2K31A

Solution structure of cgmp-binding gaf domain of phosphodiesterase 5
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
149
structure length
149
Chain Sequence
DVTALCHKIFLHIHGLISADRYSLFLVCEDSSKDKFLISRLFDVAEGSTLEEASNNCIRLEWNKGIVGHVAAFGEPLNIKDAYEDPRFNAEVDQITGYKTQSILCMPIKNHREEVVGVAQAINKKSGNGGTFTEKDEKDFAEYLAFCGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Phosphodiesterase 5A, cGMP-specific
publication title Solution Structure of the cGMP Binding GAF Domain from Phosphodiesterase 5: Insights into Nucleotide Selectivity, Dimerization, and cGMP-Dependent Conformational Change.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase
total genus 12
structure length 149
sequence length 149
ec nomenclature ec 3.1.4.35: 3',5'-cyclic-GMP phosphodiesterase.
pdb deposition date 2008-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01590 GAF GAF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2k31A00
3ZQ5A 4GLQA 2VKSA 4Y3IA 1TF1A 3E98A 5HSQA 4MN7A 3RFBA 3S7QA 2B18A 2K2NA 3NOTC 4LRYC 2O9BA 2Y79A 4YOFA 5C5KA 2KOIA 4ME4A 2VZWA 4Q0HA 4MDZA 2M7UA 2KLIA 4ETZA 5L8MA 5DFYA 3LFVA 4LRZE 3W2ZA 2M7VA 4R6LA 1ZTUA 3TRCA 3D3OA 1YSPA 4IUHA 2W1RA 3VV4A 3KSIA 4E04A 4O01A 3NHQA 4RQ9A 3G6OA 3KO6A 4ZRRA 5DFXA 4Z1WA 4PAUA 4MMNA 4CQHA 1TD5A 1YSQA 3IBRA 3EEAA 4LRXC 5I5LA 4G3KA 5TJJA 5LBRA 2O9AA 4DMZA 3NOUC 4Y5FA 2GX5A 2W1TB 4DN0A 4FOFA 2O99A 2VJWA 4EUVA 3DBAA 4MCWA 2ZMFA 2OOLA 3HCYA 4IJGA 1VHMA 2W3DA 2LB9A 2K31A 4R70A 3S7NA 5K5BA 2VEAA 2W3HA 3OBFA 4G3WA 4QPRA 2HGVA 2W1TA 3S7PA 3OOVA 2O9CA 2XROA 3MMHA 2IA2A 2Y8HA 5HL6A 2W3GA 4Y2FA 5AJGA 3BJNA 2QYBA 1STZA 2LB5A 2O0YA 4O8GA 3KSFA 3NOPC 3E0YA 2G7UA 3O5YA 1MKMA 3K2NA 3MF0A 1YKDA 3KSHA 4BWIA 1F5MA 4YNRA 4Q0IA 3IBJA 5HPFA 4GW9A 2XRNA 4Q0JA 3MQ0A 4IUKA 1MC0A 3C2WA 4EU0A 4ETXA 3KSGA 3R4KA 2XSSA 2W3EA 3S7OA 4O0PA 5HPIA 3CITA 4G3VA 3CI6A 2W3FA
chains in the Genus database with same CATH superfamily
2VKSA 3E98A 3Q7ZA 4I39A 1DY6A 1OJGA 1XX2A 3T4SA 2EXBA 4R38A 3GTCA 3C5AA 5TBMB 4BQMA 3K3CA 1LLBA 3V3SA 4DDYA 1ZG4A 3PXPA 1NYMA 4KQDA 5D3OA 4DKIA 2JC7A 4EBLA 4R4RA 3PAEA 1KGEA 2VV7A 4D2OA 4GDNA 2NUPC 1TS6A 1OMEA 1L0GA 1K54C 2WKRA 3HBRA 4C6YA 1F2KA 1N9BA 4BBTA 4A5RA 3QP6A 3WRZA 1ES3A 5HZHA 5GHZA 4R23A 5L10A 3UDXA 3UN7A 1LI9A 4B4XA 4HEFA 3FKVA 3OPLA 2Y2PA 4ID4A 1IKIA 3LYXA 1GSXA 1BLCA 1K4EA 3GDIA 1K38A 3SS5A 2HF6A 1PWCA 1UWPX 5CHUA 4RVAA 1NYYA 3FPVA 1Z09A 1MKIA 2HDUA 1S4RA 3BFDA 1WYBA 5CEBA 3LEZA 5DVAA 2EWVA 1YPRA 2UWXA 3LICA 3LO7A 3W4QA 1T19A 1XA7A 1LI0A 4DE3A 3ZCZA 4CLCC 1KDSA 3VMAA 4KQQA 1SKFA 1K57A 5M19A 2M1CA 4O0PA 3CITA 4Y15A 3IXGA 3ITBA 3SS3A 3WS0A 5HAQA 4KZ8A 1ERQA 3LR0A 2HP9A 3ZNTA 3TG9A 5AVFA 1IKGA 1VETB 4MN6A 4I3IA 4H6JA 5EVID 2A24A 2H5SA 4UA7A 1L3LA 3IXBA 4LRZE 4WN5A 1ZTUA 3ZYTA 4KZ7A 3VV4A 2EWWA 2WKPA 4Y17A 2WGIA 5CGSA 4LGWA 4DF6A 1XJ4A 3LR4A 3K3DA 3MFXA 4WLAA 1L0EA 4LRXC 1UWNX 4U0TA 3CAXA 1C3BA 5CHJA 5L09A 3VP2A 2GX5A 5J7EA 3VP1A 4PHTA 1QMFA 4QY6A 4D60A 2Q9MA 4EXOA 3VFHA 4DXCA 4HBUA 4WEJA 5TFQA 1VEUA 2O9CA 4JF5A 2XA7M 4HOIA 5KMWA 3BJNA 2FFYA 4JXVA 3E0YA 4NXFA 2V0UA 5FEFA 4WMCD 1RCJA 4MBKA 2Y2JA 4XUZA 1IELA 3VFFA 4II7A 1FSYA 2P9VB 1X0OA 3F1OB 3O87A 2EX8A 4KZ9A 5EECA 3EQVA 3H82B 3C2WA 1XP4A 3N8LA 4K08A 1IYQA 3T1SA 1BLPA 5DTKA 4Y0TA 2D01A 3PR6A 2AVXA 1XFQA 2P08A 2K7SA 4ZJ2A 3HUMA 2O9BA 4UEYA 2IWDA 3BFEA 1I2WA 3H7WB 5BOHA 4HH3A 2J9OA 2M7VA 4R6LA 2QMIA 4EV4A 5E2EA 3D3OA 3MFDA 2B95A 3BRMA 3NHQA 5EUAA 2L0WA 3IWQA 2EX9A 4ZRRA 2XGNA 1H3QA 1WE4A 3IWIA 1ES5A 5FASA 3PBRA 3MXQA 3WS5A 2V1ZA 1PYYA 3BLSA 3BY9A 5L2FA 2VJWA 5EVEA 1LT0A 1ES4A 4EUVA 4MLLA 2VV6A 1HVBA 1BT5A 3NDEA 4NKPA 4R70A 5FQ9A 3RXXA 3FYZA 4WEKA 1WA9A 2QJ5A 2I72A 2WGWB 4R4SA 4K0XA 4BBUA 3JPUA 3SZTA 3IF6C 1GHMA 3EQUA 4EBNA 2PU2A 2A2LA 2Y8HA 4R3AA 1P9WA 1XXMA 2V0WA 2O0YA 2XQZA 1O7EA 3BFGA 3H82A 4OOLA 3IBJA 4JF4A 2J7VA 4PM5A 2BTFP 3UDFA 1U60A 3F1NB 1F98A 3UPOA 3ZQ5A 5FSRA 3P09A 5HSQA 3LIBA 3UPPA 3G31A 5FI6A 3PBNA 1NRFA 1KE4A 1IFQA 3H7WA 3MXSA 1S0WA 4LRYC 2ZQ9A 1L2SA 2L1MA 3DTMA 2KOIA 2J3WA 4MDZA 5A91A 3EEHA 4GHIA 3UY6A 3MKFA 1VM1A 4GCZA 2W27A 3P98A 3BYDA 4NXGA 1H8YA 1J9MA 3NIAA 2J9PA 5HAIA 5JYPA 3LY3A 3IS2A 4HJ4A 4UA6A 3LI8A 1XPBA 3O3VA 1K56D 3PBSA 1NLZA 1YSQA 4PM9A 4GD6A 1XA1A 3IBRA 2ZJ9A 2Y2NA 1CEGA 2EX2A 5AQAA 5LBRA 3WS4A 2Y2KA 1XGIA 2B5RA 3E2LA 1SDEA 2D02A 3NOUC 5AVEA 3T4KA 2O99A 1KE3A 4X6TA 5FAOA 5FQMA 1L0DA 2W0NA 3TJZC 2K31A 4L9FA 5IS1A 2YKHA 2HJEA 1CI9A 1CQAA 5HL1A 1XFNA 2W1TA 3MMHA 4BLMA 1W8YA 2GDNA 3QP1A 2KDKA 2V8FA 2ZL1B 3CMZA 1ODVA 2QZ6A 2QHKA 4HJ6A 1EROA 4CLCB 4PKYG 3F1NA 1I2SA 1RGYA 3QNBA 4F3LB 4IUKA 3OPHA 5GLAA 4QB8A 3LIAA 2IWCA 5CHMA 3BFFA 2Y55A 3UDIA 4GLQA 1LL5A 1ACFA 1ONGA 2Z6CA 5GHYA 3RJUA 2PAVP 1HD8A 5L07A 3OPPA 1QMEA 4X53A 5HDCA 1H0MA 1S66L 4X55A 3V39A 3JYIA 5MC7A 3KYEA 2RL3A 3TRCA 4YWZA 2KX6A 1K54A 3SOIA 4S2KA 3PYPA 1NRJA 1KGFA 1PW1A 3FG8A 4I3AA 3IWOA 3MR0A 2BLSA 5G4ZA 3ZHHA 3B42A 1OJ5A 4L0LA 4P6ZM 5J4EA 3LIDA 1W79A 3UB5P 2XLNA 5IU1A 5I5LA 1O07A 4R1GA 4WUJA 2ZD8A 5TJJA 3QHYA 3G2YA 1GSWA 3V5MA 3SH7A 4OQGA 1D7EA 3BEBA 4KQOA 4IEDA 2ZQAA 4KG5A 3MBZA 2JKGA 3S4XA 2JKRM 2XDMA 3OBFA 5CECA 1TVFA 3T50A 2Y2QA 4N1HA 3CJMA 4ZTKA 3O86A 3GR2A 1DJCA 2OAQ1 5HL6A 4Y2FA 2XK1A 4E3NA 2DRWA 1MWRA 3T4QA 4F3LA 3UE6A 3NBLA 3MF0A 3KSHA 2FFFB 4YNRA 3FC7A 3DWKA 2PU4A 4JXSA 3L7HA 3UE1A 1FOFA 4OP8A 4WYYA 5DTTA 2WUQA 4N9KA 4U3TA 2ZQCA 4G3VA 1FCMA 3IQAA 3BECA 1PNEA 2PR5A 3LR3A 4NXBA 2ZC3B 2CMNA 3AGFA 4NEED 3HLGA 4YOFA 1PI4A 3BLMA 2X01A 3CPTB 1MXOA 2ZBBA 3ZG7B 1S1ZA 3IHBA 2ZC7A 3GRJA 3W2ZA 2XF3A 1CJFA 3FWLA 3SH8A 4LV3A 2H0YA 3S22A 2HP5A 1HLUP 4PKYA 1K55C 4N1XA 1ZKJA 1KVMA 4ESPA 3G6OA 2OV5A 3FPWA 4HI4A 3U2AA 2ZM2A 4PAUA 3UNWA 3GVBA 3NJAA 2UV0E 4OQIA 1Y28A 3LI9A 4EQ1A 2HPBA 2FZ0A 1FCNA 3ZFZA 5EPHA 4HIAA 3OLOA 3NULA 4P6BA 1YMXA 3FZCA 3LIEA 4ARZA 4Y7PA 2Z2LB 2JKFA 4RX3A 3IF6B 1YLTA 3MQQA 1YQSA 4FTXA 4JKTA 4EW7A 3OOVA 4DRTA 1KGGA 3P01A 3SS4A 2WKQA 2G2WA 1E3UA 4EESA 2OLVA 3HLBA 3O5YA 3Q82A 2EXAA 5GHXA 4Q0IA 1VQQA 4LCMA 1YLJA 5DF8A 2ZM0A 3W4OA 1WYCA 1DJAA 3MJQA 3B33A 3MKEA 3MS6A 2WGVA 2XFSA 2XSSA 2WKEA 3ZG9B 3CPTA 5CX7A 1OT6A 5C5KA 4KG2A 1KVLA 2KLIA 4FUWA 2DCFA 1W63Q 3CLOA 2P04A 4I38A 4NXEA 5FEGA 1ALQA 1NY0A 1Q2QA 3N8RA 4MBFA 1FILA 4EEPA 3KO6A 2B02A 5TBMA 2WK0A 1LL8A 4GZBA 5KZHA 3HL9A 3VOLA 2XR0A 2DNSA 3UE0A 4KZ3A 5IT5A 3VE4A 3DTEA 4DE0A 2VGKA 2RCXA 4GS9B 4JF6A 2HJ9C 3IF6A 4MCWA 5A8BA 5HD3A 4C75A 2EFUA 2V1BA 1HZOA 3S7NA 3AGDA 2JN7A 3N4IA 1STZA 1KE0A 4KZ4A 5FI2A 5A90A 2VK3A 5FA7A 4S2NC 5FQJA 1NXYA 3IF5A 1MC0A 3ZG8B 5EOOA 1OPXA 1TS8A 3R4KA 2J3TC 3VOYA 2VGLS 3HJIA 3PAGA 3Q1FA 2EX6A 4S2MA 2ZM8A 5F82A 4FH4A 1K25A 1EWZA 1GA0A 2GZAA 2K2NA 3IXDA 2FH5A 3OZHA 4BBVA 5FAQA 2JCHA 4E6XA 3Q81A 1FR6A 3M2KA 1OTIA 5E43A 5HW3A 4DE1A 2Y2IA 2ZLYA 1EI5A 1IYOA 4E04A 1VETA 1E25A 5TGFA 1IEMA 3UB7A 4JLFA 3P7NA 1PWDA 3T4OA 4MMNA 3H9WA 2HV1A 3A3IA 4IHQA 2JKTM 4KZBA 1ESUA 4OH0A 3T4LA 3VP4A 4NG2A 5FDHA 4OOYA 4IBXA 1MWUA 5DF9A 1RP5A 3CUEC 2J8YA 4S2LA 4MNRA 1PIOA 3FV7A 5E2HA 4Y13A 5CTMA 3LIFA 1JWPA 3QP2A 4HH2A 1CF0A 2XFTA 3ZNYA 2LB5A 5GLBA 4I3JA 2J80A 1F9IA 1MKMA 5EFWA 4WZ4A 1K57C 4ZJ1A 5KSCA 1JTDA 3VP0A 5HPFA 1GSVA 1ERMA 2V9AA 4Q0JA 1XJ3A 5AQBA 2V1AA 3T1RA 1Y54A 4JGRA 4GNUA 1VB6A 3AGEA 4NK3A 1S4SA 4DJ2A 3NECA 1FSWA 3GECA 4MN7A 1S1YA 3RFBA 4IBRA 2P9VA 3F1OA 5DTSA 2H0TA 1MWSA 5G4YA 5U47A 4OPRA 4ETZA 3LY4A 4N9LA 1PFLA 5EE8A 1HTZA 1YLWA 2R9WA 1IYSA 5CERA 1BZAA 3T12B 1ONHA 5EM0A 3B3XA 5G18A 1DJBA 1FR1A 2Q9NA 3HLDA 1OTAA 3UO9A 1BYWA 1TD5A 4H8RA 4WL9A 1JNUA 4GOGA 4LCLA 2Y2OA 5E2FA 3NDGA 5FQKA 1BSGA 3G35A 4L9EA 2HDSA 1JTGA 1V9ZA 2GJ3A 3ZG0A 2PT7A 2VGJA 4IJGA 2LB9A 4G3WA 4QPRA 4Y0UA 1AXBA 3V67A 1OTDA 4PMAA 3WS1A 2Y4AA 3N7WA 2QKPA 4OOMA 2X71A 3SH9A 1M6KA 2WGWA 3LUQA 4CJNA 5F83A 1JWVA 4MEZA 4WM9A 4PM8A 3VSKA 3S1YA 3MSHA 2PD8A 3W8KA 5DKLA 2WKIA 3KX0X 2PYPA 1TF1A 4B4ZA 2XD5A 4JXWA 3NOTC 4HESA 2VZWA 1K55A 2M7UA 3VSLA 3UE3A 2WYXA 4LPZA 2QWSA 4HP4A 4GDBA 4DXBA 3G30A 3I7JA 5HWVA 4R3JA 2WAFA 4X69A 3CHWP 4OP5A 4HBTA 4IVKA 5FATA 3Q7VB 2NUTC 3EGDC 2ZQ8A 5FL3A 2ZOIA 3C4PA 4OQ0A 3HUOA 5FDSA 1PRQA 3BY8A 4X56A 3C30A 3GQZA 1XKZA 2ZMFA 5HFOA 5TR7A 5K5BA 2HGVA 5E2GA 3S7PA 3IX3A 1W63M 3PBOA 2IA2A 2ZMAA 1G28A 1E4DA 4HQAA 4OONA 3IX8A 3M2JA 1JWZA 1G6AA 1MZUA 1H8ZA 2VGLM 3C7VA 5AQ7A 5I94A 2PD7A 3O88A 3VP3A 2ZL1A 1SCWA 4RA7A 3QP4A 4CPKA 4L9GA 4CLCA 4ZBEA 3E4OA 4Q8IA 4ZJ3A 3C38A 1N9LA 5AQ9A 4M3KA 4O7DA 4KZAA 4YINA 4S2OA 3L9KA 2Y2MA 3FKWA 5L8MA 3UMEA 4QY5A 4E3IA 2H28A 4GN2A 4OPQA 4HP9A 4KZ6A 1YSPA 2W1RA 2P74A 2QJ7A 4WZ5C 1T1BA 5DFXA 4MBHA 4QWOA 1EW0A 1FIKA 4JGQA 3EOIA 3G34A 3A3JA 3T4JA 1LSXA 3LEQA 3TOIA 4DMZA 1T1AA 2Y2HA 4DN0A 2OWHA 3IT9A 3BM6A 2ZQ7A 4FOFA 4FCFA 2Z6DA 3F1PB 1L0FA 3OPRA 1GHPA 3V50A 2OWJA 3R7WB 4EERA 3RTYA 2CC1A 5DJTA 2E8IA 3OCLA 1KDWA 3LR5A 4JPMA 3T1QB 2QYBA 1D06A 3IH8A 4O8GA 1PZPA 3NOPC 4HNBA 2V8CA 4OPYA 1XJ2A 4FH2A 4UQIS 2QPNA 4BJPA 1F5MA 1Y4OA 4EBPA 4B88A 4ZAMA 4WF0A 3U4LP 4WBGA 4E3JA 4CLCE 4EU0A 4OPZA 4GKUA 4H6JB 1OTBA 2A24B 3S7QA 2B18A 2PDRA 3HLCA 3N6IA 5KIZA 2Y79A 5HAPA 1K0KA 3VOZA 4WMCA 1YM1A 2WZZA 1TDGA 2I9VA 2WZXA 2PBYA 2ZC5B 2EFXA 4X68A 1ZG6A 5DFYA 4E3LA 3N8SA 2JKRI 4EEUA 1ESIA 1MY8A 3WRTA 4N92A 3KSIA 2BG1A 4O01A 4RQ9A 1DP8A 2XD1A 2OLUA 1W8QA 5HX9A 3E4PA 5FAPA 1ZC2A 3ICYA 3ZDJA 4CQHA 1LSWA 2GNXA 3QNCA 1MWTA 4CLCD 3CUEA 2VLGA 2A49A 5J8XA 3F1PA 2O9AA 1PWGA 2VV8A 5HARA 3R7WA 1T18A 1VEUB 1CK3A 5HD5A 3DBAA 2MJ6A 3HCYA 1GCEA 2W3HA 3V3RA 4EUZA 4X1LA 3M6BA 3UB8A 4OLDA 4R3BA 5DJUA 3GSGA 4F94A 2W3GA 3D72A 5AJGA 4BD1A 3A0SA 3PHYA 5F69A 4K91A 2ZMVA 1P97A 4XUXA 3QP8A 4BMWA 5A92A 4QD4A 4YFMA 3MQ0A 5EVIC 4FD8A 3ITAA 1BTLA 3MZEA 1P9RA 1FQGA 3KSGA 3ZGAB 4MN5A 4LV0A 4GD8A 1ES2A 1CEFA 1YLPA 1OT9A 2VX8A 3PBQA 2A3UA 5M18A 3PTEA 2Y2LA 3ZVTA 5F1FA 4E3MA 1OTEA 5EOEA 4P0MA 1I5QA 2P7JA 2INWA 4P6ZS 2J3TD 1IOUA 2V2FF 5EVLA 4KUOA 1PI5A 3M6HA 4QHCA 3ZG5A 3CWFA 5J3WA 4AFIA 1S6RA 1S67L 3TW8A 1TEMA 4FSFA 1E3UD 3EEAA 1TS0A 3BQAA 1G6OA 3UB9A 3ULFA 4C3QA 1YMSA 3RXWA 5CGWA 3KYQA 2ZC4B 1W7FA 2ZC6B 4UAAA 1VHMA 2W3DA 3DAVA 5CGXA 1YAXA 3T4TA 4GS9A 1RGZA 1K56A 2V20A 3G2ZA 3ZVWA 4NETA 4JGOA 2PYRA 4E3KA 3IX4A 4EETB 3GMWA 4BWIA 3NC8A 3W4PA 1NJ4A 1A0KA 1V9YA 3G4PA 4OQHA 1JVJA 3A0RA 3DW0A 4QU3A 2W3EA 1LSVA 3S7OA 4GHIB 4ZDXA 3CI6A 1LHYA 2PHYA 2IWBA 1W5DA 1N4OA 4GJ4A 5F68A 1G68A 1YT4A 3NCKA 4ME4A 3C7UA 3IS2B 4Z9QA 5F6AA 5HWTA 2VA0A 3C4OA 2ACGA 1MBLA 3GV9A 4Z1WA 5GL9A 2ZQDA 2C5WB 4IVIA 3DTKA 1Z6FA 2BASA 3EGXC 1YLYA 3HUNA 3TE8A 2W1TB 1K4FA 1NWZA 5HDDA 4RYEA 4JXGA 2OOLA 3JVVA 1N9NA 3Q07A 1AWIA 3D9YA 1BLHA 5DKKA 4UA9A 3DTIA 1D1JA 1P0ZA 4UQIM 4HY8A 3BFCA 1H5XA 4S2IA 1ZHHB 1DP9A 4EWFA 3MQOA 4Y0OA 3ISGA 1N9OA 1YKDA 1BLSA 4P87A 1SHVA 2PBDP 5IHVA 1G5UA 3IXHA 1UGUA 1TDLA 4X25A 3UMDA 2YKFA 2XH9A 2Y91A 3CG5A 2Z2MB 2ZOHA 3G32A 4B9OA 4DDSA 3EWKA 2WADA 2HZ5A 2JKTI 3HVFA 3A0VA 2JE5A 2Y2GA 1GA9A 1M40A 4E6WA 4LV1A 3BQ8A 5FQIA 2HDQA 1NLYA 3DWZA 4WZ5A 5HWWA 4X1MA 3LFVA 3IHAA 3HJKA 3A3DA 4KENB 2E8JA 4IUHA 4DE2A 1KOUA 5F1GA 4HJ3A 3JVUA 2JHEA 4LENA 5FQQA 4M4XA 3WS2A 4QJGA 4RX2A 2Q0OA 4PM6A 3KYZA 4KQRA 3QP5A 1NZOA 3E4QA 3PBTA 5EV0A 1TS7A 4I5SA 1MPLA 2JBFA 5EM1A 2C6WB 4BL2A 4XXRA 2EA9A 3HLWA 4KZ5A 1T1CA 5CTNA 3BWLA 2PR6A 4XT2B 4K0WA 4WELA 1CI8A 5F5YA 3BW6A 5DF7A 3UB6A 4KG6A 4BD0A 2XROA 1FCOA 3E2KA 2OSUA 1SZVA 3KSFA 2XA7S 4PPRA 5EVIB 3D4FA 2OAP1 2XRNA 1GHIA 4LFUA 3OC2A 3UPNA 3A3FA 5CXWA 4ETXA 1SKOB 3B47A 5CEDA 5M1AA 1LL9A 2W3FA 4Y3IA 2WAEA 4LV2A 3RH8B 3MXRA 1NZUA 4R0QA 1YLZA 4B93A 3LCEA 3SW1A 1DP6A 5GLCA 3HLFA 1J3WA 5KSHA 4Q0HA 4LLOB 4S2JA 3NY4A 3LGOA 2G2UA 3MZDA 2H10A 3WWXA 4BL3A 1XJ6A 2X02A 1DRMA 2L4RA 5CRFA 2PRFA 4PM7A 1Q2PA 4HHDA 4DJ3A 4ARZB 1PW8A 4GB7A 5FI7A 3IH9A 4KUKA 2HP6A 4G3KA 2R9XA 3NI9A 4XT2A 5GLDA 4U0XA 4Y5FA 3CZDA 3Q7VA 3TSGA 5A93A 3HREA 2Y59A 1BULA 4BENA 2XEPA 3A3EA 4OVDA 2DMWA 1BUEA 2VEAA 4UHUA 3T1XA 5JYOA 1H8MA 4S2PA 4JBFA 5EVIA 2WKHA 4OLGA 2R78A 2G7UA 1K6RA 1PZOA 1XGJA 4EQIA 3K2NA 1IYPA 3OCNA 4JGPA 3VE3A 1SKOA 4GW9A 3MZFA 1SDNA 4OKPA 3HLEA 4E3OA 5HDSA 1K6SA 4S2NA 3C8CA 2HDRA 5HPIA 4P85A
chains in the Genus database with same CATH topology
1OT9A 4GLQA 2VKSA 2VX8A 1S4SA 4DJ2A 3PBQA 3E98A 3GECA 4MN7A 3RFBA 1S1YA 4I39A 2Z6CA 3T4SA 1OJGA 3F1OA 5HDCA 1S66L 5G4YA 1OTEA 4R38A 5TBMB 2P7JA 3K3CA 4ETZA 2INWA 4P6ZS 3PXPA 5MC7A 2J3TD 4KQDA 1IOUA 4KUOA 3TRCA 4YWZA 2KX6A 3PYPA 1NRJA 3FG8A 4I3AA 3MR0A 3CWFA 2VV7A 5G4ZA 5J3WA 3B42A 2NUPC 1OJ5A 4L0LA 4AFIA 1TS6A 1S67L 1OTAA 3TW8A 4P6ZM 5J4EA 1BYWA 3LIDA 1TD5A 4FSFA 2WKRA 4WL9A 5IU1A 4BBTA 3EEAA 1TS0A 1JNUA 5I5LA 4WUJA 3BQAA 5HZHA 5TJJA 1G6OA 3UB9A 3ULFA 1GSWA 4L9EA 1D7EA 4KQOA 3KYQA 1V9ZA 2GJ3A 2PT7A 4IJGA 1VHMA 2W3DA 2LB9A 3LYXA 2JKRM 1GSXA 1YAXA 3OBFA 4G3WA 4QPRA 3T4TA 4GS9A 3T50A 3GDIA 3V67A 2HF6A 1UWPX 1OTDA 2OAQ1 4JGOA 4Y2FA 5HL6A 3FPVA 2QKPA 1S4RA 4OOMA 2PYRA 3T4QA 4F3LA 3UE6A 3MF0A 4EETB 2EWVA 3KSHA 4BWIA 4YNRA 3FC7A 3LUQA 1V9YA 3LICA 1T19A 4CLCC 3A0RA 2W3EA 1LSVA 2M1CA 4O0PA 3S7OA 2PD8A 3CITA 4G3VA 4GHIB 3CI6A 5DKLA 3KX0X 2PHYA 2PR5A 1TF1A 2PYPA 3LR3A 3LR0A 4NXBA 4GJ4A 5F68A 3NOTC 2CMNA 4NEED 4YOFA 5AVFA 4ME4A 2VZWA 4MN6A 4I3IA 2M7UA 2ZBBA 4H6JA 3IS2B 2A24A 1S1ZA 3UE3A 4LPZA 4LRZE 2QWSA 3W2ZA 4WN5A 4HP4A 1ZTUA 3ZYTA 5F6AA 3VV4A 4PKYA 2EWWA 2WKPA 5HWVA 5HWTA 2VA0A 3G6OA 3FPWA 4HI4A 3U2AA 4Z1WA 1XJ4A 2NUTC 4PAUA 3EGDC 3LR4A 3K3DA 5FL3A 2ZOIA 3MFXA 4WLAA 3NJAA 2BASA 3EGXC 4LRXC 1Y28A 1UWNX 3LI9A 4EQ1A 3CAXA 2FZ0A 3TE8A 3BY8A 2GX5A 2W1TB 4HIAA 3OLOA 1NWZA 3C30A 5J7EA 4PHTA 5HDDA 3LIEA 4ARZA 2ZMFA 2OOLA 4EXOA 3JVVA 1N9NA 3MQQA 5K5BA 2HGVA 4WEJA 5DKKA 3S7PA 3OOVA 4EW7A 2O9CA 1W63M 3PBOA 2XA7M 3P01A 2IA2A 2WKQA 4HOIA 1P0ZA 4UQIM 3BJNA 4HY8A 4EESA 3E0YA 1G28A 4HQAA 1ZHHB 1DP9A 2V0UA 4NXFA 3O5YA 3MQOA 1N9OA 1YKDA 1MZUA 4Q0IA 4II7A 2VGLM 1UGUA 1X0OA 3F1OB 3UMDA 2YKFA 3EQVA 3H82B 3C2WA 3MJQA 3B33A 2PD7A 2XSSA 4K08A 2ZOHA 4B9OA 3EWKA 2JKTI 2D01A 3PR6A 4L9GA 4CLCA 3E4OA 3A0VA 1XFQA 2P08A 3C38A 2K7SA 1N9LA 3BQ8A 5CX7A 2O9BA 4UEYA 1OT6A 5C5KA 1NLYA 5HWWA 2KLIA 3H7WB 5L8MA 4HH3A 1W63Q 3CLOA 3LFVA 3UMEA 2P04A 2M7VA 4I38A 2H28A 4NXEA 3HJKA 4HP9A 4R6LA 3D3OA 1YSPA 4IUHA 2W1RA 2QJ7A 1KOUA 3NHQA 4HJ3A 4EEPA 1T1BA 3JVUA 2L0WA 3KO6A 2B02A 2JHEA 5TBMA 4ZRRA 5DFXA 4M4XA 1LL8A 1H3QA 3KYZA 1EW0A 3VOLA 3PBRA 3E4QA 3MXQA 3EOIA 3PBTA 4JGQA 5IT5A 3T4JA 3VE4A 1TS7A 4I5SA 1LSXA 4GS9B 4DMZA 1T1AA 2HJ9C 4DN0A 2OWHA 2EA9A 3BY9A 4FOFA 1T1CA 2VJWA 1LT0A 3BWLA 2Z6DA 4EUVA 4MCWA 2PR6A 3F1PB 4XT2B 2VV6A 5A8BA 5HD3A 4WELA 2OWJA 3R7WB 2V1BA 4EERA 4NKPA 4R70A 3RTYA 5DJTA 5F5YA 3OCLA 4WEKA 3S7NA 1WA9A 2QJ5A 3BW6A 2JN7A 4BBUA 3UB6A 3LR5A 3EQUA 2XROA 2A2LA 2Y8HA 4R3AA 1P9WA 2QYBA 1STZA 1D06A 2V0WA 2O0YA 4O8GA 3KSFA 3NOPC 4HNBA 2XA7S 1XJ2A 4UQIS 4BJPA 1F5MA 3H82A 4OOLA 3IBJA 2OAP1 2XRNA 4WF0A 1MC0A 3OC2A 1OPXA 4CLCE 4EU0A 4ETXA 3B47A 3F1NB 1F98A 1TS8A 3R4KA 2J3TC 2VGLS 3HJIA 4H6JB 2W3FA 2A24B 1OTBA 3ZQ5A 4Y3IA 3RH8B 5HSQA 3LIBA 3S7QA 2B18A 3PBNA 4B93A 2PDRA 2GZAA 1IFQA 3H7WA 2K2NA 3SW1A 4LRYC 1DP6A 5KIZA 2FH5A 2L1MA 2Y79A 4BBVA 2KOIA 2J3WA 5KSHA 4Q0HA 4MDZA 2I9VA 3EEHA 4GHIA 4LLOB 1OTIA 5DFYA 4GCZA 2JKRI 2W27A 4EEUA 1XJ6A 4NXGA 3KSIA 4E04A 4O01A 3UB7A 4RQ9A 1DRMA 2L4RA 1DP8A 3IS2A 4HJ4A 3P7NA 3E4PA 4HHDA 4DJ3A 3ICYA 3LI8A 3T4OA 4ARZB 4MMNA 3H9WA 2HV1A 4CQHA 3PBSA 1NLZA 1YSQA 1LSWA 2GNXA 4IHQA 2JKTM 4KUKA 3IBRA 4CLCD 3CUEA 3T4LA 2VLGA 4G3KA 3F1PA 4XT2A 5LBRA 2O9AA 2VV8A 2D02A 3NOUC 4Y5FA 3R7WA 1T18A 5AVEA 3T4KA 5HD5A 5DF9A 2O99A 3DBAA 2MJ6A 3CUEC 2W0NA 3HCYA 3TJZC 2K31A 4L9FA 5IS1A 2DMWA 2YKHA 2HJEA 2VEAA 2W3HA 1XFNA 2W1TA 3LIFA 3UB8A 1H8MA 3MMHA 4HH2A 5DJUA 2W3GA 3D72A 5AJGA 2LB5A 3A0SA 3PHYA 5F69A 2R78A 2ZMVA 2G7UA 4I3JA 2J80A 2KDKA 1F9IA 1P97A 1MKMA 3K2NA 5EFWA 3OCNA 4JGPA 1ODVA 2QHKA 3VE3A 4HJ6A 4CLCB 4PKYG 3F1NA 4BMWA 5HPFA 4GW9A 1GSVA 2V9AA 4Q0JA 3MQ0A 4F3LB 1XJ3A 4IUKA 2V1AA 1P9RA 3KSGA 3LIAA 4MN5A 4JGRA 5HDSA 3C8CA 5HPIA 1VB6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZQ5 A;  4GLQ A;  2VKS A;  4Y3I A;  1TF1 A;  3E98 A;  5HSQ A;  4MN7 A;  3RFB A;  3S7Q A;  2B18 A;  2K2N A;  3NOT C;  4LRY C;  2O9B A;  2Y79 A;  4YOF A;  5C5K A;  2KOI A;  4ME4 A;  2VZW A;  4Q0H A;  4MDZ A;  2M7U A;  2KLI A;  4ETZ A;  5L8M A;  5DFY A;  3LFV A;  4LRZ E;  3W2Z A;  2M7V A;  4R6L A;  1ZTU A;  3TRC A;  3D3O A;  1YSP A;  4IUH A;  2W1R A;  3VV4 A;  3KSI A;  4E04 A;  4O01 A;  3NHQ A;  4RQ9 A;  3G6O A;  3KO6 A;  4ZRR A;  5DFX A;  4Z1W A;  4PAU A;  4MMN A;  4CQH A;  1TD5 A;  1YSQ A;  3IBR A;  3EEA A;  4LRX C;  5I5L A;  4G3K A;  5TJJ A;  5LBR A;  2O9A A;  4DMZ A;  3NOU C;  4Y5F A;  2GX5 A;  2W1T B;  4DN0 A;  4FOF A;  2O99 A;  2VJW A;  4EUV A;  3DBA A;  4MCW A;  2ZMF A;  2OOL A;  3HCY A;  4IJG A;  1VHM A;  2W3D A;  2LB9 A;  2K31 A;  4R70 A;  3S7N A;  5K5B A;  2VEA A;  2W3H A;  3OBF A;  4G3W A;  4QPR A;  2HGV A;  2W1T A;  3S7P A;  3OOV A;  2O9C A;  2XRO A;  3MMH A;  2IA2 A;  2Y8H A;  5HL6 A;  2W3G A;  4Y2F A;  5AJG A;  3BJN A;  2QYB A;  1STZ A;  2LB5 A;  2O0Y A;  4O8G A;  3KSF A;  3NOP C;  3E0Y A;  2G7U A;  3O5Y A;  1MKM A;  3K2N A;  3MF0 A;  1YKD A;  3KSH A;  4BWI A;  1F5M A;  4YNR A;  4Q0I A;  3IBJ A;  5HPF A;  4GW9 A;  2XRN A;  4Q0J A;  3MQ0 A;  4IUK A;  1MC0 A;  3C2W A;  4EU0 A;  4ETX A;  3KSG A;  3R4K A;  2XSS A;  2W3E A;  3S7O A;  4O0P A;  5HPI A;  3CIT A;  4G3V A;  3CI6 A;  2W3F A; 
#chains in the Genus database with same CATH topology
 2VKS A;  3E98 A;  3Q7Z A;  4I39 A;  1DY6 A;  1OJG A;  1XX2 A;  3T4S A;  2EXB A;  4R38 A;  3GTC A;  3C5A A;  5TBM B;  4BQM A;  3K3C A;  1LLB A;  3V3S A;  4DDY A;  1ZG4 A;  3PXP A;  1NYM A;  4KQD A;  5D3O A;  4DKI A;  2JC7 A;  4EBL A;  4R4R A;  3PAE A;  1KGE A;  2VV7 A;  4D2O A;  4GDN A;  2NUP C;  1TS6 A;  1OME A;  1L0G A;  1K54 C;  2WKR A;  3HBR A;  4C6Y A;  1F2K A;  1N9B A;  4BBT A;  4A5R A;  3QP6 A;  3WRZ A;  1ES3 A;  5HZH A;  5GHZ A;  4R23 A;  5L10 A;  3UDX A;  3UN7 A;  1LI9 A;  4B4X A;  4HEF A;  3FKV A;  3OPL A;  2Y2P A;  4ID4 A;  1IKI A;  3LYX A;  1GSX A;  1BLC A;  1K4E A;  3GDI A;  1K38 A;  3SS5 A;  2HF6 A;  1PWC A;  1UWP X;  5CHU A;  4RVA A;  1NYY A;  3FPV A;  1Z09 A;  1MKI A;  2HDU A;  1S4R A;  3BFD A;  1WYB A;  5CEB A;  3LEZ A;  5DVA A;  2EWV A;  1YPR A;  2UWX A;  3LIC A;  3LO7 A;  3W4Q A;  1T19 A;  1XA7 A;  1LI0 A;  4DE3 A;  3ZCZ A;  4CLC C;  1KDS A;  3VMA A;  4KQQ A;  1SKF A;  1K57 A;  5M19 A;  2M1C A;  4O0P A;  3CIT A;  4Y15 A;  3IXG A;  3ITB A;  3SS3 A;  3WS0 A;  5HAQ A;  4KZ8 A;  1ERQ A;  3LR0 A;  2HP9 A;  3ZNT A;  3TG9 A;  5AVF A;  1IKG A;  1VET B;  4MN6 A;  4I3I A;  4H6J A;  5EVI D;  2A24 A;  2H5S A;  4UA7 A;  1L3L A;  3IXB A;  4LRZ E;  4WN5 A;  1ZTU A;  3ZYT A;  4KZ7 A;  3VV4 A;  2EWW A;  2WKP A;  4Y17 A;  2WGI A;  5CGS A;  4LGW A;  4DF6 A;  1XJ4 A;  3LR4 A;  3K3D A;  3MFX A;  4WLA A;  1L0E A;  4LRX C;  1UWN X;  4U0T A;  3CAX A;  1C3B A;  5CHJ A;  5L09 A;  3VP2 A;  2GX5 A;  5J7E A;  3VP1 A;  4PHT A;  1QMF A;  4QY6 A;  4D60 A;  2Q9M A;  4EXO A;  3VFH A;  4DXC A;  4HBU A;  4WEJ A;  5TFQ A;  1VEU A;  2O9C A;  4JF5 A;  2XA7 M;  4HOI A;  5KMW A;  3BJN A;  2FFY A;  4JXV A;  3E0Y A;  4NXF A;  2V0U A;  5FEF A;  4WMC D;  1RCJ A;  4MBK A;  2Y2J A;  4XUZ A;  1IEL A;  3VFF A;  4II7 A;  1FSY A;  2P9V B;  1X0O A;  3F1O B;  3O87 A;  2EX8 A;  4KZ9 A;  5EEC A;  3EQV A;  3H82 B;  3C2W A;  1XP4 A;  3N8L A;  4K08 A;  1IYQ A;  3T1S A;  1BLP A;  5DTK A;  4Y0T A;  2D01 A;  3PR6 A;  2AVX A;  1XFQ A;  2P08 A;  2K7S A;  4ZJ2 A;  3HUM A;  2O9B A;  4UEY A;  2IWD A;  3BFE A;  1I2W A;  3H7W B;  5BOH A;  4HH3 A;  2J9O A;  2M7V A;  4R6L A;  2QMI A;  4EV4 A;  5E2E A;  3D3O A;  3MFD A;  2B95 A;  3BRM A;  3NHQ A;  5EUA A;  2L0W A;  3IWQ A;  2EX9 A;  4ZRR A;  2XGN A;  1H3Q A;  1WE4 A;  3IWI A;  1ES5 A;  5FAS A;  3PBR A;  3MXQ A;  3WS5 A;  2V1Z A;  1PYY A;  3BLS A;  3BY9 A;  5L2F A;  2VJW A;  5EVE A;  1LT0 A;  1ES4 A;  4EUV A;  4MLL A;  2VV6 A;  1HVB A;  1BT5 A;  3NDE A;  4NKP A;  4R70 A;  5FQ9 A;  3RXX A;  3FYZ A;  4WEK A;  1WA9 A;  2QJ5 A;  2I72 A;  2WGW B;  4R4S A;  4K0X A;  4BBU A;  3JPU A;  3SZT A;  3IF6 C;  1GHM A;  3EQU A;  4EBN A;  2PU2 A;  2A2L A;  2Y8H A;  4R3A A;  1P9W A;  1XXM A;  2V0W A;  2O0Y A;  2XQZ A;  1O7E A;  3BFG A;  3H82 A;  4OOL A;  3IBJ A;  4JF4 A;  2J7V A;  4PM5 A;  2BTF P;  3UDF A;  1U60 A;  3F1N B;  1F98 A;  3UPO A;  3ZQ5 A;  5FSR A;  3P09 A;  5HSQ A;  3LIB A;  3UPP A;  3G31 A;  5FI6 A;  3PBN A;  1NRF A;  1KE4 A;  1IFQ A;  3H7W A;  3MXS A;  1S0W A;  4LRY C;  2ZQ9 A;  1L2S A;  2L1M A;  3DTM A;  2KOI A;  2J3W A;  4MDZ A;  5A91 A;  3EEH A;  4GHI A;  3UY6 A;  3MKF A;  1VM1 A;  4GCZ A;  2W27 A;  3P98 A;  3BYD A;  4NXG A;  1H8Y A;  1J9M A;  3NIA A;  2J9P A;  5HAI A;  5JYP A;  3LY3 A;  3IS2 A;  4HJ4 A;  4UA6 A;  3LI8 A;  1XPB A;  3O3V A;  1K56 D;  3PBS A;  1NLZ A;  1YSQ A;  4PM9 A;  4GD6 A;  1XA1 A;  3IBR A;  2ZJ9 A;  2Y2N A;  1CEG A;  2EX2 A;  5AQA A;  5LBR A;  3WS4 A;  2Y2K A;  1XGI A;  2B5R A;  3E2L A;  1SDE A;  2D02 A;  3NOU C;  5AVE A;  3T4K A;  2O99 A;  1KE3 A;  4X6T A;  5FAO A;  5FQM A;  1L0D A;  2W0N A;  3TJZ C;  2K31 A;  4L9F A;  5IS1 A;  2YKH A;  2HJE A;  1CI9 A;  1CQA A;  5HL1 A;  1XFN A;  2W1T A;  3MMH A;  4BLM A;  1W8Y A;  2GDN A;  3QP1 A;  2KDK A;  2V8F A;  2ZL1 B;  3CMZ A;  1ODV A;  2QZ6 A;  2QHK A;  4HJ6 A;  1ERO A;  4CLC B;  4PKY G;  3F1N A;  1I2S A;  1RGY A;  3QNB A;  4F3L B;  4IUK A;  3OPH A;  5GLA A;  4QB8 A;  3LIA A;  2IWC A;  5CHM A;  3BFF A;  2Y55 A;  3UDI A;  4GLQ A;  1LL5 A;  1ACF A;  1ONG A;  2Z6C A;  5GHY A;  3RJU A;  2PAV P;  1HD8 A;  5L07 A;  3OPP A;  1QME A;  4X53 A;  5HDC A;  1H0M A;  1S66 L;  4X55 A;  3V39 A;  3JYI A;  5MC7 A;  3KYE A;  2RL3 A;  3TRC A;  4YWZ A;  2KX6 A;  1K54 A;  3SOI A;  4S2K A;  3PYP A;  1NRJ A;  1KGF A;  1PW1 A;  3FG8 A;  4I3A A;  3IWO A;  3MR0 A;  2BLS A;  5G4Z A;  3ZHH A;  3B42 A;  1OJ5 A;  4L0L A;  4P6Z M;  5J4E A;  3LID A;  1W79 A;  3UB5 P;  2XLN A;  5IU1 A;  5I5L A;  1O07 A;  4R1G A;  4WUJ A;  2ZD8 A;  5TJJ A;  3QHY A;  3G2Y A;  1GSW A;  3V5M A;  3SH7 A;  4OQG A;  1D7E A;  3BEB A;  4KQO A;  4IED A;  2ZQA A;  4KG5 A;  3MBZ A;  2JKG A;  3S4X A;  2JKR M;  2XDM A;  3OBF A;  5CEC A;  1TVF A;  3T50 A;  2Y2Q A;  4N1H A;  3CJM A;  4ZTK A;  3O86 A;  3GR2 A;  1DJC A;  2OAQ 1;  5HL6 A;  4Y2F A;  2XK1 A;  4E3N A;  2DRW A;  1MWR A;  3T4Q A;  4F3L A;  3UE6 A;  3NBL A;  3MF0 A;  3KSH A;  2FFF B;  4YNR A;  3FC7 A;  3DWK A;  2PU4 A;  4JXS A;  3L7H A;  3UE1 A;  1FOF A;  4OP8 A;  4WYY A;  5DTT A;  2WUQ A;  4N9K A;  4U3T A;  2ZQC A;  4G3V A;  1FCM A;  3IQA A;  3BEC A;  1PNE A;  2PR5 A;  3LR3 A;  4NXB A;  2ZC3 B;  2CMN A;  3AGF A;  4NEE D;  3HLG A;  4YOF A;  1PI4 A;  3BLM A;  2X01 A;  3CPT B;  1MXO A;  2ZBB A;  3ZG7 B;  1S1Z A;  3IHB A;  2ZC7 A;  3GRJ A;  3W2Z A;  2XF3 A;  1CJF A;  3FWL A;  3SH8 A;  4LV3 A;  2H0Y A;  3S22 A;  2HP5 A;  1HLU P;  4PKY A;  1K55 C;  4N1X A;  1ZKJ A;  1KVM A;  4ESP A;  3G6O A;  2OV5 A;  3FPW A;  4HI4 A;  3U2A A;  2ZM2 A;  4PAU A;  3UNW A;  3GVB A;  3NJA A;  2UV0 E;  4OQI A;  1Y28 A;  3LI9 A;  4EQ1 A;  2HPB A;  2FZ0 A;  1FCN A;  3ZFZ A;  5EPH A;  4HIA A;  3OLO A;  3NUL A;  4P6B A;  1YMX A;  3FZC A;  3LIE A;  4ARZ A;  4Y7P A;  2Z2L B;  2JKF A;  4RX3 A;  3IF6 B;  1YLT A;  3MQQ A;  1YQS A;  4FTX A;  4JKT A;  4EW7 A;  3OOV A;  4DRT A;  1KGG A;  3P01 A;  3SS4 A;  2WKQ A;  2G2W A;  1E3U A;  4EES A;  2OLV A;  3HLB A;  3O5Y A;  3Q82 A;  2EXA A;  5GHX A;  4Q0I A;  1VQQ A;  4LCM A;  1YLJ A;  5DF8 A;  2ZM0 A;  3W4O A;  1WYC A;  1DJA A;  3MJQ A;  3B33 A;  3MKE A;  3MS6 A;  2WGV A;  2XFS A;  2XSS A;  2WKE A;  3ZG9 B;  3CPT A;  5CX7 A;  1OT6 A;  5C5K A;  4KG2 A;  1KVL A;  2KLI A;  4FUW A;  2DCF A;  1W63 Q;  3CLO A;  2P04 A;  4I38 A;  4NXE A;  5FEG A;  1ALQ A;  1NY0 A;  1Q2Q A;  3N8R A;  4MBF A;  1FIL A;  4EEP A;  3KO6 A;  2B02 A;  5TBM A;  2WK0 A;  1LL8 A;  4GZB A;  5KZH A;  3HL9 A;  3VOL A;  2XR0 A;  2DNS A;  3UE0 A;  4KZ3 A;  5IT5 A;  3VE4 A;  3DTE A;  4DE0 A;  2VGK A;  2RCX A;  4GS9 B;  4JF6 A;  2HJ9 C;  3IF6 A;  4MCW A;  5A8B A;  5HD3 A;  4C75 A;  2EFU A;  2V1B A;  1HZO A;  3S7N A;  3AGD A;  2JN7 A;  3N4I A;  1STZ A;  1KE0 A;  4KZ4 A;  5FI2 A;  5A90 A;  2VK3 A;  5FA7 A;  4S2N C;  5FQJ A;  1NXY A;  3IF5 A;  1MC0 A;  3ZG8 B;  5EOO A;  1OPX A;  1TS8 A;  3R4K A;  2J3T C;  3VOY A;  2VGL S;  3HJI A;  3PAG A;  3Q1F A;  2EX6 A;  4S2M A;  2ZM8 A;  5F82 A;  4FH4 A;  1K25 A;  1EWZ A;  1GA0 A;  2GZA A;  2K2N A;  3IXD A;  2FH5 A;  3OZH A;  4BBV A;  5FAQ A;  2JCH A;  4E6X A;  3Q81 A;  1FR6 A;  3M2K A;  1OTI A;  5E43 A;  5HW3 A;  4DE1 A;  2Y2I A;  2ZLY A;  1EI5 A;  1IYO A;  4E04 A;  1VET A;  1E25 A;  5TGF A;  1IEM A;  3UB7 A;  4JLF A;  3P7N A;  1PWD A;  3T4O A;  4MMN A;  3H9W A;  2HV1 A;  3A3I A;  4IHQ A;  2JKT M;  4KZB A;  1ESU A;  4OH0 A;  3T4L A;  3VP4 A;  4NG2 A;  5FDH A;  4OOY A;  4IBX A;  1MWU A;  5DF9 A;  1RP5 A;  3CUE C;  2J8Y A;  4S2L A;  4MNR A;  1PIO A;  3FV7 A;  5E2H A;  4Y13 A;  5CTM A;  3LIF A;  1JWP A;  3QP2 A;  4HH2 A;  1CF0 A;  2XFT A;  3ZNY A;  2LB5 A;  5GLB A;  4I3J A;  2J80 A;  1F9I A;  1MKM A;  5EFW A;  4WZ4 A;  1K57 C;  4ZJ1 A;  5KSC A;  1JTD A;  3VP0 A;  5HPF A;  1GSV A;  1ERM A;  2V9A A;  4Q0J A;  1XJ3 A;  5AQB A;  2V1A A;  3T1R A;  1Y54 A;  4JGR A;  4GNU A;  1VB6 A;  3AGE A;  4NK3 A;  1S4S A;  4DJ2 A;  3NEC A;  1FSW A;  3GEC A;  4MN7 A;  1S1Y A;  3RFB A;  4IBR A;  2P9V A;  3F1O A;  5DTS A;  2H0T A;  1MWS A;  5G4Y A;  5U47 A;  4OPR A;  4ETZ A;  3LY4 A;  4N9L A;  1PFL A;  5EE8 A;  1HTZ A;  1YLW A;  2R9W A;  1IYS A;  5CER A;  1BZA A;  3T12 B;  1ONH A;  5EM0 A;  3B3X A;  5G18 A;  1DJB A;  1FR1 A;  2Q9N A;  3HLD A;  1OTA A;  3UO9 A;  1BYW A;  1TD5 A;  4H8R A;  4WL9 A;  1JNU A;  4GOG A;  4LCL A;  2Y2O A;  5E2F A;  3NDG A;  5FQK A;  1BSG A;  3G35 A;  4L9E A;  2HDS A;  1JTG A;  1V9Z A;  2GJ3 A;  3ZG0 A;  2PT7 A;  2VGJ A;  4IJG A;  2LB9 A;  4G3W A;  4QPR A;  4Y0U A;  1AXB A;  3V67 A;  1OTD A;  4PMA A;  3WS1 A;  2Y4A A;  3N7W A;  2QKP A;  4OOM A;  2X71 A;  3SH9 A;  1M6K A;  2WGW A;  3LUQ A;  4CJN A;  5F83 A;  1JWV A;  4MEZ A;  4WM9 A;  4PM8 A;  3VSK A;  3S1Y A;  3MSH A;  2PD8 A;  3W8K A;  5DKL A;  2WKI A;  3KX0 X;  2PYP A;  1TF1 A;  4B4Z A;  2XD5 A;  4JXW A;  3NOT C;  4HES A;  2VZW A;  1K55 A;  2M7U A;  3VSL A;  3UE3 A;  2WYX A;  4LPZ A;  2QWS A;  4HP4 A;  4GDB A;  4DXB A;  3G30 A;  3I7J A;  5HWV A;  4R3J A;  2WAF A;  4X69 A;  3CHW P;  4OP5 A;  4HBT A;  4IVK A;  5FAT A;  3Q7V B;  2NUT C;  3EGD C;  2ZQ8 A;  5FL3 A;  2ZOI A;  3C4P A;  4OQ0 A;  3HUO A;  5FDS A;  1PRQ A;  3BY8 A;  4X56 A;  3C30 A;  3GQZ A;  1XKZ A;  2ZMF A;  5HFO A;  5TR7 A;  5K5B A;  2HGV A;  5E2G A;  3S7P A;  3IX3 A;  1W63 M;  3PBO A;  2IA2 A;  2ZMA A;  1G28 A;  1E4D A;  4HQA A;  4OON A;  3IX8 A;  3M2J A;  1JWZ A;  1G6A A;  1MZU A;  1H8Z A;  2VGL M;  3C7V A;  5AQ7 A;  5I94 A;  2PD7 A;  3O88 A;  3VP3 A;  2ZL1 A;  1SCW A;  4RA7 A;  3QP4 A;  4CPK A;  4L9G A;  4CLC A;  4ZBE A;  3E4O A;  4Q8I A;  4ZJ3 A;  3C38 A;  1N9L A;  5AQ9 A;  4M3K A;  4O7D A;  4KZA A;  4YIN A;  4S2O A;  3L9K A;  2Y2M A;  3FKW A;  5L8M A;  3UME A;  4QY5 A;  4E3I A;  2H28 A;  4GN2 A;  4OPQ A;  4HP9 A;  4KZ6 A;  1YSP A;  2W1R A;  2P74 A;  2QJ7 A;  4WZ5 C;  1T1B A;  5DFX A;  4MBH A;  4QWO A;  1EW0 A;  1FIK A;  4JGQ A;  3EOI A;  3G34 A;  3A3J A;  3T4J A;  1LSX A;  3LEQ A;  3TOI A;  4DMZ A;  1T1A A;  2Y2H A;  4DN0 A;  2OWH A;  3IT9 A;  3BM6 A;  2ZQ7 A;  4FOF A;  4FCF A;  2Z6D A;  3F1P B;  1L0F A;  3OPR A;  1GHP A;  3V50 A;  2OWJ A;  3R7W B;  4EER A;  3RTY A;  2CC1 A;  5DJT A;  2E8I A;  3OCL A;  1KDW A;  3LR5 A;  4JPM A;  3T1Q B;  2QYB A;  1D06 A;  3IH8 A;  4O8G A;  1PZP A;  3NOP C;  4HNB A;  2V8C A;  4OPY A;  1XJ2 A;  4FH2 A;  4UQI S;  2QPN A;  4BJP A;  1F5M A;  1Y4O A;  4EBP A;  4B88 A;  4ZAM A;  4WF0 A;  3U4L P;  4WBG A;  4E3J A;  4CLC E;  4EU0 A;  4OPZ A;  4GKU A;  4H6J B;  1OTB A;  2A24 B;  3S7Q A;  2B18 A;  2PDR A;  3HLC A;  3N6I A;  5KIZ A;  2Y79 A;  5HAP A;  1K0K A;  3VOZ A;  4WMC A;  1YM1 A;  2WZZ A;  1TDG A;  2I9V A;  2WZX A;  2PBY A;  2ZC5 B;  2EFX A;  4X68 A;  1ZG6 A;  5DFY A;  4E3L A;  3N8S A;  2JKR I;  4EEU A;  1ESI A;  1MY8 A;  3WRT A;  4N92 A;  3KSI A;  2BG1 A;  4O01 A;  4RQ9 A;  1DP8 A;  2XD1 A;  2OLU A;  1W8Q A;  5HX9 A;  3E4P A;  5FAP A;  1ZC2 A;  3ICY A;  3ZDJ A;  4CQH A;  1LSW A;  2GNX A;  3QNC A;  1MWT A;  4CLC D;  3CUE A;  2VLG A;  2A49 A;  5J8X A;  3F1P A;  2O9A A;  1PWG A;  2VV8 A;  5HAR A;  3R7W A;  1T18 A;  1VEU B;  1CK3 A;  5HD5 A;  3DBA A;  2MJ6 A;  3HCY A;  1GCE A;  2W3H A;  3V3R A;  4EUZ A;  4X1L A;  3M6B A;  3UB8 A;  4OLD A;  4R3B A;  5DJU A;  3GSG A;  4F94 A;  2W3G A;  3D72 A;  5AJG A;  4BD1 A;  3A0S A;  3PHY A;  5F69 A;  4K91 A;  2ZMV A;  1P97 A;  4XUX A;  3QP8 A;  4BMW A;  5A92 A;  4QD4 A;  4YFM A;  3MQ0 A;  5EVI C;  4FD8 A;  3ITA A;  1BTL A;  3MZE A;  1P9R A;  1FQG A;  3KSG A;  3ZGA B;  4MN5 A;  4LV0 A;  4GD8 A;  1ES2 A;  1CEF A;  1YLP A;  1OT9 A;  2VX8 A;  3PBQ A;  2A3U A;  5M18 A;  3PTE A;  2Y2L A;  3ZVT A;  5F1F A;  4E3M A;  1OTE A;  5EOE A;  4P0M A;  1I5Q A;  2P7J A;  2INW A;  4P6Z S;  2J3T D;  1IOU A;  2V2F F;  5EVL A;  4KUO A;  1PI5 A;  3M6H A;  4QHC A;  3ZG5 A;  3CWF A;  5J3W A;  4AFI A;  1S6R A;  1S67 L;  3TW8 A;  1TEM A;  4FSF A;  1E3U D;  3EEA A;  1TS0 A;  3BQA A;  1G6O A;  3UB9 A;  3ULF A;  4C3Q A;  1YMS A;  3RXW A;  5CGW A;  3KYQ A;  2ZC4 B;  1W7F A;  2ZC6 B;  4UAA A;  1VHM A;  2W3D A;  3DAV A;  5CGX A;  1YAX A;  3T4T A;  4GS9 A;  1RGZ A;  1K56 A;  2V20 A;  3G2Z A;  3ZVW A;  4NET A;  4JGO A;  2PYR A;  4E3K A;  3IX4 A;  4EET B;  3GMW A;  4BWI A;  3NC8 A;  3W4P A;  1NJ4 A;  1A0K A;  1V9Y A;  3G4P A;  4OQH A;  1JVJ A;  3A0R A;  3DW0 A;  4QU3 A;  2W3E A;  1LSV A;  3S7O A;  4GHI B;  4ZDX A;  3CI6 A;  1LHY A;  2PHY A;  2IWB A;  1W5D A;  1N4O A;  4GJ4 A;  5F68 A;  1G68 A;  1YT4 A;  3NCK A;  4ME4 A;  3C7U A;  3IS2 B;  4Z9Q A;  5F6A A;  5HWT A;  2VA0 A;  3C4O A;  2ACG A;  1MBL A;  3GV9 A;  4Z1W A;  5GL9 A;  2ZQD A;  2C5W B;  4IVI A;  3DTK A;  1Z6F A;  2BAS A;  3EGX C;  1YLY A;  3HUN A;  3TE8 A;  2W1T B;  1K4F A;  1NWZ A;  5HDD A;  4RYE A;  4JXG A;  2OOL A;  3JVV A;  1N9N A;  3Q07 A;  1AWI A;  3D9Y A;  1BLH A;  5DKK A;  4UA9 A;  3DTI A;  1D1J A;  1P0Z A;  4UQI M;  4HY8 A;  3BFC A;  1H5X A;  4S2I A;  1ZHH B;  1DP9 A;  4EWF A;  3MQO A;  4Y0O A;  3ISG A;  1N9O A;  1YKD A;  1BLS A;  4P87 A;  1SHV A;  2PBD P;  5IHV A;  1G5U A;  3IXH A;  1UGU A;  1TDL A;  4X25 A;  3UMD A;  2YKF A;  2XH9 A;  2Y91 A;  3CG5 A;  2Z2M B;  2ZOH A;  3G32 A;  4B9O A;  4DDS A;  3EWK A;  2WAD A;  2HZ5 A;  2JKT I;  3HVF A;  3A0V A;  2JE5 A;  2Y2G A;  1GA9 A;  1M40 A;  4E6W A;  4LV1 A;  3BQ8 A;  5FQI A;  2HDQ A;  1NLY A;  3DWZ A;  4WZ5 A;  5HWW A;  4X1M A;  3LFV A;  3IHA A;  3HJK A;  3A3D A;  4KEN B;  2E8J A;  4IUH A;  4DE2 A;  1KOU A;  5F1G A;  4HJ3 A;  3JVU A;  2JHE A;  4LEN A;  5FQQ A;  4M4X A;  3WS2 A;  4QJG A;  4RX2 A;  2Q0O A;  4PM6 A;  3KYZ A;  4KQR A;  3QP5 A;  1NZO A;  3E4Q A;  3PBT A;  5EV0 A;  1TS7 A;  4I5S A;  1MPL A;  2JBF A;  5EM1 A;  2C6W B;  4BL2 A;  4XXR A;  2EA9 A;  3HLW A;  4KZ5 A;  1T1C A;  5CTN A;  3BWL A;  2PR6 A;  4XT2 B;  4K0W A;  4WEL A;  1CI8 A;  5F5Y A;  3BW6 A;  5DF7 A;  3UB6 A;  4KG6 A;  4BD0 A;  2XRO A;  1FCO A;  3E2K A;  2OSU A;  1SZV A;  3KSF A;  2XA7 S;  4PPR A;  5EVI B;  3D4F A;  2OAP 1;  2XRN A;  1GHI A;  4LFU A;  3OC2 A;  3UPN A;  3A3F A;  5CXW A;  4ETX A;  1SKO B;  3B47 A;  5CED A;  5M1A A;  1LL9 A;  2W3F A;  4Y3I A;  2WAE A;  4LV2 A;  3RH8 B;  3MXR A;  1NZU A;  4R0Q A;  1YLZ A;  4B93 A;  3LCE A;  3SW1 A;  1DP6 A;  5GLC A;  3HLF A;  1J3W A;  5KSH A;  4Q0H A;  4LLO B;  4S2J A;  3NY4 A;  3LGO A;  2G2U A;  3MZD A;  2H10 A;  3WWX A;  4BL3 A;  1XJ6 A;  2X02 A;  1DRM A;  2L4R A;  5CRF A;  2PRF A;  4PM7 A;  1Q2P A;  4HHD A;  4DJ3 A;  4ARZ B;  1PW8 A;  4GB7 A;  5FI7 A;  3IH9 A;  4KUK A;  2HP6 A;  4G3K A;  2R9X A;  3NI9 A;  4XT2 A;  5GLD A;  4U0X A;  4Y5F A;  3CZD A;  3Q7V A;  3TSG A;  5A93 A;  3HRE A;  2Y59 A;  1BUL A;  4BEN A;  2XEP A;  3A3E A;  4OVD A;  2DMW A;  1BUE A;  2VEA A;  4UHU A;  3T1X A;  5JYO A;  1H8M A;  4S2P A;  4JBF A;  5EVI A;  2WKH A;  4OLG A;  2R78 A;  2G7U A;  1K6R A;  1PZO A;  1XGJ A;  4EQI A;  3K2N A;  1IYP A;  3OCN A;  4JGP A;  3VE3 A;  1SKO A;  4GW9 A;  3MZF A;  1SDN A;  4OKP A;  3HLE A;  4E3O A;  5HDS A;  1K6S A;  4S2N A;  3C8C A;  2HDR A;  5HPI A;  4P85 A; 
#chains in the Genus database with same CATH homology
 1OT9 A;  4GLQ A;  2VKS A;  2VX8 A;  1S4S A;  4DJ2 A;  3PBQ A;  3E98 A;  3GEC A;  4MN7 A;  3RFB A;  1S1Y A;  4I39 A;  2Z6C A;  3T4S A;  1OJG A;  3F1O A;  5HDC A;  1S66 L;  5G4Y A;  1OTE A;  4R38 A;  5TBM B;  2P7J A;  3K3C A;  4ETZ A;  2INW A;  4P6Z S;  3PXP A;  5MC7 A;  2J3T D;  4KQD A;  1IOU A;  4KUO A;  3TRC A;  4YWZ A;  2KX6 A;  3PYP A;  1NRJ A;  3FG8 A;  4I3A A;  3MR0 A;  3CWF A;  2VV7 A;  5G4Z A;  5J3W A;  3B42 A;  2NUP C;  1OJ5 A;  4L0L A;  4AFI A;  1TS6 A;  1S67 L;  1OTA A;  3TW8 A;  4P6Z M;  5J4E A;  1BYW A;  3LID A;  1TD5 A;  4FSF A;  2WKR A;  4WL9 A;  5IU1 A;  4BBT A;  3EEA A;  1TS0 A;  1JNU A;  5I5L A;  4WUJ A;  3BQA A;  5HZH A;  5TJJ A;  1G6O A;  3UB9 A;  3ULF A;  1GSW A;  4L9E A;  1D7E A;  4KQO A;  3KYQ A;  1V9Z A;  2GJ3 A;  2PT7 A;  4IJG A;  1VHM A;  2W3D A;  2LB9 A;  3LYX A;  2JKR M;  1GSX A;  1YAX A;  3OBF A;  4G3W A;  4QPR A;  3T4T A;  4GS9 A;  3T50 A;  3GDI A;  3V67 A;  2HF6 A;  1UWP X;  1OTD A;  2OAQ 1;  4JGO A;  4Y2F A;  5HL6 A;  3FPV A;  2QKP A;  1S4R A;  4OOM A;  2PYR A;  3T4Q A;  4F3L A;  3UE6 A;  3MF0 A;  4EET B;  2EWV A;  3KSH A;  4BWI A;  4YNR A;  3FC7 A;  3LUQ A;  1V9Y A;  3LIC A;  1T19 A;  4CLC C;  3A0R A;  2W3E A;  1LSV A;  2M1C A;  4O0P A;  3S7O A;  2PD8 A;  3CIT A;  4G3V A;  4GHI B;  3CI6 A;  5DKL A;  3KX0 X;  2PHY A;  2PR5 A;  1TF1 A;  2PYP A;  3LR3 A;  3LR0 A;  4NXB A;  4GJ4 A;  5F68 A;  3NOT C;  2CMN A;  4NEE D;  4YOF A;  5AVF A;  4ME4 A;  2VZW A;  4MN6 A;  4I3I A;  2M7U A;  2ZBB A;  4H6J A;  3IS2 B;  2A24 A;  1S1Z A;  3UE3 A;  4LPZ A;  4LRZ E;  2QWS A;  3W2Z A;  4WN5 A;  4HP4 A;  1ZTU A;  3ZYT A;  5F6A A;  3VV4 A;  4PKY A;  2EWW A;  2WKP A;  5HWV A;  5HWT A;  2VA0 A;  3G6O A;  3FPW A;  4HI4 A;  3U2A A;  4Z1W A;  1XJ4 A;  2NUT C;  4PAU A;  3EGD C;  3LR4 A;  3K3D A;  5FL3 A;  2ZOI A;  3MFX A;  4WLA A;  3NJA A;  2BAS A;  3EGX C;  4LRX C;  1Y28 A;  1UWN X;  3LI9 A;  4EQ1 A;  3CAX A;  2FZ0 A;  3TE8 A;  3BY8 A;  2GX5 A;  2W1T B;  4HIA A;  3OLO A;  1NWZ A;  3C30 A;  5J7E A;  4PHT A;  5HDD A;  3LIE A;  4ARZ A;  2ZMF A;  2OOL A;  4EXO A;  3JVV A;  1N9N A;  3MQQ A;  5K5B A;  2HGV A;  4WEJ A;  5DKK A;  3S7P A;  3OOV A;  4EW7 A;  2O9C A;  1W63 M;  3PBO A;  2XA7 M;  3P01 A;  2IA2 A;  2WKQ A;  4HOI A;  1P0Z A;  4UQI M;  3BJN A;  4HY8 A;  4EES A;  3E0Y A;  1G28 A;  4HQA A;  1ZHH B;  1DP9 A;  2V0U A;  4NXF A;  3O5Y A;  3MQO A;  1N9O A;  1YKD A;  1MZU A;  4Q0I A;  4II7 A;  2VGL M;  1UGU A;  1X0O A;  3F1O B;  3UMD A;  2YKF A;  3EQV A;  3H82 B;  3C2W A;  3MJQ A;  3B33 A;  2PD7 A;  2XSS A;  4K08 A;  2ZOH A;  4B9O A;  3EWK A;  2JKT I;  2D01 A;  3PR6 A;  4L9G A;  4CLC A;  3E4O A;  3A0V A;  1XFQ A;  2P08 A;  3C38 A;  2K7S A;  1N9L A;  3BQ8 A;  5CX7 A;  2O9B A;  4UEY A;  1OT6 A;  5C5K A;  1NLY A;  5HWW A;  2KLI A;  3H7W B;  5L8M A;  4HH3 A;  1W63 Q;  3CLO A;  3LFV A;  3UME A;  2P04 A;  2M7V A;  4I38 A;  2H28 A;  4NXE A;  3HJK A;  4HP9 A;  4R6L A;  3D3O A;  1YSP A;  4IUH A;  2W1R A;  2QJ7 A;  1KOU A;  3NHQ A;  4HJ3 A;  4EEP A;  1T1B A;  3JVU A;  2L0W A;  3KO6 A;  2B02 A;  2JHE A;  5TBM A;  4ZRR A;  5DFX A;  4M4X A;  1LL8 A;  1H3Q A;  3KYZ A;  1EW0 A;  3VOL A;  3PBR A;  3E4Q A;  3MXQ A;  3EOI A;  3PBT A;  4JGQ A;  5IT5 A;  3T4J A;  3VE4 A;  1TS7 A;  4I5S A;  1LSX A;  4GS9 B;  4DMZ A;  1T1A A;  2HJ9 C;  4DN0 A;  2OWH A;  2EA9 A;  3BY9 A;  4FOF A;  1T1C A;  2VJW A;  1LT0 A;  3BWL A;  2Z6D A;  4EUV A;  4MCW A;  2PR6 A;  3F1P B;  4XT2 B;  2VV6 A;  5A8B A;  5HD3 A;  4WEL A;  2OWJ A;  3R7W B;  2V1B A;  4EER A;  4NKP A;  4R70 A;  3RTY A;  5DJT A;  5F5Y A;  3OCL A;  4WEK A;  3S7N A;  1WA9 A;  2QJ5 A;  3BW6 A;  2JN7 A;  4BBU A;  3UB6 A;  3LR5 A;  3EQU A;  2XRO A;  2A2L A;  2Y8H A;  4R3A A;  1P9W A;  2QYB A;  1STZ A;  1D06 A;  2V0W A;  2O0Y A;  4O8G A;  3KSF A;  3NOP C;  4HNB A;  2XA7 S;  1XJ2 A;  4UQI S;  4BJP A;  1F5M A;  3H82 A;  4OOL A;  3IBJ A;  2OAP 1;  2XRN A;  4WF0 A;  1MC0 A;  3OC2 A;  1OPX A;  4CLC E;  4EU0 A;  4ETX A;  3B47 A;  3F1N B;  1F98 A;  1TS8 A;  3R4K A;  2J3T C;  2VGL S;  3HJI A;  4H6J B;  2W3F A;  2A24 B;  1OTB A;  3ZQ5 A;  4Y3I A;  3RH8 B;  5HSQ A;  3LIB A;  3S7Q A;  2B18 A;  3PBN A;  4B93 A;  2PDR A;  2GZA A;  1IFQ A;  3H7W A;  2K2N A;  3SW1 A;  4LRY C;  1DP6 A;  5KIZ A;  2FH5 A;  2L1M A;  2Y79 A;  4BBV A;  2KOI A;  2J3W A;  5KSH A;  4Q0H A;  4MDZ A;  2I9V A;  3EEH A;  4GHI A;  4LLO B;  1OTI A;  5DFY A;  4GCZ A;  2JKR I;  2W27 A;  4EEU A;  1XJ6 A;  4NXG A;  3KSI A;  4E04 A;  4O01 A;  3UB7 A;  4RQ9 A;  1DRM A;  2L4R A;  1DP8 A;  3IS2 A;  4HJ4 A;  3P7N A;  3E4P A;  4HHD A;  4DJ3 A;  3ICY A;  3LI8 A;  3T4O A;  4ARZ B;  4MMN A;  3H9W A;  2HV1 A;  4CQH A;  3PBS A;  1NLZ A;  1YSQ A;  1LSW A;  2GNX A;  4IHQ A;  2JKT M;  4KUK A;  3IBR A;  4CLC D;  3CUE A;  3T4L A;  2VLG A;  4G3K A;  3F1P A;  4XT2 A;  5LBR A;  2O9A A;  2VV8 A;  2D02 A;  3NOU C;  4Y5F A;  3R7W A;  1T18 A;  5AVE A;  3T4K A;  5HD5 A;  5DF9 A;  2O99 A;  3DBA A;  2MJ6 A;  3CUE C;  2W0N A;  3HCY A;  3TJZ C;  2K31 A;  4L9F A;  5IS1 A;  2DMW A;  2YKH A;  2HJE A;  2VEA A;  2W3H A;  1XFN A;  2W1T A;  3LIF A;  3UB8 A;  1H8M A;  3MMH A;  4HH2 A;  5DJU A;  2W3G A;  3D72 A;  5AJG A;  2LB5 A;  3A0S A;  3PHY A;  5F69 A;  2R78 A;  2ZMV A;  2G7U A;  4I3J A;  2J80 A;  2KDK A;  1F9I A;  1P97 A;  1MKM A;  3K2N A;  5EFW A;  3OCN A;  4JGP A;  1ODV A;  2QHK A;  3VE3 A;  4HJ6 A;  4CLC B;  4PKY G;  3F1N A;  4BMW A;  5HPF A;  4GW9 A;  1GSV A;  2V9A A;  4Q0J A;  3MQ0 A;  4F3L B;  1XJ3 A;  4IUK A;  2V1A A;  1P9R A;  3KSG A;  3LIA A;  4MN5 A;  4JGR A;  5HDS A;  3C8C A;  5HPI A;  1VB6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...