4ARZB

The crystal structure of gtr1p-gtr2p complexed with gtp-gdp
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
321
structure length
304
Chain Sequence
ATDSKAMVLLMGVRRCGKSSICKVVFHNMQPLDTLYLESTSNPSLEHFSTLIDLAVMELPGQLNYFEPSYDSERLFKSVGALVYVIDSQDEYINAITNLAMIIEYAYKVNPSINIEVLIHKVDGLSEDFKVDAQRDIMQRTGEELLELGLDGVQVSFYLTSIFDHSIYEAFSRIVQKLIPELSFLENMLDNLIQHSKIEKAFLFDVNSKIYVSTDSNPVDIQMYEVCSEFIDVTIDLFDLYKAPRNELQNVSQLANGVIIYLRQMIRGLALVAIIRPNGTDMESCLTVADYNIDIFKKGLEDIW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords GTP-BINDING PROTEIN GTR1
publication title Crystal Structure of the Gtr1Pgtp-Gtr2Pgdp Complex Reveals Large Structural Rearrangements Triggered by GTP-to-Gdp Conversion
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 98
structure length 304
sequence length 321
ec nomenclature
pdb deposition date 2012-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF04670 Gtr1_RagA Gtr1/RagA G protein conserved region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.190 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4arzB02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4arzB01
2YV5A 1R6BX 5C4MA 1OT3A 3U3MA 3VNUA 1UDXA 2Z83A 2ZE7A 3KDSE 2BJWA 1S8FA 3BB3A 4GOJA 5F2EA 1W0JA 4CIDA 1C9KA 1XBTA 3KQKA 1KMHB 2ZYTX 2F7SA 2MMGA 2RMKA 2ZPTX 1E2QA 4QJ3A 2Z43A 3CRMA 1G7SA 4AKIA 3T1VA 2ATVA 1ZVQA 4PSKA 4ACAA 3TKLA 2CVFA 1U98A 2Z5FA 5FBRB 3ONWA 3VTKA 1B0UA 4W9MC 2V4ZA 2CK3D 1FUUA 3HJNA 4ON9A 1Q1ZA 3U44A 5BW8A 3SYKA 3X1WA 2D74A 5IRCD 3H0KA 4F92B 1AZTA 1E4VA 4QGFA 2ORWA 3IIKA 2WAXA 2JLSA 3RC3A 4BLOA 2PL3A 4FWTA 5CLLA 3QY0A 3RWOA 2FSHA 3V9PA 3SBDA 2X19A 2A9KA 3K9NA 5JWOA 3AKYA 2VSFA 5EE9A 1DO2A 2XTZA 1E79A 1TUEA 3CONA 3GLFB 2QORA 1HV8A 1ZP6A 5EP3A 2DHRA 3RYTC 2JATA 5BQ5A 1X8JA 1N6IA 3MG9A 5DO9A 3ADKA 2GZHA 4I1UA 3U7GA 1XTQA 2TMKA 1NMXA 4JVMA 2W6ID 3TH5A 2XZOA 4PC6A 4LV5B 5HKKA 3NC0C 3GLGB 2MSDB 2ZRAA 3S1AB 4DCNA 5JCPA 4B71A 1FX0A 5LB2A 3SFZA 3DZDA 4GT1A 1NSFA 5CITA 1LS6A 2QPOA 3WMFA 5HCNA 2R6DA 1Z0JA 5K8IA 2NO6A 3KZ1E 1D9XA 2C95A 4B6EA 3RSLA 3TAUA 4Q9HA 1O87A 1UKVY 4H1UA 4LJ5A 1PJRA 5DGXA 1RKBA 3QF4A 4TTQA 4D4LA 3I8SA 4XVQA 2G0TA 4QFMA 3UXMA 4MRPA 4RJLA 3GJ5A 1TEVA 1EWQA 3UWKA 4DLZA 5KDOA 2J3EA 3AVQA 1W46A 4FCWA 4M1TA 4QHYA 5JI3E 4PC2A 4PAQA 3V4FA 3IQWA 3B60A 3IEUA 1ETUA 4A4DA 3CF2A 1JXOA 3NBYC 2G1JA 1ODFA 4Q1EA 4HB0A 1G7TA 2P67A 1J2JA 3KX2A 2CCJA 3B2EA 5FTJA 3HPRA 4D0LB 1ZIOA 3D31A 1IN5A 5B64A 1BKDR 3W9YA 4BLPA 2ZRHA 1D6JA 3LLUA 1ONBA 5BYKA 1I2MA 1G1MA 3VR1A 3U6KA 1TQ6A 3GLHA 2ORVA 5L3QB 5G3ZA 1YR7A 4KSBA 1P2TA 4P33A 5FI0B 3VHXA 4D4JA 4LC0A 4CT5A 1VYVA 1U0LA 1V5WA 3BB4A 4JL6A 3SE0A 5IHPA 3W6PA 2PLRA 1DELA 1I2DA 2OV2A 3NEYA 1Y3AA 4KHZA 4OQNA 1T8TA 1EFRA 2FFBA 4IVPA 4LJ4A 1X1SA 1CEEA 2JA1A 3U7FB 1MRSA 5LPNA 3BH6A 1BIFA 2GBLC 4WZBE 1EK0A 3AM1A 3P20A 3IHWA 4KFTA 2ZRIA 3AVTA 2F3TA 1N6LA 1KO8A 4GBMA 2P5TB 1S3GA 4LBZA 4ZDKA 2UVQA 4IEIA 4QM6A 1OYWA 4G1UC 5C2JB 1Z2CA 1CJKC 5E95A 3TUZC 4JVNA 3VKHA 1NRJB 1KDTA 5B57C 2F1RA 2QAGB 4HB2A 4DDUA 4BLTA 5FI1B 4YXWD 5J4VA 4JLVA 2R6CA 3EARA 5AUOB 4PTLA 4DUGA 3BRWD 4Q9JA 2YINC 3EIEA 1Z63A 1HYQA 1NLZA 3OZXA 2J45A 4DCVA 4W5JA 3H1TA 3RS4A 1W5SA 2XB2A 1BH2A 1XF9A 5FBWB 4QBGB 4RSGA 3X1YA 1GAJA 5FPKA 3F0TA 3LFUA 1Q20A 5F98A 1CF4A 4KODA 4WIAA 2RGNC 3ETLA 1CJVC 4I1SA 1W0JD 2QN6A 1ZNXA 3ND8A 1FTNA 4HDCA 2HT6A 2WMNB 2HYIC 1NN0A 1AQUA 1DARA 3T1TA 4UQOA 4DDWA 4TMXA 5DE3A 1KI4A 1YRAA 4N3NA 1IN8A 4TT3A 4CYMA 4CEJA 5FOXA 4AYTA 1OKKA 1YZGA 5M04A 1XXHA 1OLOA 3PEWA 1P72A 3OEEA 3WHKA 5G3YA 1KO7A 1U81A 3KB1A 2IX3A 2OXCA 2ZYWX 1R2QA 4L9SA 1KK3A 1OIXA 2VHCA 3LBHA 5G40A 1KMHA 4EAQA 3AKCA 3TMKA 2NG1A 1J8YF 3CZPA 3A4NA 2DBYA 2FN4A 4DWJA 4LOAA 3RANA 2KBFA 3P26A 2ZRGA 3OHMA 5BN3A 2VH5R 1IJEA 2IYWA 3LBNA 3NWJA 1S2MA 4KLZA 1GKUB 4UKDA 3QI2A 4BWYA 4RZXA 3TJZA 2SHKA 3K0CC 1E79D 2B8TA 2VF7A 3GPLA 2EFDB 4TL9A 4A0FA 1ZU4A 5SZIA 5L3VA 4PC1A 5JS7A 3KQNA 3B1VA 4JYCA 3QXXA 2Q0HA 1DAFA 2QM7A 4Q48A 1XJQA 4XH9B 4AD8A 1HEIA 2CHQA 5HKKD 4M2LA 2H1LA 4LUCA 4ARZB 2P65A 2DFTA 2ZAMA 1XEWY 4DSNA 1ZD8A 1GIAA 1AA9A 2J7KA 2JJ8A 1G19A 1QHNA 2LKCA 3LLMA 4LBVA 3GLFA 2ZU0C 3WYGA 4B47A 4JLPA 2OCPA 5JS8A 1NVXQ 3VU9B 2ZEJA 1RYFA 4HLUC 5LDDC 4URWR 4BE7B 3SQXA 2PMKA 4F91B 4FIDA 2V6JA 4NYMQ 3NHAA 1KSGA 1XX6A 1G16A 3REGA 1Z08A 1M7GA 3GLGA 1QHXA 1Z5ZA 2QPTA 3S1AA 3C14C 1Q0UA 2WM9B 1ELOA 3H84A 3U3RA 3W90A 3CRW1 1NLFA 4MQBA 2FF7A 2B21A 1S1CA 1Q3HA 3OIYA 4WOPA 4B34A 2J46A 2ZRMA 4Q7LA 3VKWA 3KJEA 4OQMA 2QSZA 3O8CA 4JKYA 4AYWA 4TMTA 2FEOA 4QGGA 5AUPB 1G64A 5DN6A 1QDEA 2RH5A 3PCRB 3PUXA 2FA9A 2XGJA 4B43A 1F3OA 1KI3A 2WICA 4HAZA 4D0NA 4U00A 1GL7A 2JLRA 5BYJA 1DAEA 1E9FA 5DI3B 3PEYA 1II0A 2B7CA 1TX4B 3BORA 3FVQA 2WJIA 1P6XA 2CJWB 1QG2A 2GJ8A 2W6JA 1OPXA 2WWYA 4KV9A 2ANBA 2REBA 4JIMA 5GJWC 1TL7C 3Q5DA 2Z4SA 4NTZA 1WA5A 3W6NA 2JLWA 2QZ4A 1PVOA 2RGXA 5TXGA 1E32A 5D3MB 4CDGA 2PX3A 2WBLC 3I3SR 2C03A 2QMOA 1NBMA 1E2JA 4QBFA 1P62B 3I73A 1EFRD 4B32A 2IA5A 4FMBB 1LNZA 1NN3A 1P4SA 1E0KA 2CLSA 1ANKA 4LYAA 3ZDQA 2P5SA 2IK8A 1AN0A 1A82A 3B85A 1NIJA 1CRPA 1NVUQ 1E9DA 2FU5C 3MWYW 3DVLA 1KZ7B 5HE9A 4DVGA 5KSOA 4ZCMA 5L3QA 2IYXA 3PQCA 2HF8A 2WVJA 1FNMA 4EPTA 4L16A 4PAMA 1T91A 4NYJQ 1E0JA 1P2SA 5TARA 1IXSB 4IVRA 2BIFA 3QKTA 3PJRA 1W36D 1SKQA 1S4QA 3GEIA 4XVRA 4B2LA 4DUGD 2CDNA 3MJRA 4BFVA 2QPAA 4RZUA 1J8MF 2PCJA 4BUJA 1W2HA 3G0HA 3FKSA 1SVIA 1VCNA 5JECA 2P0EA 2DWOA 1XTJA 1GL9B 4AURA 4I81A 4DCTA 5FOUA 4AKGA 3CWZA 4JKIA 2ZR7A 4N1AA 4OK6A 4V03A 2REXB 4XSHA 2O8EB 1CRQA 4M1OA 3JVUA 2FSIA 5B58C 2QAGA 1E9SA 3RS7A 2EQBA 3OEHA 1S1MA 2BV3A 2D3WA 2RGBA 1XEXB 3MWLA 4PQRA 4KSCA 3N70A 2C9OA 1T9HA 1YU9A 2BCGY 4TT3D 5A0FA 5HE8A 2QENA 4RZ2A 4US1R 5EQTA 4A36A 1VHLA 3JZMA 2JLZA 1T3LA 2L0XA 4O0MA 3ZZUA 2BM1A 1OXSC 4IDNA 5EP1A 1NVVQ 4NCJA 3OEED 4A82A 1QVRA 2JJ1A 1WB9A 4MGYR 5J40A 1KY2A 4TSFA 2AFIE 2X2FA 3HWSA 5EE5B 5K8UA 4RD6A 2PLFA 3C5HA 1N6NA 2XTMA 1G6HA 2ZI7A 3D6TB 3RVBA 1NIPA 3AF1A 4MUBA 2EVWX 4TYQA 3GLIE 3QXJA 4BEBA 4JSYA 1BS1A 1S3SA 4GMXA 4JL8A 2OSBA 121PA 4TMWA 4URXR 4G5QA 4R98A 1JAHA 4X8OA 4OHYA 1TQDA 1L4UA 4LGMA 4Q4AB 3A8TA 4IDPA 2GJKA 1G7RA 1II9A 4J0QA 2B92A 3BD9A 2D62A 3EASA 1TU4A 1YE8A 3PV0A 1BO6A 4P4SB 4IDHA 4BLQA 1E2HA 3EX7C 4JLBA 2ZRNA 4TN1A 1NLYA 1PLLA 2N42A 4B35A 1S96A 3SI7A 4TWZA 1LVGA 4WBSA 1JPJA 3SJZA 2V1XA 4PQFA 2GNOA 4I1OA 2AHOA 3Q3JB 1E2DA 3L0PA 1DAHA 2JEOA 4P3YA 4ZI3A 3KXKA 1ZM2A 4E5UA 3A1WA 3DKVA 3GJ7A 5J4YA 1AKEA 1F2TB 2FH5B 5FUYA 1NN1A 1M6NA 2O0JA 1NSTA 4RY2A 2ZS9A 5JCZA 3HR7A 1DAMA 3OIWA 4A92A 2YWEA 3AB3A 4C0LA 4D6PA 4C2TA 2IWRA 2ZJ8A 2NZJA 1Z0FA 1KJWA 2OAQ1 3EXAA 5FL3A 1TF2A 4C4PA 2OT3B 1KK1A 4MA4A 4ARZA 5IT5A 2DFKB 5KSYA 2GCPA 3DOFA 3BBPA 4XSGA 3X1DA 2GZDA 3SJBA 3VAAA 3REFA 1D9ZA 2PZGA 2ZI5A 4LJYA 4PHHA 4EUNA 5FPSA 4LYJA 3VU9A 3KKQA 2J0UB 4Q9LA 1OH5A 4R2HA 4M1YA 4IDQA 5B2ZA 4IJMA 1G7CA 3DOEA 1T3HA 2ERXA 2QAJA 3DEFA 1WE2A 5DN6D 4Z1MA 3A1SA 1VIAA 4NMMA 5AWFC 4BZQA 3GFTA 1W36C 3WBJA 1W2GA 4EPXA 821PA 4M1WA 2OHFA 2QL6A 3RAPR 4NCHA 3CF0A 3NVAA 1O3YA 3SN6A 1KNQA 4DLUA 1RZ3A 1NMYA 1VCMA 2W6JD 3TNFA 1J99A 621PA 4CT4B 4D2IA 2FSGA 2ZJYA 2BJVA 4R2IA 4TL7A 2AXPA 3AVWA 1IXZA 3LW7A 2HJGA 2IC5A 5HCIA 1IONA 2W6IA 1T0HB 2A5JA 1D5CA 2ZSBA 3B6EA 1TADA 5CB8A 2XXAA 1W44A 4OKSA 3IDQA 1OJLA 1KSHA 1NBMD 1XJ0A 2ZSDA 3PR1A 3QXHA 3P4YA 4TQ9A 5DI3A 1LFDB 2ZR0A 2AXNA 1KAGA 3RNLA 2CJWA 5CM8B 3BFXA 4LJ7A 1HQCA 5KSPA 4V0MA 3ZVRA 3BH7A 1I4TD 2ZJZA 2GEDA 4BZXA 3SJAA 1BYUA 5D3MA 2IS6A 3AF2A 2WPDA 2EFCB 2FPLA 4A0RA 4JLJA 2HCJB 1JXMA 2J1LA 5E7MA 2ZSEA 3ZVLA 2GF0A 1C1YA 5H68A 2JIZA 3SBEA 1IXRC 1P2VA 4DDVA 2HYDA 3Q8XB 1TNDA 4W7SA 4F4CA 3BOSA 2A30A 4HEJA 3IKJA 3ZQJA 4IOKA 4A2QA 3FKSD 2VP4A 3FMFA 2VP5A 2NIPA 1G291 1C4OA 2YNMA 1ZYUA 2V55B 1G9XA 3W8RA 1YZNA 4Z51A 1P60A 5EZ6B 4XIGS 1VCIA 5EP2A 3CBQA 3HU2A 5AJZA 3B78A 2W58A 1F48A 1G4UR 3GD7A 4ASUA 3IIMA 4B75A 2JLVA 3Q7PA 3PFIA 3ZQ6A 2OLKA 1XB2A 1OXVA 2BEKA 3U61B 1DAGA 1EFUA 3K1JA 1GL6A 1PV4A 3P32A 4HLUA 4JLMA 4KBFA 2R8RA 2B7BA 4Q7MB 5CK4A 4UXJA 5CJPA 2O8EA 3TQFA 3KJHA 1KI2A 1LV7A 1U0JA 2JJ1D 2Z4RA 4YMSA 4EKDA 3ADCA 4DB4A 4TSFD 3CR7A 1UM8A 1XEFA 3DMNA 4D4KA 1LY1A 2QTFA 3UK6A 4DSTA 3AF4A 4LHWA 4B3XA 1JBKA 4X8MA 1XEXA 1ZNYA 4OHWA 1FQKA 3K09A 4OJKA 4Y0AA 2PMDA 1QHYA 3E70C 3EG5A 3F5FA 4QGHA 4GSYA 5FH9A 2FWRA 4E09A 3KQLA 2FFQA 2J9RA 2IXFA 3GJ8A 1NG1A 3WP1B 5AJYA 1RW4A 1OF1A 2JCSA 4GDFA 5FR2A 3U5ZB 2FDCA 4Q1FA 5FTMA 1ZC3A 2XJ4A 2IUTA 3X1XA 4LSGA 1KAOA 1AGRA 4Q47A 1Z28A 3QE0A 3FB4A 2QGZA 1E2IA 4MGKR 4A8JB 2ZAOA 3LH5A 3UATA 1ZM3A 2YJTD 4PPGA 2GCNA 1G8HA 2J0SA 2DYKA 3RHFA 2IW3A 4YQFA 1IN4A 2BDTA 1JPNA 4TLBA 4AYXA 1GOTA 3CH5A 3HYTA 3AKEA 1TTTA 2VP2A 4Q4AA 1N0UA 1ESMA 2ZSAA 4IFBA 2R9VA 1QG4A 4L9WA 4TYWA 2E1RA 4P4SA 1PZNA 4JJKA 4RCYA 4TLAA 5DISB 4OQLA 3KUCA 3WYFA 1W4RA 4QBHA 4DLTA 2JJ2D 2YVUA 4GFDA 5EUQB 2OLJA 4TQAA 3PEVA 4W5WA 2B6HA 3A4MA 3L8ZA 2F1JA 2F1IA 2YYZA 3FMIA 1QF9A 1F2TA 4JMPA 4KYUA 4QRHA 1CS4C 1GRRA 1Z29A 3CNOA 2AD1A 1RYHA 4DLWA 4QJ4A 4PHTA 1Z83A 1MO6A 1WRBA 3M4YA 2OFWA 3LVRE 4PHFA 1ZNWA 3AP2A 3RS0A 3I61A 1EG7A 2W0SA 4Z1MD 4TMZA 3THOA 4WZAE 5SZJA 4JSTA 3ECCA 1EWRA 1NL3A 2IYSA 3VR4A 4BLSA 1G4AE 4GZLA 5C46F 4HUQB 1U2RA 2G6BA 2BBSA 2V54A 4M1MA 1KKMA 2W2TA 4IDOA 2WWIA 2IEZA 4YMWA 3R9XA 1YHNA 4NPHA 2QNRA 2Q9AA 1SXJE 1HT1E 2ZVPX 1DE0A 2QP4A 3N2EA 2WKPA 3DM5A 2J0UA 2OBLA 1G6OA 4E03A 4JLNA 3C16C 2MMCA 1BYIA 1E98A 1SVMA 1MABB 3GCGA 4C0QC 4KXFB 2IUSA 3NXSA 2ATXA 2VHJA 3TVTA 2QAGC 2OXRA 1D2NA 4DXAA 1XNJA 2R6GA 1T4GA 4IRUB 1T8UA 5CIWA 4RCZA 3T15A 4Z8YA 4LRWA 2QRZA 2OFOA 4NH0A 4JLKA 2FPMA 4OQFA 5HR5A 4BFYA 2H57A 2KSQA 3QQ5A 5FBLB 2P6UA 3Q85A 2FOLA 4PPFA 2W2VA 3L0IB 3SJCA 1FQJA 2XNDA 1XZQA 4ZDIA 1XPRA 2ODNA 2WPDD 5J4KA 3A6PC 1ZBDA 1DO0A 3QPWA 4Z8XA 2E87A 1CP2A 2CCKA 4Q9IA 5H70A 3ZS8A 1FFHA 2J7PA 1P3JA 4I1VA 1HURA 3PENA 4Q1BA 1E9CA 3Q72A 2JIZD 4OI4A 4ZPXA 1CULC 2FEMA 1JJVA 3KJIA 5B30A 4Q21A 4QBIA 4BFWA 2KBEA 3R8FA 2Y8EA 1G8YA 5EE0A 4CGZA 4D82A 4NYIR 1RFLA 2IYVA 1TAGA 4IKEA 5SZHB 5GVRA 3K53A 1ZUIA 4D0GA 4LBWA 1XEWX 4M1SA 5J47A 2NMVA 3QVUA 1ZIPA 2EFGA 1XTIA 3L43A 5EXTA 4ASUD 5JLJA 1TQ2A 2GTPA 4XVUA 2REOA 5D3QA 2DPXA 3FHCB 3L0SA 3M1IA 2GDJA 4H1VA 1MR3F 4KFRA 2C9CA 4PC3A 1XWIA 1FPMA 5TVKA 4P0TA 3ZVNA 1Z0KA 3NH9A 4MRVA 2DR3A 3LY5A 1KI9A 2ODWA 4OQXA 721PA 3P1JA 3DMDA 1KNXA 4KBGA 2YZ2A 3IILA 1M74A 3R7WB 1CR0A 2H5EA 2F3RA 3W3AA 3K0SA 1RIFA 3G82C 2O8BB 2IYUA 1E2EA 2XSZA 1HE8B 5L3SB 3KL4A 5FTLA 1E2MA 2NZ8A 1YJ5A 5CM9C 3IBYA 1OXTA 1KKLA 3B1ZA 1X1RA 3CRRA 5SZKB 3CPJB 5CYOA 2HDNB 3WHLA 2QQEA 4Q03A 1HY3A 2BKEA 1KJYA 2GWHA 1LF0A 2WHXA 2IYQA 2ONJA 2EYQA 1S9DA 2C96A 1A2BA 2V7QA 3LV8A 2B8WA 2WSSA 1E94E 2P3SA 5G41A 4PAOA 1Q57A 4MRSA 1G17A 3W3ZB 2Q9BA 4UNRA 5FTKA 2RGGA 4LI0A 1CXZA 1BMFD 3ZS9A 3KB2A 5P21A 2G1KA 1OYYA 2CMKA 3EIQA 4NYJR 4C30A 4BFTA 3BH0A 3H2YA 4JJZA 2E9SA 4LJ8A 4HAYA 5KPDA 3C5CA 4M9SA 5KO2A 2O0KA 4D80A 1XFAA 3QOFA 2PH1A 3CIOA 1T6NA 4NP6A 2PJRA 2FFHA 4RD1A 3RS5A 2ZRDA 3UKDA 1SVLA 3QKUA 1EX7A 4A8JA 5FUXA 1UFQA 1OXUA 2WWHA 2VLIA 5CLQA 2A5GA 4NL4H 2I1QA 2ZUBA 3VR6A 2G3YA 3LO5A 3OAAA 5FR1A 2C04A 2IHYA 4YLGA 4UJ3A 2RGAA 3H4MA 3J81k 5JZVA 3EAQA 5DIFA 3LXXA 4RVCA 2HF9A 1GNQA 1J70A 4KFUA 3VQTA 1KSFX 3CX8A 2YC2C 2ZE6A 4B3DA 1N6RA 2OEPA 2CBZA 3BXZA 2Z0MA 1SHZA 2D06A 4W5HA 5HTKA 1TPZA 4QJ5A 1A2KC 4FD2A 4TZ0A 4Q9KA 2Q3MA 2IS4A 3H86A 4PHGA 4GRAA 4QG7A 2ZS7A 4EPRA 2F6RA 1XMSA 1WBBA 1KO4A 2O52A 2AK2A 4ZCLA 5FPHA 1MO3A 2CNWA 1NNEA 1XTRA 3O8DA 4JL5A 2LWIA 1Q1QA 3ZJYA 1HQYE 4UXIA 2A5YB 1KI7A 1TEXA 1GNPA 3A1VA 1NY5A 2VPPA 3F8TA 1Z2AA 4XD7A 4QXAA 4ACBA 2EYUA 1Z6XA 3ASYA 1N5JA 4CW7A 4C7OB 1X8KA 3I32A 4HUQA 1CR2A 4P32A 2ZRBA 4D4MA 2IBMA 1CR4A 5FL7A 3VR3A 2CE7A 5KNDA 4TL8A 1QHGA 2ERYA 2C5LA 3MWJA 5G53C 3MCAA 4ZV4A 3K0FB 1U8YA 4GZMA 5CIQA 4B2PA 2O0HA 3VKGA 1G3UA 3JVVA 3RS3A 5FBVB 2XNDD 2WIBA 2CL0X 1MABA 2GJAA 2ZETA 1W4BA 1LW7A 2BEJA 5TDHA 1RJ9B 5FOVA 4GP7A 4BECA 5KHOC 1KI6B 2XZLA 2J7PD 5GJBA 2ZROA 2GEVA 1N0WA 4G3XA 4V0NA 5FOWA 3C4JA 4MITA 4BFZA 1COWA 1N5IA 3K9GA 3VX3A 4G01B 3M0EA 3K09C 4C0HA 5TMPA 3NKVA 2FMXA 4ZDJA 2MSEB 2ZRJA 4JT2A 5FUWA 3TUIC 5FFMA 5L3RA 1VYUA 2XXAB 3TVDA 3GLGE 1P73A 2O8DB 5CK5A 1AS0A 2H8KA 3BIFA 4NKRA 4URUR 1GG2A 3U3OA 1GZSA 1GDDA 1JB1A 3NH6A 2XZPA 3TUJC 1OE0A 2Q3FA 2QMUA 3ADDA 4MKIA 2GA8A 3SHFA 3GFOA 1Z3IX 521PA 1OW3B 1SKYB 3BB1A 2IWHA 5J4HA 3QNUA 3QF7A 5HPYB 2PJZA 2ZM5A 5IF9A 3ICQB 3BC1A 3OF5A 3DDCA 3ADBA 4ZCIA 1DADA 2N1BA 3BAFA 4KI0A 2CL7X 3RC8A 3KUDA 2VYFA 1VDZA 2PT5A 4G5SA 1ZUHA 4M9ZA 3TK1A 3TW4A 5KPJA 2IXGA 1WCV1 5HZKA 4Q1CA 3QENA 1AM4D 4AI6A 1R0YA 2ZUCA 1OIVA 2WSMA 2X2EA 2AX4A 2XSZD 3AP1A 4DC9A 3THWB 4JLAA 1EESA 3NBFA 2H16A 3EWSA 4Q4JB 5DYIA 3MGCA 5BN5A 4A0GA 2D2EA 1NBME 4WZ6A 2KI5A 3EC1A 3VMFA 1AGPA 1F6BA 1TMKA 1IM2A 1HE1C 1VKJA 3R7WA 1XTSA 3CF6R 4LDJA 1YQTA 2D4HA 1SVWA 2V7QD 3Q9LA 5KNCA 2WSSD 4B2IA 2VIIA 3UMSA 2O8BA 4F4JA 5L3SA 1X6VA 2YKGA 1KDPA 3TRFA 1P2UA 1AQYA 1HH4A 3HYRA 1JALA 4DLSA 1E6CA 3NBXX 4PC7A 1CBUA 3R9IA 1FP7A 3O8BA 4MUAA 2JASA 2WWFA 5GJCA 4AIIA 4C0BA 4UNQA 1XJCA 1JNYA 1OV4A 5KUTA 1JR3A 2HXYA 1XD2B 3GMTA 4DDTA 3CB4A 3RABA 221PA 1ESNA 1KI8A 3L82B 1E0SA 4X8LA 1VG8A 2EFHB 2QP3A 3MRSA 2BCJQ 2W2XA 4DEYA 3SFVA 1M7HA 2BMEA 1XCPA 4ZIRB 2QUZA 2ZVQX 2LKDA 4RKFA 1GKYA 1NJGA 3OE7A 4OI1A 2X77A 1G3IA 2ZITA 4LYHA 3E2IA 1UPTA 2IHBA 2CE2X 3W5IA 3OAAD 1ZM9A 2DFLA 3BGWA 3CPEA 2BBTA 1MV5A 2C78A 2P6NA 4EJSB 1UEJA 1GWNA 3A1TA 4WW0A 5DSZA 1CR1A 4XWAA 5KTYA 3M6AA 2GRJA 1SVKA 1PLJA 4NU0A 2IF2A 4IVQA 2AWOA 3PUZA 1JQLB 5J5CA 1R5BA 2G9NA 1J7KA 2G77B 5CJ2A 2HCBA 2HJVA 3AH8A 2OE2A 4U7DA 3ZZTA 1R10A 3U60B 2RHMA 2ZJAA 1D2MA 2NGRA 4WA7A 3SS8A 1K8RA 2FX3A 1VG9B 2FZ4A 3LAWA 4FN5A 3EC2A 4UXHA 3MJHA 4D26A 2CNWD 2I1VB 3A36A 3NBZC 3A4LA 3W8NA 1A1VA 1JI0A 1XMVA 1GP2A 2OBNA 2ZRLA 1YVDA 1GITA 1JEEA 1N5KA 1E9BA 2ZS8A 2XITA 5JJLA 3TSWA 4XD7D 5DLQC 4LYFA 3SU8A 4B3GA 2O8CB 3RSOA 2K5UA 2WTUA 3N2IA 4MRRA 2OG2A 4EFMA 2OUKA 5FL7D 4OHXA 4KLNA 4MKGA 4A2WA 3T5GA 1YZTA 4AG5A 4IOJA 1MH1A 2LCFA 3AQ4A 2W83A 2IYRA 1DVRA 3SEAA 2CXXA 4O2RA 3R8CA 2QG6A 4RKEA 4DRZA 3I92A 1V43A 3A58B 1UJ2A 2JJ2A 3KKNA 4PR0A 1FTSA 1W7AA 4DB2A 1Z6AA 1EXMA 4B44A 5JJKA 1E3MA 2FGKA 3SNHA 3THYB 1OH6A 3U7HB 1B23P 2WKQA 1I4LD 1W5TA 4DIEA 4C7OA 3MD0A 1FW6A 3UMRA 2YOHA 4FMDB 1A4RA 1COWD 1K6MA 1W47A 1Z0IA 5KOYA 3KQHA 2RCNA 1Y63A 5JEDA 2OZEA 1G8FA 1UKZA 2O8FB 3K0FA 5FBQB 1SXJB 4IW3B 2A5FA 1VHTA 4HDOB 2RGEA 5ANRB 1RJ9A 3BFKA 4ESVA 1KI6A 2GKSA 4V0KA 3IO3A 3U4QB 3DO6A 3FGNA 4IXMA 4Q02A 5C18A 4RFSB 4U5XA 4B33A 3AF3A 2VHUA 5EXSA 4MRNA 3TE6A 1Q22A 3CNNA 3UMFA 5JEEA 4C0JA 1XD9A 1G41A 3LQRA 4MYUA 3R20A 3E1SA 1OB5A 4OI0A 4CEIB 3T12A 5KYKA 4A0HA 2ONKA 4N0DA 4CF7A 1I4DD 2AR7A 2ZUDA 4TYNA 2O8DA 1G18A 2VQSA 2CHVA 4LY6A 2Z6VA 1K5DA 2GJ9A 3CM0A 3FTQA 2VSOA 2N46A 3Q7QA 5IDVA 3KQUA 2EFEB 3IHLA 1LB1B 1N0VC 2CL6X 2RAPA 3ZYCA 3ZLJA 2EU8A 3KXIA 4A8JC 2BBOA 1ZU5A 1GILA 1CJTC 3C7KA 1M34E 2RB4A 1VECA 2AD5A 4B3BA 2XNSA 1P9NA 4JBWA 2W00A 4OL0A 5E3HA 4KITB 1E2LA 1E99A 1Q1EA 3BJIC 3RRMA 5JRZA 3QBTA 2WZQA 2ODBA 4LPSA 5JHGB 4KYIB 3THWA 1F60A 1EFTA 2F55A 2YHSA 2VA8A 2GK6A 1S9HA 1G5PA 4LPKA 4GOKA 4Q4JA 5FPYA 1R0WA 2QTHA 5JJIA 2FFAA 2GILA 4CVNA 4B3CA 4EPYA 1DEKA 3AVVA 1MO5A 5TV2A 3MMPA 3QG1A 4DLXA 1RRGA 1AZSC 2RGCA 1JR3D 2I3BA 3HDTA 2ZJ5A 2PZFA 1ZCAA 4TLDA 2ZIAA 3K0EA 5F9HA 4UNPA 2J41A 1E9RA 1YR8A 1U9IA 2VEDA 1P9RA 5EJEA 4POAA 5UKDA 4FMCF 2GVDC 1U94A 4Q4LA 2OILA 2DWPA 3GFPA 1TU3A 1NG9A 3GJ0A 3NEJA 3AVPA 4LHXA 4M21A 5JWRA 1WMSA 3OE7D 5BXQC 4OI2A 1FMJA 2IEYA 2JDIA 2QQ0A 4MYTA 2FG5A 2G83A 4QHSA 3EWAA 1XD2A 3SDZA 2Q3HA 2GAOA 2IUUA 4HATA 3QXCA 5H8WA 1DG3A 4X8HA 4DSOA 4C9BA 1TQ4A 5CYPA 1JECA 1KMQA 1H8EA 1KOFA 3RDPA 3DHWC 4RD0A 4HLQB 1SZPA 2QI9C 3EZ2A 3L0OA 5DYGA 4M8NE 4ZIRA 1OH8A 2AKYA 3IIJA 2ZI3A 4TL6A 3SYLA 3OFNA 1ZNZA 4EFNA 2ECKA 1HA3A 4BLRA 4URVR 1MO4A 1XZPA 4EPVA 2QT1A 2VP9A 2EWWA 2NO0A 2FE4A 4XTRA 4EJSA 4I99A 1RE0A 5CDFE 4Q7KA 1F5NA 2BMJA 4KO8A 4C3ZA 1AS2A 1BMFA 1UKEA 3C8UA 4AKHA 1AK2A 3BWDD 1QZXA 3CNLA 4B73A 1MT0A 1YZLA 2ZTSA 3AP3A 2VRWA 4A6PA 3CRVA 4K81B 3TSOA 4O2LA 1DBSA 5J4LA 3A37A 3AGQA 1NF3A 1E1RA 1UADA 2ZQ5A 1Q21A 1S0UA 4WVFA 4DLVA 4TYYA 2AFHE 3WNCA 3AV0B 3I1FA 2R65A 2KE5A 4GNKA 3VR2A 5DNYB 4NBSA 2ZYUX 5AJVB 3WY9A 4JZKA 1QHSA 4KVGA 1U99A 2YOGA 4ZKEA 1F2UB 4PX9A 2ZE8A 5JBQA 3TR5A 1YZQA 5EXXA 3KFVA 1W48A 3LRPA 2O8CA 1P9WA 4JT4A 4L5BA 3QXSA 3T61A 4PPNA 3I8XA 4DEXA 2O5VA 1MRNA 4URZR 2RHDA 4QHTA 4ZI2A 4AY2A 421PA 4WAUA 2ZRKA 1GTVA 1VPLA 3G5UA 1CU1A 2PZEA 2AK3A 4A9AA 4BFUA 2VBCA 1UBCA 4TQUS 2WAYA 2GF9A 1G3RA 1K5GA 5LB4A 2ANCA 3IEVA 1OHHD 2VF8A 3CWQA 3AF0A 4GI7A 1Z0DA 2GK7A 5LD2B 4IXNA 3THYA 3ZD7A 4DZZA 2RGDA 1HTWA 2GESA 3K70B 1NMZA 4LJAA 3RWMB 1FUKA 4G5RA 4OHVA 2ZJ2A 1Z07A 3DL0A 3BK7A 1UDWA 4QC2A 4LV8B 2O8FA 4RZ3A 3PUYA 5AK0A 2RKOA 4RFVA 3EZ7A 5JSZB 1SXJA 4BGDA 2ZU6A 3CO5A 4MGIR 4G5OA 4M4SA 4O3MA 1NP6A 2DWQA 2YC4C 4BZPA 4TLCA 1NI3A 5EP4A 3QBVA 3PIRA 3T35A 4PZYA 4M22A 4IFEA 2WOOA 3ZVMA 3IPYA 3U4QA 1E2KA 3GQBA 1X3SA 2FZLA 4FCVA 4YC7A 3WBKA 4RFSA 1IQPA 4E07A 3ND9A 4F7WA 2JGNA 2KJQA 2F1HA 2IF0A 1CJMA 4GPTA 5KDDA 1N6OA 2GXQA 2A78A 4NONA 4CEIA 1OIWA 1IY0A 2VO1A 2OCAA 5DH9A 2C77A 3V00A 4NE2A 1WBDA 4XWKA 5ELXA 1GKIA 2F9LA 3B5JA 1FL9A 3DM9B 4GMDA 3KKOA 1TUIA 4S2EA 3B1YA 4PXAA 4G0NA 2GXAA 2ZRPA 2CLDX 1RVDA 3KKMA 1E69A 4HAUA 2ZI6A 1MKYA 1YZKA 1Z47A 4NYMR 1EGAA 2GHIA 4AKEA 5CB6A 2GCOB 1ZRHA 4HLDA 4EPWA 2ZSFA 3QEJA 1LF5A 2BHRA 1YZUA 4Z54A 3HPQA 2NOAA 3HU1A 3CKLA 1GUAA 3CPHA 2GAAA 1Z06A 4K46A 4PSVA 4TLEA 4IHQA 3T1QA 5A5GA 3WRYC 5AUNB 2GETA 1DAIA 1XDBA 3LXRA 3SYNA 2QSYA 1IN7A 1KIMA 2CHGA 1XCGB 2HLDA 4V02A 2JLYA 3HR8A 1KY3A 2F43B 4BRWA 3IGFA 2JDID 3PXGA 3B1WA 1R5OA 2XTNA 1KO5A 3EIHA 3GEEA 4V0OA 1UAAA 3U7EB 2AWNA 3GJ4A 1W1WA 2PEZA 3A1UA 4QL3A 3GP8A 4V0LA 3EPJA 4P4TA 3BS4A 1IHUA 2BM0A 4PO8A 1NJFA 4M9XA 4YONB 3GLHE 4M1KA 4AG6A 3QKRB 1H8ED 3I5XA 5LBIA 4FCTA 1OFHA 3TLXA 2UZ3A 1IJFA 4LHVA 5JMTA 4O25A 3EZ9A 1KSJA 1ZAKA 2WMOB 4KJZA 5EXPA 1Z22A 3SZRA 1YR6A 4D81A 3OFND 2J0QA 3CR8A 2OM2A 3GJ6A 3I4LA 4S35A 1OFIA 2WV9A 4KU4A 5F9FA 1WQ1R 2IXEA 2R44A 1U90A 5C1BA 2UZIR 2OCYC 1D8TA 1JEDA 4M53A 3VHLB 1G20E 4OK3A 2A7QA 3WRXC 1E96A 2UKDA 1QRAA 2J87A 4QGAA 3LD9A 4R9UC 3TQCA 1E2FA 3W6OA 1RC8A 2PBRA 1KK2A 4LCBA 1GFIA 4Q1AA 4EIWA 1SULA 4ESHA 4C0AC 2Q21A 1E1QA 4QM7A 4OJQA 2EWVA 2XOKA 4TTPA 4DJTA 3BFVA 4FINA 1ZMXA 4LJ6A 3NC1C 1IY2A 1G8GA 4MYCA 4HAXA 1E1RD 1IY1A 1D2EA 1XPUA 2GXUA 4Q18A 5H1YA 2BMFA 2QA5A 4P31A 3GLIB 3L8YA 2WKRA 5IK2A 4HYYA 3EW9A 3FFBA 3LQQA 4B48A 4UNNA 4L15A 1G8PA 2R6FA 1T5LA 3LVQE 4HI0E 2CCGA 4NDZA 3D3QA 1PUJA 3HU3A 1J90A 1JQJC 3DPUA 5JHHB 4Q19A 4OK5A 2GVZC 2V1UA 2ZANA 1XMIA 1KDRA 1L7VC 1T3SA 2JLXA 2QTVB 1XXHE 3AUXA 1MOZA 1ZJ6A 1KJZA 1Q44A 4U02A 1F2UA 4EQ6B 1II8B 1NVVR 1AS3A 2GEUA 3CUEF 2XAUA 4N0EA 4MDFA 4WXRA 3F3YA 5TB5A 2XEXA 3W5JA 2FPKA 3ZZ0A 2FNAA 1IBRA 2QRNA 3MWKA 3BERA 1YR9A 4PQYA 2BC9A 3C41J 3MUFA 1SXJD 2HT1A 2NO9A 4CZ2A 4PZZA 2QM8A 2A2ZA 4NCKA 4TTRA 1U9IC 3FWYA 1N25A 3WXMA 1KHTA 2V8OA 1XD8A 1VMAA 3CX7A 2WJYA 4HAVA 1XPOA 4Q00A 5TY0A 2WWWA 5K8TA 5KNBA 4DHEA 4I4LA 3UG6A 4CRWB 4JS0A 4TYPA 5HZHA 4TZ6A 2ZR9A 1SQ5A 2QROA 3FYHA 2PCLA 3KKPA 3LW8A 3Q5EA 4HB4A 4R7ZA 4XWOA 4BASA 4GL2A 1L8QA 3OIUA 2D2FA 1R0ZA 1DOAA 4YDHB 6Q21A 4GP6A 4NZYA 4B3FX 5JSZA 2MSCB 1SGWA 4K8OA 3OESA 1FOEB 2QT0A 5FPTA 1W4AA 2DY1A 3I62A 4NCNA 1U0HC 4LHYA 3GLFE 3QEOA 1ZD9A 3FDIA 1KI1A 2IL1A 4C0KA 2ZREA 4US0R 1ZC4A 5E7IA 4OHZA 3SHWA 3TBKA 1GVNB 3SR0A 1UBGA 4PFSA 2Q9CA 1CJUC 1Q3TA 5A4JA 3FHOA 4YMVA 1UF9A 2WJHA 4Q7JB 4MDEA 4DLRA 1WDTA 4DT1B 4XTCS 2HV8A 4NYIQ 5BWMA 3PUWA 2J59A 3K9LA 4LWZA 3U6BA 1A5TA 1KTVA 3B9QA 1W49A 1QVAA 4WXPA 2F9MA 4Q66C 4EJSC 4LHZA 3WMGA 3QSYA 4QOSA 1R0XA 3WMEA 4PO9A 4CEHB 3V4RA 4ZDWA 1EFHA 3RRZA 1ZW6A 4URYR 3FMOB 3CZQA 2HLDD 4PO1A 2IS1A 1KK0A 2VTKA 2GCOA 2QE7A 1GRQA 3EPKA 1RRFA 1QBKC 2HXSA 3LX8A 1H65A 1FP6A 3UIEA 2ZJBA 8OHMA 3FPAA 2Q6TA 4HZUB 2PX0A 3ZIAA 3N5CA 3RS2A 4A2PA 4E22A 3TGPA 2IS2A 1P75A 3LA6A 3PVSA 4Q4HB 1E0AA 4C0SA 4M9QA 1A7JA 2QBYB 5EZ5A 4XOIA 2NTYC 3CLVA 2H92A 3KTAB 3WNDA 4HUTA 2YWHA 5L8VA 5GJVC 4YDSA 1AKYA 1UEIA 2F43A 4ERNA 4DKXA 3EZFA 3GJ3A 2PEYA 1RPZA 4ZO4A 3K8YA 2QU8A 1E9EA 4IOMA 3QKSB 4LZZA 4LV6A 2BWJA 5KU1A 2WOJA 4YMTA 1RRPA 2EW1A 3IQXA 1FMLA 3SQWA 3IO5A 3K0AB 1OB2A 1P5ZB 3QKRA 2BKUA 2ORIA 2G0NA 3C15C 4FI3C 1N6HA 2W0MA 4KAXA 1GNRA 1XMJA 1E1QD 1T0JB 2OCBA 4JVSB 4P4UA 1E2GA 4L4UA 2ODEA 1ZUNB 2XOKD 1H8HA 2H17A 1US8B 3TW8B 1R5NA 4AWXA 2OAP1 2GXSA 4JYBA 2V6IA 1P61B 1VCOA 3U2QA 4B6FA 2J5XA 1IAQA 3VNVA 3B13B 3MAAC 5EE3A 4F38A 4PSAA 1ZM4A 1JAIA 1FZQA 1SXJC 1EX6A 3MLEA 2HEIA 5E4FA 1JR3E 3P4XA 2QGNA 3FOZA 4QNRA 5KDLA 4ILEA 3AVXA 4DCSA 5IK2D 3PITA 5FUVA 2A5DA 1ZCBA 3LDAA 3QPUA 2X1VA 3THXB 4DLYA 2VHTA 2V3CC 1DPFA 3AEZA 4A6XA 4BEJA 3QUSA 4DSUA 4EFLA 1DG1G 2OFXA 2AL7A 3WNBA 4LX0A 4M0LA 2FJUA 3PUVA 3MSXA 1OXXK 5DHFA 2WIAA 4BFSA 1CTQA 1OSNA 3GJXC 3GLIA 4PZLA 1N3BA 1ZM7A 3CW2A 1OKKD 3WYAA 1Q1BA 1G5RA 1Z0AA 4ITRC 3I5YA 3EA0A 2I4IA 3B1XA 3D7MA 4IOLA 4BFXA 1LS1A 1W4CA 1YRBA 4OYHA 4ZKDA 1OFTA 1VTKA 1XCMA 3GEHA 4OBEA 3VX4A 3FHTA 4R71A 1Z6GA 3D8BA 4MKFA 1G21E 4BQSA 5BN4A 1P7CA 1ZINA 3O47A 3IBGA 2VL7A 1AJEA 1E4YA 3FFAA 4A1FA 3QG5A 3JZAA 4MH0R 1KZGB 1QHHB 1XRJA 3LNCA 4BPBA 2H7VA 3EPHA 1VG0B 2NO7A 4EQ6A 1II8A 1OFUX 2C9YA 2J0VA 1VIYA 1E2PA 1W0KA 2IYYA 2FV8A 4IEEA 4QNMA 2YWGA 4FMDF 3TAHA 3K70D 1ZD1A 3OIVA 3NDBB 2WJVA 4FW9A 1BOFA 4AC9A 3IPXA 1R8QA 3U3KA 2WJGA 1L2TA 1G3QA 2GZAA 3DZ8A 4L8GA 1XP8A 1N2CE 4AK9A 5F3WB 1QHIA 4UNSA 3B8HA 1DS6A 4II7A 2KB0A 2C2HA 4JBXA 1NVWQ 1R4AA 2GJSA 3QIAA 4UJ5A 3UWOA 2IYLD 4JBYA 2ZJOA 2NO1A 2XJ9A 4HB3A 5EE1A 3P27A 2NPIA 3U44B 1FNNA 4TMVA 1VYTA 1GM5A 3WP0A 1SVOA 2R6AA 1YKSA 2R62A 3L2OB 2VHQA 3EA5A 2ZE5A 2V9PA 1M1YE 1KGDA 4HZIA 2GBLA 1NN5A 2ASEA 1E9AA 3LX5A 3SC3A 3TR0A 2DB3A 1LTQA 4B74A 1OHHA 1SHKA 4QKQA 4US2R 1RRCA 2BVNA 2WWGA 2P6RA 5FTNA 2DCUA 2ZRCA 3I72A 2QMHA 1XTKA 4PPQA 1AIPA 1R8SA 2CK3A 5DHAA 3QPVA 3W34A 1N6KA 4LC1A 2G88A 4GOXA 2H18A 3E5HA 3UPUA 2JAQA 4RD3A 4G5GA 2JLQA 4HDQB 2NQ2C 4KCGA 4DT1A 3ZD6A 2QE7D 1NKTA 4Q1DA 4Y0VA 3KFXA 2ZRFA 3AVOA 4NHOA 1VG1A 3UG7A 1Z6TA 3RRYA 2BMDA 1IN6A 1NY6A 2C99A 3AUYA 3PG5A 1X8LA 2P2LA 5GVSA 1T5IA 4A15A 1FX0B 1WF3A 4RD2A 1GRNA 2QMEA 3ZIAD 4DBLC 4XJXA 2R2AA 1Z6YA 5EUMA 3ZGXA 3X1ZA 4CEHA 2PT7A 3ASZA 1DAKA 3U3JA 2RGNA 1E2NA 5KSZA 3SOPA 1R7RA 3FMPB 2ZI9A 1SVSA 2BOVA 1GSIA 2NPFA 4MYHA 1X86B 2CLCX 4LJ9A 3X2SA 2OESA 2C8VA 3TSZA 3ICEA 5C4GB 3TIFA 1L4YA 2D7DA 2C98A 3NTUA 3K9HA 3QF4B 4Q5IA 1CLUA 1EFCA 3IUYA 3KXLA 5K8LA 4RD4A 4EDHA 4HZUA 3RRNA 4V0ME 1SKYE 3EPLA 1UKYA 1HUQA 4Q4HA 2IYTA 3LWNA 2CEAA 2XB4A 5AJWA 2QBYA 2WJJA 1OH7A 3KTAA 1CKEA 3B82A 4MKHA 1IOZA 1JJ7A 2QEQA 3CRQA 2AN9A 3NHBA 1H8HD 3CX6A 3PEUA 3NG1A 3QKSA 1U8AA 1JR6A 1Z8FA 2CVHA 4ABYA 2BBWA 2VP6A 1XU4A 3K0CA 3T06B 3VR5A 3K0AA 3QVVA 2YOFA 3VFDA 3RLFA 3GLHB 4C2UA 4LK2A 2FGJA 2WWXA 2XX3A 2ZYVX 3AGPA 3FE2A 5LD2C 4MGZR 5GADl 4FXPA 4NCIA 2VP0A 3K70C 4FWIB 3T1OA 5JRJA 1US8A 5AJXA 1N6PA 3QJYA 2VSXA 2D7CA 5AR1A 3O8RA 4B76A 4BRUA 3NDPA 1Q12A 3OEHD 2AKAB 4D25A 1TF5A 2OBMA 4PANA 3B9PA 4KVAA 1M7BA 3NIBA 1G3MA 4LBYA 5FOSA 3ZH9B 5AUQA 5JFGA 2HUPA 2IYZA 5JWHA 3AVYA 3B7GA 1TF7A 3MFYA 3FKQA 4DIDA 3LBIA 3THXA 4H9GA 2X8AA 3BE4A 1KO1A 3EZ6A 1UBEA 1WXQA 4HSEA 1W36B 1N5LA 3AKDA 4JLDA 1NKSA 5DI9A 2QY9A 4Q01A 3AVUA 3T5DA 1KDOA 2DFNA 4TMKA 2IT1A 4FMCB 5CDFA 3CH4B 3R9WA 4JVLA 1M2OB 3KJGA 1PUIA 1WP9A 2ZXUA 1HT2E 1W0KD 2JLUA 2YWFA 3T34A 2OO7A 5FOTA 4HAWA 1G5TA 4YXWA 4F4IA 4F93B 5E7JA 1CIPA 4HLCA 2QP9X 1UBFA 1PLKA 2A3RA 2KWIA 4DCUA 3HP1A 2FSFA 4YMUA 1U8ZA 3UANA 4CEJB 1M8PA 3DKPA 2ZI4A 4JLOA 1QHHA 4KFSA 1DTSA 5JI2E 1KYIA 1XXHB
chains in the Genus database with same CATH superfamily
1DKQA 2WWRA 2IXTA 3JQQA 3U56A 3LGSA 4PLTA 4PX5A 4YMHA 4CG0A 2I91A 3G7NA 3RAGA 2X3FA 1MQ9A 2IHNA 3O88A 5FBRB 3BD8A 1X2EA 2VXYA 4IRXA 1FUUA 4W5NA 5GIPE 3D5EA 5ADHA 3WO0A 4PRLA 1WCXA 4FNAA 1FY2A 2DFPA 1M2VB 2JATA 1N6IA 4PPYA 1XTQA 3TX6A 1NMXA 5DM0A 1K8YB 3LHFA 4B71A 3FPHA 1GFZA 4UPEA 3DZKA 2C84A 2KW5A 1T3ZA 2EIXA 4NMLA 1W29A 3HCYA 3RF7A 4GE3A 4XVQA 2PFSA 3HUUA 4EWLA 2F64A 3BDAA 3IDZA 1WD7A 5A5VA 4JBGA 4IDAA 4A4DA 2IWDA 2BGUA 1RCJA 3HACA 3UEOA 3ORSA 3I7JA 2UZ4A 4REQA 2YWDA 4ZRMA 4FGZA 2OCKA 5CCDA 4DC1A 4WLAA 1VMEA 3BJMA 6YASA 1YI0A 3IP3A 2XLNA 4IVPA 5IJ9B 2J3WA 1NVDA 5LPNA 2MR5A 1EK0A 2ZSHA 4KFTA 2F90A 3N3BC 4YCCA 4GBMA 2R78A 2QSJA 6CHYA 1N7GA 4OU4A 3N75A 1QKKA 4INPA 5F23A 1NRJB 1XJWA 4WMCA 2R6CA 3HVIA 2VV7A 1KY4A 2A9VA 3BRWD 3A6EA 1HYQA 4QO8A 2YFKA 5K3FA 4WIAA 1JLLB 4JASB 3O90A 2HYIC 4ETIA 2C97A 4YAKA 2G0AA 5GAJA 4EG6A 1YZGA 1ZAYA 4FYKA 1R2QA 1WEHA 3P9SA 2ONZA 3WL4A 4NC9A 5A62A 4ZRNA 3A4NA 3FWZA 1LI7A 3SS4A 2J07A 4ITVA 5SZIA 4ZGWA 3I12A 3AWDA 4PC1A 2YNMC 1T18A 2FG6C 5CTJA 5JNWA 3FMGA 4XH9B 4YAUA 2QOEA 2ZK7A 4JSRA 2GZRA 2B5VA 2ZAMA 3LJKA 1ZD8A 1GG9A 3LLMA 4DR3B 3QRWA 1PW8A 2HRRA 4B47A 1U0BB 3TDKA 1G63A 3C45A 4XIJA 1WVIA 5HUJA 3C6ZA 1QMGA 3RV4A 4B5LA 4QUAA 4E2WA 1XX6A 1Z08A 1W75A 1XRNA 3D7NA 4ZEVA 3MS7A 4JJ8A 4CHGA 3O2JA 3V7NA 2YMLA 3GW8A 4U6QA 3O8CA 1I6LA 3WGIA 5AUPB 3WS4A 4ND7A 5D6NA 3OOHA 2NU7A 3A6KA 1V9YA 2HA5A 4YPFA 3EGXC 3KQTA 1QG2A 4D56A 2JLWA 1H0RA 3HM2A 4NV3A 1X94A 1P62B 1E0KA 3ZDQA 4EHLA 2IEGA 1FTYA 3MWYW 4TVKA 3DDSA 4YP9A 3FRJA 4HY8A 3N1UA 1E0JA 3CW9A 5JYBA 2Y2MA 5TARA 1EK2A 3LI2A 5FA5A 4WBNA 4I3JA 4KDCA 5KX5F 1X1CA 4UDOA 3GFFA 2XCSB 4BVKA 1JI3A 1GL9B 2FZ5A 1X2BA 1IULA 2D5IA 4XSHA 1MXFA 1U0OC 1J1ZA 2FSIA 2X5OA 2M6KA 4ALKA 5KCZA 1X1QA 4KSCA 2FPGA 2F00A 4MEBA 2AZMA 4RC9A 1NUAA 3ZZUA 3CPTB 1EUCB 3JD3A 3O3CA 1Z68A 2ZI7A 3T4QA 1PKEA 3GLIE 4AUEA 4ZVKA 1NV8A 3R7SA 2BGIA 1JH9A 3AHJA 4OHYA 1Y6RA 3OM8A 1JT2A 4BNTA 4XR9A 4IDHA 1LPOA 1E2HA 5LU9A 3KTFA 1HZJA 2V1XA 1LFAA 3LEZA 1LC3A 3C8CA 2CYCA 4NR0A 3O93A 3TFWA 4I4TA 1SIWA 4I5GA 4ZQIA 1DAMA 4L6CA 1BCRA 2AE1A 4IUBS 4FIZA 4QOHA 2Y1GA 1Y5IA 3NR2A 3V4SA 4W1SA 3BBPA 4O2AB 3IJRA 2F4VB 5EQFA 3NT5A 2G40A 4QE3A 1RHUA 2ERXA 2ALJA 3F7MA 2EHJA 1ZKDA 5EKSA 4DLUA 4WLEA 1JWBB 1Y8RB 3L1HA 2P9VA 4JB0A 3LW7A 2UZ1A 3GDFA 1XJ0A 4KQ2A 5GINE 4YV7A 4KG6A 2CJWA 2PTGA 3U37A 3IALA 1OPRA 4BZXA 2VHWA 1Y28A 2HCJB 1YF3A 1HFEL 3ZVLA 2XWPA 4NE7A 1X7ZB 4C3QA 2JIZA 1JFFA 3G9ZA 1FDUA 2WM3A 4JHXA 4NBTA 1SHVA 1ADFA 5I9NA 2P2ZA 2E5LB 3CBQA 3QX9A 3DDHA 1J9ZA 3GD7A 1JUDA 1LRJA 3VOSA 4JLWA 3DDWA 1FDVA 4LE2A 5EPHA 3N2NA 2R8RA 1GPJA 3TXYA 3RBAA 4OUDA 1PUXA 4TRJA 2QTFA 3QTLA 1FQKA 1KJJA 1YUBA 3UF0A 4JC4A 4E09A 3P52A 4K88A 1K7CA 5CP8A 4C7MA 1ZC3A 1JSLA 4RU1A 5DSTA 2J0SA 3LCUA 3RHFA 2J3TD 2XGSA 4IDCA 4H27A 5DRYA 5A4IS 4FX5A 2R9VA 2DFDA 1VSQA 1BNCA 4XGNA 3UOAB 1XK7A 4F3KA 1F2TA 4KYUA 4KC0A 2I66A 3I09A 4GZLA 4X6UA 1U2RA 1S2IA 3WS0A 3E5RA 1UK6A 1MIOA 3N2EA 2AVDA 3T9EA 5ALSA 3P9CA 2OPBA 1FB5A 1XG5A 4QG3A 4XUGB 1BWSA 3DNMA 2V8BA 4NZNA 2QL5A 3D0RA 4ALNA 2IU4A 1ZITA 4GXQA 3Q3VA 4A91A 3R7LA 1HE4A 2JJQA 1CULC 2FEMA 4Q21A 5AW2A 4NYIR 1T13A 2IYVA 2QTCA 1GGVA 3K53A 2C29D 4M1SA 4WBNF 5TMBA 1PGQA 3WGLA 2DY0A 4CG2A 5JLJA 2ZZMA 3ZU6A 5LUBA 4J07A 3E9DA 5G02A 2VK4A 4YPOA 5YASA 3DMDA 3Q98A 1CQPA 1VJTA 4XUCA 1GR0A 5EPOA 4TTSA 2AMLA 3KL4A 1YJ5A 1KETA 4B3IA 2PZAA 1OXTA 1KKLA 4RTSA 5ESWA 1SEVA 3H19A 4C04A 4J0GA 1BFKA 3G0DA 1TEMA 2C96A 1A2BA 4HF7A 2Q9BA 1XGJA 4EUEA 4KQMA 5JY6A 3QEMB 4JU9A 4A8TA 4LV3A 3O5YA 1T9AA 3IUMA 3W78A 2J4CA 2PH1A 4GGPA 1YM1A 4JEIA 3CNQS 2CD7A 2DPMA 5IEBA 2FLVA 5AQ1A 3LO5A 3OJCA 3ZDJA 1VA5A 4I4TF 3WHIA 5L7WA 4O4LB 1HDXA 3CX8A 2OB1A 5K03A 3NHPA 4OXYA 1PW1A 4QG7A 2ZS7A 4YWHA 5HGXA 2ETXA 2G4LA 2JKFA 1TZKA 1FMTA 1E25A 1EDDA 2WG1A 1TEXA 1NY5A 1PJLA 4LHSA 3KDAA 1G8MA 2IBMA 1CR4A 1YL5A 2XNHA 2W2NA 3MD9A 4N6NA 3AHEA 2C8KA 2BEJA 1R6XA 3P9RA 2GEVA 2VYND 4D8YA 1COWA 3SZUA 4ZDJA 1S1ZA 4JT2A 3DJYA 4RCVA 1P73A 4ZEWA 3BIFA 3B3XA 2JLAA 4OJYA 4UUMA 2XZPA 1OE0A 3AXTA 4MKIA 1OW3B 3QF7A 3JZDA 4UAGA 2H1IA 4RQAA 3FZEA 1JSCA 3QENA 1QP0A 2C7BA 5KTMA 5AKEA 4CCAA 1CIVA 1TUBA 2JG3A 2EEPA 3MGCA 3TNJA 1EP1B 3HL4A 3ITEA 4XYBA 1E1LA 2GBCA 2WA1A 1L3IA 2WSSD 2CEKA 2APJA 3JVEA 2O8BA 1HH4A 4K9SA 3HYRA 4K9QA 1PO7A 1E6CA 3OCJA 4PC7A 3LUDA 3N4IA 5GJCA 4N5NA 2H1HA 3H87A 4IHKA 4P35A 2C2MA 3SMVA 3CR3C 2H51A 1FFYA 1QWSA 4ZIRB 1W5EA 2UV0E 3G17A 4RKFA 1IFXA 3TE7A 1G3IA 3MCWA 2ZITA 4AJ2A 4LFAB 5COQA 5DF8A 3FKJA 5H7XA 5AW9A 3BDIA 3L4EA 4IHAA 5J5CA 2CLEB 2H31A 2RHMA 2WJPA 3RSSA 5BURA 2RBEA 3OZEA 3EC2A 2CXSA 3MJHA 1Q16A 2NZYA 1XMVA 2DTEA 3DEJA 1XA3A 2NUTA 3DFFA 1H5UA 3LYXA 4BMCA 1VM6A 1YZTA 2NT4A 4IOJA 1DVRA 4HVTA 2BH9A 2P69A 3WLLA 2IHTA 1B23P 2C2ZA 3UJNA 3AETA 4F06A 3LF2A 4P4LA 5IVDA 3SC2A 2P6OA 2IEIA 3UV6A 3NALA 2V7GA 3TOXA 2C4HA 3F1PA 2O3QA 1K88A 1ZIXA 3OA2A 4RFSB 2X0NA 1CUIA 2ZQDA 3UMFA 1TECE 1XDDA 4N0DA 1QE0A 3A0RB 3U0VA 1QM5A 4NU8X 2YQZA 1YMVA 1TAQA 2IOHA 3DTEA 4Q0JA 2RH9B 4BY9E 1P9NA 4PZDA 2W00A 3MWFA 4FR2A 2WZQA 2ODBA 3WFJA 2JI4A 4IDBA 3IB6A 3B12A 1TXGA 1Y8ZA 3LC1O 1EFTA 1OU4A 3T7EA 2QD2A 4BNLA 2HA6A 2Q45A 5TV2A 3H1BA 3RVDA 1WMBA 2AJ8A 1IPEA 4MHTA 4AICA 2WAAA 2ZQAA 5UKDA 4ER5A 5IS2A 4BO5A 4OLAA 2CWDA 3FPKA 2X02A 3KCNA 5MN4A 1F20A 1PL7A 1UZMA 4DSOA 1DT3A 5DYGA 3D6HA 3PBKA 1XOIA 2CLOB 3OFNA 2Q8NA 4PNPA 1HA3A 2BZGA 2H7YA 3AOEC 3C3XA 5BSVA 2G06A 2VCHA 3HYSA 4HK4A 3U4GA 4KAJA 3P5SA 3A2KA 3UHPA 5K4GA 5JSFA 4NRDA 2D8MA 3NYWA 4RGYA 5FV4A 2O8CA 4LRSB 1AUQA 4PPNA 3I8XA 3NY4A 2IWCA 4OXKA 2WVAA 1SELA 1VPLA 5ESRA 3WLHA 4M9RA 2AK3A 2VBCA 2EGUA 2DQZA 1JVBA 3IEVA 4NQZA 4OH1A 1FSWA 4BU0A 2YJ6A 3THYA 4R5HA 4N0QA 4HGQA 3TZ6A 3N2KB 3DFMA 1PJ3A 3DXXA 5C51B 4RZ3A 2HOQA 4MGIR 4F12A 4G5OA 1NP6A 2WKIA 4TLCA 1ORVA 3LUPA 3ZDDA 1X3SA 4GX0A 4R2XA 4E07A 4LE1A 1I7QB 3WOVA 2F62A 5JMPA 2QLJA 2GCIA 4G5FA 3R5JA 2F9LA 3OHSX 1O94C 3DM9B 2XE7A 3AHGA 2ZRPA 4J7UA 3BKWA 4LXHA 1P77A 4NYMR 3O82A 1K9SA 1E1NA 4LQDA 1LF5A 3A3KA 1NVFA 1ESIA 1YZUA 3SDBA 4Z54A 5DHRA 4MS3A 3D2BA 3CE6A 5A5GA 5AUNB 4X66B 2HJSA 1GUDA 5I9IA 1KIMA 1XCGB 1CG6A 1TYEB 2GPYA 3EIHA 3OZRA 5G1PA 3ZWAA 4TV9A 1EE1A 1ATIA 3S6JA 1IWOA 3ZZ1A 1YFLA 3CCCA 1JDBB 4L78A 2W2MA 2H4ZA 1W88B 5GY7A 1NRWA 4UTPA 1JTVA 3TXXA 2AX3A 3B1JA 4HZGA 3G6KA 5A5DA 2JCGA 5ILOA 3ZV5A 3VHLB 2FPWA 5I8ZA 2UKDA 3E9YA 1E2FA 5CXSA 1WSBA 4QM7A 2EWVA 1DLIA 2XOKA 4TTPA 4MYCA 1VRCA 4IDFA 2PBDP 1D2EA 3AR7A 2H0TA 4Q18A 2WZCA 1T9GS 3DSRA 4FEEA 5BSWA 4FHEA 1D0SA 4IEDA 4QEZA 4NENB 2AG1A 3S8YA 4E5YA 1A8SA 1KDRA 5AVTA 1AHPA 3VPDA 1LJLA 3NDJA 4TUYA 4N0EA 2BM8A 1IG3A 3TRKA 2I7CA 2EF0A 2FK8A 1B4DA 5AHWA 2XEXA 3VOBA 5ALJA 5F7XA 2FPXA 4HTAA 1CUZA 4PGGA 5E2EA 4EU0A 4KZ6A 5HS6A 3CX7A 5A7FA 4EL5A 3CVJA 5KNBA 1YCHA 5TQ2A 3SPXA 2HK8A 2FWBA 1KRWA 1W4AA 2AYZA 3JRXA 4BAGA 3TE8A 4B5KA 4FHGA 2ZREA 5F1KA 1U1EA 1V35A 3IX7A 4Q7JB 2IHKA 3QPDA 4WUJA 4DLRA 2J8ZA 3AGDA 3E9EA 4WK2B 1K54A 5CG1A 1SC1A 3RQSA 1DXOA 4EJSC 1U0EA 2W6PA 3WMEA 3W1EA 5MDHA 4Q15A 1U7WA 4KR9A 3U4LP 4WCVA 5FTWA 3IBSA 1QFJA 4EY6A 3LX8A 4XPIA 2PNJA 2H1CA 2XZTA 1OZHA 3ZHHA 4YRBA 3GDGA 5EJ2A 4FBLA 7ABPA 2IY9A 2Y79A 3FOAA 2YWHA 4Y8VA 1C50A 4MIKA 2KX7A 4U4AA 3MOSA 1FRFS 3OE1A 4YMTA 3NHZA 2X3YA 1UXGA 2C5WB 5HX7A 1WY7A 3HJUA 2DPHA 3AJEA 1KVTA 1MB0A 3N5KA 3SS5A 3OQVA 1L5HB 3KX0X 3PITA 5FUVA 1ODLA 2QRLA 3Q3GE 1VPDA 4EKEA 4NARA 2DULA 2W6MA 5KX5B 1J33A 1OSNA 3ZU2A 1ES4A 3EA0A 2I4IA 2PD6A 5K4AA 5FD8A 4UUOA 2JZCA 3QG5A 2AFHB 5JDCC 1Q6ZA 1VG0B 4YRLA 2C9YA 2YWGA 1CUDA 3U3KA 4QWMA 1SKOA 4LZNA 5CMLA 2G9RA 4II7A 4I19A 2KOIA 1ORRA 3QIAA 2F1OA 4D74A 3M6IA 5A4DA 4AZTA 2I22A 2QLNA 3LX5A 1LPNA 4EI2A 3E4QA 2GEJA 3GPDG 1XK6A 4J94A 4AZWA 2PSDA 2JLQA 3NGLA 3JQAD 4ZVPA 4JPMA 3AVOA 3UG7A 2B4AA 4U2KA 3WRWA 3IFSA 1Z6YA 3C39A 4HNBA 4YB8A 3FMPB 5AHXA 3PE3A 4DMFA 1UBSB 2CLCX 2ZB2A 4EUKA 1VEUA 4TV9F 3KXLA 1OQAA 3EPLA 5BOHA 1FBTA 1RT9A 4CFSA 3EVDA 3G2IA 1NC3A 2Z5VA 1JJ7A 1ZXBA 2FW9A 4REOA 4REQB 3BIJA 2CVHA 3PYPA 3STXA 2YOFA 3CZRA 3AGPA 3W4OA 4JXXA 3H17A 3A3JA 3I1YA 5DTQA 2DXIA 4WCFA 4ETMA 4UZFA 1ZHOA 3B9PA 1CQZA 1XTTA 5L4LA 1I2BA 3DZIA 2FJPA 4GRDA 4E5VA 2CJYA 1KDZA 2V5AA 2AJTA 5ERYA 4GZ3A 4JLDA 3IBTA 3OCWA 2SICE 3LP8A 3GLSA 2XQZA 4FMCB 5K3FB 1T34A 4PINA 1SD2A 1S2NA 1WP9A 1ABFA 3UPTA 2NYAA 1CIPA 3AHHA 2WAMA 3SF0A 3DKPA 3IS2A 4ZT7A 1J1IA 2Z6CA 3DVSX 3QYAA 4UU0A 1IZZA 4GOJA 2OA0A 2GOYA 2B1IA 4QJ3A 5ALDA 3KSRA 3RREA 3OECA 1RGZA 2ATVA 4QUJA 5EKDA 1A27A 2EC5A 1Z45A 1CZNA 3QXGA 1FCNA 3EEFA 5I7VA 4HNAA 2YL2A 3T7AA 3PNBA 1E4VA 2IE8A 2JLSA 3V9PA 4O1IA 2RGRA 2VSFA 5EE9A 3DE3X 5AKIA 1AUVA 3G8YA 5BQ5A 3ME5A 1QLWA 4LQLA 4I1UA 3U7GA 3DAYA 2TMKA 5DBOA 3UNWA 5AM4A 4WADA 1KJNA 5T67A 1I9GA 4RQ9A 2AZTA 3ZK9A 3B5EA 3HLWA 2QPOA 2R6DA 5I5GA 2VX8A 4B6EA 5CNIA 4ZJ2A 3IIEA 3MHTA 2NU7B 4MRPA 1ATZA 3TL3A 2PFKA 4QHYA 4OGGA 3F3SA 3LYLA 4E31A 3BTSA 3F5SA 1BLHA 1JDVA 1XRRA 1PNEA 4RTLA 4LGYA 1J2JA 4YECA 3E7XA 5TPZD 3VC2A 1FLVA 3GPIA 3HFSA 2XUHA 4AMBA 5FA6A 1TD1A 5I01A 2M9MA 4WBNB 3J7TA 1MRSA 2P8JA 4TROA 1TTQB 3P20A 4DSAA 1S5PA 3N87A 1JLMA 1N9ZA 3FNEA 4KK3A 1KYQA 1GSAA 2FPGB 3AFGA 1XF9A 2C4MA 4RJKA 1D2HA 3H5AA 1T2VA 1LI9A 2OBYA 4WLVA 4ALLA 1L7AA 5E2BA 4OP3A 1M1ZA 1Y3FE 1JPVA 2JD1A 4D9FA 1F7UA 4M99A 1J8YF 3RANA 2WYHA 3SC4A 5C7IO 3LIPA 2ZUFA 4FFBA 3TJZA 1IU9A 1FFBA 4G1BA 4F86A 5HZGA 5L3VA 4WRRA 4I4TB 2D5LA 3BRQA 5CFRA 3QVTA 5HDQA 1I6MA 3DL2A 2WG2A 1BCRB 4G4JA 1HEIA 4B83A 5NULA 2G5PA 3VV4A 3EYWA 3UUEA 2HRQA 1KJQA 3WYGA 1KPHA 2ZEJA 1RYFA 1Y9DA 3AR9A 5C81A 4B7ZA 3F5DA 3S1AA 3W90A 4GPIB 2P9VB 4R2LA 2UZ1B 4GI2A 2RH5A 2VYQA 1D7EA 3PUXA 1PR3A 4D0NA 4K9LA 3G49A 1E9FA 2CJWB 4LGCA 4K40A 4JIMA 1WA5A 2C2BA 4ATNA 6LDHA 3D6NB 4CDGA 1T6BY 2C03A 4GB7A 2G5TA 1P4SA 3G30A 1ANKA 3GZJA 3INYA 2P5SA 4J7AA 1JFFB 1A82A 2B1RA 2YBDA 1VI6A 1WZIA 3DVLA 3RUFA 1Y48E 1SC3A 3QHAA 4I3GA 4BNHA 3EXG1 3SX4A 1U7DA 1LDMA 4BOYA 2BG1A 3GUZA 5JNUA 1B41A 5E4TA 1W2HA 3UGJA 3G0HA 1L5VA 3FKSA 2OO5A 1WPRA 2YHAA 3IJPA 5DYTA 4IBOA 4OUDB 3IWOA 3GWZA 5L4NA 1Z12A 2WW8A 1OXSC 1YJ8A 3DTVA 4ZYYA 3IC5A 5CEFA 2OGSA 1KGGA 4BEBA 5TJ9A 4DDKA 4BNKA 1QX3A 1TQDA 3ZBTA 4KRGA 2WYIA 1TU4A 3HVRA 1X0XA 4PYIA 5IT0A 5D3ZA 2EX4A 4DIBA 3DKVA 4MCAA 4RZIA 1F2TB 3ZDFA 4H0FA 5EVIC 1W5DA 4YFMA 1I2CA 3GEDA 1P1HA 2PANA 3HHPA 4JKOA 3C5WP 1OWMA 3OY2A 4Z3KA 5C1DA 3LY8A 4R1QA 1G9SA 5EMMA 4RANA 4OHKA 4F56A 1U6JA 4NQRA 1MIOB 3ELYA 4R2HA 3EQ7A 1ZD2P 4IDQA 5B2ZA 2XF2A 3ROPA 1GAWA 3DEFA 1YQ9A 2YASA 3P2EA 4Y2XA 2JFFA 3NVMB 1DNPA 4UOQA 1U8XX 4LRXC 4D2IA 4C2BA 1TADA 4OKSA 1DRWA 2Z6QA 3COYA 3QXHA 4BP3A 1I0IA 1LDEA 1I6KA 4N39A 2GBIA 4LJ7A 1I4TD 5CFOA 4WSOA 4NV1A 5GWXA 2R00C 3Q8XB 4BUCA 5F4ZA 3BHJA 2PMFA 1E5LA 3U7IA 4IL5A 3IIMA 1UKCA 1XB2A 4CLXA 3W4IA 1Q7RA 5BP7A 3C8MA 1F4LA 1TMOA 4MXDA 3HZZA 2B7BA 3VKFA 1EWTA 1ZG4A 3VJKA 1Z5NA 4DR7B 3O7MA 1I4WA 2JFWA 1ISSA 1VZ2A 7REQA 1C14A 3EG5A 1IEXA 2M6SA 2PT9A 4IIYA 2HAEA 1QUFA 3CGWA 2VV6A 5EIXA 1K3TA 2XJ4A 4LY9A 3FCXA 5KZMB 4MGKR 2MYTA 3TM5A 3UATA 2NXJA 4XYGA 4XWYA 1T8RA 1E6LA 2PKCA 1GOTA 2CVPA 4G67A 2WZDA 4OYRA 2A1TR 1P3DA 3W7BA 4CM1A 4RCYA 5DISB 4C5AA 3EA4A 1W4RA 1IB0A 4XPZA 1HQDA 3K6KA 3RXXA 1Z29A 3LA8A 3EXIA 4UHUA 2GS9A 1EGHA 5KYTA 1UPBA 5F2NA 2BBSA 4H7KA 4FDMA 2AUNA 1CRWG 1HMPA 2WTEA 2VYVA 3RFUA 2IHJA 3WLIA 4QOFA 4Q3CA 2QAGC 4DXAA 5KSCA 1ZIYA 4PX3A 1D2CA 1YWGO 5GLCA 2RB5A 1FUEA 2Q2QA 4N7BA 4Z8YA 1YB5A 4BFYA 2H57A 3IL2A 5ITWA 3DW3X 3P2JA 4KB5A 1DO0A 3N59A 4I1VA 1U0RA 1X1EA 3UM9A 1AMOA 2PXHA 3ISTA 4Y2UA 3TTYA 5DTRA 4D0GA 3TNLA 4GGOA 1EP3B 4IJVA 2WJ3A 1G2PA 4ASUD 4QXOA 5JC8A 1QOQB 2DPXA 1TUBB 5JG7A 3DW1X 2OWHA 2XR0A 1KE0A 3NV9A 4X7MA 2YZ2A 3IILA 3PNQA 2Y05A 4MUGA 4J0DA 1GD1O 2O8BB 1NVGA 4KDFA 4JMLA 5FTLA 3IBYA 1OJGA 3D3JA 3CPJB 4KRXA 4EEPA 5CYOA 1ZVJA 2BKEA 5IW8A 1NULA 1B15A 3KSAC 2HWXA 4Y1RA 1NW6A 1I7PA 3EIUA 1BMFD 4UMEA 4FSDA 3GP3A 5JASA 3KPVA 4MUNA 5CPBA 3UV3A 4EHIA 4OPQA 5K5EA 4A7PA 1QLHA 4MMYB 4BB6A 3VU1A 1TO1E 1Q0SA 4W8HA 2WHRA 5FA8A 1S4MA 2ISQA 1J06A 3OAAA 4FPXA 4UJ3A 3H4MA 4Z5XA 3VQTA 2NYUA 3C7TA 4ND5A 2NUTB 3ZHRA 4ZU1X 5BSHA 2PGIA 3RC2A 3PQ2A 2Q3MA 2HMWA 4ZCLA 3HL9A 3QWBA 4XWTA 4G3VA 2CNWA 4JL5A 1Q1QA 2WTNA 1QF7A 3JQDA 1LV8A 4CW7A 3AETB 1VYHA 2CE7A 2DPLA 3SC2B 3N2KA 2QRUA 3S2SA 2PZJA 1DSSG 3F1PB 5CG2A 1LX7A 3KLMX 3IWIA 1RBMA 2BR5A 4ZVSA 4BFZA 3QE4A 4CBVA 3HU5A 3K09C 1L7RA 3W9UA 4RDXA 2GUWA 4OGFA 4Z86A 4Y3IA 3DEZA 3GLGE 3R3WA 1NR7A 1J8VA 1GG2A 1NNLA 1VKNA 4JZYA 2IWHA 3KUDA 3L41A 1L7PA 3L93A 1N7JA 1H69A 4YO7A 1OIVA 2VJPA 4MUXA 1G6AA 3ZIDA 5DYIA 1NBME 3EC1A 4W6ZA 5FI2A 1GO2A 3DMFA 5JLAA 1Y3HA 1HE1C 1V6AA 1IYZA 3I6BA 5L3SA 3CINA 2B4KA 4DLSA 2VLGA 2QM3A 1WZ2A 2PU7A 3V2HA 3NI2A 1IYSA 1SCWA 2YHUA 1MG5A 3M7IA 1Z56C 2ZM8A 3U4HA 3SFVA 2R4QA 1DKOA 1XELA 4FNMA 4MZXA 1YVPA 3H3XA 4FTWA 3BGWA 4DJDC 3HQ4O 2WU0A 5CGZA 4GPEA 4XWAA 2PS9A 4NU0A 1GCGA 1ESZA 1R10A 1SC4A 1C7QA 1X38A 2Z2XA 2O6HA 5IHVA 3PDHA 4HJRA 4D26A 1GGJA 4FT4A 1THZA 1VPWA 3FNFA 2HDRA 5EIBC 3OWXA 1TD9A 2O8CB 3ZX5A 3VR3D 3DJFA 3I01M 4UTRA 2RK6A 4UHKA 4O2RA 1GSWA 5IABA 4RKEA 1W7AA 4UTOA 3THYB 1OH6A 3KEQA 1I4LD 1W5TA 2OZEA 5JFOA 4N9LA 2H63A 1V8OA 2A5FA 2RGEA 3BFKA 3DOUA 4V0KA 1CEXA 3L05A 3AF3A 4MRNA 4GBJA 5BNTA 4YR9A 3T12A 4QASA 4ETXA 4H6WA 1IFQA 4RVAA 3KQUA 2FUG1 2ZC4B 1X74A 4RK6A 4LIPD 4RDIA 2XF3A 3WDSA 4CMEC 3DP7A 5EHZA 2BP7A 1ZWKA 4LNUA 4MS3B 4CLCD 4LRYA 3W5AA 4KYIB 1HEUA 4I14A 1C8VB 4LPKA 5FPYA 2YIJA 5IFLA 4QHCA 1MGOA 5DJTA 4UU8A 3UMDA 4GOMD 2VGKA 4TV9B 3ETNA 2C59A 1YZHA 2DWPA 3GFPA 1Y4ZA 1T4MA 3IVCA 4QHSA 4EVSA 1E5VA 4H6VA 5EUAA 5DBGA 3KUKA 4QYTA 4KPUA 4DE2A 4RD0A 5ADUS 4OLDA 4LZPA 4QPNA 1OH8A 1GZ7A 4FDUA 4BLRA 1MQAA 4NG2A 4OGWA 4XTRA 4C3ZA 2FHSA 4ZCPA 1NVBA 4JXGA 4IIDA 4PYLA 3WNCA 3AV0B 4ZYXA 3WY9A 4KVGA 5FX2A 4L9RA 2YOGA 4CU5A 4XJVA 4TUYB 2W2LA 3TR5A 1P9WA 4RADA 2Z2ZA 2DRWA 1C9MA 4BX0A 3Q9UA 4BFUA 2QI9F 1ZDMA 3H2SA 4BNMA 1IEQA 5B7NA 3AF0A 4GI7A 1ECLA 2AOUA 4EO4A 3F73A 4NF2A 2NZ2A 1X9HA 2I9KA 5F78A 5TQ2B 1R6VA 4LV8B 3TI9A 1NNSA 3FWPA 2DBZA 4M4SA 4DUZB 4D60A 5HDSA 4ZYWA 5CA0A 4CEIA 1SZJG 2B36A 3OICA 1QAMA 1KGSA 3V00A 1QJ4A 4X91A 5BSKA 4LDQA 1Q50A 1AKUA 2E21A 4YO8A 4ZQBA 4HAUA 3F9RA 5IVPA 3M83A 1ISFA 4IQ8A 4MSUA 3F1NA 3QNMA 4XPIB 1E7YA 4U39A 4LZAA 2HFKA 2KS6A 1M8KA 3W5CA 1VC2A 3T3GA 3D8SA 3OEYA 2I2CA 1PSDA 3BLMA 1KO5A 3U7EB 4PO8A 4M9XA 5IM4A 4E2YA 3I5XA 2IZ5A 2DKNA 2VOJA 3WDKA 3IS3A 1Z0SA 4N03A 1O77A 3INNA 2WV9A 4EY3A 3TKAA 4HNVA 1KK2A 1ND5A 2J7VA 3WWCA 2VYCA 1LQUA 1H1TA 3EXEA 2GN9A 4HWPA 1E1RD 1YAHA 1AB5A 2NU8A 5F3DA 4L15A 3CZAA 3HKCA 4RKWA 4NDZA 4EA9A 1C5KA 4PTYA 2Z08A 2HDHA 3AUXA 2O4CA 4KREA 5FASA 1I1NA 4TMFA 2O1EA 4ODIA 1YH3A 2DCMA 1V47A 1IBRA 1SKOB 1N77A 2XXJA 4MCWA 2YV3A 3EIXA 3MUFA 1K7FB 3C7VA 4PZZA 2VR1A 2COEA 5HOEA 1T2EA 2NN3C 1WDMA 3ZWDA 4DHEA 4I4LA 1M6KA 4TYPA 2RHBA 2Q49A 1R88A 5CM2Z 1RCFA 1ZC4A 1C7ZA 4BP1A 1GVNB 1Z2OX 2Q9CA 2A6PA 2PX6A 2FEXA 1BE8A 3CV3A 3FBGA 1EA7A 1KTVA 1C8LA 2HWKA 2R9XA 4G89A 4BKMA 3P0EA 4ZV7A 3O1JC 3PDUA 5CXQA 3L02A 5M29A 3BCUA 1VEUB 1RXSA 2WGWB 1H65A 2ZJBA 4E22A 3PVSA 4GMHA 2BZ1A 1YRHA 2NTYC 3NATA 2H92A 5CD1A 5L8VA 5ESDA 2PSEA 4YDSA 5E0KB 2Y0PA 2H2IA 2JI6A 3PBTA 2OO3A 2NTJA 2PX8A 1XLWA 1R6DA 1E1DA 3PFNA 3RADC 1I5EA 3G34A 2XEDA 4L4UA 1NUTA 3EZYA 4AKTA 1R5NA 5KWIA 2P7HA 1VCOA 5CTMA 4WCFB 1QU2A 5J58A 3EVGA 2ID8A 4MUJA 1YMSA 4BB9A 2CDAA 1MC0A 4E6WA 8LDHA 5IVKA 4K87A 4MYRA 4LX0A 2VAPA 3AG5A 3BGVA 2CUKA 5G4YA 5HEKA 3CJQA 1G8SA 3GLIA 3V4VB 3CW2A 1E60A 4LRZE 4Q0IA 4XAQA 5EJIA 1DL5A 1SCIA 1X7XA 1RHKA 2WIGA 3IS2B 2XKAA 4IDGA 1KOJA 2P30A 3ILVA 2VPQA 1VJDA 2NO7A 1I14A 1E2PA 2XCUA 3TAHA 2VNIA 3F4BA 1CZRA 5F3WB 2CF6A 1FUYB 3RH8B 2DGDA 1RC1A 3WYEA 4DL9A 3KTOA 1I2SA 4HNAB 5CA0F 3IA7A 3U40A 1GJRA 4PIVA 3TR0A 3KYBA 4INJA 5L6MB 5FTNA 4UEOA 3I72A 1Z25A 5ALGA 5KYVA 3G6WA 5LLDA 2C2OA 2V7WA 3KOZA 4ABTA 3E9MA 1VLJA 3DNPA 4HDQB 4BC1A 2IU6A 4N47A 1H2BA 3A05A 1YSCA 3OZSA 4X1YA 2P2LA 4A15A 4RD2A 2QMEA 4DBLC 3BCSA 2H54A 1VHQA 3M6XA 1YBMA 3TTWA 1GSIA 4WJZA 3AUUA 4WVLA 2OESA 3FPFA 3K9HA 1G2QA 3CWFA 4HZUA 1VIVA 5IM4F 4UCFA 2MSWA 2TRSB 4NAVA 3BYZA 4Q4HA 4OLHA 4BN5A 4FNGA 5AJWA 3L8FA 4C88A 1LX6A 1HEYA 5TNXA 3PKZA 4B4KA 2WF7A 1GSOA 3ROFA 1EWZA 3FR7A 3ANYB 3K6RA 2XADA 3BXFA 4E2FA 3K70C 2E48A 2BGTA 3UE6A 1US8A 5AJXA 1X7GA 4L57A 3PSAA 1CT9A 2AKAB 1F8GA 4C4OA 3BWBA 3HWX1 1GTZA 3WYBA 1P7ZA 4JU8A 3N8LA 2HP9A 4PRYA 5CVTA 2J4DA 2X6TA 4HP4A 2OV6A 3NRBA 5DGDA 2IBSA 3I2HA 1ZGBA 4LYEA 5J3JA 5FWNA 2O19A 2C5EA 2OO7A 5FOTA 2GSDA 2NAFA 3RBZA 2ZB3A 3SF8A 4LTNA 1DCMA 4NXFA 3BMOA 5AW4A 1NTRA 1DTSA 1OT3A 1LC0A 5KVAA 2BJWA 3AINA 2MMGA 2GNXA 4HV4A 5BT8A 4ISCA 3FLAA 4ETZA 4MA0A 1PFKA 1UPUA 1PR1A 1BDMA 4FDVA 4FFBB 2X2PA 2UXDB 2HA3A 3ZCXA 5DXFA 1Q1ZA 4F92B 3OPYI 3CN9A 1XMOB 2GDNA 2QLBA 3W6UA 5KWJA 5I7HA 2IELA 3N6IA 3B3AA 4P98A 1OT5A 3PX2A 4NMWA 1ZN2A 2XZOA 3GVBA 3IX3A 3NC0C 3DT9A 3S1AB 1LI0A 2JIPA 3F74A 3V8BA 3PQ4A 3TAUA 1UKVY 4DIKA 1GPUA 4JI2B 2JFNA 4J0JA 1AKWA 3MF4A 3QTTA 4QFMA 1AURA 1TEVA 3MQ4A 4PC2A 1BJTA 2Q6KA 4IUDS 4C4SA 3Q82A 1FYWA 4Q1EA 1NDHA 2YICA 4AO8A 1MJFA 5FTJA 3H1GA 3VZRA 3ONNA 1Q92A 4FGJA 1ONBA 1H2RS 4P82A 1PRQA 2E1PA 2OTCA 4JH0A 1TQ6A 3F6SA 2ZT5A 3VHXA 1OI2A 1VYVA 3BB4A 5COAA 2BFCA 5WRFA 2ZUTA 1Y3AA 4AUMA 1TYDE 3UJDA 1N2HA 2V6FA 3KG2A 2GBLC 3PJGA 2AZDA 3UDXA 3O2QB 4IILA 4IGIA 4IEIA 2DBRA 4Q9DA 1E4OA 3FOWA 4JGPA 3Q2KA 4DJFC 2EQ5A 2P9FA 4YXWD 1DJCA 4R1MA 1PNOA 3G13A 5KHLB 3RS4A 4MROA 2V98A 2P9QA 2JGKA 1E59A 1X8XA 3H5IA 3DTVB 1MJNA 3PT5A 3N0RA 1U9JA 4QTYA 3BA1A 3MKFA 4CYMA 1HDOA 2VF2A 1XMQB 1JEYA 1XDSA 3MS6A 1EVIA 2OXCA 1HYHA 4EAQA 2OLEA 4JXVA 4IICA 1EM8A 4KZ9A 4ZZIA 5HFNA 2UYGA 1T0BA 4HS4A 1D1SA 3ZHUA 4I3AA 4E0BA 3I6YA 2RD2A 3IVGA 2PUHA 2ISSD 1EE2A 1C3EA 5LMZA 5K6AC 3KP1A 2O54A 1WYBA 2ZM2A 2OHVA 2GTIA 2ZU0C 3U1TA 3DBAA 3RTEA 2E3JA 3LQ2A 5E7QA 1X0VA 1KQFA 3HSSA 5JS1A 4OP5A 1P1IA 2BFPA 3U3RA 1Q0UA 3DCIA 4UAAA 4S1NA 4F4FA 1IEVA 2WM8A 2RJNA 2FEOA 1RP5A 3RUPA 1J3WA 1GL7A 1HX7A 2Z2LB 3OLYA 3MS2A 1P4JA 2GJ8A 2I55A