5J4EA

Crystal structures reveal signaling states of a short blue light photoreceptor protein ppsb1-lov (photoexcited state)
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
133
structure length
133
Chain Sequence
MINAQLLQSMVDASNDGIVVAEKEGDDTILIYVNAAFEYLTGYSRDEILYQDCRFLQGDDRDQLGRARIRKAMAEGRPCREVLRNYRKDGSAFWNELSITPVKSDFDQRTYFIGIQKDVSRQVELERELAELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sensory box protein
publication title Signaling States of a Short Blue-Light Photoreceptor Protein PpSB1-LOV Revealed from Crystal Structures and Solution NMR Spectroscopy.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Signaling protein
total genus 35
structure length 133
sequence length 133
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 5j4eA00
3P7NA 3NOPC 1X0OA 1OT9A 4F3LA 2D02A 5A8BA 2WKRA 4HOIA 3B33A 2QJ7A 5HD5A 4HJ6A 1MZUA 3F1PB 4PKYG 3MR0A 1V9YA 2PHYA 2A24B 5AVEA 3KX0X 1T19A 4HH3A 4EERA 2YKFA 4L9GA 3LIAA 1XJ6A 1OTAA 1GSVA 5J4EA 1KOUA 4KUKA 3A0VA 5HWVA 2QKPA 5HWTA 5G4ZA 2B02A 5DKKA 3E4PA 4HIAA 3VOLA 4JGQA 1OJGA 2V1AA 4HP9A 3ULFA 3HJIA 1WA9A 3EEHA 5TBMA 3D72A 4HJ3A 2WKPA 4EW7A 3LICA 4NXGA 2INWA 4R38A 3K3DA 2J80A 3UE6A 2I9VA 1DRMA 1T1AA 3F1NB 3CWFA 2PR5A 1LT0A 1OJ5A 4YWZA 1EW0A 4GS9B 2V9AA 2QHKA 1TS6A 5F68A 3VE3A 4WF0A 3GDIA 3F1OB 2L0WA 2EA9A 4HJ4A 4NXBA 3VE4A 2WKQA 2W0NA 4LLOB 3IBRA 1S66L 2VV6A 1TS7A 3H82B 4LRZE 4H6JA 4XT2B 1T18A 2PYPA 3OLOA 2H28A 3LUQA 3G6OA 1S67L 4HHDA 3NOTC 2L4RA 2JHEA 1UWPX 2QWSA 1S1ZA 4E04A 2CMNA 1S4SA 1TS0A 1N9NA 4WUJA 2PD7A 5J3WA 3CLOA 3A0RA 1G28A 5J7EA 5HDSA 5F69A 4K08A 4HNBA 4R3AA 4L9FA 1VB6A 1BYWA 4I3IA 4M4XA 2PYRA 1JNUA 5EFWA 3FC7A 5DJTA 3LIDA 1P97A 3ZQ5A 4I3AA 3UB9A 5TBMB 4R70A 5G4YA 1XFNA 2Z6DA 3UB8A 4R6LA 1LSVA 2QJ5A 3MXQA 3BY9A 1XFQA 1ODVA 1N9OA 3LIEA 4JGPA 3NHQA 3IS2A 4EESA 2V0WA 3H7WA 2PR6A 3UMDA 1OTDA 2YKHA 5HDCA 4WN5A 1F98A 4B9OA 3SW1A 3CAXA 4JGOA 2V1BA 4NXFA 1DP6A 2W27A 2V0UA 3RTYA 1OTIA 1OTBA 1DP9A 4EEPA 2D01A 1UWNX 1GSWA 4GHIA 4HP4A 3ICYA 3MQQA 3UB7A 3UB6A 4HY8A 2Z6CA 4F3LB 1GSXA 4H6JB 4DJ3A 2L1MA 3A0SA 5I5LA 1D06A 3FG8A 4I39A 2OWJA 3PYPA 3F1PA 1Y28A 2K7SA 4HQAA 1T1BA 5F5YA 5IU1A 2A24A 5F6AA 5HWWA 4LPZA 1LSXA 2ZOHA 4GCZA 4EEUA 1F9IA 2P7JA 5AVFA 3E4OA 3LIFA 4DJ2A 4PKYA 5KIZA 1XJ3A 2ZBBA 4KUOA 4BBVA 3UMEA 4GW9A 1S4RA 4EXOA 3H9WA 3K3CA 2M1CA 3MQOA 2GJ3A 3GECA 3LYXA 4I38A 4WLAA 2BASA 2VV8A 3C8CA 3MFXA 3T50A 4HI4A 2OWHA 2JN7A 2ZOIA 3LI8A 5HSQA 4WL9A 4EETB 3NJAA 3PHYA 1N9LA 1XJ2A 4KQDA 2PDRA 2PD8A 4BBUA 3F1NA 2KX6A 1D7EA 3IS2B 5DJUA 4RQ9A 3H7WB 5HD3A 3NOUC 2KDKA 3BWLA 2R78A 4GS9A 4EQ1A 4MN6A 3RH8B 1LL8A 1LSWA 1TS8A 4I3JA 4I5SA 5HDDA 1OT6A 5DKLA 5HZHA 3LIBA 4L9EA 3C2WA 5IS1A 1T1CA 1NWZA 3F1OA 1S1YA 1P0ZA 4BBTA 2VV7A 4HH2A 3LI9A 2VLGA 4LRXC 4NXEA 3EWKA 1DP8A 4JGRA 3E4QA 1V9ZA 4GHIB 2OOLA 3BY8A 2HV1A 4LRYC 1UGUA 4MN5A 1OTEA 3H82A 1XJ4A 4XT2A 3MJQA 3HJKA 2VEAA
chains in the Genus database with same CATH superfamily
3QP5A 1OT9A 3NDGA 4JXSA 2WKRA 2V8FA 1FR6A 3B33A 1F2KA 2QJ7A 3IH9A 2WK0A 4Q8IA 3BFGA 1K55C 5TFQA 4Y0UA 3VFFA 3ZG5A 4RX3A 4GKUA 4HJ6A 4PM9A 1MZUA 3T4TA 3WS5A 1GHPA 3F1PB 2OSUA 3MR0A 2R9WA 2ZMAA 2EX2A 1RGYA 3QP6A 5AVEA 3UE1A 4GLQA 4HH3A 2YKFA 4BWIA 4DE2A 2VJWA 3UY6A 3T1SA 3MXSA 5AQ7A 1W8YA 1W5DA 2VA0A 1GA0A 3S7OA 1YQSA 4PM6A 1PWGA 2XEPA 5G4ZA 1M40A 4KG6A 3BFCA 4KQOA 5A91A 2XRNA 1FQGA 1KDSA 3VOLA 3RXWA 3ULFA 4A5RA 3VOYA 3ZGAB 2Y2LA 2J8YA 2JKTM 3R4KA 3PXPA 3D72A 2OAQ1 4ZDXA 3T12B 1G68A 3IXGA 4EW7A 4OPZA 1O7EA 4LCMA 2ZQDA 4KZ5A 4EU0A 3VP4A 4G3WA 4DE1A 4QY5A 5FQIA 4ESPA 4JF5A 2JKRM 3JVVA 3P98A 3N8LA 4O8GA 1JTGA 5AQBA 4OP8A 2GZAA 3W4PA 3F1NB 2B95A 3IWQA 3CWFA 1L2SA 1KGGA 3JPUA 1MKIA 3FPWA 2KLIA 3UNWA 4UA9A 3HREA 3HVFA 2ZQ8A 3QHYA 1ALQA 4WF0A 4QHCA 3GDIA 3LGOA 3F1OB 2L0WA 2EA9A 1EWZA 4R23A 3CMZA 4HJ4A 2P9VA 1KE3A 3O88A 2J3TC 4Y0OA 1O07A 3ZCZA 3IBRA 1S66L 1PYYA 4H6JA 1WE4A 3IWIA 3NY4A 1K57C 1P9WA 4BQMA 1GCEA 2ZQ9A 3IWOA 4Q0JA 1CK3A 5CHJA 1PW1A 1FCNA 4KQRA 3NOTC 5CEDA 1NJ4A 2A3UA 5DTTA 1FIKA 1W63Q 2JHEA 3D3OA 3ITBA 2QWSA 3O5YA 2RL3A 4PHTA 1KE4A 4R3JA 3ZG8B 3DW0A 4RVAA 3A0RA 1G28A 4U3TA 4Q0HA 1XP4A 5F69A 4K08A 1DJAA 2Y79A 3IQAA 4WEJA 5TJJA 4R3AA 5CHUA 4L9FA 3HLEA 1XPBA 5LBRA 3ZG7B 4D60A 4CJNA 4CLCB 1HD8A 4UA6A 3FC7A 4CLCC 1NLYA 2Y2QA 4KZ3A 4KZ6A 3LIDA 2Q9MA 5TBMB 4II7A 3UB8A 2QJ5A 3E2KA 1W8QA 2EX6A 5FEGA 4JF6A 2C6WB 3NHQA 4IEDA 4BLMA 5CEBA 4S2JA 3PBNA 2V0WA 1G6AA 2O9BA 3TW8A 1OTDA 5HDCA 5CTMA 1S0WA 5GHZA 1PIOA 4Z1WA 3SW1A 4C75A 1VM1A 5CGXA 1CI9A 2E8IA 3VSLA 2W27A 2V0UA 3G2ZA 4S2MA 2BTFP 4MBHA 1OTIA 3T4SA 3MZEA 3L7HA 1DP9A 4RA7A 2PT7A 3IH8A 1ERMA 5E2EA 3ZYTA 2J7VA 4KZAA 1PI5A 3ICYA 5FAOA 1D1JA 1I5QA 4DDSA 5FSRA 5GLAA 1K56A 1K55A 3W2ZA 4NKPA 1WYBA 3G35A 2H0TA 3A0SA 4N9LA 2ZD8A 1PNEA 1D06A 4WYYA 3OZHA 3F1PA 4X1MA 3SH8A 2P74A 5GHYA 4EBLA 1SDNA 2G2WA 4OPYA 4YNRA 5HWWA 1LSXA 5FL3A 3VMAA 3WRZA 2WGIA 4GDNA 3LFVA 4KZ9A 1LL5A 3LEZA 2P08A 2J9PA 4P6ZS 5DVAA 2GNXA 1K6RA 1BLPA 3UMEA 2O9CA 3KYZA 1YLPA 2HZ5A 1JWZA 2EX9A 5IT5A 4FOFA 4I38A 4N1HA 4KG2A 1PW8A 1I2SA 2ZMVA 4E3LA 3HLCA 2EFXA 3MFXA 2OWHA 4WL9A 4EETB 3NJAA 3GV9A 3S22A 4WEKA 1YMXA 3PTEA 2PDRA 3GRJA 1I2WA 3CPTB 3F1NA 5FQKA 3R7WB 1OMEA 4EQIA 5EPHA 3H7WB 1SKFA 5HD3A 3OPLA 4EQ1A 1E4DA 1LLBA 4OPRA 4P87A 5DKLA 2W3GA 5HZHA 4L9EA 3C2WA 5IS1A 3CI6A 3V5MA 5DTKA 3F1OA 3MKEA 3PBTA 3EWKA 3WS0A 1MY8A 1LL9A 1V9ZA 5EV0A 2ZLYA 4GHIB 4S2LA 1K57A 4MN5A 1K0KA 3SH9A 4E3NA 3NOPC 2Y59A 4KZBA 1FCMA 4F3LA 1NLZA 2D02A 5A8BA 4ETZA 4X1LA 3B3XA 3A3JA 1MWSA 1BLHA 1H8MA 1K4FA 4PKYG 4B4XA 4O01A 1V9YA 3E0YA 5FDHA 1YSQA 2PHYA 2A24B 3KX0X 1T19A 3UDXA 1MWRA 3LIAA 4JPMA 1XJ6A 1OTAA 1GSVA 4QJGA 3S7QA 1KOUA 4OLGA 4LCLA 3V39A 4OQ0A 5HWTA 4CLCA 2LB5A 4WBGA 1RGZA 1YLTA 4HIAA 1CJFA 2XROA 4S2NC 2ZL1B 3IF6B 2ZJ9A 1WA9A 4K0XA 5TBMA 4YINA 1IFQA 1YMSA 3T1QB 4IHQA 1K6SA 2WKPA 3B47A 3IF6C 3LICA 3UE3A 1FR1A 3C30A 4R38A 3K3DA 2I9VA 3GQZA 2Y2KA 4LGWA 1SKOA 4ZRRA 1T1AA 1ZHHB 2XH9A 1OJ5A 3C4PA 2ZM8A 5KMWA 3O86A 1EW0A 5CTNA 3ZNYA 4GS9B 4MN7A 2V9AA 4OH0A 2VGKA 3UB5P 2ZC4B 1YAXA 4PM5A 4ID4A 2IWBA 4DDYA 1ZC2A 1ONHA 4JXWA 4R4RA 3U2AA 1YLZA 4E3MA 4ZJ2A 4Y17A 3G32A 3VE4A 3N7WA 5EVIB 3NULA 5FQJA 3MZFA 2VV6A 4LRZE 5EVIC 3LY3A 2IA2A 4XT2B 1T18A 4DRTA 5HW3A 5E2GA 4GZBA 3KSGA 1JTDA 5CERA 2HP6A 2XLNA 4MBFA 3CITA 1UWPX 5FAQA 1DJBA 3A3FA 4IUHA 2CMNA 3QP8A 4OQHA 1TS0A 4E3OA 3M2JA 2VX8A 2V1ZA 4NK3A 3LCEA 3CLOA 5L2FA 5DF7A 4EWFA 2HDSA 4Y3IA 2XD5A 3MS6A 2JE5A 1VB6A 4EUVA 3O87A 4R1GA 4OPQA 2X01A 4OQIA 2PYRA 1JNUA 3QP2A 5FI7A 3ZVWA 3LR3A 1VEUB 5DJTA 2WZXA 1XXMA 3ZQ5A 4FH4A 3WWXA 3M2KA 4B4ZA 2J3WA 4EUZA 5BOHA 3UN7A 2PRFA 3MXQA 1XA7A 2Y2JA 5FAPA 2M7UA 1XFQA 3IX3A 1ODVA 1E25A 1NZUA 2VGJA 3JVUA 3CPTA 4RYEA 3LIEA 3R7WA 3HLFA 4GDBA 3IXHA 3TRCA 1BULA 3UPNA 3H7WA 1FCOA 3UMDA 3O3VA 4KZ7A 5IHVA 1XGIA 2YKHA 3BLSA 4WN5A 2Y91A 4JXVA 3OBFA 2VGLS 4JLFA 1L0EA 1ZG6A 3MBZA 1TVFA 3S4XA 4RX2A 3CHWP 4ZBEA 3P01A 3Q07A 3Q1FA 4U0TA 3A3EA 1HTZA 3NECA 2Z2LB 4OOYA 4BMWA 5F1GA 4MBKA 4Y13A 5EVEA 1KVLA 5G18A 1GSWA 4JXGA 4GHIA 2B5RA 3NCKA 3CUEC 3MQQA 4IUKA 3BJNA 1K56D 1OPXA 3HUNA 5M18A 4F3LB 2UWXA 4DJ3A 3LR4A 3VSKA 4EBPA 3FG8A 3HUOA 3IBJA 4HBUA 1Y28A 3BW6A 3EGDC 1NYYA 4G3VA 5IU1A 2IWDA 2A24A 4WMCA 3HUMA 4LPZA 4R3BA 2O9AA 2ZOHA 4Y15A 2ZC5B 2P7JA 4PM7A 3E4OA 3B42A 2FFFB 5EECA 4XUXA 1ES4A 2FFYA 5FQQA 1RCJA 4DXBA 4S2NA 5KIZA 1XJ3A 5D3OA 2ZMFA 1PWDA 1W79A 5L10A 5K5BA 3C4OA 1S4RA 2ZL1A 4Q0IA 2V8CA 2M1CA 3IF6A 5AQ9A 4E6WA 2HPBA 3TE8A 2XGNA 4X6TA 2HP9A 3C8CA 5CECA 3VFHA 3SS5A 3BLMA 2JKFA 4P6ZM 3WS4A 1SZVA 4QY6A 3AGEA 1KGFA 1XGJA 3QNCA 1SKOB 4ZTKA 1N9LA 2ACGA 2PD8A 2QMIA 2W1RA 1D7EA 1M6KA 1PZOA 4S2PA 3PR6A 1ACFA 4PM8A 1J9MA 2A49A 1BSGA 2R78A 4GS9A 4C3QA 1QMEA 1LL8A 1TS8A 3OC2A 2PU2A 3A3DA 3HLGA 2NUPC 2O99A 1NWZA 2Y2HA 3DTIA 4FSFA 2OLUA 3IF5A 3LI9A 2VLGA 3DWKA 4LRXC 2WGWB 4KG5A 5EVIA 3CZDA 2WGVA 1VHMA 1Y54A 3N4IA 4M3KA 3MXRA 4XT2A 2ZC3B 1CQAA 3P7NA 1Y4OA 4N1XA 3Q81A 4HOIA 1ZG4A 4DXCA 1SCWA 1NZOA 5FI6A 5M19A 2Y2GA 5HD5A 4X56A 1ERQA 3CJMA 3MSHA 3S7NA 4OKPA 1MXOA 5HL1A 4ARZB 3BYDA 5GHXA 2WKHA 5I94A 4EERA 3SS4A 4ZJ1A 1F5MA 1Q2PA 3T4OA 4N92A 2ZM2A 5HWVA 3UPPA 3BQAA 4CLCD 2ZQCA 5A92A 2QKPA 3EQUA 4OONA 2ZM0A 2XD1A 1DY6A 1FSYA 4LV1A 2B02A 2WAEA 5DKKA 4BD1A 1VEUA 4XXRA 1SHVA 4LV2A 1IEMA 4CLCE 1H3QA 2OV5A 4JGQA 4QD4A 5FDSA 2V1AA 1K38A 4HP9A 2Y2PA 3HJIA 3EEHA 3DAVA 4HJ3A 1H8ZA 4OOLA 4QWOA 4U0XA 5MC7A 5DFYA 4NETA 2WZZA 1ES2A 5EOOA 1TF1A 4NXGA 2INWA 2W3DA 3BFFA 3UPOA 3UE6A 4MLLA 3IHBA 1JWPA 4UEYA 3TG9A 1MC0A 4IVKA 1G5UA 1RP5A 2PR5A 1LT0A 4X55A 2RCXA 5FA7A 3PBOA 1YM1A 2HJEA 4GNUA 4LV0A 3T1XA 1NYMA 2QPNA 2Y2IA 1FOFA 2VKSA 2QHKA 2E8JA 3UDFA 5HFOA 5FI2A 4X69A 5F68A 2G2UA 3VE3A 1IOUA 4P85A 3CUEA 4XUZA 4HEFA 5EE8A 1ONGA 2Y2OA 2WKQA 2W0NA 3PBQA 2EX8A 4HBTA 1KGEA 1S6RA 1YLJA 4OLDA 3QP1A 1TS7A 3H82B 1H0MA 5FASA 2PYPA 2H28A 1JWVA 3LUQA 3SOIA 4O7DA 2ZC6B 3BEBA 1IYQA 1ES5A 4DF6A 4NG2A 3KSFA 4HHDA 1YLYA 1ESUA 1E3UA 1L0DA 2VK3A 2L4RA 4PPRA 1IYPA 4E04A 5TR7A 4WZ5C 1S4SA 1N9NA 5GL9A 1GA9A 5E43A 3ZNTA 5J3WA 5A90A 4HESA 4KQQA 2WAFA 4N9KA 5DF9A 3VP1A 4MNRA 4ME4A 2EFUA 2H10A 2DNSA 4I3IA 2PBDP 5E2FA 4YOFA 3FWLA 4GN2A 2W3EA 1K54C 4GJ4A 1BLSA 4CQHA 3ZHHA 3IHAA 2XA7S 3VP0A 4I3AA 4OQGA 3UB9A 5FQMA 4R4SA 5EUAA 4Y5FA 2Z6DA 3RXXA 1NRFA 4R6LA 3P09A 3KSHA 3ITAA 3HLBA 3BY9A 3W4QA 3VOZA 3MF0A 1BT5A 1N9OA 2HDUA 3MMHA 3IX8A 3V50A 3RFBA 3HCYA 1EROA 2HF6A 2PR6A 1XA1A 4F94A 1IELA 1VETB 3ISGA 4X68A 3ZFZA 4IVIA 1LI9A 4S2IA 3S7PA 3LR5A 2LB9A 1Z09A 1F98A 3E2LA 2V1BA 1IKGA 4NXFA 1DP6A 3LY4A 2MJ6A 3OPPA 3OCLA 3RTYA 3MFDA 2W1TB 3RJUA 1OTBA 3EEAA 2EWWA 4EEPA 2D01A 2WGWA 1UWNX 3C7UA 4O0PA 4P6BA 5J8XA 2XK1A 1PRQA 1W63M 4EBNA 4GD8A 2VGLM 4FCFA 3C5AA 2DMWA 1NY0A 3KYEA 1Q2QA 2Z6CA 5FATA 1N9BA 3KO6A 3LR0A 2KOIA 3FV7A 5I5LA 4I39A 4PMAA 4OVDA 2XF3A 5EM0A 3PYPA 2NUTC 1TDGA 2WUQA 4BL3A 2K7SA 4HQAA 3BECA 4WMCD 4ARZA 1N4OA 1T1BA 3D4FA 5FQ9A 2ZQAA 3PAGA 1IKIA 4OOMA 3G30A 4QPRA 3WS2A 3SZTA 2JCHA 4EEUA 1TD5A 5DF8A 3BFDA 5AVFA 3LIFA 3HBRA 4JF4A 1C3BA 2X71A 4DJ2A 4PKYA 3GTCA 4JBFA 5FEFA 3IT9A 4UQIS 4KUOA 4BBVA 4K91A 2Y2MA 1LI0A 4NEED 4E3KA 4EXOA 3K3CA 3LO7A 3Q82A 3MQOA 4MMNA 2B18A 3GECA 3LYXA 4WLAA 4BENA 5L09A 2CC1A 3E98A 2BASA 5F1FA 3EQVA 4DKIA 3T50A 4QB8A 1H5XA 4HI4A 2H0YA 2JC7A 1IYSA 4DE0A 5HAQA 2ZOIA 3LI8A 5GLCA 2QZ6A 2X02A 4LENA 2Y2NA 3GMWA 3PHYA 4S2OA 2PU4A 4KQDA 3D9YA 4BBUA 4QU3A 3AGDA 3IS2B 3UDIA 5DJUA 4DMZA 5EM1A 1HZOA 2KDKA 3BWLA 1W7FA 3T1RA 4MN6A 2A2LA 4I5SA 5HDDA 1OT6A 2OAP1 4E3JA 2FH5A 1T1CA 2WKIA 1S1YA 1P0ZA 1L0GA 2VV7A 1MPLA 5EVID 1A0KA 1XKZA 5AQAA 4NXEA 3NDEA 3W8KA 5L07A 1YT4A 2OOLA 3BY8A 4H8RA 1NXYA 2J9OA 3C7VA 1G6OA 2HDRA 2Y8HA 1OTEA 3H82A 5E2HA 2I72A 1MWUA 1Z6FA 5KSHA 3T4QA 3MJQA 3HJKA 2Q9NA 3ZDJA 1X0OA 2FZ0A 2HP5A 4FD8A 1K25A 2XR0A 2WKEA 4Y0TA 1PI4A 5CHMA 4WZ5A 3G2YA 2O0YA 1TEMA 3BRMA 3GR2A 4BL2A 2GDNA 3EGXC 2W3HA 2V20A 1ESIA 3EOIA 3MZDA 4Y2FA 4L9GA 3G31A 3HLDA 3DWZA 2W3FA 4KZ4A 4UA7A 1K54A 4IBXA 5J4EA 4KUKA 3A0VA 3KYQA 4ETXA 1ZTUA 5M1AA 5CRFA 4E6XA 2K2NA 1J3WA 3E4PA 3PAEA 1K4EA 3BFEA 3GVBA 4X53A 1OJGA 1L0FA 1BZAA 2M7VA 3FPVA 4GD6A 1KE0A 3Q7VB 1KVMA 1YLWA 4MCWA 1VQQA 3BM6A 3S1YA 3G4PA 3NC8A 3OPRA 5L8MA 3AGFA 1HLUP 3MQ0A 1CEFA 1FILA 2J80A 1YSPA 4ZAMA 4LFUA 1DRMA 3VV4A 1PFLA 2JBFA 4B88A 1PZPA 2PAVP 1VETA 4LV3A 2WADA 5DFXA 4K0WA 4DN0A 4YWZA 5GLBA 3WS1A 2J3TD 1SDEA 1JVJA 4WM9A 2GX5A 1TS6A 2W1TA 3C38A 2XQZA 1LHYA 3N8SA 1NRJA 3IXDA 5AJGA 3OPHA 2HGVA 3CG5A 3ZVTA 1GHMA 1STZA 4X25A 3UO9A 4NXBA 5F83A 4UHUA 4LLOB 4GOGA 2Z2MB 5JYOA 4MEZA 4GB7A 2BLSA 5C5KA 2K31A 3OLOA 1MBLA 2XDMA 4KENB 1P9RA 5JYPA 4D2OA 3G6OA 1E3UD 1S67L 5HAIA 2OLVA 1QMFA 5KZHA 4P0MA 4JKTA 1ZKJA 3VP2A 1S1ZA 4WUJA 3TOIA 5DTSA 2PD7A 5A93A 2AVXA 1YKDA 5J7EA 1XX2A 1MWTA 5HDSA 2BG1A 2EXAA 4ZJ3A 4HNBA 3M6BA 1BTLA 2Y4AA 1BYWA 4M4XA 3HLWA 5CX7A 1EI5A 1KDWA 5EFWA 1MKMA 4OP5A 1P97A 4BD0A 3VP3A 1CF0A 4R70A 5G4YA 4G3KA 5HX9A 1XFNA 1YPRA 1LSVA 3NI9A 3NBLA 3IX4A 2P04A 2UV0E 3MKFA 4JGPA 2V2FF 3T4KA 5EVLA 3IS2A 4EESA 2XA7M 1IYOA 3M6HA 4IJGA 3I7JA 4R0QA 3JYIA 2DRWA 1DJCA 4B9OA 3CAXA 4JGOA 3U4LP 4IBRA 3G34A 3T4JA 5HPFA 2Y55A 2WYXA 2C5WB 1ES3A 3TSGA 3DTKA 3N6IA 3PBSA 1TDLA 4UAAA 2HJ9C 4CPKA 1AWIA 3DTEA 3FKWA 4HP4A 2P9VB 4Z9QA 3UB7A 3UB6A 3QP4A 4B93A 4HY8A 2VZWA 1GSXA 4H6JB 1BUEA 3IXBA 2Q0OA 2L1MA 1BLCA 3QNBA 5GLDA 3ZG9B 3FYZA 2H5SA 2OWJA 1GHIA 3T4LA 2ZQ7A 5TGFA 1U60A 2IWCA 3SS3A 4AFIA 3TJZC 5F5YA 3K2NA 5F6AA 4WELA 5HPIA 3V3SA 3Q7ZA 4L0LA 4PAUA 1H8YA 4S2KA 4GCZA 1F9IA 3KSIA 3L9KA 5HARA 2EWVA 4C6YA 4FH2A 1HVBA 2ZBBA 5HL6A 3SH7A 3W4OA 5F82A 4GW9A 3OOVA 5CGWA 1L3LA 3N8RA 2XSSA 3V3RA 3H9WA 1CI8A 2ZC7A 2GJ3A 3Q7VA 3DTMA 5KSCA 3FKVA 4FTXA 3BQ8A 3WRTA 3NIAA 1AXBA 3GSGA 4MDZA 2VV8A 4BJPA 3PBRA 2JN7A 2DCFA 5HSQA 3HL9A 1FSWA 4UQIM 1XJ2A 2QYBA 3A3IA 1WYCA 2KX6A 5HAPA 4RQ9A 3NOUC 4KZ8A 5CGSA 2HDQA 3RH8B 2JKTI 1LSWA 1CEGA 5CXWA 4Y7PA 4E3IA 3ZG0A 4I3JA 2JKGA 5U47A 4YFMA 3UE0A 2G7UA 4DE3A 2XFSA 3LIBA 4EV4A 2R9XA 3OCNA 3FZCA 2XFTA 4BBTA 4HH2A 3DBAA 2JKRI 1DP8A 4JGRA 3E4QA 2PBYA 3LEQA 5EOEA 2HV1A 4LRYC 1UGUA 4WZ4A 1PWCA 3V67A 1XJ4A 2EXBA 4FUWA 2VEAA
chains in the Genus database with same CATH topology
3P7NA 3NOPC 1X0OA 2FZ0A 1OT9A 4F3LA 1NLZA 2D02A 5A8BA 2WKRA 4HOIA 4ETZA 3B33A 2QJ7A 2O0YA 5HD5A 4HJ6A 1H8MA 1MZUA 3T4TA 3F1PB 4PKYG 3EGXC 3MR0A 2W3HA 4O01A 1V9YA 3S7NA 3E0YA 4ARZB 1YSQA 3EOIA 2PHYA 2A24B 5AVEA 4Y2FA 3KX0X 4GLQA 1T19A 4HH3A 4EERA 2YKFA 4BWIA 4L9GA 2VJWA 3LIAA 1F5MA 2W3FA 3T4OA 1XJ6A 1OTAA 1GSVA 5J4EA 3S7QA 1KOUA 4KUKA 3A0VA 5HWVA 3KYQA 2VA0A 3BQAA 4CLCD 4ETXA 2QKPA 1ZTUA 3EQUA 3S7OA 2K2NA 5HWTA 4CLCA 5G4ZA 2B02A 2LB5A 5DKKA 4KQOA 3E4PA 4HIAA 2XRNA 4CLCE 2XROA 1H3QA 3VOLA 4JGQA 1OJGA 2V1AA 4HP9A 2M7VA 3ULFA 3HJIA 1WA9A 3EEHA 3FPVA 5TBMA 1IFQA 2JKTM 3R4KA 3PXPA 3D72A 2OAQ1 4HJ3A 4OOLA 4IHQA 3B47A 2WKPA 4MCWA 4EW7A 5MC7A 5DFYA 3LICA 1TF1A 4NXGA 5L8MA 3UE3A 2INWA 4EU0A 2W3DA 3C30A 3MQ0A 4G3WA 4R38A 3K3DA 2J80A 3UE6A 2I9VA 1YSPA 2JKRM 3JVVA 4UEYA 4O8GA 2GZAA 1DRMA 3VV4A 1MC0A 1T1AA 4ZRRA 3F1NB 3CWFA 1ZHHB 2PR5A 1LT0A 1OJ5A 5DFXA 4DN0A 4YWZA 3PBOA 2HJEA 3FPWA 1EW0A 4GS9B 4MN7A 2V9AA 2KLIA 2VKSA 2J3TD 2QHKA 1YAXA 2GX5A 1TS6A 2W1TA 3C38A 1NRJA 5F68A 3VE3A 5AJGA 2HGVA 4WF0A 1IOUA 3GDIA 3CUEA 3F1OB 3U2AA 1STZA 2L0WA 2EA9A 4HJ4A 4NXBA 3VE4A 2WKQA 2W0NA 3PBQA 2J3TC 4LLOB 3IBRA 1S66L 2VV6A 1TS7A 3H82B 4LRZE 4H6JA 2IA2A 4XT2B 5C5KA 1T18A 2K31A 2PYPA 3OLOA 2H28A 1P9WA 1P9RA 3LUQA 3G6OA 4Q0JA 3KSGA 1S67L 3KSFA 4HHDA 3NOTC 2L4RA 1W63Q 3CITA 2JHEA 3D3OA 1UWPX 2QWSA 1S1ZA 4E04A 4IUHA 3O5YA 2CMNA 1S4SA 1TS0A 1N9NA 4PHTA 4WUJA 2VX8A 2PD7A 1YKDA 5J3WA 3CLOA 3A0RA 1G28A 5J7EA 5DF9A 5HDSA 4Q0HA 5F69A 4K08A 2Y79A 4HNBA 4Y3IA 4WEJA 5TJJA 4R3AA 4L9FA 4ME4A 1VB6A 1BYWA 4I3IA 4EUVA 4YOFA 4M4XA 2W3EA 5CX7A 4GJ4A 5LBRA 4CLCB 2PYRA 1JNUA 3LR3A 3FC7A 1MKMA 5EFWA 5DJTA 4CLCC 1NLYA 4CQHA 2XA7S 3LIDA 1P97A 3ZQ5A 4I3AA 5TBMB 3UB9A 4R70A 5G4YA 4II7A 2J3WA 4G3KA 1XFNA 4Y5FA 2Z6DA 3UB8A 4R6LA 1LSVA 2QJ5A 3MXQA 3KSHA 3BY9A 2M7UA 1XFQA 3MF0A 1ODVA 2P04A 1N9OA 3MMHA 3JVUA 3LIEA 4JGPA 3R7WA 3NHQA 3T4KA 3RFBA 3IS2A 3HCYA 3TRCA 4EESA 2HF6A 2V0WA 3PBNA 3H7WA 2PR6A 2O9BA 3TW8A 3UMDA 1OTDA 2XA7M 2YKHA 5HDCA 4WN5A 4IJGA 3S7PA 3OBFA 2VGLS 3LR5A 2LB9A 4Z1WA 1F98A 4B9OA 3SW1A 3CAXA 4JGOA 2V1BA 4NXFA 1DP6A 3P01A 2MJ6A 2W27A 2V0UA 3T4JA 3OCLA 3RTYA 5HPFA 2W1TB 3T4SA 1OTIA 1OTBA 4BMWA 1DP9A 3EEAA 2EWWA 2PT7A 3ZYTA 4EEPA 2D01A 4O0PA 1UWNX 3PBSA 1GSWA 2HJ9C 4GHIA 1W63M 4HP4A 3ICYA 2VGLM 3CUEC 3MQQA 4IUKA 3BJNA 3UB7A 3UB6A 2DMWA 4B93A 1OPXA 4HY8A 2Z6CA 2VZWA 4F3LB 1GSXA 4H6JB 3W2ZA 4DJ3A 4NKPA 3LR4A 2L1MA 3KO6A 3A0SA 3LR0A 2KOIA 5I5LA 1D06A 3FG8A 4I39A 2OWJA 3T4LA 3PYPA 3F1PA 3IBJA 1Y28A 2NUTC 3BW6A 3EGDC 4AFIA 2K7SA 4HQAA 4G3VA 4ARZA 3TJZC 1T1BA 5F5YA 3K2NA 5IU1A 2A24A 4YNRA 5F6AA 4WELA 5HWWA 4LPZA 1LSXA 5HPIA 4OOMA 2O9AA 4L0LA 2ZOHA 4QPRA 5FL3A 4PAUA 4GCZA 4EEUA 1F9IA 1TD5A 2P7JA 5AVFA 3E4OA 3LIFA 3LFVA 3B42A 3KSIA 4DJ2A 2P08A 4PKYA 2EWVA 4P6ZS 5KIZA 2GNXA 1XJ3A 4UQIS 2ZBBA 5HL6A 2ZMFA 4KUOA 4BBVA 3UMEA 2O9CA 3KYZA 5K5BA 4GW9A 3OOVA 4NEED 1S4RA 4EXOA 2XSSA 3H9WA 3K3CA 4Q0IA 2M1CA 3MQOA 4MMNA 3TE8A 2B18A 5IT5A 2GJ3A 3GECA 3LYXA 4FOFA 4I38A 4WLAA 3BQ8A 3E98A 2ZMVA 2BASA 3EQVA 4MDZA 2VV8A 3C8CA 3MFXA 3T50A 4HI4A 2OWHA 3PBRA 4BJPA 2JN7A 4P6ZM 2ZOIA 3LI8A 5HSQA 4WL9A 4EETB 4UQIM 3NJAA 3PHYA 1N9LA 1XJ2A 2QYBA 4WEKA 4KQDA 2PDRA 2PD8A 4BBUA 3F1NA 2W1RA 3R7WB 2KX6A 1D7EA 3IS2B 5DJUA 4DMZA 4RQ9A 3H7WB 3PR6A 5HD3A 3NOUC 2KDKA 3BWLA 2R78A 4GS9A 4EQ1A 4MN6A 3RH8B 1LL8A 2JKTI 1LSWA 1TS8A 3OC2A 2A2LA 4I3JA 4I5SA 2NUPC 5HDDA 1OT6A 5DKLA 2OAP1 2G7UA 2W3GA 5HZHA 3LIBA 4L9EA 2O99A 3C2WA 2FH5A 5IS1A 1T1CA 3CI6A 1NWZA 3OCNA 3F1OA 1S1YA 4FSFA 1P0ZA 4BBTA 2VV7A 4HH2A 3DBAA 3LI9A 2JKRI 2VLGA 4LRXC 3PBTA 3EWKA 1DP8A 4NXEA 4JGRA 3E4QA 1V9ZA 4GHIB 2OOLA 3BY8A 2HV1A 1VHMA 4LRYC 1UGUA 1G6OA 4MN5A 2Y8HA 1OTEA 3H82A 3V67A 1XJ4A 4XT2A 5KSHA 3T4QA 3MJQA 3HJKA 2VEAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P7N A;  3NOP C;  1X0O A;  1OT9 A;  4F3L A;  2D02 A;  5A8B A;  2WKR A;  4HOI A;  3B33 A;  2QJ7 A;  5HD5 A;  4HJ6 A;  1MZU A;  3F1P B;  4PKY G;  3MR0 A;  1V9Y A;  2PHY A;  2A24 B;  5AVE A;  3KX0 X;  1T19 A;  4HH3 A;  4EER A;  2YKF A;  4L9G A;  3LIA A;  1XJ6 A;  1OTA A;  1GSV A;  5J4E A;  1KOU A;  4KUK A;  3A0V A;  5HWV A;  2QKP A;  5HWT A;  5G4Z A;  2B02 A;  5DKK A;  3E4P A;  4HIA A;  3VOL A;  4JGQ A;  1OJG A;  2V1A A;  4HP9 A;  3ULF A;  3HJI A;  1WA9 A;  3EEH A;  5TBM A;  3D72 A;  4HJ3 A;  2WKP A;  4EW7 A;  3LIC A;  4NXG A;  2INW A;  4R38 A;  3K3D A;  2J80 A;  3UE6 A;  2I9V A;  1DRM A;  1T1A A;  3F1N B;  3CWF A;  2PR5 A;  1LT0 A;  1OJ5 A;  4YWZ A;  1EW0 A;  4GS9 B;  2V9A A;  2QHK A;  1TS6 A;  5F68 A;  3VE3 A;  4WF0 A;  3GDI A;  3F1O B;  2L0W A;  2EA9 A;  4HJ4 A;  4NXB A;  3VE4 A;  2WKQ A;  2W0N A;  4LLO B;  3IBR A;  1S66 L;  2VV6 A;  1TS7 A;  3H82 B;  4LRZ E;  4H6J A;  4XT2 B;  1T18 A;  2PYP A;  3OLO A;  2H28 A;  3LUQ A;  3G6O A;  1S67 L;  4HHD A;  3NOT C;  2L4R A;  2JHE A;  1UWP X;  2QWS A;  1S1Z A;  4E04 A;  2CMN A;  1S4S A;  1TS0 A;  1N9N A;  4WUJ A;  2PD7 A;  5J3W A;  3CLO A;  3A0R A;  1G28 A;  5J7E A;  5HDS A;  5F69 A;  4K08 A;  4HNB A;  4R3A A;  4L9F A;  1VB6 A;  1BYW A;  4I3I A;  4M4X A;  2PYR A;  1JNU A;  5EFW A;  3FC7 A;  5DJT A;  3LID A;  1P97 A;  3ZQ5 A;  4I3A A;  3UB9 A;  5TBM B;  4R70 A;  5G4Y A;  1XFN A;  2Z6D A;  3UB8 A;  4R6L A;  1LSV A;  2QJ5 A;  3MXQ A;  3BY9 A;  1XFQ A;  1ODV A;  1N9O A;  3LIE A;  4JGP A;  3NHQ A;  3IS2 A;  4EES A;  2V0W A;  3H7W A;  2PR6 A;  3UMD A;  1OTD A;  2YKH A;  5HDC A;  4WN5 A;  1F98 A;  4B9O A;  3SW1 A;  3CAX A;  4JGO A;  2V1B A;  4NXF A;  1DP6 A;  2W27 A;  2V0U A;  3RTY A;  1OTI A;  1OTB A;  1DP9 A;  4EEP A;  2D01 A;  1UWN X;  1GSW A;  4GHI A;  4HP4 A;  3ICY A;  3MQQ A;  3UB7 A;  3UB6 A;  4HY8 A;  2Z6C A;  4F3L B;  1GSX A;  4H6J B;  4DJ3 A;  2L1M A;  3A0S A;  5I5L A;  1D06 A;  3FG8 A;  4I39 A;  2OWJ A;  3PYP A;  3F1P A;  1Y28 A;  2K7S A;  4HQA A;  1T1B A;  5F5Y A;  5IU1 A;  2A24 A;  5F6A A;  5HWW A;  4LPZ A;  1LSX A;  2ZOH A;  4GCZ A;  4EEU A;  1F9I A;  2P7J A;  5AVF A;  3E4O A;  3LIF A;  4DJ2 A;  4PKY A;  5KIZ A;  1XJ3 A;  2ZBB A;  4KUO A;  4BBV A;  3UME A;  4GW9 A;  1S4R A;  4EXO A;  3H9W A;  3K3C A;  2M1C A;  3MQO A;  2GJ3 A;  3GEC A;  3LYX A;  4I38 A;  4WLA A;  2BAS A;  2VV8 A;  3C8C A;  3MFX A;  3T50 A;  4HI4 A;  2OWH A;  2JN7 A;  2ZOI A;  3LI8 A;  5HSQ A;  4WL9 A;  4EET B;  3NJA A;  3PHY A;  1N9L A;  1XJ2 A;  4KQD A;  2PDR A;  2PD8 A;  4BBU A;  3F1N A;  2KX6 A;  1D7E A;  3IS2 B;  5DJU A;  4RQ9 A;  3H7W B;  5HD3 A;  3NOU C;  2KDK A;  3BWL A;  2R78 A;  4GS9 A;  4EQ1 A;  4MN6 A;  3RH8 B;  1LL8 A;  1LSW A;  1TS8 A;  4I3J A;  4I5S A;  5HDD A;  1OT6 A;  5DKL A;  5HZH A;  3LIB A;  4L9E A;  3C2W A;  5IS1 A;  1T1C A;  1NWZ A;  3F1O A;  1S1Y A;  1P0Z A;  4BBT A;  2VV7 A;  4HH2 A;  3LI9 A;  2VLG A;  4LRX C;  4NXE A;  3EWK A;  1DP8 A;  4JGR A;  3E4Q A;  1V9Z A;  4GHI B;  2OOL A;  3BY8 A;  2HV1 A;  4LRY C;  1UGU A;  4MN5 A;  1OTE A;  3H82 A;  1XJ4 A;  4XT2 A;  3MJQ A;  3HJK A;  2VEA A; 
#chains in the Genus database with same CATH topology
 3QP5 A;  1OT9 A;  3NDG A;  4JXS A;  2WKR A;  2V8F A;  1FR6 A;  3B33 A;  1F2K A;  2QJ7 A;  3IH9 A;  2WK0 A;  4Q8I A;  3BFG A;  1K55 C;  5TFQ A;  4Y0U A;  3VFF A;  3ZG5 A;  4RX3 A;  4GKU A;  4HJ6 A;  4PM9 A;  1MZU A;  3T4T A;  3WS5 A;  1GHP A;  3F1P B;  2OSU A;  3MR0 A;  2R9W A;  2ZMA A;  2EX2 A;  1RGY A;  3QP6 A;  5AVE A;  3UE1 A;  4GLQ A;  4HH3 A;  2YKF A;  4BWI A;  4DE2 A;  2VJW A;  3UY6 A;  3T1S A;  3MXS A;  5AQ7 A;  1W8Y A;  1W5D A;  2VA0 A;  1GA0 A;  3S7O A;  1YQS A;  4PM6 A;  1PWG A;  2XEP A;  5G4Z A;  1M40 A;  4KG6 A;  3BFC A;  4KQO A;  5A91 A;  2XRN A;  1FQG A;  1KDS A;  3VOL A;  3RXW A;  3ULF A;  4A5R A;  3VOY A;  3ZGA B;  2Y2L A;  2J8Y A;  2JKT M;  3R4K A;  3PXP A;  3D72 A;  2OAQ 1;  4ZDX A;  3T12 B;  1G68 A;  3IXG A;  4EW7 A;  4OPZ A;  1O7E A;  4LCM A;  2ZQD A;  4KZ5 A;  4EU0 A;  3VP4 A;  4G3W A;  4DE1 A;  4QY5 A;  5FQI A;  4ESP A;  4JF5 A;  2JKR M;  3JVV A;  3P98 A;  3N8L A;  4O8G A;  1JTG A;  5AQB A;  4OP8 A;  2GZA A;  3W4P A;  3F1N B;  2B95 A;  3IWQ A;  3CWF A;  1L2S A;  1KGG A;  3JPU A;  1MKI A;  3FPW A;  2KLI A;  3UNW A;  4UA9 A;  3HRE A;  3HVF A;  2ZQ8 A;  3QHY A;  1ALQ A;  4WF0 A;  4QHC A;  3GDI A;  3LGO A;  3F1O B;  2L0W A;  2EA9 A;  1EWZ A;  4R23 A;  3CMZ A;  4HJ4 A;  2P9V A;  1KE3 A;  3O88 A;  2J3T C;  4Y0O A;  1O07 A;  3ZCZ A;  3IBR A;  1S66 L;  1PYY A;  4H6J A;  1WE4 A;  3IWI A;  3NY4 A;  1K57 C;  1P9W A;  4BQM A;  1GCE A;  2ZQ9 A;  3IWO A;  4Q0J A;  1CK3 A;  5CHJ A;  1PW1 A;  1FCN A;  4KQR A;  3NOT C;  5CED A;  1NJ4 A;  2A3U A;  5DTT A;  1FIK A;  1W63 Q;  2JHE A;  3D3O A;  3ITB A;  2QWS A;  3O5Y A;  2RL3 A;  4PHT A;  1KE4 A;  4R3J A;  3ZG8 B;  3DW0 A;  4RVA A;  3A0R A;  1G28 A;  4U3T A;  4Q0H A;  1XP4 A;  5F69 A;  4K08 A;  1DJA A;  2Y79 A;  3IQA A;  4WEJ A;  5TJJ A;  4R3A A;  5CHU A;  4L9F A;  3HLE A;  1XPB A;  5LBR A;  3ZG7 B;  4D60 A;  4CJN A;  4CLC B;  1HD8 A;  4UA6 A;  3FC7 A;  4CLC C;  1NLY A;  2Y2Q A;  4KZ3 A;  4KZ6 A;  3LID A;  2Q9M A;  5TBM B;  4II7 A;  3UB8 A;  2QJ5 A;  3E2K A;  1W8Q A;  2EX6 A;  5FEG A;  4JF6 A;  2C6W B;  3NHQ A;  4IED A;  4BLM A;  5CEB A;  4S2J A;  3PBN A;  2V0W A;  1G6A A;  2O9B A;  3TW8 A;  1OTD A;  5HDC A;  5CTM A;  1S0W A;  5GHZ A;  1PIO A;  4Z1W A;  3SW1 A;  4C75 A;  1VM1 A;  5CGX A;  1CI9 A;  2E8I A;  3VSL A;  2W27 A;  2V0U A;  3G2Z A;  4S2M A;  2BTF P;  4MBH A;  1OTI A;  3T4S A;  3MZE A;  3L7H A;  1DP9 A;  4RA7 A;  2PT7 A;  3IH8 A;  1ERM A;  5E2E A;  3ZYT A;  2J7V A;  4KZA A;  1PI5 A;  3ICY A;  5FAO A;  1D1J A;  1I5Q A;  4DDS A;  5FSR A;  5GLA A;  1K56 A;  1K55 A;  3W2Z A;  4NKP A;  1WYB A;  3G35 A;  2H0T A;  3A0S A;  4N9L A;  2ZD8 A;  1PNE A;  1D06 A;  4WYY A;  3OZH A;  3F1P A;  4X1M A;  3SH8 A;  2P74 A;  5GHY A;  4EBL A;  1SDN A;  2G2W A;  4OPY A;  4YNR A;  5HWW A;  1LSX A;  5FL3 A;  3VMA A;  3WRZ A;  2WGI A;  4GDN A;  3LFV A;  4KZ9 A;  1LL5 A;  3LEZ A;  2P08 A;  2J9P A;  4P6Z S;  5DVA A;  2GNX A;  1K6R A;  1BLP A;  3UME A;  2O9C A;  3KYZ A;  1YLP A;  2HZ5 A;  1JWZ A;  2EX9 A;  5IT5 A;  4FOF A;  4I38 A;  4N1H A;  4KG2 A;  1PW8 A;  1I2S A;  2ZMV A;  4E3L A;  3HLC A;  2EFX A;  3MFX A;  2OWH A;  4WL9 A;  4EET B;  3NJA A;  3GV9 A;  3S22 A;  4WEK A;  1YMX A;  3PTE A;  2PDR A;  3GRJ A;  1I2W A;  3CPT B;  3F1N A;  5FQK A;  3R7W B;  1OME A;  4EQI A;  5EPH A;  3H7W B;  1SKF A;  5HD3 A;  3OPL A;  4EQ1 A;  1E4D A;  1LLB A;  4OPR A;  4P87 A;  5DKL A;  2W3G A;  5HZH A;  4L9E A;  3C2W A;  5IS1 A;  3CI6 A;  3V5M A;  5DTK A;  3F1O A;  3MKE A;  3PBT A;  3EWK A;  3WS0 A;  1MY8 A;  1LL9 A;  1V9Z A;  5EV0 A;  2ZLY A;  4GHI B;  4S2L A;  1K57 A;  4MN5 A;  1K0K A;  3SH9 A;  4E3N A;  3NOP C;  2Y59 A;  4KZB A;  1FCM A;  4F3L A;  1NLZ A;  2D02 A;  5A8B A;  4ETZ A;  4X1L A;  3B3X A;  3A3J A;  1MWS A;  1BLH A;  1H8M A;  1K4F A;  4PKY G;  4B4X A;  4O01 A;  1V9Y A;  3E0Y A;  5FDH A;  1YSQ A;  2PHY A;  2A24 B;  3KX0 X;  1T19 A;  3UDX A;  1MWR A;  3LIA A;  4JPM A;  1XJ6 A;  1OTA A;  1GSV A;  4QJG A;  3S7Q A;  1KOU A;  4OLG A;  4LCL A;  3V39 A;  4OQ0 A;  5HWT A;  4CLC A;  2LB5 A;  4WBG A;  1RGZ A;  1YLT A;  4HIA A;  1CJF A;  2XRO A;  4S2N C;  2ZL1 B;  3IF6 B;  2ZJ9 A;  1WA9 A;  4K0X A;  5TBM A;  4YIN A;  1IFQ A;  1YMS A;  3T1Q B;  4IHQ A;  1K6S A;  2WKP A;  3B47 A;  3IF6 C;  3LIC A;  3UE3 A;  1FR1 A;  3C30 A;  4R38 A;  3K3D A;  2I9V A;  3GQZ A;  2Y2K A;  4LGW A;  1SKO A;  4ZRR A;  1T1A A;  1ZHH B;  2XH9 A;  1OJ5 A;  3C4P A;  2ZM8 A;  5KMW A;  3O86 A;  1EW0 A;  5CTN A;  3ZNY A;  4GS9 B;  4MN7 A;  2V9A A;  4OH0 A;  2VGK A;  3UB5 P;  2ZC4 B;  1YAX A;  4PM5 A;  4ID4 A;  2IWB A;  4DDY A;  1ZC2 A;  1ONH A;  4JXW A;  4R4R A;  3U2A A;  1YLZ A;  4E3M A;  4ZJ2 A;  4Y17 A;  3G32 A;  3VE4 A;  3N7W A;  5EVI B;  3NUL A;  5FQJ A;  3MZF A;  2VV6 A;  4LRZ E;  5EVI C;  3LY3 A;  2IA2 A;  4XT2 B;  1T18 A;  4DRT A;  5HW3 A;  5E2G A;  4GZB A;  3KSG A;  1JTD A;  5CER A;  2HP6 A;  2XLN A;  4MBF A;  3CIT A;  1UWP X;  5FAQ A;  1DJB A;  3A3F A;  4IUH A;  2CMN A;  3QP8 A;  4OQH A;  1TS0 A;  4E3O A;  3M2J A;  2VX8 A;  2V1Z A;  4NK3 A;  3LCE A;  3CLO A;  5L2F A;  5DF7 A;  4EWF A;  2HDS A;  4Y3I A;  2XD5 A;  3MS6 A;  2JE5 A;  1VB6 A;  4EUV A;  3O87 A;  4R1G A;  4OPQ A;  2X01 A;  4OQI A;  2PYR A;  1JNU A;  3QP2 A;  5FI7 A;  3ZVW A;  3LR3 A;  1VEU B;  5DJT A;  2WZX A;  1XXM A;  3ZQ5 A;  4FH4 A;  3WWX A;  3M2K A;  4B4Z A;  2J3W A;  4EUZ A;  5BOH A;  3UN7 A;  2PRF A;  3MXQ A;  1XA7 A;  2Y2J A;  5FAP A;  2M7U A;  1XFQ A;  3IX3 A;  1ODV A;  1E25 A;  1NZU A;  2VGJ A;  3JVU A;  3CPT A;  4RYE A;  3LIE A;  3R7W A;  3HLF A;  4GDB A;  3IXH A;  3TRC A;  1BUL A;  3UPN A;  3H7W A;  1FCO A;  3UMD A;  3O3V A;  4KZ7 A;  5IHV A;  1XGI A;  2YKH A;  3BLS A;  4WN5 A;  2Y91 A;  4JXV A;  3OBF A;  2VGL S;  4JLF A;  1L0E A;  1ZG6 A;  3MBZ A;  1TVF A;  3S4X A;  4RX2 A;  3CHW P;  4ZBE A;  3P01 A;  3Q07 A;  3Q1F A;  4U0T A;  3A3E A;  1HTZ A;  3NEC A;  2Z2L B;  4OOY A;  4BMW A;  5F1G A;  4MBK A;  4Y13 A;  5EVE A;  1KVL A;  5G18 A;  1GSW A;  4JXG A;  4GHI A;  2B5R A;  3NCK A;  3CUE C;  3MQQ A;  4IUK A;  3BJN A;  1K56 D;  1OPX A;  3HUN A;  5M18 A;  4F3L B;  2UWX A;  4DJ3 A;  3LR4 A;  3VSK A;  4EBP A;  3FG8 A;  3HUO A;  3IBJ A;  4HBU A;  1Y28 A;  3BW6 A;  3EGD C;  1NYY A;  4G3V A;  5IU1 A;  2IWD A;  2A24 A;  4WMC A;  3HUM A;  4LPZ A;  4R3B A;  2O9A A;  2ZOH A;  4Y15 A;  2ZC5 B;  2P7J A;  4PM7 A;  3E4O A;  3B42 A;  2FFF B;  5EEC A;  4XUX A;  1ES4 A;  2FFY A;  5FQQ A;  1RCJ A;  4DXB A;  4S2N A;  5KIZ A;  1XJ3 A;  5D3O A;  2ZMF A;  1PWD A;  1W79 A;  5L10 A;  5K5B A;  3C4O A;  1S4R A;  2ZL1 A;  4Q0I A;  2V8C A;  2M1C A;  3IF6 A;  5AQ9 A;  4E6W A;  2HPB A;  3TE8 A;  2XGN A;  4X6T A;  2HP9 A;  3C8C A;  5CEC A;  3VFH A;  3SS5 A;  3BLM A;  2JKF A;  4P6Z M;  3WS4 A;  1SZV A;  4QY6 A;  3AGE A;  1KGF A;  1XGJ A;  3QNC A;  1SKO B;  4ZTK A;  1N9L A;  2ACG A;  2PD8 A;  2QMI A;  2W1R A;  1D7E A;  1M6K A;  1PZO A;  4S2P A;  3PR6 A;  1ACF A;  4PM8 A;  1J9M A;  2A49 A;  1BSG A;  2R78 A;  4GS9 A;  4C3Q A;  1QME A;  1LL8 A;  1TS8 A;  3OC2 A;  2PU2 A;  3A3D A;  3HLG A;  2NUP C;  2O99 A;  1NWZ A;  2Y2H A;  3DTI A;  4FSF A;  2OLU A;  3IF5 A;  3LI9 A;  2VLG A;  3DWK A;  4LRX C;  2WGW B;  4KG5 A;  5EVI A;  3CZD A;  2WGV A;  1VHM A;  1Y54 A;  3N4I A;  4M3K A;  3MXR A;  4XT2 A;  2ZC3 B;  1CQA A;  3P7N A;  1Y4O A;  4N1X A;  3Q81 A;  4HOI A;  1ZG4 A;  4DXC A;  1SCW A;  1NZO A;  5FI6 A;  5M19 A;  2Y2G A;  5HD5 A;  4X56 A;  1ERQ A;  3CJM A;  3MSH A;  3S7N A;  4OKP A;  1MXO A;  5HL1 A;  4ARZ B;  3BYD A;  5GHX A;  2WKH A;  5I94 A;  4EER A;  3SS4 A;  4ZJ1 A;  1F5M A;  1Q2P A;  3T4O A;  4N92 A;  2ZM2 A;  5HWV A;  3UPP A;  3BQA A;  4CLC D;  2ZQC A;  5A92 A;  2QKP A;  3EQU A;  4OON A;  2ZM0 A;  2XD1 A;  1DY6 A;  1FSY A;  4LV1 A;  2B02 A;  2WAE A;  5DKK A;  4BD1 A;  1VEU A;  4XXR A;  1SHV A;  4LV2 A;  1IEM A;  4CLC E;  1H3Q A;  2OV5 A;  4JGQ A;  4QD4 A;  5FDS A;  2V1A A;  1K38 A;  4HP9 A;  2Y2P A;  3HJI A;  3EEH A;  3DAV A;  4HJ3 A;  1H8Z A;  4OOL A;  4QWO A;  4U0X A;  5MC7 A;  5DFY A;  4NET A;  2WZZ A;  1ES2 A;  5EOO A;  1TF1 A;  4NXG A;  2INW A;  2W3D A;  3BFF A;  3UPO A;  3UE6 A;  4MLL A;  3IHB A;  1JWP A;  4UEY A;  3TG9 A;  1MC0 A;  4IVK A;  1G5U A;  1RP5 A;  2PR5 A;  1LT0 A;  4X55 A;  2RCX A;  5FA7 A;  3PBO A;  1YM1 A;  2HJE A;  4GNU A;  4LV0 A;  3T1X A;  1NYM A;  2QPN A;  2Y2I A;  1FOF A;  2VKS A;  2QHK A;  2E8J A;  3UDF A;  5HFO A;  5FI2 A;  4X69 A;  5F68 A;  2G2U A;  3VE3 A;  1IOU A;  4P85 A;  3CUE A;  4XUZ A;  4HEF A;  5EE8 A;  1ONG A;  2Y2O A;  2WKQ A;  2W0N A;  3PBQ A;  2EX8 A;  4HBT A;  1KGE A;  1S6R A;  1YLJ A;  4OLD A;  3QP1 A;  1TS7 A;  3H82 B;  1H0M A;  5FAS A;  2PYP A;  2H28 A;  1JWV A;  3LUQ A;  3SOI A;  4O7D A;  2ZC6 B;  3BEB A;  1IYQ A;  1ES5 A;  4DF6 A;  4NG2 A;  3KSF A;  4HHD A;  1YLY A;  1ESU A;  1E3U A;  1L0D A;  2VK3 A;  2L4R A;  4PPR A;  1IYP A;  4E04 A;  5TR7 A;  4WZ5 C;  1S4S A;  1N9N A;  5GL9 A;  1GA9 A;  5E43 A;  3ZNT A;  5J3W A;  5A90 A;  4HES A;  4KQQ A;  2WAF A;  4N9K A;  5DF9 A;  3VP1 A;  4MNR A;  4ME4 A;  2EFU A;  2H10 A;  2DNS A;  4I3I A;  2PBD P;  5E2F A;  4YOF A;  3FWL A;  4GN2 A;  2W3E A;  1K54 C;  4GJ4 A;  1BLS A;  4CQH A;  3ZHH A;  3IHA A;  2XA7 S;  3VP0 A;  4I3A A;  4OQG A;  3UB9 A;  5FQM A;  4R4S A;  5EUA A;  4Y5F A;  2Z6D A;  3RXX A;  1NRF A;  4R6L A;  3P09 A;  3KSH A;  3ITA A;  3HLB A;  3BY9 A;  3W4Q A;  3VOZ A;  3MF0 A;  1BT5 A;  1N9O A;  2HDU A;  3MMH A;  3IX8 A;  3V50 A;  3RFB A;  3HCY A;  1ERO A;  2HF6 A;  2PR6 A;  1XA1 A;  4F94 A;  1IEL A;  1VET B;  3ISG A;  4X68 A;  3ZFZ A;  4IVI A;  1LI9 A;  4S2I A;  3S7P A;  3LR5 A;  2LB9 A;  1Z09 A;  1F98 A;  3E2L A;  2V1B A;  1IKG A;  4NXF A;  1DP6 A;  3LY4 A;  2MJ6 A;  3OPP A;  3OCL A;  3RTY A;  3MFD A;  2W1T B;  3RJU A;  1OTB A;  3EEA A;  2EWW A;  4EEP A;  2D01 A;  2WGW A;  1UWN X;  3C7U A;  4O0P A;  4P6B A;  5J8X A;  2XK1 A;  1PRQ A;  1W63 M;  4EBN A;  4GD8 A;  2VGL M;  4FCF A;  3C5A A;  2DMW A;  1NY0 A;  3KYE A;  1Q2Q A;  2Z6C A;  5FAT A;  1N9B A;  3KO6 A;  3LR0 A;  2KOI A;  3FV7 A;  5I5L A;  4I39 A;  4PMA A;  4OVD A;  2XF3 A;  5EM0 A;  3PYP A;  2NUT C;  1TDG A;  2WUQ A;  4BL3 A;  2K7S A;  4HQA A;  3BEC A;  4WMC D;  4ARZ A;  1N4O A;  1T1B A;  3D4F A;  5FQ9 A;  2ZQA A;  3PAG A;  1IKI A;  4OOM A;  3G30 A;  4QPR A;  3WS2 A;  3SZT A;  2JCH A;  4EEU A;  1TD5 A;  5DF8 A;  3BFD A;  5AVF A;  3LIF A;  3HBR A;  4JF4 A;  1C3B A;  2X71 A;  4DJ2 A;  4PKY A;  3GTC A;  4JBF A;  5FEF A;  3IT9 A;  4UQI S;  4KUO A;  4BBV A;  4K91 A;  2Y2M A;  1LI0 A;  4NEE D;  4E3K A;  4EXO A;  3K3C A;  3LO7 A;  3Q82 A;  3MQO A;  4MMN A;  2B18 A;  3GEC A;  3LYX A;  4WLA A;  4BEN A;  5L09 A;  2CC1 A;  3E98 A;  2BAS A;  5F1F A;  3EQV A;  4DKI A;  3T50 A;  4QB8 A;  1H5X A;  4HI4 A;  2H0Y A;  2JC7 A;  1IYS A;  4DE0 A;  5HAQ A;  2ZOI A;  3LI8 A;  5GLC A;  2QZ6 A;  2X02 A;  4LEN A;  2Y2N A;  3GMW A;  3PHY A;  4S2O A;  2PU4 A;  4KQD A;  3D9Y A;  4BBU A;  4QU3 A;  3AGD A;  3IS2 B;  3UDI A;  5DJU A;  4DMZ A;  5EM1 A;  1HZO A;  2KDK A;  3BWL A;  1W7F A;  3T1R A;  4MN6 A;  2A2L A;  4I5S A;  5HDD A;  1OT6 A;  2OAP 1;  4E3J A;  2FH5 A;  1T1C A;  2WKI A;  1S1Y A;  1P0Z A;  1L0G A;  2VV7 A;  1MPL A;  5EVI D;  1A0K A;  1XKZ A;  5AQA A;  4NXE A;  3NDE A;  3W8K A;  5L07 A;  1YT4 A;  2OOL A;  3BY8 A;  4H8R A;  1NXY A;  2J9O A;  3C7V A;  1G6O A;  2HDR A;  2Y8H A;  1OTE A;  3H82 A;  5E2H A;  2I72 A;  1MWU A;  1Z6F A;  5KSH A;  3T4Q A;  3MJQ A;  3HJK A;  2Q9N A;  3ZDJ A;  1X0O A;  2FZ0 A;  2HP5 A;  4FD8 A;  1K25 A;  2XR0 A;  2WKE A;  4Y0T A;  1PI4 A;  5CHM A;  4WZ5 A;  3G2Y A;  2O0Y A;  1TEM A;  3BRM A;  3GR2 A;  4BL2 A;  2GDN A;  3EGX C;  2W3H A;  2V20 A;  1ESI A;  3EOI A;  3MZD A;  4Y2F A;  4L9G A;  3G31 A;  3HLD A;  3DWZ A;  2W3F A;  4KZ4 A;  4UA7 A;  1K54 A;  4IBX A;  5J4E A;  4KUK A;  3A0V A;  3KYQ A;  4ETX A;  1ZTU A;  5M1A A;  5CRF A;  4E6X A;  2K2N A;  1J3W A;  3E4P A;  3PAE A;  1K4E A;  3BFE A;  3GVB A;  4X53 A;  1OJG A;  1L0F A;  1BZA A;  2M7V A;  3FPV A;  4GD6 A;  1KE0 A;  3Q7V B;  1KVM A;  1YLW A;  4MCW A;  1VQQ A;  3BM6 A;  3S1Y A;  3G4P A;  3NC8 A;  3OPR A;  5L8M A;  3AGF A;  1HLU P;  3MQ0 A;  1CEF A;  1FIL A;  2J80 A;  1YSP A;  4ZAM A;  4LFU A;  1DRM A;  3VV4 A;  1PFL A;  2JBF A;  4B88 A;  1PZP A;  2PAV P;  1VET A;  4LV3 A;  2WAD A;  5DFX A;  4K0W A;  4DN0 A;  4YWZ A;  5GLB A;  3WS1 A;  2J3T D;  1SDE A;  1JVJ A;  4WM9 A;  2GX5 A;  1TS6 A;  2W1T A;  3C38 A;  2XQZ A;  1LHY A;  3N8S A;  1NRJ A;  3IXD A;  5AJG A;  3OPH A;  2HGV A;  3CG5 A;  3ZVT A;  1GHM A;  1STZ A;  4X25 A;  3UO9 A;  4NXB A;  5F83 A;  4UHU A;  4LLO B;  4GOG A;  2Z2M B;  5JYO A;  4MEZ A;  4GB7 A;  2BLS A;  5C5K A;  2K31 A;  3OLO A;  1MBL A;  2XDM A;  4KEN B;  1P9R A;  5JYP A;  4D2O A;  3G6O A;  1E3U D;  1S67 L;  5HAI A;  2OLV A;  1QMF A;  5KZH A;  4P0M A;  4JKT A;  1ZKJ A;  3VP2 A;  1S1Z A;  4WUJ A;  3TOI A;  5DTS A;  2PD7 A;  5A93 A;  2AVX A;  1YKD A;  5J7E A;  1XX2 A;  1MWT A;  5HDS A;  2BG1 A;  2EXA A;  4ZJ3 A;  4HNB A;  3M6B A;  1BTL A;  2Y4A A;  1BYW A;  4M4X A;  3HLW A;  5CX7 A;  1EI5 A;  1KDW A;  5EFW A;  1MKM A;  4OP5 A;  1P97 A;  4BD0 A;  3VP3 A;  1CF0 A;  4R70 A;  5G4Y A;  4G3K A;  5HX9 A;  1XFN A;  1YPR A;  1LSV A;  3NI9 A;  3NBL A;  3IX4 A;  2P04 A;  2UV0 E;  3MKF A;  4JGP A;  2V2F F;  3T4K A;  5EVL A;  3IS2 A;  4EES A;  2XA7 M;  1IYO A;  3M6H A;  4IJG A;  3I7J A;  4R0Q A;  3JYI A;  2DRW A;  1DJC A;  4B9O A;  3CAX A;  4JGO A;  3U4L P;  4IBR A;  3G34 A;  3T4J A;  5HPF A;  2Y55 A;  2WYX A;  2C5W B;  1ES3 A;  3TSG A;  3DTK A;  3N6I A;  3PBS A;  1TDL A;  4UAA A;  2HJ9 C;  4CPK A;  1AWI A;  3DTE A;  3FKW A;  4HP4 A;  2P9V B;  4Z9Q A;  3UB7 A;  3UB6 A;  3QP4 A;  4B93 A;  4HY8 A;  2VZW A;  1GSX A;  4H6J B;  1BUE A;  3IXB A;  2Q0O A;  2L1M A;  1BLC A;  3QNB A;  5GLD A;  3ZG9 B;  3FYZ A;  2H5S A;  2OWJ A;  1GHI A;  3T4L A;  2ZQ7 A;  5TGF A;  1U60 A;  2IWC A;  3SS3 A;  4AFI A;  3TJZ C;  5F5Y A;  3K2N A;  5F6A A;  4WEL A;  5HPI A;  3V3S A;  3Q7Z A;  4L0L A;  4PAU A;  1H8Y A;  4S2K A;  4GCZ A;  1F9I A;  3KSI A;  3L9K A;  5HAR A;  2EWV A;  4C6Y A;  4FH2 A;  1HVB A;  2ZBB A;  5HL6 A;  3SH7 A;  3W4O A;  5F82 A;  4GW9 A;  3OOV A;  5CGW A;  1L3L A;  3N8R A;  2XSS A;  3V3R A;  3H9W A;  1CI8 A;  2ZC7 A;  2GJ3 A;  3Q7V A;  3DTM A;  5KSC A;  3FKV A;  4FTX A;  3BQ8 A;  3WRT A;  3NIA A;  1AXB A;  3GSG A;  4MDZ A;  2VV8 A;  4BJP A;  3PBR A;  2JN7 A;  2DCF A;  5HSQ A;  3HL9 A;  1FSW A;  4UQI M;  1XJ2 A;  2QYB A;  3A3I A;  1WYC A;  2KX6 A;  5HAP A;  4RQ9 A;  3NOU C;  4KZ8 A;  5CGS A;  2HDQ A;  3RH8 B;  2JKT I;  1LSW A;  1CEG A;  5CXW A;  4Y7P A;  4E3I A;  3ZG0 A;  4I3J A;  2JKG A;  5U47 A;  4YFM A;  3UE0 A;  2G7U A;  4DE3 A;  2XFS A;  3LIB A;  4EV4 A;  2R9X A;  3OCN A;  3FZC A;  2XFT A;  4BBT A;  4HH2 A;  3DBA A;  2JKR I;  1DP8 A;  4JGR A;  3E4Q A;  2PBY A;  3LEQ A;  5EOE A;  2HV1 A;  4LRY C;  1UGU A;  4WZ4 A;  1PWC A;  3V67 A;  1XJ4 A;  2EXB A;  4FUW A;  2VEA A; 
#chains in the Genus database with same CATH homology
 3P7N A;  3NOP C;  1X0O A;  2FZ0 A;  1OT9 A;  4F3L A;  1NLZ A;  2D02 A;  5A8B A;  2WKR A;  4HOI A;  4ETZ A;  3B33 A;  2QJ7 A;  2O0Y A;  5HD5 A;  4HJ6 A;  1H8M A;  1MZU A;  3T4T A;  3F1P B;  4PKY G;  3EGX C;  3MR0 A;  2W3H A;  4O01 A;  1V9Y A;  3S7N A;  3E0Y A;  4ARZ B;  1YSQ A;  3EOI A;  2PHY A;  2A24 B;  5AVE A;  4Y2F A;  3KX0 X;  4GLQ A;  1T19 A;  4HH3 A;  4EER A;  2YKF A;  4BWI A;  4L9G A;  2VJW A;  3LIA A;  1F5M A;  2W3F A;  3T4O A;  1XJ6 A;  1OTA A;  1GSV A;  5J4E A;  3S7Q A;  1KOU A;  4KUK A;  3A0V A;  5HWV A;  3KYQ A;  2VA0 A;  3BQA A;  4CLC D;  4ETX A;  2QKP A;  1ZTU A;  3EQU A;  3S7O A;  2K2N A;  5HWT A;  4CLC A;  5G4Z A;  2B02 A;  2LB5 A;  5DKK A;  4KQO A;  3E4P A;  4HIA A;  2XRN A;  4CLC E;  2XRO A;  1H3Q A;  3VOL A;  4JGQ A;  1OJG A;  2V1A A;  4HP9 A;  2M7V A;  3ULF A;  3HJI A;  1WA9 A;  3EEH A;  3FPV A;  5TBM A;  1IFQ A;  2JKT M;  3R4K A;  3PXP A;  3D72 A;  2OAQ 1;  4HJ3 A;  4OOL A;  4IHQ A;  3B47 A;  2WKP A;  4MCW A;  4EW7 A;  5MC7 A;  5DFY A;  3LIC A;  1TF1 A;  4NXG A;  5L8M A;  3UE3 A;  2INW A;  4EU0 A;  2W3D A;  3C30 A;  3MQ0 A;  4G3W A;  4R38 A;  3K3D A;  2J80 A;  3UE6 A;  2I9V A;  1YSP A;  2JKR M;  3JVV A;  4UEY A;  4O8G A;  2GZA A;  1DRM A;  3VV4 A;  1MC0 A;  1T1A A;  4ZRR A;  3F1N B;  3CWF A;  1ZHH B;  2PR5 A;  1LT0 A;  1OJ5 A;  5DFX A;  4DN0 A;  4YWZ A;  3PBO A;  2HJE A;  3FPW A;  1EW0 A;  4GS9 B;  4MN7 A;  2V9A A;  2KLI A;  2VKS A;  2J3T D;  2QHK A;  1YAX A;  2GX5 A;  1TS6 A;  2W1T A;  3C38 A;  1NRJ A;  5F68 A;  3VE3 A;  5AJG A;  2HGV A;  4WF0 A;  1IOU A;  3GDI A;  3CUE A;  3F1O B;  3U2A A;  1STZ A;  2L0W A;  2EA9 A;  4HJ4 A;  4NXB A;  3VE4 A;  2WKQ A;  2W0N A;  3PBQ A;  2J3T C;  4LLO B;  3IBR A;  1S66 L;  2VV6 A;  1TS7 A;  3H82 B;  4LRZ E;  4H6J A;  2IA2 A;  4XT2 B;  5C5K A;  1T18 A;  2K31 A;  2PYP A;  3OLO A;  2H28 A;  1P9W A;  1P9R A;  3LUQ A;  3G6O A;  4Q0J A;  3KSG A;  1S67 L;  3KSF A;  4HHD A;  3NOT C;  2L4R A;  1W63 Q;  3CIT A;  2JHE A;  3D3O A;  1UWP X;  2QWS A;  1S1Z A;  4E04 A;  4IUH A;  3O5Y A;  2CMN A;  1S4S A;  1TS0 A;  1N9N A;  4PHT A;  4WUJ A;  2VX8 A;  2PD7 A;  1YKD A;  5J3W A;  3CLO A;  3A0R A;  1G28 A;  5J7E A;  5DF9 A;  5HDS A;  4Q0H A;  5F69 A;  4K08 A;  2Y79 A;  4HNB A;  4Y3I A;  4WEJ A;  5TJJ A;  4R3A A;  4L9F A;  4ME4 A;  1VB6 A;  1BYW A;  4I3I A;  4EUV A;  4YOF A;  4M4X A;  2W3E A;  5CX7 A;  4GJ4 A;  5LBR A;  4CLC B;  2PYR A;  1JNU A;  3LR3 A;  3FC7 A;  1MKM A;  5EFW A;  5DJT A;  4CLC C;  1NLY A;  4CQH A;  2XA7 S;  3LID A;  1P97 A;  3ZQ5 A;  4I3A A;  5TBM B;  3UB9 A;  4R70 A;  5G4Y A;  4II7 A;  2J3W A;  4G3K A;  1XFN A;  4Y5F A;  2Z6D A;  3UB8 A;  4R6L A;  1LSV A;  2QJ5 A;  3MXQ A;  3KSH A;  3BY9 A;  2M7U A;  1XFQ A;  3MF0 A;  1ODV A;  2P04 A;  1N9O A;  3MMH A;  3JVU A;  3LIE A;  4JGP A;  3R7W A;  3NHQ A;  3T4K A;  3RFB A;  3IS2 A;  3HCY A;  3TRC A;  4EES A;  2HF6 A;  2V0W A;  3PBN A;  3H7W A;  2PR6 A;  2O9B A;  3TW8 A;  3UMD A;  1OTD A;  2XA7 M;  2YKH A;  5HDC A;  4WN5 A;  4IJG A;  3S7P A;  3OBF A;  2VGL S;  3LR5 A;  2LB9 A;  4Z1W A;  1F98 A;  4B9O A;  3SW1 A;  3CAX A;  4JGO A;  2V1B A;  4NXF A;  1DP6 A;  3P01 A;  2MJ6 A;  2W27 A;  2V0U A;  3T4J A;  3OCL A;  3RTY A;  5HPF A;  2W1T B;  3T4S A;  1OTI A;  1OTB A;  4BMW A;  1DP9 A;  3EEA A;  2EWW A;  2PT7 A;  3ZYT A;  4EEP A;  2D01 A;  4O0P A;  1UWN X;  3PBS A;  1GSW A;  2HJ9 C;  4GHI A;  1W63 M;  4HP4 A;  3ICY A;  2VGL M;  3CUE C;  3MQQ A;  4IUK A;  3BJN A;  3UB7 A;  3UB6 A;  2DMW A;  4B93 A;  1OPX A;  4HY8 A;  2Z6C A;  2VZW A;  4F3L B;  1GSX A;  4H6J B;  3W2Z A;  4DJ3 A;  4NKP A;  3LR4 A;  2L1M A;  3KO6 A;  3A0S A;  3LR0 A;  2KOI A;  5I5L A;  1D06 A;  3FG8 A;  4I39 A;  2OWJ A;  3T4L A;  3PYP A;  3F1P A;  3IBJ A;  1Y28 A;  2NUT C;  3BW6 A;  3EGD C;  4AFI A;  2K7S A;  4HQA A;  4G3V A;  4ARZ A;  3TJZ C;  1T1B A;  5F5Y A;  3K2N A;  5IU1 A;  2A24 A;  4YNR A;  5F6A A;  4WEL A;  5HWW A;  4LPZ A;  1LSX A;  5HPI A;  4OOM A;  2O9A A;  4L0L A;  2ZOH A;  4QPR A;  5FL3 A;  4PAU A;  4GCZ A;  4EEU A;  1F9I A;  1TD5 A;  2P7J A;  5AVF A;  3E4O A;  3LIF A;  3LFV A;  3B42 A;  3KSI A;  4DJ2 A;  2P08 A;  4PKY A;  2EWV A;  4P6Z S;  5KIZ A;  2GNX A;  1XJ3 A;  4UQI S;  2ZBB A;  5HL6 A;  2ZMF A;  4KUO A;  4BBV A;  3UME A;  2O9C A;  3KYZ A;  5K5B A;  4GW9 A;  3OOV A;  4NEE D;  1S4R A;  4EXO A;  2XSS A;  3H9W A;  3K3C A;  4Q0I A;  2M1C A;  3MQO A;  4MMN A;  3TE8 A;  2B18 A;  5IT5 A;  2GJ3 A;  3GEC A;  3LYX A;  4FOF A;  4I38 A;  4WLA A;  3BQ8 A;  3E98 A;  2ZMV A;  2BAS A;  3EQV A;  4MDZ A;  2VV8 A;  3C8C A;  3MFX A;  3T50 A;  4HI4 A;  2OWH A;  3PBR A;  4BJP A;  2JN7 A;  4P6Z M;  2ZOI A;  3LI8 A;  5HSQ A;  4WL9 A;  4EET B;  4UQI M;  3NJA A;  3PHY A;  1N9L A;  1XJ2 A;  2QYB A;  4WEK A;  4KQD A;  2PDR A;  2PD8 A;  4BBU A;  3F1N A;  2W1R A;  3R7W B;  2KX6 A;  1D7E A;  3IS2 B;  5DJU A;  4DMZ A;  4RQ9 A;  3H7W B;  3PR6 A;  5HD3 A;  3NOU C;  2KDK A;  3BWL A;  2R78 A;  4GS9 A;  4EQ1 A;  4MN6 A;  3RH8 B;  1LL8 A;  2JKT I;  1LSW A;  1TS8 A;  3OC2 A;  2A2L A;  4I3J A;  4I5S A;  2NUP C;  5HDD A;  1OT6 A;  5DKL A;  2OAP 1;  2G7U A;  2W3G A;  5HZH A;  3LIB A;  4L9E A;  2O99 A;  3C2W A;  2FH5 A;  5IS1 A;  1T1C A;  3CI6 A;  1NWZ A;  3OCN A;  3F1O A;  1S1Y A;  4FSF A;  1P0Z A;  4BBT A;  2VV7 A;  4HH2 A;  3DBA A;  3LI9 A;  2JKR I;  2VLG A;  4LRX C;  3PBT A;  3EWK A;  1DP8 A;  4NXE A;  4JGR A;  3E4Q A;  1V9Z A;  4GHI B;  2OOL A;  3BY8 A;  2HV1 A;  1VHM A;  4LRY C;  1UGU A;  1G6O A;  4MN5 A;  2Y8H A;  1OTE A;  3H82 A;  3V67 A;  1XJ4 A;  4XT2 A;  5KSH A;  3T4Q A;  3MJQ A;  3HJK A;  2VEA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...