2K31A

Solution structure of cgmp-binding gaf domain of phosphodiesterase 5
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
149
structure length
149
Chain Sequence
DVTALCHKIFLHIHGLISADRYSLFLVCEDSSKDKFLISRLFDVAEGSTLEEASNNCIRLEWNKGIVGHVAAFGEPLNIKDAYEDPRFNAEVDQITGYKTQSILCMPIKNHREEVVGVAQAINKKSGNGGTFTEKDEKDFAEYLAFCGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Solution Structure of the cGMP Binding GAF Domain from Phosphodiesterase 5: Insights into Nucleotide Selectivity, Dimerization, and cGMP-Dependent Conformational Change.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase
molecule keywords Phosphodiesterase 5A, cGMP-specific
total genus 12
structure length 149
sequence length 149
ec nomenclature ec 3.1.4.35: 3',5'-cyclic-GMP phosphodiesterase.
pdb deposition date 2008-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01590 GAF GAF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2k31A00
1VHMA 2VZWA 4E04A 4MDZA 3MF0A 1F5MA 3MQ0A 4Q0IA 2W3EA 2Y8HA 5DFYA 2VKSA 1MKMA 1STZA 2W3GA 4MMNA 5AJGA 2LB9A 3KSHA 3G6OA 4CQHA 2XRNA 4GLQA 2O0YA 2K31A 2O99A 3E98A 2W3HA 4EUVA 3KSFA 3NOTC 4LRXC 4Y3IA 3VV4A 4O01A 3EEAA 3MMHA 3O5YA 2OOLA 2O9CA 4R70A 3CI6A 5I5LA 4O0PA 1YKDA 3IBJA 5HPIA 4Z1WA 4LRYC 3S7OA 3KSIA 2LB5A 3RFBA 2K2NA 2G7UA 5LBRA 4O8GA 2XSSA 4G3KA 4G3WA 5L8MA 3KO6A 3W2ZA 1TD5A 1TF1A 4FOFA 2KOIA 5HL6A 3CITA 3OOVA 2M7VA 3NOPC 1YSPA 3D3OA 4Y2FA 2W3FA 4PAUA 3BJNA 3HCYA 4BWIA 2B18A 4DN0A 2VEAA 4Q0HA 1YSQA 2IA2A 2W1TA 4DMZA 5HPFA 1ZTUA 3OBFA 4ETZA 3S7QA 5TJJA 4YOFA 1MC0A 2W1TB 3NOUC 3TRCA 4MN7A 2HGVA 3IBRA 5K5BA 3KSGA 2O9BA 5DFXA 4IUHA 3DBAA 4Q0JA 2QYBA 4MCWA 4G3VA 4QPRA 4YNRA 4GW9A 4ETXA 4RQ9A 3E0YA 5HSQA 2O9AA 3S7NA 4ME4A 2XROA 3R4KA 3C2WA 2KLIA 4LRZE 3K2NA 4EU0A 2W3DA 4R6LA 2ZMFA 2GX5A 4ZRRA 2M7UA 3LFVA 2VJWA 3NHQA 5C5KA 4Y5FA 4IJGA 2W1RA 4IUKA 3S7PA 3ZQ5A 2Y79A
chains in the Genus database with same CATH superfamily
1F9IA 4HBTA 3MF0A 4Q0IA 2WZZA 5A92A 1K56D 4S2LA 4E3NA 3FPVA 3IXDA 3OCNA 4LPZA 4GKUA 1V9ZA 4K0WA 3D9YA 3B47A 3OPPA 4JKTA 1YKDA 4HESA 2AVXA 1L0FA 1ES4A 2A24B 2Q9MA 4NETA 1CEGA 4YINA 4P85A 5F69A 4OPYA 1N9BA 2PD8A 1ES5A 1NJ4A 5GLDA 2ZQ8A 3PAGA 2M7VA 4CLCB 1TS0A 4IVKA 2Y2KA 4R4RA 2W3FA 3QNCA 5A91A 3BJNA 4XT2A 5IHVA 4DN0A 2PT7A 4X69A 3FG8A 4LV3A 2PBYA 3DAVA 5HAIA 4RVAA 4JXWA 5DKKA 3C4OA 4YOFA 2EX8A 1YLJA 5F83A 4EETB 5AVEA 3A3FA 5GHXA 4MNRA 4KG5A 2V1BA 3BWLA 3VFHA 1J9MA 2VV7A 4FH4A 5CHMA 3V5MA 5CXWA 3AGDA 1M6KA 2Y2IA 4EQIA 1ES3A 1BSGA 2XROA 5EVLA 2P74A 1H8YA 3B33A 1DY6A 1K54A 4ZRRA 2YKFA 4BBTA 3NHQA 1CQAA 1BLPA 1KOUA 3QP5A 4I3AA 3N4IA 5KSHA 1UWPX 1NYMA 1OJ5A 5TBMA 1X0OA 4R23A 5FQ9A 1KE0A 3DTMA 1BTLA 3W4PA 1DP8A 1FILA 1XFQA 1VM1A 3UPPA 1N9LA 2ZL1B 4C6YA 3E98A 4YFMA 4O01A 3UPOA 2JKTI 3OZHA 2WKRA 2O9CA 4KZ9A 1E25A 3IBJA 2EX9A 3FC7A 1FCNA 1NRJA 3LCEA 1WYBA 4Y0TA 1A0KA 2EWVA 4LV1A 4DRTA 2ZQ7A 1FCOA 3KO6A 5F1FA 5HDSA 3PBSA 3VP2A 4MBKA 1BLCA 3IX4A 3V3SA 3LIBA 1IFQA 4B9OA 3VE3A 1K4EA 3PBTA 3PBOA 4BL2A 2ZD8A 2X02A 2GNXA 4ETZA 3UMDA 1E3UA 1MXOA 1H3QA 3ITAA 1PWCA 1S4SA 4IUHA 5GL9A 5EPHA 4Q8IA 2G2UA 4YNRA 5A93A 1T18A 1L0DA 2J3TC 3E0YA 4UEYA 2DRWA 3GR2A 1VETA 2WKHA 3E2LA 3IF6C 3LI8A 4EU0A 4JGQA 5JYPA 5CECA 4CLCC 3IX3A 1GHPA 5KZHA 2W1RA 4WELA 2EFUA 1F5MA 2UV0E 3ZFZA 2WKIA 1ODVA 4D2OA 1ZHHB 1KVMA 2HDUA 5E2EA 3BW6A 4KUKA 4S2NC 1E3UD 1S0WA 1BLSA 3VP1A 2ZM0A 2W0NA 2WUQA 2EWWA 2XF3A 5HPIA 1IEMA 4DJ3A 3NCKA 1Q2PA 2WZXA 4HI4A 3DW0A 2V1AA 4ZJ2A 1P9WA 3KYZA 4DE3A 5L8MA 1NXYA 3OPHA 2VX8A 1TD5A 4OONA 3M2JA 1JNUA 2NUTC 4X68A 4H6JA 4NKPA 1JWPA 2QWSA 4R1GA 1RGYA 3HLGA 4X25A 3HLWA 4LCMA 3LUQA 3ZG0A 3Q81A 3RJUA 1YT4A 2Q9NA 1FQGA 4JLFA 5CTMA 2HJEA 4Q0JA 2C6WB 4HOIA 4N9LA 1JTDA 3MKFA 5FI2A 2Y2LA 4WZ5C 1VEUA 4OPZA 3N7WA 1XP4A 1GA0A 4JGRA 3ZNTA 2KLIA 1L0EA 3PR6A 2JHEA 3O3VA 4EWFA 2JKGA 1SCWA 2VJWA 4HY8A 5L10A 1RCJA 2WKQA 2XFTA 2E8IA 3QP8A 3S7PA 5JYOA 4JF4A 1PW1A 3G30A 2JKTM 5HD3A 1OTBA 2OLUA 1NWZA 3T4TA 4GLQA 1DP6A 4WM9A 1GSWA 1P97A 3E4QA 1J3WA 3B42A 3A3EA 4OOMA 3UN7A 1BULA 1YLZA 2CC1A 3SZTA 3IQAA 3A3DA 1XJ3A 3IF6B 4RX3A 5U47A 5LBRA 3ZVTA 3DWZA 5TFQA 2KOIA 5HL6A 3OOVA 4U0XA 4X6TA 5HAPA 3C8CA 3IH9A 5FEGA 4CPKA 1F98A 1TS7A 1L3LA 3NJAA 3RXWA 1W7FA 4EW7A 1SKFA 1OTAA 3DTIA 4HJ3A 2Z6CA 2ZMVA 2D02A 3BQ8A 4OLGA 4D60A 2XA7S 4I38A 3WS0A 5DFXA 1Y28A 2EXAA 4GCZA 4MCWA 4B4XA 4OQIA 4ETXA 3BLSA 1YLPA 1ERMA 4E3OA 3S7NA 3A0RA 4EUZA 3T4OA 1PW8A 5EE8A 2FH5A 5HD5A 2OV5A 3ZG7B 1SDNA 4P6ZS 5M19A 3NECA 3IF5A 3AGFA 2B5RA 3GRJA 2HP6A 1YLWA 4IJGA 3EQVA 4JXVA 4KQQA 3BY8A 5E2HA 2Y59A 3C7UA 5DFYA 2CMNA 3T4JA 4EEUA 2M1CA 1FSYA 3A3JA 5HDDA 2JC7A 3VSKA 1IOUA 4OH0A 1YAXA 5EVIC 5A8BA 3MR0A 3CZDA 1LL8A 3UPNA 3EEAA 3CJMA 4Y0UA 4FCFA 1G28A 4B88A 2A2LA 4HJ4A 2A24A 4KQRA 5FAQA 3BEBA 1EI5A 4F3LA 2G7UA 5EM0A 1PWGA 4R3AA 3W2ZA 5GLAA 4DKIA 4BL3A 1GA9A 2HJ9C 5CERA 3HBRA 3R7WB 1IELA 2ZL1A 1TDLA 2WKEA 2VLGA 3BYDA 3MXQA 4P6ZM 4CJNA 3F1PA 5EECA 5DJTA 1H0MA 1ACFA 1O07A 4PPRA 4NXFA 4P0MA 4BENA 1S66L 2XH9A 1ZC2A 1U60A 3SH9A 4G3VA 1TS6A 2HF6A 1H5XA 1T1CA 3G32A 2DCFA 1OTDA 4H8RA 4KZBA 4QWOA 4MN5A 4E3MA 1KE4A 3L7HA 3FZCA 3ZDJA 3IWIA 5FL3A 2XLNA 4B93A 2GX5A 3C7VA 4NEED 3NC8A 1G68A 4LGWA 3MQ0A 3MFDA 3UB8A 1GSXA 3PHYA 5TBMB 3F1OA 4LLOB 1H8ZA 2W27A 3TE8A 1YMSA 3D72A 1WYCA 4GDNA 2K31A 2IWDA 1OMEA 3SW1A 3G2ZA 3O5YA 5E2GA 2Q0OA 1EW0A 2WAFA 3HLDA 1PIOA 2GJ3A 4DE1A 5HWVA 1IKIA 3NBLA 3TG9A 3BFGA 1NY0A 1K4FA 4WYYA 2WK0A 2V20A 1S1YA 4GDBA 4L9GA 2IA2A 2V0WA 3MXRA 4PM8A 3IH8A 3LR5A 3T4LA 2H28A 4MN7A 4BBVA 4CLCD 3SS4A 3CPTA 5F82A 2VGKA 3ZCZA 3I7JA 4OOLA 3JYIA 3O87A 3WRTA 2VGLM 5DJUA 3LEZA 3O88A 5MC7A 1BYWA 1VETB 2ZJ9A 2WGWA 1O7EA 3HL9A 3OCLA 4RYEA 4WEKA 4EBPA 1PYYA 2ZC5B 3N8SA 2BG1A 2Z2LB 2ZQCA 3QP1A 4U3TA 4E3KA 1PZOA 2W3GA 3HJIA 4WMCA 1VB6A 3G6OA 1T19A 4DF6A 3LYXA 5L2FA 4PKYA 1FR6A 5FQMA 4GZBA 4EUVA 1LI9A 5KSCA 4KZ7A 1PZPA 4EXOA 1XJ2A 1XPBA 2X01A 2V1ZA 3S7OA 3BRMA 3A0VA 1K6SA 1XA1A 5HWTA 3LO7A 2I9VA 5AQAA 1K55A 3LIDA 1LI0A 3PBQA 3MJQA 4KZ5A 1GCEA 3UO9A 2J9OA 1F2KA 3A0SA 2QHKA 2UWXA 4ARZB 5HPFA 1TS8A 3OBFA 3UE6A 4I3JA 1AWIA 2XR0A 3OC2A 1G6OA 2OWJA 3GTCA 3EOIA 4RX2A 3TRCA 2XFSA 3RH8B 4GD8A 1OTEA 3C4PA 3N6IA 2H10A 4QPRA 5FQIA 4PHTA 4WBGA 2H0YA 2JKFA 4RQ9A 4I39A 1LSWA 3IXBA 1IYSA 3QP2A 3EGDC 1Z6FA 4F3LB 3T4SA 1IYQA 2BLSA 3K2NA 4IHQA 4BD1A 1GHMA 2Y2MA 4QHCA 4E3JA 4F94A 1LLBA 3FKVA 2HPBA 4BMWA 1K57C 3ZQ5A 1VHMA 4KZAA 5HFOA 3HLFA 5TGFA 3VSLA 4WEJA 3T1XA 1KDSA 1KGEA 3E2KA 2V0UA 3KX0X 5J8XA 3UDXA 2YKHA 1W63Q 2O99A 1HTZA 4KZ3A 1OPXA 5I94A 3VP0A 4U0TA 2Y55A 5L09A 1D06A 1I2SA 4GOGA 2P08A 5GHZA 2ACGA 3VP4A 5FI7A 4ZJ3A 4G3WA 3NI9A 3BY9A 4QU3A 2PR6A 4JGPA 5FA7A 5M1AA 4QY6A 5G18A 4X56A 4PM5A 5EVIA 3O86A 3M2KA 3ITBA 1NZUA 3P98A 3MZEA 5EVID 2KX6A 3U2AA 2QMIA 3CUEC 1CJFA 3LIFA 1I2WA 3Q7VB 2HGVA 3A3IA 3TJZC 3KSGA 2JKRI 3VMAA 3ZGAB 3T1SA 3SS3A 4HH3A 4FD8A 4XUZA 3VE4A 2XD5A 5G4ZA 3NDGA 4R38A 4EEPA 4EQ1A 2NUPC 2O9AA 5FAPA 2XA7M 4UA7A 1UWNX 4KZ8A 5HL1A 1HD8A 2W3DA 2FFFB 5EVEA 4ZDXA 3NY4A 3IXGA 2PU4A 1KE3A 5CGSA 4Y5FA 1W63M 4PMAA 2QZ6A 4DE2A 1LL5A 3IXHA 4YWZA 2PD7A 2PYPA 4H6JB 4WUJA 2RCXA 3OLOA 2VV8A 4UHUA 4ARZA 2XDMA 2J3WA 3SOIA 3EGXC 4FTXA 3KYEA 3P09A 1MPLA 3IS2A 4PKYG 3KSFA 4Y3IA 1K54C 4P6BA 3VV4A 1LSVA 1D7EA 2K7SA 2IWBA 3GVBA 1KVLA 1K57A 5J4EA 2HDSA 2QKPA 1NRFA 2OWHA 1XFNA 3KSIA 4XUXA 2LB5A 3T1QB 3HUMA 3TW8A 5CRFA 2WADA 3BLMA 4Y7PA 3PTEA 4OOYA 4HHDA 1YSPA 4FUWA 3D3OA 3UB7A 3S4XA 1LL9A 4Q0HA 4K08A 3EEHA 1S1ZA 1V9YA 4S2KA 4EERA 5TJJA 4LENA 2X71A 4C75A 3V39A 2O9BA 4I5SA 5FDHA 1JWVA 4R3JA 4R0QA 1AXBA 3CHWP 4GW9A 4UQIS 2B02A 2WGVA 4HQAA 4Y13A 1HVBA 3M6BA 2L0WA 4WL9A 3CMZA 1HLUP 3HUOA 3G31A 3LFVA 3MZDA 1S4RA 4Y15A 3UB6A 3OPLA 3MS6A 3CG5A 2J9PA 3M6HA 4UAAA 4DXCA 3LGOA 4Y0OA 2W3EA 4N9KA 4PM9A 4R3BA 1FOFA 4S2IA 2HDRA 3K3DA 4GHIB 1H8MA 2O0YA 4K0XA 4OKPA 1EWZA 3VOLA 4EBLA 3P01A 4WMCD 1TVFA 1YLYA 3WWXA 4L0LA 1FR1A 2ZOHA 4QB8A 2PDRA 3WS5A 4ESPA 4Z1WA 3UE3A 1E4DA 4O8GA 2XSSA 3CUEA 4G3KA 3GMWA 3UDIA 1LSXA 3NOPC 4DJ2A 4KQDA 1PRQA 1T1AA 5GHYA 4B4ZA 1DRMA 4ZBEA 5HW3A 1SKOA 1LHYA 4QY5A 2VK3A 3UY6A 3HUNA 4KG6A 4GS9B 4GS9A 1YLTA 4K91A 1W8YA 3C38A 3LY4A 3WS1A 1IKGA 5BOHA 3T1RA 3VOYA 4KZ4A 4MEZA 1EROA 2ZMAA 4M3KA 5GLBA 5CX7A 5CEDA 4GB7A 3TSGA 4S2OA 3QP4A 2ZMFA 3SH7A 3NDEA 2XQZA 1MZUA 4AFIA 2ZLYA 3MFXA 5EVIB 5IT5A 1N9NA 1ONGA 3T12B 4OQ0A 4MDZA 3UB5P 4XT2B 4HBUA 4DXBA 1XGIA 2HV1A 3AGEA 2VV6A 3NIAA 3V3RA 1XJ4A 5M18A 2QJ5A 4OQHA 2R9XA 3IHAA 2W3HA 1OTIA 5F5YA 3NOTC 3PXPA 1P0ZA 5DTSA 3MMHA 2FFYA 3L9KA 3LEQA 2Y2HA 4O0PA 4S2MA 3T4KA 3PYPA 2PBDP 2PAVP 1D1JA 4HIAA 1S67L 5AQBA 2J3TD 5FEFA 1W79A 2WKPA 3IF6A 2VGJA 4X1MA 3DTKA 1JWZA 2PU2A 3ZG8B 1Z09A 2G2WA 4HNBA 4OP8A 1SKOB 1G5UA 3WRZA 3C30A 4BWIA 1PNEA 4JXSA 2JBFA 4DMZA 1CK3A 3WS2A 3PBNA 3IWQA 3PBRA 4GHIA 4FSFA 1C3BA 5CEBA 5E43A 4MBHA 3PAEA 1VQQA 4P87A 2QYBA 2Y4AA 4HP9A 1GSVA 4N1XA 1SZVA 2QJ7A 3N8RA 3HLBA 4NG2A 4RA7A 1XA7A 3C2WA 2BASA 3H7WB 5HAQA 4OQGA 2EX6A 2Y2NA 4MN6A 3W4OA 3R7WA 1MWTA 3Q1FA 4EBNA 4E3IA 3MQOA 3BQAA 3IHBA 4R4SA 2JKRM 2XRNA 4BBUA 2XK1A 5AQ7A 3BM6A 1Y54A 3W8KA 1I5QA 4X55A 2VGLS 3CLOA 3OPRA 2OOLA 3CPTB 4KUOA 5TR7A 3UE1A 3ZG9B 3RFBA 2Y2OA 3N8LA 3RXXA 3ULFA 4CLCE 4HH2A 2XD1A 5GLCA 4JXGA 5DKLA 3HCYA 1K38A 4IEDA 2P9VA 2V8FA 2W1TA 1L0GA 3EQUA 1YM1A 2J7VA 1KDWA 4IVIA 3RTYA 1ERQA 3JVUA 1PI4A 3Q7VA 5EOEA 3F1PB 5DTTA 5EOOA 3S22A 5CGXA 4NK3A 4KENB 5FATA 3LIEA 3E4PA 4JBFA 1ZG4A 1IYOA 1KGFA 2ZC3B 2A49A 1YPRA 3UNWA 4PM6A 4ZJ1A 3MBZA 3FWLA 4C3QA 3MXSA 4E04A 3GDIA 1M40A 4QD4A 2E8JA 4UA6A 1RP5A 4A5RA 1MKMA 1XXMA 2J8YA 2H0TA 2HDQA 5E2FA 3D4FA 3Q7ZA 1PFLA 3IS2B 4Y17A 4LRXC 2HP9A 3FV7A 1HZOA 3CI6A 1K55C 4DE0A 5DTKA 1MY8A 1Y4OA 2ZQ9A 2P7JA 4LV2A 2OLVA 1MKIA 4O7DA 3WS4A 3E4OA 4LFUA 2IWCA 4N92A 5CGWA 4PAUA 3VP3A 4BJPA 1T1BA 1CEFA 2R9WA 4GJ4A 2WYXA 4Z9QA 1OJGA 2Y2PA 2GDNA 2ZC7A 5FDSA 2R78A 4WZ4A 2OAP1 3S7QA 3QP6A 2XGNA 5EUAA 3NOUC 4KZ6A 3IBRA 5K5BA 1CF0A 3UDFA 1MWSA 1DJAA 4JF5A 4UQIM 4OPQA 5HARA 3UB9A 2Y2GA 5HSQA 4JF6A 2PHYA 1W8QA 1XX2A 2Y2JA 4X1LA 3R4KA 4LRZE 2D01A 4UA9A 2PYRA 4NXBA 4NXGA 4E3LA 4LV0A 3GECA 2Y79A 2VZWA 3H9WA 3LY3A 1PWDA 3VFFA 1K0KA 1YQSA 2Y8HA 3FPWA 3IX8A 1OT9A 4X53A 4WN5A 4MLLA 1QMFA 2H5SA 3DTEA 2J80A 3KYQA 1NLZA 2PR5A 2ZC4B 1L2SA 4E6WA 4IBRA 3F1NB 4R70A 3LR4A 1ESUA 1N9OA 3P7NA 4QJGA 4GN2A 3SH8A 2Z6DA 1NZOA 2ZM8A 5AQ9A 4CLCA 5F1GA 3U4LP 1XKZA 5CTNA 3GV9A 1JVJA 3CITA 3HREA 1NLYA 1IYPA 3HLEA 5EFWA 2OSUA 3CWFA 4BD0A 4WF0A 1ONHA 1XJ6A 4L9EA 1BT5A 1P9RA 3MQQA 3BFEA 5CHUA 4II7A 1CI8A 3LI9A 4DDYA 3DWKA 3DBAA 1OT6A 3FKWA 4JPMA 3IT9A 1N4OA 2FZ0A 5FSRA 3TOIA 2QPNA 5CHJA 2L1MA 1MBLA 1TDGA 5IU1A 1MWRA 1SDEA 3S1YA 3Q82A 2L4RA 4ID4A 4R6LA 3QHYA 4BLMA 1DJCA 1FSWA 4EV4A 2RL3A 4HEFA 3VOZA 1ZKJA 2P9VB 1W5DA 2A3UA 2C5WB 2I72A 3F1OB 2P04A 1CI9A 2JE5A 4OLDA 4M4XA 3NULA 5KIZA 1LT0A 4LCLA 5A90A 5L07A 1ESIA 3ZVWA 5AJGA 3T4QA 2LB9A 5F68A 3KSHA 5F6AA 2ZM2A 4FH2A 2MJ6A 3CAXA 2DNSA 4KG2A 3ZHHA 4L9FA 4OVDA 2INWA 5DF9A 2V9AA 1FIKA 2Y2QA 4NXEA 5I5LA 3BFCA 4LRYC 5HWWA 2B95A 3V50A 1DP9A 2Y91A 1RGZA 2VA0A 3T50A 1G6AA 5FQKA 5HDCA 1PI5A 2DMWA 3G4PA 4S2JA 1S6RA 5KMWA 3QNBA 3H82B 4Y2FA 4BQMA 4E6XA 5EM1A 2B18A 5D3OA 5IS1A 3LIAA 1MC0A 4XXRA 2V8CA 2W1TB 2ZC6B 2BTFP 3K3CA 3ISGA 3G35A 4IBXA 1BZAA 2XEPA 1K25A 1GHIA 4S2NA 3IWOA 1NYYA 1ALQA 4N1HA 1ZG6A 5EV0A 2JN7A 2ZBBA 2EXBA 1BLHA 3JVVA 1ES2A 3HLCA 2Z2MB 2M7UA 5HZHA 1KGGA 4ZAMA 3ZYTA 2GZAA 3EWKA 1MWUA 4IUKA 3G34A 1K56A 3LR3A 2ZQAA 3MZFA 3GQZA 4KQOA 1XGJA 5FASA 2WGIA 4I3IA 2WAEA 2VKSA 1STZA 4HJ6A 4MMNA 3H82A 1JTGA 4GD6A 5J3WA 4CQHA 3MSHA 5J7EA 5FI6A 1BUEA 3BFDA 4EESA 4OPRA 2ZQDA 4MBFA 1QMEA 5DVAA 4DDSA 3UMEA 4WLAA 3ZNYA 5FQQA 2EA9A 4HP4A 3V67A 2K2NA 1K6RA 3B3XA 4GNUA 4PM7A 3UE0A 2WGWB 3BECA 3FYZA 1TF1A 4OP5A 4FOFA 2OAQ1 3MKEA 2HP5A 1UGUA 1SHVA 1TEMA 5DF7A 1FCMA 4WZ5A 1WE4A 3W4QA 3H7WA 2V2FF 2VEAA 2EX2A 1DJBA 2EFXA 5FAOA 1YSQA 1ZTUA 2ZOIA 4S2PA 2JCHA 5FQJA 4ZTKA 3HVFA 5AVFA 3F1NA 1VEUB 1YMXA 3ZG5A 3Q07A 5DF8A 5G4YA 5HX9A 3GSGA 3C5AA 3G2YA 2PRFA 1Q2QA 3SS5A 2KDKA 4ME4A 3BFFA 2HZ5A 3ICYA 4JGOA 3LR0A 5C5KA 1WA9A 3HJKA 3JPUA 3LICA
chains in the Genus database with same CATH topology
1F9IA 2PYPA 4E04A 3MF0A 3GDIA 4H6JB 4Q0IA 4WUJA 3OLOA 5DFYA 2VV8A 2CMNA 1MKMA 3T4JA 4ARZA 2J3WA 4EEUA 3FPVA 2M1CA 3EGXC 3OCNA 4LPZA 5HDDA 1IOUA 3IS2A 1YAXA 4PKYG 5A8BA 3KSFA 3IS2B 3MR0A 1V9ZA 4LRXC 4Y3IA 3VV4A 1LL8A 3EEAA 1LSVA 1D7EA 3B47A 2K7SA 3CI6A 1G28A 5J4EA 2A2LA 4HJ4A 1YKDA 2A24A 2QKPA 2OWHA 2A24B 1XFNA 3KSIA 2LB5A 3TW8A 4F3LA 2G7UA 5F69A 2PD8A 2P7JA 4R3AA 3W2ZA 4HHDA 3E4OA 2M7VA 4CLCB 1TS0A 1YSPA 2HJ9C 3D3OA 2W3FA 3UB7A 4PAUA 3BJNA 4XT2A 3R7WB 4BJPA 1T1BA 4GJ4A 4DN0A 2PT7A 4Q0HA 4K08A 2VLGA 1OJGA 3FG8A 3MXQA 3EEHA 4P6ZM 1S1ZA 1V9YA 4EERA 2R78A 3F1PA 5DKKA 2OAP1 5TJJA 3S7QA 4YOFA 5DJTA 3NOUC 4EETB 3IBRA 5K5BA 4NXFA 2O9BA 5AVEA 4I5SA 1S66L 4UQIM 4G3VA 1TS6A 2V1BA 3BWLA 2HF6A 1T1CA 3UB9A 4GW9A 4UQIS 2B02A 1OTDA 2VV7A 4HQAA 5HSQA 2PHYA 4MN5A 2L0WA 2XROA 3R4KA 4WL9A 4LRZE 2D01A 3B33A 5FL3A 4B93A 2GX5A 4ZRRA 2PYRA 4NXBA 2YKFA 3LFVA 1S4RA 4BBTA 4NXGA 3NHQA 4NEED 3UB6A 1KOUA 4I3AA 3GECA 5KSHA 2Y79A 2VZWA 1UWPX 3H9WA 3MQ0A 2W3EA 2Y8HA 3FPWA 3UB8A 1OJ5A 5TBMA 1GSXA 1X0OA 3PHYA 5TBMB 3F1OA 1OT9A 4LLOB 3K3DA 2W27A 1DP8A 4WN5A 4GHIB 1XFQA 1H8MA 3KYQA 2J80A 3TE8A 1NLZA 3D72A 1N9LA 2PR5A 2O0YA 2K31A 3E98A 3VOLA 3P01A 3SW1A 4O01A 3F1NB 4L0LA 2JKTI 2WKRA 2ZOHA 3O5YA 2PDRA 2O9CA 4R70A 3LR4A 3IBJA 1N9OA 4Z1WA 3FC7A 3UE3A 3P7NA 1NRJA 1EW0A 2EWVA 2Z6DA 4O8GA 2XSSA 3CUEA 4G3KA 4CLCA 2GJ3A 3KO6A 5HWVA 5HDSA 3PBSA 3CITA 1LSXA 3NOPC 1NLYA 3LIBA 4DJ2A 5EFWA 4KQDA 1IFQA 1T1AA 4B9OA 3VE3A 3PBTA 3PBOA 1DRMA 1S1YA 4L9GA 2IA2A 2V0WA 3LR5A 3CWFA 2GNXA 4WF0A 4ETZA 3UMDA 1XJ6A 4L9EA 3T4LA 1P9RA 3MQQA 4GS9B 1H3QA 2H28A 4II7A 4MN7A 4GS9A 1S4SA 4BBVA 3LI9A 4CLCD 4IUHA 3C38A 3DBAA 1OT6A 4YNRA 4OOLA 1T18A 2FZ0A 2J3TC 3E0YA 4UEYA 2VGLM 5DJUA 2L1MA 5IU1A 5MC7A 1BYWA 5CX7A 2L4RA 3LI8A 4EU0A 4JGQA 2ZMFA 4R6LA 4CLCC 1MZUA 4AFIA 3OCLA 4WEKA 3MFXA 5IT5A 1N9NA 2W1RA 4WELA 3F1OB 4MDZA 2P04A 1F5MA 4XT2B 4M4XA 2HV1A 5KIZA 1LT0A 2VV6A 2W3GA 1ODVA 5AJGA 3HJIA 3T4QA 2LB9A 5F68A 3KSHA 5F6AA 1VB6A 3G6OA 1XJ4A 1T19A 2QJ5A 1ZHHB 3LYXA 4PKYA 2MJ6A 2W3HA 3CAXA 4EUVA 1OTIA 5F5YA 3NOTC 3PXPA 1P0ZA 3BW6A 4L9FA 4KUKA 3MMHA 2INWA 5DF9A 4EXOA 2V9AA 2W0NA 1XJ2A 4NXEA 5I5LA 2EWWA 4O0PA 5HPIA 4LRYC 5HWWA 3S7OA 3T4KA 4DJ3A 3A0VA 3PYPA 5HWTA 2I9VA 4HI4A 1DP9A 2V1AA 4HIAA 1P9WA 1S67L 3KYZA 2J3TD 3LIDA 5L8MA 2WKPA 3PBQA 2VX8A 1TD5A 2VA0A 3MJQA 3T50A 5HDCA 2DMWA 4HNBA 1JNUA 3H82B 4Y2FA 2NUTC 3C30A 4BWIA 3A0SA 2QHKA 2B18A 4H6JA 4NKPA 5IS1A 2QWSA 4ARZB 3LUQA 5HPFA 4DMZA 1TS8A 3OBFA 3UE6A 4I3JA 3PBNA 3OC2A 3LIAA 1G6OA 2OWJA 1MC0A 3PBRA 2W1TB 3EOIA 3TRCA 4GHIA 3K3CA 4FSFA 3RH8B 1OTEA 2HJEA 4Q0JA 2QYBA 4QPRA 4HP9A 1GSVA 4HOIA 4PHTA 2QJ7A 4RQ9A 4I39A 1LSWA 3EGDC 4F3LB 2JN7A 3T4SA 4JGRA 3C2WA 2BASA 2KLIA 2ZBBA 3K2NA 4IHQA 3H7WB 2JHEA 3PR6A 3JVVA 2M7UA 5HZHA 2VJWA 4MN6A 3ZYTA 4HY8A 2GZAA 3EWKA 2WKQA 3R7WA 4BMWA 4IUKA 3S7PA 3ZQ5A 1VHMA 3LR3A 4KQOA 4I3IA 4WEJA 2VKSA 1STZA 3MQOA 3BQAA 4HJ6A 2JKTM 4MMNA 5HD3A 1OTBA 2JKRM 3H82A 1NWZA 2V0UA 3KX0X 5J3WA 4CQHA 2XRNA 2YKHA 1W63Q 4GLQA 3T4TA 1DP6A 4BBUA 2O99A 5J7EA 1GSWA 1P97A 1OPXA 3E4QA 3B42A 2VGLS 3CLOA 4OOMA 4EESA 2OOLA 4KUOA 1D06A 3UMEA 2P08A 4WLAA 1XJ3A 2EA9A 4HP4A 3V67A 3RFBA 2K2NA 5LBRA 4G3WA 3BY9A 1TF1A 4FOFA 2KOIA 2OAQ1 2PR6A 5HL6A 3ULFA 3OOVA 4CLCE 4JGPA 1UGUA 4HH2A 3C8CA 5DKLA 1F98A 1TS7A 3HCYA 3NJAA 3H7WA 4EW7A 1OTAA 2VEAA 1YSQA 4HJ3A 2W1TA 2KX6A 1ZTUA 2Z6CA 3U2AA 2ZMVA 3EQUA 2D02A 2ZOIA 3BQ8A 3CUEC 3RTYA 3LIFA 3JVUA 2XA7S 4I38A 2HGVA 3TJZC 3KSGA 5AVFA 5DFXA 2JKRI 3F1PB 3F1NA 1Y28A 4HH3A 4GCZA 4MCWA 3VE4A 5G4YA 4ETXA 5G4ZA 4R38A 4EEPA 4EQ1A 2NUPC 2O9AA 3LIEA 3S7NA 3E4PA 2KDKA 3A0RA 4ME4A 2XA7M 3T4OA 1UWNX 2FH5A 3ICYA 2W3DA 5HD5A 4JGOA 3LR0A 4P6ZS 5C5KA 4Y5FA 1W63M 1WA9A 3HJKA 4IJGA 3EQVA 4YWZA 3LICA 3BY8A 2PD7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VHM A;  2VZW A;  4E04 A;  4MDZ A;  3MF0 A;  1F5M A;  3MQ0 A;  4Q0I A;  2W3E A;  2Y8H A;  5DFY A;  2VKS A;  1MKM A;  1STZ A;  2W3G A;  4MMN A;  5AJG A;  2LB9 A;  3KSH A;  3G6O A;  4CQH A;  2XRN A;  4GLQ A;  2O0Y A;  2K31 A;  2O99 A;  3E98 A;  2W3H A;  4EUV A;  3KSF A;  3NOT C;  4LRX C;  4Y3I A;  3VV4 A;  4O01 A;  3EEA A;  3MMH A;  3O5Y A;  2OOL A;  2O9C A;  4R70 A;  3CI6 A;  5I5L A;  4O0P A;  1YKD A;  3IBJ A;  5HPI A;  4Z1W A;  4LRY C;  3S7O A;  3KSI A;  2LB5 A;  3RFB A;  2K2N A;  2G7U A;  5LBR A;  4O8G A;  2XSS A;  4G3K A;  4G3W A;  5L8M A;  3KO6 A;  3W2Z A;  1TD5 A;  1TF1 A;  4FOF A;  2KOI A;  5HL6 A;  3CIT A;  3OOV A;  2M7V A;  3NOP C;  1YSP A;  3D3O A;  4Y2F A;  2W3F A;  4PAU A;  3BJN A;  3HCY A;  4BWI A;  2B18 A;  4DN0 A;  2VEA A;  4Q0H A;  1YSQ A;  2IA2 A;  2W1T A;  4DMZ A;  5HPF A;  1ZTU A;  3OBF A;  4ETZ A;  3S7Q A;  5TJJ A;  4YOF A;  1MC0 A;  2W1T B;  3NOU C;  3TRC A;  4MN7 A;  2HGV A;  3IBR A;  5K5B A;  3KSG A;  2O9B A;  5DFX A;  4IUH A;  3DBA A;  4Q0J A;  2QYB A;  4MCW A;  4G3V A;  4QPR A;  4YNR A;  4GW9 A;  4ETX A;  4RQ9 A;  3E0Y A;  5HSQ A;  2O9A A;  3S7N A;  4ME4 A;  2XRO A;  3R4K A;  3C2W A;  2KLI A;  4LRZ E;  3K2N A;  4EU0 A;  2W3D A;  4R6L A;  2ZMF A;  2GX5 A;  4ZRR A;  2M7U A;  3LFV A;  2VJW A;  3NHQ A;  5C5K A;  4Y5F A;  4IJG A;  2W1R A;  4IUK A;  3S7P A;  3ZQ5 A;  2Y79 A; 
#chains in the Genus database with same CATH topology
 1F9I A;  4HBT A;  3MF0 A;  4Q0I A;  2WZZ A;  5A92 A;  1K56 D;  4S2L A;  4E3N A;  3FPV A;  3IXD A;  3OCN A;  4LPZ A;  4GKU A;  1V9Z A;  4K0W A;  3D9Y A;  3B47 A;  3OPP A;  4JKT A;  1YKD A;  4HES A;  2AVX A;  1L0F A;  1ES4 A;  2A24 B;  2Q9M A;  4NET A;  1CEG A;  4YIN A;  4P85 A;  5F69 A;  4OPY A;  1N9B A;  2PD8 A;  1ES5 A;  1NJ4 A;  5GLD A;  2ZQ8 A;  3PAG A;  2M7V A;  4CLC B;  1TS0 A;  4IVK A;  2Y2K A;  4R4R A;  2W3F A;  3QNC A;  5A91 A;  3BJN A;  4XT2 A;  5IHV A;  4DN0 A;  2PT7 A;  4X69 A;  3FG8 A;  4LV3 A;  2PBY A;  3DAV A;  5HAI A;  4RVA A;  4JXW A;  5DKK A;  3C4O A;  4YOF A;  2EX8 A;  1YLJ A;  5F83 A;  4EET B;  5AVE A;  3A3F A;  5GHX A;  4MNR A;  4KG5 A;  2V1B A;  3BWL A;  3VFH A;  1J9M A;  2VV7 A;  4FH4 A;  5CHM A;  3V5M A;  5CXW A;  3AGD A;  1M6K A;  2Y2I A;  4EQI A;  1ES3 A;  1BSG A;  2XRO A;  5EVL A;  2P74 A;  1H8Y A;  3B33 A;  1DY6 A;  1K54 A;  4ZRR A;  2YKF A;  4BBT A;  3NHQ A;  1CQA A;  1BLP A;  1KOU A;  3QP5 A;  4I3A A;  3N4I A;  5KSH A;  1UWP X;  1NYM A;  1OJ5 A;  5TBM A;  1X0O A;  4R23 A;  5FQ9 A;  1KE0 A;  3DTM A;  1BTL A;  3W4P A;  1DP8 A;  1FIL A;  1XFQ A;  1VM1 A;  3UPP A;  1N9L A;  2ZL1 B;  4C6Y A;  3E98 A;  4YFM A;  4O01 A;  3UPO A;  2JKT I;  3OZH A;  2WKR A;  2O9C A;  4KZ9 A;  1E25 A;  3IBJ A;  2EX9 A;  3FC7 A;  1FCN A;  1NRJ A;  3LCE A;  1WYB A;  4Y0T A;  1A0K A;  2EWV A;  4LV1 A;  4DRT A;  2ZQ7 A;  1FCO A;  3KO6 A;  5F1F A;  5HDS A;  3PBS A;  3VP2 A;  4MBK A;  1BLC A;  3IX4 A;  3V3S A;  3LIB A;  1IFQ A;  4B9O A;  3VE3 A;  1K4E A;  3PBT A;  3PBO A;  4BL2 A;  2ZD8 A;  2X02 A;  2GNX A;  4ETZ A;  3UMD A;  1E3U A;  1MXO A;  1H3Q A;  3ITA A;  1PWC A;  1S4S A;  4IUH A;  5GL9 A;  5EPH A;  4Q8I A;  2G2U A;  4YNR A;  5A93 A;  1T18 A;  1L0D A;  2J3T C;  3E0Y A;  4UEY A;  2DRW A;  3GR2 A;  1VET A;  2WKH A;  3E2L A;  3IF6 C;  3LI8 A;  4EU0 A;  4JGQ A;  5JYP A;  5CEC A;  4CLC C;  3IX3 A;  1GHP A;  5KZH A;  2W1R A;  4WEL A;  2EFU A;  1F5M A;  2UV0 E;  3ZFZ A;  2WKI A;  1ODV A;  4D2O A;  1ZHH B;  1KVM A;  2HDU A;  5E2E A;  3BW6 A;  4KUK A;  4S2N C;  1E3U D;  1S0W A;  1BLS A;  3VP1 A;  2ZM0 A;  2W0N A;  2WUQ A;  2EWW A;  2XF3 A;  5HPI A;  1IEM A;  4DJ3 A;  3NCK A;  1Q2P A;  2WZX A;  4HI4 A;  3DW0 A;  2V1A A;  4ZJ2 A;  1P9W A;  3KYZ A;  4DE3 A;  5L8M A;  1NXY A;  3OPH A;  2VX8 A;  1TD5 A;  4OON A;  3M2J A;  1JNU A;  2NUT C;  4X68 A;  4H6J A;  4NKP A;  1JWP A;  2QWS A;  4R1G A;  1RGY A;  3HLG A;  4X25 A;  3HLW A;  4LCM A;  3LUQ A;  3ZG0 A;  3Q81 A;  3RJU A;  1YT4 A;  2Q9N A;  1FQG A;  4JLF A;  5CTM A;  2HJE A;  4Q0J A;  2C6W B;  4HOI A;  4N9L A;  1JTD A;  3MKF A;  5FI2 A;  2Y2L A;  4WZ5 C;  1VEU A;  4OPZ A;  3N7W A;  1XP4 A;  1GA0 A;  4JGR A;  3ZNT A;  2KLI A;  1L0E A;  3PR6 A;  2JHE A;  3O3V A;  4EWF A;  2JKG A;  1SCW A;  2VJW A;  4HY8 A;  5L10 A;  1RCJ A;  2WKQ A;  2XFT A;  2E8I A;  3QP8 A;  3S7P A;  5JYO A;  4JF4 A;  1PW1 A;  3G30 A;  2JKT M;  5HD3 A;  1OTB A;  2OLU A;  1NWZ A;  3T4T A;  4GLQ A;  1DP6 A;  4WM9 A;  1GSW A;  1P97 A;  3E4Q A;  1J3W A;  3B42 A;  3A3E A;  4OOM A;  3UN7 A;  1BUL A;  1YLZ A;  2CC1 A;  3SZT A;  3IQA A;  3A3D A;  1XJ3 A;  3IF6 B;  4RX3 A;  5U47 A;  5LBR A;  3ZVT A;  3DWZ A;  5TFQ A;  2KOI A;  5HL6 A;  3OOV A;  4U0X A;  4X6T A;  5HAP A;  3C8C A;  3IH9 A;  5FEG A;  4CPK A;  1F98 A;  1TS7 A;  1L3L A;  3NJA A;  3RXW A;  1W7F A;  4EW7 A;  1SKF A;  1OTA A;  3DTI A;  4HJ3 A;  2Z6C A;  2ZMV A;  2D02 A;  3BQ8 A;  4OLG A;  4D60 A;  2XA7 S;  4I38 A;  3WS0 A;  5DFX A;  1Y28 A;  2EXA A;  4GCZ A;  4MCW A;  4B4X A;  4OQI A;  4ETX A;  3BLS A;  1YLP A;  1ERM A;  4E3O A;  3S7N A;  3A0R A;  4EUZ A;  3T4O A;  1PW8 A;  5EE8 A;  2FH5 A;  5HD5 A;  2OV5 A;  3ZG7 B;  1SDN A;  4P6Z S;  5M19 A;  3NEC A;  3IF5 A;  3AGF A;  2B5R A;  3GRJ A;  2HP6 A;  1YLW A;  4IJG A;  3EQV A;  4JXV A;  4KQQ A;  3BY8 A;  5E2H A;  2Y59 A;  3C7U A;  5DFY A;  2CMN A;  3T4J A;  4EEU A;  2M1C A;  1FSY A;  3A3J A;  5HDD A;  2JC7 A;  3VSK A;  1IOU A;  4OH0 A;  1YAX A;  5EVI C;  5A8B A;  3MR0 A;  3CZD A;  1LL8 A;  3UPN A;  3EEA A;  3CJM A;  4Y0U A;  4FCF A;  1G28 A;  4B88 A;  2A2L A;  4HJ4 A;  2A24 A;  4KQR A;  5FAQ A;  3BEB A;  1EI5 A;  4F3L A;  2G7U A;  5EM0 A;  1PWG A;  4R3A A;  3W2Z A;  5GLA A;  4DKI A;  4BL3 A;  1GA9 A;  2HJ9 C;  5CER A;  3HBR A;  3R7W B;  1IEL A;  2ZL1 A;  1TDL A;  2WKE A;  2VLG A;  3BYD A;  3MXQ A;  4P6Z M;  4CJN A;  3F1P A;  5EEC A;  5DJT A;  1H0M A;  1ACF A;  1O07 A;  4PPR A;  4NXF A;  4P0M A;  4BEN A;  1S66 L;  2XH9 A;  1ZC2 A;  1U60 A;  3SH9 A;  4G3V A;  1TS6 A;  2HF6 A;  1H5X A;  1T1C A;  3G32 A;  2DCF A;  1OTD A;  4H8R A;  4KZB A;  4QWO A;  4MN5 A;  4E3M A;  1KE4 A;  3L7H A;  3FZC A;  3ZDJ A;  3IWI A;  5FL3 A;  2XLN A;  4B93 A;  2GX5 A;  3C7V A;  4NEE D;  3NC8 A;  1G68 A;  4LGW A;  3MQ0 A;  3MFD A;  3UB8 A;  1GSX A;  3PHY A;  5TBM B;  3F1O A;  4LLO B;  1H8Z A;  2W27 A;  3TE8 A;  1YMS A;  3D72 A;  1WYC A;  4GDN A;  2K31 A;  2IWD A;  1OME A;  3SW1 A;  3G2Z A;  3O5Y A;  5E2G A;  2Q0O A;  1EW0 A;  2WAF A;  3HLD A;  1PIO A;  2GJ3 A;  4DE1 A;  5HWV A;  1IKI A;  3NBL A;  3TG9 A;  3BFG A;  1NY0 A;  1K4F A;  4WYY A;  2WK0 A;  2V20 A;  1S1Y A;  4GDB A;  4L9G A;  2IA2 A;  2V0W A;  3MXR A;  4PM8 A;  3IH8 A;  3LR5 A;  3T4L A;  2H28 A;  4MN7 A;  4BBV A;  4CLC D;  3SS4 A;  3CPT A;  5F82 A;  2VGK A;  3ZCZ A;  3I7J A;  4OOL A;  3JYI A;  3O87 A;  3WRT A;  2VGL M;  5DJU A;  3LEZ A;  3O88 A;  5MC7 A;  1BYW A;  1VET B;  2ZJ9 A;  2WGW A;  1O7E A;  3HL9 A;  3OCL A;  4RYE A;  4WEK A;  4EBP A;  1PYY A;  2ZC5 B;  3N8S A;  2BG1 A;  2Z2L B;  2ZQC A;  3QP1 A;  4U3T A;  4E3K A;  1PZO A;  2W3G A;  3HJI A;  4WMC A;  1VB6 A;  3G6O A;  1T19 A;  4DF6 A;  3LYX A;  5L2F A;  4PKY A;  1FR6 A;  5FQM A;  4GZB A;  4EUV A;  1LI9 A;  5KSC A;  4KZ7 A;  1PZP A;  4EXO A;  1XJ2 A;  1XPB A;  2X01 A;  2V1Z A;  3S7O A;  3BRM A;  3A0V A;  1K6S A;  1XA1 A;  5HWT A;  3LO7 A;  2I9V A;  5AQA A;  1K55 A;  3LID A;  1LI0 A;  3PBQ A;  3MJQ A;  4KZ5 A;  1GCE A;  3UO9 A;  2J9O A;  1F2K A;  3A0S A;  2QHK A;  2UWX A;  4ARZ B;  5HPF A;  1TS8 A;  3OBF A;  3UE6 A;  4I3J A;  1AWI A;  2XR0 A;  3OC2 A;  1G6O A;  2OWJ A;  3GTC A;  3EOI A;  4RX2 A;  3TRC A;  2XFS A;  3RH8 B;  4GD8 A;  1OTE A;  3C4P A;  3N6I A;  2H10 A;  4QPR A;  5FQI A;  4PHT A;  4WBG A;  2H0Y A;  2JKF A;  4RQ9 A;  4I39 A;  1LSW A;  3IXB A;  1IYS A;  3QP2 A;  3EGD C;  1Z6F A;  4F3L B;  3T4S A;  1IYQ A;  2BLS A;  3K2N A;  4IHQ A;  4BD1 A;  1GHM A;  2Y2M A;  4QHC A;  4E3J A;  4F94 A;  1LLB A;  3FKV A;  2HPB A;  4BMW A;  1K57 C;  3ZQ5 A;  1VHM A;  4KZA A;  5HFO A;  3HLF A;  5TGF A;  3VSL A;  4WEJ A;  3T1X A;  1KDS A;  1KGE A;  3E2K A;  2V0U A;  3KX0 X;  5J8X A;  3UDX A;  2YKH A;  1W63 Q;  2O99 A;  1HTZ A;  4KZ3 A;  1OPX A;  5I94 A;  3VP0 A;  4U0T A;  2Y55 A;  5L09 A;  1D06 A;  1I2S A;  4GOG A;  2P08 A;  5GHZ A;  2ACG A;  3VP4 A;  5FI7 A;  4ZJ3 A;  4G3W A;  3NI9 A;  3BY9 A;  4QU3 A;  2PR6 A;  4JGP A;  5FA7 A;  5M1A A;  4QY6 A;  5G18 A;  4X56 A;  4PM5 A;  5EVI A;  3O86 A;  3M2K A;  3ITB A;  1NZU A;  3P98 A;  3MZE A;  5EVI D;  2KX6 A;  3U2A A;  2QMI A;  3CUE C;  1CJF A;  3LIF A;  1I2W A;  3Q7V B;  2HGV A;  3A3I A;  3TJZ C;  3KSG A;  2JKR I;  3VMA A;  3ZGA B;  3T1S A;  3SS3 A;  4HH3 A;  4FD8 A;  4XUZ A;  3VE4 A;  2XD5 A;  5G4Z A;  3NDG A;  4R38 A;  4EEP A;  4EQ1 A;  2NUP C;  2O9A A;  5FAP A;  2XA7 M;  4UA7 A;  1UWN X;  4KZ8 A;  5HL1 A;  1HD8 A;  2W3D A;  2FFF B;  5EVE A;  4ZDX A;  3NY4 A;  3IXG A;  2PU4 A;  1KE3 A;  5CGS A;  4Y5F A;  1W63 M;  4PMA A;  2QZ6 A;  4DE2 A;  1LL5 A;  3IXH A;  4YWZ A;  2PD7 A;  2PYP A;  4H6J B;  4WUJ A;  2RCX A;  3OLO A;  2VV8 A;  4UHU A;  4ARZ A;  2XDM A;  2J3W A;  3SOI A;  3EGX C;  4FTX A;  3KYE A;  3P09 A;  1MPL A;  3IS2 A;  4PKY G;  3KSF A;  4Y3I A;  1K54 C;  4P6B A;  3VV4 A;  1LSV A;  1D7E A;  2K7S A;  2IWB A;  3GVB A;  1KVL A;  1K57 A;  5J4E A;  2HDS A;  2QKP A;  1NRF A;  2OWH A;  1XFN A;  3KSI A;  4XUX A;  2LB5 A;  3T1Q B;  3HUM A;  3TW8 A;  5CRF A;  2WAD A;  3BLM A;  4Y7P A;  3PTE A;  4OOY A;  4HHD A;  1YSP A;  4FUW A;  3D3O A;  3UB7 A;  3S4X A;  1LL9 A;  4Q0H A;  4K08 A;  3EEH A;  1S1Z A;  1V9Y A;  4S2K A;  4EER A;  5TJJ A;  4LEN A;  2X71 A;  4C75 A;  3V39 A;  2O9B A;  4I5S A;  5FDH A;  1JWV A;  4R3J A;  4R0Q A;  1AXB A;  3CHW P;  4GW9 A;  4UQI S;  2B02 A;  2WGV A;  4HQA A;  4Y13 A;  1HVB A;  3M6B A;  2L0W A;  4WL9 A;  3CMZ A;  1HLU P;  3HUO A;  3G31 A;  3LFV A;  3MZD A;  1S4R A;  4Y15 A;  3UB6 A;  3OPL A;  3MS6 A;  3CG5 A;  2J9P A;  3M6H A;  4UAA A;  4DXC A;  3LGO A;  4Y0O A;  2W3E A;  4N9K A;  4PM9 A;  4R3B A;  1FOF A;  4S2I A;  2HDR A;  3K3D A;  4GHI B;  1H8M A;  2O0Y A;  4K0X A;  4OKP A;  1EWZ A;  3VOL A;  4EBL A;  3P01 A;  4WMC D;  1TVF A;  1YLY A;  3WWX A;  4L0L A;  1FR1 A;  2ZOH A;  4QB8 A;  2PDR A;  3WS5 A;  4ESP A;  4Z1W A;  3UE3 A;  1E4D A;  4O8G A;  2XSS A;  3CUE A;  4G3K A;  3GMW A;  3UDI A;  1LSX A;  3NOP C;  4DJ2 A;  4KQD A;  1PRQ A;  1T1A A;  5GHY A;  4B4Z A;  1DRM A;  4ZBE A;  5HW3 A;  1SKO A;  1LHY A;  4QY5 A;  2VK3 A;  3UY6 A;  3HUN A;  4KG6 A;  4GS9 B;  4GS9 A;  1YLT A;  4K91 A;  1W8Y A;  3C38 A;  3LY4 A;  3WS1 A;  1IKG A;  5BOH A;  3T1R A;  3VOY A;  4KZ4 A;  4MEZ A;  1ERO A;  2ZMA A;  4M3K A;  5GLB A;  5CX7 A;  5CED A;  4GB7 A;  3TSG A;  4S2O A;  3QP4 A;  2ZMF A;  3SH7 A;  3NDE A;  2XQZ A;  1MZU A;  4AFI A;  2ZLY A;  3MFX A;  5EVI B;  5IT5 A;  1N9N A;  1ONG A;  3T12 B;  4OQ0 A;  4MDZ A;  3UB5 P;  4XT2 B;  4HBU A;  4DXB A;  1XGI A;  2HV1 A;  3AGE A;  2VV6 A;  3NIA A;  3V3R A;  1XJ4 A;  5M18 A;  2QJ5 A;  4OQH A;  2R9X A;  3IHA A;  2W3H A;  1OTI A;  5F5Y A;  3NOT C;  3PXP A;  1P0Z A;  5DTS A;  3MMH A;  2FFY A;  3L9K A;  3LEQ A;  2Y2H A;  4O0P A;  4S2M A;  3T4K A;  3PYP A;  2PBD P;  2PAV P;  1D1J A;  4HIA A;  1S67 L;  5AQB A;  2J3T D;  5FEF A;  1W79 A;  2WKP A;  3IF6 A;  2VGJ A;  4X1M A;  3DTK A;  1JWZ A;  2PU2 A;  3ZG8 B;  1Z09 A;  2G2W A;  4HNB A;  4OP8 A;  1SKO B;  1G5U A;  3WRZ A;  3C30 A;  4BWI A;  1PNE A;  4JXS A;  2JBF A;  4DMZ A;  1CK3 A;  3WS2 A;  3PBN A;  3IWQ A;  3PBR A;  4GHI A;  4FSF A;  1C3B A;  5CEB A;  5E43 A;  4MBH A;  3PAE A;  1VQQ A;  4P87 A;  2QYB A;  2Y4A A;  4HP9 A;  1GSV A;  4N1X A;  1SZV A;  2QJ7 A;  3N8R A;  3HLB A;  4NG2 A;  4RA7 A;  1XA7 A;  3C2W A;  2BAS A;  3H7W B;  5HAQ A;  4OQG A;  2EX6 A;  2Y2N A;  4MN6 A;  3W4O A;  3R7W A;  1MWT A;  3Q1F A;  4EBN A;  4E3I A;  3MQO A;  3BQA A;  3IHB A;  4R4S A;  2JKR M;  2XRN A;  4BBU A;  2XK1 A;  5AQ7 A;  3BM6 A;  1Y54 A;  3W8K A;  1I5Q A;  4X55 A;  2VGL S;  3CLO A;  3OPR A;  2OOL A;  3CPT B;  4KUO A;  5TR7 A;  3UE1 A;  3ZG9 B;  3RFB A;  2Y2O A;  3N8L A;  3RXX A;  3ULF A;  4CLC E;  4HH2 A;  2XD1 A;  5GLC A;  4JXG A;  5DKL A;  3HCY A;  1K38 A;  4IED A;  2P9V A;  2V8F A;  2W1T A;  1L0G A;  3EQU A;  1YM1 A;  2J7V A;  1KDW A;  4IVI A;  3RTY A;  1ERQ A;  3JVU A;  1PI4 A;  3Q7V A;  5EOE A;  3F1P B;  5DTT A;  5EOO A;  3S22 A;  5CGX A;  4NK3 A;  4KEN B;  5FAT A;  3LIE A;  3E4P A;  4JBF A;  1ZG4 A;  1IYO A;  1KGF A;  2ZC3 B;  2A49 A;  1YPR A;  3UNW A;  4PM6 A;  4ZJ1 A;  3MBZ A;  3FWL A;  4C3Q A;  3MXS A;  4E04 A;  3GDI A;  1M40 A;  4QD4 A;  2E8J A;  4UA6 A;  1RP5 A;  4A5R A;  1MKM A;  1XXM A;  2J8Y A;  2H0T A;  2HDQ A;  5E2F A;  3D4F A;  3Q7Z A;  1PFL A;  3IS2 B;  4Y17 A;  4LRX C;  2HP9 A;  3FV7 A;  1HZO A;  3CI6 A;  1K55 C;  4DE0 A;  5DTK A;  1MY8 A;  1Y4O A;  2ZQ9 A;  2P7J A;  4LV2 A;  2OLV A;  1MKI A;  4O7D A;  3WS4 A;  3E4O A;  4LFU A;  2IWC A;  4N92 A;  5CGW A;  4PAU A;  3VP3 A;  4BJP A;  1T1B A;  1CEF A;  2R9W A;  4GJ4 A;  2WYX A;  4Z9Q A;  1OJG A;  2Y2P A;  2GDN A;  2ZC7 A;  5FDS A;  2R78 A;  4WZ4 A;  2OAP 1;  3S7Q A;  3QP6 A;  2XGN A;  5EUA A;  3NOU C;  4KZ6 A;  3IBR A;  5K5B A;  1CF0 A;  3UDF A;  1MWS A;  1DJA A;  4JF5 A;  4UQI M;  4OPQ A;  5HAR A;  3UB9 A;  2Y2G A;  5HSQ A;  4JF6 A;  2PHY A;  1W8Q A;  1XX2 A;  2Y2J A;  4X1L A;  3R4K A;  4LRZ E;  2D01 A;  4UA9 A;  2PYR A;  4NXB A;  4NXG A;  4E3L A;  4LV0 A;  3GEC A;  2Y79 A;  2VZW A;  3H9W A;  3LY3 A;  1PWD A;  3VFF A;  1K0K A;  1YQS A;  2Y8H A;  3FPW A;  3IX8 A;  1OT9 A;  4X53 A;  4WN5 A;  4MLL A;  1QMF A;  2H5S A;  3DTE A;  2J80 A;  3KYQ A;  1NLZ A;  2PR5 A;  2ZC4 B;  1L2S A;  4E6W A;  4IBR A;  3F1N B;  4R70 A;  3LR4 A;  1ESU A;  1N9O A;  3P7N A;  4QJG A;  4GN2 A;  3SH8 A;  2Z6D A;  1NZO A;  2ZM8 A;  5AQ9 A;  4CLC A;  5F1G A;  3U4L P;  1XKZ A;  5CTN A;  3GV9 A;  1JVJ A;  3CIT A;  3HRE A;  1NLY A;  1IYP A;  3HLE A;  5EFW A;  2OSU A;  3CWF A;  4BD0 A;  4WF0 A;  1ONH A;  1XJ6 A;  4L9E A;  1BT5 A;  1P9R A;  3MQQ A;  3BFE A;  5CHU A;  4II7 A;  1CI8 A;  3LI9 A;  4DDY A;  3DWK A;  3DBA A;  1OT6 A;  3FKW A;  4JPM A;  3IT9 A;  1N4O A;  2FZ0 A;  5FSR A;  3TOI A;  2QPN A;  5CHJ A;  2L1M A;  1MBL A;  1TDG A;  5IU1 A;  1MWR A;  1SDE A;  3S1Y A;  3Q82 A;  2L4R A;  4ID4 A;  4R6L A;  3QHY A;  4BLM A;  1DJC A;  1FSW A;  4EV4 A;  2RL3 A;  4HEF A;  3VOZ A;  1ZKJ A;  2P9V B;  1W5D A;  2A3U A;  2C5W B;  2I72 A;  3F1O B;  2P04 A;  1CI9 A;  2JE5 A;  4OLD A;  4M4X A;  3NUL A;  5KIZ A;  1LT0 A;  4LCL A;  5A90 A;  5L07 A;  1ESI A;  3ZVW A;  5AJG A;  3T4Q A;  2LB9 A;  5F68 A;  3KSH A;  5F6A A;  2ZM2 A;  4FH2 A;  2MJ6 A;  3CAX A;  2DNS A;  4KG2 A;  3ZHH A;  4L9F A;  4OVD A;  2INW A;  5DF9 A;  2V9A A;  1FIK A;  2Y2Q A;  4NXE A;  5I5L A;  3BFC A;  4LRY C;  5HWW A;  2B95 A;  3V50 A;  1DP9 A;  2Y91 A;  1RGZ A;  2VA0 A;  3T50 A;  1G6A A;  5FQK A;  5HDC A;  1PI5 A;  2DMW A;  3G4P A;  4S2J A;  1S6R A;  5KMW A;  3QNB A;  3H82 B;  4Y2F A;  4BQM A;  4E6X A;  5EM1 A;  2B18 A;  5D3O A;  5IS1 A;  3LIA A;  1MC0 A;  4XXR A;  2V8C A;  2W1T B;  2ZC6 B;  2BTF P;  3K3C A;  3ISG A;  3G35 A;  4IBX A;  1BZA A;  2XEP A;  1K25 A;  1GHI A;  4S2N A;  3IWO A;  1NYY A;  1ALQ A;  4N1H A;  1ZG6 A;  5EV0 A;  2JN7 A;  2ZBB A;  2EXB A;  1BLH A;  3JVV A;  1ES2 A;  3HLC A;  2Z2M B;  2M7U A;  5HZH A;  1KGG A;  4ZAM A;  3ZYT A;  2GZA A;  3EWK A;  1MWU A;  4IUK A;  3G34 A;  1K56 A;  3LR3 A;  2ZQA A;  3MZF A;  3GQZ A;  4KQO A;  1XGJ A;  5FAS A;  2WGI A;  4I3I A;  2WAE A;  2VKS A;  1STZ A;  4HJ6 A;  4MMN A;  3H82 A;  1JTG A;  4GD6 A;  5J3W A;  4CQH A;  3MSH A;  5J7E A;  5FI6 A;  1BUE A;  3BFD A;  4EES A;  4OPR A;  2ZQD A;  4MBF A;  1QME A;  5DVA A;  4DDS A;  3UME A;  4WLA A;  3ZNY A;  5FQQ A;  2EA9 A;  4HP4 A;  3V67 A;  2K2N A;  1K6R A;  3B3X A;  4GNU A;  4PM7 A;  3UE0 A;  2WGW B;  3BEC A;  3FYZ A;  1TF1 A;  4OP5 A;  4FOF A;  2OAQ 1;  3MKE A;  2HP5 A;  1UGU A;  1SHV A;  1TEM A;  5DF7 A;  1FCM A;  4WZ5 A;  1WE4 A;  3W4Q A;  3H7W A;  2V2F F;  2VEA A;  2EX2 A;  1DJB A;  2EFX A;  5FAO A;  1YSQ A;  1ZTU A;  2ZOI A;  4S2P A;  2JCH A;  5FQJ A;  4ZTK A;  3HVF A;  5AVF A;  3F1N A;  1VEU B;  1YMX A;  3ZG5 A;  3Q07 A;  5DF8 A;  5G4Y A;  5HX9 A;  3GSG A;  3C5A A;  3G2Y A;  2PRF A;  1Q2Q A;  3SS5 A;  2KDK A;  4ME4 A;  3BFF A;  2HZ5 A;  3ICY A;  4JGO A;  3LR0 A;  5C5K A;  1WA9 A;  3HJK A;  3JPU A;  3LIC A; 
#chains in the Genus database with same CATH homology
 1F9I A;  2PYP A;  4E04 A;  3MF0 A;  3GDI A;  4H6J B;  4Q0I A;  4WUJ A;  3OLO A;  5DFY A;  2VV8 A;  2CMN A;  1MKM A;  3T4J A;  4ARZ A;  2J3W A;  4EEU A;  3FPV A;  2M1C A;  3EGX C;  3OCN A;  4LPZ A;  5HDD A;  1IOU A;  3IS2 A;  1YAX A;  4PKY G;  5A8B A;  3KSF A;  3IS2 B;  3MR0 A;  1V9Z A;  4LRX C;  4Y3I A;  3VV4 A;  1LL8 A;  3EEA A;  1LSV A;  1D7E A;  3B47 A;  2K7S A;  3CI6 A;  1G28 A;  5J4E A;  2A2L A;  4HJ4 A;  1YKD A;  2A24 A;  2QKP A;  2OWH A;  2A24 B;  1XFN A;  3KSI A;  2LB5 A;  3TW8 A;  4F3L A;  2G7U A;  5F69 A;  2PD8 A;  2P7J A;  4R3A A;  3W2Z A;  4HHD A;  3E4O A;  2M7V A;  4CLC B;  1TS0 A;  1YSP A;  2HJ9 C;  3D3O A;  2W3F A;  3UB7 A;  4PAU A;  3BJN A;  4XT2 A;  3R7W B;  4BJP A;  1T1B A;  4GJ4 A;  4DN0 A;  2PT7 A;  4Q0H A;  4K08 A;  2VLG A;  1OJG A;  3FG8 A;  3MXQ A;  3EEH A;  4P6Z M;  1S1Z A;  1V9Y A;  4EER A;  2R78 A;  3F1P A;  5DKK A;  2OAP 1;  5TJJ A;  3S7Q A;  4YOF A;  5DJT A;  3NOU C;  4EET B;  3IBR A;  5K5B A;  4NXF A;  2O9B A;  5AVE A;  4I5S A;  1S66 L;  4UQI M;  4G3V A;  1TS6 A;  2V1B A;  3BWL A;  2HF6 A;  1T1C A;  3UB9 A;  4GW9 A;  4UQI S;  2B02 A;  1OTD A;  2VV7 A;  4HQA A;  5HSQ A;  2PHY A;  4MN5 A;  2L0W A;  2XRO A;  3R4K A;  4WL9 A;  4LRZ E;  2D01 A;  3B33 A;  5FL3 A;  4B93 A;  2GX5 A;  4ZRR A;  2PYR A;  4NXB A;  2YKF A;  3LFV A;  1S4R A;  4BBT A;  4NXG A;  3NHQ A;  4NEE D;  3UB6 A;  1KOU A;  4I3A A;  3GEC A;  5KSH A;  2Y79 A;  2VZW A;  1UWP X;  3H9W A;  3MQ0 A;  2W3E A;  2Y8H A;  3FPW A;  3UB8 A;  1OJ5 A;  5TBM A;  1GSX A;  1X0O A;  3PHY A;  5TBM B;  3F1O A;  1OT9 A;  4LLO B;  3K3D A;  2W27 A;  1DP8 A;  4WN5 A;  4GHI B;  1XFQ A;  1H8M A;  3KYQ A;  2J80 A;  3TE8 A;  1NLZ A;  3D72 A;  1N9L A;  2PR5 A;  2O0Y A;  2K31 A;  3E98 A;  3VOL A;  3P01 A;  3SW1 A;  4O01 A;  3F1N B;  4L0L A;  2JKT I;  2WKR A;  2ZOH A;  3O5Y A;  2PDR A;  2O9C A;  4R70 A;  3LR4 A;  3IBJ A;  1N9O A;  4Z1W A;  3FC7 A;  3UE3 A;  3P7N A;  1NRJ A;  1EW0 A;  2EWV A;  2Z6D A;  4O8G A;  2XSS A;  3CUE A;  4G3K A;  4CLC A;  2GJ3 A;  3KO6 A;  5HWV A;  5HDS A;  3PBS A;  3CIT A;  1LSX A;  3NOP C;  1NLY A;  3LIB A;  4DJ2 A;  5EFW A;  4KQD A;  1IFQ A;  1T1A A;  4B9O A;  3VE3 A;  3PBT A;  3PBO A;  1DRM A;  1S1Y A;  4L9G A;  2IA2 A;  2V0W A;  3LR5 A;  3CWF A;  2GNX A;  4WF0 A;  4ETZ A;  3UMD A;  1XJ6 A;  4L9E A;  3T4L A;  1P9R A;  3MQQ A;  4GS9 B;  1H3Q A;  2H28 A;  4II7 A;  4MN7 A;  4GS9 A;  1S4S A;  4BBV A;  3LI9 A;  4CLC D;  4IUH A;  3C38 A;  3DBA A;  1OT6 A;  4YNR A;  4OOL A;  1T18 A;  2FZ0 A;  2J3T C;  3E0Y A;  4UEY A;  2VGL M;  5DJU A;  2L1M A;  5IU1 A;  5MC7 A;  1BYW A;  5CX7 A;  2L4R A;  3LI8 A;  4EU0 A;  4JGQ A;  2ZMF A;  4R6L A;  4CLC C;  1MZU A;  4AFI A;  3OCL A;  4WEK A;  3MFX A;  5IT5 A;  1N9N A;  2W1R A;  4WEL A;  3F1O B;  4MDZ A;  2P04 A;  1F5M A;  4XT2 B;  4M4X A;  2HV1 A;  5KIZ A;  1LT0 A;  2VV6 A;  2W3G A;  1ODV A;  5AJG A;  3HJI A;  3T4Q A;  2LB9 A;  5F68 A;  3KSH A;  5F6A A;  1VB6 A;  3G6O A;  1XJ4 A;  1T19 A;  2QJ5 A;  1ZHH B;  3LYX A;  4PKY A;  2MJ6 A;  2W3H A;  3CAX A;  4EUV A;  1OTI A;  5F5Y A;  3NOT C;  3PXP A;  1P0Z A;  3BW6 A;  4L9F A;  4KUK A;  3MMH A;  2INW A;  5DF9 A;  4EXO A;  2V9A A;  2W0N A;  1XJ2 A;  4NXE A;  5I5L A;  2EWW A;  4O0P A;  5HPI A;  4LRY C;  5HWW A;  3S7O A;  3T4K A;  4DJ3 A;  3A0V A;  3PYP A;  5HWT A;  2I9V A;  4HI4 A;  1DP9 A;  2V1A A;  4HIA A;  1P9W A;  1S67 L;  3KYZ A;  2J3T D;  3LID A;  5L8M A;  2WKP A;  3PBQ A;  2VX8 A;  1TD5 A;  2VA0 A;  3MJQ A;  3T50 A;  5HDC A;  2DMW A;  4HNB A;  1JNU A;  3H82 B;  4Y2F A;  2NUT C;  3C30 A;  4BWI A;  3A0S A;  2QHK A;  2B18 A;  4H6J A;  4NKP A;  5IS1 A;  2QWS A;  4ARZ B;  3LUQ A;  5HPF A;  4DMZ A;  1TS8 A;  3OBF A;  3UE6 A;  4I3J A;  3PBN A;  3OC2 A;  3LIA A;  1G6O A;  2OWJ A;  1MC0 A;  3PBR A;  2W1T B;  3EOI A;  3TRC A;  4GHI A;  3K3C A;  4FSF A;  3RH8 B;  1OTE A;  2HJE A;  4Q0J A;  2QYB A;  4QPR A;  4HP9 A;  1GSV A;  4HOI A;  4PHT A;  2QJ7 A;  4RQ9 A;  4I39 A;  1LSW A;  3EGD C;  4F3L B;  2JN7 A;  3T4S A;  4JGR A;  3C2W A;  2BAS A;  2KLI A;  2ZBB A;  3K2N A;  4IHQ A;  3H7W B;  2JHE A;  3PR6 A;  3JVV A;  2M7U A;  5HZH A;  2VJW A;  4MN6 A;  3ZYT A;  4HY8 A;  2GZA A;  3EWK A;  2WKQ A;  3R7W A;  4BMW A;  4IUK A;  3S7P A;  3ZQ5 A;  1VHM A;  3LR3 A;  4KQO A;  4I3I A;  4WEJ A;  2VKS A;  1STZ A;  3MQO A;  3BQA A;  4HJ6 A;  2JKT M;  4MMN A;  5HD3 A;  1OTB A;  2JKR M;  3H82 A;  1NWZ A;  2V0U A;  3KX0 X;  5J3W A;  4CQH A;  2XRN A;  2YKH A;  1W63 Q;  4GLQ A;  3T4T A;  1DP6 A;  4BBU A;  2O99 A;  5J7E A;  1GSW A;  1P97 A;  1OPX A;  3E4Q A;  3B42 A;  2VGL S;  3CLO A;  4OOM A;  4EES A;  2OOL A;  4KUO A;  1D06 A;  3UME A;  2P08 A;  4WLA A;  1XJ3 A;  2EA9 A;  4HP4 A;  3V67 A;  3RFB A;  2K2N A;  5LBR A;  4G3W A;  3BY9 A;  1TF1 A;  4FOF A;  2KOI A;  2OAQ 1;  2PR6 A;  5HL6 A;  3ULF A;  3OOV A;  4CLC E;  4JGP A;  1UGU A;  4HH2 A;  3C8C A;  5DKL A;  1F98 A;  1TS7 A;  3HCY A;  3NJA A;  3H7W A;  4EW7 A;  1OTA A;  2VEA A;  1YSQ A;  4HJ3 A;  2W1T A;  2KX6 A;  1ZTU A;  2Z6C A;  3U2A A;  2ZMV A;  3EQU A;  2D02 A;  2ZOI A;  3BQ8 A;  3CUE C;  3RTY A;  3LIF A;  3JVU A;  2XA7 S;  4I38 A;  2HGV A;  3TJZ C;  3KSG A;  5AVF A;  5DFX A;  2JKR I;  3F1P B;  3F1N A;  1Y28 A;  4HH3 A;  4GCZ A;  4MCW A;  3VE4 A;  5G4Y A;  4ETX A;  5G4Z A;  4R38 A;  4EEP A;  4EQ1 A;  2NUP C;  2O9A A;  3LIE A;  3S7N A;  3E4P A;  2KDK A;  3A0R A;  4ME4 A;  2XA7 M;  3T4O A;  1UWN X;  2FH5 A;  3ICY A;  2W3D A;  5HD5 A;  4JGO A;  3LR0 A;  4P6Z S;  5C5K A;  4Y5F A;  1W63 M;  1WA9 A;  3HJK A;  4IJG A;  3EQV A;  4YWZ A;  3LIC A;  3BY8 A;  2PD7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...