4ARZB

The crystal structure of gtr1p-gtr2p complexed with gtp-gdp
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
321
structure length
304
Chain Sequence
ATDSKAMVLLMGVRRCGKSSICKVVFHNMQPLDTLYLESTSNPSLEHFSTLIDLAVMELPGQLNYFEPSYDSERLFKSVGALVYVIDSQDEYINAITNLAMIIEYAYKVNPSINIEVLIHKVDGLSEDFKVDAQRDIMQRTGEELLELGLDGVQVSFYLTSIFDHSIYEAFSRIVQKLIPELSFLENMLDNLIQHSKIEKAFLFDVNSKIYVSTDSNPVDIQMYEVCSEFIDVTIDLFDLYKAPRNELQNVSQLANGVIIYLRQMIRGLALVAIIRPNGTDMESCLTVADYNIDIFKKGLEDIW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Gtr1Pgtp-Gtr2Pgdp Complex Reveals Large Structural Rearrangements Triggered by GTP-to-Gdp Conversion
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase
molecule keywords GTP-BINDING PROTEIN GTR1
total genus 98
structure length 304
sequence length 321
ec nomenclature
pdb deposition date 2012-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF04670 Gtr1_RagA Gtr1/RagA G protein conserved region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.190 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4arzB02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4arzB01
3K0SA 2F1JA 2QAJA 3R9IA 2NO6A 1P4SA 2P67A 3NEJA 4OQMA 2AHOA 3CPHA 5DI3B 2X2EA 5JS8A 1OIXA 1F2TB 4JLKA 4Q48A 1G8PA 2HDNB 4CEHA 1VCNA 2FGJA 4TLBA 3QKRB 1KI7A 3SBDA 2WMOB 1DAKA 1KZGB 2PT7A 1P7CA 3BFXA 2BV3A 1U94A 1CP2A 2PJZA 1FP6A 2OBMA 4MUAA 2BMEA 1DAGA 2ZS8A 3A1TA 4RZ2A 4N3NA 3MRSA 3ZDQA 2YWHA 2VH5R 5DSZA 2VHTA 2FU5C 4HSEA 1US8B 3IBYA 4Y0VA 5EP4A 3LXRA 3AKDA 1L8QA 1U8ZA 5JMTA 1FPMA 1OXTA 5BW8A 2QMEA 5CJPA 5G3YA 5CLQA 3AKYA 4CDGA 2QAGB 4X8LA 1JR3D 2R8RA 2WHXA 4IDHA 2OFXA 2XEXA 1XTSA 4HLUA 2AFIE 1NLZA 1XTIA 2ZI3A 5KDLA 1DAIA 1FP7A 4A0GA 1JAHA 1US8A 1JBKA 3OF5A 2YHSA 3WHLA 3QKTA 2ZIAA 2XNDD 2WWXA 1XTQA 1VIYA 1OHHA 3VAAA 2AL7A 5SZHB 1Q1EA 2A9KA 2WJJA 3K0AB 3OAAA 4IDOA 4BUJA 1QRAA 3Q85A 5HZHA 5SZJA 1LF5A 1A2KC 4BRUA 5KTYA 3P27A 4KVAA 4NYJQ 4TLDA 5FI0B 3EASA 1YR6A 1WBBA 3L2OB 1KI8A 4M1YA 1F6BA 2ZS7A 3CX6A 1G8FA 2VP4A 1EESA 3VR4A 2CNWA 1DPFA 2W00A 1BMFD 5H1YA 4LJ9A 5FPSA 5J5CA 3SYNA 4NDZA 4TYNA 1NRJB 4LPKA 5AR1A 3X1XA 1RRFA 4FIDA 4EDHA 3LY5A 1GUAA 1X8KA 1W2GA 5E4FA 4DSOA 1GTVA 4M1WA 1PJRA 1NY5A 2OBNA 2OSBA 2QN6A 4HUTA 1HA3A 3EWAA 4HLCA 3ZQJA 3B78A 1FNMA 2AK3A 2I3BA 2O0JA 1XTJA 4I1VA 1UF9A 1DAHA 3EIHA 4QBFA 4BLTA 3RS0A 1OYYA 2J9RA 2JATA 5ELXA 4FW9A 4EKDA 4TMZA 4EPTA 1ZD8A 1ZIPA 2IYZA 4LYFA 1YKSA 1P60A 4OQLA 1NN1A 4M0LA 1VYVA 1ZM9A 4RSGA 1DE0A 1Q1BA 4AWXA 3PUYA 4JVMA 4JLPA 3GJ3A 2ZSBA 1W5SA 3SFVA 3AVYA 1J2JA 4EPVA 1XP8A 2G6BA 4Q1EA 4OQNA 1UEJA 2OZEA 4GL2A 2P5SA 3ZVLA 1A1VA 1DAMA 2ZRDA 1XTRA 2CJWB 4ON9A 1E2DA 4OHVA 3VQTA 2BC9A 3K53A 4IOLA 1N5LA 5FL7A 4YDHB 4XWKA 3GJ7A 3P4XA 3FPAA 3U44B 3AQ4A 5F9HA 4KXFB 4LJ7A 5K8TA 3GMTA 1YZGA 1OFUX 4TYPA 2AXNA 3QF4A 2QMUA 4DEXA 1U90A 1LW7A 1ZNXA 3CRRA 1XEWX 2HT6A 2IS4A 2J41A 2ZXUA 3ZVRA 3KFXA 1VG8A 3SHFA 2HF9A 3BH0A 3THYB 1J7KA 2NPFA 3WY9A 1XWIA 2W6JD 3BB1A 1P62B 1HUQA 4IXNA 1QZXA 5C4GB 4BFSA 4D0GA 1YZLA 4L16A 1Z6YA 5J4VA 3OE7D 4G5QA 3M4YA 4DBLC 3AVXA 1ETUA 2CHGA 3JVUA 3NHBA 1KO7A 4GOKA 4U02A 4V0LA 4V0ME 1UBGA 4BLOA 3Q8XB 1JEEA 3QKSA 4Z1MA 5KNCA 4F92B 1KI1A 1R5OA 2BM0A 2GEDA 3N2IA 2CMKA 2NO9A 1E99A 3PFIA 4B74A 1GNRA 2WWFA 1D8TA 3CWQA 2DR3A 2B21A 3QBTA 3ZVNA 4HAXA 1DO0A 2VSFA 1T9HA 2JIZD 1FMLA 4L9SA 3OIWA 1IHUA 3I5XA 5CB6A 5C1BA 1XFAA 3CR8A 2CXXA 3RRMA 4A4DA 1JXMA 4NYJR 1KYIA 1ZNWA 3GJ6A 1GNQA 5JRJA 1AZTA 1WRBA 2MMCA 1IXZA 1XDBA 3W5IA 4MRSA 4QC2A 4OHYA 5F2EA 2P6RA 1PZNA 2NO7A 3RRZA 3EW9A 1E96A 2ZETA 3X1ZA 1VCMA 2Z83A 1AZSC 4YLGA 5GJBA 2ZQ5A 3CH4B 4Q9JA 4AKGA 4TN1A 4Q4JA 1JPNA 3ZJYA 5CYPA 1VYUA 4KFSA 1P9WA 4RY2A 5DHAA 1XZQA 2A5GA 4KLNA 3GQBA 3KJEA 5IF9A 2ZSEA 1NF3A 4TQ9A 3UG6A 1M6NA 2HYDA 4PZLA 4ACBA 1E2QA 2FSGA 4IVPA 3A4LA 4LDJA 2IEZA 2JAQA 2PX0A 3UIEA 2OM2A 1LF0A 1TX4B 2OEPA 2ZI4A 2QAGC 1HV8A 2WJYA 3QPUA 5L3RA 1SHKA 4UJ3A 2CCJA 4RD6A 4KYUA 4L8GA 1XCMA 1OFIA 2RGNA 3TUIC 5IT5A 4AY2A 3PUXA 5KSOA 2Q9CA 3NHAA 2ZJYA 5KSZA 1N6IA 3HR8A 1VECA 4WA7A 3A36A 1GAJA 3QJYA 4TL6A 2ZE8A 1EFRA 1AN0A 4YQFA 3Q7QA 3ICQB 3RRNA 3AP2A 3AF0A 1SVKA 3NBFA 5HE9A 1SXJA 3GJXC 2QEQA 4P0TA 2F3TA 1KK0A 4CT4B 3IHWA 3ZVMA 3B1YA 2XB4A 3J81k 3P32A 2ORVA 4MRRA 5F9FA 1W49A 3TSZA 1E2KA 1XEFA 2GJKA 3C5CA 2H18A 3MWYW 3I62A 2IYQA 3AP3A 2QRNA 3WNDA 4ZV4A 3L0SA 3A8TA 4IVQA 3A1SA 4XVUA 4HLUC 3AGPA 2YWFA 1CF4A 1IN4A 4BPBA 1VCOA 1S1CA 3TQFA 1X1SA 2YKGA 1BOFA 4NCNA 2FFHA 4EFMA 5IRCD 2PX3A 3LVRE 3LV8A 2IYVA 1I4DD 1Z07A 2WPDD 3AF3A 1SGWA 3DEFA 1CTQA 1OPXA 2RGXA 3GJ4A 3WHKA 1QVRA 4JVNA 5ANRB 4BFYA 2IF2A 1D2NA 2J0UB 2BIFA 3A4NA 4KFRA 5JFGA 4BLSA 4HYYA 4DDUA 2ZUCA 4U5XA 3QXHA 5DLQC 1Z8FA 4RD0A 4TLCA 3A1UA 4LBVA 3BGWA 1TQDA 3RSLA 1JECA 3D6TB 1Q3HA 3FMPB 4DLTA 3T35A 4R9UC 6Q21A 1OSNA 1I4LD 2DFTA 5FTJA 4Q02A 2CK3A 4DT1B 1DG1G 1N0UA 4FWIB 1IY1A 3QKUA 4PPFA 4S2EA 5TVKA 4OHWA 4KCGA 5JI3E 2ZRJA 1G6OA 2QPOA 2W83A 1XTKA 3BB3A 3GFTA 3QG1A 4HB2A 4W7SA 4US2R 3BBPA 3B9QA 4C0JA 4TMXA 1RYFA 1GRNA 2FPLA 3EIQA 4JT4A 5CYOA 1AA9A 2ZRPA 4NPHA 4FINA 4KITB 3AEZA 3FMFA 3R8FA 4BASA 1MOZA 2FPKA 1EFRD 3L43A 4PPGA 5TB5A 2JLSA 3GJ0A 3U4QB 3REFA 1WA5A 2H16A 4JSYA 1S96A 4W5WA 2GCPA 1XD2A 4NMMA 2WZQA 1TU3A 3KDSE 421PA 1XPRA 3LDAA 4GNKA 5DISB 1NY6A 1RE0A 3TNFA 1DO2A 2ERYA 4H1UA 3FVQA 3NH9A 2FGKA 5DI3A 3MGCA 3W9YA 4IW3B 1Q57A 2XTZA 3FWYA 3MJRA 1KO5A 2AWOA 4IKEA 2V4ZA 1PUJA 5HCIA 2VBCA 3THWA 3DHWC 2JA1A 3IO3A 1G8YA 5EP1A 2C95A 3SDZA 2NGRA 4LHYA 4QJ5A 3OESA 4URWR 2J0UA 2KBFA 4P31A 3X1DA 4W5JA 2IHBA 2J45A 1AGRA 2IYSA 3P20A 3WXMA 2HYIC 4B3CA 1N6NA 2RGDA 4DRZA 2O5VA 1HQYE 2RMKA 2Q6TA 5CM8B 4CIDA 3IPYA 2KWIA 4KI0A 2CVFA 2V9PA 4FCTA 4A92A 3ND9A 1KDPA 1HYQA 5FUWA 1VCIA 1II8B 3ZLJA 5FOTA 3SJBA 1G16A 1KSGA 1NVXQ 1G4AE 1NL3A 5HKKA 1I2MA 2GHIA 2IXFA 1MR3F 2ZJZA 4QM6A 5L3QB 4DKXA 5M04A 4LC1A 3BRWD 4AI6A 2QNRA 1J90A 1J70A 3W8NA 4ZCMA 3AKCA 2J7PD 4URXR 1E9EA 1SXJB 1GIAA 5JEDA 1KTVA 4MYCA 1YJ5A 2VTKA 1M1YE 4BFWA 4RKEA 1G41A 1W4BA 1EG7A 4TTRA 3WRYC 2BDTA 4R7ZA 3UK6A 2ODEA 1E9BA 4URYR 2RGCA 1UBEA 4ESHA 5FUVA 2EYQA 5AJXA 2ZE5A 1OV4A 2JLRA 2XZOA 2L0XA 3G82C 1LY1A 3I8XA 3IKJA 4NH0A 1OH6A 4F38A 3HU2A 4URVR 1BS1A 1DAFA 2IA5A 4CYMA 1M34E 2ZJBA 4DLSA 3TKLA 2IYLD 1A4RA 2A5DA 4LHVA 4US1R 2G9NA 4D25A 1G7TA 4FCVA 4KAXA 2P2LA 3V9PA 4C0SA 3U7FB 4OHZA 4RCZA 4DCTA 3EC1A 1IN6A 2FDCA 2V3CC 4Q1DA 2IWHA 4DSTA 2HJVA 4OK6A 1G1MA 1Z2AA 4E5UA 1E69A 4PQFA 4UXIA 4H9GA 5F98A 4P4SB 1KI4A 3TW4A 4R2HA 4CGZA 5TV2A 2CCGA 1G9XA 2BMFA 1ZINA 1ZUHA 4JL5A 4DVGA 2HT1A 1OFTA 5AWFC 3IGFA 2GCNA 3QQ5A 1EXMA 2ORIA 2MMGA 1TF7A 4EJSA 2IYXA 4WAUA 3SYLA 3CONA 3G0HA 4ZKDA 1KY2A 3DMDA 1KZ7B 3ZIAD 1E2MA 4RKFA 2ZR0A 3OIVA 1LTQA 4OQFA 1RC8A 3SEAA 3QXCA 5G41A 2B92A 4LY6A 4OYHA 1G7CA 4A6PA 4GZLA 2VLIA 1FTNA 3ND8A 3KJHA 1RZ3A 4A8JC 2QORA 1CJMA 5CDFA 2O8FA 1OLOA 3MD0A 1T5LA 1XMSA 2ERXA 4F4JA 5CJ2A 3L0IB 4WVFA 4AD8A 3FMIA 3DZ8A 2CVHA 2BEKA 3RDPA 2ANCA 2W58A 1P9NA 4PFSA 1ESNA 4Q4LA 3DVLA 1KMHA 4E09A 5C46F 3QF7A 3LFUA 5UKDA 1SKYB 1GDDA 5JLJA 2JASA 2JJ2D 3MWJA 4EQ6A 3UWKA 2OAQ1 1M2OB 4WXRA 2OBLA 4TQUS 4DB2A 1ELOA 3V00A 4GP7A 4B32A 1RRGA 3IBGA 2QM7A 2KBEA 3DPUA 1NIJA 1XD2B 2V55B 2ZITA 1R2QA 3NEYA 2H7VA 4LC0A 1ODFA 1EFHA 1Z29A 3DDCA 4UNSA 4B76A 1PV4A 2XXAA 1IY0A 5KDOA 1LB1B 3AH8A 2QZ4A 3KTAA 3NC0C 3ADCA 5KHOC 3VR3A 1D2EA 2D3WA 4V0NA 4ERNA 1DVRA 1KI6B 2HEIA 3KKQA 4YMSA 2PJRA 2IEYA 3MSXA 2VHQA 4A8JB 1M7HA 4M4SA 1U9IC 4I1SA 2ZRCA 3C5HA 4LBZA 4P33A 3E2IA 2RGAA 5AJZA 4A8JA 5EE1A 2G3YA 1JALA 4OK5A 5CIWA 3DM9B 1OKKA 4G1UC 2D4HA 4D4LA 2ASEA 5FTNA 4XTRA 2RH5A 1E9CA 4LV5B 3UKDA 4PPQA 1PUIA 3GLIA 1E9FA 4P4UA 5JI2E 1Q22A 1EFUA 1TUIA 2QT0A 2R2AA 4J0QA 5AUPB 1EFTA 4OKSA 4PQRA 1E0JA 4NE2A 2HV8A 3R7WA 4BFXA 2O0HA 1TADA 1P5ZB 1SXJD 1XMJA 1W47A 2JCSA 2NZJA 2Q9BA 1NJGA 4BQSA 2ONJA 3ZS9A 2DWQA 4US0R 4A0HA 3R9WA 3NWJA 3KB1A 2F9LA 3KJIA 1QHGA 4FMDB 2CLDX 3Q5EA 4GPTA 4KVGA 3TAHA 4HLDA 4QL3A 3THXB 1VKJA 5JSZB 1M7GA 4C9BA 3CO5A 4N1AA 3WNBA 3KL4A 3VX4A 1G7SA 2PZFA 2VL7A 1KAGA 1P61B 2XZPA 3B1WA 1G3IA 5J4LA 4UQOA 2WSMA 4NYMR 3LAWA 2AX4A 3IEVA 2ZE7A 2PLFA 2ZTSA 3U5ZB 4U00A 2ZRAA 5C2JB 1RKBA 3NBYC 4BEBA 4NCJA 1G3UA 2YWEA 4DLRA 4ARZA 3O8DA 3CF6R 4PX9A 4MKIA 1S8FA 2IBMA 4ASUA 2GXUA 2YVUA 4II7A 3UMSA 4JLDA 4AC9A 3N70A 4L5BA 3G5UA 3N2EA 2W6ID 3QUSA 3KQUA 1XCGB 4TL9A 2FEMA 2GF9A 3AV0B 3HR7A 2BM1A 2JDIA 3O8BA 4AURA 1OB2A 4ZDIA 3QXSA 5EXSA 3FKSA 2NZ8A 3QNUA 3K1JA 2WKRA 2XSZA 1CEEA 2QQ0A 3KUCA 2IS2A 2C04A 2J87A 1YR9A 2FH5B 5BXQC 3PEWA 1TUEA 2FJUA 5J40A 4JLMA 3T1QA 1E32A 3QOFA 2RGEA 2VSXA 1S0UA 2X19A 3H4MA 2PBRA 5C4MA 5HZKA 4DEYA 3GFPA 4KBFA 4CZ2A 1KMQA 4ZDKA 1D2MA 1U0LA 2RHDA 4CEJB 2R44A 5DE3A 1S3SA 3BS4A 4Q01A 5TARA 5B64A 2H5EA 5E3HA 1D9XA 2ZRNA 1XZPA 2ORWA 2IL1A 3RS2A 1E2PA 4MGYR 1KKLA 2D74A 3KXLA 4MDEA 3H84A 1UDWA 2G83A 2WJHA 3S1AB 1KNXA 1VG9B 1YU9A 2Q9AA 5L3SB 2G1KA 2JLXA 2C77A 1GL6A 3B8HA 5GJVC 1GILA 2A5FA 3QY0A 4QBGB 4GOXA 4B48A 1Q3TA 1F2UB 1P6XA 1GM5A 3HWSA 4PC1A 1GFIA 1TNDA 4MYHA 5DGXA 4F4CA 1YVDA 3M1IA 2HXYA 1R10A 5SZKB 3I8SA 1Z63A 1RJ9A 3HU1A 1G3QA 2QP9X 3MWKA 4IJMA 2AK2A 1IN5A 2XXAB 1TF2A 1N0WA 2EFEB 4GOJA 4IDQA 3GLGA 4D26A 1P73A 2PT5A 2OLKA 5EP2A 3U7HB 2B7CA 3PQCA 2CL6X 1UBCA 3EA0A 3HYTA 3BAFA 4MKGA 1UKEA 2CL0X 1RRCA 3DOFA 2ZI5A 4C2TA 1OYWA 2MSCB 4Q03A 2AXPA 2AN9A 2TMKA 2ZSDA 3SC3A 1TQ4A 2NQ2C 3UMFA 1G8GA 3TLXA 2GILA 1U8AA 1E2EA 4BZXA 3BERA 3K70B 2P0EA 3REGA 3ZGXA 2YOFA 4WW0A 4Q21A 1Z06A 3CRVA 1HT1E 3IIMA 4ZO4A 4IOKA 2FNAA 4DIEA 4BFZA 4CEHB 4AKHA 1EWRA 3OIUA 3THYA 4ESVA 2LKCA 4JIMA 2P5TB 1M7BA 1HEIA 1GNPA 1U8YA 3U7EB 1JR6A 1CXZA 1UDXA 4RFSB 2WKPA 3GLGB 2C5LA 3FGNA 1ZW6A 1AIPA 2ATXA 1DOAA 1YR7A 1Z0AA 2P6NA 5B57C 3KKPA 3NIBA 1EGAA 4B3FX 4HAZA 4QKQA 1N6RA 1VPLA 2ZREA 4QGFA 4AYXA 2GXQA 1II9A 2GXAA 5EQTA 4Q1BA 3C15C 5IK2A 3EZ2A 4IDPA 3K09C 1DAEA 3ZD7A 2IUUA 3MWLA 2FA9A 3IHLA 4EPWA 5K8UA 4BLRA 4CRWB 3T61A 3EG5A 4B3XA 2I1VB 2WBLC 1OT3A 2VP5A 4QOSA 3GLFB 3OAAD 2IXEA 3EWSA 4QHYA 1F5NA 2PH1A 4LI0A 5J4YA 2WAXA 2NG1A 4FMCB 2J7PA 2R6AA 3BORA 4BFTA 4GSYA 2FFBA 4DLWA 1QHSA 4UXHA 4DLVA 1MRSA 3CX8A 3O8RA 1O3YA 3ETLA 2J46A 4HZIA 1UKYA 2GKSA 1W44A 2WV9A 3VKHA 2F1HA 1ZAKA 1E2IA 1KSHA 2QENA 1NKTA 1Z5ZA 3R20A 3AUYA 4E03A 4TTPA 1XD8A 5KU1A 4LYHA 4ITRC 1R0YA 4ZDJA 5EE9A 1E1RA 3H2YA 1RPZA 4I99A 4D0LB 3CBQA 1QG2A 3PVSA 3K70D 2YZ2A 1GKIA 1LVGA 3GLHB 4AYTA 2AWNA 3PENA 4M22A 4M9SA 3W3ZB 1JR3E 2EU8A 2QTHA 2ZU6A 4NYIQ 4NCIA 5BYJA 3GLGE 2AKAB 2E1RA 4FMDF 3AVQA 2YOGA 4PTLA 3TE6A 3SJZA 1E79A 2EFDB 3GPLA 2ZEJA 4DZZA 1P75A 4QM7A 4PSKA 1W4CA 1OXXK 2QBYA 1GRRA 2C9YA 2ODNA 4E07A 4HLQB 1LV7A 1RW4A 1AM4D 5KUTA 4WXPA 1Q0UA 4Q4HA 4IFBA 4JL6A 4DJTA 4ACAA 5L3QA 3ECCA 1TEVA 4GMDA 4TTQA 4D4KA 4JVLA 3X2SA 4LBWA 2VP2A 1BKDR 2D7DA 2EQBA 1GL9B 1KSFX 1NBME 2VP9A 3F3YA 5BWMA 3FHCB 1AKYA 2XJ4A 2Z0MA 4NCHA 4A82A 2QPAA 3B1VA 2QSYA 3X1YA 2GA8A 2ZJAA 2IUSA 4X8OA 2WKQA 1NVUQ 4NU0A 1LNZA 2VP0A 3CUEF 1Z6TA 1Z22A 3OEEA 3TR0A 4PHFA 3LW8A 3WYFA 5CK4A 4HUQA 1P2UA 4QG7A 3T1OA 721PA 3F0TA 1ZM7A 4D81A 2O52A 2R65A 1ZC3A 4Z8YA 1NN3A 4DXAA 4V03A 2I4IA 2J59A 2NOAA 3EPHA 2JJ1D 2GBLA 2P3SA 1NVWQ 1OF1A 4DCVA 1OJLA 1JEDA 2KSQA 3FDIA 4IEEA 3K0FA 4P4SA 5EXXA 2YC2C 3O47A 2YWGA 1C1YA 2HCJB 4PO8A 3RWOA 2O8CB 1KI3A 4TL7A 4LYJA 1Q1QA 2W6IA 4LOAA 5SZIA 3EARA 1AQYA 1CULC 4L9WA 5DN6A 1NSFA 3B60A 2G0TA 1MKYA 3X1WA 1SVIA 4D0NA 2KI5A 1G5RA 4G5RA 5AJYA 4A1FA 1KY3A 1AGPA 1WE2A 1E9DA 2GVZC 3KTAB 4RFSA 4ZKEA 3TW8B 3ZS8A 4U7DA 1J8YF 2ZUDA 1YZUA 4TYQA 1UKVY 1MABA 3BH7A 3SI7A 2WWGA 3T5GA 3W3AA 2WIBA 4IVRA 4JT2A 2VSOA 1XXHA 1HQCA 1MO4A 4PC3A 2ECKA 4JLJA 3MCAA 3NH6A 2PCLA 4WZAE 3QSYA 4DDTA 3QG5A 1YHNA 4AIIA 3ASZA 1TF5A 2BEJA 2F1RA 4PZYA 1W36B 2OCYC 3PUWA 2O8EB 2QL6A 3ZD6A 5B58C 3SS8A 2ZRBA 4JBYA 4A0RA 2RGGA 1IN8A 3GLFA 3F5FA 1SVLA 4Q7JB 1ZVQA 4V0OA 2GNOA 2QQEA 3PUVA 4I1UA 5JCZA 2FZ4A 1Z83A 1ZNYA 2Q21A 3AGQA 3EA5A 3BH6A 2BKUA 3E1SA 4NYIR 4M9QA 4LJ6A 3KZ1E 3SFZA 3AVWA 4EQ6B 5L8VA 2Q3HA 1XJCA 1IXRC 2JJ1A 2B7BA 2RCNA 5CIQA 1G291 4LUCA 1E2JA 5FTKA 4V0KA 1E0SA 1OIWA 1VDZA 3CPEA 2JIZA 2YOHA 3TMKA 3SZRA 1X3SA 1JQLB 3BFVA 2ZRGA 1E4VA 1XJ0A 4XSGA 3K0CC 4D4MA 4L15A 2ZRMA 1XMIA 3EZ6A 3OZXA 4TWZA 3LWNA 4C2UA 2QP4A 3R8CA 3NKVA 3RRYA 4YMUA 4Z54A 3A1WA 4JL8A 2HLDA 2GVDC 1AJEA 3IILA 4OJQA 4G01B 5G53C 1T4GA 3DL0A 4ZDWA 4HAWA 1CLUA 1QHIA 3EC2A 4MH0R 2EYUA 4A2WA 1KSJA 4ZIRB 1J99A 2KE5A 3LA6A 1FQJA 3VR2A 3AVVA 1NI3A 5AUQA 1N5KA 1U0JA 3K09A 4P4TA 4D82A 2MSEB 3AM1A 1TQ6A 5E7MA 1MRNA 3MAAC 4YMWA 1SULA 2XOKA 2ZRIA 2QRZA 1JJ7A 2ZU0C 4G3XA 4JLVA 2A5JA 4TZ6A 2VYFA 1GVNB 4D6PA 3NXSA 1A7JA 4DLZA 3WP0A 3LW7A 4GZMA 121PA 3L0OA 1HH4A 3IEUA 5FUXA 3SHWA 5IHPA 3PR1A 2REXB 3F8TA 3FTQA 1Z0KA 4E22A 1OE0A 2DBYA 3VNUA 2C99A 2VF7A 2ZYUX 3B85A 3BOSA 4LX0A 3I92A 4YXWA 3V4RA 1AS0A 1E2FA 1NMZA 1SQ5A 4Q7KA 2CHQA 2FSFA 2KJQA 1P72A 3ZIAA 3RLFA 4A15A 5KYKA 4B33A 3M0EA 4HAYA 1E4YA 2GZHA 4W9MC 3KQKA 1Z0DA 4NZYA 4JS0A 3WMFA 3K8YA 3DKPA 1NMXA 3BK7A 1QG4A 3CF2A 5TMPA 5KO2A 3W5JA 1G20E 5KNBA 1GP2A 1F2UA 2DFLA 1N6LA 1ZM3A 5KSPA 2RB4A 3SBEA 1AS3A 1MO6A 1R8SA 1G7RA 1K5GA 4C30A 1G3MA 3DMNA 1VIAA 1G64A 4NONA 1A5TA 5DYGA 4B2PA 1X86B 4QGGA 1N3BA 1T0JB 1IN7A 2GK7A 4G5OA 5G40A 3TQCA 4YXWD 5HR5A 5GJWC 2ZANA 2CE7A 2DFNA 4KFUA 4MKFA 1HY3A 4D80A 1NG1A 4A36A 3MUFA 1KI6A 2PLRA 2ZI7A 3NC1C 4RCYA 3SE0A 2WPDA 3MLEA 3QKRA 2F3RA 1G4UR 4B3GA 4UNPA 3VU9A 1E1QD 1FMJA 5JJIA 4HDOB 2BBSA 4OI4A 3OEED 1WBDA 5AUNB 1R5NA 4QXAA 1Z6GA 2OILA 3FHOA 3W8RA 3WNCA 3ZYCA 4BZQA 1BMFA 2JLVA 4QGAA 3DZDA 5LB2A 1IONA 4QFMA 4P32A 5FOSA 4O3MA 3QEJA 1XB2A 3SR0A 1O87A 4NP6A 4B73A 3U4QA 2C9OA 2R9VA 2J0VA 3GEEA 3LBIA 4Q7MB 2HLDD 3P1JA 2CCKA 1XMVA 1W48A 2ANBA 1OXUA 2OV2A 4EPXA 2BWJA 1HURA 3SJCA 2X8AA 3I72A 5FFMA 2OESA 1N6PA 2YINC 1E2HA 3EXAA 4HAUA 2BBTA 1QHYA 1E0KA 4M53A 1HE8B 1R8QA 4GRAA 4LBYA 2W2TA 5LD2B 5DH9A 3S1AA 3TBKA 3VTKA 1ZM4A 1YZTA 1XU4A 3AVUA 2C9CA 1KDTA 4F91B 4I1OA 2V1UA 2GJAA 1NN0A 3AP1A 5DO9A 3HP1A 3LO5A 4KFTA 3TK1A 1WMSA 3K9GA 4Q4AB 2GWHA 1T0HB 621PA 2UZ3A 1LS6A 1NJFA 5TY0A 2V7QD 2ZROA 3AB3A 4B34A 2W0SA 1XPUA 2H92A 3QIAA 4LJ5A 4Q1FA 3M6AA 4LK2A 1Z0JA 3D3QA 3OEHA 1II8A 4KSBA 3KQLA 1F3OA 2G77B 4FCWA 5H70A 1E9AA 2QA5A 2D06A 4ZI3A 1XD9A 3HDTA 2VIIA 1IOZA 2QU8A 2ZRLA 3K9LA 2IS6A 3D7MA 3W90A 1NLYA 5EE0A 3KKNA 2BJWA 2NTYC 3EPKA 4FN5A 2VP6A 1T8TA 4RJLA 1NSTA 3U6KA 2W2XA 1T3LA 2RAPA 3ONWA 5FBLB 3SN6A 5JWRA 3TJZA 1KK2A 2OXRA 1XRJA 1PLLA 1DG3A 3LX5A 2JLQA 3B82A 4UXJA 2YC4C 4RD1A 2D2FA 4KBGA 1W5TA 1CS4C 2OXCA 4IHQA 1IJFA 4LZZA 1CR1A 4Q1AA 1XF9A 3U3KA 3GFOA 4EFNA 4PSVA 1KI9A 1OH8A 5LB4A 3EPLA 3KX2A 1YR8A 4M9XA 1XEWY 3PCRB 1JB1A 1VHLA 3LQQA 4B43A 4MA4A 2VRWA 4B2LA 4MGIR 3RHFA 2FX3A 1C9KA 2GEUA 3PXGA 4EPYA 3QF4B 5IK2D 4F4IA 3T5DA 3CNNA 1CU1A 1DEKA 3U3JA 3WBKA 2EVWX 1IJEA 1G3RA 4QJ3A 4FD2A 1D9ZA 1KK3A 8OHMA 2J0SA 1JXOA 1YRBA 1ZCBA 2QROA 3LVQE 2W6JA 4M8NE 3BD9A 4K46A 1CR0A 3LRPA 2CHVA 5FPTA 2QGZA 4DLUA 3GP8A 2XX3A 2GJ9A 3RANA 4PC7A 4JZKA 2N1BA 1TL7C 4QNMA 5IDVA 5JBQA 5AJVB 1PVOA 3NBXX 4JKYA 1TEXA 1NG9A 4S35A 1GKUB 2J1LA 1NBMD 2F1IA 1Q12A 3CRW1 1Q20A 4C7OB 2A78A 1E2GA 3IQWA 2FEOA 5GADl 1ZD9A 1S3GA 2YJTD 1HTWA 2ZSAA 1WQ1R 2YNMA 5H8WA 3U2QA 5JZVA 4LCBA 1T8UA 3LX8A 1W36D 1T6NA 2PMDA 1FFHA 2ZE6A 2WTUA 1N6OA 3K70C 1R4AA 1R6BX 4TLAA 1KGDA 4D4JA 3THXA 2ZJ2A 1K6MA 2QE7D 3EZFA 5J4HA 3P4YA 2P6UA 1QVAA 2CNWD 4Q5IA 5KPDA 3RYTC 1PLJA 1CJUC 3PIRA 3SYKA 4B75A 4GBMA 5EE5B 3I61A 3QVVA 3IIKA 3WYAA 2GCOB 1WXQA 4HUQB 2IYYA 1ZJ6A 3U3RA 4CEJA 1OHHD 4IDNA 4A6XA 3ICEA 4PANA 2Q3FA 2Q3MA 4TMWA 5B30A 2GESA 1ZYUA 2XNDA 3WMEA 1H8HD 5FBVB 4B6EA 1WP9A 4A2PA 4C0AC 2RKOA 3PEYA 4B44A 4YC7A 2Z4SA 2WWWA 5J47A 3TRFA 4QBIA 5CDFE 1W7AA 2O8BA 1XXHB 2C78A 1N25A 1E1RD 4EFLA 5JHHB 2X77A 3A58B 3BB4A 3DO6A 1QF9A 2VPPA 1E9SA 4POAA 3CW2A 5KDDA 4TL8A 5D3MA 3TSOA 5E7IA 5EE3A 1OXVA 4AKIA 1DBSA 4C7OA 4IXMA 3OEHD 3W6NA 1OKKD 5E95A 1H65A 5CITA 2OO7A 1GG2A 1W0JD 2IC5A 5FOUA 4FWTA 1ZU4A 4DIDA 2PL3A 2QG6A 1JAIA 1T3SA 2Z43A 3B6EA 3CNLA 3UATA 2OHFA 1X8JA 2WMNB 1U2RA 2ZJ5A 3SU8A 3A6PC 2QY9A 1DS6A 4ARZB 4BRWA 3UG7A 3IDQA 1W0JA 4XWOA 5FL3A 3VKGA 5LD2C 1G5TA 4PPNA 3SJAA 3THOA 4KV9A 1NNEA 1X6VA 1TTTA 4RD4A 2VHCA 3MFYA 1QHNA 3QXJA 4BECA 2H1LA 2IK8A 4JLOA 3TVDA 1NKSA 3QENA 3BXZA 3RS5A 3DOEA 1Z6XA 2GZDA 4NYMQ 4OI0A 2GJ8A 3UXMA 4XTCS 1QHHB 4RZXA 3N5CA 4M1KA 5KSYA 3TVTA 3VX3A 2QUZA 3ZZTA 1ONBA 2FE4A 1X8LA 1D5CA 3SNHA 4EAQA 5KOYA 1SHZA 5EUMA 3ZQ6A 1TMKA 2UKDA 4JJKA 2AFHE 4CT5A 4MKHA 1XEXB 4F93B 3HJNA 2ODWA 3GLIE 3L82B 2XB2A 1YE8A 2OFOA 5FOVA 3AUXA 4ABYA 1CRPA 3U61B 3PEUA 2JLUA 2LWIA 3GD7A 5J4KA 3K9HA 3CIOA 5JECA 3QKSB 2FMXA 4PHHA 1QDEA 2ONKA 1CRQA 1A2BA 3BE4A 3UPUA 5DIFA 1K8RA 1R0XA 1FOEB 1Z6AA 4HDCA 3PG5A 5FR2A 5FOWA 3PJRA 2BMJA 1COWA 5P21A 4Q9IA 2K5UA 1ZIOA 5A0FA 1NN5A 1E3MA 2FN4A 2RGBA 1MV5A 2VF8A 1E9RA 1A82A 3FOZA 4MQBA 2JLYA 5DN6D 3GEIA 2IT1A 4O25A 3U60B 2DYKA 1W4RA 3CH5A 2AR7A 2R6FA 4M21A 1KK1A 5EZ5A 2OCAA 2O8EA 2ZRHA 4MUBA 4BGDA 5FR1A 1E94E 2IHYA 2NO1A 1GRQA 2FFQA 2GZAA 2Z4RA 5DYIA 1BO6A 2QTFA 1WF3A 1W0KD 1R0WA 2R62A 4IEIA 3KXIA 3OFNA 4ZCIA 4M1MA 1L2TA 3GEHA 2IS1A 5EZ6B 4LJ8A 2N46A 5JCPA 1E98A 2WIAA 2F6RA 1FTSA 3C16C 4V0MA 3NVAA 2IYRA 521PA 1FNNA 2CE2X 4CW7A 1W2HA 4PSAA 4GMXA 3KQHA 1ZP6A 2OLJA 1KJYA 2P65A 5LBIA 3K9NA 1B23P 3U3MA 1ZCAA 4BLQA 5FTLA 2ATVA 5JS7A 1TAGA 1E2LA 3ZZUA 1Z3IX 1W46A 5FPHA 2FG5A 2G88A 3TAUA 5L3SA 4CF7A 1CJVC 3KKMA 2FF7A 2GXSA 3RWMB 5FPKA 3Q72A 1W36C 1V5WA 2B8WA 3CWZA 3AVTA 4NHOA 1WB9A 5E7JA 3TR5A 4B6FA 4ZPXA 4OI2A 1FX0A 1CJTC 3T12A 4EUNA 1VYTA 3FFAA 3Q7PA 4WBSA 4YDSA 3L8YA 1E79D 1YZNA 2A7QA 3JZMA 5BN5A 5JJKA 1FUKA 1YZKA 1JR3A 2BCJQ 2DWOA 4HZUA 1KNQA 2A3RA 4QJ4A 4Q1CA 2NMVA 3FE2A 2OCPA 4X8HA 3AF4A 4JYBA 5GVSA 3VR5A 1XBTA 4Q18A 2GBLC 4DDWA 4HDQB 1AKEA 4DT1A 2QT1A 2RHMA 1SXJC 2E87A 4B2IA 2V7QA 4LGMA 1Q21A 4LPSA 1MT0A 3O8CA 5JRZA 4F7WA 4PR0A 4TQAA 4AK9A 1RRPA 3BC1A 3B13B 3C4JA 2BMDA 1G17A 1S9DA 4Q19A 3QXXA 5GVRA 4RD3A 3HPRA 4XH9B 2R6GA 2WWIA 1KDRA 2N42A 2IF0A 1N5IA 4TYWA 1S9HA 1H8HA 3W6OA 1ZRHA 4XD7A 2V6IA 3A4MA 5FTMA 2ZR7A 3ADBA 4TZ0A 1CJKC 3ZZ0A 1YRAA 1KMHB 3VNVA 4Q9HA 3EZ9A 2J7KA 2OG2A 1SVWA 2Z6VA 1G8HA 2DFKB 3U44A 1D6JA 1Z0FA 2ZYTX 4LSGA 1EK0A 1U98A 1CR2A 3PUZA 3KFVA 4HB0A 4PAOA 2I1QA 1Q1ZA 2VQSA 1ZD1A 3PV0A 2J5XA 1LS1A 1OFHA 4M1TA 1BIFA 1EFCA 2AD1A 821PA 3AKEA 4C0BA 1C4OA 2IYUA 2FOLA 1NLFA 3EAQA 3FMOB 2LCFA 5CB8A 3A37A 2XNSA 4OHXA 2D7CA 2QPTA 4FXPA 2IUTA 2XAUA 1J8MF 1W4AA 3RNLA 5FUYA 4BEJA 4C4PA 4MRPA 4YMVA 5FBWB 4JBXA 2LKDA 3NDPA 2WJGA 3BIFA 1GSIA 5BYKA 1Z2CA 1XCPA 4Q66C 3IUYA 1ZNZA 3I73A 2SHKA 4G5SA 1MO5A 2BBOA 2FSHA 4R71A 2O8FB 4P3YA 1SKQA 2OE2A 4XVRA 1BYUA 1U0HC 2MSDB 4PXAA 3QE0A 2PCJA 4C0KA 4B3DA 1H8ED 5C18A 1XXHE 4I81A 1N5JA 2CDNA 3K0AA 4B71A 1E0AA 2GEVA 3CRQA 1ZMXA 4FI3C 4MRVA 1VG1A 2BVNA 3B9PA 4OL0A 4QNRA 4DCUA 2ZI9A 3QBVA 4JJZA 1WCV1 4JSTA 4OK3A 3T34A 3UWOA 4Q4HB 3EPJA 4PZZA 1WDTA 3UMRA 4OJKA 3CZPA 1IQPA 2EFHB 2VHJA 2NIPA 1TPZA 3C7KA 3LXXA 1KJZA 4HI0E 4UNNA 4YONB 2XZLA 4Q4AA 2OFWA 1ZM2A 4H1VA 3ZH9B 4TT3D 4G5GA 3H86A 3HU3A 1KO4A 4DB4A 5JEEA 2GJSA 3CNOA 1SVMA 4M2LA 5A4JA 2DHRA 1M74A 4DDVA 1EWQA 3SQXA 4C0QC 4JYCA 4JLBA 2DWPA 2IYWA 3VR6A 4A0FA 5L3VA 4KLZA 1XJQA 5K8IA 2XTNA 4TLEA 3WBJA 1M8PA 4Q4JB 1R7RA 3LD9A 4Q7LA 3AF1A 2C2HA 5FBQB 4DUGA 2GRJA 5B2ZA 4NKRA 2XITA 4BFVA 2QP3A 2JJ2A 1AQUA 3H0KA 3I1FA 3IPXA 1S1MA 1RJ9B 4QBHA 1NVVR 1RVDA 1KJWA 4Q9LA 4HEJA 4BZPA 1V43A 1VMAA 3VMFA 2GETA 4GI7A 1UKZA 1UJ2A 2VO1A 1ZBDA 1G5PA 3QPWA 2DB3A 2ZRKA 2QE7A 1NIPA 1UADA 4JLAA 2CL7X 5EXPA 1KAOA 5K8LA 3GLHE 4QGHA 3E5HA 4RD2A 2D2EA 4QHTA 3EX7C 3D31A 4RZ3A 4OBEA 3TUJC 3L0PA 4KO8A 3CF0A 1E6CA 3CZQA 2IW3A 2BBWA 2ZSFA 4L4UA 5AK0A 1Y63A 2XSZD 1T91A 1U81A 2FWRA 5JJLA 3THWB 3CB4A 2WJVA 4DC9A 5AUOB 3FHTA 1ZUIA 2A5YB 2W0MA 2GTPA 1NBMA 4KU4A 2BHRA 2C96A 4GFDA 2GDJA 3I3SR 1AS2A 1KDOA 1YZQA 2QGNA 1Z0IA 1G19A 4UJ5A 4URZR 1OXSC 2CLCX 4ZCLA 1SXJE 5HPYB 1Z08A 1P2VA 1GKYA 1N2CE 2ZAMA 3GJ5A 1IY2A 4Y0AA 2B8TA 2XGJA 1EX7A 5DHFA 3VFDA 3WYGA 5BN3A 1CBUA 4MDFA 1GL7A 3Q5DA 1BH2A 4MGZR 1FQKA 2XJ9A 1W1WA 1ZU5A 2G0NA 3LBHA 4PAQA 4JLNA 3RC8A 5D3MB 4O2LA 4A9AA 5JWOA 3GLFE 4DSNA 5BN4A 1XNJA 4NL4H 3OE7A 4C0HA 3AF2A 1Y3AA 2ZUBA 3L8ZA 4TSFD 2NPIA 2QBYB 4B3BA 3RSOA 1OB5A 2CJWA 5HTKA 4C3ZA 1FW6A 4XOIA 4G0NA 3FYHA 2QAGA 1DADA 2R6DA 3Q9LA 4NTZA 3CPJB 4D2IA 3I32A 4IOMA 5HKKD 1E1QA 1TU4A 3BWDD 4UNRA 2EWVA 3U7GA 1E2NA 2X2FA 5EXTA 1XX6A 3PITA 1KIMA 2PEZA 2EFGA 1VHTA 4XSHA 3RAPR 3DM5A 3T1TA 4GP6A 1UEIA 1BYIA 4AKEA 2KB0A 5FL7D 4LV8B 3RC3A 4LV6A 4JKIA 2YV5A 2VHUA 2HF8A 2ZVPX 2H17A 1CKEA 2FPMA 1F2TA 4XIGS 2QTVB 5GJCA 5F3WB 2WOOA 2QMHA 1FUUA 2IYTA 3NDBB 1G21E 2ZYWX 3QPVA 4DWJA 3U3OA 3K0EA 2IXGA 3KKOA 3RS7A 3B1XA 2CEAA 4TMTA 1XPOA 1KOFA 2B6HA 2WJIA 4RFVA 4IFEA 4WZ6A 4EIWA 4TYYA 3CRMA 3HPQA 3FFBA 2XTMA 1OH5A 3CX7A 4RZUA 3KQNA 2WWHA 4Q00A 3WMGA 2O0KA 5JSZA 1NVVQ 3KXKA 3A1VA 2ZJOA 4C0LA 1ESMA 5KNDA 4PC6A 4PO9A 2F7SA 1NP6A 2O8DB 4URUR 4NCKA 1U9IA 1QHHA 2UZIR 1T5IA 3BJIC 4N0EA 5JWHA 4XJXA 2RGNC 4IRUB 1R0ZA 4BLPA 3R7WB 4ILEA 1SKYE 4HB3A 4M1SA 1UAAA 1OW3B 2DCUA 2Y8EA 4JMPA 2WOJA 3GLHA 2X1VA 2NO0A 1KKMA 1UFQA 3B7GA 2ZPTX 3KJGA 1XEXA 3LBNA 2Z5FA 2VA8A 5A5GA 2ODBA 1GOTA 3ADKA 1B0UA 2HCBA 3C8UA 4LJAA 1G18A 4MRNA 4LJ4A 3ADDA 3LLUA 4UNQA 5LPNA 4Q47A 2BKEA 3T06B 4DCNA 2ZM5A 3Q3JB 5LDDC 1S4QA 5BQ5A 1RFLA 4WZBE 4LHZA 3QVUA 4I4LA 4AG5A 5D3QA 5TDHA 4PHGA 1VG0B 2OUKA 1H8EA 1I4TD 4DUGD 4DSUA 1NMYA 1X1RA 3TIFA 1DELA 3K0CA 2ZS9A 1Z47A 2JDID 2GAAA 1DARA 5TXGA 1G6HA 2C8VA 4QHSA 3B1ZA 2A2ZA 2DPXA 1L4YA 3TH5A 2O8CA 3VHLB 2HJGA 1DTSA 1N6HA 3W34A 1FZQA 2IWRA 5KPJA 3CR7A 4TT3A 3RABA 2FZLA 3MG9A 4LYAA 2FFAA 1SVOA 4ASUD 1RYHA 1HE1C 3VR1A 3LH5A 4HZUB 2JJ8A 4TMVA 4MITA 4A2QA 2OT3B 3ASYA 4XWAA 4XVQA 1QBKC 3I5YA 1IBRA 4R2IA 3AVPA 3VU9B 2VEDA 5HCNA 2CBZA 2QMOA 4CEIB 4RVCA 4JBWA 3FB4A 3VHXA 1P3JA 2PZGA 1AK2A 3NTUA 4MYUA 4BFUA 1FX0B 4K81B 2FV8A 3LLMA 3E70C 3JZAA 2EFCB 2OCBA 4R98A 3T15A 3TSWA 2EW1A 4LHWA 5DI9A 1OH7A 4PO1A 3WP1B 2V8OA 4KJZA 1Q44A 2E9SA 2OAP1 4YMTA 3LNCA 3TGPA 1TQ2A 4XD7D 2Q0HA 1L4UA 2YYZA 3I4LA 2JGNA 2GCOA 2JLWA 3SQWA 3BFKA 1N0VC 2BCGY 2WVJA 1ZUNB 2CLSA 4GDFA 2WWYA 2XOKD 2HXSA 4KYIB 4TMKA 3QI2A 5CLLA 2GF0A 4LJYA 1MH1A 1SZPA 3RS3A 4TSFA 4UKDA 3RVBA 1Z28A 1RIFA 3OIYA 2F43B 4BWYA 3VKWA 4MYTA 1IXSB 4KSCA 2REOA 1KO1A 221PA 3IIJA 4K8OA 4O0MA 5HE8A 1R5BA 1CR4A 2WICA 4JVSB 2ZJ8A 5CK5A 3SOPA 2JLZA 4AG6A 4FMBB 2O8DA 1JPJA 3HYRA 4OQXA 1KO8A 1T3HA 3IQXA 2V6JA 2H57A 4MGKR 5FPYA 5G3ZA 3PEVA 3QEOA 2J3EA 1UPTA 1P2SA 2PZEA 2PMKA 3CKLA 3LQRA 2GAOA 3OHMA 1FL9A 2QI9C 5EUQB 5JHGB 1II0A 4WIAA 4ZIRA 4AYWA 2WAYA 2O8BB 3TUZC 1QHXA 2W2VA 3B5JA 1JQJC 2IX3A 2WSSD 4HAVA 3V4FA 4BE7B 2QSZA 3IO5A 4PQYA 4EJSB 1F60A 4KODA 2HUPA 3KB2A 5AJWA 1KHTA 1L7VC 4DLYA 1N6KA 4B35A 1JJVA 4Z1MD 2BJVA 3GLIB 4CEIA 3EIEA 4O2RA 3RS4A 2UVQA 3B2EA 2ZR9A 3JVVA 2V54A 4Q9KA 5CM9C 3W6PA 2V1XA 2AKYA 2EWWA 1HT2E 4M9ZA 3CM0A 4DCSA 1YQTA 4Z8XA 4PHTA 3NBZC 3OFND 4OI1A 3NG1A 2REBA 1LFDB 3FKQA 4EPRA 2WM9B 2ZVQX 4HATA 2J0QA 1W0KA 3KUDA 3MMPA 3WRXC 4PAMA 3D8BA 2FSIA 1I2DA 1UBFA 2WSSA 1U99A 5DNYB 3R9XA 1S2MA 2ZRFA 3P26A 1P2TA 4DHEA 2CK3D 2PEYA 2GK6A 4NBSA 4ZI2A 3FKSD 4B47A 4CVNA 4W5HA 4WOPA 1IM2A 4PC2A 3T1VA 4EJSC 3CLVA 2ZAOA 2F43A 1MABB 4Z51A 1UM8A 1SVSA 2QM8A 2A30A 3K0FB 4FMCF 5FBRB 4DLXA 2G1JA 1OIVA 4X8MA 4LRWA 3U6BA 4LHXA 2ZI6A 1PLKA 1ZC4A 3EZ7A 5EP3A 3GJ8A 3H1TA 4GT1A 1GZSA 5FI1B 1GITA 3DKVA 5H68A 1JI0A 4IOJA 3GCGA 1P9RA 5EJEA 4QRHA 2BOVA 4KHZA 1ANKA 1MO3A 2AD5A 1F48A 1JNYA 2R6CA 3MJHA 2ZYVX 1IAQA 2DY1A 4M1OA 2C03A 2H8KA 4LWZA 3C41J 3C14C 3UANA 1VTKA 2F9MA 4V02A 2F55A 5FH9A 1K5DA 5FOXA 1GWNA 1KI2A 3AVOA 2JEOA 4N0DA 2D62A 1CIPA 1EX6A 2C98A 1COWD 4HB4A
chains in the Genus database with same CATH superfamily
3DDOA 2F1JA 1L5FA 3W77A 4D42A 3QRWA 4NEGA 2E6UX 2NO6A 4J1TA 4N0QA 3ZE7A 3FPFA 4WOKA 3CPHA 3KU4A 4IUCS 4XX1A 5DI3B 4OVDA 4MBFA 1RXUA 3HBRA 1OJ5A 5IVHA 4JLKA 4QUAA 2DVMA 3WOVA 3HCCA 4J9VA 1LGYA 2QVXX 4EITA 4QDOA 5TQJA 2HU5A 1YZYA 3CQ9A 4IIGA 4E1VA 2WMOB 4O1HA 1F5SA 2R4QA 1JGTA 2OXTA 1TB4A 2XMQA 3A04A 3VHQA 3QOXA 3OQNA 2YXLA 1B73A 1P7CA 3G5AA 5IFKA 2RHOA 2BV3A 3ABRB 1CP2A 4N76A 4KUOA 2IPXA 3MHPA 4MUAA 4WLVA 3AV3A 3BE8A 3A1TA 4N3NA 4RZSA 5CW2A 3MCUA 4KN6A 4OYLA 4AUNA 4TSKA 4BEWA 4IJWA 2H1IA 4PWYA 4DY6A 2OCGA 4XJVA 3NYQA 5LOVA 1T10A 2IZZA 1L8QA 4RM3A 2AJDA 1FDIA 1OXTA 2QTCA 3CSDA 3SHVA 2KX7A 4JF4A 1AV7A 2JF0A 3PDCA 2DKNA 4C6HA 3DAFA 4MEJA 5G3YA 1FS4A 3ZU3A 1N78A 3DWGA 2C9DA 1DHTA 2P2CA 4CDGA 2QAGB 4JGPA 4X8LA 5B1YA 3JD4A 4X3OA 3CWCA 3DT8A 1KE4A 1H9AA 3CVJA 2Q5FA 4WADA 3AJDA 4HLUA 1NLZA 3S7QA 2ZI3A 2EX8A 1BLPA 1DAIA 2VATA 2JNWA 4N5HX 4Q6WA 4YYEA 1JAHA 2JGLA 5HM6A 1RWKA 4YAIA 3IS2A 3P2MA 2FR8C 3QKTA 2ZIAA 2BMVA 1KE3A 5I8WA 2VYNA 1VGVA 2AW5A 3B48A 1TTQB 1UC4B 3TG8A 2H2WA 4YJGB 3V34A 4K1LA 2XE4A 3PF8A 5SZHB 2XYVA 4D8XA 7MDHA 3IE0A 3K0AB 2PUHA 3S4XA 3OAAA 1QRAA 1UK9A 3D2LA 3Q85A 1FW8A 4I55F 2J6IA 4KMOA 4UVGA 5SZJA 1LF5A 4DPLA 4KE9A 4JGQA 1J00A 4OG2A 5BUSA 4JCOA 1QS0B 3AOEA 4LYGA 4UAVA 1TS6A 1DEOA 2Q4RA 4TLDA 3ZIDA 1DO8A 3NPMA 1ZZEA 4RVGA 3G2NA 3K1AA 5F51A 1MAVA 1OC4A 1RXEA 3CX6A 4YJ3B 3L7JA 5BSVA 2BR5A 1NQOA 1DPFA 1HZZA 3WL7A 2NNLD 4LMRA 4X1YA 5ALXA 4O0LA 5FPSA 5H1YA 3WIUA 3E4QA 1T1RA 4ZI5A 4HP9A 1VHQA 3O8OB 2DM6A 3ETDA 5FTJA 3E35A 3GGDA 1Z7GA 1U7DA 5CA1A 4C7XA 3AF6A 3T1YB 2A9VA 4K8RB 1W2GA 3SQOA 4HN2A 3ZCSA 1GTVA 1OX5A 5BN1A 2BUAA 2OBNA 1H05A 3PDIA 4HUTA 1G38A 3MGKA 4RSMA 3EWAA 1S3IA 4HLCA 3ZQJA 1EA7A 3SG0A 4TQGA 4KHPB 3P5BA 2AK3A 5F77A 3I9LA 2QG9A 1XTJA 4HNTA 1D1PA 2QMIA 1UF9A 4I1VA 1E59A 3EIHA 4QBFA 3WL5A 4FB4A 5JADA 3FSGD 5IEJA 4BLTA 1W88B 1I9GA 2PU5A 3SSAA 4OSPA 1QO9A 3P9CA 4QASA 4CM6A 1EVEA 3FC7A 3N8HA 4HQKA 1YKGA 2JATA 4DJJA 5FQNA 5DTJA 2H0RA 4XLTA 2VDLB 5LNK6 4X55A 3GVXA 5B2EA 4QD4A 3RNOA 1Z5GA 5CT5A 3V3KA 3Q9SA 3QVGB 1V6CA 2LW7A 1QV6A 5KHAA 5TE9A 4AJIA 4B3MB 3IBJA 1PX2A 4OQLA 1ZM9A 4RXUA 1KZ9A 4OMDA 4DNOA 4CKYA 2G25A 2GZRA 1F0KA 2W9XA 4JLPA 4LGWA 3ER8A 1D1QA 2ODTX 1CHDA 1J2JA 4R16A 2G6BA 4UHJA 4ROSA 5CYGA 2D7DA 3AVYA 4OQNA 4WKCA 1UEJA 1Y9JA 1USKA 2FJPA 4WD3A 4C7MA 3ZVLA 3QW2A 3U56A 4C4AA 5DLDA 2XA7M 2VPYA 2BGMA 4YRTA 3ZWCA 1RGYA 4ON9A 3WWEA 2ZZNA 3K53A 4IOLA 4YDHB 2WZCA 1JDBC 1WF6A 4P5EA 1M73E 3P4XA 3GZJA 4HADA 3U44B 3E4CA 1KMCA 4LW8A 1NMSA 1ZN2A 3OM8A 1AQ6A 1G98A 1MVNA 1FUYB 1VLMA 4LJ7A 1P33A 3FD8A 2Y55A 3AUUA 4PEVA 3GMTA 3WB0A 1IH8A 2XIQA 4IX9A 3E7PA 4ZYXA 4WBXC 5HZMA 1T6ZA 2AXNA 4YJFB 1JSLA 4GGPA 2VUSA 1PNTA 3G5TA 5JG7A 9ATCA 1MWRA 2PVSA 4FKMA 4Y1GA 2IS4A 4EQIA 2J41A 3OMWA 3ZVRA 3LP6A 1VG8A 1H2FA 3SHFA 5JSQA 1RS0A 1HSZA 5AK4A 3LR3A 1G28A 2IZ6A 3WRTA 4QDTA 6ABPA 1FDUA 1P62B 3LI8A 1AUXA 5HD5A 1HUQA 1RYNA 2HIMA 4IXNA 4MULA 2A58A 3HXKA 1V1MB 4ZA2A 3GLQA 4D0GA 1MXFA 3VKVA 3OE7D 3ZG8B 1GSWA 3M4YA 1ETUA 3JVUA 2GGSA 1V5IA 1KO7A 1PW8A 4GOKA 4DMMA 5GONB 1UBGA 3Q8XB 4DRYA 4ZZIA 4QXMA 4TV8B 4Z1MA 3F1OB 2OORC 3RUAA 1V71A 3BCSA 1RCFA 5G2OA 3LYXA 1BWQA 3A9CA 1PWZA 2BM0A 3CW8X 5T4BA 2CMKA 2NO9A 4UASA 4W7IA 1X0VA 2PUEA 3NPAA 3H83A 5KJEA 1RJEA 2WWFA 4S1VA 1Y1RA 1V11B 1UK8A 3OJFA 3OTHA 1IOVA 4LOKA 3WGMA 4EY4A 2QF7A 3GOQA 5FQKA 3C7DB 3EH1A 4ZYWA 3UJNA 2VSFA 4I4TF 1PV1A 1T9HA 1JF8A 1SOAA 3OIWA 1IHUA 3D3JA 4OX9Y 2X76A 5C1BA 4PBTA 4YB8A 2CXXA 4OGFA 1GA0A 1H0HA 2TRSB 4XPIA 3N3BC 5FDHA 1B6SA 3DBVO 3G7UA 3GJ6A 4PO3X 4V3CA 3KYCA 5BV2P 1AZTA 3JVIA 5GY7A 1XDBA 3W5IA 4MRSA 4QC2A 4OHYA 5FEUA 2E4ZA 2D1RA 4XPZA 5F2EA 3WMWA 2P6RA 1W75A 2JIMA 4ZRNA 2VX8A 3W2HA 3BQAA 5L07A 1E96A 3X1ZA 4FNGA 2R97A 5ADWA 1VCMA 1KETA 1ZI9A 2JFGA 2Z83A 3D54D 3ROPA 4GS9A 3M8KA 2J3QA 1UDAA 1NW7A 2FDRA 2XEDA 1KL7A 5LQJA 3DVAA 5F33A 4B4ZA 2KHZA 3CH4B 2DQSA 2Q8QA 3OA0A 5GAJA 1Y7IA 3KOWA 3ZJYA 4LF6B 1JTDA 3HCNA 1EWKA 4RY2A 5KIZA 4ZPJA 2JFZA 2FE1A 4F6LA 1QGZA 1XZQA 3BMOB 2B4RO 5IF9A 5TJ9A 2ZSEA 1NF3A 3MFXA 4TQ9A 3VOSA 4A23A 1COZA 4WE3A 2HYDA 4PZLA 2QRHA 4B6QA 4JXSA 3A1DA 3OSUA 1OBCA 2FSGA 4KE8A 1J24A 4FLEA 2PT6A 3A4LA 3KOMA 2PX0A 1KRXA 2FMKA 5AKKA 2OM2A 1LF0A 4M38A 2OEPA 4UOEA 3JAKA 1HV8A 4A27A 3M9WA 1X0XA 5CGZA 3ZY5A 1OBOA 4CV1A 4LRQA 4RVAA 2HNKA 2N3ZA 3I2KA 5MGBA 4EHBA 4EY5A 1PJ2A 4GB7A 4BX2A 1AF7A 3PUXA 3NUGA 4NABA 3NHAA 3C5WP 5KSZA 2OVBA 4D3ZA 1ZH2A 3WNZA 2IHKA 3VYTB 2GN6A 3F5SA 1NFQA 4LV2A 1VECA 3K72B 4L5CA 5A0TA 1J2YA 1CUBA 2CB9A 2E49A 3QJYA 1VFPA 5EVEA 1ZKDA 2CFOA 2KX6A 2G08A 4YQFA 3VOYA 2YHAA 4JP2A 2PV7A 3DGFC 3ICQB 3AF0A 4YFYA 3TQSA 4LRXA 3NHKA 3HY6A 1J2TA 5HE9A 4WEKA 2QEQA 4IHKA 1G8KA 1KK0A 3UM9A 2IITA 5F76A 3B1YA 2XB4A 4CT4B 5BPHA 2KDKA 3TF5A 1E7RA 2JCBA 3D43A 2XCIA 3P32A 5KEIA 1XEFA 3GRYA 5KYXA 1Y82A 3OZVA 4FN4A 1OGIA 3IVGA 3K4HA 5CVJA 1VJRA 2IYQA 3AP3A 4ZOEA 4DFDA 4ZV4A 3P9SA 1TYZA 3ONVA 2NUPB 4ROTA 2Z6UA 5F6AA 1PT5A 4C3VA 1I5OA 1IN4A 4BPBA 3GROA 3K16A 2YKGA 2IDKA 4NCNA 3IAHA 2B5RA 3MA0A 4BQOA 2P3QA 3LVRE 3TOCA 4YI3A 2XCQA 2FEPA 2WPDD 5FLKA 3AI3A 2ATEA 3RC2A 2RGXA 3GJ4A 4H6JB 2BM8A 3WHKA 4F60A 1D6SA 2J8ZA 4JVNA 5ANRB 1O5OA 2C94A 2PV0A 4OUDB 3VOAA 1GEGA 3ZH2A 4DDUA 3IUPA 3LECA 5DLQC 4RD0A 4DIKA 4LBVA 1E7YA 3MWDA 3ZI4A 2YDXA 1IOLA 4EBFA 3N7WA 1WPRA 1DT3A 1EU1A 5HIMA 2ZIXA 4R9UC 3GH3A 4YPOA 5J2UF 4DJ3A 1QWOA 2FUG6 2XE7A 3BFPA 1B76A 2OGUA 3GGSA 4G36A 3VP0A 4XUEA 3UMJA 5C8YB 5I7UA 1MX1A 1DG1G 1Z8DA 2QMQA 2YQ4A 5AYVA 2WB2A 3S5UA 1LEHA 1XZKA 1K56A 4DR3B 1V26A 4UM8B 3A28A 5AK3A 3VE4A 1NVEA 5D01A 5IANA 4CR6A 3WSWA 2AC7A 4KH0A 3Q82A 2W83A 3LIAA 1XTKA 2DQKA 5AP9A 3GFTA 5JSYA 2J8YA 4C0JA 4TMXA 4YV7A 1A8HA 4RLFA 4LE0A 1AA9A 2EXBA 2ZRPA 3CVUA 2NVWA 2HMUA 3AEZA 3C3JA 2PBYA 3FMFA 4GUDA 3NXKA 4LSWA 4TTIA 3TE8A 1MOZA 2RJOA 3GT4A 4RQAA 4ZK6A 1L9KA 3L93A 3LF1A 2OMKA 3I5UA 3U7JA 3ZG6A 2SKCA 4EI8A 2JAOA 3L92A 1S96A 4J2TA 1PS9A 1QH1B 1PEYA 2WZQA 3O1JC 4IDBA 1XPRA 3LDAA 2CDCA 2OKCA 2I71A 1TOAA 1AKVA 1KQPA 4DE2A 1N3LA 1QGAA 2IHJA 2JD1A 2Y1KA 1GV0A 3FVQA 4H1UA 1Q57A 1NOIA 1VJ1A 3PK0A 1KO5A 2FP4A 2V5AA 4Y0TA 1Z3CA 2IV3A 3PCXA 3EXHA 5HCIA 2J9ZB 1LBTA 1C3LA 1OTHA 3FG9A 2FEXA 4JR2A 4ENUA 3F46A 1P2DA 2A49A 1QMEA 1ITZA 2QDKA 3QUTA 1OQAA 3R6LA 4C5AA 2GI4A 2NGRA 3CMZA 5CVDA 1RBYA 3RCBA 3RARA 3THSA 3EEHA 3OCVA 5C1DA 5CB4A 2KBFA 1JIIA 1QOZA 2MYUA 3M5DA 4W5JA 5T4EA 4AU1A 2RKWA 3QE9Y 4A16A 3G2YA 2I2CA 3FDZB 4K6MA 2HYIC 2D0OB 2XUAA 5DVZA 2L18A 3K35A 4HWRA 5G0UA 2O5VA 1HQYE 3C8HA 4GE0A 5CM8B 3UH1A 4E4RA 5C9ZA 2KWIA 2J7VA 4A92A 1BYWA 4FCTA 5K0EA 4H4CA 3ROEA 4B3HA 1PNRA 2FFJA 2CUNA 1AZLA 1T5BA 3AEQA 4KDEA 5FUWA 2XTJA 3P7NA 1VCIA 2DHQA 5REQA 5I5GA 5HW3A 4F56A 4YP5A 3KAKA 4L4XA 1E1LA 1I2MA 1MUUA 2IXFA 3O8NA 3O8QA 3T4XA 3VPSA 5EJ4A 1Z2PX 5L3QB 2O8VA 4Q3OA 3PGLA 1M8GA 3LPDA 3A6HA 2ZG6A 4EA7A 4D9KA 3ZVKA 3AKCA 3UK7A 1PGNA 1ZJ5A 3O8OA 1GRCA 1U0RA 4EG6A 1EUDA 1JRLA 4FZVA 3G8CA 4QJGA 2Y67A 1GIAA 1V39A 3JZIA 1KTVA 5BOVA 4DTIA 1HWYA 5BOHA 3TTXA 5GHZA 2O1WA 4WCFB 4OX9B 1W4BA 1T0BA 4YP6A 4MN5A 1KFEB 2X13A 3RUPA 1N2JA 3AUSA 1ZESA 4LX8A 5BO5A 5A92A 1OY1A 3OQ6A 3OVMA 3N6IA 4URYR 3DZCA 3WG9A 2RGCA 1UBEA 3RVRA 3VNQA 5FUVA 3D3WB 3LCJA 4ESHA 1J5EB 2ZBBA 3OKCA 4MDHA 3UTDA 3LCVB 4PXSA 1ADBA 1JILA 2YN2A 2Z8YA 3PPIA 1XGJA 5AQ9A 4O8ZA 1NW5A 3CUEC 5F5XA 5IW8A 5LQKA 1NVFA 2HHCA 1OXMA 3PGA1 2FOXA 4DIMA 3VZRA 1JDTA 1RWNA 2VUTA 3CMCO 3E15A 4DLSA 2A5DA 4D25A 4US1R 1Z4KA 2ODQA 4KAXA 5I9TA 3U7FB 4DMZA 1TJ3A 4RCZA 1XMPA 4B79A 3C2QA 5TLSA 4I3JA 1FJ2A 2EX4A 1PQPA 2IU0A 3VOLA 2FDCA 2J3KA 5FRDA 3UMYA 1LWNA 2HJVA 4KWTA 5HIJA 3OU7A 1Q1GA 3EEFA 2KLHA 3QU4A 3WLTA 3U1BA 5F2KA 5F98A 4U7JA 2XMSA 2R8BA 5DGHA 2X5XA 2XMPA 3WMXA 2DUMA 5IN5A 3B33A 2O8NA 2AHRA 2CCGA 3FPVA 3EF3A 1G9XA 4HDSA 1WVIA 3EFEA 4DVGA 4XB1A 3Q3EA 4YEDA 1R5JA 2B36A 3QQ5A 5M3BA 1EXMA 3MT9A 5J7EA 3R3XA 3C7TA 4HEA6 5L6MB 3ZQ5A 4B2IA 4BP1A 2BW0A 1KY2A 2BFBA 2QD2A 3GAAA 3ZIAD 5K0JA 1D0VA 3OIVA 1A4XA 2C42A 4I0WB 2KMLA 1JHZA 3QOWA 4OHFA 4BRZA 3NYIA 3A3NA 4N5DA 1I6MA 2D8AA 3NECA 4NNOA 1IUPA 1FRNA 3O2SB 1XYVA 5DCLA 1FTNA 3WISA 3ND8A 3REOA 3FNQA 5JH7F 3HB7A 4DZTA 5HYVA 1QRUA 2H54A 3BMCB 3NCKA 1QWSA 2WYVA 1FRVA 3CLUD 1RYYA 3HKDB 3MD0A 3X1JA 1XMSA 1QH1A 4R8SA 4BVKA 5HILA 4GGOA 3JQAD 5DW0A 5CXQA 4TKVA 3PSAA 5DTKA 4WZ4A 3GEMA 3L0IB 3WJAA 4AN4A 3NC4A 2CHFA 2ZJFA 4C22A 5EZYA 5FEGA 2QIOA 1CUZA 2AG0A 2W58A 2GBFA 2VDVE 4S12A 4DE5A 4INOA 4GKBA 2FOIA 4JDPA 3L1KA 1K6EA 1GDDA 2AEEA 4QAJA 3TWOA 2JASA 5CHEA 5EN4A 4YYZA 1A88A 2JGEA 2HWXA 3N75A 2I6SA 4GAEA 4Y2YA 4MCIA 4R1LA 3W1EA 2XQJA 5C35A 5A91A 2VOEA 2YHUA 3E7DA 5JJ5A 1U2QA 2ZXEA 1YLYA 4DB2A 3QLUA 1J22A 5K0ZA 3PUJA 4LTMA 3V00A 3OQIB 4GP7A 1RRGA 4IBRA 2CFRA 3FOWA 4LVOA 2KBEA 4P7JA 3SM9A 1F0PA 3DPUA 5A4KA 3W05A 3OD1A 1DP9A 3IF5A 3PHHA 1VJ0A 2G0AA 3SR4A 4LC0A 3EOIA 1ODFA 4L5YA 3DDCA 4B76A 4RHFA 1LB1B 3SF0A 3LCUA 1JHOA 1L8XA 2D54A 4Y6OA 4L8YA 5KHOC 1RI3A 4PS1A 3ADCA 1RSZA 3EPRA 4DBLE 1M2VA 3ILVA 1HOXA 2D3WA 4ERNA 5FAXA 4HQRA 1DVRA 4M98A 4EGFA 5BQXA 2HEIA 3KKQA 4ZOCA 5ECDA 1JBEA 2ZDHA 2WAEA 3Q0TA 4R1SA 4JI3B 4C6SA 3AGFA 3GVIA 1PFGA 1ONOA 1U9IC 2HF2A 2V6MA 1M2NA 4I1SA 4MQFA 2OC9A 3HI4A 4JV5B 4KAFA 2BGJA 1B93A 1SU4A 3TTTA 2ENWA 2ZUSA 5EE1A 4ZJ3A 4GLQA 2WSLA 2GTIA 4IKPA 5DSTA 3ZJ4A 4RS4A 3ILXA 4DYVA 1JALA 4M8LA 1DCKA 3QPCA 5CIWA 1X3LA 1OKKA 1MFPA 3OO1A 5CDSA 4M1QA 3NHFA 3MYYA 2ASEA 2W2LD 4BJ5A 4UHCA 4XTRA 2RH5A 4ENVA 4I3HA 1N8KA 1NE2A 3GARA 3ND5A 3TMAA 3PTEA 4E6XA 1B3RA 1HF3A 3V3TA 1EFUA 3MTAA 2QT0A 3ENWA 3GFRA 4ZO6A 5KYXB 1QU3A 1X70A 4MV1A 5KOYA 1E0JA 2JGAA 3R7WA 1EINA 3KCNA 3DYIA 3G79A 1NC1A 2QTNA 1BU5A 3N9IA 3RPEA 3UMGA 1BD3A 4LKOA 3ZCPA 3NALA 3SDSA 5LUAA 1RLIA 5AK5A 3WAKA 3A7DA 3ZS9A 5ALYA 4JI4B 4RTLA 1NBWB 1N7GA 1MWUA 2G2WA 1UZMA 1QHGA 2K2WA 3WYEA 2BKAA 5I3ZA 2FG6C 3WK9A 1UJNA 2J5KA 1VKJA 2VDKB 4NOJA 4QO8A 2CNKA 1T34A 2M32A 2NV0A 4ZZ1A 1RPNA 1M7GA 3DHNA 2J6HA 3WNBA 5GGXA 4BATA 2ADMA 2H85A 1LX6A 4H0NA 3C1UA 4GC9A 2PKQO 6REQA 3NM6B 3VX4A 1L4KA 2O1XA 3OBFA 2PZFA 1M6EX 1KAGA 3B1JA 4YBRA 1S4MA 2WLTA 3NJRA 1P2BA 1J21A 3FHLA 4Y2TA 4NYMR 1M0SA 2FN9A 1HBJA 3FR7A 5CB4F 4MLPA 2W3HA 1V1MA 2PLFA 2RARA 3GBSA 4LHEA 4U00A 2ZRAA 4UMDA 3H2IA 4W1SA 1QGDA 3B6KA 3R76A 1SBCA 4K28A 4MCAA 4UUOA 2X23A 3AR3A 2NU8B 3U48A 5ALLA 2JBHA 4N12A 4EZIA 1U8UA 4NCJA 5EPEA 3SYMA 2XHEA 4DLRA 1PRYA 3AT1A 4EYQA 1PP4A 1EGMB 1AURA 1AHPA 1NXVA 4MKIA 2O7NA 4KKXB 4OAOA 3RK4A 3RRXA 3V3RA 1E1CB 1ZXLA 2GXUA 3I45A 1AQJA 2ZUEA 5HDDA 2YVUA 4F3LB 1Y6JA 3LC0A 4JLDA 4AC9A 4FZ5A 4GS5A 4NK4A 4X60A 4GNRA 4U3JB 2V6FA 2XKBA 4NZOA 4PPYA 4QUKA 1JSCA 3ZWAA 4XIFA 4MHTA 5C4MA 1K97A 3R0XA 4B8ZA 3IEPA 4RNDB 4CLEA 3IOMA 2IY8A 2P3LA 2BM1A 3CLRC 1SQ6A 4IHJA 3PKJA 3BTUA 2BYTA 4C3QA 1YJAA 4AURA 4Y7DA 1GPJA 3DP7A 3MXSA 1N57A 2BEVB 5G4KA 3QXSA 1RMYA 4BJ3A 1ZGZA 1PZGA 1VZ2A 2QJWA 2ZP1A 3FKSA 3K1JA 2JFQA 4IYJA 5EY5B 4UDNA 2QQ0A 4IHAA 1RD4A 2C04A 5E6UB 3M6LA 1DTEA 5EINA 4PINA 4JLMA 3H3XA 2OD2A 3T1QA 5IJ0B 4HGZA 1E32A 2VJMA 1HDIA 3CZ5A 2X19A 3U26A 1GTG1 4YJHA 5D2CA 5JS1A 4I9FA 3P2JA 4DEYA 1R00A 1I7DA 3TX6A 5ICGA 3E9EA 4CZ2A 3S8EA 1DAPA 3OPYA 3PNKA 3WKCA 4L3OA 1J8VA 1D2MA 4R3JA 2I1WA 4Q93A 3Q11A 3AR8A 1O97D 3W7VA 4EEPA 1C14A 1Z38A 2QL5A 2R44A 3DC2A 3GN2A 4WZAB 4GBJA 1A5BB 5BN3B 4ZVPA 4I39A 1CF9A 5B7PA 4IG9A 4BBTA 5TNXA 3Q7TA 4PZ0A 3QTBA 2FFRA 4MA5A 3VTFA 5B64A 4CM4A 5E3HA 2ZRNA 4F5YA 2X14A 2QK4A 3W2FA 3PDIB 3GA5A 1HOTA 1GQRA 1XL1A 2MYNA 5J9FA 3S29A 1KAHA 4N9LA 4EXOA 2IU6A 3GLUA 4ZOLA 5KVCA 1IOUA 2DTXA 5AHKA 2WJHA 4PG5A 3S1AB 1L4NA 4CKWB 2W2QA 4RHUA 5F9HA 2CV0A 1ESUA 3GLVA 5L3SB 4MQFB 1W9MA 2DHDA 5B7QA 5GJVC 16PKA 2JI7A 4B48A 5K3EA 4Z53A 1V3QE 1GM5A 2KPOA 1H2RS 2BZ1A 3DOOA 1GFIA 3KVYA 5DGXA 4OP2A 3CNHA 3M1IA 5CCDA 2HXYA 2ZOIA 2YJ3A 2I9KA 3BL8A 3DFIA 1UC9A 1G3QA 1RYDA 2Y6UA 4YASA 5DXJA 2EFEB 4UHUA 5DX8A 4IDQA 4BNXA 3GLGA 4D26A 1P73A 3EVCA 2CVQA 5CXSA 1GCEA 1KZ4A 2DGDA 5K3BA 3S7PA 1CUCA 2B7CA 2CLMB 2JLAA 4EESA 3UAVA 5TIIA 3A6GA 2BSXA 2AZ4A 3BAFA 3MBKA 4QPNA 5K0CA 3CISA 3F7MA 4EGJA 4BGUA 3DOFA 2PBFA 2X2PA 3LF2A 2P40A 2ZI5A 3OLYA 3T3GA 4YRNA 4MUXA 2AXPA 4OLGA 2TMKA 2ZSDA 3QHPA 4QYTA 1TQ4A 2Y2QA 1OT9A 4EUVA 1N1EA 4WBNB 2GPYA 2K87A 3P0IA 4LXGA 2VJWA 3FZGA 2RH8A 1BHSA 1C0PA 2W6MA 1E2EA 1IHYA 1U5CA 2H9AA 2VTVA 2GPTA 2WA1A 6PFKA 1U4OA 2GWRA 3RC9A 5M7EA 1RKVA 1C80A 1XRSB 3H6KA 1J49A 2YOFA 4BYGA 4WW0A 2B1GA 2JGMA 4YACA 3ZJ5A 2R6R1 1G2QA 3VPHA 1I3LA 1EXVA 4ZO4A 1YVUA 4ZOAA 3G2PA 1TYCA 2XR0A 3MINB 1EK6A 1A9ZA 1XFDA 3OIUA 3MTDA 2OYSA 1KE1A 4ZU1X 3H9GA 3LUCA 2R84A 3U7EB 1LDGA 3RRBA 1I6WA 2Q4TA 4RFSB 3S7OA 2ACVA 2G8NA 3CF4G 3HGTA 1ZD5A 3KIPA 1L9XA 2ATXA 3OA2A 5AW5A 3W5SA 3CVYA 3F3KA 4K9QA 3SHOA 2HWUA 2P6NA 2R96A 4FOPA 3ZWWA 4D98A 5AW9A 5B57C 4RQ9A 3NIBA 1WKBA 2J3MA 1OFUA 5ALKA 5LXTB 1B42A 5BNFA 2ZREA 4WZ5A 3BQMB 3QLVC 3J80A 3HLKA 1Q2UA 2VDJA 3DE5X 3DONA 5KOIA 1DTWA 4HNHA 2PO5A 5IK2A 4GX0A 4N9KA 2Y0EA 5F9MA 4BZWA 3QVLA 5JD3A 1ICIA 1G5QA 3CXRA 1Q77A 5LYYA 1KDVA 2NT4A 4HY8A 2V7EA 4EPWA 3M82A 5K0SA 5DWVA 4CRWB 4R0QA 1T4MA 1YCGA 3EG5A 2I1VB 5TMBA 3WS2A 3AEQB 4ECAA 1DJLA 1QCZA 2YH2A 1W94A 2IKSA 2UZ1B 1A5SB 3NX4A 4QOSA 4CN8A 3OAAD 3OOEA 3HXMA 3ERCA 2EBHX 1GUFA 2C83A 2YX1A 4II3A 2XYPA 5E6SA 5B37A 4JJAA 1F5NA 4GI3A 1T0PA 1T35A 1NRJA 3HM2A 2WAXA 2R8EA 3IBTA 4OLHA 2PFKA 1LA2A 3KWMA 5CXXA 1GGJA 5ULLA 5CA1F 3KJQA 1BWRA 4BFTA 4GSYA 4I5IA 1ID8A 4BMSA 4CMHA 1VL6A 2GBGA 1MRSA 3GRVA 3S22A 1P9OA 4I5FA 3IQHX 4JI6B 3O8RA 1UKYA 4Y1FA 1W44A 3L49A 4DCCA 1YOBA 1KSHA 2QENA 1UOQA 1VL5A 1Z5ZA 3CITA 3AUYA 4LVUA 2OB1A 4TTPA 3ZLUA 1DLIA 1JFVA 3VZPA 4KQEA 1ZVKA 1E1RA 4WZAA 4XFKA 3QP6A 5EE9A 3QYPA 4YWZA 3DKKA 2IE8A 2FVXA 2P9YA 1T36B 1LK5A 2DOKA 2VDOB 2WD9A 3E61A 3ESCA 4GEGA 5DM2A 3PD0A 2YCLA 1TM1E 4Z4QA 2XCRB 1X7WA 3W2IA 1S02A 4DCPA 4D9IA 2AYYA 4JQCA 4DM3A 4GU5A 4AYTA 1EFKA 2AWNA 3I6ZA 4HZGA 2Z9CA 3VJKA 3ASVA 4FFPA 3KFLA 2KM1A 4BE9A 1LL5A 1BXZA 1P18A 5DOVA 1NWCA 2ZU6A 2FLVA 4NYIQ 4YX9A 4Y6RA 1FLNA 1J6UA 3WGUA 1T19A 2W90A 1C30A 3AVQA 4HRYA 1N9NA 3ROXA 1KYWA 1D1JA 3HA5A 4KXVA 3WS7A 4A0QA 1R1DA 3SOIA 1KHHA 1ZY2A 3GPLA 3KTFA 1QQ5A 4IX1A 3FCEA 1Y5IA 2QBYA 1ULAA 1LSXA 5H7XA 3Q8MA 3U31A 1AM4D 3G0DA 4RWZA 2JKRI 3I6QA 3ZK9A 3BRSA 4CQMB 2VT2A 4UFOA 1EUDB 1HZJA 1Q0UA 2NADA 2Y1DA 4S2KA 4DDYA 2ZIXB 4Q4HA 4RE5A 3S0JA 3TEMA 3UW3A 1BVUA 4LISA 3UE6A 1QU2A 2GO7A 4LRXC 3LK7A 2HGZA 3KDPA 3OPYI 3O8LA 4FP9A 4TTQA 1GGVA 1KVTA 3X2SA 4QX6A 5EZQA 1RYEA 1U80A 2CKDA 4AVYA 2HLHA 1P1HA 3FBTA 2C6WB 1H2ZA 3ZHCA 1FZTA 2DRWA 1NBME 4LCLA 2H4ZA 5J23A 4ZVMA 3OZEA 4A82A 4CF5A 3MR0A 1F4VA 4QOEA 2GA8A 2NZUG 1YR3A 2J6CA 1ZH8A 3DL7A 2IUSA 4ER6A 5F73A 4MS3B 4CIWA 3KL2A 2WGWA 2VP0A 2A1UA 1Y1KE 1Z22A 3CUEF 1OXBB 2NSYA 3NR2A 4MQ6A 3DFMA 3TTYA 4DQKA 4CIYA 1GO2A 1XMOB 3OPRA 1SKAA 3A1NA 3ZZNA 3PXAA 3ROQA 4QG7A 5I8ZA 721PA 2ZIGA 1Z36A 4P7BA 5EJ9A 3ZDDA 5IKOA 4PU0A 4QXOA 1NN3A 1WXDA 4V03A 4QYMA 4DXAA 1EH5A 1V9SA 3CS3A 2P3SA 3PFGA 2M6KA 3ZWOA 4GHIA 1NVWQ 2VR1A 3GMDA 4N5LA 3UT0A 5AVSA 1ERMA 1OBVA 4XI9A 2KSQA 3K0FA 3QX9A 1T2DA 2BLNA 4U7GA 5EXXA 3H8VA 1N3YA 2HCJB 3O4VA 3RWOA 2Q0SA 1UWKA 2JI6A 4IFIA 4LQCA 4LCJA 2DG2A 1I33A 3E22A 4MQ4A 1UC5B 4TL7A 3UF0A 2ZM6B 4OKPA 2OZKA 3PDHA 1E6WA 2Q50A 2M9MA 5DN6A 1ZRNA 1D7EA 1NSFA 4PSUA 2APJA 2W93A 1QCCA 1ECLA 2OP1A 3T4UA 1G5RA 1TRHA 4D5GA 3K2QA 4WF0A 2VSYA 4GKKB 5EVIA 1X1BA 1P17A 1KY3A 1SIUA 4XWYA 1U02A 2WAOA 4FCFA 4Y7PA 2GVZC 1KJIA 3KTAB 3LHFA 4A8TA 2V7BA 4BO9A 2H2GA 2J9YB 3ETGA 2ZUDA 3BH7A 1BHQ1 4AJEA 4GM4A 3DBLA 3TINA 2V9ZA 4LRYC 3W3AA 4KTTE 2AI3A 3O4IA 4O29A 1HQCA 3TX2A 1C0EA 3JQ7B 4ZYVA 3LKDA 2Z56A 1SB8A 2J48A 4QECA 4JLJA 1YLWA 5DNEA 3ZV4A 3RF6A 4QREA 2PHYA 5TF0A 1IHOA 3EQUA 1YHNA 3WGOA 3ASZA 1TF5A 2EIHA 1UEXC 1ZH6A 1CIJA 4BTLA 4Z3KA 3ZD6A 2GAIA 5G0SA 2ZRBA 1F51E 2A9QA 3VHRA 1QDUA 5J4EA 1EVIA 1YUBA 1OILA 3Q7IA 1FVFA 2P2YA 4Q7JB 3ZWMA 4L4SA 4XJTA 3BN3A 3HL9A 5D1NA 3UK0A 3KDAA 1H4QA 2H2AA 3USZA 1LDMA 1U3DA 2Q21A 3ORYA 3KZOA 1VPEA 4OFWA 4ZZ3A 1ML3A 3K1YA 3ZNNA 4E5SA 3E1SA 3SFZA 3IRVA 4LJ6A 1P4HA 2ZKIA 2D1YA 4CM5A 3TJRA 5CDYA 3WMRA 1UODA 3WQHA 1MNQA 5BNZA 5L8VA 3IT1A 4MWTA 3A3FA 2PD3A 1JPVA 2L1MA 3CKMA 3W2EA 2EJUA 1YU6A 4B45A 5C7IO 3DTKA 3MWGA 2R4UA 3AJ9A 1NZDA 1TCVA 3D7RA 3A0SA 4XCXA 1O6FA 4HQLA 3TLZA 3AR7A 4YRZA 1VDZA 4H31A 4IZ6A 2QV7A 2X0IA 4EZBA 3O7MA 4MVYA 4Q6BA 3TMKA 4BD0A 1MB3A 1ZXBA 1IJBA 3EHDA 3QMPA 3TZLA 1X3SA 3NS7A 4R31A 3PFCA 1C1HA 1DMSA 3BFVA 3OPYB 4GVLA 2QV0A 2Z6CA 1JLMA 1RBQA 1T0IA 1XJ0A 2R5NA 5DM60 1G8SA 3K0CC 4L15A 3GDFA 2Y77A 3K9WA 4GPAA 4TKZA 3N6RA 4N3AA 2A8YA 4QY6A 3R8CA 3RRYA 4KVZA 4YMUA 2G4LA 3AUJB 3RTAA 4Z54A 1WU7A 3WWCA 3MXTA 4IIJF 4PRLA 3VU1A 3PTAA 1WB4A 3O4JA 1T4GA 5B6IA 5HS4A 3R5XA 5DM1A 4LDZA 1SCUA 1I8TA 4OXYA 4A2WA 1J99A 3BD6A 5EOVA 2JHEA 1TS0A 3LT2A 4HQ0A 5JMOA 4OJMX 4LFCB 3RSGA 1DKLA 1XA1A 1N5KA 1E1DA 3K09A 3LRTA 2R85A 4QU8A 2MSEB 2D5LA 4EB8A 2XF3A 1EEHA 2H4WA 2BFWA 3URKA 2LP4Y 4WINA 4N6NA 2QRZA 3S81A 4F71A 1PR0A 4M3NA 4R2LA 2XYHA 1Y6ZA 1NM5C 2NQ8A 3B7WA 3GCDA 4V0RA 3DZJA 2ZBQA 3BILA 3ISTA 4U2KA 3SHWA 1FP4B 1L5VA 2WJZB 5JATA 5EVLA 5LNK1 4MSUA 2DT5A 5HS6A 4RY8A 2DBYA 3L7DA 2ZYUX 1RQGA 3B85A 3BOSA 5AI0A 3EF1A 3GVHA 4MQMA 5ALEA 1E2FA 5IM5A 2YJNA 1I3CA 1O0SA 1Z5PA 2EP8A 2DH6A 3FNFA 3QTLA 3ZIAA 4BV8A 1WDKA 1DXQA 4A15A 4KDFA 4B33A 1M8FA 5FF9A 1SG9A 5HQTA 1IVSA 1JKIA 1CUJA 4JS0A 5F82A 3KO6A 2O7QA 3KXPA 5JJCA 4BO5A 3BK7A 1N2CB 4PX5A 1YFKA 2OBBA 4NBKA 1O4VA 4X7BA 5GV8A 5BT9A 4DJ5X 5KO2A 5E8RA 1OLUB 3IMCA 1GP2A 2BGUA 1F2UA 2DFLA 1S1YA 3MTBA 4BIMA 1E6MA 4O02B 1L7OA 2ZXUA 1AS3A 5FAOA 3ICCA 1T8YA 1MO6A 1G7RA 3IOBA 4F1KA 1G3MA 1K7YA 1VIDA 3BMQB 3GBVA 3OH8A 4IMJB 1LKZA 3IX8A 3MJFA 4HY3A 4RJKA 5FLXA 1OI3A 1QUEA 2P4HX 4DMGA 4WJLA 1G64A 4NONA 1I0LA 1MMFB 1J20A 4FT4A 1KEPA 3AR4A 5D5HA 5DN9A 3T1RA 5DV9A 2PA3A 4B2PA 1IN7A 1CB0A 3TQCA 5G40A 2QN2A 5J2TB 1KMNA 1AWIA 1CSEE 1CUIA 2H9YA 4ISCA 3FR8A 2CE7A 5GJWC 5I7FA 1X8XA 4RX3A 1XPBA 1A50B 3CSUA 3T12B 3EGOA 4EHFA 5I9NA 2BD0A 3I8OA 2H10A 3V5MA