4ARZB

The crystal structure of gtr1p-gtr2p complexed with gtp-gdp
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
321
structure length
304
Chain Sequence
ATDSKAMVLLMGVRRCGKSSICKVVFHNMQPLDTLYLESTSNPSLEHFSTLIDLAVMELPGQLNYFEPSYDSERLFKSVGALVYVIDSQDEYINAITNLAMIIEYAYKVNPSINIEVLIHKVDGLSEDFKVDAQRDIMQRTGEELLELGLDGVQVSFYLTSIFDHSIYEAFSRIVQKLIPELSFLENMLDNLIQHSKIEKAFLFDVNSKIYVSTDSNPVDIQMYEVCSEFIDVTIDLFDLYKAPRNELQNVSQLANGVIIYLRQMIRGLALVAIIRPNGTDMESCLTVADYNIDIFKKGLEDIW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTP-BINDING PROTEIN GTR1
publication title Crystal Structure of the Gtr1Pgtp-Gtr2Pgdp Complex Reveals Large Structural Rearrangements Triggered by GTP-to-Gdp Conversion
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase
total genus 98
structure length 304
sequence length 321
ec nomenclature
pdb deposition date 2012-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF04670 Gtr1_RagA Gtr1/RagA G protein conserved region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.190 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4arzB02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4arzB01
1T91A 1XU4A 2E1RA 4QNMA 1NBME 1MT0A 4V0MA 5H68A 5C2JB 1WCV1 2R62A 1UBGA 2WSSD 4XOIA 4CYMA 4RD6A 3AKEA 3T61A 4DEXA 4QKQA 2E9SA 1I4TD 2XTZA 3LQRA 4TLBA 4CZ2A 4DC9A 4JVLA 1EFTA 2CHQA 2QU8A 2RKOA 3IBGA 2O8EA 2VQSA 4URZR 4AC9A 1ZM2A 1LS6A 3H1TA 3HR7A 4JVSB 4RZ2A 2X2EA 3UKDA 2GCOA 621PA 3C5HA 2DWOA 1HYQA 1S4QA 1DAMA 4RZXA 5EE9A 4MDFA 4Q03A 3CM0A 2LWIA 2VO1A 1Q22A 4XD7D 1XEXA 1JR3A 2GF9A 3LX5A 2ZQ5A 1RRCA 4QJ5A 2ZUDA 1Z6YA 2FFHA 3EIHA 4KFSA 3TVTA 3GLGB 3SJBA 2R8RA 1AJEA 5D3MA 4M22A 2IS6A 2YC2C 4PO1A 1XTIA 5BYKA 4XTRA 1E94E 2GF0A 3RANA 2GCPA 4PZYA 1OXUA 2Z6VA 3BS4A 1CJMA 1SXJD 4LZZA 2H92A 3UMSA 3LDAA 3QQ5A 3MCAA 1NVWQ 4QNRA 2X77A 3IPXA 2YC4C 2HJGA 1GITA 2A9KA 3BERA 4Q21A 4ZKEA 4TL6A 2EWVA 2PCLA 3NWJA 4DBLC 2W0MA 4WXPA 3X1YA 3NBXX 2IXEA 3SOPA 2PJRA 3N2EA 3GLHE 4HAZA 1OXTA 1SVMA 4JLAA 4PC3A 3QPWA 2QENA 4K8OA 4WIAA 5E4FA 1FTSA 4MDEA 4UXIA 2J7KA 4B48A 5JLJA 1SXJB 2H1LA 2YOGA 4XWOA 4A36A 1Z29A 2IXGA 2WJGA 4EKDA 3OE7D 4L5BA 1SKYE 1E4YA 4V02A 4BFZA 1B23P 3GJ8A 5J4YA 4DLWA 4M1SA 4OBEA 4MKIA 4LV8B 1VDZA 2GZDA 2ZU6A 5DHAA 3ICQB 2W2TA 2UZIR 1Z0FA 4B2LA 2VHQA 2KB0A 1FUUA 3FDIA 3ZVRA 3ASZA 1Z07A 3KKQA 4TMXA 5LB4A 1NSFA 4AKGA 1L8QA 1QHIA 2W0SA 1JJVA 2B92A 5KU1A 3LWNA 5J47A 2ZJZA 3AUYA 1K8RA 1RPZA 4TQUS 1WBDA 4R2IA 4V0ME 3TVDA 2XGJA 4L15A 3IKJA 2ERYA 4ZKDA 3FOZA 4QXAA 1UAAA 3MD0A 2C5LA 5DGXA 4ZCMA 4GZLA 1E2FA 4HB0A 4F92B 3GPLA 2F55A 3OAAD 5FL7D 5J4LA 2P0EA 4TYYA 3QF7A 3WNDA 2R65A 3OEHA 1VECA 3AP1A 4LYHA 4DT1A 1ZD9A 2F3RA 4Q4JA 3JZMA 3OFND 3I61A 3ZZ0A 4B76A 4KYIB 5A5GA 1YE8A 1TF2A 4UNQA 3KJHA 2Z4RA 4OK6A 2J59A 5CITA 1AGPA 2IL1A 2QE7D 4JLNA 4BLTA 2IA5A 4M1WA 3HU3A 2WHXA 3L8YA 4OI2A 1JR3E 3M4YA 1JEDA 1QRAA 1GTVA 4B35A 2PEZA 1RRGA 1U99A 1F5NA 2VEDA 3NEYA 4IHQA 1RJ9A 3H2YA 1VG9B 1VYUA 1FW6A 3GLIB 1OIXA 3K0AA 1QDEA 3SJZA 2QTFA 2DFNA 5KNCA 2XNDA 3THXB 3DO6A 3RWMB 1EWRA 2ZJOA 3OEEA 3AVUA 3D6TB 3QG1A 2J5XA 5E3HA 3KFVA 2OFXA 3HPRA 3HDTA 3BBPA 2O8FB 4MGKR 3LVQE 4OHVA 1G20E 4MRVA 1EK0A 4HEJA 3Q72A 4NPHA 1EFUA 3LW8A 1YZGA 4Q66C 1XCGB 1COWD 3LA6A 5KNDA 2GETA 1DO2A 1FFHA 3UWOA 3V4FA 4XJXA 3QXHA 1TADA 4BASA 2QPTA 2JLVA 1PVOA 1ZU4A 2R6FA 4HUQB 1HURA 1XXHB 1IN7A 1OHHD 3RS7A 4A4DA 1H8ED 4PQRA 1QHGA 2DFTA 2GILA 2JDID 1QF9A 4LJ8A 4A8JB 1V5WA 4HB2A 5AWFC 4KJZA 5BWMA 4RZ3A 3DOEA 3AEZA 4V03A 2R44A 5EP4A 1KGDA 3PV0A 4DIDA 1NVUQ 4LI0A 1H8HA 4YMVA 2CL7X 1T3HA 1X3SA 2FFQA 4ASUD 1ZUNB 3NDPA 1TX4B 4Q1CA 2B7BA 4LSGA 4ZDWA 3TW4A 1D9XA 1XJCA 3OIVA 5HE8A 1CIPA 1IM2A 1KO5A 3AH8A 3B13B 3L43A 4M0LA 3DPUA 2ZXUA 4DZZA 1NSTA 1AA9A 3KB2A 5IK2A 3ZQJA 2QP4A 4LYFA 3RRMA 3U6BA 3IHLA 4UNNA 5FPTA 3CF2A 1T4GA 2HLDD 2IYLD 4OQXA 3LH5A 4B74A 3E1SA 1DAIA 4TQ9A 1R4AA 4DJTA 5FH9A 5FOWA 5FPKA 5FUYA 3LXXA 3TSZA 3I72A 3AVXA 4OHXA 3HU1A 2VTKA 1E0AA 2RGDA 2IYSA 1KKLA 5AUQA 1XBTA 2O0HA 1SVWA 4BGDA 2EFDB 2CK3D 2W00A 1K5GA 4R7ZA 5LBIA 2ZTSA 1X8LA 1J8YF 2BHRA 2RB4A 3A37A 2ZR7A 1NVVR 1ODFA 4B43A 2J0SA 3AGPA 4XSGA 3B60A 3IBYA 3U3MA 4C0SA 2WPDA 5TY0A 3K8YA 1OXSC 4QFMA 2XZPA 2VP6A 1VG0B 2HYDA 1L4YA 2ZETA 4B71A 2V54A 3MRSA 3A8TA 1Q0UA 4KSBA 2FSGA 4IKEA 2WIBA 3EC1A 2C95A 2QMEA 4FMDF 2JEOA 4Z8YA 4B6EA 3K70D 3EAQA 3BH6A 1E2DA 1JALA 3PUYA 4C0JA 4D4JA 5JHHB 2O8DA 1LTQA 3K9NA 5E95A 2QM8A 2ZI9A 2A5YB 4DCSA 1GSIA 2D4HA 3GJ6A 1Z83A 3S1AB 4P4SB 4YDHB 2J46A 1NRJB 2QY9A 4PX9A 4KLZA 1A7JA 2VBCA 2GJSA 2GCNA 3IO3A 4BLOA 4E09A 1F60A 1OH6A 2QBYB 2IT1A 1M7BA 2HV8A 3HWSA 4R2HA 2JJ1A 2C2HA 3K70B 4V0NA 2REXB 4DB2A 4HLUA 2QI9C 1Q3HA 5AJXA 1E2EA 4DDUA 3K0CA 4GRAA 4NYIQ 2ZI7A 1GRNA 2RGXA 2JLUA 2JJ2D 1HY3A 4GP7A 4MRNA 3WYGA 4RVCA 5CB6A 4Q4HB 2Q6TA 4BLSA 3MSXA 3N70A 4IDPA 4GFDA 3T12A 2AKYA 4HSEA 3FGNA 1TF5A 3CB4A 3SDZA 4ABYA 4OK5A 2JGNA 1KY3A 2WBLC 3BFKA 4YONB 1QG2A 3SJAA 2QPOA 1TF7A 3GJXC 4CEHA 3RLFA 2QT0A 5CJPA 2IYVA 4IOJA 1BOFA 1NLYA 3CPJB 3BC1A 3B7GA 3T5DA 3PR1A 4PAQA 3A1UA 2GK7A 4R71A 4YQFA 2F1HA 2QORA 2F1IA 4US2R 3CBQA 4DXAA 1EG7A 3PUXA 4G0NA 1PLKA 2FGJA 4ZDIA 4Q47A 1CR2A 2ZRNA 2MMCA 4A0FA 1Z2AA 1GP2A 2CDNA 1UKYA 4QHTA 5L3QB 4M2LA 4TLEA 3GJ4A 1NIJA 2OEPA 2CNWD 1I4LD 2ZPTX 1E9BA 3QENA 2VP5A 4FI3C 4WA7A 5G40A 3U7EB 2V4ZA 1BYIA 1H65A 2P3SA 1NKSA 3LAWA 4PC2A 2ZEJA 4HZUA 1T0JB 4I99A 3OHMA 4AKEA 3U44A 2OHFA 1E2JA 5JHGB 2WWGA 5JS7A 5GJVC 2R6CA 3WHLA 3FWYA 5IRCD 2ZUCA 121PA 2ZITA 2ZJYA 2NIPA 4FMBB 3NBFA 3PVSA 3K9HA 1XEFA 1JECA 2HJVA 2K5UA 3JVUA 4PXAA 2QT1A 2F6RA 4TLCA 2GJ9A 1OSNA 1NBMD 4YMWA 1KK1A 4B47A 5JBQA 1G8YA 4J0QA 3KZ1E 3M6AA 3R20A 2OZEA 2ZRKA 1SVSA 4LHYA 1P5ZB 4Q1EA 2JLRA 5JWRA 1Q1EA 1W44A 1IBRA 2GWHA 3WP0A 3FKQA 4JL5A 1AQYA 4EFMA 5B58C 1N6LA 4EFNA 1KIMA 1VPLA 5EZ6B 2BCJQ 4TLAA 5J4VA 1N6RA 1Z63A 2BV3A 5JI3E 4V0KA 1YR8A 5FPSA 5J5CA 2GEUA 1W46A 3H0KA 3VHXA 3W6OA 1MABB 4MYUA 2OXRA 1DS6A 3SR0A 4QHSA 4FIDA 4H1VA 3R8FA 3ZD6A 1P9WA 5EE0A 2Q9AA 4A2WA 2ZU0C 3IPYA 2MSEB 3A4NA 1HEIA 4PO9A 1EGAA 4Q4LA 3RYTC 1EESA 2CL6X 3L8ZA 2XITA 3UG6A 5AUPB 3FMIA 221PA 2A5JA 2ZUBA 4HAXA 1US8A 1IN8A 1II8A 1PUJA 4M1OA 2KBEA 1BIFA 4ITRC 4WZ6A 1W0JA 2ZRDA 3I5YA 1KI7A 1KJZA 4EFLA 5CB8A 1ZVQA 3K0SA 3QF4B 4JBWA 3TSOA 1BYUA 2CE2X 2WJYA 5FFMA 3V9PA 2OO7A 2XOKD 4PAMA 4GL2A 3VR5A 3SFVA 5KNBA 2ZR0A 3GMTA 4ARZA 3NVAA 2ANCA 1KJWA 3SEAA 2W6ID 1F48A 4ZIRB 2J0UA 4TMWA 3AVQA 2VSFA 2XSZA 3CUEF 1P7CA 2ANBA 2ZSFA 4NYJQ 3WMGA 1KI1A 4CVNA 4HYYA 4HLUC 5BN3A 4MKHA 1Q44A 4NDZA 1N6HA 2OT3B 4YC7A 1OH5A 2A5GA 3K0CC 3R9WA 1ZM3A 4BUJA 3AF0A 5CDFA 3EX7C 2CLSA 3TMKA 1JR6A 4JLOA 1E2IA 3K0FA 2YYZA 2IF0A 3AV0B 2ZM5A 1FMLA 3GLHB 4JVNA 1VCMA 3NHAA 2CLDX 3QKUA 5FTNA 3L2OB 3FKSD 4PC1A 1NG9A 2EFEB 1KDPA 3EPKA 1G18A 2QRNA 5FOVA 5HCIA 5AUOB 3ICEA 1RFLA 1E1QA 3O8CA 3Q8XB 2IX3A 1ZM4A 5FUXA 4GOJA 1KHTA 1E2LA 1UADA 1SKYB 1X86B 3CZPA 4ACBA 4ZI2A 1YVDA 3I62A 3QIAA 2ZR9A 1F3OA 3I3SR 4XVRA 3D7MA 2GJKA 3IIJA 4W5HA 3WRYC 2FA9A 2FPKA 1II9A 2AXNA 3VU9A 1XD9A 2ZRAA 4CEIB 1VCIA 1QVRA 1N5KA 5GVSA 2AWNA 4PO8A 1XJQA 2XXAB 1BMFA 4PAOA 4UNSA 1CRPA 1T8TA 5EUMA 4A92A 3B6EA 1UDXA 1D9ZA 2RCNA 2QMOA 2WVJA 2OBLA 2D3WA 2B21A 1EFRA 2W6JA 1IHUA 4RKEA 4MUBA 2IK8A 3GFTA 2FE4A 2JIZA 2V1XA 5FUWA 2JLQA 2A78A 2UKDA 1FZQA 1XP8A 1P9RA 1GRRA 3AP3A 2HF9A 3ZIAA 5EZ5A 4TTQA 3O8BA 2ZRHA 3A1TA 1WDTA 5LPNA 2O8EB 2BEJA 3GFOA 3W90A 4CRWB 1VMAA 1P3JA 1NIPA 1NP6A 2GCOB 4C4PA 1E6CA 3BB1A 3B82A 5FI0B 1Q12A 1TMKA 2IWRA 5EUQB 4MYTA 1E2KA 1XEXB 2D06A 5CK5A 3KUCA 2H7VA 4M9XA 5B2ZA 2VP2A 2MSDB 5D3MB 2J1LA 4WOPA 2QROA 2QN6A 4JBYA 2P6RA 1R0WA 3PG5A 2Z4SA 1UEJA 2P6NA 3W9YA 2FOLA 2ZAOA 4BRUA 4A9AA 4L9WA 2IS1A 2QEQA 5IDVA 2BJVA 4D26A 2X2FA 2YWFA 1AKEA 2PZGA 5KO2A 4AKHA 1YRAA 2C03A 5JECA 3PENA 4JLKA 3BB4A 4M1TA 1OIWA 2CJWA 1NI3A 2VP4A 3Q5DA 2O5VA 1E79A 1Z28A 1OFHA 3EA5A 4PTLA 2J7PA 4IOKA 2PLFA 3CF0A 1LY1A 3NXSA 1WP9A 1L4UA 2ZSEA 2NO1A 1IONA 4DUGA 4IOLA 1WB9A 3KKNA 3RNLA 4D6PA 2ATVA 2IEZA 4JL6A 1BO6A 1Q1BA 4GPTA 4M9ZA 3NKVA 5KSYA 4TSFA 4RFVA 1G7RA 1T9HA 5HZHA 4URUR 1VG8A 5BN4A 4RD1A 3K0EA 3TIFA 3VX3A 1QHYA 2J9RA 1W36C 3MFYA 1YR9A 4OL0A 3K53A 1KNQA 4Q9KA 3OEHD 5TDHA 4PHFA 5KDOA 2EFCB 4PC7A 1YZKA 4YDSA 2O0JA 4HAYA 1T6NA 2GAAA 1NN1A 1U2RA 4Q1BA 3PJRA 2A2ZA 3DVLA 4URXR 2ZRFA 1WXQA 2GZAA 4HLDA 4JT4A 1NMYA 4Y0VA 2GKSA 1AK2A 1OB5A 2QL6A 3EIQA 1KZGB 2OESA 1E9SA 3LX8A 4LJ5A 5FBVB 3JZAA 4RFSA 1QG4A 4DT1B 4QBFA 4MGZR 2H18A 1W4CA 3E5HA 4Q4JB 2BBSA 2DY1A 3A4MA 5AK0A 3AVVA 3GLFE 2AHOA 1XD2A 3U3OA 1OFIA 3CX7A 1E0SA 3QVUA 4LC1A 4PSVA 1UEIA 2PMDA 1HQCA 1CR4A 2PMKA 2ZJ2A 4XSHA 4Z54A 3KJIA 1WE2A 2ZE8A 1UBFA 3ZS9A 3ADCA 2QMHA 2YNMA 2XNDD 3IIMA 2ZS9A 1W48A 4NYJR 3AP2A 4GOKA 2LCFA 2E87A 4EPTA 2UZ3A 3BGWA 1Q21A 2IWHA 3CWZA 4GP6A 4MYCA 4JKYA 1XDBA 4QBHA 1XB2A 3O8DA 3SJCA 1RJ9B 2CVHA 4Q00A 4MRRA 1Q1QA 2V6IA 4DEYA 1CBUA 2DFLA 2PH1A 3W6NA 2XZLA 1N2CE 2ZRMA 3QEOA 1KI6A 4W5WA 4PANA 3K0AB 2OLJA 4PHTA 4NMMA 4KHZA 3PEUA 4C9BA 3AVPA 4M1MA 5CIQA 1M7HA 1JJ7A 3UIEA 2GVZC 4G01B 4M1KA 4C7OA 1M34E 1XPUA 4DDTA 1A82A 3FFAA 3LFUA 1YJ5A 4KSCA 421PA 5LD2C 3EPLA 1KO4A 2GDJA 4DWJA 1DADA 1NVVQ 1W47A 3G82C 4OYHA 3AM1A 4HI0E 2OCPA 2QTHA 4Y0AA 1XZQA 2FN4A 2NTYC 2R6GA 3HP1A 1IOZA 2BM0A 3ECCA 5EXTA 2JA1A 1GVNB 5BYJA 5GJCA 5L3RA 2I3BA 1HE8B 2FSHA 1E4VA 1H8HD 5C4GB 4Q7MB 2EFGA 1R6BX 4IXMA 1LV7A 3VKGA 4CT5A 1Q57A 4MRSA 1KMHA 1G5RA 4NL4H 4JIMA 2O0KA 2GA8A 2HXSA 4L16A 4YXWA 2MSCB 4AD8A 5HPYB 1R5NA 1YQTA 4TMTA 5EXSA 3U61B 3ZD7A 5F2EA 3W8RA 1R10A 3RSOA 3DHWC 4US1R 5IK2D 4H1UA 4M9QA 2IYYA 2RGNA 1MKYA 4A0GA 3Q7PA 2Z83A 1KO7A 1N0WA 1Z6XA 4BFSA 4E22A 4DSUA 1UM8A 1XZPA 4D4LA 1G4AE 4DLZA 2YWGA 5FL3A 1G7TA 1ZAKA 3QY0A 4C0KA 3A1WA 2XTNA 3DM9B 4GI7A 4K81B 1KSGA 2FEMA 3FHOA 3HPQA 4PZZA 4Q1DA 4G5RA 2FPMA 4JJZA 5HTKA 1U8AA 4NE2A 2O52A 2VLIA 4KYUA 4NKRA 1G8GA 1YU9A 1N6OA 4DHEA 1GM5A 5G3YA 1EX7A 1VTKA 1DPFA 2D2FA 3GD7A 3LLUA 3EASA 2WPDD 5SZHB 3CR7A 1WBBA 4TT3A 5DIFA 3X1XA 1G291 2Y8EA 1KI8A 3WBKA 2V8OA 5HKKA 2UVQA 5JMTA 3U7GA 5DNYB 2BBOA 4TQAA 2ZI4A 3QXXA 4TTRA 1BH2A 1HV8A 2QMUA 2ZRIA 1G3IA 4O2RA 5JJKA 1GDDA 1D6JA 3DEFA 4KVGA 1TU4A 5IF9A 1C9KA 2BEKA 3TBKA 3JVVA 1GNQA 3TK1A 3QSYA 1ONBA 4GT1A 2FEOA 4HLQB 4NU0A 5EP1A 1GNPA 4EQ6A 5JZVA 4Q7LA 2VHJA 4A2QA 4MGIR 4IFBA 2QPAA 1XNJA 4OQLA 3VFDA 1AN0A 2GRJA 2QA5A 1A5TA 1Q3TA 3KKPA 3A4LA 2FNAA 1EX6A 2JJ1D 4ZCIA 2FH5B 1M7GA 2EYUA 3FHTA 2YWEA 1A4RA 1ZC4A 2O8DB 1E99A 3SQWA 4IEIA 1PUIA 3RABA 3KB1A 3I1FA 4BFWA 2JLWA 1GZSA 2QSZA 2BC9A 2H16A 4O0MA 1XCPA 3EXAA 4AYWA 4QM7A 4Q7JB 2J0VA 4KITB 4EPXA 2WM9B 1D2MA 4US0R 5IHPA 2FG5A 1E9DA 2FSIA 3AKDA 3BOSA 3BE4A 3D31A 1W0KD 1RE0A 3GJ7A 4X8MA 2I1VB 4B3XA 5L3SA 3AF3A 3ONWA 1Q1ZA 3FPAA 3DDCA 4MA4A 2YVUA 1N5IA 4PPQA 3TW8B 3QOFA 2H5EA 4KI0A 4UKDA 3VR4A 5GJBA 2QP9X 3REFA 1KJYA 2WMOB 4RD4A 2AL7A 2IHYA 2F3TA 2ZRLA 3GEEA 1PLLA 2ZYUX 3BAFA 1IQPA 1ETUA 2NO7A 2QUZA 3IEUA 2IXFA 4XD7A 1GFIA 1RRFA 1B0UA 4MH0R 2O8BB 4I1VA 5AR1A 2JLSA 3TNFA 3RHFA 3BXZA 2P5TB 4CEHB 1MO6A 1XTSA 2ASEA 3C41J 3DOFA 4TWZA 1UJ2A 3MJRA 5A0FA 2MMGA 2ORWA 2AX4A 4O2LA 1YKSA 4EPWA 4TZ6A 2HDNB 2REBA 4ACAA 1RYHA 1U98A 4B75A 3ASYA 3I8XA 4M9SA 4PQYA 3HU2A 4D80A 3Q85A 4EIWA 4M4SA 1VCNA 2ZYTX 4II7A 3FMPB 1Y3AA 2PBRA 5L3VA 3OF5A 1UKVY 3A1VA 4B2PA 4LHWA 4ZO4A 5AJZA 1G8HA 2NZJA 1UBCA 1ZUHA 2OSBA 3LO5A 4P3YA 3QI2A 3U7FB 5A4JA 4FMCB 5KDLA 1F6BA 4LHXA 2DHRA 2NPIA 1NG1A 4HATA 4KBGA 1F2UA 4HZUB 1JEEA 2ODWA 4MYHA 3U44B 3RC8A 1M1YE 1OLOA 4NCJA 2RGNC 2IYWA 4POAA 3BFVA 2AK3A 2J3EA 1W49A 3UMFA 2IBMA 1XMJA 4LHVA 1KK0A 5B30A 4CEJA 1FNMA 1LF5A 3BD9A 4B2IA 1CEEA 1AGRA 4A0HA 3VKHA 2IYXA 1HTWA 3FTQA 3B1XA 3K9GA 3GP8A 1MR3F 5TMPA 4B3FX 3QKRA 5JEDA 2WJIA 1KZ7B 2XB4A 4I1SA 3UPUA 4M1YA 4KBFA 2ZSBA 1ESMA 2ECKA 4FINA 4DDWA 1Z08A 4NBSA 2GBLA 5CYOA 2QSYA 1Z8FA 2WAXA 4UXJA 4V0OA 1NJFA 1U8ZA 4QBGB 2NG1A 4AKIA 5FBWB 3U60B 1IN6A 4B32A 1MH1A 1W0JD 3MWKA 4HDCA 4P4UA 3CNLA 1XTKA 2PZEA 3OFNA 3ZZUA 1KO1A 1NN0A 2P65A 5EP2A 2ZI6A 3W6PA 3U6KA 3E70C 1ZM9A 2ERXA 3OZXA 1HH4A 4IDOA 3SNHA 1T5LA 2Q3FA 3OIWA 1KOFA 3ZH9B 1E9AA 2OV2A 2SHKA 4KLNA 1XCMA 4BPBA 1W36D 1US8B 4E07A 4ESVA 4B73A 1II8B 2OCYC 1JQLB 1XFAA 4BEBA 3THYA 4L9SA 4BZPA 3DKPA 1TAGA 2F1RA 2XSZD 4WZAE 4EJSA 3EA0A 3K09C 4QM6A 4KVAA 5JJIA 2FSFA 4LOAA 3ZVMA 1XJ0A 2QQEA 2WWXA 3CX6A 3M0EA 4MITA 2PT7A 3PQCA 1TL7C 4OQMA 1FP6A 4PSKA 5EQTA 1R7RA 2AN9A 1N5JA 3T34A 2GVDC 1ZCAA 3W5JA 2YWHA 4IEEA 2YJTD 4HAWA 2GXSA 4Z51A 1PV4A 1W36B 2VF7A 2Z43A 3O47A 1PJRA 4ARZB 4UNPA 3WXMA 5M04A 1OH8A 3UATA 3P4XA 4GMXA 4Q9HA 2J0UB 3AQ4A 3KTAB 3VHLB 3KQLA 1ZM7A 4LYAA 1CULC 4LBYA 1ZYUA 4D0GA 3PUWA 1OJLA 2PJZA 1NLZA 3CNOA 3P32A 4UJ5A 1E1QD 4W5JA 1Z0JA 1COWA 3LNCA 1OIVA 3P1JA 2ZRJA 1QHHA 3IEVA 1XF9A 3A36A 4OQNA 3SC3A 1NY5A 1NNEA 2BM1A 2B8WA 2ORVA 1XTRA 3K0FB 1E1RA 3CX8A 2WOOA 1DOAA 4QRHA 3QBVA 3PUZA 3W3AA 1SHZA 4FW9A 4GMDA 1KK2A 3LBNA 1OHHA 1E32A 4JLBA 5EE3A 4X8HA 5DN6A 4DLRA 4FCVA 1P4SA 1LVGA 2N1BA 5K8TA 1BMFD 1KO8A 4NZYA 5JWHA 1R5OA 2I1QA 2YOFA 2ZRPA 3DZ8A 4KCGA 4PQFA 5KTYA 1M8PA 1AQUA 4F93B 2DB3A 2WAYA 2HUPA 2CCKA 2XEXA 1XMVA 4JSTA 1EFRD 2IUUA 3ZGXA 4ESHA 3L0SA 1E2NA 1ESNA 1G21E 3VU9B 4ASUA 1RYFA 4M21A 2ZJBA 1AS2A 3C16C 5KYKA 2NO9A 5F98A 4RD0A 2IUTA 3T5GA 2C96A 5H1YA 2OE2A 3QPVA 4XVQA 3SHFA 3MWJA 4ZI3A 3CRQA 1E3MA 2ZROA 4NYMR 4PFSA 4P0TA 2B6HA 1NN3A 2FX3A 4LRWA 4A6PA 4EAQA 5JI2E 3OIUA 1L7VC 4URYR 2RMKA 4UNRA 1GRQA 3EZ9A 1XD8A 4WBSA 1TUEA 1RZ3A 4LV5B 3R9IA 3QKTA 2LKCA 5LD2B 5B64A 3EIEA 2BOVA 2YV5A 3L0PA 2QQ0A 5KHOC 1DO0A 5KPDA 2CL0X 3IILA 3WHKA 2CK3A 2W58A 3GLFB 3CF6R 2VHUA 2CEAA 3AF2A 3X1DA 1N5LA 1RIFA 3AF1A 1X8JA 1Q20A 5CIWA 4QGFA 1EFHA 4HUTA 1W1WA 2BJWA 2ZSDA 3K9LA 4KFRA 3WRXC 2IYUA 4LJ7A 4MKGA 1E2MA 4DKXA 1IY2A 2IYQA 2GBLC 2GHIA 2YZ2A 4LJ4A 1FQJA 1W5SA 3C15C 4MGYR 5JSZA 3D8BA 4Z1MD 1E79D 2ZI5A 3GJ5A 2OUKA 3BIFA 4NP6A 2PZFA 5CM8B 2AKAB 2D62A 2J7PD 1ANKA 1FNNA 2G0TA 4IW3B 2A7QA 2WMNB 1UPTA 4ON9A 4DCNA 1UDWA 3TLXA 3GCGA 3KFXA 4N1AA 3T1QA 2G77B 1VYTA 2ZRGA 4DUGD 1P61B 1Z2CA 3BH0A 4TYNA 3F0TA 1JBKA 2CVFA 4EPRA 4Q9IA 5FR1A 3EG5A 2VP9A 2CCGA 4OI1A 4YLGA 1E0KA 2VHTA 1GWNA 2GJAA 1S1MA 2CJWB 3QJYA 4AIIA 1J8MF 2WWFA 4IVPA 4WAUA 4AYXA 1UFQA 4PPFA 3QKSA 1DG1G 3EPJA 1WQ1R 1JI0A 1FX0A 2RHDA 5E7JA 1N25A 2G9NA 2IS2A 1O3YA 1CF4A 4B44A 1DVRA 4JYBA 1R2QA 3CLVA 4UXHA 3PCRB 4EJSC 2OM2A 3I4LA 4MRPA 4G3XA 2C8VA 4TMZA 2ZE5A 2ZJAA 3ND8A 3VR3A 1CR0A 2FV8A 4HAUA 5TVKA 4E03A 3VR1A 4OHWA 2ONKA 1XPOA 1ZNZA 1ZU5A 1T3LA 2F43A 3B85A 4KU4A 4LGMA 4RD2A 4OQFA 4U00A 4DIEA 1JAIA 1X1RA 1E69A 2I4IA 3TQCA 1U0JA 1YRBA 4C2UA 2WKRA 5HZKA 2WJHA 1K6MA 1SGWA 4EPVA 1J2JA 1CU1A 3TUIC 2HYIC 1LB1B 4BLRA 2R6AA 3P20A 3B2EA 3DM5A 1G64A 1BS1A 2D7DA 5DYGA 3PFIA 1QHXA 2WV9A 3C4JA 4NTZA 5CJ2A 1NLFA 4IFEA 1JXOA 1JPNA 2CMKA 3I73A 3RRNA 4B3GA 1DAGA 3SFZA 1SVOA 1G7SA 4N0DA 5CM9C 4RFSB 2D7CA 2CHGA 3FFBA 4Q19A 2DCUA 2OBNA 4IDHA 1TPZA 1J70A 1S1CA 3AGQA 2NO6A 1P2TA 1XD2B 1AIPA 1N0UA 1U9IA 3H84A 3TE6A 1JR3D 4TYPA 2X1VA 3KQKA 3U4QA 3BRWD 4BECA 5D3QA 3DMNA 2H57A 5SZKB 4ZV4A 1XTQA 2RGCA 4UJ3A 2PL3A 3CRW1 2VIIA 5EE1A 2RAPA 1P75A 3HR8A 1NY6A 4LY6A 2V6JA 2G1KA 4BZXA 1JQJC 4RY2A 2F1JA 2Q9CA 1Z0AA 4LPKA 5DSZA 5LB2A 4QG7A 4BFUA 1IXSB 3TAHA 1OXVA 1Z0IA 2NQ2C 2HT1A 3MWLA 1KI6B 1ZCBA 5FBLB 1Z22A 1CP2A 2R6DA 2XX3A 3GQBA 1VHTA 1GUAA 4JS0A 4JYCA 1ZP6A 4C7OB 3ZJYA 4ZDJA 3AVYA 4QGAA 3B9QA 4NONA 4HAVA 2V1UA 1TU3A 2KSQA 2O8CA 2ODEA 2ZSAA 1G9XA 2AR7A 2A30A 2IYZA 1C1YA 4TYQA 2YHSA 3ZLJA 5CDFE 4C30A 1IXZA 1A2BA 1CS4C 1E2HA 4HDOB 3IQWA 5C46F 5F9FA 1CXZA 4O25A 2FF7A 2ZE7A 3NG1A 4A15A 3GJ0A 5FI1B 4TMKA 1HA3A 2V7QA 1KMHB 1F2TA 3BH7A 3C14C 4LJAA 4WXRA 3UXMA 4Q9JA 3NEJA 4XVUA 1J99A 1KNXA 3TSWA 5BXQC 4NCHA 3AUXA 4KXFB 2F7SA 2OAQ1 3RS3A 4V0LA 1OB2A 2QAGA 1EWQA 2P5SA 2WSMA 4JT2A 1G1MA 4FN5A 4XWKA 5K8UA 3CRVA 4CT4B 1VG1A 1E98A 4TT3D 2N42A 4JSYA 2ZRBA 2IHBA 1LFDB 3HJNA 1PLJA 3QEJA 3RS2A 5HKKD 1CR1A 1KSHA 2NOAA 1VYVA 3C7KA 4JLPA 3SZRA 1P72A 5E7MA 3LD9A 4MKFA 4CGZA 4BFVA 1OF1A 1SZPA 4N3NA 1GIAA 1CTQA 2B8TA 5HE9A 4LK2A 2BWJA 2P2LA 3ND9A 4F7WA 1NN5A 5DI3A 5H8WA 4YMSA 1AM4D 4BLPA 3B5JA 3CRRA 2C99A 2V55B 1GNRA 3CONA 1HUQA 1IY0A 1MO3A 4DLTA 5JS8A 1CJKC 1RW4A 4Q1FA 3KQUA 3OEED 4EQ6B 4PZLA 2ZREA 5P21A 2NPFA 2LKDA 2H17A 3KX2A 1VIAA 4YMTA 2IYTA 2V9PA 2RHMA 4R9UC 2KJQA 3P4YA 3I5XA 4JL8A 1GKIA 4ERNA 2AXPA 1HE1C 4LV6A 3R8CA 5JRJA 3KJGA 2VP0A 2CLCX 2A3RA 4DDVA 1KI2A 2EVWX 3RS0A 1UKZA 3THOA 3LV8A 1LNZA 1U0LA 3NTUA 8OHMA 1E2PA 4C0QC 2KI5A 2WJVA 3TGPA 4RJLA 1Z6AA 1HQYE 1OKKA 5KPJA 1U9IC 1TQDA 1ZD1A 4CF7A 3KQNA 2EW1A 4O3MA 3ADDA 2GEVA 3GFPA 3B1YA 3MWYW 4NCNA 4G1UC 4IVRA 2GESA 1EFCA 4Q48A 5L3SB 2VYFA 1OFUX 3PEVA 1X1SA 5KOYA 2FJUA 1OV4A 5DLQC 2XTMA 3HYTA 1KY2A 4OKSA 4C0LA 4DLUA 2BKEA 3LQQA 3SBEA 1ZBDA 2ZJ5A 1X6VA 2Z0MA 4C0AC 2J45A 1I4DD 2Q9BA 4EDHA 4AI6A 3SU8A 3WMFA 4DLXA 3UANA 2VSXA 1P2VA 4S35A 3EZ6A 3U2QA 3VTKA 1DE0A 4OJKA 3PEWA 4L8GA 1G41A 5BW8A 3CR8A 1T5IA 3E2IA 1P62B 1DAHA 2VF8A 3TR5A 3THWA 1G7CA 3N5CA 3I32A 4Z8XA 4URVR 2HCBA 1JNYA 1RKBA 5FOXA 4BFYA 2IW3A 2XJ9A 4AG5A 3KJEA 2XZOA 2C9OA 1OT3A 4ZCLA 5EE5B 3W3ZB 4B3BA 2AD5A 1KTVA 5J4HA 3PXGA 3IDQA 1GG2A 1J90A 1FOEB 1XMSA 2QP3A 2BVNA 2TMKA 5GJWC 2QNRA 3MAAC 2ODNA 1N3BA 1OFTA 4B3CA 4H9GA 1E9CA 3EZ2A 4TYWA 2WKPA 2BMJA 3KUDA 2CBZA 1ZJ6A 3CH5A 3NBYC 1ZD8A 4N0EA 4Q4AA 5G3ZA 3T06B 2QGZA 4BWYA 1R0XA 3IQXA 3ZS8A 3R7WA 1ZNWA 4DSTA 3R9XA 2DFKB 4RCYA 4WZBE 1R5BA 1OXXK 2XJ4A 4TL9A 5J40A 3CZQA 1KK3A 2QAJA 4QC2A 3MJHA 4I1OA 1F2UB 1X8KA 1CLUA 1P2SA 2ODBA 1XPRA 4G5QA 4U7DA 4LX0A 2QAGC 3I8SA 4JLMA 4LYJA 1GILA 3T1VA 1KI3A 5CK4A 1E0JA 5TB5A 1KMQA 5ELXA 2ZS7A 4JLDA 5AJWA 1KI4A 1WF3A 1Y63A 1MV5A 3G5UA 2Q3MA 2IC5A 4CEJB 4I1UA 3T1OA 2P67A 1U81A 5FOUA 1FTNA 1R0YA 1IN5A 1ZNXA 2GAOA 3EWAA 5EXXA 4LDJA 3KXKA 2EYQA 4B33A 5F3WB 1T3SA 1OYYA 4QGGA 3QKRB 3QXJA 1T0HB 5KSPA 1W2GA 3K09A 4PPNA 5DI9A 1GL7A 3B1WA 3QBTA 3A6PC 4D4KA 4D81A 3LRPA 4QJ3A 4D0NA 3B1ZA 2PEYA 5FUVA 3U3JA 2IS4A 3MUFA 3SBDA 1SVLA 2QRZA 3AVWA 1S9HA 2FPLA 1VIYA 2OILA 2XAUA 3F5FA 2CE7A 4OHYA 3RAPR 2WSSA 4KV9A 2WIAA 3VKWA 521PA 3TJZA 2JATA 2VRWA 1T8UA 3D3QA 3IHWA 3AKCA 3GLGA 1IXRC 2OBMA 3U5ZB 3U3KA 3BB3A 2C78A 4NCKA 4PHGA 1N6IA 3RRZA 1N6PA 2W2XA 3Q7QA 2FMXA 4TMVA 3THYB 1S8FA 4NYMQ 1G3MA 5GADl 3HYRA 3CH4B 1ZIPA 4EJSB 4EUNA 1R8QA 5JFGA 4BLQA 2OG2A 2PLRA 2RH5A 5ANRB 1SVKA 3NC1C 2ZE6A 2FZLA 1TTTA 1VKJA 5JEEA 4AWXA 3LVRE 3VMFA 3AKYA 1XRJA 1CRQA 2F9MA 4GBMA 4RD3A 3NIBA 2C9CA 2WOJA 1OPXA 4A6XA 1W5TA 4PPGA 1E1RD 5HCNA 2YOHA 3C8UA 4A82A 1SXJA 1P73A 1RRPA 4DCVA 5DN6D 3VNUA 4D2IA 1Z5ZA 4JZKA 4LPSA 3WYFA 3K1JA 4AYTA 1LW7A 1KDRA 1IJEA 1GKYA 1QHHB 1WMSA 3UWKA 821PA 3OESA 3QXCA 1G17A 4KO8A 3CW2A 4G5GA 1HT1E 3L0OA 3ZQ6A 3TAUA 1G16A 2ZI3A 3U3RA 1Z06A 1U94A 2FZ4A 3TH5A 1OH7A 2IYRA 3KL4A 3PUVA 2JASA 4JBXA 1FQKA 1S3SA 3B8HA 3EARA 3VR2A 1G8FA 3OE7A 3DKVA 2PX0A 1YR7A 2VHCA 4GNKA 4AY2A 2DYKA 5FBQB 5JJLA 1KSJA 1FMJA 2VSOA 4KFTA 3SI7A 3KXIA 1GL9B 4A1FA 2XNSA 1ZIOA 3IIKA 3X1WA 2EFHB 5JRZA 3IO5A 4QJ4A 4BEJA 3TRFA 4TZ0A 4LBWA 1QZXA 4A0RA 4E5UA 3QXSA 1ZMXA 1ZW6A 4EPYA 3SE0A 4QBIA 3REGA 3QPUA 4WW0A 4OHZA 4LWZA 5H70A 4BQSA 3G0HA 4W7SA 4A2PA 3U7HB 3H4MA 2QM7A 2PT5A 4JLVA 4PHHA 3TUJC 1U8YA 1I2MA 3VX4A 3X1ZA 3BORA 4URWR 3T35A 3FMFA 3CWQA 4QHYA 3OAAA 4B3DA 2FU5C 5FL7A 4TTPA 2QTVB 2ZJ8A 1G8PA 1U90A 4RSGA 3T1TA 5FPHA 2NO0A 4Q7KA 2VH5R 3GJ3A 4LJ9A 1R8SA 4LJ6A 1S0UA 3GLGE 1N6KA 1A1VA 3LY5A 1UF9A 5IT5A 2AFIE 4JMPA 2JLYA 4QL3A 2DWQA 4OK3A 4BFTA 3PITA 4AURA 3AB3A 4G5OA 1YZQA 3GLIA 2VA8A 3L82B 4HDQB 4XWAA 1TNDA 2QE7A 2C77A 3CKLA 2HT6A 1J7KA 5EXPA 5KSZA 1KKMA 3NBZC 3THXA 5DH9A 4DRZA 4PC6A 4HB3A 2GTPA 2IEYA 5G53C 1JXMA 1W4RA 2O8FA 2F9LA 2GJ8A 1KSFX 5FOSA 2WZQA 1Z6TA 3MG9A 4TL8A 5LDDC 1DAEA 5B57C 3FB4A 4OI4A 1XEWX 5JSZB 1GAJA 1LF0A 1NKTA 3LBHA 2OCBA 1SXJE 2BCGY 3TKLA 4DSNA 2FWRA 5J4KA 4MQBA 1KDTA 4C0BA 2Q0HA 2WWYA 2KE5A 3NH6A 1NVXQ 2EWWA 4HUQA 1XXHA 2AWOA 4IOMA 1KYIA 1QHSA 2GXQA 3WNBA 1W7AA 2FDCA 1SHKA 3NC0C 3FYHA 5EJEA 1G3UA 3DZDA 2P6UA 3DL0A 4GSYA 4A8JA 2RGAA 1GKUB 5FTMA 4DLVA 5L8VA 5DE3A 1U0HC 1MO5A 3A1SA 4KFUA 2O8BA 1W0KA 5AJVB 4UQOA 3QKSB 3RSLA 5DISB 2AD1A 2ZVQX 1FX0B 1HT2E 4X8LA 1P2UA 3WBJA 2OFWA 2X19A 3BJIC 4GOXA 2BMEA 1M6NA 3SYLA 4JJKA 5KSOA 4NH0A 1M2OB 2FGKA 3EW9A 5FTJA 2NGRA 2REOA 1KDOA 2C98A 1H8EA 1L2TA 2BKUA 1D2NA 4FWIB 3ZVLA 4IDNA 1AS3A 2JDIA 4U02A 4I4LA 1N0VC 5TARA 2C04A 2ZAMA 3M1IA 2WWWA 3NH9A 4OJQA 2F43B 5K8LA 1AZTA 1S9DA 3H86A 2GZHA 1EXMA 3DMDA 4NHOA 4CIDA 2W6JD 4QOSA 2OCAA 1Z6GA 2JCSA 2YINC 4JKIA 1G19A 2JIZD 2HXYA 1SXJC 1D5CA 4Q18A 2QGNA 4GDFA 1TQ4A 5FTKA 3ZIAD 3IGFA 1XWIA 5JWOA 1IAQA 4WVFA 2A5FA 3FHCB 4DB4A 1FPMA 3A58B 4DSOA 2ZYWX 1SVIA 2IF2A 4IXNA 4XH9B 1G5PA 1TQ6A 2JLXA 2H8KA 2Z5FA 2HLDA 2PX3A 3SN6A 5CLLA 1G6OA 2BMFA 5FOTA 1NMXA 5SZJA 3W34A 3LXRA 4LBVA 3GLIE 2ZRCA 1IY1A 5K8IA 4G5SA 1DTSA 1Z0DA 3U4QB 2G1JA 3ZYCA 4KAXA 1E2QA 4R98A 2CCJA 3VR6A 2RGGA 5JCZA 4LCBA 2ZVPX 3RRYA 2BBTA 4S2EA 4XIGS 4D82A 3EZFA 3WNCA 3WYAA 1NMZA 4KODA 2ZYVX 2OAP1 3CIOA 1S3GA 3S1AA 3T15A 1JAHA 4F38A 4P4SA 3KXLA 3RDPA 1KAGA 2BIFA 2ZS8A 2PCJA 2QBYA 2NZ8A 1ZC3A 2AFHE 4PSAA 5TV2A 2C9YA 3UG7A 1OYWA 1TQ2A 1UBEA 2JJ8A 1SQ5A 1YHNA 4C3ZA 1VHLA 3RWOA 3BK7A 4CW7A 2W2VA 4TL7A 3FVQA 3BWDD 1XXHE 4BZQA 1JPJA 4YMUA 2D2EA 1E9RA 1Z0KA 2HEIA 4IRUB 5CLQA 1S2MA 3SYNA 2V7QD 1GOTA 1DELA 2O8CB 5GVRA 2OLKA 3EZ7A 4ZDKA 2ZANA 4AK9A 3CNNA 3Q9LA 4Q4HA 3RC3A 3QE0A 5EP3A 3EC2A 2VL7A 3CRMA 3IUYA 4TLDA 3QVVA 4TSFD 1P9NA 4P33A 2DWPA 5DYIA 5G41A 3SS8A 3UMRA 3O8RA 2YKGA 4BE7B 4MUAA 3GEIA 1G4UR 2G88A 1WA5A 5C18A 1TUIA 1W4BA 4RCZA 2OFOA 2X8AA 5FPYA 3ZZTA 1F2TB 1DBSA 4B6FA 4U5XA 2R9VA 1A2KC 1WRBA 2JJ2A 1MOZA 1DARA 1LS1A 3KTAA 2IUSA 1YZTA 2CHVA 2Q3HA 5CYPA 3TQFA 1KI9A 3B1VA 4RKFA 2VPPA 4D4MA 3SHWA 1E96A 2QAGB 3I92A 1D2EA 2ATXA 4BRWA 1RVDA 2BBWA 3ADKA 3Q5EA 4NCIA 1C4OA 4IVQA 2J41A 2G3YA 2GNOA 4LBZA 1CJUC 2BMDA 3FMOB 4B34A 5L3QA 5AJYA 1YZLA 3MGCA 4LJYA 2Q21A 4X8OA 4HZIA 4FCTA 4QGHA 3ETLA 3AF4A 5F9HA 2J87A 3LBIA 3AVOA 4RZUA 3VAAA 4A8JC 3V4RA 3KDSE 5HR5A 5KDDA 4Q9LA 5DO9A 3RVBA 1CJVC 1E9FA 4K46A 3SYKA 1M74A 1W4AA 4ZPXA 3CO5A 1JB1A 2QG6A 1DEKA 3MLEA 3QG5A 4F4JA 1D8TA 4FMDB 4I81A 5DI3B 4CDGA 5C1BA 2CNWA 1FP7A 1ZNYA 1QBKC 2GXUA 3VNVA 4IJMA 1UKEA 4HLCA 6Q21A 3SQXA 1GL6A 4NYIR 3V00A 1MO4A 3KKMA 4M53A 2WTUA 4F4IA 2EU8A 2GXAA 5BQ5A 2HCJB 4DVGA 4JLJA 3CPEA 4F4CA 1CKEA 1G6HA 3CPHA 1QVAA 4DCTA 1IJFA 2W83A 5SZIA 2A5DA 1NL3A 1OKKD 1AZSC 1P6XA 1I2DA 5KUTA 2OXCA 5C4MA 1MABA 1NBMA 1SKQA 1PZNA 4C2TA 5FR2A 3BFXA 4FCWA 2WWIA 1AKYA 1II0A 2FFAA 3RS5A 1AS0A 3LLMA 3NHBA 1O87A 3GLFA 1OW3B 2L0XA 1FUKA 1SULA 4OI0A 1QHNA 2WKQA 1ZUIA 5FTLA 2J0QA 5AUNB 3FE2A 3F8TA 4BFXA 3W8NA 3C5CA 2V3CC 4YXWD 1FL9A 2CXXA 4LUCA 1IN4A 1NJGA 3N2IA 4HB4A 4F91B 1YZUA 1XMIA 3EPHA 3NDBB 1ZINA 3QF4A 3AVTA 1E2GA 4PR0A 1Z47A 1XTJA 3PIRA 4GZMA 3WP1B 1G5TA 2ORIA 3X2SA 2XB2A 3EWSA 3ZVNA 2AK2A 1G3RA 1NF3A 2R2AA 4P31A 5DHFA 2WWHA 1XX6A 3VQTA 2WICA 4Q5IA 1TEXA 4D0LB 1ELOA 3ZDQA 2RGEA 1TEVA 3B9PA 3UK6A 1XEWY 2QZ4A 2RGBA 1K5DA 3QUSA 2N46A 4C0HA 4TN1A 2G6BA 4ZIRA 4DCUA 1BKDR 3P27A 3LW7A 1MRNA 5TXGA 3K70C 3KQHA 3L0IB 1W2HA 2WJJA 3GEHA 3THWB 1G3QA 4LHZA 3ADBA 4Z1MA 4XTCS 4L4UA 1CJTC 2XOKA 1Z3IX 3TR0A 2ZIAA 2DR3A 2G0NA 3Q3JB 1S96A 3WY9A 4IDQA 1KAOA 4P32A 1DAFA 3WMEA 1N6NA 4DLSA 1E9EA 2JLZA 3TUZC 2W6IA 4AG6A 4W9MC 3GLHA 2DBYA 3QNUA 4M8NE 1P60A 1YR6A 2FFBA 4ILEA 721PA 4FD2A 1ZRHA 5FBRB 1DG3A 3OIYA 3W5IA 4Q1AA 4Q4AB 3KKOA 1RC8A 4P4TA 3B78A 2ONJA 2D74A 2JAQA 2EQBA 2GEDA 3R7WB 2HF8A 1DAKA 1OE0A 1YZNA 5E7IA 4DLYA 2BDTA 3P26A 1MRSA 1VCOA 5JCPA 2KBFA 2DPXA 3PEYA 3F3YA 5BN5A 1R0ZA 2G83A 4JVMA 3J81k 4CEIA 3MMPA 3FKSA 2B7CA 2GK6A 4Q02A 4Q01A 4D25A 5UKDA 2XXAA 4FWTA 4LC0A 4FMCF 4FXPA 2NMVA 1V43A 2KWIA 3RS4A
chains in the Genus database with same CATH superfamily
1IFXA 1TUBA 4KQCA 4V0MA 5IBRA 4TWRA 2TS1A 1JLKA 2XCTB 3SOZA 1PX0A 1N4AA 3JRWA 4MV0A 2QU8A 5KIZA 4RPGA 4ZQEA 3FNBA 3FRHA 1DAMA 2FFRA 2VO1A 1Q22A 3MVEA 3ANYB 2NVOA 1XA4A 1VZ2A 1X1DA 2IS6A 4HBTA 3ZTWA 5I7AA 5EJIA 1SXJD 4W7HA 2QX8A 3U7RA 3BERA 2WFLA 1QP7A 4WXPA 3X1YA 3BECA 3E4PA 3EG9B 5G4KB 3H2KA 4XWOA 4KXMA 3AQIA 2PX8A 2Y0DA 4O8CA 1G8MA 4KH1A 4I8IA 3TN7A 1T36B 3HCRA 5E2BA 4YRDA 4BP9A 3MTGA 3RTAA 3TVDA 2C2MA 3HSKA 5EMLA 1KE0A 1XNQB 4CR7A 2JHCA 1JHAA 3FZNA 5CW2A 1LBIA 3OM8A 4E6XA 4HB0A 4BO8A 4AJOA 4DCPA 3LS2A 3SNKA 1VECA 4E33A 4DT1A 3PZRA 4JBIA 3OFND 1QIJA 2PANA 5DM70 5KNBH 4UNQA 3R4VA 2F9FA 4AX8A 2IL1A 3NZEA 3VYRB 2J3QA 1RNLA 3RWBA 1JR3E 4EYQA 3NAGA 2RHTA 1QO0A 3CJRA 5FAKA 1ZR2A 4JOQA 3NHJA 1UKAA 3VP2A 2ZJOA 3PJDA 1BDJA 2J5XA 2GARA 4NCBA 4B4ZA 3O0DA 3K35A 4HEJA 3Q72A 4XGIA 1JIVA 4F06A 3MGBA 2HBYA 2NU6A 3WWPA 1DO2A 1FFHA 3EY4A 6LDHA 1PVOA 4ND6A 1ZU4A 2R6FA 3VDRA 4PQRA 3BILA 3ABQB 5BWMA 5CFOA 2XA1A 4I55F 2P74A 3D5EA 4P54A 3L0CA 3IMEA 1FYWA 2H00A 3HTXA 1CNMA 3DPUA 4ZRRA 4YMIA 1T6ZA 1N4DA 1M1NB 2HLDD 1E61A 1TK9A 1M0EA 4BNXA 2SKEA 1T10A 1Y0BA 5AM0A 1X7DA 4B6JA 4BGDA 2I3GA 4R41A 1HFWA 3K8YA 2FRDA 3C6YA 1XE3A 3TGLA 3UAWA 2FSGA 2FH5A 3EC1A 4Y6QA 5ILGA 3EAQA 3B6JA 2XH8A 4BS9A 4KZ7A 2D4HA 3S1AB 2GJSA 1NXWA 3O1JC 1MXFA 5IP5A 2IT1A 3PYLA 1NYYA 4YRSA 1KFKB 5AHRA 2C2HA 1WABA 1KAHA 4K6FA 5CECA 2FG6C 1C3XA 1UFKA 5HTOA 4PM8A 13PKA 4K9KA 4I9HA 4JXGA 4PR3A 3UY4A 2IDMA 4GFDA 2CMFA 3R3HA 2YV1A 2PGAA 1YL7A 2GK3A 3RF6A 3PB3A 1PT7A 3MINB 2WVGA 2KHZA 5DM4A 4IJWA 5IS2A 3FPEA 1ZDMA 4UM9B 3MOSA 3P7NA 4ETNA 1A0KA 4Q47A 1CR2A 4QAQA 3Q7EA 4BQRA 1JLLB 2I3AA 2VP5A 4GZ5A 4PICA 4PYLA 4OMDA 1EKXA 1E2JA 3S4YA 3FETA 2Q1XA 1WEKA 1IOWA 4YJFA 4Q3BA 3TZBA 1BCSB 3EEOA 4P9NA 1SUSA 3M6AA 4LHYA 5JWRA 1E4EB 1QUEA 1TD9A 5JQGB 1EP1B 1AQLA 1Z63A 1ZL0A 5JI3E 3FGPA 3OBIA 3KE8A 4QHSA 4FIDA 4U2FA 5J2UA 1EGAA 3D7SA 3UG6A 4S12A 5JFTA 1LWNA 3SF8B 4N76A 4C7VA 3K0SA 2JHGA 5DFAA 3WQRA 1KH3A 2X58A 4ARZA 1MZVA 2EKDA 3QMMA 4EAAA 3NWBA 4E3NA 1S2OA 1H2BA 3OC0A 3FYUC 4G3KA 3AYZB 4X68A 3VU0A 1JYSA 2Y2IA 1CC1S 3UZUA 3QKUA 1KDPA 2WIGA 1G18A 4H3KB 1CI9A 1THZA 1DBVO 4K03A 3DGFC 4ZI2A 2ID4A 4O1HA 5FQKA 5EXDA 4RF3A 3D7MA 4PN3A 2GJKA 4NSNA 3HNRA 2Q9MA 2OHXA 1HLDA 1XAGA 1Z8DA 2HRCA 3D8RA 3Q7TA 3NEAA 5FT9A 1H3FA 4IZ6A 3OM1A 3HKBA 1BD4A 3GFOA 4FDAA 1CRLA 1FLNA 2JBFA 4PN7A 3D3WA 1C9NA 5LMCA 2ES4A 3ZOZA 2ACKA 2VP2A 4PO3X 3IP9A 4KOEC 1C3BA 4GLJA 3RSSA 3SDBA 2G7ZA 1ZC2A 3T9AA 4KXYA 2XKBA 5FNVB 1EVIA 3UAOA 2VP4A 1Z28A 4HP9A 1CEXA 1J42A 1MB2A 1I4WA 1Y33E 4FT2A 5CB4A 1RLOA 1J49A 1T6XA 1KGEA 2J08A 2RC6A 5LNK1 2UYHA 4AJLA 3DL7A 2QRVB 2YDXA 4Q1BA 2A2ZA 4NZMA 1DBIA 1YGPA 4UD6A 4CQJA 3GARA 1NNLA 1VKHA 2O4CA 1O77A 1UPXA 4QBFA 1M2VB 3ZCZA 2XBLA 4BNMA 1U1GA 4WLEA 3KJIA 1OMOA 1TFRA 1KXJA 2XNDD 5AOCA 1X0OA 1WUHS 1C41A 3RUDA 3G34A 1EBFA 3W6NA 2GM4A 3QVKA 1AKMA 4M0FA 4PHTA 2BFBA 4H4EA 4GJ4A 5CFRA 2PGJA 2GVZC 1BLPA 4C7OA 1YJCA 3PQ6A 2VDVE 1WXGA 3GNLA 3ZHRA 3O8OA 1GVNB 3F2IA 4UARA 1U4OA 2B4QA 1U7HA 2ZQ8A 3L7BA 3VKGA 3BG5A 3D4IA 1YD7A 2GA8A 4AD8A 1SWVA 3ZD7A 3C8CA 5EXSA 4ZALA 1IM8A 4PZCA 1BXGB 2V8CA 5LLSA 3IUQA 1XALA 4JJZA 4NE2A 2I2XB 2GQ0A 4KYUA 1OLUB 3QQPA 4QU9A 4N0PA 1ULUA 5AW3A 4JUFA 3N74A 1G291 1ZH4A 2O8VA 5IF9A 2WSLA 1S89A 4HWTA 3QSYA 5KMGA 2G9ZA 3WL3A 3E3MA 3KG2A 2WU1A 4NCAA 3PXXA 3LKBA 5LP6F 1IWOA 3G2PA 3JARA 2ZC4B 1NDHA 4TTSA 1S6YA 1STZA 4TN5A 1Q7GA 4L1KA 3OQBA 4F12A 2XE6A 5IHPA 3Q0TA 5I7OA 4WEOA 3BFCA 3AF3A 4PPQA 4MI3A 4YQEA 1N5IA 2AXQA 4JR1A 5ESDA 3NHKA 3IEUA 4G25A 2IXFA 1HLFA 4L8FA 4BHTA 1JHVA 2BEWB 4L08A 1UJ2A 2ATEA 1R8XA 5TS2A 2G1AA 4JP8A 1NUUA 2LDBA 4XDZA 1G6AA 1YB4A 4B2PA 5AJZA 2FX2A 1G2IA 5AVYA 2GNXA 4ZK2A 4MYHA 4BJ6A 1HDIA 3M2TA 2J3EA 4AY4A 3R6DA 3CBGA 1HTWA 4EO9A 4RX3A 2ZSBA 1ESMA 1T0IA 2KPOA 3BJMA 2XQIA 4WEJA 1C7RA 4ZEMA 3V2HA 1JHRA 4KJXA 4WBNA 3ZE6A 1N1GA 5EP2A 4OHOA 5DB4A 4ML3A 3T3NA 5T7BA 4FFDA 2WTNA 1LQTA 4Z1OA 4E07A 3H17A 3N6VA 1TS6A 1IIBA 4UUAA 2XSZD 4MHSA 4U1RA 5LA6F 4DLNA 2GX5A 3CX6A 3LG2A 5JOQA 3DEHA 4PSKA 1QH8A 1L7RA 4IEEA 1FX1A 2IU4A 4WLUA 2NVUA 1A9RA 4L5IA 3P32A 3GEGA 1JA9A 2ZRJA 4D45A 1DKNA 3SC3A 3T9DA 5AI8A 2ORVA 4QGSA 4XPIB 1PWEA 3ENQA 2O3TA 4LAFA 2YOFA 3IOBA 2X14A 2DULA 3MCZA 1ARZA 2CCKA 2CBXA 1ZWKA 1EFRD 2IUUA 1U0GA 4XLZA 1G21E 3Q7VB 3VU9B 4GE3A 4LOLA 4EEZA 3H2JA 2C96A 1EE9A 2H0TA 5CH5A 5H0IA 5CNMA 4EAQA 4NNPA 3M6MD 3CEMA 1OX4B 2O99A 1MB4A 1SBIA 2GJ4A 1TUEA 1N9KA 5B64A 2A1UA 1LVHA 5KHOC 1P2GA 3VPGA 2CK3A 2OXEA 4ENWA 1ZGZA 2QLTA 5HJ2A 2QR3A 3CLTD 1DOHA 4NQRA 1DKOA 4Y0OA 1CY8A 4UOZA 1EUCB 1W581 1XPJA 2VT7A 4HDKB 3UGQA 5ICEA 1GDTA 3T9EA 1Y5IA 4DUGD 3EWKA 4BX0A 3OBFA 2N75A 4HWOA 2WWFA 4HN4B 4DRYA 1DVRA 1B6TA 4AMBA 3EUAA 1NQWA 2QJWA 4E3LA 4RD2A 1MW9X 2I4IA 4R16A 5TQ0B 3ZUGA 1DJPA 3VYUB 1BE8A 1SURA 2VFAA 1K8ZB 3PVCA 3H75A 3WGUA 2W6OA 4IV8A 3AGQA 4BAUA 4RL6A 1XD2B 3PPYA 1W2WB 2YFYA 5D3QA 2P0AA 2PL3A 3KAJA 4OD0A 1FP4A 3AM5A 3A6HA 2C2OA 1OU4A 4N65A 3PS9A 4EKYA 1KMCA 4M54A 2PLNA 2JCHA 1KYWA 3IP3A 1WMEA 1RJGA 1TMOA 3UOWA 5JPCA 5E6UB 5F73A 4ISBA 3ABIA 2C42A 3REOA 1QK5A 1ULAA 4YDRA 4QUJA 5ITZA 1A5BB 2YJ6A 2J6CA 5ALDA 1EX1A 2FQWA 2NXEA 3HACA 3NX4A 2IPAB 3WS1A 2D1FA 5FX2A 4EG0A 1NDUA 4W1QA 5C1PA 1TO6A 3U09A 3USZA 2R1VA 4E3MA 1FB5A 4HSGA 2DPYA 4BFVA 3DV0B 1K55A 2X9VA 3O4RA 1JV2B 3T4KA 2R8XA 1U7ZA 5HNKA 4TVKA 5HG0A 3K8ZA 5FO1A 5JS6A 4YMTA 2FWIA 3A27A 5HKAA 1J9MA 5DASA 2AEJA 2ZTUA 3KT8A 2HMYB 3DFMA 3NBQA 3A70A 4EATA 3VPCA 4LG1A 1Z6AA 5IKEA 1V71A 1G2PA 4O3MA 3MHTA 5CA0F 2HU2A 4X1YA 1JFTA 3MWYW 3DVRX 1EFCA 3AZPA 1OV4A 1YMUA 4TS9A 2ZDGA 3LQQA 3U4CA 3U9LA 1C8VB 2P9VB 1HEUA 1KIFA 2WUQA 1YDEA 2XXJA 4URVR 2HCBA 4DQXA 2XZOA 2C3UA 5D3KA 4GRIA 5LSAA 1KTVA 1XMSA 4JJEA 2R97A 3FGZA 2QRLA 3ZPXA 4GR5A 4WKCA 5AK4A 2VQ3A 2DFKB 4LF4B 4UFPA 3P5BA 4U7DA 2A3UA 3EQ6A 4JC5A 1E7WA 2A1IA 3AINA 1AQNA 1XZBA 3ZD9A 2P08A 2HQSA 3HV2A 4B7UA 2XD5A 3HLDA 1Y6GA 4FZRA 1WCXA 2PEYA 3U3JA 4LF7B 2R1TA 1DBWA 3U17A 2PR2A 1YZ3A 4AFIA 3RAPR 4N47A 3TR6A 2VRWA 4AP5A 3ZE1B 2P1RA 5E0OA 1RQ2A 4DLAA 1N6IA 2Z6CA 4NYMQ 3KXDA 3S5JA 1U6IA 2EJCA 3QBEA 4X65B 2FZLA 1ODCA 1MOQA 4Y1RA 1FTQA 3NOXA 2C9CA 1GSOA 3E9EA 4BMPB 3B8EA 2BFCA 4P34A 3ZU6A 4OLFA 4DJEC 4ED9A 3AXSA 4S2UA 4H31A 3NHYA 2JASA 4F56A 4D98A 1IEQA 2AEFA 3GJSA 1KBOA 4EVRA 3B3AA 4Z9QA 3L4BC 4M3KA 5DMHA 4B79A 2WZDA 3EC7A 1H2XA 4C7JA 3V4PB 5A3JA 1L7NA 5BUCA 3CNQS 1IUOA 3IDSA 3OAAA 4KFCA 4FNAA 4P85A 5L07A 4LJ6A 1Z8HA 1N6KA 1VLVA 2IU0A 1T3TA 2JLYA 1ZX1A 3V2UA 3O8LA 3MMZA 2HT6A 3DAPA 4IJQA 4YP0A 2BE7A 2DG2A 2AIRA 2QJRA 4EI7A 2CGEA 2IEDA 5A4DA 2PUGA 1EK1A 1IL0A 3BQNB 3DUFA 2AFHA 2H59A 2FWRA 4IG4A 3RBAA 5JNUA 1CETA 2AWOA 3OZGA 2GAFA 4E2XA 5DOZA 3GGJA 3QKSB 3IQFA 3E82A 1P2UA 1OGYA 3VNQA 4BEWA 3EW9A 1P44A 1KDOA 4J1TC 1D2NA 1Q0QA 1DTEA 3FJ1A 2ZAMA 1EXMA 4QOSA 1ZG6A 2O06A 2C92A 1G19A 4WFQA 1ADFA 4KZ4A 1J0XO 2O54A 3FWLA 1WCWA 5ALEA 1R6TA 3LZ6A 3OSZA 3T4EA 1E3QA 2JCBA 1L5HB 2PX3A 1LPMA 1I7DA 4MINA 2HD4A 4CLOB 1SKFA 2XLBA 2C5BA 2GZ1A 2RGGA 3F3KA 1IDOA 5L4LA 1UBOS 2PCJA 4WQMA 4LGVA 1P4GA 4GL4A 1TQ2A 3V33A 1XJ3A 3N59A 2ZUWA 5TR7A 5L7YA 1FUEA 3ZWAA 1Z2NX 1SWWA 4ECAA 1UXOA 4FGKA 5DNEA 3RJMA 3PNKA 4J4TA 4HNQA 1CS0B 4RC9A 1C9DB 1N75A 5C7YA 1DDGA 4TM7A 4W9NC 2OFOA 4MW2A 4X1KB 4DFDA 2VPPA 3SE7A 1W85A 1R64A 4MQ6A 4IVQA 3LCEA 4PSDA 1CJUC 3TLZA 2BMDA 3K73O 3MPUA 3AVOA 1U7PA 5DO9A 2VGJA 1ENYA 5CLGA 5IH7A 2ZJ3A 4J3NA 1QBKC 4ZYVA 3GP5A 1ORIA 2VQDA 4RIHA 3PDUA 1MO4A 3OQNA 3TOIA 4OPZA 3ZDXB 3JQ9C 4H35A 3CPEA 1G6HA 4RM3A 3S28A 2W83A 4BKRA 1Y6RA 3OJXA 1TJ4A 1SKQA 4IVNA 2WWIA 1TCUA 4UAJA 3RYFA 4GN2A 4GF5A 1QHNA 2WKQA 4ND5A 5BWLA 5IMSA 2CXXA 2IYNA 5DXAA 1MC1A 4PR0A 2XB2A 1FYXA 1M9NA 2WWHA 3I64A 1EEHA 4EYGA 3EMDA 2Q9UA 1BKDR 4Q3KA 3MOGA 2W48A 1USGA 2RAUA 3F1PA 1KH2A 5H7XA 3KSBC 3IF6A 5FI3A 1YS1X 4I5EA 1QP0A 4Q4AB 1RC8A 2D74A 4U6NA 2C5GA 5JCPA 1OV6A 4YROA 2PRFA 4ESEA 4ZAWA 5JD3A 3G2IA 3LT4A 3FKSA 2H5IA 3EIOA 4HNSA 2XRYA 4JC8A 1T91A 4RVNA 1B3BA 3VJLA 4RSRA 4CZ2A 3EH2A 4TVOA 4U3JA 2G72A 1OWOA 3NP7A 1EUDB 621PA 1JU3A 4OGGA 4MDFA 2QRJA 3CUWA 2PMBA 2LE0A 2GF9A 4F2DA 4L72A 4CMAA 1ESZA 1PD1A 1NAIA 5MF6A 3R76A 2FEXA 1NV8A 5BNWA 4HNHA 4C6TB 1QNLA 2PKWA 3O3VA 3G0GA 3PIIA 3T0GA 2PBYA 3ZE8A 2PJRA 2KX6A 4IGIA 4BGEA 3IX7A 1FTSA 2JL1A 5JLJA 3L4BA 4MR8B 4LSMA 3OE7D 1J9GA 3IMFA 4V02A 3HZOA 4MUEA 2G09A 1VDZA 2DFVA 3NT4A 3A6FA 3ZJUA 5NLLA 5EVIB 2XGNA 1NPTO 1UDCA 3PHCA 1XWWA 1M75A 2ETXA 3ENNA 4H3HB 1KVMA 3QF7A 1KR2A 4BB5A 3D6FA 3KKEA 2QLJA 4PM9A 1ENPA 1AF4A 3DGEC 1KAMA 5ULLA 1JEDA 5TPZA 2X0FA 1QTIA 4Z3DA 1NHGA 2QTFA 2VXBA 2X8BA 3RBZA 4AZWA 1RC0A 5JV5A 4LV2A 1YZGA 3VSKA 1CE8A 3D8TA 3L8CA 4BASA 5ETJA 1YM1A 3C30A 3ML1A 2XQVA 1QYXA 1C9YA 2XGOA 2I1WA 4KJZA 4Q15A 3WDSA 4C4TA 2CXNA 5CDSA 4V03A 3ZCTA 5K6TA 4MVJI 1KGDA 3A3YA 4F6RB 1GEEA 2QQFA 1X7ZA 1D9XA 1ZIXA 2H28A 2Q3EA 2G8LA 1VHMA 3RUFA 3G6OA 1T4GA 3ZI4A 2VHXA 1PSWA 4EA9A 4K1XA 3RU2A 3OY7A 2HF7A 2PUDA 5CFLA 2EFDB 3TYXA 1P9OA 3D1VA 3A37A 2H08A 3GFQA 5E9WA 2J0SA 2WPDA 4XASA 4UUQA 2IITA 1XN1A 5K5BA 5ERGB 1BZAA 3FRJA 2D0DA 5L6LB 1MVOA 3MMHA 3HCPA 7REQB 1BEEA 4RYLA 5F1YA 1QMFA 5AT1A 3HWSA 2VF5X 2BGLA 2E4XA 5IJZA 3VU3A 2JVJA 1M3SA 3P2OA 4QOGA 2C94A 4OUDA 1W19A 4MS3A 3ZHUA 5EPHA 4PZUA 4H3VA 1GAEO 2O3RA 2A58A 3CPJB 2NTNA 1YZYA 1LLDA 3CBQA 2J3DA 3FG9A 1O97C 3PAGA 2Q7XA 3B6ZA 3JQ9A 2R47A 1M5UA 2QD1A 1UT5A 5G40A 3WIOA 3WS0A 1JAZA 4RVGA 2VRBA 4AKEA 2VTBA 3ZCXA 3N8HA 3DAFA 4S24A 1H05A 4RAOA 2QT1A 4A8PA 2OHGA 1F1BA 4ODIA 5FASA 4F5WA 4EGQA 1DNPA 3KUUA 2GZSA 3UY6A 1BFUA 1N6LA 4EFNA 1VPLA 5CYFA 1XHEA 3FUVA 4KG5A 2NZXA 3GUZA 5FPSA 1T8PA 3H0KA 4OJYA 1TMYA 3KFLA 5ALMA 3TM4A 4UHJA 1I7NA 2UXDB 3MRXA 2FWJA 4YUWA 5AUPB 4BMWA 3FGOA 3O3CA 3R3ZA 1ND5A 3L1KA 3PR2B 3T3DA 5L9AA 1CHDA 1NE2A 1H2ZA 5KNBA 3IHKA 4CTNA 4C3OB 3RYIB 4N6NA 2QWXA 2ZYAA 3K9QO 2J4CA 4L75A 4U0KA 5IFLA 4YC7A 2Y77A 5CMLA 3KJQA 2RGYA 5JADA 3W4KA 3K31A 3W2GA 4HK4A 1LPPA 1RS0A 3OQJA 3IA7A 5JH7B 5B7QA 1PEAA 4P98A 3LYLA 2ZR9A 2FZKA 3M6IA 5DF9A 5HIIA 3BZWA 5CX4A 5BVGB 2AXNA 3FPWA 1NZJA 3F4KA 3KS9A 1EJ6A 4MP3A 4R1UA 3DAVA 5EUMA 3EFEA 1UDXA 3UKJA 4P5EA 3ST7A 3R8XA 3E7XA 2FQ1A 1KDVA 2Y1EA 4DBVO 5EUAA 3B2NA 1OLXB 3GGSA 3ZWCA 5IDYA 3MTIA 3JWGA 4G8JA 5E9QA 2VJKA 2P9ZA 3OT5A 2PZKA 1UKBA 2Y3IA 3B6KA 5C32A 3IBRA 3TRCA 1R0WA 1Q15A 3W9YA 5C3MA 2FMKA 2ZAOA 2F4NA 1ACFA 4L9WA 5IDVA 3OQ6A 3NBKA 1E62A 5CA1F 3IUJA 4JDPA 3KIPA 4GW9A 5BOHA 3DW1X 4ZOCA 1RQGA 3SQDA 4D6PA 4ZMBA 2ATVA 3DC7A 2O9BA 1JBEA 4L50A 4TSFA 1OT6A 4LTDA 1L7AA 1JDPA 3VX3A 1C9MA 3Q2IA 2YMPA 1P3Y1 4YDSA 3ROXA 2PD7A 2GAAA 3AUSA 3ZE7A 5K3FB 4URXR 1AK2A 1N5RA 3TKAA 4NIMA 3ZEAA 2IZ1A 5CVJA 2BR3A 4FE7A 5F52A 3AVVA 4BBAA 2AHOA 4LC1A 1HQCA 1C4XA 1LL8A 3PDIB 2ZAIA 2R85A 1RBYA 1XZGA 3TJRA 3CXRA 2CVHA 1SNYA 1QIKA 4ZZ0A 2BKXA 1E58A 2ZBEA 3DDSA 1EHIA 2RFLA 2PS1A 3EEHA 2Z2MB 1R8YA 3NCTA 4MGEA 4WHMA 5K0EA 1M34E 4IDEA 1CF2O 5LD2C 1KO4A 1TECE 3G82C 3A32A 1SHLA 4JWKA 3BJEA 1N3LA 2I78A 2JA1A 4LK3A 5BYJA 5D84A 1K66A 1QQ7A 5L10A 4PONA 3DHWC 3RAFC 2NZVG 4DSUA 4C1BA 1YMVA 1LGYA 2AC2A 1HR0B 1C1DB 3G17A 3HUMA 1MENA 3F71A 2C5FA 1YU6A 1JQKA 3ZDJA 3HSYA 3K4PA 1O94D 3PFCA 1F1JA 3WBKA 2O2IA 4TQAA 1Q50A 3BD8A 1ZXLA 2KW5A 2ZSKA 1XAJA 4KVGA 1DC7A 3PXUA 3S99A 1K6SA 1ONBA 1NA5A 2GRJA 1GCOA 2FNAA 3PNVA 5ESRA 2YWEA 1N36B 1ZC4A 4AJ2A 4G1VA 2JLWA 3G79A 3KSGA 3VPAA 2ZJ7A 1CQAA 1BQ4A 4LC9A 4KITB 1EFLA 4US0R 3BOSA 4EF5A 5DNVA 4BNDB 1RE0A 3NIAA 1BX0A 2YVUA 1OTEA 3KEQA 2ATCA 2XMDA 3SR3A 4RMHA 2REQB 3EXHA 4FDVA 3IXQA 2VDKB 1H94A 1FTWA 2XIQA 2PYPA 2NW6A 3ILXA 4ZD6A 1GA4A 2PBRA 1T3ZA 3OF5A 3CUVA 1XPBA 2CF6A 5T8KC 3CZ4A 2P7IA 3BQ8A 2E4UA 4XZ3A 2L69A 4KDFA 1ACJA 2DHRA 3KVNA 3I4CA 3HFGA 2JCGA 1E3LA 4C5AA 4D2OA 4J0IA 1UQRA 2IYWA 1KWGA 3J7AC 2ZJFA 2FZEA 3PD1A 5ECYA 1OWPA 4MLZA 4F8JA 3IHAA 1NYMA 2XROA 1QVZA 5F4BA 4ENQA 2H51A 4FINA 1Z8FA 2QY6A 3AI7A 3LY3A 3U60B 4FKBA 5FWYA 4HDCA 1CY1A 3WGGA 2CXHA 4IIJF 3F8WA 4H7JA 3I04M 2OV2A 4L0QA 5BNIA 3A9TA 5CB0A 4D9CA 4RPCA 2DPLA 4I19A 4QOFA 1I30A 3OZTA 3BBLA 2GVDC 4Z51A 2YJTD 1CF9A 1MP0A 2GXSA 4GVXA 5HWVA 3KTAB 3VHLB 4WV3A 1I3LA 3WL4A 3HUEA 3I2HA 1OXBB 5ICMA 2NYUA 1R0LA 2NV6A 2JFUA 1E32A 2Y2JA 1MG5A 5DN6A 3WVNA 4IIFA 2LB9A 4DSAA 3NPAA 4PFJA 3C2QA 2BI8A 4MAAA 3AW9A 3TINA 1C2TA 3TW6A 4RD0A 4CIWA 4EWFA 1IOVA 1PT8A 5B37A 2B6HA 4HPXB 5CX1A 4ZARA 5ARDA 1ML4A 1RZ3A 2QTVA 2XXBA 1B14A 5CFNA 2BOVA 4NPCA 3BK2A 3OLCX 2UYCA 3GLFB 5EMJA 4QJIA 2AOXA 2ZUTA 4R1NA 5IAOA 3L40A 5CIWA 2I7VA 3CFYA 4M1QA 1S7CA 1P1FA 4TUYA 1HGXA 1PYDA 3KQOA 4FZJA 2XZDA 3OZEA 3WIBA 3Q8MA 4KUEA 3KYCA 1TCVA 4OI1A 4YLGA 4AP9A 1GWNA 1BN6A 3FV7A 1UFQA 2QJ7A 1JYFA 1N25A 4P84A 1CF4A 2W98A 2ZFUA 1X1CA 3BTVA 3JQQA 2C8VA 4OM8A 1J06A 4R54A 1E3UD 3GU3A 3VR1A 4OHWA 1N0IA 1YI1A 3WDMA 2O3SA 5G4YA 3MN1A 2B1IA 2O14A 4E5DA 1QHXA 5TBMA 1NLFA 1NXPA 1LLCA 4UQIM 4ZAXA 2SNIE 3IUMA 3FFBA 4IDHA 2X5OA 2PO5A 2VA9A 1AUQA 4FVTA 3MA0A 1JG6A 4W5RA 1NNI1 1XROA 2AZTA 5I7VA 2FMFA 4BLMA 1NY6A 3NCKA 2JK1A 2OKCA 2V1BA 4QG7A 3UPPA 4YJ2F 3HVKA 3MWLA 4YRQA 4BLVA 3URKA 2ACVA 5G02A 2FUEA 3SSMA 3WLLA 4JUBA 1XDWA 4EI8A 5TR9A 2HTEA 4EL0A 3O3MB 4RV4A 2R6HA 1FJGB 4RVDA 1V95A 4IH4A 3BH7A 3C14C 1FYVA 3AUXA 4YCCA 4Y1GA 4X62B 2FZWA 4IXDA 3RFUA 1MWRA 3PICA 4LMBA 1VFNA 3W79A 4KQ9A 1ZRSA 3ZDRA 3J81A 3OZFA 3OP4A 1TK2A 4K28A 1V6CA 4CLXA 2BWJA 2OV5A 2VJAA 2ZWIA 3KJXA 2PYZA 4DR3B 2V55B 2FZ0A 3TE8A 1HUQA 1K54A 4N5NA 3RVKA 4Q1FA 4I3FA 2P2YA 4G5FA 5EQFA 2FCRA 3OE5A 3VBCA 3M4JA 4MO9A 3I5XA 3A6DA 2E49A 3L41A 4KWTA 1T35A 1XFNA 4DMUB 1C30B 1X13A 4X41A 3HA2A 4L9GA 3VUFA 4MV5A 1N77A 4C0XA 4EHAA 1SHTX 3OKAA 2RAVA 3TIGA 5L3SB 4DN0A 5KOYA 1P5HA 1Z6ZA 1A8IA 1IYQA 1BMTA 5DLQC 4C0LA 5T8KA 1IMJA 2OAGA 3CCFA 4WNAB 3I09A 3UANA 2V4MA 2WFMA 2B5VA 1G20A 5KWEA 1HDXA 5CVTA 1JIQA 2EP8A 3RJ9A 5J4HA 1E1MA 1J90A 5GJWC 3IPAA 1HYEA 3R0XA 1Z82A 3PSAA 3NBYC 3R44A 4QYWA 3IQXA 1RPAA 3R9XA 5F83A 1S4SA 2P9YA 1MXOA 4NZ9A 3P9ZA 2PGOA 5HBRA 3RIXA 2RBEA 3I23A 3BIWA 3QBTA 4X3OA 4CG1A 1EM8A 2HK8A 5FUVA 5KYUB 4OQEA 4NS1A 2AYYA 3HYLA 1VIYA 4MWCA 4BV2A 4RTKA 2JATA 4MZXA 4J0JA 4BYMA 4HD8A 3SD7A 4AS3A 2IZ7A 1CY4A 3F6CA 3THYB 5FEFA 3IV6A 5AXDA 1ZHHA 2BAGA 2C4MA 2DT8A 2RH5A 5DBOA 2PRYA 4PLCA 5H83A 5K6RA 3F3MA 2X4DA 2PD6A 3C8UA 3FJYA 3L93A 2E8IA 1SXJA 1Z8NA 3KELA 1XJWA 3BHNA 3UWKA 3IELA 1D2GA 1NKVA 3G6WA 4HDNA 3QXCA 5A4MS 1Q2PA 1AUPA 1XKTA 1G16A 2FW9A 2A9FA 1M6KA 5H4HA 3GUHA 4JBXA 1T2FA 1T1SA 3B8HA 1GTZA 5FBQB 5JJLA 1GL9B 5JXHA 3HKDA 4KNVA 4QJ4A 4QTZA 2W71A 2AA3A 3NDEA 4QPPA 4EPYA 3E7PA 3IA2A 4RBNA 4BQSA 3G0HA 2R87A 3LT0A 4E3WA 1I2MA 2ZQYA 4LY9A 1KE1A 5BSEA 3EH1A 3DW0A 3LI8A 2CFTA 4RSGA 1LD3A 2VH5R 4COKA 3C5AA 4QL3A 5F7XA 2R9WA 4BUCA 5MHTA 4RK5A 1JDNA 3THXA 1E3WA 2GZRA 2BMWA 4XUGB 4HB3A 4D4IA 4OYRA 5JCJD 4GKBA 2K7SA 4HUJA 4HG2A 1JDUA 4MQBA 2WWYA 2CUTA 3IJEB 2GN6A 5HL1A 3HCYA 2FFFB 1W0KA 1UBTS 4CIXA 2DTEA 1FX0B 3DTEA 2X19A 5FBZA 2BMEA 2REOA 4TV9A 3TG8A 4OBWA 4XWGA 1AS3A 4U02A 2PFKA 2R4TA 2WUFA 3H5LA 2YHAA 1SIBE 2PFSA 3KXPA 2GZHA 2FG7C 4YHHB 1WPGA 1EP3B 3I8OA 1Z25A 3GDWA 4EZEA 4F11A 2JHFA 4LZNA 1R50A 1D5CA 3AR2A 3N86A 2JG3A 3IGFA 3ZBPA 4LYDA 4NFLA 2HLDA 2XW6A 4ARIA 5SZJA 4RIIA 1PIWA 1IY1A 3KSMA 2CHUA 3DV2A 5LU9A 1FVOA 4DRXA 2XOEA 3ZYCA 2CCJA 1NMZA 2I6GA 5I8WA 1NRJA 3N2GA 4ZOLB 2BIFA 4KMMA 1SAYA 1KP9A 4UAAA 2NZ8A 5TV2A 2HB6A 1Y8RB 4MW6A 2W2VA 2W22A 2Z9CA 5L7WA 4IRUB 3ZBQA 2JKGA 4KPGA 3PE6A 5EIXA 1VBMA 3B3GA 3M4ZA 5G41A 4RVUA 3PK0A 5EMNA 4DR5B 3FFXA 2I62A 1RFGE 4AB1A 1H9BA 1BC5A 3T0FA 1YZTA 5CYPA 1KI9A 2P7HA 4FI3F 3A6GA 2B30A 3GZ4A 5L3QA 1XL1A 1AGXA 4RY0A 2BFFA 2H1CA 2H2DA 3AK4A 2HDQA 1ZK0A 2C5EA 2V97A 1E9FA 5BP7A 1WQ3A 1W94A 3EF3A 1DC5A 5HZMA 4I81A 4HN9A 4BCCA 4K5QA 3ZJ4A 1L5WA 5F6AA 4CXMA 3PPVA 3S8YA 2FWMX 3PWTA 4M53A 1FFXA 5SY9A 4UMVA 5EVLA 2HCJB 1RGZA 2BLNA 3FJOA 4JLJA 5CT6A 3OCYA 4ND2A 1BG6A 1PNVA 3IAS1 5HFNA 4WDRA 1SK9A 1YKGA 5I9BA 1N2XA 4HZGA 4F4HA 4LJSA 5DTIA 1N1MA 3ZOKA 4QUHA 1Q0RA 3W5CA 4ZV7A 2WAOA 1I3MA 3C24A 4MK4A 4BLUA 5AUNB 1VZ3A 3L49A 5CTNA 1QCYA 4F91B 2YFQA 3GCZA 5COBA 4GSLA 1PFLA 3PIRA 3WP1B 5CEEA 3C38A 3GMWA 4P31A 4KZ8A 5HUQA 3TTUA 1ELOA 3HUNA 2CV2A 4XJSA 1CB7A 1W1IA 2H3EA 2FP4A 3UTCA 2DBQA 3DLBA 4YACA 1T4MA 2GD2A 4R3AA 2J09A 1SVNA 4M8NE 4ILEA 4MGHA 4E5YA 2PAVP 3R6LA 4PBRA 3R7WB 2AEEA 3TZHA 2RONA 1E1KA 1Y6FA 4FB5A 1GCAA 4Z0TA 3FOZA 4N49A 1GGEA 5D86A 4QVIA 5GLCA 2WSSD 4WLOA 4QYXA 4RD6A 3EMVA 4IM7A 1XUOA 2V03A 2OXFA 3IBGA 4KACA 1ZM2A 2I80A 4QB8A 4UMEA 2EJUA 3RD5A 2QMYA 3S7QA 3IX4A 3AIKA 5BVHB 4NG5A 3NBAA 1RRCA 2R8RA 4M22A 1P31A 4Q0JA 1OZHA 1LLBA 3Q1KA 1NOIA 3G4PA 3T7CA 5EZYB 2D1RA 3DTIA 3KYDB 2BFEB 3UA4A 1A72A 4BVKA 3NJ8A 3SOPA 4LXYA 2YXDA 2DCFA 3T3HA 4MDEA 2FAXA 2C2GA 4A36A 1TQ8A 4HXEB 4FILA 1M40A 4BJPA 2HDSA 4KQMA 1SKYE 1ISMA 5JDCC 5HWSA 3OP1A 3V7WA 2V65A 2W2TA 4IV5A 2F3UA 5IXSA 3CLTC 3RU9A 2JF0A 5J47A 3ROKA 1G8SA 8ADHA 4S1OA 2KOIA 4ZCMA 4DM3A 4TYYA 3STWA 4ZVVA 4XR4A 3PQ3A 2HP9A 2GDNA 2IXDA 4MROA 3VYTB 4IXTA 3DCNA 1SDNA 2NXJA 3DZKA 2WI8A 3AR9A 4GGMX 1QRAA 5K8CA 2Y4AA 1D4FA 1DKUA 4QTTB 1QV6A 2X76A 3JATA 2XNDA 1EWRA 3QG1A 4WN9A 2HP5A 2J5QA 5JU6A 1XA3A 2F64A 3LVQE 4ZEOA 4DMLA 3TFOA 2H2GA 4GX1A 2NU7A 1XJ6A 1EZ4A 2HK6A 4QD4A 4PYQA 3QXHA 2AUTA 2R9XA 4OB6A 3HM2A 2BZ1A 2R5WA 3V8NA 1OHHD 1AUOA 1DP6A 1HDZA 3PRJA 4EMUA 4LQCA 1FRFS 4OPRA 1JWVA 3FVWA 2AUMA 3KTDA 4M6WB 3FMVA 2EJTA 1JXQA 1KFEB 5HM6A 3N0WA 1T3HA 2G4VA 2CVPA 5F68A 3OPRA 4UM8B 5DW3A 3OIVA 3HY4A 1IQUA 2HU7A 4K1LA 1KBZA 1GFSA 4YUAA 3A9VA 4DA6A 3ILVA 5FPKA 4R8VA 3D0OA 2EX1A 5J5AA 5DTJA 1KKLA 2VDWB 2RB4A 4S2PA 4WFKA 5KAMA 3IOCA 4BMSA 4W1RA 3IBYA 3I9OA 2E18A 3P2JA 2XD4A 2G63A 4KSBA 2WIBA 2C95A 4FMDF 1EFPA 3ZCVA 1CUIA 2WLTA 2AG0A 3CVYA 3ZYTA 3PNQA 1Z83A 4QVKA 2PWAA 1A7JA 2PR5A 2V0WA 3F5QA 3H9EO 4CMHA 1DCTA 2HV8A 1XFDA 3DZGA 5AW0A 2BGGA 3Q41A 5JASA 3K70B 1V1RB 4HDRB 1Q3HA 5AJXA 1E2EA 3FYUA 2BTFP 2VPWA 4CF3A 3FM9A 4GQBA 3FCSB 2V6FA 1L4KA 4ICIA 4WT7A 4UM9D 3GRKA 4YYEA 4RANA 4ABYA 3V67A 1GGKA 3BFKA 5DYNA 1EVZA 1PZEA 3PPXA 1B2RA