2K31A

Solution structure of cgmp-binding gaf domain of phosphodiesterase 5
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
149
structure length
149
Chain Sequence
DVTALCHKIFLHIHGLISADRYSLFLVCEDSSKDKFLISRLFDVAEGSTLEEASNNCIRLEWNKGIVGHVAAFGEPLNIKDAYEDPRFNAEVDQITGYKTQSILCMPIKNHREEVVGVAQAINKKSGNGGTFTEKDEKDFAEYLAFCGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Phosphodiesterase 5A, cGMP-specific
publication title Solution Structure of the cGMP Binding GAF Domain from Phosphodiesterase 5: Insights into Nucleotide Selectivity, Dimerization, and cGMP-Dependent Conformational Change.
pubmed doi rcsb
source organism Mus musculus
total genus 12
structure length 149
sequence length 149
ec nomenclature ec 3.1.4.35: 3',5'-cyclic-GMP phosphodiesterase.
pdb deposition date 2008-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01590 GAF GAF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2k31A00
2W1TB 3EEAA 3W2ZA 4MDZA 1YSQA 2O0YA 4ETXA 2VEAA 2VZWA 4Y3IA 1YSPA 3E98A 2O9BA 4QPRA 4E04A 3OBFA 4R70A 5AJGA 3NOTC 4FOFA 2VJWA 4G3VA 2LB5A 3ZQ5A 2O9CA 2Y8HA 2O9AA 2O99A 3RFBA 3LFVA 4Y5FA 2IA2A 3HCYA 3KSFA 4DMZA 4Q0IA 2VKSA 3KSHA 5HPIA 3S7QA 3K2NA 2Y79A 5I5LA 2KLIA 1YKDA 2XRNA 4EU0A 5DFYA 2W3GA 5HL6A 3D3OA 1TD5A 1MC0A 3NOUC 4DN0A 1TF1A 5L8MA 5C5KA 2QYBA 1ZTUA 5K5BA 4ETZA 4O8GA 2M7VA 2W3FA 4Y2FA 4O0PA 4MCWA 3S7OA 4MMNA 3G6OA 2OOLA 2W3HA 3IBRA 3KSIA 2XSSA 3C2WA 2K2NA 3R4KA 3MMHA 3DBAA 4GLQA 4O01A 4G3WA 2M7UA 4GW9A 4Z1WA 3NHQA 3OOVA 4IJGA 1F5MA 3MQ0A 2W1TA 2B18A 3CITA 4Q0HA 5LBRA 3MF0A 3S7PA 3NOPC 4G3KA 2XROA 4PAUA 4YOFA 4EUVA 3KO6A 2LB9A 5TJJA 4Q0JA 3TRCA 3S7NA 4IUKA 3BJNA 3IBJA 5HSQA 4MN7A 4ME4A 2HGVA 4LRXC 4BWIA 5DFXA 2GX5A 4RQ9A 2ZMFA 2W3DA 4CQHA 4IUHA 4LRZE 4YNRA 2KOIA 3VV4A 3E0YA 2W3EA 3KSGA 4R6LA 4ZRRA 1VHMA 1MKMA 5HPFA 2W1RA 3O5YA 1STZA 2G7UA 3CI6A 4LRYC 2K31A
chains in the Genus database with same CATH superfamily
1YSQA 2O0YA 2HPBA 3BFEA 1CI8A 2J80A 3UMEA 1TVFA 2VJWA 3GVBA 1DP8A 3FKVA 3HLWA 5DJUA 1YKDA 3UPOA 1IELA 3HLGA 5IHVA 2NUTC 1NZOA 3PAGA 5FQJA 1MY8A 1JWPA 5M18A 1K0KA 1IKGA 2M7VA 3F1OA 4BENA 3CG5A 4S2NA 3F1PA 2EX2A 4WMCA 4IVIA 5L09A 2XSSA 2XD5A 3M2KA 1Z6FA 3HBRA 1IYQA 4E3LA 4MLLA 4G3WA 3OLOA 1NYMA 4GDBA 2QKPA 3P98A 4OQGA 3BQAA 2Z6DA 1W7FA 5EVEA 3H9WA 3B3XA 2XK1A 4NEED 2PD8A 1S0WA 3BECA 1RP5A 5KMWA 4LRXC 1XJ2A 4C3QA 5CHMA 3SH9A 4OH0A 2Y2PA 4KQRA 3KYEA 4IVKA 3ZGAB 4BL2A 2G7UA 1HZOA 3F1NB 1L3LA 1ONGA 3ZFZA 1EW0A 2UWXA 3NDGA 2EFXA 3V67A 5F82A 5GLCA 2HDRA 4OKPA 3O88A 5TR7A 2VEAA 2WKRA 3E2LA 5FQQA 2O99A 2VX8A 2WKIA 1JWZA 3B33A 3CLOA 5F6AA 4OQIA 4EETB 1W5DA 2Y4AA 1JTGA 5CECA 3VP0A 3T12B 4S2LA 3NBLA 3NIAA 2OLUA 4B4XA 1E3UD 4JGQA 2EWWA 5G18A 1CEGA 4PM9A 4WN5A 1XX2A 5HL1A 5DTTA 2PT7A 3AGEA 2PD7A 3UE3A 3V3SA 4Y2FA 2ZOIA 3FPWA 4PM7A 3PBTA 2FZ0A 2HV1A 3S7OA 3MKEA 3A0RA 3KSIA 3MFXA 3T4OA 3IX8A 2EWVA 2V1BA 3F1NA 4Q8IA 4NXBA 4IJGA 1GCEA 3EGDC 3WS4A 5A90A 5DKLA 3ISGA 5DJTA 2HDQA 3HJKA 4EBLA 5TBMA 2B02A 3KO6A 3MR0A 1BULA 3T1QB 5GHZA 1P97A 2ZC4B 4H8RA 4FD8A 1VM1A 2Y55A 5AVEA 1DJAA 3SZTA 1H8ZA 3S22A 1T1AA 1KE3A 2EX8A 4Y3IA 3A3DA 2XDMA 2OSUA 2WZXA 1LSVA 2L0WA 2L1MA 4DXCA 2VGLM 3BRMA 1SDNA 4GB7A 2QJ7A 2VKSA 2C5WB 1I2WA 4KZ3A 4L9GA 3ZG5A 4MBFA 4CJNA 3ZDJA 1LT0A 1S1YA 1KVLA 2PR5A 2JKRI 1W8YA 5F5YA 4OP5A 4HJ6A 1Y4OA 2WUQA 1ZTUA 1ESIA 1MWTA 4B88A 4UHUA 4DKIA 2X71A 1ODVA 4X55A 1GHMA 4BMWA 2Y91A 3K3CA 5CRFA 5BOHA 2P9VA 1NXYA 4NKPA 2ZM0A 5AQ7A 1H5XA 2X02A 3IF6A 4Z1WA 2IWCA 4DDYA 3U4LP 1FOFA 3IX3A 3LUQA 4WBGA 3MXRA 3DWZA 4HJ3A 1QMFA 2KX6A 4PAUA 1XJ3A 4E6WA 1ZHHB 4FUWA 3IBJA 3QP1A 1K4FA 3CAXA 2HGVA 3IXBA 2ZQ9A 1W63M 4A5RA 5EPHA 1E25A 5A93A 4IUHA 4X6TA 2Q9MA 2B95A 4ZRRA 4K91A 3G35A 4NXFA 2W1RA 3S4XA 4WELA 1Y54A 4D60A 3H82B 4FSFA 4S2KA 3W4QA 3NDEA 5EECA 5EM1A 4ETXA 3G2ZA 5E2EA 1G5UA 1N4OA 3MZFA 4GN2A 3P09A 1ESUA 1GHIA 1KDSA 3NOTC 3ZQ5A 2LB5A 3HLCA 4QY5A 1XXMA 4RVAA 3IXDA 2PR6A 2Z2MB 4Q0IA 3WS0A 1IYSA 3T1SA 5HAPA 1BZAA 5JYOA 4EU0A 2ZMAA 3SH7A 3BLMA 4OLDA 4PKYA 2JKFA 5HDCA 2Y2QA 4BD0A 4GKUA 4KZ5A 4F3LA 4O8GA 1XFQA 3Q1FA 4ESPA 1S1ZA 2VV7A 3GR2A 4LGWA 1XP4A 4ID4A 1CJFA 1G6AA 1Y28A 5CXWA 4WZ4A 3H82A 5HZHA 4Y17A 5E43A 4NXGA 1NZUA 3UB8A 2PDRA 1DP6A 2V0UA 3O3VA 2PYPA 2XROA 4L0LA 3LEZA 2ZLYA 4OONA 3PBQA 4MN6A 3T4KA 2V2FF 4ME4A 4GS9B 4JF6A 5U47A 2J8YA 1YLYA 1U60A 2JKTM 2J9OA 1HTZA 3Q81A 1T18A 5DTSA 3V3RA 4F94A 3OC2A 3N6IA 3JYIA 4S2PA 3EWKA 4DE3A 1IYOA 2K7SA 4JGRA 3ZG8B 4LCLA 5CX7A 4HH3A 4HEFA 4L9FA 1BUEA 2A49A 3LCEA 1MBLA 3WS2A 4EERA 4PHTA 1PWGA 2JC7A 4JPMA 5KZHA 1TDLA 1RGYA 3BY8A 3NJAA 2X01A 2WKPA 3ZHHA 4DN0A 5L8MA 3UO9A 3HLBA 5C5KA 3HLEA 2PRFA 3E4PA 4P6ZM 3PHYA 4IBRA 3IWIA 4WUJA 3G34A 1WYCA 3QNBA 2BTFP 5EVID 4UA6A 1PFLA 3MZDA 4GS9A 4I39A 5HFOA 4EXOA 1O7EA 3LI8A 2WZZA 3R4KA 2ACGA 4EQIA 2ZQDA 2A3UA 3LY3A 4YFMA 2ZC5B 4JXVA 3P01A 4R4RA 1MKIA 3CITA 1P9WA 3MKFA 3MBZA 3EGXC 5I94A 3C4PA 4BBVA 5AVFA 3LYXA 4FH4A 3UDFA 3LGOA 1W8QA 3FC7A 5TFQA 2J3TD 5FEGA 4OQ0A 4YNRA 3N4IA 3N8SA 4BLMA 4R6LA 1OTDA 3O5YA 4ZBEA 2EXBA 4ZJ2A 1ES2A 4AFIA 3OZHA 3SOIA 1OJ5A 1YSPA 3IS2B 2ZM8A 5E2GA 2XA7M 4QJGA 2R9WA 3UE0A 4P6BA 2O9AA 1JWVA 3NY4A 3A3IA 3UN7A 4OPYA 2J7VA 1ZG4A 2Y79A 4U3TA 5I5LA 3VMAA 2H0YA 4WM9A 3QP8A 2Y2IA 3HLDA 1FQGA 5AQAA 3C5AA 1T1BA 3MXSA 3E4OA 4QB8A 3CZDA 4WYYA 5KSCA 1PI4A 3ULFA 4EEUA 4O7DA 4EV4A 4KQDA 1GA0A 3ZCZA 3Q7ZA 2Y2KA 1XKZA 4GLQA 5EVIC 5G4ZA 4WLAA 5DTKA 3JVUA 5FQ9A 4IHQA 4DF6A 2FH5A 4JXSA 4GHIB 4ZTKA 3IS2A 3BEBA 3MQQA 3ITAA 4LV1A 5GLDA 2WGWB 1PRQA 2HP5A 3TRCA 1YM1A 4BWIA 1PW1A 1H3QA 5CGSA 3PBRA 1V9ZA 2WGVA 5HDSA 1K55C 2Z6CA 1LI9A 1TS8A 2XQZA 4PKYG 2J3TC 3TG9A 3BM6A 4QPRA 3RH8B 3BLSA 1K6SA 3G31A 3NCKA 3VOZA 2XFTA 2XD1A 4OOYA 4R3BA 5D3OA 3DAVA 5EVIB 3BFCA 4U0TA 1F9IA 5TGFA 2Y2HA 1W79A 3K2NA 3S7QA 4K08A 5FSRA 2H28A 2Y2LA 1FR6A 3PBOA 1XJ6A 5EVLA 5L10A 3OCLA 4PM5A 4R0QA 1GSWA 3UDXA 4GHIA 4X56A 5TBMB 2EX9A 4X69A 2WGWA 5GLBA 3VSLA 1NYYA 3GMWA 4I38A 4O0PA 1FCNA 3GDIA 4MEZA 3LIAA 2H10A 4MBKA 4HQAA 4QU3A 2BASA 5CHJA 1K56D 2B18A 3FPVA 1N9OA 4UA7A 2YKHA 3IF6C 3VP4A 4EUVA 3TSGA 2LB9A 4LPZA 5CTNA 4MN5A 5EVIA 5HSQA 4KUKA 4KQQA 1FCOA 3UB9A 4RQ9A 2BG1A 1AWIA 2JHEA 1OT9A 1IEMA 3G32A 4OVDA 3DTEA 3V5MA 5HWVA 3KX0X 5HD5A 1K6RA 1J3WA 4ZJ3A 5HARA 3C7UA 2ZBBA 1I5QA 2XH9A 1YAXA 3OBFA 5AJGA 3B47A 1DJCA 2P04A 2ZD8A 1K55A 2P9VB 4HESA 1N9NA 5FEFA 3JVVA 3QNCA 2VGJA 3MSHA 4GJ4A 3RXXA 2ZQ7A 2YKFA 3IF6B 1MWRA 3D4FA 3TOIA 3QP2A 2KLIA 4YWZA 5FI2A 5A92A 3D3OA 1Q2PA 1FSYA 3ZNTA 3LR4A 4RX3A 3N8RA 3FG8A 3SS3A 5IT5A 3UE1A 4LV0A 1SKFA 1VEUB 4UA9A 5F69A 2VV8A 3ICYA 4Y15A 1ES4A 3UPNA 4DJ3A 4P0MA 1S6RA 2W0NA 1ERMA 1LL8A 2RCXA 2PBYA 1GHPA 3E2KA 1FIKA 1IYPA 1NLYA 1FR1A 1F2KA 2ZC3B 3O87A 4KZ9A 3L9KA 3S7NA 4EEPA 1YPRA 2JKGA 1CI9A 2UV0E 5DFXA 4XT2B 3V50A 5FDHA 3LIEA 2H0TA 1JNUA 3LIBA 2ZL1B 4NK3A 4RYEA 1G28A 1PW8A 5HAQA 3LIDA 3T4TA 2EA9A 4Z9QA 2V1AA 3TE8A 1L0GA 4K0WA 4FTXA 3RXWA 1K25A 3C4OA 3W2ZA 5DF8A 4F3LB 1VQQA 5J3WA 1EROA 5KSHA 2WAFA 3LR3A 1I2SA 3C8CA 4JXWA 1YLPA 3ZVWA 2O9CA 4DXBA 1VEUA 3LIFA 3AGDA 3RJUA 4DJ2A 2XRNA 3IXHA 3W8KA 3TW8A 1T1CA 3CWFA 5JYPA 4KZBA 5F68A 1SDEA 2G2UA 3IHBA 1OTEA 4I3IA 4JKTA 3T4LA 4BD1A 4LV2A 4XT2A 4LCMA 1N9LA 2OLVA 5EUAA 3ZNYA 3C2WA 2ZL1A 1NY0A 4HP4A 4E3OA 2FFYA 3C30A 5FQIA 3SH8A 5EV0A 4Y13A 4HP9A 4ZJ1A 3MQ0A 1ALQA 4X68A 4UAAA 2V20A 1OTIA 3TJZC 3HJIA 3SS4A 1D7EA 3DTKA 2E8JA 3A3FA 3U2AA 5A8BA 1IFQA 1P0ZA 1OMEA 3N8LA 2DNSA 4EBNA 5CGWA 3CJMA 3H7WA 4HI4A 1YLWA 1STZA 4CPKA 2HDSA 4LLOB 2P74A 4OP8A 3R7WB 4DDSA 2C6WB 1K56A 4EW7A 3EEAA 5FAQA 4MDZA 3LI9A 3E98A 4E04A 1V9YA 1N9BA 2WKEA 1DRMA 1O07A 3BFFA 3ZG7B 3OCNA 1L0DA 1PI5A 4CLCD 2FFFB 4IBXA 3IWOA 3DTIA 4GDNA 4K0XA 5EE8A 4YINA 2Y59A 4LFUA 4X53A 1QMEA 1TD5A 4HHDA 1TF1A 1VB6A 2XF3A 1C3BA 1MXOA 3Q7VB 4QY6A 4PMAA 5K5BA 3IQAA 1UGUA 4WEKA 1OTBA 3E4QA 3PTEA 2WKHA 1J9MA 3G6OA 1LHYA 1WE4A 3LEQA 2JCHA 4MBHA 4BBUA 2JKRM 1IKIA 3M2JA 2AVXA 1XPBA 4GW9A 3R7WA 3UB5P 1TS0A 3VE3A 1UWPX 2H5SA 1L0EA 2E8IA 2WKQA 2B5RA 3MF0A 4KQOA 4HIAA 5HWTA 4QHCA 5TJJA 2XR0A 2EXAA 5AQBA 1S4SA 5FDSA 4X1MA 1DP9A 3OPLA 4OPRA 4CQHA 2V8FA 1D1JA 3KSGA 4S2IA 2XLNA 5J8XA 2D02A 4I3AA 1ZC2A 1VETB 5DF7A 1EWZA 3I7JA 3CI6A 3G2YA 2Y2OA 4UEYA 3Q7VA 2OAQ1 2ZC6B 1AXBA 2IWDA 5CHUA 3VOYA 5HW3A 2HF6A 2WYXA 1M6KA 3IH8A 3HUOA 4IEDA 2VK3A 4R70A 3BY9A 1H8YA 2A24B 1LLBA 4QWOA 2WGIA 1W63Q 1L2SA 2IA2A 5E2FA 5L2FA 5FI7A 1NRJA 2BLSA 2XGNA 5F83A 5CEDA 1E4DA 1BYWA 1ES3A 5HPIA 5DFYA 5F1FA 4E6XA 4CLCC 2OWHA 1LSXA 1KE0A 2QWSA 3FYZA 3GV9A 4UQIM 1K57C 2QMIA 3IF5A 1S4RA 1UWNX 3BQ8A 5FAOA 3M6HA 5AQ9A 3A0VA 1KOUA 3S1YA 2W27A 4EUZA 1NJ4A 4E3JA 1VETA 3T1XA 4C75A 5GL9A 3B42A 4O01A 1ZG6A 4P85A 3GSGA 1F98A 4ZAMA 1F5MA 4XXRA 1A0KA 1BSGA 4G3KA 3LR0A 4KUOA 4U0XA 1SHVA 3HUNA 5J4EA 1HLUP 2A24A 4N9LA 1Z09A 3BJNA 2V0WA 1YQSA 1OT6A 3GRJA 3QP6A 4BJPA 4CLCB 4LRZE 1K38A 2A2LA 3HL9A 3D72A 3ZYTA 3W4OA 1G6OA 1L0FA 1PWCA 1TS6A 1OTAA 2W1TB 1M40A 1ACFA 4OLGA 4EESA 2O9BA 4FH2A 1LSWA 3CPTB 2HJ9C 2ZJ9A 1YT4A 5M1AA 5DF9A 2QJ5A 3HCYA 3A0SA 2GNXA 3NI9A 3VOLA 1TDGA 1XJ4A 1LI0A 1LL5A 2OAP1 3DW0A 4BBTA 5HL6A 3EEHA 5EOEA 5FL3A 1ZKJA 4Y0TA 3W4PA 2MJ6A 2RL3A 2VLGA 2Y2NA 4CLCA 4PM8A 3P7NA 3MFDA 2K2NA 1K57A 2CC1A 3MMHA 1NWZA 3LO7A 4S2JA 3OPRA 1KE4A 2M7UA 1ERQA 3OOVA 3Q07A 1KDWA 2W1TA 2VGKA 5A91A 5LBRA 2VGLS 3NOPC 5HAIA 4E3NA 3CPTA 3NECA 4X25A 2WADA 4JGPA 1MWUA 4E3MA 2PU4A 1XGIA 4R3AA 1H8MA 3WS5A 1YMXA 3E0YA 3LY4A 3QP5A 3EOIA 2ZMVA 3AGFA 1RGZA 5J7EA 2Q0OA 3GECA 4S2MA 1DY6A 2M1CA 3MS6A 1CQAA 4OOLA 3QHYA 2HP9A 3ITBA 4M3KA 1S66L 5KIZA 1PZOA 4FOFA 3FV7A 4II7A 3A3JA 4GNUA 4LENA 4Y5FA 3KSFA 3DTMA 2JBFA 3PR6A 4JBFA 4B4ZA 1TS7A 4PPRA 4E3IA 4GOGA 2I9VA 3VSKA 2GZAA 2KDKA 2W3GA 3PXPA 1XA1A 4I5SA 3CUEC 1XGJA 2J3WA 3GQZA 1CK3A 1GA9A 1MZUA 3UPPA 5GLAA 3MJQA 5DVAA 1HD8A 4ARZB 4FCFA 1YLZA 5CERA 1BLPA 4MMNA 3T4SA 3ZG0A 3IBRA 4PM6A 1PZPA 4KZ8A 3UY6A 2PBDP 4JF5A 4JLFA 1FCMA 2P08A 3IX4A 3PYPA 3NHQA 2DCFA 2JKTI 1XFNA 4YOFA 4EWFA 4RX2A 1DJBA 2PAVP 5L07A 3SW1A 1WYBA 4EBPA 4WF0A 3IWQA 3VFFA 2G2WA 4X1LA 1ONHA 4Y0OA 1YMSA 3T1RA 2XFSA 4KG5A 3IHAA 4DRTA 1YLJA 1VHMA 4KENB 3BWLA 2HJEA 2V1ZA 4N1HA 5FQKA 4HY8A 3FKWA 2PU2A 5E2HA 4NETA 2V8CA 1KGGA 5FQMA 3VE4A 2D01A 5FAPA 3WWXA 3LICA 1K54C 3G4PA 4G3VA 4ARZA 4LV3A 1PNEA 4BL3A 3IT9A 4DE1A 3LFVA 4GZBA 1BLHA 4KZ6A 3LR5A 1SCWA 3D9YA 2PYRA 1BTLA 3BFGA 3G30A 3MXQA 5GHXA 2ZQCA 3HVFA 4GD8A 3WS1A 2HZ5A 4ETZA 3K3DA 3VP1A 2DMWA 2OWJA 4GCZA 4RA7A 2QZ6A 3OPHA 3CUEA 2OOLA 1FSWA 2P7JA 1GSXA 3Q82A 3H7WB 3JPUA 4HBTA 5HDDA 5CEBA 2GJ3A 4EQ1A 3ZVTA 3HREA 1NLZA 4M4XA 4B93A 4Q0HA 5EOOA 1H0MA 4KZ4A 2Y2GA 5CTMA 4Q0JA 4S2OA 4OPZA 4WZ5C 3EQVA 2GX5A 4H6JB 2DRWA 1PIOA 2ZMFA 3T50A 4HH2A 2KOIA 3VV4A 4L9EA 2W3EA 4HNBA 2Z2LB 3PBSA 3T4JA 5MC7A 1MKMA 1SKOB 1T19A 3IXGA 3MZEA 1BLCA 4P6ZS 3IH9A 4D2OA 2EFUA 1OJGA 4R1GA 3KYQA 1K4EA 3FZCA 1Q2QA 3O86A 4KG2A 4OPQA 2ZC7A 3UNWA 2NUPC 4WMCD 4JGOA 3KSHA 2OV5A 2I72A 1JTDA 4KZAA 1JVJA 4R38A 4N92A 1K54A 1G68A 2WK0A 1GSVA 1MC0A 1E3UA 3A3EA 5G4YA 5F1GA 4DE0A 3N7WA 4R4SA 3C7VA 5HWWA 2W3FA 5M19A 3SS5A 1BT5A 5CGXA 3KYZA 4KG6A 4H6JA 5GHYA 4OOMA 3UMDA 1ES5A 2JN7A 1SKOA 4WL9A 1IOUA 4R23A 3DWKA 2XA7S 1CF0A 5FASA 3VP3A 4DE2A 4UQIS 2ZOHA 3EQUA 2VV6A 3S7PA 4JXGA 1LL9A 2EX6A 4Y0UA 3HUMA 3NC8A 4E3KA 3VP2A 2ZQAA 1KGEA 2V9AA 1XA7A 2JE5A 4GD6A 1PYYA 3GTCA 1YLTA 4JF4A 3UE6A 3M6BA 2QPNA 3UB6A 1WA9A 2R78A 5HD3A 1S67L 1D06A 1CEFA 4WEJA 4LRYC 4N9KA 3PAEA 4WZ5A 5FA7A 1HVBA 4I3JA 2INWA 4ZDXA 4QD4A 2VZWA 2VA0A 5FI6A 3CHWP 1MPLA 4C6YA 3NULA 4HJ4A 5FATA 3WRZA 2Y8HA 3RFBA 4Y7PA 5IU1A 3C38A 3T4QA 4DMZA 3BFDA 3WRTA 4N1XA 2Y2MA 3QP4A 4B9OA 1PWDA 4HOIA 2J9PA 1X0OA 1TEMA 4S2NC 3NOUC 3PBNA 2HDUA 2GDNA 4P87A 3V39A 4KZ7A 1SZVA 2QYBA 4XUZA 4HBUA 1BLSA 2Y2JA 3OPPA 1MWSA 3MQOA 2HP6A 4MNRA 3HLFA 3VFHA 2Q9NA 4BQMA 2WAEA 4NG2A 4MCWA 3BYDA 5IS1A 3ZG9B 5EFWA 2W3HA 1EI5A 1RCJA 1FILA 2PHYA 2QHKA 5EM0A 3DBAA 4OQHA 4R3JA 4CLCE 3L7HA 2IWBA 1KVMA 2ZQ8A 4NXEA 1NRFA 3UDIA 2R9XA 2ZM2A 3CMZA 2L4RA 1P9RA 1KGFA 4IUKA 3F1OB 4MN7A 4XUXA 3F1PB 2W3DA 5DKKA 3UB7A 3FWLA 2CMNA 1OPXA 3RTYA 3BW6A 2XEPA 5HPFA 5HX9A 2K31A
chains in the Genus database with same CATH topology
3GECA 2M1CA 3W2ZA 1YSQA 2O0YA 4OOLA 4F3LB 5J3WA 1T18A 5KSHA 1S66L 5KIZA 3LR3A 2J80A 3UMEA 3OC2A 3C8CA 4FOFA 2VJWA 4II7A 2O9CA 1DP8A 3EWKA 2K7SA 3LIFA 4JGRA 4Y5FA 5CX7A 3KSFA 4HH3A 4L9FA 3PR6A 4PHTA 4DJ2A 4EERA 1TS7A 1YKDA 2XRNA 5DJUA 3BY8A 3NJAA 2I9VA 3TW8A 2GZAA 2KDKA 2W3GA 2WKPA 3PXPA 1T1CA 3CWFA 4I5SA 3CUEC 2NUTC 4DN0A 2J3WA 5L8MA 5F68A 5C5KA 1MZUA 3E4PA 1OTEA 4P6ZM 3PHYA 4I3IA 2M7VA 4WUJA 3F1OA 3MJQA 4ARZB 3T4LA 4XT2A 3F1PA 4MMNA 3T4SA 1N9LA 4GS9A 4I39A 4EXOA 3IBRA 2XSSA 3LI8A 3C2WA 4HP4A 3R4KA 2P08A 3C30A 3PYPA 4G3WA 3OLOA 3NHQA 4HP9A 2QKPA 3MQ0A 3P01A 3BQAA 2JKTI 2Z6DA 3CITA 1XFNA 1OTIA 4YOFA 3TJZC 1P9WA 3H9WA 3HJIA 3EGXC 4NEED 2PD8A 4BBVA 3SW1A 1D7EA 5AVFA 3LYXA 4WF0A 4LRXC 1XJ2A 3U2AA 3FC7A 5A8BA 1IFQA 1P0ZA 2J3TD 4YNRA 4R6LA 1VHMA 1OTDA 3H7WA 4HI4A 3BWLA 3O5YA 2HJEA 1STZA 2G7UA 3F1NB 1EW0A 4LLOB 3R7WB 4HY8A 4EW7A 3EEAA 3V67A 4MDZA 4AFIA 3LI9A 2VEAA 1OJ5A 1YSPA 3IS2B 3E98A 3VE4A 2D01A 2WKRA 4E04A 1V9YA 3LICA 2XA7M 1DRMA 4G3VA 4ARZA 2O9AA 2O99A 2VX8A 3OCNA 3B33A 3CLOA 4CLCD 5F6AA 3LFVA 4EETB 2Y79A 5I5LA 3LR5A 4JGQA 2PYRA 2EWWA 3MXQA 1TD5A 4HHDA 1TF1A 1VB6A 4WN5A 1T1BA 3E4OA 5K5BA 2PT7A 1UGUA 2PD7A 4ETZA 3UE3A 3K3DA 4WEKA 4Y2FA 2ZOIA 2DMWA 2OWJA 3FPWA 4GCZA 3ULFA 4EEUA 3PBTA 1OTBA 3E4QA 2FZ0A 2HV1A 3S7OA 3G6OA 3A0RA 3CUEA 2OOLA 4KQDA 2P7JA 3KSIA 1GSXA 3H7WB 3MFXA 4BBUA 3T4OA 2JKRM 2EWVA 4GLQA 2V1BA 3F1NA 2GJ3A 5HDDA 4GW9A 5G4ZA 4NXBA 4WLAA 3R7WA 3JVUA 4EQ1A 4IJGA 4IHQA 1TS0A 3VE3A 1UWPX 1NLZA 2FH5A 3EGDC 4GHIB 4M4XA 4B93A 4Q0HA 2WKQA 3IS2A 3MF0A 3MQQA 5DKLA 5DJTA 4KQOA 3HJKA 5TBMA 2B02A 3KO6A 3MR0A 4HIAA 5HWTA 5TJJA 4Q0JA 3TRCA 1P97A 1S4SA 3EQVA 4BWIA 1DP9A 2GX5A 4H6JB 2ZMFA 4CQHA 3T50A 1H3QA 4HH2A 2KOIA 3PBRA 4L9EA 3VV4A 2W3EA 5AVEA 3KSGA 4HNBA 1V9ZA 2D02A 3PBSA 4I3AA 3T4JA 5MC7A 1MKMA 5HDSA 1T19A 3CI6A 2Z6CA 4P6ZS 1T1AA 1TS8A 4PKYG 1OJGA 4UEYA 2J3TC 2OAQ1 2HF6A 3KYQA 4Y3IA 4QPRA 3RH8B 4R70A 3BY9A 1LSVA 2A24B 2L0WA 2NUPC 2L1MA 2VGLM 1W63Q 2IA2A 2QJ7A 1NRJA 2VKSA 4JGOA 1F9IA 3KSHA 1BYWA 5HPIA 3S7QA 3K2NA 4K08A 4R38A 2H28A 4L9GA 3PBOA 1XJ6A 5DFYA 1LT0A 1S1YA 3OCLA 4CLCC 1GSWA 2JKRI 2PR5A 2OWHA 5J7EA 1GSVA 1MC0A 4GHIA 1LSXA 2QWSA 5F5YA 5TBMB 4HJ6A 4UQIM 5G4YA 1ZTUA 1S4RA 1UWNX 3BQ8A 5HWWA 2W3FA 1ODVA 4I38A 4O0PA 4BMWA 3KYZA 3GDIA 4H6JA 3LIAA 3A0VA 1KOUA 4OOMA 3K3CA 2W27A 3UMDA 4NKPA 2JN7A 4WL9A 1IOUA 4HQAA 3B42A 4O01A 2BASA 4Z1WA 1F98A 2XA7S 1F5MA 3LUQA 2B18A 2ZOHA 3FPVA 1N9OA 4UQIS 2YKHA 3EQUA 2VV6A 3S7PA 4HJ3A 4G3KA 3LR0A 4KUOA 2KX6A 4PAUA 1XJ3A 4EUVA 5J4EA 2LB9A 2A24A 1ZHHB 2V9AA 4LPZA 3BJNA 4MN5A 2V0WA 3IBJA 4KUKA 5HSQA 3CAXA 1OT6A 2HGVA 1W63M 3UE6A 4BJPA 4CLCB 3UB9A 4RQ9A 3UB6A 4IUHA 4LRZE 1WA9A 2R78A 5HD3A 4ZRRA 2A2LA 2JHEA 1OT9A 1S67L 3D72A 1D06A 4NXFA 2W1RA 3ZYTA 4WELA 4WEJA 1G6OA 4LRYC 5HWVA 3H82B 3KX0X 4FSFA 1TS6A 4I3JA 1OTAA 5HD5A 2W1TB 2INWA 4ETXA 2VZWA 2ZBBA 4EESA 2O9BA 2VA0A 1YAXA 1LSWA 3OBFA 5AJGA 4HJ4A 3NOTC 3B47A 3ZQ5A 2LB5A 2Y8HA 2HJ9C 2P04A 3RFBA 5IU1A 1N9NA 2PR6A 5DF9A 2QJ5A 3C38A 3A0SA 3HCYA 3JVVA 3T4QA 2GNXA 4DMZA 4Q0IA 4GJ4A 2YKFA 3VOLA 1XJ4A 2KLIA 4EU0A 4B9OA 4YWZA 2OAP1 4HOIA 1X0OA 4BBTA 5HL6A 3D3OA 3EEHA 3NOUC 3PBNA 5FL3A 4PKYA 5HDCA 2MJ6A 3LR4A 2QYBA 2VLGA 4F3LA 3MQOA 4O8GA 1XFQA 3FG8A 1S1ZA 5IT5A 4CLCA 4MCWA 2VV7A 5IS1A 5F69A 2VV8A 3P7NA 3ICYA 5EFWA 2W3HA 2K2NA 4DJ3A 2PHYA 2QHKA 3MMHA 1NWZA 3DBAA 1Y28A 2M7UA 2W0NA 4CLCE 3H82A 3OOVA 5HZHA 1LL8A 2W1TA 4NXGA 3UB8A 2PDRA 1DP6A 4NXEA 5LBRA 2VGLS 3NOPC 2V0UA 2XROA 2PYPA 4L0LA 1NLYA 3PBQA 2L4RA 1P9RA 4MN6A 4JGPA 4IUKA 3S7NA 3F1OB 3T4KA 4EEPA 4MN7A 4ME4A 4R3AA 1H8MA 5DFXA 4XT2B 3F1PB 3LIEA 2W3DA 4GS9B 5DKKA 3UB7A 1JNUA 3E0YA 2CMNA 1OPXA 3LIBA 3EOIA 2ZMVA 3RTYA 3BW6A 1G28A 5HPFA 3LIDA 3T4TA 2EA9A 2JKTM 2V1AA 3TE8A 2K31A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W1T B;  3EEA A;  3W2Z A;  4MDZ A;  1YSQ A;  2O0Y A;  4ETX A;  2VEA A;  2VZW A;  4Y3I A;  1YSP A;  3E98 A;  2O9B A;  4QPR A;  4E04 A;  3OBF A;  4R70 A;  5AJG A;  3NOT C;  4FOF A;  2VJW A;  4G3V A;  2LB5 A;  3ZQ5 A;  2O9C A;  2Y8H A;  2O9A A;  2O99 A;  3RFB A;  3LFV A;  4Y5F A;  2IA2 A;  3HCY A;  3KSF A;  4DMZ A;  4Q0I A;  2VKS A;  3KSH A;  5HPI A;  3S7Q A;  3K2N A;  2Y79 A;  5I5L A;  2KLI A;  1YKD A;  2XRN A;  4EU0 A;  5DFY A;  2W3G A;  5HL6 A;  3D3O A;  1TD5 A;  1MC0 A;  3NOU C;  4DN0 A;  1TF1 A;  5L8M A;  5C5K A;  2QYB A;  1ZTU A;  5K5B A;  4ETZ A;  4O8G A;  2M7V A;  2W3F A;  4Y2F A;  4O0P A;  4MCW A;  3S7O A;  4MMN A;  3G6O A;  2OOL A;  2W3H A;  3IBR A;  3KSI A;  2XSS A;  3C2W A;  2K2N A;  3R4K A;  3MMH A;  3DBA A;  4GLQ A;  4O01 A;  4G3W A;  2M7U A;  4GW9 A;  4Z1W A;  3NHQ A;  3OOV A;  4IJG A;  1F5M A;  3MQ0 A;  2W1T A;  2B18 A;  3CIT A;  4Q0H A;  5LBR A;  3MF0 A;  3S7P A;  3NOP C;  4G3K A;  2XRO A;  4PAU A;  4YOF A;  4EUV A;  3KO6 A;  2LB9 A;  5TJJ A;  4Q0J A;  3TRC A;  3S7N A;  4IUK A;  3BJN A;  3IBJ A;  5HSQ A;  4MN7 A;  4ME4 A;  2HGV A;  4LRX C;  4BWI A;  5DFX A;  2GX5 A;  4RQ9 A;  2ZMF A;  2W3D A;  4CQH A;  4IUH A;  4LRZ E;  4YNR A;  2KOI A;  3VV4 A;  3E0Y A;  2W3E A;  3KSG A;  4R6L A;  4ZRR A;  1VHM A;  1MKM A;  5HPF A;  2W1R A;  3O5Y A;  1STZ A;  2G7U A;  3CI6 A;  4LRY C;  2K31 A; 
#chains in the Genus database with same CATH topology
 1YSQ A;  2O0Y A;  2HPB A;  3BFE A;  1CI8 A;  2J80 A;  3UME A;  1TVF A;  2VJW A;  3GVB A;  1DP8 A;  3FKV A;  3HLW A;  5DJU A;  1YKD A;  3UPO A;  1IEL A;  3HLG A;  5IHV A;  2NUT C;  1NZO A;  3PAG A;  5FQJ A;  1MY8 A;  1JWP A;  5M18 A;  1K0K A;  1IKG A;  2M7V A;  3F1O A;  4BEN A;  3CG5 A;  4S2N A;  3F1P A;  2EX2 A;  4WMC A;  4IVI A;  5L09 A;  2XSS A;  2XD5 A;  3M2K A;  1Z6F A;  3HBR A;  1IYQ A;  4E3L A;  4MLL A;  4G3W A;  3OLO A;  1NYM A;  4GDB A;  2QKP A;  3P98 A;  4OQG A;  3BQA A;  2Z6D A;  1W7F A;  5EVE A;  3H9W A;  3B3X A;  2XK1 A;  4NEE D;  2PD8 A;  1S0W A;  3BEC A;  1RP5 A;  5KMW A;  4LRX C;  1XJ2 A;  4C3Q A;  5CHM A;  3SH9 A;  4OH0 A;  2Y2P A;  4KQR A;  3KYE A;  4IVK A;  3ZGA B;  4BL2 A;  2G7U A;  1HZO A;  3F1N B;  1L3L A;  1ONG A;  3ZFZ A;  1EW0 A;  2UWX A;  3NDG A;  2EFX A;  3V67 A;  5F82 A;  5GLC A;  2HDR A;  4OKP A;  3O88 A;  5TR7 A;  2VEA A;  2WKR A;  3E2L A;  5FQQ A;  2O99 A;  2VX8 A;  2WKI A;  1JWZ A;  3B33 A;  3CLO A;  5F6A A;  4OQI A;  4EET B;  1W5D A;  2Y4A A;  1JTG A;  5CEC A;  3VP0 A;  3T12 B;  4S2L A;  3NBL A;  3NIA A;  2OLU A;  4B4X A;  1E3U D;  4JGQ A;  2EWW A;  5G18 A;  1CEG A;  4PM9 A;  4WN5 A;  1XX2 A;  5HL1 A;  5DTT A;  2PT7 A;  3AGE A;  2PD7 A;  3UE3 A;  3V3S A;  4Y2F A;  2ZOI A;  3FPW A;  4PM7 A;  3PBT A;  2FZ0 A;  2HV1 A;  3S7O A;  3MKE A;  3A0R A;  3KSI A;  3MFX A;  3T4O A;  3IX8 A;  2EWV A;  2V1B A;  3F1N A;  4Q8I A;  4NXB A;  4IJG A;  1GCE A;  3EGD C;  3WS4 A;  5A90 A;  5DKL A;  3ISG A;  5DJT A;  2HDQ A;  3HJK A;  4EBL A;  5TBM A;  2B02 A;  3KO6 A;  3MR0 A;  1BUL A;  3T1Q B;  5GHZ A;  1P97 A;  2ZC4 B;  4H8R A;  4FD8 A;  1VM1 A;  2Y55 A;  5AVE A;  1DJA A;  3SZT A;  1H8Z A;  3S22 A;  1T1A A;  1KE3 A;  2EX8 A;  4Y3I A;  3A3D A;  2XDM A;  2OSU A;  2WZX A;  1LSV A;  2L0W A;  2L1M A;  4DXC A;  2VGL M;  3BRM A;  1SDN A;  4GB7 A;  2QJ7 A;  2VKS A;  2C5W B;  1I2W A;  4KZ3 A;  4L9G A;  3ZG5 A;  4MBF A;  4CJN A;  3ZDJ A;  1LT0 A;  1S1Y A;  1KVL A;  2PR5 A;  2JKR I;  1W8Y A;  5F5Y A;  4OP5 A;  4HJ6 A;  1Y4O A;  2WUQ A;  1ZTU A;  1ESI A;  1MWT A;  4B88 A;  4UHU A;  4DKI A;  2X71 A;  1ODV A;  4X55 A;  1GHM A;  4BMW A;  2Y91 A;  3K3C A;  5CRF A;  5BOH A;  2P9V A;  1NXY A;  4NKP A;  2ZM0 A;  5AQ7 A;  1H5X A;  2X02 A;  3IF6 A;  4Z1W A;  2IWC A;  4DDY A;  3U4L P;  1FOF A;  3IX3 A;  3LUQ A;  4WBG A;  3MXR A;  3DWZ A;  4HJ3 A;  1QMF A;  2KX6 A;  4PAU A;  1XJ3 A;  4E6W A;  1ZHH B;  4FUW A;  3IBJ A;  3QP1 A;  1K4F A;  3CAX A;  2HGV A;  3IXB A;  2ZQ9 A;  1W63 M;  4A5R A;  5EPH A;  1E25 A;  5A93 A;  4IUH A;  4X6T A;  2Q9M A;  2B95 A;  4ZRR A;  4K91 A;  3G35 A;  4NXF A;  2W1R A;  3S4X A;  4WEL A;  1Y54 A;  4D60 A;  3H82 B;  4FSF A;  4S2K A;  3W4Q A;  3NDE A;  5EEC A;  5EM1 A;  4ETX A;  3G2Z A;  5E2E A;  1G5U A;  1N4O A;  3MZF A;  4GN2 A;  3P09 A;  1ESU A;  1GHI A;  1KDS A;  3NOT C;  3ZQ5 A;  2LB5 A;  3HLC A;  4QY5 A;  1XXM A;  4RVA A;  3IXD A;  2PR6 A;  2Z2M B;  4Q0I A;  3WS0 A;  1IYS A;  3T1S A;  5HAP A;  1BZA A;  5JYO A;  4EU0 A;  2ZMA A;  3SH7 A;  3BLM A;  4OLD A;  4PKY A;  2JKF A;  5HDC A;  2Y2Q A;  4BD0 A;  4GKU A;  4KZ5 A;  4F3L A;  4O8G A;  1XFQ A;  3Q1F A;  4ESP A;  1S1Z A;  2VV7 A;  3GR2 A;  4LGW A;  1XP4 A;  4ID4 A;  1CJF A;  1G6A A;  1Y28 A;  5CXW A;  4WZ4 A;  3H82 A;  5HZH A;  4Y17 A;  5E43 A;  4NXG A;  1NZU A;  3UB8 A;  2PDR A;  1DP6 A;  2V0U A;  3O3V A;  2PYP A;  2XRO A;  4L0L A;  3LEZ A;  2ZLY A;  4OON A;  3PBQ A;  4MN6 A;  3T4K A;  2V2F F;  4ME4 A;  4GS9 B;  4JF6 A;  5U47 A;  2J8Y A;  1YLY A;  1U60 A;  2JKT M;  2J9O A;  1HTZ A;  3Q81 A;  1T18 A;  5DTS A;  3V3R A;  4F94 A;  3OC2 A;  3N6I A;  3JYI A;  4S2P A;  3EWK A;  4DE3 A;  1IYO A;  2K7S A;  4JGR A;  3ZG8 B;  4LCL A;  5CX7 A;  4HH3 A;  4HEF A;  4L9F A;  1BUE A;  2A49 A;  3LCE A;  1MBL A;  3WS2 A;  4EER A;  4PHT A;  1PWG A;  2JC7 A;  4JPM A;  5KZH A;  1TDL A;  1RGY A;  3BY8 A;  3NJA A;  2X01 A;  2WKP A;  3ZHH A;  4DN0 A;  5L8M A;  3UO9 A;  3HLB A;  5C5K A;  3HLE A;  2PRF A;  3E4P A;  4P6Z M;  3PHY A;  4IBR A;  3IWI A;  4WUJ A;  3G34 A;  1WYC A;  3QNB A;  2BTF P;  5EVI D;  4UA6 A;  1PFL A;  3MZD A;  4GS9 A;  4I39 A;  5HFO A;  4EXO A;  1O7E A;  3LI8 A;  2WZZ A;  3R4K A;  2ACG A;  4EQI A;  2ZQD A;  2A3U A;  3LY3 A;  4YFM A;  2ZC5 B;  4JXV A;  3P01 A;  4R4R A;  1MKI A;  3CIT A;  1P9W A;  3MKF A;  3MBZ A;  3EGX C;  5I94 A;  3C4P A;  4BBV A;  5AVF A;  3LYX A;  4FH4 A;  3UDF A;  3LGO A;  1W8Q A;  3FC7 A;  5TFQ A;  2J3T D;  5FEG A;  4OQ0 A;  4YNR A;  3N4I A;  3N8S A;  4BLM A;  4R6L A;  1OTD A;  3O5Y A;  4ZBE A;  2EXB A;  4ZJ2 A;  1ES2 A;  4AFI A;  3OZH A;  3SOI A;  1OJ5 A;  1YSP A;  3IS2 B;  2ZM8 A;  5E2G A;  2XA7 M;  4QJG A;  2R9W A;  3UE0 A;  4P6B A;  2O9A A;  1JWV A;  3NY4 A;  3A3I A;  3UN7 A;  4OPY A;  2J7V A;  1ZG4 A;  2Y79 A;  4U3T A;  5I5L A;  3VMA A;  2H0Y A;  4WM9 A;  3QP8 A;  2Y2I A;  3HLD A;  1FQG A;  5AQA A;  3C5A A;  1T1B A;  3MXS A;  3E4O A;  4QB8 A;  3CZD A;  4WYY A;  5KSC A;  1PI4 A;  3ULF A;  4EEU A;  4O7D A;  4EV4 A;  4KQD A;  1GA0 A;  3ZCZ A;  3Q7Z A;  2Y2K A;  1XKZ A;  4GLQ A;  5EVI C;  5G4Z A;  4WLA A;  5DTK A;  3JVU A;  5FQ9 A;  4IHQ A;  4DF6 A;  2FH5 A;  4JXS A;  4GHI B;  4ZTK A;  3IS2 A;  3BEB A;  3MQQ A;  3ITA A;  4LV1 A;  5GLD A;  2WGW B;  1PRQ A;  2HP5 A;  3TRC A;  1YM1 A;  4BWI A;  1PW1 A;  1H3Q A;  5CGS A;  3PBR A;  1V9Z A;  2WGV A;  5HDS A;  1K55 C;  2Z6C A;  1LI9 A;  1TS8 A;  2XQZ A;  4PKY G;  2J3T C;  3TG9 A;  3BM6 A;  4QPR A;  3RH8 B;  3BLS A;  1K6S A;  3G31 A;  3NCK A;  3VOZ A;  2XFT A;  2XD1 A;  4OOY A;  4R3B A;  5D3O A;  3DAV A;  5EVI B;  3BFC A;  4U0T A;  1F9I A;  5TGF A;  2Y2H A;  1W79 A;  3K2N A;  3S7Q A;  4K08 A;  5FSR A;  2H28 A;  2Y2L A;  1FR6 A;  3PBO A;  1XJ6 A;  5EVL A;  5L10 A;  3OCL A;  4PM5 A;  4R0Q A;  1GSW A;  3UDX A;  4GHI A;  4X56 A;  5TBM B;  2EX9 A;  4X69 A;  2WGW A;  5GLB A;  3VSL A;  1NYY A;  3GMW A;  4I38 A;  4O0P A;  1FCN A;  3GDI A;  4MEZ A;  3LIA A;  2H10 A;  4MBK A;  4HQA A;  4QU3 A;  2BAS A;  5CHJ A;  1K56 D;  2B18 A;  3FPV A;  1N9O A;  4UA7 A;  2YKH A;  3IF6 C;  3VP4 A;  4EUV A;  3TSG A;  2LB9 A;  4LPZ A;  5CTN A;  4MN5 A;  5EVI A;  5HSQ A;  4KUK A;  4KQQ A;  1FCO A;  3UB9 A;  4RQ9 A;  2BG1 A;  1AWI A;  2JHE A;  1OT9 A;  1IEM A;  3G32 A;  4OVD A;  3DTE A;  3V5M A;  5HWV A;  3KX0 X;  5HD5 A;  1K6R A;  1J3W A;  4ZJ3 A;  5HAR A;  3C7U A;  2ZBB A;  1I5Q A;  2XH9 A;  1YAX A;  3OBF A;  5AJG A;  3B47 A;  1DJC A;  2P04 A;  2ZD8 A;  1K55 A;  2P9V B;  4HES A;  1N9N A;  5FEF A;  3JVV A;  3QNC A;  2VGJ A;  3MSH A;  4GJ4 A;  3RXX A;  2ZQ7 A;  2YKF A;  3IF6 B;  1MWR A;  3D4F A;  3TOI A;  3QP2 A;  2KLI A;  4YWZ A;  5FI2 A;  5A92 A;  3D3O A;  1Q2P A;  1FSY A;  3ZNT A;  3LR4 A;  4RX3 A;  3N8R A;  3FG8 A;  3SS3 A;  5IT5 A;  3UE1 A;  4LV0 A;  1SKF A;  1VEU B;  4UA9 A;  5F69 A;  2VV8 A;  3ICY A;  4Y15 A;  1ES4 A;  3UPN A;  4DJ3 A;  4P0M A;  1S6R A;  2W0N A;  1ERM A;  1LL8 A;  2RCX A;  2PBY A;  1GHP A;  3E2K A;  1FIK A;  1IYP A;  1NLY A;  1FR1 A;  1F2K A;  2ZC3 B;  3O87 A;  4KZ9 A;  3L9K A;  3S7N A;  4EEP A;  1YPR A;  2JKG A;  1CI9 A;  2UV0 E;  5DFX A;  4XT2 B;  3V50 A;  5FDH A;  3LIE A;  2H0T A;  1JNU A;  3LIB A;  2ZL1 B;  4NK3 A;  4RYE A;  1G28 A;  1PW8 A;  5HAQ A;  3LID A;  3T4T A;  2EA9 A;  4Z9Q A;  2V1A A;  3TE8 A;  1L0G A;  4K0W A;  4FTX A;  3RXW A;  1K25 A;  3C4O A;  3W2Z A;  5DF8 A;  4F3L B;  1VQQ A;  5J3W A;  1ERO A;  5KSH A;  2WAF A;  3LR3 A;  1I2S A;  3C8C A;  4JXW A;  1YLP A;  3ZVW A;  2O9C A;  4DXB A;  1VEU A;  3LIF A;  3AGD A;  3RJU A;  4DJ2 A;  2XRN A;  3IXH A;  3W8K A;  3TW8 A;  1T1C A;  3CWF A;  5JYP A;  4KZB A;  5F68 A;  1SDE A;  2G2U A;  3IHB A;  1OTE A;  4I3I A;  4JKT A;  3T4L A;  4BD1 A;  4LV2 A;  4XT2 A;  4LCM A;  1N9L A;  2OLV A;  5EUA A;  3ZNY A;  3C2W A;  2ZL1 A;  1NY0 A;  4HP4 A;  4E3O A;  2FFY A;  3C30 A;  5FQI A;  3SH8 A;  5EV0 A;  4Y13 A;  4HP9 A;  4ZJ1 A;  3MQ0 A;  1ALQ A;  4X68 A;  4UAA A;  2V20 A;  1OTI A;  3TJZ C;  3HJI A;  3SS4 A;  1D7E A;  3DTK A;  2E8J A;  3A3F A;  3U2A A;  5A8B A;  1IFQ A;  1P0Z A;  1OME A;  3N8L A;  2DNS A;  4EBN A;  5CGW A;  3CJM A;  3H7W A;  4HI4 A;  1YLW A;  1STZ A;  4CPK A;  2HDS A;  4LLO B;  2P74 A;  4OP8 A;  3R7W B;  4DDS A;  2C6W B;  1K56 A;  4EW7 A;  3EEA A;  5FAQ A;  4MDZ A;  3LI9 A;  3E98 A;  4E04 A;  1V9Y A;  1N9B A;  2WKE A;  1DRM A;  1O07 A;  3BFF A;  3ZG7 B;  3OCN A;  1L0D A;  1PI5 A;  4CLC D;  2FFF B;  4IBX A;  3IWO A;  3DTI A;  4GDN A;  4K0X A;  5EE8 A;  4YIN A;  2Y59 A;  4LFU A;  4X53 A;  1QME A;  1TD5 A;  4HHD A;  1TF1 A;  1VB6 A;  2XF3 A;  1C3B A;  1MXO A;  3Q7V B;  4QY6 A;  4PMA A;  5K5B A;  3IQA A;  1UGU A;  4WEK A;  1OTB A;  3E4Q A;  3PTE A;  2WKH A;  1J9M A;  3G6O A;  1LHY A;  1WE4 A;  3LEQ A;  2JCH A;  4MBH A;  4BBU A;  2JKR M;  1IKI A;  3M2J A;  2AVX A;  1XPB A;  4GW9 A;  3R7W A;  3UB5 P;  1TS0 A;  3VE3 A;  1UWP X;  2H5S A;  1L0E A;  2E8I A;  2WKQ A;  2B5R A;  3MF0 A;  4KQO A;  4HIA A;  5HWT A;  4QHC A;  5TJJ A;  2XR0 A;  2EXA A;  5AQB A;  1S4S A;  5FDS A;  4X1M A;  1DP9 A;  3OPL A;  4OPR A;  4CQH A;  2V8F A;  1D1J A;  3KSG A;  4S2I A;  2XLN A;  5J8X A;  2D02 A;  4I3A A;  1ZC2 A;  1VET B;  5DF7 A;  1EWZ A;  3I7J A;  3CI6 A;  3G2Y A;  2Y2O A;  4UEY A;  3Q7V A;  2OAQ 1;  2ZC6 B;  1AXB A;  2IWD A;  5CHU A;  3VOY A;  5HW3 A;  2HF6 A;  2WYX A;  1M6K A;  3IH8 A;  3HUO A;  4IED A;  2VK3 A;  4R70 A;  3BY9 A;  1H8Y A;  2A24 B;  1LLB A;  4QWO A;  2WGI A;  1W63 Q;  1L2S A;  2IA2 A;  5E2F A;  5L2F A;  5FI7 A;  1NRJ A;  2BLS A;  2XGN A;  5F83 A;  5CED A;  1E4D A;  1BYW A;  1ES3 A;  5HPI A;  5DFY A;  5F1F A;  4E6X A;  4CLC C;  2OWH A;  1LSX A;  1KE0 A;  2QWS A;  3FYZ A;  3GV9 A;  4UQI M;  1K57 C;  2QMI A;  3IF5 A;  1S4R A;  1UWN X;  3BQ8 A;  5FAO A;  3M6H A;  5AQ9 A;  3A0V A;  1KOU A;  3S1Y A;  2W27 A;  4EUZ A;  1NJ4 A;  4E3J A;  1VET A;  3T1X A;  4C75 A;  5GL9 A;  3B42 A;  4O01 A;  1ZG6 A;  4P85 A;  3GSG A;  1F98 A;  4ZAM A;  1F5M A;  4XXR A;  1A0K A;  1BSG A;  4G3K A;  3LR0 A;  4KUO A;  4U0X A;  1SHV A;  3HUN A;  5J4E A;  1HLU P;  2A24 A;  4N9L A;  1Z09 A;  3BJN A;  2V0W A;  1YQS A;  1OT6 A;  3GRJ A;  3QP6 A;  4BJP A;  4CLC B;  4LRZ E;  1K38 A;  2A2L A;  3HL9 A;  3D72 A;  3ZYT A;  3W4O A;  1G6O A;  1L0F A;  1PWC A;  1TS6 A;  1OTA A;  2W1T B;  1M40 A;  1ACF A;  4OLG A;  4EES A;  2O9B A;  4FH2 A;  1LSW A;  3CPT B;  2HJ9 C;  2ZJ9 A;  1YT4 A;  5M1A A;  5DF9 A;  2QJ5 A;  3HCY A;  3A0S A;  2GNX A;  3NI9 A;  3VOL A;  1TDG A;  1XJ4 A;  1LI0 A;  1LL5 A;  2OAP 1;  3DW0 A;  4BBT A;  5HL6 A;  3EEH A;  5EOE A;  5FL3 A;  1ZKJ A;  4Y0T A;  3W4P A;  2MJ6 A;  2RL3 A;  2VLG A;  2Y2N A;  4CLC A;  4PM8 A;  3P7N A;  3MFD A;  2K2N A;  1K57 A;  2CC1 A;  3MMH A;  1NWZ A;  3LO7 A;  4S2J A;  3OPR A;  1KE4 A;  2M7U A;  1ERQ A;  3OOV A;  3Q07 A;  1KDW A;  2W1T A;  2VGK A;  5A91 A;  5LBR A;  2VGL S;  3NOP C;  5HAI A;  4E3N A;  3CPT A;  3NEC A;  4X25 A;  2WAD A;  4JGP A;  1MWU A;  4E3M A;  2PU4 A;  1XGI A;  4R3A A;  1H8M A;  3WS5 A;  1YMX A;  3E0Y A;  3LY4 A;  3QP5 A;  3EOI A;  2ZMV A;  3AGF A;  1RGZ A;  5J7E A;  2Q0O A;  3GEC A;  4S2M A;  1DY6 A;  2M1C A;  3MS6 A;  1CQA A;  4OOL A;  3QHY A;  2HP9 A;  3ITB A;  4M3K A;  1S66 L;  5KIZ A;  1PZO A;  4FOF A;  3FV7 A;  4II7 A;  3A3J A;  4GNU A;  4LEN A;  4Y5F A;  3KSF A;  3DTM A;  2JBF A;  3PR6 A;  4JBF A;  4B4Z A;  1TS7 A;  4PPR A;  4E3I A;  4GOG A;  2I9V A;  3VSK A;  2GZA A;  2KDK A;  2W3G A;  3PXP A;  1XA1 A;  4I5S A;  3CUE C;  1XGJ A;  2J3W A;  3GQZ A;  1CK3 A;  1GA9 A;  1MZU A;  3UPP A;  5GLA A;  3MJQ A;  5DVA A;  1HD8 A;  4ARZ B;  4FCF A;  1YLZ A;  5CER A;  1BLP A;  4MMN A;  3T4S A;  3ZG0 A;  3IBR A;  4PM6 A;  1PZP A;  4KZ8 A;  3UY6 A;  2PBD P;  4JF5 A;  4JLF A;  1FCM A;  2P08 A;  3IX4 A;  3PYP A;  3NHQ A;  2DCF A;  2JKT I;  1XFN A;  4YOF A;  4EWF A;  4RX2 A;  1DJB A;  2PAV P;  5L07 A;  3SW1 A;  1WYB A;  4EBP A;  4WF0 A;  3IWQ A;  3VFF A;  2G2W A;  4X1L A;  1ONH A;  4Y0O A;  1YMS A;  3T1R A;  2XFS A;  4KG5 A;  3IHA A;  4DRT A;  1YLJ A;  1VHM A;  4KEN B;  3BWL A;  2HJE A;  2V1Z A;  4N1H A;  5FQK A;  4HY8 A;  3FKW A;  2PU2 A;  5E2H A;  4NET A;  2V8C A;  1KGG A;  5FQM A;  3VE4 A;  2D01 A;  5FAP A;  3WWX A;  3LIC A;  1K54 C;  3G4P A;  4G3V A;  4ARZ A;  4LV3 A;  1PNE A;  4BL3 A;  3IT9 A;  4DE1 A;  3LFV A;  4GZB A;  1BLH A;  4KZ6 A;  3LR5 A;  1SCW A;  3D9Y A;  2PYR A;  1BTL A;  3BFG A;  3G30 A;  3MXQ A;  5GHX A;  2ZQC A;  3HVF A;  4GD8 A;  3WS1 A;  2HZ5 A;  4ETZ A;  3K3D A;  3VP1 A;  2DMW A;  2OWJ A;  4GCZ A;  4RA7 A;  2QZ6 A;  3OPH A;  3CUE A;  2OOL A;  1FSW A;  2P7J A;  1GSX A;  3Q82 A;  3H7W B;  3JPU A;  4HBT A;  5HDD A;  5CEB A;  2GJ3 A;  4EQ1 A;  3ZVT A;  3HRE A;  1NLZ A;  4M4X A;  4B93 A;  4Q0H A;  5EOO A;  1H0M A;  4KZ4 A;  2Y2G A;  5CTM A;  4Q0J A;  4S2O A;  4OPZ A;  4WZ5 C;  3EQV A;  2GX5 A;  4H6J B;  2DRW A;  1PIO A;  2ZMF A;  3T50 A;  4HH2 A;  2KOI A;  3VV4 A;  4L9E A;  2W3E A;  4HNB A;  2Z2L B;  3PBS A;  3T4J A;  5MC7 A;  1MKM A;  1SKO B;  1T19 A;  3IXG A;  3MZE A;  1BLC A;  4P6Z S;  3IH9 A;  4D2O A;  2EFU A;  1OJG A;  4R1G A;  3KYQ A;  1K4E A;  3FZC A;  1Q2Q A;  3O86 A;  4KG2 A;  4OPQ A;  2ZC7 A;  3UNW A;  2NUP C;  4WMC D;  4JGO A;  3KSH A;  2OV5 A;  2I72 A;  1JTD A;  4KZA A;  1JVJ A;  4R38 A;  4N92 A;  1K54 A;  1G68 A;  2WK0 A;  1GSV A;  1MC0 A;  1E3U A;  3A3E A;  5G4Y A;  5F1G A;  4DE0 A;  3N7W A;  4R4S A;  3C7V A;  5HWW A;  2W3F A;  5M19 A;  3SS5 A;  1BT5 A;  5CGX A;  3KYZ A;  4KG6 A;  4H6J A;  5GHY A;  4OOM A;  3UMD A;  1ES5 A;  2JN7 A;  1SKO A;  4WL9 A;  1IOU A;  4R23 A;  3DWK A;  2XA7 S;  1CF0 A;  5FAS A;  3VP3 A;  4DE2 A;  4UQI S;  2ZOH A;  3EQU A;  2VV6 A;  3S7P A;  4JXG A;  1LL9 A;  2EX6 A;  4Y0U A;  3HUM A;  3NC8 A;  4E3K A;  3VP2 A;  2ZQA A;  1KGE A;  2V9A A;  1XA7 A;  2JE5 A;  4GD6 A;  1PYY A;  3GTC A;  1YLT A;  4JF4 A;  3UE6 A;  3M6B A;  2QPN A;  3UB6 A;  1WA9 A;  2R78 A;  5HD3 A;  1S67 L;  1D06 A;  1CEF A;  4WEJ A;  4LRY C;  4N9K A;  3PAE A;  4WZ5 A;  5FA7 A;  1HVB A;  4I3J A;  2INW A;  4ZDX A;  4QD4 A;  2VZW A;  2VA0 A;  5FI6 A;  3CHW P;  1MPL A;  4C6Y A;  3NUL A;  4HJ4 A;  5FAT A;  3WRZ A;  2Y8H A;  3RFB A;  4Y7P A;  5IU1 A;  3C38 A;  3T4Q A;  4DMZ A;  3BFD A;  3WRT A;  4N1X A;  2Y2M A;  3QP4 A;  4B9O A;  1PWD A;  4HOI A;  2J9P A;  1X0O A;  1TEM A;  4S2N C;  3NOU C;  3PBN A;  2HDU A;  2GDN A;  4P87 A;  3V39 A;  4KZ7 A;  1SZV A;  2QYB A;  4XUZ A;  4HBU A;  1BLS A;  2Y2J A;  3OPP A;  1MWS A;  3MQO A;  2HP6 A;  4MNR A;  3HLF A;  3VFH A;  2Q9N A;  4BQM A;  2WAE A;  4NG2 A;  4MCW A;  3BYD A;  5IS1 A;  3ZG9 B;  5EFW A;  2W3H A;  1EI5 A;  1RCJ A;  1FIL A;  2PHY A;  2QHK A;  5EM0 A;  3DBA A;  4OQH A;  4R3J A;  4CLC E;  3L7H A;  2IWB A;  1KVM A;  2ZQ8 A;  4NXE A;  1NRF A;  3UDI A;  2R9X A;  2ZM2 A;  3CMZ A;  2L4R A;  1P9R A;  1KGF A;  4IUK A;  3F1O B;  4MN7 A;  4XUX A;  3F1P B;  2W3D A;  5DKK A;  3UB7 A;  3FWL A;  2CMN A;  1OPX A;  3RTY A;  3BW6 A;  2XEP A;  5HPF A;  5HX9 A;  2K31 A; 
#chains in the Genus database with same CATH homology
 3GEC A;  2M1C A;  3W2Z A;  1YSQ A;  2O0Y A;  4OOL A;  4F3L B;  5J3W A;  1T18 A;  5KSH A;  1S66 L;  5KIZ A;  3LR3 A;  2J80 A;  3UME A;  3OC2 A;  3C8C A;  4FOF A;  2VJW A;  4II7 A;  2O9C A;  1DP8 A;  3EWK A;  2K7S A;  3LIF A;  4JGR A;  4Y5F A;  5CX7 A;  3KSF A;  4HH3 A;  4L9F A;  3PR6 A;  4PHT A;  4DJ2 A;  4EER A;  1TS7 A;  1YKD A;  2XRN A;  5DJU A;  3BY8 A;  3NJA A;  2I9V A;  3TW8 A;  2GZA A;  2KDK A;  2W3G A;  2WKP A;  3PXP A;  1T1C A;  3CWF A;  4I5S A;  3CUE C;  2NUT C;  4DN0 A;  2J3W A;  5L8M A;  5F68 A;  5C5K A;  1MZU A;  3E4P A;  1OTE A;  4P6Z M;  3PHY A;  4I3I A;  2M7V A;  4WUJ A;  3F1O A;  3MJQ A;  4ARZ B;  3T4L A;  4XT2 A;  3F1P A;  4MMN A;  3T4S A;  1N9L A;  4GS9 A;  4I39 A;  4EXO A;  3IBR A;  2XSS A;  3LI8 A;  3C2W A;  4HP4 A;  3R4K A;  2P08 A;  3C30 A;  3PYP A;  4G3W A;  3OLO A;  3NHQ A;  4HP9 A;  2QKP A;  3MQ0 A;  3P01 A;  3BQA A;  2JKT I;  2Z6D A;  3CIT A;  1XFN A;  1OTI A;  4YOF A;  3TJZ C;  1P9W A;  3H9W A;  3HJI A;  3EGX C;  4NEE D;  2PD8 A;  4BBV A;  3SW1 A;  1D7E A;  5AVF A;  3LYX A;  4WF0 A;  4LRX C;  1XJ2 A;  3U2A A;  3FC7 A;  5A8B A;  1IFQ A;  1P0Z A;  2J3T D;  4YNR A;  4R6L A;  1VHM A;  1OTD A;  3H7W A;  4HI4 A;  3BWL A;  3O5Y A;  2HJE A;  1STZ A;  2G7U A;  3F1N B;  1EW0 A;  4LLO B;  3R7W B;  4HY8 A;  4EW7 A;  3EEA A;  3V67 A;  4MDZ A;  4AFI A;  3LI9 A;  2VEA A;  1OJ5 A;  1YSP A;  3IS2 B;  3E98 A;  3VE4 A;  2D01 A;  2WKR A;  4E04 A;  1V9Y A;  3LIC A;  2XA7 M;  1DRM A;  4G3V A;  4ARZ A;  2O9A A;  2O99 A;  2VX8 A;  3OCN A;  3B33 A;  3CLO A;  4CLC D;  5F6A A;  3LFV A;  4EET B;  2Y79 A;  5I5L A;  3LR5 A;  4JGQ A;  2PYR A;  2EWW A;  3MXQ A;  1TD5 A;  4HHD A;  1TF1 A;  1VB6 A;  4WN5 A;  1T1B A;  3E4O A;  5K5B A;  2PT7 A;  1UGU A;  2PD7 A;  4ETZ A;  3UE3 A;  3K3D A;  4WEK A;  4Y2F A;  2ZOI A;  2DMW A;  2OWJ A;  3FPW A;  4GCZ A;  3ULF A;  4EEU A;  3PBT A;  1OTB A;  3E4Q A;  2FZ0 A;  2HV1 A;  3S7O A;  3G6O A;  3A0R A;  3CUE A;  2OOL A;  4KQD A;  2P7J A;  3KSI A;  1GSX A;  3H7W B;  3MFX A;  4BBU A;  3T4O A;  2JKR M;  2EWV A;  4GLQ A;  2V1B A;  3F1N A;  2GJ3 A;  5HDD A;  4GW9 A;  5G4Z A;  4NXB A;  4WLA A;  3R7W A;  3JVU A;  4EQ1 A;  4IJG A;  4IHQ A;  1TS0 A;  3VE3 A;  1UWP X;  1NLZ A;  2FH5 A;  3EGD C;  4GHI B;  4M4X A;  4B93 A;  4Q0H A;  2WKQ A;  3IS2 A;  3MF0 A;  3MQQ A;  5DKL A;  5DJT A;  4KQO A;  3HJK A;  5TBM A;  2B02 A;  3KO6 A;  3MR0 A;  4HIA A;  5HWT A;  5TJJ A;  4Q0J A;  3TRC A;  1P97 A;  1S4S A;  3EQV A;  4BWI A;  1DP9 A;  2GX5 A;  4H6J B;  2ZMF A;  4CQH A;  3T50 A;  1H3Q A;  4HH2 A;  2KOI A;  3PBR A;  4L9E A;  3VV4 A;  2W3E A;  5AVE A;  3KSG A;  4HNB A;  1V9Z A;  2D02 A;  3PBS A;  4I3A A;  3T4J A;  5MC7 A;  1MKM A;  5HDS A;  1T19 A;  3CI6 A;  2Z6C A;  4P6Z S;  1T1A A;  1TS8 A;  4PKY G;  1OJG A;  4UEY A;  2J3T C;  2OAQ 1;  2HF6 A;  3KYQ A;  4Y3I A;  4QPR A;  3RH8 B;  4R70 A;  3BY9 A;  1LSV A;  2A24 B;  2L0W A;  2NUP C;  2L1M A;  2VGL M;  1W63 Q;  2IA2 A;  2QJ7 A;  1NRJ A;  2VKS A;  4JGO A;  1F9I A;  3KSH A;  1BYW A;  5HPI A;  3S7Q A;  3K2N A;  4K08 A;  4R38 A;  2H28 A;  4L9G A;  3PBO A;  1XJ6 A;  5DFY A;  1LT0 A;  1S1Y A;  3OCL A;  4CLC C;  1GSW A;  2JKR I;  2PR5 A;  2OWH A;  5J7E A;  1GSV A;  1MC0 A;  4GHI A;  1LSX A;  2QWS A;  5F5Y A;  5TBM B;  4HJ6 A;  4UQI M;  5G4Y A;  1ZTU A;  1S4R A;  1UWN X;  3BQ8 A;  5HWW A;  2W3F A;  1ODV A;  4I38 A;  4O0P A;  4BMW A;  3KYZ A;  3GDI A;  4H6J A;  3LIA A;  3A0V A;  1KOU A;  4OOM A;  3K3C A;  2W27 A;  3UMD A;  4NKP A;  2JN7 A;  4WL9 A;  1IOU A;  4HQA A;  3B42 A;  4O01 A;  2BAS A;  4Z1W A;  1F98 A;  2XA7 S;  1F5M A;  3LUQ A;  2B18 A;  2ZOH A;  3FPV A;  1N9O A;  4UQI S;  2YKH A;  3EQU A;  2VV6 A;  3S7P A;  4HJ3 A;  4G3K A;  3LR0 A;  4KUO A;  2KX6 A;  4PAU A;  1XJ3 A;  4EUV A;  5J4E A;  2LB9 A;  2A24 A;  1ZHH B;  2V9A A;  4LPZ A;  3BJN A;  4MN5 A;  2V0W A;  3IBJ A;  4KUK A;  5HSQ A;  3CAX A;  1OT6 A;  2HGV A;  1W63 M;  3UE6 A;  4BJP A;  4CLC B;  3UB9 A;  4RQ9 A;  3UB6 A;  4IUH A;  4LRZ E;  1WA9 A;  2R78 A;  5HD3 A;  4ZRR A;  2A2L A;  2JHE A;  1OT9 A;  1S67 L;  3D72 A;  1D06 A;  4NXF A;  2W1R A;  3ZYT A;  4WEL A;  4WEJ A;  1G6O A;  4LRY C;  5HWV A;  3H82 B;  3KX0 X;  4FSF A;  1TS6 A;  4I3J A;  1OTA A;  5HD5 A;  2W1T B;  2INW A;  4ETX A;  2VZW A;  2ZBB A;  4EES A;  2O9B A;  2VA0 A;  1YAX A;  1LSW A;  3OBF A;  5AJG A;  4HJ4 A;  3NOT C;  3B47 A;  3ZQ5 A;  2LB5 A;  2Y8H A;  2HJ9 C;  2P04 A;  3RFB A;  5IU1 A;  1N9N A;  2PR6 A;  5DF9 A;  2QJ5 A;  3C38 A;  3A0S A;  3HCY A;  3JVV A;  3T4Q A;  2GNX A;  4DMZ A;  4Q0I A;  4GJ4 A;  2YKF A;  3VOL A;  1XJ4 A;  2KLI A;  4EU0 A;  4B9O A;  4YWZ A;  2OAP 1;  4HOI A;  1X0O A;  4BBT A;  5HL6 A;  3D3O A;  3EEH A;  3NOU C;  3PBN A;  5FL3 A;  4PKY A;  5HDC A;  2MJ6 A;  3LR4 A;  2QYB A;  2VLG A;  4F3L A;  3MQO A;  4O8G A;  1XFQ A;  3FG8 A;  1S1Z A;  5IT5 A;  4CLC A;  4MCW A;  2VV7 A;  5IS1 A;  5F69 A;  2VV8 A;  3P7N A;  3ICY A;  5EFW A;  2W3H A;  2K2N A;  4DJ3 A;  2PHY A;  2QHK A;  3MMH A;  1NWZ A;  3DBA A;  1Y28 A;  2M7U A;  2W0N A;  4CLC E;  3H82 A;  3OOV A;  5HZH A;  1LL8 A;  2W1T A;  4NXG A;  3UB8 A;  2PDR A;  1DP6 A;  4NXE A;  5LBR A;  2VGL S;  3NOP C;  2V0U A;  2XRO A;  2PYP A;  4L0L A;  1NLY A;  3PBQ A;  2L4R A;  1P9R A;  4MN6 A;  4JGP A;  4IUK A;  3S7N A;  3F1O B;  3T4K A;  4EEP A;  4MN7 A;  4ME4 A;  4R3A A;  1H8M A;  5DFX A;  4XT2 B;  3F1P B;  3LIE A;  2W3D A;  4GS9 B;  5DKK A;  3UB7 A;  1JNU A;  3E0Y A;  2CMN A;  1OPX A;  3LIB A;  3EOI A;  2ZMV A;  3RTY A;  3BW6 A;  1G28 A;  5HPF A;  3LID A;  3T4T A;  2EA9 A;  2JKT M;  2V1A A;  3TE8 A;  2K31 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...