA 2H0YA 2QYBA 3KSGA 2QWSA 4N9KA 3MBZA 3VSLA 2MJ6A 1KGEA 1W63M 3C38A 4OPQA 2OWHA 2ZMAA 2GDNA 4R3BA 3AGDA 3BY9A 1YPRA 4I5SA 5KMWA 5KSCA 4KENB 3PHYA 2H28A 4LPZA 1MWSA 3UMEA 1OMEA 4Y2FA 2OOLA 4O01A 1I2SA 3MQ0A 3W4OA 4WELA 5CHJA 3AGFA 4L9FA 4S2MA 3OPRA 1DJBA 3O88A 3TJZC 1YLJA 2HJ9C 3LIEA 2JC7A 3QP8A 3OBFA 1YMSA 3VMAA 2NUPC 3UE1A 3T50A 1JWPA 4R3AA 4ZRRA 3U2AA 1T1AA 2XROA 5G4ZA 3P09A 1MPLA 3L7HA 1K4EA 4HQAA 3M2JA 3ULFA 4LCMA 1TVFA 1YLWA 1T19A 3PBOA 2LB9A 1D06A 1LSWA 3T1SA 3LIDA 2JKTM 3GR2A 2WGWA 2WZXA 1ZG4A 1SHVA 4R3JA 5CXWA 5HPIA 3WS0A 2WK0A 1IKGA 4X25A 5FQMA 5HW3A 4WYYA 2BLSA 1L2SA 2JKRM 3R7WB 1S66L 3ZNYA 3CAXA 2O0YA 1E3UD 2ZQAA 2V1BA 1JTDA 1PWCA 5FI6A 4DE3A 4F3LB 4HEFA 3MJQA 4S2NC 3FKWA 4F3LA 4NG2A 1N9NA 4IUKA 1D7EA 3LR5A 3ZG0A 2OAP1 1LSXA 3LR0A 5EOOA 1F98A 4XXRA 1GHIA 3H7WB 1FQGA 3VP0A 4MN7A 1K25A 3SZTA 1WYBA 2PYRA 1P0ZA 3EQUA 3HLFA 4MEZA 4QY6A 4JXVA 4PM5A 3UY6A 2G2WA 5EECA 2BASA 3WRZA 1ERMA 4GJ4A 3CI6A 1MWTA 4KZAA 2PD8A 2QPNA 4C3QA 1S6RA 3SOIA 2ZC4B 4KQDA 1PI5A 3O86A 3NOUC 4Z1WA 4K0WA 2INWA 2P7JA 2ZC6B 2HDUA 1H0MA 4JXSA 4WMCA 2P08A 1YLZA 4OLGA 4PKYA 2G7UA 2IWBA 3C5AA 1LSVA 4ZJ1A 4IEDA 3G35A 1NRJA 5E2EA 4X1LA 3IX8A 1OPXA 4E04A 4KQQA 4MBHA 4ETZA 5AQBA 1PW1A 2V0UA 1YT4A 2C5WB 1XFNA 4LV2A 2Q9MA 4EV4A 4LRZE 3TSGA 1K6RA 3KYZA 5TJJA 1W7FA 4BD1A 4Y3IA 5EUAA 3BQ8A 5F6AA 1BUEA 2WKRA 1FSYA 5HAIA 3HLBA 5DJUA 2D01A 3HLGA 1PWGA 1UWNX 4UQIS 5FI2A 4MLLA 1ERQA 4DF6A 2XH9A 4KZ8A 1ESUA 4OOLA 5K5BA 1TD5A 4FSFA 3EEHA 1KVMA 2Y2PA 3GTCA 5GLAA 1SDEA 1XFQA 3OOVA 2ZQCA 3KSFA 3T12B 3T4LA 4FD8A 2ZOHA 2ZM0A 2A49A 1KDWA 4MN5A 1Z6FA 4DE0A 4DE1A 3C4PA 1IYPA 4EQIA 2L1MA 4GB7A 3VSKA 4X6TA 2Y91A 3ZDJA 2O9BA 4DKIA 2ZQ7A 4K91A
chains in the Genus database with same CATH topology
3T4TA 3IBJA 2GNXA 3OLOA 4KQOA 5TBMA 1VHMA 1ZTUA 3EWKA 1JNUA 4B93A 4B9OA 3E4PA 4HI4A 3P7NA 2QHKA 1OTDA 3F1NB 5HD3A 4ARZB 3SW1A 3OCLA 1TS8A 4GS9A 1F5MA 2JKTI 4GCZA 5KSHA 3KYQA 3FPVA 2W1TB 1YSPA 4EUVA 2W1TA 3ZYTA 1F9IA 4H6JB 4PHTA 3LICA 2JKRI 2XA7M 4GHIB 1LL8A 1OTBA 1T18A 2B18A 4O0PA 4Y5FA 3EQVA 3RFBA 4BBUA 4HJ4A 5IT5A 2VJWA 4HP9A 3TW8A 4GW9A 5AVEA 1YAXA 3PBSA 2NUTC 5I5LA 5HDCA 5HL6A 2PD7A 2YKFA 3JVUA 3EEAA 4IHQA 4KUOA 4EEPA 1W63Q 2JHEA 1P9WA 3BJNA 3T4SA 2HF6A 3IBRA 5DFXA 3D72A 2VA0A 4I3AA 3KO6A 4MDZA 5KIZA 3E4QA 4G3WA 4HNBA 3S7NA 4EESA 4EETB 5AJGA 3UE3A 2PT7A 4OOMA 2O9AA 4L9GA 4MCWA 3UE6A 2HGVA 5HPFA 5A8BA 5J4EA 1YSQA 4CLCE 5DKLA 3K3DA 1P97A 3HJKA 3EGXC 3ICYA 2EWVA 4EXOA 3PYPA 1GSVA 1TS6A 1WA9A 2J3WA 2GJ3A 2OAQ1 3S7PA 3MFXA 4NKPA 3PBQA 4HH2A 4XT2B 2J3TD 3GDIA 4LRXC 4I38A 3G6OA 2XRNA 2VLGA 3D3OA 4XT2A 1NWZA 4HJ3A 4NXBA 3V67A 1N9LA 1STZA 2GX5A 2OWJA 2W3GA 3NHQA 4DMZA 2W3FA 3C30A 3E98A 4EERA 3R7WA 2D02A 1TS0A 2V0WA 3H82A 1XJ2A 3A0SA 4EQ1A 1V9ZA 5HD5A 4P6ZM 2W3EA 5CX7A 5IU1A 1X0OA 1EW0A 3RTYA 1OTEA 3DBAA 2Y8HA 3PBRA 4YNRA 3PBTA 4WLAA 2V1AA 4CLCD 2A2LA 4WN5A 3TRCA 4Q0JA 3K2NA 1NLZA 3CWFA 2QYBA 3KSGA 3LYXA 2QWSA 4UQIM 1G6OA 4BWIA 5HWVA 5HZHA 2MJ6A 4IUHA 3H7WA 1W63M 3C38A 3EGDC 2LB5A 3T4QA 2M7UA 2OWHA 1IFQA 4WL9A 2VX8A 3BY9A 2QJ5A 4HIAA 4BMWA 3O5YA 4I5SA 4GS9B 1NLYA 5HSQA 3PHYA 4DJ3A 2H28A 4LPZA 4WEJA 2JN7A 2V9AA 3UMEA 4Y2FA 3C8CA 2OOLA 4O01A 3UB8A 3TE8A 3LIFA 3MQ0A 4NXGA 5DJTA 5G4YA 4YWZA 4HH3A 4WELA 1UWPX 5HWWA 2VV6A 4L9FA 2QJ7A 5IS1A 3TJZC 2HJ9C 3LIEA 4R6LA 4I39A 4R70A 3UMDA 1XJ3A 3UB9A 3W2ZA 4HOIA 3MMHA 4GLQA 2DMWA 3OBFA 4IJGA 5DKKA 2L0WA 5EFWA 1UGUA 5F5YA 2NUPC 2L4RA 3T50A 1XJ4A 4R3AA 4ZRRA 1OT6A 3U2AA 1T1AA 2XROA 3CITA 2VEAA 5G4ZA 3MQQA 2EA9A 4WUJA 2PHYA 4K08A 2KDKA 4WEKA 4HQAA 3PR6A 1DP8A 3ULFA 2K7SA 1T19A 2B02A 3T4OA 3PBOA 2LB9A 2YKHA 1D06A 5LBRA 2WKQA 4QPRA 1LSWA 3LIDA 3IS2A 3LR3A 5MC7A 2JKTM 4II7A 4UEYA 3E4OA 4R38A 2VGLS 5F69A 1S1YA 5HPIA 4ME4A 4HP4A 3F1PB 4NXFA 3F1PA 3H9WA 4ETXA 2JKRM 3R7WB 3A0RA 1S66L 2Y79A 3JVVA 3VV4A 3H82B 2ZMVA 3CAXA 2O0YA 3CUEA 2VV7A 2GZAA 2W1RA 2VKSA 3B42A 2V1BA 1H3QA 5L8MA 4F3LB 2VV8A 3MJQA 3F1OA 5HWTA 4F3LA 2PR6A 1N9NA 1S4RA 3MXQA 4IUKA 1D7EA 3LR5A 3NOPC 2OAP1 1LSXA 3LR0A 1MC0A 1TS7A 3FC7A 1YKDA 1ZHHB 1F98A 2ZMFA 5C5KA 4DJ2A 1OJ5A 3LI8A 3H7WB 4I3IA 4MMNA 2O9CA 4RQ9A 4MN7A 2Z6CA 1GSWA 1DP6A 2VZWA 3KSIA 2KLIA 4BBTA 4O8GA 2PYRA 1S4SA 1P0ZA 4NXEA 4HY8A 3EQUA 3OCNA 1DP9A 2A24B 4WF0A 2A24A 4LLOB 3LIAA 2XA7S 2BASA 4GJ4A 1MKMA 2I9VA 3CI6A 1OT9A 2PD8A 4HHDA 2XSSA 3KSHA 3BY8A 3R4KA 2ZBBA 5HDDA 2KOIA 3FG8A 4PAUA 1H8MA 4KQDA 3CUEC 3VE4A 3NOUC 1ODVA 4Z1WA 2K31A 3F1NA 4ARZA 1LT0A 2INWA 1XJ6A 2P7JA 1VB6A 2O99A 1TF1A 3BW6A 4Q0HA 4DN0A 1S1ZA 4BJPA 3MQOA 2R78A 4BBVA 3S7OA 3PBNA 4H6JA 4PKYG 2P08A 3LI9A 3CLOA 4PKYA 4GHIA 2G7UA 3P01A 3PXPA 3A0VA 3B47A 3B33A 3RH8B 4JGOA 1P9RA 5F68A 2J80A 3HJIA 4G3KA 5AVFA 4EEUA 4KUKA 1LSVA 5J7EA 4JGQA 1S67L 3LUQA 4AFIA 5DFYA 1NRJA 2PDRA 1OTAA 4CLCB 2CMNA 4G3VA 1MZUA 3T4JA 2QKPA 4CLCA 1OPXA 4E04A 3LR4A 4HJ6A 1T1BA 4CQHA 3IS2B 2W0NA 4L0LA 3KX0X 4ETZA 3BQAA 2M1CA 3LIBA 2V0UA 3NJAA 2IA2A 2FH5A 1XFNA 4M4XA 2ZOIA 4P6ZS 4LRZE 1V9YA 3KYZA 2PR5A 5TJJA 3GECA 1OTIA 4Y3IA 2W3DA 2HJEA 3ZQ5A 1Y28A 2K2NA 3BQ8A 2HV1A 2PYPA 5F6AA 2KX6A 1KOUA 5J3WA 4L9EA 5HDSA 2WKRA 3E0YA 2J3TC 2EWWA 2W27A 4EU0A 1BYWA 4JGRA 5DJUA 3FPWA 2D01A 3F1OB 3T4KA 3C2WA 1N9OA 1UWNX 2FZ0A 4UQIS 3VE3A 3UB7A 4I3JA 1T1CA 4MN6A 3MR0A 1IOUA 1DRMA 2Z6DA 4OOLA 5K5BA 1TD5A 4LRYC 4FSFA 3EEHA 3HCYA 2W3HA 4NEED 3NOTC 1XFQA 1G28A 2VGLM 5DF9A 4EW7A 3BWLA 4Q0IA 2M7VA 3OOVA 5FL3A 3KSFA 3K3CA 1OJGA 3T4LA 2ZOHA 4MN5A 1GSXA 3EOIA 4CLCC 2WKPA 3UB6A 3S7QA 4JGPA 3MF0A 4YOFA 2L1MA 2P04A 3VOLA 2O9BA 3OC2A 3LFVA 4FOFA 5TBMB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OLO A;  5TBM A;  3EWK A;  1JNU A;  4B9O A;  3E4P A;  4HI4 A;  3P7N A;  2QHK A;  1OTD A;  3F1N B;  5HD3 A;  3SW1 A;  1TS8 A;  4GS9 A;  4GCZ A;  1F9I A;  4H6J B;  3LIC A;  4GHI B;  1LL8 A;  1OTB A;  1T18 A;  4BBU A;  4HJ4 A;  4HP9 A;  4GW9 A;  5AVE A;  5I5L A;  5HDC A;  2PD7 A;  2YKF A;  4KUO A;  4EEP A;  2JHE A;  3IBR A;  3D72 A;  4I3A A;  5KIZ A;  3E4Q A;  4HNB A;  4EES A;  4EET B;  4L9G A;  3UE6 A;  5A8B A;  5J4E A;  5DKL A;  3K3D A;  1P97 A;  3HJK A;  3ICY A;  4EXO A;  3PYP A;  1GSV A;  1TS6 A;  1WA9 A;  2GJ3 A;  3MFX A;  4HH2 A;  4XT2 B;  3GDI A;  4LRX C;  4I38 A;  3G6O A;  2VLG A;  4XT2 A;  1NWZ A;  4HJ3 A;  4NXB A;  1N9L A;  2OWJ A;  3NHQ A;  4EER A;  2D02 A;  1TS0 A;  2V0W A;  3H82 A;  1XJ2 A;  3A0S A;  4EQ1 A;  1V9Z A;  5HD5 A;  5IU1 A;  1X0O A;  1EW0 A;  3RTY A;  1OTE A;  4WLA A;  2V1A A;  4WN5 A;  3CWF A;  3LYX A;  2QWS A;  5HWV A;  5HZH A;  3H7W A;  2OWH A;  4WL9 A;  3BY9 A;  2QJ5 A;  4HIA A;  4I5S A;  4GS9 B;  5HSQ A;  3PHY A;  4DJ3 A;  2H28 A;  4LPZ A;  2JN7 A;  2V9A A;  3UME A;  3C8C A;  2OOL A;  3UB8 A;  3LIF A;  4NXG A;  5DJT A;  5G4Y A;  4YWZ A;  4HH3 A;  1UWP X;  5HWW A;  2VV6 A;  4L9F A;  2QJ7 A;  5IS1 A;  3LIE A;  4R6L A;  4I39 A;  4R70 A;  3UMD A;  1XJ3 A;  3UB9 A;  4HOI A;  5DKK A;  2L0W A;  5EFW A;  1UGU A;  5F5Y A;  3T50 A;  2L4R A;  1XJ4 A;  4R3A A;  1OT6 A;  1T1A A;  2VEA A;  5G4Z A;  3MQQ A;  2EA9 A;  4WUJ A;  2PHY A;  4K08 A;  2KDK A;  4HQA A;  1DP8 A;  3ULF A;  2K7S A;  1T19 A;  2B02 A;  2YKH A;  1D06 A;  2WKQ A;  1LSW A;  3LID A;  3IS2 A;  3E4O A;  4R38 A;  5F69 A;  1S1Y A;  4HP4 A;  3F1P B;  4NXF A;  3F1P A;  3H9W A;  3A0R A;  1S66 L;  3H82 B;  3CAX A;  2VV7 A;  2V1B A;  4F3L B;  2VV8 A;  3MJQ A;  3F1O A;  5HWT A;  4F3L A;  2PR6 A;  1N9N A;  1S4R A;  3MXQ A;  1D7E A;  3NOP C;  1LSX A;  1TS7 A;  3FC7 A;  1F98 A;  4DJ2 A;  1OJ5 A;  3LI8 A;  3H7W B;  4I3I A;  4RQ9 A;  2Z6C A;  1GSW A;  1DP6 A;  4BBT A;  2PYR A;  1S4S A;  1P0Z A;  4NXE A;  4HY8 A;  1DP9 A;  2A24 B;  4WF0 A;  2A24 A;  4LLO B;  3LIA A;  2BAS A;  2I9V A;  1OT9 A;  2PD8 A;  4HHD A;  3BY8 A;  2ZBB A;  5HDD A;  3FG8 A;  4KQD A;  3VE4 A;  3NOU C;  1ODV A;  3F1N A;  1LT0 A;  2INW A;  1XJ6 A;  2P7J A;  1VB6 A;  1S1Z A;  3MQO A;  2R78 A;  4BBV A;  4H6J A;  4PKY G;  3LI9 A;  3CLO A;  4PKY A;  4GHI A;  3RH8 B;  3A0V A;  3B33 A;  4JGO A;  5F68 A;  2J80 A;  3HJI A;  5AVF A;  4EEU A;  4KUK A;  1LSV A;  5J7E A;  4JGQ A;  1S67 L;  3LUQ A;  2PDR A;  1OTA A;  2CMN A;  1MZU A;  2QKP A;  4E04 A;  4HJ6 A;  1T1B A;  3IS2 B;  2W0N A;  3KX0 X;  2M1C A;  3LIB A;  2V0U A;  3NJA A;  1XFN A;  4M4X A;  2ZOI A;  4LRZ E;  1V9Y A;  2PR5 A;  3GEC A;  1OTI A;  3ZQ5 A;  1Y28 A;  2HV1 A;  2PYP A;  5F6A A;  2KX6 A;  1KOU A;  5J3W A;  4L9E A;  5HDS A;  2WKR A;  2W27 A;  1BYW A;  4JGR A;  5DJU A;  2D01 A;  3F1O B;  3C2W A;  1N9O A;  1UWN X;  3VE3 A;  3UB7 A;  4I3J A;  1T1C A;  4MN6 A;  3MR0 A;  1DRM A;  2Z6D A;  4LRY C;  3EEH A;  3NOT C;  1XFQ A;  1G28 A;  4EW7 A;  3BWL A;  3K3C A;  1OJG A;  2ZOH A;  4MN5 A;  1GSX A;  3UB6 A;  2WKP A;  4JGP A;  2L1M A;  3VOL A;  5TBM B; 
#chains in the Genus database with same CATH topology
 3T4T A;  2RCX A;  1L0E A;  4U3T A;  3OLO A;  4KQO A;  3EWK A;  1ZTU A;  4GN2 A;  3G2Y A;  3C7V A;  3E4P A;  2J9O A;  3G31 A;  4HI4 A;  5E2H A;  3MFD A;  4KG6 A;  4S2P A;  1O7E A;  1K6S A;  5HX9 A;  4ID4 A;  5HD3 A;  3PTE A;  3SW1 A;  3OCL A;  4JF4 A;  4GS9 A;  1KE4 A;  1F5M A;  4D2O A;  5TR7 A;  2HDS A;  3IX4 A;  5KSH A;  2W1T B;  2Y4A A;  1CEF A;  1CQA A;  2W1T A;  4R4S A;  4X55 A;  1BTL A;  1I5Q A;  3HUO A;  1FOF A;  4Y5F A;  5JYP A;  1GHP A;  3TW8 A;  1FCN A;  2V8F A;  4GW9 A;  4IVI A;  5AVE A;  4E3N A;  4C75 A;  1BSG A;  1EWZ A;  5CED A;  4BL3 A;  4ZAM A;  1Y4O A;  3EEA A;  4IHQ A;  3VFH A;  4N1H A;  3V3R A;  3N6I A;  3D72 A;  5KIZ A;  4Y0O A;  2OLU A;  3GMW A;  2XQZ A;  1G6A A;  4LCL A;  5A8B A;  4CLC E;  3ICY A;  1WA9 A;  4Y0T A;  3PAE A;  2J8Y A;  3TG9 A;  2Y2H A;  1BLS A;  3GDI A;  4LRX C;  4I38 A;  4RX3 A;  3ZNT A;  3V67 A;  1N9L A;  4XUX A;  1U60 A;  2V20 A;  4DMZ A;  2W3F A;  1NXY A;  2HP9 A;  2V0W A;  2HP6 A;  3A0S A;  3ZGA B;  4KZ9 A;  5HD5 A;  3LCE A;  4P6Z M;  4P6B A;  1EW0 A;  5DF8 A;  3IHB A;  3CG5 A;  4KG2 A;  4BQM A;  3PBR A;  4CJN A;  1HD8 A;  4WN5 A;  2Y2L A;  1NLZ A;  3GVB A;  1YMX A;  3BRM A;  3T1Q B;  4BWI A;  2H10 A;  3Q7V B;  3NC8 A;  3Q7V A;  3T4Q A;  5FAS A;  2Y2N A;  4WL9 A;  2VX8 A;  5L2F A;  2QJ5 A;  3O5Y A;  2ZD8 A;  1KGG A;  3DTM A;  4E3L A;  1YLY A;  3C8C A;  4FUW A;  5HFO A;  3NBL A;  5DJT A;  1I2W A;  1ERO A;  4HH3 A;  4YWZ A;  1MY8 A;  4PPR A;  2WAE A;  2J7V A;  4R6L A;  1JWZ A;  4MNR A;  4ZTK A;  2PU2 A;  4ZJ3 A;  4Y0U A;  1LHY A;  5FSR A;  1BUL A;  1H8Z A;  4Y17 A;  4B4X A;  2DMW A;  5E43 A;  1MKI A;  3GRJ A;  3U4L P;  4RA7 A;  2PRF A;  1OT6 A;  2HP5 A;  3C7U A;  3QP2 A;  4LGW A;  4WUJ A;  2Y2I A;  4K08 A;  3OPL A;  5CGW A;  1LI0 A;  1NYY A;  3DWZ A;  1MWU A;  2YKH A;  3C4O A;  2WKQ A;  5LBR A;  4QPR A;  3IS2 A;  3LR3 A;  3S4X A;  5DF7 A;  2EX6 A;  4R38 A;  2IWC A;  4ME4 A;  3F1P B;  1RP5 A;  1PZP A;  5CHU A;  4E3M A;  2ZM2 A;  3F1P A;  1H8Y A;  4ETX A;  2Y79 A;  1NY0 A;  2WZZ A;  2W1R A;  3B42 A;  4OQ0 A;  1TEM A;  4MBK A;  3F1O A;  5A90 A;  3GQZ A;  2PR6 A;  4E6W A;  4OPZ A;  3MXQ A;  3IWI A;  5FAP A;  1IYQ A;  1MC0 A;  4P0M A;  2OSU A;  4U0X A;  1HVB A;  5GLD A;  2V1Z A;  1BLH A;  1XA1 A;  4I3I A;  2O9C A;  3HRE A;  4JF5 A;  2Z6C A;  1DP6 A;  2A3U A;  2J9P A;  4E3I A;  4BBT A;  1CI9 A;  3QHY A;  1DP9 A;  1YQS A;  1CEG A;  3IQA A;  4LLO B;  3LIA A;  5D3O A;  1HZO A;  3NCK A;  1K55 A;  2ZBB A;  4HES A;  5HDD A;  4B4Z A;  3FG8 A;  3G4P A;  4PAU A;  3ISG A;  1K56 D;  3VE4 A;  1ES3 A;  1FIL A;  2ZM8 A;  3B3X A;  4ARZ A;  5F82 A;  1E4D A;  1LL9 A;  1J9M A;  2O99 A;  1G5U A;  4Q0H A;  5M19 A;  1CF0 A;  4BBV A;  3S7O A;  4UHU A;  2XFS A;  3PBN A;  4H6J A;  3LI9 A;  3CLO A;  1ACF A;  3P01 A;  3D9Y A;  3B47 A;  3IT9 A;  2C6W B;  4KUK A;  4YFM A;  1OTA A;  1GHM A;  2WYX A;  1MZU A;  3T4J A;  2QKP A;  4Y7P A;  1ES2 A;  1ESI A;  2XEP A;  1T1B A;  4CQH A;  3BYD A;  1NRF A;  2WGW B;  4O7D A;  1NZU A;  4L0L A;  3BQA A;  1N4O A;  2EXA A;  4EUZ A;  2FH5 A;  3IF6 A;  4M4X A;  1PFL A;  1V9Y A;  3MS6 A;  1ZKJ A;  1OTI A;  4HBU A;  2W3D A;  5FQK A;  2PYP A;  3Q7Z A;  3DTI A;  5FA7 A;  5J3W A;  5FQQ A;  1J3W A;  3E0Y A;  2J3T C;  3W4Q A;  4IBX A;  3FPW A;  3NUL A;  1S0W A;  3IXG A;  1T1C A;  2ZL1 B;  4MN6 A;  1IOU A;  3DTK A;  2ZL1 A;  3OPP A;  5CEB A;  3N7W A;  4LRY C;  1L0D A;  1SKF A;  3NOT C;  5DF9 A;  5EE8 A;  3A3E A;  1A0K A;  2M7V A;  1GSX A;  2AVX A;  2WKP A;  4N1X A;  3UB6 A;  1LLB A;  5EVE A;  5HAR A;  5G18 A;  4R23 A;  4YOF A;  1JTG A;  1ONH A;  4GD6 A;  4X53 A;  2PAV P;  3FYZ A;  1K57 A;  2JBF A;  1TDG A;  2XK1 A;  1VHM A;  4B93 A;  3BEB A;  4JKT A;  1ES5 A;  3MZE A;  4E3K A;  3MKF A;  1DY6 A;  4EWF A;  3I7J A;  4GCZ A;  1CJF A;  2XF3 A;  3IWQ A;  3S22 A;  3ZYT A;  4X1M A;  3JYI A;  1QME A;  1LL8 A;  1W8Y A;  4BBU A;  4HJ4 A;  4R1G A;  2VJW A;  2UWX A;  4HP9 A;  5IT5 A;  3G2Z A;  5I5L A;  2DRW A;  3BLS A;  2PU4 A;  2PD7 A;  4KUO A;  5EM1 A;  4EEP A;  3BFD A;  5J8X A;  1G68 A;  2JHE A;  4PM9 A;  5CTN A;  2HF6 A;  3T4S A;  5DFX A;  3IWO A;  3SH9 A;  2VA0 A;  4MDZ A;  4G3W A;  1CK3 A;  3S7N A;  4EET B;  3UE3 A;  2O9A A;  4GZB A;  1PW8 A;  4JPM A;  4L9G A;  4YIN A;  2HGV A;  4R4R A;  1YSQ A;  1XPB A;  5DKL A;  5A92 A;  2WKI A;  1W5D A;  3ZVW A;  2P9V B;  3EGX C;  4C6Y A;  3UPP A;  4EXO A;  3UN7 A;  3W4P A;  1TS6 A;  2P9V A;  3VFF A;  4NKP A;  3PBQ A;  4FH4 A;  4HH2 A;  3G6O A;  4KZ7 A;  1NWZ A;  2WGI A;  3QNB A;  4HJ3 A;  1K56 A;  2VGK A;  4IVK A;  2GX5 A;  5DTS A;  3SS5 A;  2UV0 E;  3E98 A;  1SKO B;  3WS2 A;  1TS0 A;  1PZO A;  3H82 A;  1XJ2 A;  1SKO A;  2DNS A;  4LV0 A;  3CZD A;  5GHZ A;  5IU1 A;  4BD0 A;  1X0O A;  3MXS A;  3RTY A;  4OQI A;  2EFX A;  2Z2M B;  2ZQ9 A;  1VEU A;  4WLA A;  4CLC D;  2A2L A;  3TRC A;  1XKZ A;  1IYO A;  1SCW A;  3IH8 A;  3ZVT A;  3LYX A;  3NIA A;  4UQI M;  5EVI D;  4IUH A;  2WKH A;  4DRT A;  4S2O A;  5FI7 A;  3EGD C;  2LB5 A;  4E3J A;  2M7U A;  5A93 A;  1BZA A;  1IFQ A;  4HIA A;  4GS9 B;  4JXW A;  5HSQ A;  1VQQ A;  4OQG A;  3ZFZ A;  3RJU A;  2X02 A;  4KZB A;  5GLB A;  3UB8 A;  3GV9 A;  3LIF A;  4NXG A;  3WS4 A;  2FFY A;  5G4Y A;  5EOE A;  1UWP X;  5HWW A;  2VV6 A;  2QJ7 A;  5IS1 A;  3WS5 A;  4B88 A;  3UMD A;  3O3V A;  4OPR A;  3UB9 A;  3W2Z A;  4PM7 A;  3MMH A;  4GLQ A;  4IJG A;  4JF6 A;  4N9L A;  1UGU A;  3AGE A;  3IHA A;  5F5Y A;  3UB5 P;  2L4R A;  5AQA A;  4OPY A;  3CIT A;  2VEA A;  1L0F A;  2XDM A;  2EA9 A;  2PHY A;  3MZF A;  3ZG8 B;  3PR6 A;  1PYY A;  3QP4 A;  5F1F A;  2K7S A;  3VP3 A;  2B02 A;  3T4O A;  1W79 A;  3OPH A;  3N8L A;  5FAT A;  3N8R A;  3NY4 A;  4II7 A;  2R9W A;  2CC1 A;  4QB8 A;  2VGL S;  5F69 A;  1S1Y A;  3A3F A;  4RX2 A;  4KZ6 A;  3UDI A;  3H9W A;  4GOG A;  3KYE A;  3VV4 A;  3A0R A;  2WGV A;  3JVV A;  4KZ3 A;  3CUE A;  2VV7 A;  2GZA A;  2V2F F;  4ZBE A;  3VOY A;  1H3Q A;  3G32 A;  2EX8 A;  2VV8 A;  3CMZ A;  2Y59 A;  2X71 A;  2Y2M A;  3LGO A;  3LO7 A;  3NOP C;  4PMA A;  5E2F A;  1TS7 A;  3FC7 A;  1YKD A;  1ZHH B;  4D60 A;  2ZMF A;  1GA9 A;  4DJ2 A;  3NI9 A;  1BLP A;  1OJ5 A;  3LI8 A;  5FQJ A;  5CEC A;  4RQ9 A;  5M18 A;  3OZH A;  4GD8 A;  4X69 A;  1GSW A;  2VZW A;  4O8G A;  4OQH A;  1Y54 A;  4E3O A;  4HY8 A;  2A24 B;  2A24 A;  2HPB A;  2XA7 S;  2I9V A;  3UPO A;  1FR1 A;  1OT9 A;  4HHD A;  2XSS A;  3KSH A;  3BY8 A;  2ZJ9 A;  3R4K A;  3L9K A;  4DXB A;  2Y55 A;  3UO9 A;  1IYS A;  2KOI A;  1H8M A;  2WAF A;  4OLD A;  1PWD A;  3D4F A;  4QU3 A;  3MXR A;  3F1N A;  1LT0 A;  2JE5 A;  1K4F A;  1VB6 A;  5E2G A;  5HAP A;  3ITB A;  1TF1 A;  3BW6 A;  2JKG A;  4WZ5 A;  5EVL A;  1S1Z A;  2R78 A;  1KDS A;  3MSH A;  1L0G A;  1IKI A;  4PKY G;  3HLD A;  3LEQ A;  4KZ4 A;  4GHI A;  3PAG A;  3PXP A;  4JGO A;  1P9R A;  5KZH A;  2J80 A;  4G3K A;  5J7E A;  4JGQ A;  2R9X A;  2P74 A;  3LUQ A;  4AFI A;  5DFY A;  4EBL A;  4CLC B;  4QWO A;  1Z09 A;  4CLC A;  2XLN A;  4OP5 A;  2ZQ8 A;  4HJ6 A;  3IS2 B;  5U47 A;  2Z2L B;  4KQR A;  3KX0 X;  1XX2 A;  2M1C A;  5EVI A;  3NJA A;  1O07 A;  1RGY A;  1K55 C;  2X01 A;  3ZG5 A;  5I94 A;  2ZOI A;  1IEL A;  3E2K A;  3Q07 A;  1DJC A;  1LI9 A;  5AQ7 A;  4FH2 A;  2HJE A;  1Y28 A;  2HV1 A;  4OKP A;  2KX6 A;  1KOU A;  2Y2G A;  4L9E A;  5HDS A;  3SH8 A;  1W8Q A;  2W27 A;  4GNU A;  4EU0 A;  5FEF A;  3N8S A;  3F1O B;  3T4K A;  3C2W A;  1N9O A;  3DTE A;  3V5M A;  3UB7 A;  4I3J A;  4DDS A;  2I72 A;  4JBF A;  1DRM A;  2Z6D A;  1KVL A;  2Q0O A;  5CHM A;  2W3H A;  3LEZ A;  4NEE D;  2G2U A;  1G28 A;  3VOZ A;  3BFG A;  4Q0I A;  5FL3 A;  1F2K A;  2VGJ A;  1OJG A;  2Y2K A;  5A91 A;  4PM6 A;  1YLT A;  3ZHH A;  3EOI A;  3MF0 A;  3FWL A;  4OON A;  2ZC7 A;  2B5R A;  3VOL A;  3LFV A;  4FOF A;  3P98 A;  5GHY A;  3IF6 C;  3GSG A;  5TBM B;  3IBJ A;  4X68 A;  3WRT A;  5TFQ A;  5TBM A;  1XGI A;  3VP1 A;  5EM0 A;  3P7N A;  2HDR A;  4ESP A;  3Q1F A;  4WM9 A;  1XXM A;  4Q8I A;  4IBR A;  4ARZ B;  1AXB A;  1TS8 A;  3KYQ A;  3RXW A;  4XUZ A;  1YSP A;  1E25 A;  3SH7 A;  1F9I A;  4UA9 A;  3QNC A;  4H6J B;  5L07 A;  3LIC A;  1T18 A;  3MKE A;  2B18 A;  3RFB A;  4BL2 A;  1L3L A;  2E8J A;  3VP4 A;  3W8K A;  2JKF A;  2FFF B;  3UDF A;  5CER A;  5HDC A;  5HL6 A;  3O87 A;  1WE4 A;  1PNE A;  3V50 A;  2XD1 A;  4KG5 A;  4UA7 A;  1XP4 A;  3IF5 A;  1K57 C;  3FKV A;  3IF6 B;  4FTX A;  4I3A A;  3KO6 A;  5AJG A;  3CHW P;  4OOY A;  1NZO A;  2ZC3 B;  4MCW A;  5HPF A;  3K3D A;  5GLC A;  1LL5 A;  3HJK A;  3BLM A;  3PYP A;  1GSV A;  2J3W A;  2GJ3 A;  2OAQ 1;  3S7P A;  4PM8 A;  1FSW A;  4XT2 B;  3HUN A;  2JCH A;  3HLE A;  1SDN A;  4XT2 A;  3QP1 A;  1KGF A;  1STZ A;  3DAV A;  1K54 C;  1MXO A;  3DWK A;  3IH9 A;  3R7W A;  2D02 A;  4DXC A;  4ZJ2 A;  1V9Z A;  1FCM A;  3ITA A;  3G30 A;  2W3E A;  3UDX A;  3JPU A;  4WZ4 A;  1Q2Q A;  3TOI A;  3DBA A;  3HLC A;  2OV5 A;  2Y8H A;  3PBT A;  2V1A A;  4BLM A;  1DJA A;  4Q0J A;  3CWF A;  5FQI A;  4JXG A;  2ACG A;  4R0Q A;  1G6O A;  5CGS A;  2BTF P;  5HWV A;  5HZH A;  3H7W A;  1WYC A;  1HLU P;  5GHX A;  3N4I A;  3RXX A;  2EXB A;  4BMW A;  4P85 A;  1FIK A;  3A3D A;  3M6H A;  1NLY A;  1Q2P A;  4DJ3 A;  4WEJ A;  2EX2 A;  2JN7 A;  4WBG A;  2V9A A;  3SS4 A;  1XA7 A;  5FQ9 A;  3MZD A;  4E6X A;  2Q9N A;  3TE8 A;  4H8R A;  1YLP A;  4RYE A;  4U0T A;  1K54 A;  4GKU A;  4Y15 A;  1GCE A;  1M6K A;  4EBN A;  2Y2O A;  4I39 A;  4R70 A;  2EX9 A;  2RL3 A;  1XJ3 A;  3BEC A;  3IXB A;  4HOI A;  1ZC2 A;  4S2N A;  3NDE A;  4RVA A;  5DKK A;  2L0W A;  5EFW A;  2IWD A;  1XJ4 A;  2Y2Q A;  2B95 A;  3MQQ A;  2PBY A;  2KDK A;  4WEK A;  1DP8 A;  3DW0 A;  1BT5 A;  1ALQ A;  4LEN A;  3CPT B;  2XFT A;  1JWV A;  3CPT A;  5MC7 A;  3QP6 A;  4UEY A;  3E4O A;  5BOH A;  1EI5 A;  4HP4 A;  3NDG A;  5F1G A;  4NXF A;  5FDH A;  1AWI A;  2XGN A;  4KZ5 A;  3HUM A;  3H82 B;  2ZMV A;  5TGF A;  4DDY A;  5JYO A;  4UA6 A;  2VKS A;  1GA0 A;  5L8M A;  1YM1 A;  4S2L A;  3E2L A;  5HWT A;  1KE3 A;  3LY3 A;  1VEU B;  2WUQ A;  5FAO A;  1S4R A;  4UAA A;  2PBD P;  2BG1 A;  4OVD A;  5C5K A;  4CPK A;  2WKE A;  4QJG A;  4MMN A;  5CGX A;  1HTZ A;  1BLC A;  5M1A A;  4QD4 A;  1PRQ A;  3KSI A;  2KLI A;  1S4S A;  3G34 A;  4NXE A;  3OCN A;  4WF0 A;  3FV7 A;  4BEN A;  1MKM A;  1MBL A;  1IEM A;  4K0X A;  3A3J A;  3V39 A;  3IXD A;  2ZQD A;  1H5X A;  3CUE C;  1VM1 A;  1ODV A;  2K31 A;  1C3B A;  2HZ5 A;  1XJ6 A;  3HL9 A;  2E8I A;  2QZ6 A;  4DN0 A;  4BJP A;  3MQO A;  3VP2 A;  1E3U A;  5CTM A;  3RH8 B;  3A0V A;  3B33 A;  5F68 A;  3HJI A;  3HLW A;  5AVF A;  4EEU A;  3CJM A;  4ZDX A;  1S67 L;  5FDS A;  2PDR A;  2QMI A;  2CMN A;  1RCJ A;  4G3V A;  5EPH A;  1FCO A;  3LR4 A;  5DTK A;  3ZG7 B;  2W0N A;  3UE0 A;  4GDN A;  1N9B A;  3LIB A;  4DE2 A;  2IA2 A;  4N92 A;  4GDB A;  4P6Z S;  1K38 A;  1JVJ A;  2PR5 A;  3GEC A;  5L09 A;  1KE0 A;  3ZQ5 A;  2K2N A;  4QHC A;  1RGZ A;  4LV3 A;  4A5R A;  2EWW A;  3A3I A;  3HBR A;  5CRF A;  1BYW A;  4JGR A;  2Y2J A;  3UNW A;  3WWX A;  3M2K A;  3T1X A;  2FZ0 A;  3VE3 A;  3SS3 A;  4WZ5 C;  3MR0 A;  2OLV A;  4M3K A;  3S1Y A;  4F94 A;  3HCY A;  2ZC5 B;  2VGL M;  1CI8 A;  4EW7 A;  4S2K A;  3BWL A;  3K3C A;  3BFC A;  2XR0 A;  2VK3 A;  4CLC C;  3ZG9 B;  3S7Q A;  4JGP A;  3HVF A;  1SZV A;  3Q82 A;  1D1J A;  2P04 A;  1FR6 A;  5EVI C;  3OC2 A;  2GNX A;  5L10 A;  1JNU A;  4B9O A;  1M40 A;  5HL1 A;  1PI4 A;  3LY4 A;  2H0T A;  2QHK A;  1OTD A;  5FAQ A;  4HBT A;  4X56 A;  3F1N B;  3T1R A;  4QY5 A;  2JKT I;  2V8C A;  4S2J A;  4Z9Q A;  3FPV A;  5F83 A;  3UPN A;  5DVA A;  4EUV A;  3BFF A;  3WS1 A;  4PHT A;  2JKR I;  2XA7 M;  4GHI B;  1OTB A;  4LV1 A;  1MWR A;  1ONG A;  4O0P A;  3FZC A;  1NYM A;  3EQV A;  1ES4 A;  5HAQ A;  1YAX A;  3PBS A;  2H5S A;  2NUT C;  3BM6 A;  2XD5 A;  3QP5 A;  2YKF A;  3JVU A;  4NET A;  3IXH A;  1NJ4 A;  3IX3 A;  1W63 Q;  1P9W A;  1TDL A;  2EFU A;  3BJN A;  5EVI B;  3IBR A;  4OP8 A;  1ZG6 A;  5GL9 A;  3E4Q A;  4HNB A;  4EES A;  5AQ9 A;  4NK3 A;  1PIO A;  2PT7 A;  4OOM A;  3V3S A;  1K0K A;  3UE6 A;  5J4E A;  2ZLY A;  1XGJ A;  3NEC A;  1P97 A;  2EWV A;  4S2I A;  3BFE A;  4EBP A;  3MFX A;  5DTT A;  2J3T D;  2DCF A;  4FCF A;  1VET B;  2XRN A;  4Y13 A;  2VLG A;  3D3O A;  4P87 A;  2WAD A;  4NXB A;  1VET A;  2W3G A;  2OWJ A;  3NHQ A;  5IHV A;  3C30 A;  4EER A;  4WMC D;  3ZCZ A;  4EQ1 A;  5CX7 A;  1QMF A;  5FEG A;  1OTE A;  2HDQ A;  4JLF A;  4OH0 A;  3Q81 A;  4LFU A;  4MBF A;  4YNR A;  5EV0 A;  3M6B A;  3K2N A;  2H0Y A;  2QYB A;  3KSG A;  2QWS A;  4N9K A;  3MBZ A;  3VSL A;  2MJ6 A;  1KGE A;  1W63 M;  3C38 A;  4OPQ A;  2OWH A;  2ZMA A;  2GDN A;  4R3B A;  3AGD A;  3BY9 A;  1YPR A;  4I5S A;  5KMW A;  5KSC A;  4KEN B;  3PHY A;  2H28 A;  4LPZ A;  1MWS A;  3UME A;  1OME A;  4Y2F A;  2OOL A;  4O01 A;  1I2S A;  3MQ0 A;  3W4O A;  4WEL A;  5CHJ A;  3AGF A;  4L9F A;  4S2M A;  3OPR A;  1DJB A;  3O88 A;  3TJZ C;  1YLJ A;  2HJ9 C;  3LIE A;  2JC7 A;  3QP8 A;  3OBF A;  1YMS A;  3VMA A;  2NUP C;  3UE1 A;  3T50 A;  1JWP A;  4R3A A;  4ZRR A;  3U2A A;  1T1A A;  2XRO A;  5G4Z A;  3P09 A;  1MPL A;  3L7H A;  1K4E A;  4HQA A;  3M2J A;  3ULF A;  4LCM A;  1TVF A;  1YLW A;  1T19 A;  3PBO A;  2LB9 A;  1D06 A;  1LSW A;  3T1S A;  3LID A;  2JKT M;  3GR2 A;  2WGW A;  2WZX A;  1ZG4 A;  1SHV A;  4R3J A;  5CXW A;  5HPI A;  3WS0 A;  2WK0 A;  1IKG A;  4X25 A;  5FQM A;  5HW3 A;  4WYY A;  2BLS A;  1L2S A;  2JKR M;  3R7W B;  1S66 L;  3ZNY A;  3CAX A;  2O0Y A;  1E3U D;  2ZQA A;  2V1B A;  1JTD A;  1PWC A;  5FI6 A;  4DE3 A;  4F3L B;  4HEF A;  3MJQ A;  4S2N C;  3FKW A;  4F3L A;  4NG2 A;  1N9N A;  4IUK A;  1D7E A;  3LR5 A;  3ZG0 A;  2OAP 1;  1LSX A;  3LR0 A;  5EOO A;  1F98 A;  4XXR A;  1GHI A;  3H7W B;  1FQG A;  3VP0 A;  4MN7 A;  1K25 A;  3SZT A;  1WYB A;  2PYR A;  1P0Z A;  3EQU A;  3HLF A;  4MEZ A;  4QY6 A;  4JXV A;  4PM5 A;  3UY6 A;  2G2W A;  5EEC A;  2BAS A;  3WRZ A;  1ERM A;  4GJ4 A;  3CI6 A;  1MWT A;  4KZA A;  2PD8 A;  2QPN A;  4C3Q A;  1S6R A;  3SOI A;  2ZC4 B;  4KQD A;  1PI5 A;  3O86 A;  3NOU C;  4Z1W A;  4K0W A;  2INW A;  2P7J A;  2ZC6 B;  2HDU A;  1H0M A;  4JXS A;  4WMC A;  2P08 A;  1YLZ A;  4OLG A;  4PKY A;  2G7U A;  2IWB A;  3C5A A;  1LSV A;  4ZJ1 A;  4IED A;  3G35 A;  1NRJ A;  5E2E A;  4X1L A;  3IX8 A;  1OPX A;  4E04 A;  4KQQ A;  4MBH A;  4ETZ A;  5AQB A;  1PW1 A;  2V0U A;  1YT4 A;  2C5W B;  1XFN A;  4LV2 A;  2Q9M A;  4EV4 A;  4LRZ E;  3TSG A;  1K6R A;  3KYZ A;  5TJJ A;  1W7F A;  4BD1 A;  4Y3I A;  5EUA A;  3BQ8 A;  5F6A A;  1BUE A;  2WKR A;  1FSY A;  5HAI A;  3HLB A;  5DJU A;  2D01 A;  3HLG A;  1PWG A;  1UWN X;  4UQI S;  5FI2 A;  4MLL A;  1ERQ A;  4DF6 A;  2XH9 A;  4KZ8 A;  1ESU A;  4OOL A;  5K5B A;  1TD5 A;  4FSF A;  3EEH A;  1KVM A;  2Y2P A;  3GTC A;  5GLA A;  1SDE A;  1XFQ A;  3OOV A;  2ZQC A;  3KSF A;  3T12 B;  3T4L A;  4FD8 A;  2ZOH A;  2ZM0 A;  2A49 A;  1KDW A;  4MN5 A;  1Z6F A;  4DE0 A;  4DE1 A;  3C4P A;  1IYP A;  4EQI A;  2L1M A;  4GB7 A;  3VSK A;  4X6T A;  2Y91 A;  3ZDJ A;  2O9B A;  4DKI A;  2ZQ7 A;  4K91 A; 
#chains in the Genus database with same CATH homology
 3T4T A;  3IBJ A;  2GNX A;  3OLO A;  4KQO A;  5TBM A;  1VHM A;  1ZTU A;  3EWK A;  1JNU A;  4B93 A;  4B9O A;  3E4P A;  4HI4 A;  3P7N A;  2QHK A;  1OTD A;  3F1N B;  5HD3 A;  4ARZ B;  3SW1 A;  3OCL A;  1TS8 A;  4GS9 A;  1F5M A;  2JKT I;  4GCZ A;  5KSH A;  3KYQ A;  3FPV A;  2W1T B;  1YSP A;  4EUV A;  2W1T A;  3ZYT A;  1F9I A;  4H6J B;  4PHT A;  3LIC A;  2JKR I;  2XA7 M;  4GHI B;  1LL8 A;  1OTB A;  1T18 A;  2B18 A;  4O0P A;  4Y5F A;  3EQV A;  3RFB A;  4BBU A;  4HJ4 A;  5IT5 A;  2VJW A;  4HP9 A;  3TW8 A;  4GW9 A;  5AVE A;  1YAX A;  3PBS A;  2NUT C;  5I5L A;  5HDC A;  5HL6 A;  2PD7 A;  2YKF A;  3JVU A;  3EEA A;  4IHQ A;  4KUO A;  4EEP A;  1W63 Q;  2JHE A;  1P9W A;  3BJN A;  3T4S A;  2HF6 A;  3IBR A;  5DFX A;  3D72 A;  2VA0 A;  4I3A A;  3KO6 A;  4MDZ A;  5KIZ A;  3E4Q A;  4G3W A;  4HNB A;  3S7N A;  4EES A;  4EET B;  5AJG A;  3UE3 A;  2PT7 A;  4OOM A;  2O9A A;  4L9G A;  4MCW A;  3UE6 A;  2HGV A;  5HPF A;  5A8B A;  5J4E A;  1YSQ A;  4CLC E;  5DKL A;  3K3D A;  1P97 A;  3HJK A;  3EGX C;  3ICY A;  2EWV A;  4EXO A;  3PYP A;  1GSV A;  1TS6 A;  1WA9 A;  2J3W A;  2GJ3 A;  2OAQ 1;  3S7P A;  3MFX A;  4NKP A;  3PBQ A;  4HH2 A;  4XT2 B;  2J3T D;  3GDI A;  4LRX C;  4I38 A;  3G6O A;  2XRN A;  2VLG A;  3D3O A;  4XT2 A;  1NWZ A;  4HJ3 A;  4NXB A;  3V67 A;  1N9L A;  1STZ A;  2GX5 A;  2OWJ A;  2W3G A;  3NHQ A;  4DMZ A;  2W3F A;  3C30 A;  3E98 A;  4EER A;  3R7W A;  2D02 A;  1TS0 A;  2V0W A;  3H82 A;  1XJ2 A;  3A0S A;  4EQ1 A;  1V9Z A;  5HD5 A;  4P6Z M;  2W3E A;  5CX7 A;  5IU1 A;  1X0O A;  1EW0 A;  3RTY A;  1OTE A;  3DBA A;  2Y8H A;  3PBR A;  4YNR A;  3PBT A;  4WLA A;  2V1A A;  4CLC D;  2A2L A;  4WN5 A;  3TRC A;  4Q0J A;  3K2N A;  1NLZ A;  3CWF A;  2QYB A;  3KSG A;  3LYX A;  2QWS A;  4UQI M;  1G6O A;  4BWI A;  5HWV A;  5HZH A;  2MJ6 A;  4IUH A;  3H7W A;  1W63 M;  3C38 A;  3EGD C;  2LB5 A;  3T4Q A;  2M7U A;  2OWH A;  1IFQ A;  4WL9 A;  2VX8 A;  3BY9 A;  2QJ5 A;  4HIA A;  4BMW A;  3O5Y A;  4I5S A;  4GS9 B;  1NLY A;  5HSQ A;  3PHY A;  4DJ3 A;  2H28 A;  4LPZ A;  4WEJ A;  2JN7 A;  2V9A A;  3UME A;  4Y2F A;  3C8C A;  2OOL A;  4O01 A;  3UB8 A;  3TE8 A;  3LIF A;  3MQ0 A;  4NXG A;  5DJT A;  5G4Y A;  4YWZ A;  4HH3 A;  4WEL A;  1UWP X;  5HWW A;  2VV6 A;  4L9F A;  2QJ7 A;  5IS1 A;  3TJZ C;  2HJ9 C;  3LIE A;  4R6L A;  4I39 A;  4R70 A;  3UMD A;  1XJ3 A;  3UB9 A;  3W2Z A;  4HOI A;  3MMH A;  4GLQ A;  2DMW A;  3OBF A;  4IJG A;  5DKK A;  2L0W A;  5EFW A;  1UGU A;  5F5Y A;  2NUP C;  2L4R A;  3T50 A;  1XJ4 A;  4R3A A;  4ZRR A;  1OT6 A;  3U2A A;  1T1A A;  2XRO A;  3CIT A;  2VEA A;  5G4Z A;  3MQQ A;  2EA9 A;  4WUJ A;  2PHY A;  4K08 A;  2KDK A;  4WEK A;  4HQA A;  3PR6 A;  1DP8 A;  3ULF A;  2K7S A;  1T19 A;  2B02 A;  3T4O A;  3PBO A;  2LB9 A;  2YKH A;  1D06 A;  5LBR A;  2WKQ A;  4QPR A;  1LSW A;  3LID A;  3IS2 A;  3LR3 A;  5MC7 A;  2JKT M;  4II7 A;  4UEY A;  3E4O A;  4R38 A;  2VGL S;  5F69 A;  1S1Y A;  5HPI A;  4ME4 A;  4HP4 A;  3F1P B;  4NXF A;  3F1P A;  3H9W A;  4ETX A;  2JKR M;  3R7W B;  3A0R A;  1S66 L;  2Y79 A;  3JVV A;  3VV4 A;  3H82 B;  2ZMV A;  3CAX A;  2O0Y A;  3CUE A;  2VV7 A;  2GZA A;  2W1R A;  2VKS A;  3B42 A;  2V1B A;  1H3Q A;  5L8M A;  4F3L B;  2VV8 A;  3MJQ A;  3F1O A;  5HWT A;  4F3L A;  2PR6 A;  1N9N A;  1S4R A;  3MXQ A;  4IUK A;  1D7E A;  3LR5 A;  3NOP C;  2OAP 1;  1LSX A;  3LR0 A;  1MC0 A;  1TS7 A;  3FC7 A;  1YKD A;  1ZHH B;  1F98 A;  2ZMF A;  5C5K A;  4DJ2 A;  1OJ5 A;  3LI8 A;  3H7W B;  4I3I A;  4MMN A;  2O9C A;  4RQ9 A;  4MN7 A;  2Z6C A;  1GSW A;  1DP6 A;  2VZW A;  3KSI A;  2KLI A;  4BBT A;  4O8G A;  2PYR A;  1S4S A;  1P0Z A;  4NXE A;  4HY8 A;  3EQU A;  3OCN A;  1DP9 A;  2A24 B;  4WF0 A;  2A24 A;  4LLO B;  3LIA A;  2XA7 S;  2BAS A;  4GJ4 A;  1MKM A;  2I9V A;  3CI6 A;  1OT9 A;  2PD8 A;  4HHD A;  2XSS A;  3KSH A;  3BY8 A;  3R4K A;  2ZBB A;  5HDD A;  2KOI A;  3FG8 A;  4PAU A;  1H8M A;  4KQD A;  3CUE C;  3VE4 A;  3NOU C;  1ODV A;  4Z1W A;  2K31 A;  3F1N A;  4ARZ A;  1LT0 A;  2INW A;  1XJ6 A;  2P7J A;  1VB6 A;  2O99 A;  1TF1 A;  3BW6 A;  4Q0H A;  4DN0 A;  1S1Z A;  4BJP A;  3MQO A;  2R78 A;  4BBV A;  3S7O A;  3PBN A;  4H6J A;  4PKY G;  2P08 A;  3LI9 A;  3CLO A;  4PKY A;  4GHI A;  2G7U A;  3P01 A;  3PXP A;  3A0V A;  3B47 A;  3B33 A;  3RH8 B;  4JGO A;  1P9R A;  5F68 A;  2J80 A;  3HJI A;  4G3K A;  5AVF A;  4EEU A;  4KUK A;  1LSV A;  5J7E A;  4JGQ A;  1S67 L;  3LUQ A;  4AFI A;  5DFY A;  1NRJ A;  2PDR A;  1OTA A;  4CLC B;  2CMN A;  4G3V A;  1MZU A;  3T4J A;  2QKP A;  4CLC A;  1OPX A;  4E04 A;  3LR4 A;  4HJ6 A;  1T1B A;  4CQH A;  3IS2 B;  2W0N A;  4L0L A;  3KX0 X;  4ETZ A;  3BQA A;  2M1C A;  3LIB A;  2V0U A;  3NJA A;  2IA2 A;  2FH5 A;  1XFN A;  4M4X A;  2ZOI A;  4P6Z S;  4LRZ E;  1V9Y A;  3KYZ A;  2PR5 A;  5TJJ A;  3GEC A;  1OTI A;  4Y3I A;  2W3D A;  2HJE A;  3ZQ5 A;  1Y28 A;  2K2N A;  3BQ8 A;  2HV1 A;  2PYP A;  5F6A A;  2KX6 A;  1KOU A;  5J3W A;  4L9E A;  5HDS A;  2WKR A;  3E0Y A;  2J3T C;  2EWW A;  2W27 A;  4EU0 A;  1BYW A;  4JGR A;  5DJU A;  3FPW A;  2D01 A;  3F1O B;  3T4K A;  3C2W A;  1N9O A;  1UWN X;  2FZ0 A;  4UQI S;  3VE3 A;  3UB7 A;  4I3J A;  1T1C A;  4MN6 A;  3MR0 A;  1IOU A;  1DRM A;  2Z6D A;  4OOL A;  5K5B A;  1TD5 A;  4LRY C;  4FSF A;  3EEH A;  3HCY A;  2W3H A;  4NEE D;  3NOT C;  1XFQ A;  1G28 A;  2VGL M;  5DF9 A;  4EW7 A;  3BWL A;  4Q0I A;  2M7V A;  3OOV A;  5FL3 A;  3KSF A;  3K3C A;  1OJG A;  3T4L A;  2ZOH A;  4MN5 A;  1GSX A;  3EOI A;  4CLC C;  2WKP A;  3UB6 A;  3S7Q A;  4JGP A;  3MF0 A;  4YOF A;  2L1M A;  2P04 A;  3VOL A;  2O9B A;  3OC2 A;  3LFV A;  4FOF A;  5TBM B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...