4ARZB

The crystal structure of gtr1p-gtr2p complexed with gtp-gdp
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
321
structure length
304
Chain Sequence
b'ATDSKAMVLLMGVRRCGKSSICKVVFHNMQPLDTLYLESTSNPSLEHFSTLIDLAVMELPGQLNYFEPSYDSERLFKSVGALVYVIDSQDEYINAITNLAMIIEYAYKVNPSINIEVLIHKVDGLSEDFKVDAQRDIMQRTGEELLELGLDGVQVSFYLTSIFDHSIYEAFSRIVQKLIPELSFLENMLDNLIQHSKIEKAFLFDVNSKIYVSTDSNPVDIQMYEVCSEFIDVTIDLFDLYKAPRNELQNVSQLANGVIIYLRQMIRGLALVAIIRPNGTDMESCLTVADYNIDIFKKGLEDIW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTP-BINDING PROTEIN GTR1
publication title Crystal Structure of the Gtr1Pgtp-Gtr2Pgdp Complex Reveals Large Structural Rearrangements Triggered by GTP-to-Gdp Conversion
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase
total genus 98
structure length 304
sequence length 321
ec nomenclature
pdb deposition date 2012-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF04670 Gtr1_RagA Gtr1/RagA G protein conserved region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.190 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4arzB02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4arzB01
3I73A 2DB3A 5DIFA 5AUNB 1XMIA 3L43A 4HLUC 1SZPA 1LB1B 2BWJA 2ODEA 2DR3A 3MWJA 1N6KA 3EWAA 3K09C 4KLNA 4BFUA 3U3JA 4YXWD 5JLJA 1CULC 2DFKB 4JYCA 4TSFA 2VL7A 3QOFA 3BORA 3NDPA 1BYIA 3IDQA 1Z0IA 2IYSA 5EP2A 5AJYA 1E0KA 4ASUA 3OIUA 2R8RA 2AHOA 3CO5A 4K8OA 5FI1B 1SVLA 2AK3A 2GDJA 3VKGA 4DIDA 1XD2A 3LBHA 1OB5A 5BWMA 3W9YA 1XEWY 5CDFE 2G0TA 4KXFB 2QORA 4FCWA 3EARA 4BFTA 1ZU4A 5JCPA 2H1LA 4DDWA 4IDQA 4IW3B 1W7AA 1ZCAA 3T1TA 4GT1A 2ZSEA 2YC2C 1KJZA 3PQCA 4DCNA 4BZXA 1U0JA 1XEXA 4IXNA 5DNYB 3WMFA 2UKDA 4B3XA 3V4RA 1VYTA 1AS3A 3QKRB 2QI9C 4HLUA 2XZLA 3VQTA 4KBGA 2ANCA 2WHXA 4QGAA 3HPQA 3QXSA 3QF7A 5DYGA 2J3EA 3GPLA 2MMCA 4LGMA 3MJRA 4RD0A 1JR3E 3LV8A 5LBIA 3AGPA 5F2EA 5B30A 2PBRA 4ZDWA 1PLKA 2JJ8A 2WSSA 1S9HA 3KKQA 3MAAC 3CR7A 4DEYA 5BYJA 4TMZA 5K8LA 2QU8A 4C0LA 1LS6A 4LBYA 4C0JA 4EFNA 2EFGA 1VPLA 3GJ3A 3IUYA 4IOMA 3JZMA 5JJLA 2ZIAA 4HAZA 5L3SA 4PSKA 3AVXA 4OI2A 2LKCA 2FWRA 1E9EA 4Y0VA 2XJ4A 3GEEA 3KUCA 2JATA 2QGZA 1JQLB 1OFHA 4IFBA 1QF9A 3TAHA 4P33A 3K9GA 1G21E 4M53A 4B48A 3PIRA 4N3NA 4M1OA 4B75A 4LBVA 2KBEA 4KBFA 4QFMA 4DT1B 3LLUA 2V3CC 3B2EA 5IRCD 3UMFA 1H8HA 3TVTA 3AVOA 2F1HA 1KO8A 1CR1A 1B0UA 1JNYA 3AKEA 4Q01A 1E9SA 1TQ2A 3L82B 2GNOA 3ZGXA 4AKIA 1K5GA 1QHNA 3FMIA 2J59A 4IDOA 4CVNA 2ZE8A 1E2LA 2REBA 3AVPA 4I81A 3EWSA 3OFND 4GOXA 4CDGA 2ORWA 3ZZUA 2G1KA 2V4ZA 1HUQA 3CIOA 3K70C 2Z83A 1M8PA 1OXUA 5CIWA 2AD5A 3I8XA 2BJWA 2RGBA 3QG1A 3WYAA 3FHOA 5FPTA 2FV8A 1KI2A 2GK6A 3SN6A 4CGZA 4KFSA 3O8RA 3DDCA 3NBZC 2JIZD 2I4IA 4BWYA 3MUFA 1W2HA 5FBVB 2F1IA 3AVUA 4YDSA 4NYJR 1MKYA 3WNDA 1TL7C 1YZGA 2PT5A 2QA5A 3B78A 5D3MA 2C03A 2CJWB 2ZYVX 6Q21A 2YWFA 4R2IA 3CW2A 4HUQB 1AA9A 1FNNA 1GIAA 4Z1MA 5C4GB 5L3QA 4PPNA 2P6NA 4Q7MB 4XD7A 2XB2A 3A1UA 4B71A 1N0WA 1KSHA 4O2RA 1VG0B 2AK2A 3A6PC 3F8TA 3U61B 1G7SA 1FP7A 3C16C 1OIWA 4XVRA 4AK9A 1DVRA 4NBSA 2QT0A 4RFSA 4ARZA 3AP2A 3OEED 3X1XA 4F93B 2IYWA 4I1UA 4IOKA 1FQJA 2JJ1D 3BH6A 4JJKA 3OESA 4NMMA 1Q1QA 2RAPA 2J0QA 2RGNA 2RHDA 5DI9A 1DE0A 4ZIRA 3U3OA 4PQFA 4OHWA 3CF0A 4QJ4A 4YMUA 2ZRMA 3WP0A 3MSXA 4LJ4A 2CL0X 4IOJA 1OH6A 4LPSA 2I3BA 4TYNA 1G7RA 5JSZB 4UJ3A 2QMHA 2ZRLA 1E6CA 1S8FA 2VO1A 3SOPA 1MOZA 4P3YA 5AJXA 3FMOB 2E87A 1DTSA 1HE1C 3TAUA 3Q3JB 4NCHA 1OF1A 3IIJA 4BE7B 1GVNB 4BLPA 4BZQA 3BFKA 3IQWA 3UWKA 5JZVA 2QP3A 5G3YA 1KI3A 3FKQA 4KU4A 1DOAA 1FX0B 4LZZA 1P5ZB 2ZRKA 3B82A 3NVAA 3DOFA 4N0EA 1RRCA 3PEYA 4K46A 2BVNA 4HDQB 2RGAA 1P3JA 3CRVA 3EXAA 4B3FX 3EIEA 3KQKA 1W36D 2Z6VA 3I5YA 1OB2A 421PA 3H4MA 4C0KA 4A92A 4BFYA 1E2PA 4EPTA 2CCJA 4MGYR 2EFCB 3PENA 1IOZA 2FFQA 4U5XA 1HE8B 1H65A 5A0FA 1VECA 2DFNA 4WAUA 1N5IA 2CLDX 2O8EA 4M22A 4OYHA 3ZVRA 3EC1A 2QE7D 3T1QA 4YQFA 2YWEA 3HR7A 2IW3A 1E1QA 2WPDA 2NZ8A 1FW6A 4QHTA 3BC1A 3VX3A 2O8CB 3QE0A 4LK2A 3I8SA 5JS8A 3S1AA 1GAJA 2D4HA 3DM5A 5DSZA 3THXB 5F9HA 4KI0A 1OHHA 5JI3E 3GJ8A 2OEPA 5GADl 4DJTA 3AKDA 1NBMA 4TT3D 4G5SA 1XMSA 3CBQA 2OCBA 2QAGA 2ZRCA 4RSGA 3GLFA 2ZJYA 2FSFA 3AVQA 3UPUA 1LVGA 4QGFA 2QM7A 4URUR 4DSOA 4IHQA 3P32A 3KQHA 2G83A 2QBYA 2XITA 1HY3A 1R4AA 4FI3C 221PA 1KDOA 1XTJA 2VHJA 3GLIA 1E0SA 1P61B 3LD9A 2AWNA 1KO7A 4U00A 5AUOB 4NL4H 5KYKA 4RD1A 4QBFA 1PLJA 2Q9AA 4D4MA 3OAAD 2ZSBA 3DVLA 1Z3IX 2J0UB 3VR2A 3VX4A 3NIBA 2CDNA 1I2MA 2E9SA 1D8TA 4RCYA 4Q4AB 1FL9A 1KIMA 3T1VA 2FE4A 4MRRA 3QEOA 2ZYUX 3RRNA 1XJCA 3EC2A 3ZZTA 4I99A 2IS4A 1NVWQ 1MABB 1KYIA 5EP1A 3QXHA 4D26A 5BYKA 2YNMA 3A4MA 2PEZA 1PUIA 1BMFD 1JXOA 4QOSA 3RAPR 3NDBB 521PA 5TXGA 2VSOA 2WKRA 1Q12A 1F2TA 2W2XA 2HCJB 1N6OA 2C99A 1G291 1FMJA 1GL7A 2GCOB 3KKPA 2GKSA 2XOKD 4PPFA 1U98A 3CRQA 1L4YA 3BH0A 1ZUNB 1DAIA 4HZUB 3TGPA 3IBGA 3B60A 1E69A 5FPSA 2O8BB 5FOUA 5IDVA 5IT5A 4OHXA 2HUPA 4YMTA 3TRFA 1QRAA 2FPMA 4PZZA 3NKVA 1SQ5A 3BS4A 3R20A 2MSDB 2DPXA 2IYQA 3X1DA 4Q47A 2LCFA 1Z28A 1QHHA 4CW7A 1TMKA 3M0EA 5K8TA 2BBTA 1NP6A 3L0IB 3SQXA 2C98A 4XWKA 3GQBA 1XPOA 2NZJA 2D74A 1IJEA 2ZR7A 4YDHB 1P72A 2ZVPX 3FMPB 4C2UA 2GXSA 3N5CA 3IKJA 3K9LA 1NBME 5CJ2A 1TEVA 1Q21A 4NDZA 3RVBA 1AS0A 3ECCA 2KSQA 2Z4SA 4L4UA 3RYTC 4BEBA 2Z5FA 1AZSC 1G7TA 1KAOA 1MT0A 1YZKA 2QUZA 5EP3A 1IY2A 1S3SA 1TQ6A 1Z6YA 2IYVA 1NJGA 2PZFA 3LXXA 4LCBA 5L8VA 1JPJA 2WIAA 1E94E 3KTAB 3GFPA 1DO0A 3LAWA 3ICEA 2EW1A 4IDHA 1RYFA 3THWB 1W4CA 3NH6A 1NG1A 3U3MA 1DARA 1FMLA 1E2KA 1II0A 4LJ6A 1R0YA 1ZIPA 4KFTA 2A3RA 4PC7A 2F6RA 1VG9B 2GK7A 2GWHA 2Q6TA 3UMSA 2OCPA 3CR8A 3KJHA 1RFLA 2OBLA 4X8MA 3QF4A 3CLVA 1YZUA 1MR3F 2VH5R 5HR5A 3DMDA 1D2NA 4DLZA 2R62A 2OBMA 4G01B 4RZ3A 4D82A 2EFHB 1JJ7A 3L0PA 5LD2C 3LFUA 1ZBDA 1ZINA 2YZ2A 1U9IC 1X6VA 1T8UA 3P4YA 3P4XA 3PUWA 2WIBA 4CEIB 1KI9A 1Z0AA 1Z08A 2HLDA 4GP6A 5CLLA 1NN5A 3AVYA 5DH9A 1PVOA 2ZI9A 5JCZA 4F38A 2IUSA 2J0VA 1XZPA 4A2WA 2PMKA 3OIVA 5JEDA 4G5OA 3TSWA 121PA 1SVWA 2ZE6A 1Z6GA 2CL7X 1UADA 3A36A 4D0LB 3ZS9A 2OCYC 5KTYA 4EAQA 3QKSB 2P0EA 4DLYA 2SHKA 3I61A 1KO4A 1W2GA 2VIIA 4JLJA 3P26A 5CLQA 2F43B 4UJ5A 1W36B 3AP3A 2PMDA 1JXMA 2Q21A 3SI7A 3TKLA 3MGCA 3SQWA 4CIDA 3EPJA 1AS2A 2GRJA 4G1UC 4HLDA 3H86A 1VCIA 4M8NE 1UBGA 2JEOA 2PLRA 2A78A 2QP9X 5B2ZA 5L3RA 1L2TA 5EE0A 2JLRA 2GXAA 1FZQA 1FX0A 3GCGA 4TLBA 1KTVA 1QG2A 2KWIA 2K5UA 3PVSA 4TYWA 1XU4A 5KSYA 5FL7A 1XTRA 3GLGB 1DAFA 3T12A 1QBKC 4V0ME 4AYTA 3UATA 4FMDB 2V1XA 4Y0AA 821PA 2B7BA 2ZU6A 3Q7PA 2HYDA 1P75A 2FH5B 2WSMA 4FWTA 2JA1A 2QEQA 1KMHB 3FE2A 4YXWA 1NLYA 4B2LA 2QPOA 1DELA 2IWHA 4TMVA 1JECA 5BN4A 1VHLA 3U7HB 4NCNA 3K1JA 1NF3A 3Q9LA 1QZXA 3TW8B 3R8CA 4LV5B 2X19A 5FOTA 1P73A 4OQMA 4PC3A 2IT1A 1JEDA 1RRPA 1XEWX 4G5GA 1ZNYA 1S3GA 3RDPA 2L0XA 3LA6A 4JLDA 3SJZA 2E1RA 1R5NA 2G0NA 2PCJA 1R8SA 4G5QA 4M1KA 2NOAA 1JALA 3REGA 1M1YE 2FEOA 4AG6A 2MSEB 1TF5A 2C04A 4MRVA 1VCOA 4C9BA 3RANA 4Z8YA 2ORIA 2XNDA 1OV4A 1P2TA 2YOGA 4MKFA 1IN5A 5SZJA 3WBKA 3OF5A 4JLPA 5IF9A 4JZKA 4RCZA 3PXGA 1XX6A 4F4CA 2ZR9A 5B64A 1TADA 4HDOB 1P2VA 1KMQA 3BFVA 1BH2A 1JAHA 3AH8A 1YR8A 2A7QA 4BEJA 1P6XA 5F98A 1R5OA 5EXPA 3GLHA 5FOXA 2DWQA 2WJGA 1BOFA 2ZRAA 1OYWA 5FTMA 1EX6A 4MYCA 4EKDA 2JLUA 1ZM4A 1HT1E 4DXAA 4KSCA 5HCNA 5JHGB 2ZM5A 3TQCA 3CH4B 3ZVLA 4IJMA 5BQ5A 2GESA 2Q9CA 2VSFA 3ONWA 2IS2A 4GSYA 4TTPA 4Q4AA 4LY6A 4JLNA 3BGWA 2PL3A 2G9NA 1NI3A 2DWPA 2XSZA 2ZROA 2ZRJA 3U7GA 2Q3MA 2GJ9A 1XP8A 4IXMA 2FU5C 5CB6A 2OESA 1P2UA 1MABA 1N2CE 3IQXA 3Q7QA 5DN6D 1Z6XA 2DFTA 1II9A 2ZPTX 4PQRA 4E09A 4IOLA 4BZPA 3B6EA 1Z5ZA 4HAYA 1NKTA 3I92A 2R65A 4UNNA 1F5NA 3HU3A 4L9SA 2GCOA 3C5HA 3ND8A 1XTQA 3LX8A 5DI3B 3EPHA 4OJKA 4B3BA 4W5WA 2VA8A 5E7IA 2IHYA 3K0FA 1X8KA 2VP9A 3LY5A 2XGJA 4GOJA 1QG4A 5HZKA 1K8RA 2YC4C 1BYUA 3BK7A 3U4QB 1XTSA 1DADA 2W6JD 3BB4A 4QHYA 3EAQA 4QKQA 3BERA 2AXNA 4LHYA 4D4JA 4DDVA 3CX6A 5G41A 5CDFA 2CBZA 4OI0A 1FUUA 1ZJ6A 2C9YA 3GJ0A 4UXIA 4TZ6A 5GVRA 1F2UA 2EQBA 2NO7A 1ZM3A 2XAUA 5G40A 4ZDJA 4WIAA 2GCNA 3U60B 2ZYWX 3NBYC 1XJQA 1SKQA 2N46A 3GMTA 3FOZA 5L3VA 2GVDC 1BIFA 4JT4A 2B6HA 3B8HA 4XIGS 3VR5A 4A0RA 2QPTA 2MSCB 4QJ5A 4AIIA 2VHTA 4DB4A 2YV5A 1N6HA 4NP6A 3KTAA 2WOJA 1GRQA 3TUJC 2CNWD 2UVQA 3IPXA 3T5GA 1PJRA 4HYYA 3THWA 4HLQB 1J70A 1KKMA 2IEYA 4IEEA 4NU0A 2NIPA 4A8JB 2ZRDA 4JYBA 4DLWA 3OEEA 1UDXA 1OLOA 4AD8A 1ZM7A 1FNMA 3NEYA 1U0HC 5KHOC 1Z29A 2LKDA 3C5CA 4I1OA 4LBWA 5KUTA 1W36C 2O8FA 1Z0KA 3QBTA 3K0CC 4OBEA 5CIQA 2AFIE 4US0R 3MWYW 3AP1A 1OH7A 3VU9A 3CZQA 5LPNA 2ZAMA 2H5EA 2C96A 4V0NA 3RRYA 1E9RA 2WAYA 2IK8A 3VR4A 2F1JA 3W8RA 1CIPA 5JBQA 2RGEA 4CEIA 5CYPA 4EIWA 1K5DA 4R2HA 3G0HA 1ZM2A 1VIYA 1E79A 1CJKC 2WAXA 4LJYA 3LDAA 1OFUX 2HT1A 2ODWA 3FB4A 1G8FA 1WDTA 4QBGB 4PZLA 1ESMA 1W0JD 1OFIA 2ZRHA 4DUGA 3OEHD 1W0KD 1XB2A 2JLQA 2VHQA 4OKSA 2GEVA 1NIJA 4V03A 3AVTA 2NGRA 5H68A 3QKSA 4Z51A 1G8PA 3IIMA 1ZIOA 4HB0A 1DPFA 2CHVA 2F43A 1NKSA 1ZCBA 2J87A 2GILA 4TL8A 5LDDC 1KZGB 2OM2A 3EZ6A 3H84A 4Q7KA 2P5SA 4WXPA 4DCUA 2B92A 3MWKA 2AR7A 1LFDB 3NH9A 4CRWB 2V6JA 2GJ8A 4LI0A 2JLVA 2V7QD 3C41J 3K09A 2IBMA 2JJ2D 1ZC3A 2WWWA 3NBXX 1S9DA 4X8HA 1NN3A 4GPTA 2C95A 3CONA 2O52A 2GJKA 3BOSA 4GI7A 4BRWA 2IUUA 3UIEA 3GLGA 1P4SA 4MGIR 3U44B 4H9GA 4TMKA 2QL6A 4GMXA 1SKYB 3BRWD 1XCMA 2ORVA 2ZRPA 2ZUBA 3GEIA 2DYKA 3A37A 3TLXA 4CEJB 4TT3A 3U6BA 3ZVMA 2YWHA 3FGNA 3K0AB 4RY2A 3AVWA 2ZS8A 1P9NA 2YJTD 2IWRA 1UPTA 4GOKA 2AD1A 4UNSA 4M4SA 3RNLA 1GDDA 5H8WA 2BBOA 1OW3B 3R9XA 2JDID 621PA 2ANBA 2PZGA 2OFOA 1BS1A 1YR7A 5KOYA 5DHFA 4KYUA 5FBLB 4Q1BA 4JKYA 4B32A 1ZW6A 4LC0A 5CM8B 1C4OA 2F55A 3NG1A 1ZU5A 4Z8XA 3SBEA 4LDJA 4B74A 5FH9A 2F3TA 1KI8A 2IF2A 2FX3A 1TQ4A 3FYHA 1UM8A 4CF7A 4JVSB 2CK3D 4QL3A 4BFZA 2Y8EA 1US8B 4TLEA 1XCPA 3UXMA 3L0SA 4PANA 2ZJZA 2PX0A 5SZIA 2GZDA 1ZUIA 3R7WA 5J47A 1R0WA 4EJSB 4CEHB 2GETA 3SDZA 1M74A 1TU3A 3AV0B 4GP7A 4DLSA 1TAGA 2CEAA 1EX7A 5J4KA 3PFIA 2IA5A 5IK2D 1P9RA 5FOWA 3TSOA 4B34A 4CYMA 3CUEF 2QRZA 4DSNA 1AK2A 2PJZA 4A2QA 3T5DA 1BMFA 5E4FA 1RYHA 1AM4D 1CLUA 4A15A 4QBIA 4KFUA 2ZI7A 3KJGA 4LUCA 4D25A 1BO6A 1S2MA 2ZJ8A 1ZNZA 2A5YB 2ONKA 1T91A 4PQYA 4C0HA 1X8JA 3C4JA 4EQ6A 1HQCA 2I1VB 2GAOA 1IN6A 4YC7A 3HPRA 4H1VA 1OT3A 4FWIB 5HKKD 3EPLA 1R10A 1COWD 4JLVA 1U90A 1XTKA 4P0TA 4J0QA 2GAAA 5FR2A 2JLXA 4R9UC 1NVXQ 1R0ZA 4TQ9A 3GLGE 2XJ9A 3VR6A 3D8BA 4YONB 2CMKA 1JR6A 2REOA 3FMFA 3UG7A 1OFTA 1WCV1 4BLQA 4LHXA 3VAAA 2CCKA 4MRPA 2VRWA 2IEZA 2QTHA 3LH5A 1IXZA 2NO9A 1Z2AA 3A4NA 4Q03A 4LHZA 4MKHA 4JVNA 4DLUA 4DLXA 1Q0UA 3D3QA 1AN0A 3B7GA 3WRYC 4WZAE 5FTKA 1HQYE 3W6NA 2GXUA 4A8JC 4OQXA 1A1VA 1KGDA 1OKKA 2GZHA 1NY6A 4M2LA 1G1MA 2ZETA 2B8TA 4M9QA 2ZI4A 3DOEA 1B23P 1G6HA 2BMFA 1EWQA 2PLFA 3CNOA 5FUVA 1WA5A 3U3KA 5KPDA 4FIDA 1KI6B 3B85A 3THYA 4GFDA 1W5SA 1ELOA 2FSHA 3T06B 3IBYA 3KQNA 4JVMA 4TN1A 1SHKA 1ESNA 2HJGA 2WWIA 4G5RA 4E03A 3FFAA 1VHTA 2QMOA 4LHVA 2TMKA 1KI1A 1M6NA 2ZSFA 3O8CA 3CPHA 1ZYUA 4TSFD 3ZVNA 2VP2A 4EPXA 2FEMA 1UEIA 1W5TA 4PC2A 5GVSA 4M9SA 1I4TD 4ASUD 3CNLA 3MCAA 4UNQA 4DLRA 1MV5A 3CF2A 4XTCS 2H18A 5H1YA 5JEEA 4BLRA 1NMZA 1IBRA 1IAQA 4TYPA 5EE9A 1XMVA 3RLFA 1G8GA 4IDNA 1KK1A 5AJWA 1SXJD 1E2QA 4M0LA 3CB4A 3L2OB 2I1QA 4US1R 1E98A 3QIAA 3QNUA 3QPVA 3RC3A 3K53A 1W1WA 2P67A 3AB3A 3VHXA 3RS4A 1G18A 1DAMA 3C15C 5JMTA 4FMCB 1T5LA 1X8LA 1F48A 1EGAA 2NO6A 1J8YF 3X1YA 1NJFA 1VDZA 3PUVA 1WQ1R 5CYOA 1EWRA 3A1SA 4QC2A 2ERXA 2C9CA 4TLAA 3K0EA 2MMGA 1MO3A 3UK6A 3I3SR 5M04A 5FBQB 3MJHA 3EPKA 3W34A 1KZ7B 1T3LA 2IL1A 1RE0A 2GF9A 2XZPA 3KXKA 4UQOA 4D81A 4K81B 2GJAA 1G3RA 3W90A 2OAP1 1GRNA 4KITB 3ZS8A 2EFDB 1E9AA 2N42A 4RKEA 4W7SA 5UKDA 1G20E 3D31A 3QVUA 3A1VA 2A30A 1WBDA 1FOEB 5A5GA 3WBJA 3KX2A 2HV8A 3TK1A 5K8UA 4HI0E 4TQUS 4LV8B 1KHTA 3A58B 3SHWA 4B43A 3F0TA 4BLSA 3QSYA 4TZ0A 2ZVQX 1A5TA 1DAGA 1Q57A 1E4YA 1VYVA 2P2LA 4ZV4A 4AI6A 1YE8A 2NMVA 3QKRA 3DZDA 3K9HA 2IUTA 4EUNA 2FPKA 5C2JB 5HZHA 4WOPA 1HV8A 2W83A 1DG1G 2WKPA 4Q4HB 2CHGA 3SS8A 2GEUA 1XRJA 1KJYA 1JAIA 2QZ4A 1A4RA 1SVKA 1E2EA 3BB3A 3FDIA 4DCVA 2O5VA 2WJIA 1NMXA 4KV9A 4JBWA 4Q9HA 4Q9JA 4EJSC 3U44A 1XPRA 1JJVA 1KK2A 1W49A 1E2HA 1E1RD 1FPMA 2IXGA 2Z43A 1GNPA 1VG1A 1A2BA 1CJTC 3ND9A 4HSEA 5BN5A 3U6KA 4CEJA 1L8QA 4DHEA 1JEEA 1OSNA 3V4FA 4F4JA 3KQUA 4NHOA 1KOFA 4MUBA 3LBIA 4GDFA 1MH1A 3B1YA 3A4LA 1UBCA 2BCGY 3NHBA 4QBHA 2HYIC 3D7MA 4HAUA 3AM1A 1UBEA 1Z8FA 2QMEA 4IVPA 2VP4A 4HAXA 4XWAA 4DT1A 2QQ0A 4QNRA 3W6OA 1QHXA 3UANA 4Q4LA 1UKEA 3LQQA 3LLMA 4NH0A 4Q9KA 4NCIA 4LBZA 4A82A 1KNQA 5FI0B 4Z1MD 1T3SA 1NVVQ 4V0KA 2J41A 2OXRA 2PH1A 1ZD8A 4XD7D 4W9MC 1N6IA 1NLFA 3QEJA 2AKYA 2PEYA 2VHUA 2PT7A 1P7CA 2NO0A 1YZQA 3CZPA 3E5HA 3KKOA 4JBYA 5KPJA 5FBWB 3SYNA 1VYUA 4GZLA 2QGNA 4TMXA 1GITA 3HP1A 2BMDA 5JFGA 2J46A 4V0MA 5DN6A 1EXMA 1G3QA 3K9NA 3FPAA 4N0DA 1K6MA 4PZYA 4II7A 2W0SA 2QNRA 1QHGA 3WNCA 3G82C 2HT6A 1GZSA 5HE9A 2W0MA 3KDSE 3QXCA 3X1ZA 3FHTA 4URVR 2G1JA 4XJXA 5J4VA 2R6CA 4LYJA 4Q66C 1G6OA 4ESVA 1IJFA 1YZLA 4F4IA 4QJ3A 1HT2E 4PR0A 1OIVA 2CJWA 2J5XA 1RZ3A 2BM1A 3TMKA 4DCSA 1M7GA 1S1MA 2QROA 4DDTA 4AY2A 4HUQA 2OILA 3ZIAA 2FMXA 2W2TA 1E0AA 3ADKA 3KUDA 5AUQA 3FVQA 3TR0A 5KNDA 4LSGA 4D4LA 2BC9A 4HLCA 3JVVA 1GWNA 1M2OB 2ZS7A 1R7RA 4YLGA 5EJEA 1MO4A 4JS0A 1SKYE 1ZAKA 1X3SA 3DPUA 4QNMA 1Q1EA 5HE8A 4Q7LA 4Q7JB 4OHZA 4NYMQ 3F5FA 5FR1A 4LX0A 4I1SA 3E2IA 5SZHB 3ADCA 1Z2CA 2OLJA 3B13B 3B9QA 2R6GA 1X1SA 2FNAA 4Q1AA 2YWGA 4M21A 5JJIA 2KJQA 2IYZA 4JLOA 4DKXA 4MKIA 4V02A 3HJNA 3TBKA 1XEFA 3BXZA 1U99A 2IYTA 3BH7A 5JSZA 3WMEA 1CTQA 5DHAA 3G5UA 3SE0A 2J9RA 2ZRBA 4HEJA 4A0FA 2WWHA 2X77A 4D80A 5A4JA 2ATXA 2WPDD 3RRMA 2P3SA 3CRMA 1U9IA 4A6PA 3O47A 5EZ5A 2WWYA 2GZAA 3AGQA 4IDPA 1XD2B 1J7KA 5IHPA 1OHHD 5TMPA 1NN0A 4RJLA 4UNRA 1XPUA 3T61A 1SXJB 1EFUA 1U0LA 2ZITA 2ZU0C 5EQTA 3I5XA 1CJMA 1NBMD 1IY1A 1Z83A 3WXMA 2IXFA 2WJVA 3B5JA 4TLDA 5KSPA 3X1WA 4M1WA 1NG9A 4I4LA 1P62B 2ZXUA 4Q9LA 4A2PA 4EFMA 1Y63A 2XZOA 1D2EA 4BUJA 1VCNA 4BFSA 3LXRA 4MA4A 2ZE5A 3GD7A 4LC1A 3N2EA 2OE2A 3R9IA 1FP6A 3B9PA 3PEUA 3ZD6A 4Q9IA 5DISB 3TSZA 2WOOA 4WXRA 3GJ7A 2AX4A 3P27A 1W0JA 3RSOA 3OEHA 1W0KA 5FPHA 3QJYA 1KAGA 4MQBA 1C9KA 2O8CA 3THXA 4EPVA 4PTLA 5ANRB 3GFTA 2QRNA 3EZFA 2FSGA 3PR1A 1GP2A 2WM9B 2QSYA 1UEJA 5EUMA 1T6NA 2EU8A 1Z6TA 1E0JA 2CL6X 3GJ4A 2C77A 3FKSD 1HYQA 2A5DA 4B73A 3OE7D 2KI5A 3KFVA 5EE5B 4C2TA 2KB0A 3C7KA 3LNCA 2B21A 3FWYA 4LJ9A 1YJ5A 2F9LA 3Q8XB 1U94A 3ZZ0A 2PJRA 1IY0A 2XEXA 3P1JA 4AYWA 2ZSAA 3NC1C 1G17A 2R6AA 3WMGA 3B1XA 3TUIC 3CF6R 4DLVA 3ADBA 4ACBA 2J7KA 1U2RA 1G4UR 4B3CA 1IONA 1Z6AA 3SR0A 1IXRC 4KFRA 2J0UA 2UZIR 1WF3A 1W44A 2YHSA 4Q21A 3LW7A 4A36A 1GOTA 1GNQA 2GJSA 3QVVA 4JT2A 1GNRA 1G8HA 1YHNA 2FZLA 2GBLC 3IO5A 4DEXA 3PJRA 1PZNA 4Q1FA 2JLWA 1AJEA 2ODBA 3EZ7A 4UXHA 2FSIA 3PITA 4NYJQ 3TVDA 4MDFA 4XOIA 3SJCA 3SBDA 1XD9A 2JDIA 4V0OA 4FN5A 4P32A 1U8AA 3EA0A 4ILEA 5HCIA 4P4SB 1JQJC 2P6RA 2GA8A 3UKDA 2X8AA 1T9HA 4B3DA 4BQSA 3WRXC 5D3MB 3K0SA 1ZMXA 2QP4A 4B6FA 1QDEA 1Z07A 2VSXA 4ZCMA 4HZUA 1J8MF 3PG5A 5L3QB 2F9MA 1P60A 2LWIA 1GKUB 2O8BA 4EPRA 3BAFA 1SULA 1E2NA 4DSTA 1WRBA 2W2VA 4CZ2A 2J7PD 4D0NA 1UFQA 4ZDIA 3QUSA 2IYYA 3CPEA 1TF2A 3OFNA 3LBNA 4E07A 3V9PA 4U02A 4TL9A 3VR3A 4ARZB 5IK2A 1IM2A 4CT4B 4OJQA 1HURA 2ATVA 2RB4A 4GL2A 4ITRC 1CRPA 5FFMA 2A5JA 2IS6A 1HEIA 5TARA 4G0NA 2AWOA 2JIZA 1W4RA 1V43A 1KY2A 2GTPA 4TYYA 3ZH9B 2QY9A 4WZBE 4D4KA 3LRPA 4IVQA 4KVGA 4GNKA 4C0QC 4PSAA 4QM7A 2X2FA 4GBMA 4UXJA 3MWLA 4C3ZA 5CM9C 4OQFA 1TU4A 4OK5A 2C8VA 4P4TA 1WE2A 2C2HA 1DBSA 3IO3A 5GJBA 1COWA 1FQKA 4A0HA 1T8TA 1KSJA 2D7CA 5TDHA 1PLLA 1GL9B 2VHCA 1WBBA 4RD6A 4MDEA 1D9XA 4KJZA 5EP4A 4Q1EA 1Z0FA 5J5CA 1U81A 4PHGA 3DO6A 4RZXA 4TL7A 5HPYB 1XZQA 4ESHA 1NNEA 3KJIA 3RHFA 1KI7A 1FFHA 5JS7A 2JJ1A 2ZJAA 3OIWA 1XXHB 4HB3A 3HWSA 1E9FA 2R6FA 2W6ID 4XH9B 1KO5A 2V55B 5GJWC 3V00A 2J1LA 5DE3A 4PPQA 1QVRA 2R2AA 5KNBA 3RS7A 1TTTA 2FFAA 2WTUA 1YR6A 3ASYA 1YU9A 2ZUCA 4E22A 1VG8A 4F91B 1J99A 4DIEA 1C1YA 4A1FA 1N6PA 1HH4A 2P5TB 1UF9A 1SXJC 2V9PA 2IYUA 3CM0A 1DG3A 4Q4JB 1JB1A 2OBNA 5FUWA 3LO5A 3I4LA 3WY9A 3FFBA 2RMKA 5FTNA 1L7VC 2F1RA 2P65A 1H8ED 5BN3A 5FL7D 3S1AB 3SEAA 2QTFA 1GM5A 4XVUA 4OK3A 4NYMR 3U7EB 3Q72A 3KKNA 4GZMA 4TQAA 1EESA 4AYXA 4POAA 1VCMA 1OH8A 3RSLA 2RCNA 2R44A 5LB4A 4B44A 1YR9A 1AKEA 4NYIQ 4U7DA 1KK3A 2BCJQ 2FZ4A 2QAGB 3GEHA 5BXQC 3GLFB 1KDTA 1OIXA 1T0HB 3K0CA 3SJBA 1I4LD 3RC8A 1E4VA 4MYUA 3VHLB 3ETLA 3SYKA 1LTQA 4MRSA 1ZVQA 4UKDA 4NPHA 4JJZA 4C0AC 2QBYB 4FINA 4DBLC 2H57A 1XJ0A 1R6BX 4A0GA 3GLIB 2ZYTX 1NSFA 2ZQ5A 4URXR 4B76A 4TMTA 2QE7A 3HU2A 3AKYA 1S4QA 1SXJA 1T0JB 2FG5A 1KKLA 2XNDD 2OXCA 3CX8A 4NE2A 3AUXA 5FL3A 2O0JA 2ECKA 1NIPA 1AKYA 2PZEA 4C0SA 3ZDQA 1GUAA 1EFRD 4PO1A 5KO2A 1KMHA 1M7BA 4MITA 2RHMA 4B35A 3SHFA 3NWJA 1DAEA 1DAKA 5TY0A 4PC1A 1AIPA 4NONA 4C4PA 2FOLA 4FW9A 4OHYA 2C9OA 2D06A 5C46F 2OLKA 2HEIA 1E32A 1SVIA 3U5ZB 3W3AA 1F2TB 3SFZA 2UZ3A 4O2LA 2ZI5A 3MRSA 2QPAA 1UBFA 3AQ4A 4R98A 3ZD7A 1XMJA 1R5BA 5KSZA 1OJLA 4NCJA 3TW4A 2AKAB 3OIYA 4URYR 3IGFA 3T35A 2WKQA 1U8YA 1QHIA 3OAAA 2XSZD 1RRFA 1UKZA 2D2EA 3M1IA 5EE1A 1IN8A 1LNZA 1NY5A 3RS5A 1DS6A 3VMFA 2OFWA 4DLTA 1G16A 1QHHB 3I1FA 4Q19A 4OL0A 1CXZA 1OYYA 4XSHA 5JHHB 2VEDA 1NMYA 2ZR0A 1WP9A 3EW9A 4IKEA 4Q18A 5KDOA 1GRRA 2ONJA 4TWZA 1Z0DA 1GFIA 1KY3A 3CWZA 1P2SA 4DC9A 3RS2A 1IXSB 4RVCA 4GMDA 4D2IA 4Q02A 1UAAA 4A4DA 1AGPA 4ZDKA 4WW0A 2REXB 1HA3A 2EFEB 4A6XA 3CPJB 2D2FA 2FA9A 2XNSA 5EXTA 3QG5A 1GL6A 4HDCA 2BEJA 5FTJA 4MUAA 3K8YA 5JRJA 1RIFA 2XOKA 2H7VA 1T5IA 4ON9A 1E1RA 1GSIA 3TR5A 3WYGA 5C1BA 3REFA 2JLZA 3ADDA 2FGJA 3NBFA 4N1AA 5JWHA 1T4GA 4ZO4A 3AF1A 2WBLC 5G53C 4KYIB 4MGZR 4ACAA 4ERNA 1SXJE 2ZRFA 2BHRA 4XWOA 1ZM9A 2A5GA 2RGNC 2ZI6A 3C14C 1LF0A 4LYHA 4Q5IA 4L16A 4L5BA 3DM9B 4LWZA 1DO2A 4P4SA 4F7WA 1UDWA 3BB1A 1YRAA 2CCGA 2R9VA 3DZ8A 3QF4B 4C7OB 2V54A 2YKGA 3IEUA 4OHVA 5CK4A 4B2PA 2CLSA 5DI3A 1II8B 1S1CA 2DCUA 3PV0A 3MLEA 4KHZA 3R8FA 4IVRA 1CR2A 1JR3D 4PO9A 3U4QA 4EPWA 2H17A 2JAQA 3VFDA 3M4YA 2C78A 4URZR 3WHKA 3SJAA 3CNNA 4EFLA 3TNFA 4PX9A 5AWFC 1KJWA 2QENA 3SNHA 3I32A 4IFEA 3HYTA 4JLMA 4TTQA 1EFCA 2PX3A 3EZ9A 3IEVA 4BASA 5FUYA 1CR4A 2Z0MA 1E96A 4D0GA 3ZQ6A 2IYRA 4JSYA 3DHWC 3UG6A 4FMDF 4C30A 2VQSA 1E2IA 5BW8A 1EFTA 2HCBA 3IIKA 2IXEA 3PEVA 4KLZA 4XTRA 1J90A 1CR0A 3QXXA 5FTLA 2WVJA 4IEIA 2FFBA 4F92B 4WBSA 3TE6A 1X86B 1E79D 5LD2B 2O0HA 2ZRIA 2BIFA 3QENA 4RD3A 5DO9A 1TF7A 4LJ8A 2FN4A 4JSTA 3PCRB 4L15A 2QQEA 2BMEA 1QHSA 4BFWA 4DUGD 4A8JA 1M7HA 1LY1A 1OXSC 4RFVA 2FF7A 4PAQA 5TB5A 2BBSA 4LHWA 3KXIA 5F3WB 3DL0A 4FCTA 4HB4A 1DAHA 1Y3AA 2DBYA 1XXHA 2B8WA 2EVWX 2QAGC 4TTRA 2BJVA 2OO7A 4M1YA 2Q0HA 3B1ZA 3BBPA 2IHBA 3KXLA 4FD2A 5GJCA 2QN6A 1NL3A 4M1MA 5JRZA 1G3IA 4URWR 4OI1A 3ICQB 3GJ6A 1W47A 5DLQC 1G3UA 2B7CA 2VP0A 1HTWA 3U7FB 2A9KA 2KE5A 1SHZA 5H70A 1PV4A 2R6DA 2QM8A 4OI4A 2A2ZA 2F7SA 2FPLA 2N1BA 3IHLA 1KSGA 1CU1A 4XVQA 2WWGA 2HF8A 1UJ2A 1WB9A 3HU1A 3M6AA 1Q3HA 1ZD1A 5FBRB 4Q4JA 2ZI3A 2WJYA 1ETUA 3VKWA 1MO5A 1XFAA 4B2IA 1OE0A 2G6BA 3LVRE 3TJZA 2H92A 2VF8A 4W5HA 4YMVA 4US2R 4PAOA 3EASA 3SYLA 3WHLA 2WSSD 2OUKA 1Q20A 1N6RA 1QVAA 1E2GA 1CP2A 3KB1A 5HTKA 2WICA 3KJEA 4BLTA 1ODFA 4JLBA 5DGXA 4Z54A 1MO6A 4Q1DA 5CK5A 3KL4A 4KSBA 1KK0A 1CS4C 5AJVB 4QGHA 1M34E 3W5JA 1N25A 3RRZA 3QKTA 4NYIR 4O0MA 3T34A 3C8UA 5FUXA 1Z0JA 3NHAA 4FMBB 1LW7A 3UMRA 3RWOA 5TVKA 3GLHB 3MMPA 1E2DA 2WJHA 4W5JA 4RZ2A 1IHUA 3BIFA 3HYRA 4PPGA 3ZLJA 1H8HD 4RD2A 5KNCA 2OZEA 3ZQJA 4WA7A 1LS1A 3ZJYA 3HDTA 3EA5A 1EK0A 2YOFA 1NLZA 1A2KC 3EG5A 4A9AA 2NPIA 2D7DA 4E5UA 4HUTA 1SVSA 1R8QA 1IN4A 2IS1A 5J4YA 2AXPA 3PUZA 1Q1ZA 2BV3A 3GP8A 4JLAA 4BRUA 3FKSA 3BD9A 2ASEA 4JL5A 4R71A 3N2IA 4ZPXA 3OE7A 3DMNA 3K0AA 5C4MA 2OG2A 1GTVA 2ZREA 4KODA 3TUZC 1AQYA 5FPKA 1XXHE 4JBXA 3AVVA 5GJVC 2RH5A 1CEEA 3DKVA 2VP5A 2XB4A 4JL6A 1UKYA 3KQLA 4H1UA 4HAWA 4R7ZA 4LOAA 3I72A 2W00A 2W58A 2ZJ5A 2QMUA 1XF9A 4S35A 1Q22A 2FJUA 5JI2E 2G88A 2XXAB 2DY1A 4BECA 2ZSDA 3CRW1 4PHHA 5AUPB 1RW4A 1G5TA 3K0FB 5E3HA 2OAQ1 4YMSA 4MGKR 3CRRA 2OCAA 1VKJA 2IYXA 2WJJA 2GVZC 1US8A 2H16A 2OV2A 2C5LA 1O3YA 3EIHA 2JASA 2RGXA 4AKHA 4LV6A 4LYFA 4JVLA 5EXXA 2WZQA 2RGCA 4EJSA 4CEHA 1E9CA 1RJ9B 1RRGA 2P6UA 2BKUA 2RGGA 4L8GA 1F2UB 4DVGA 3K70D 1XBTA 2CE2X 1D6JA 5CJPA 5B58C 2VLIA 4DCTA 3LQRA 4B3GA 4KCGA 4MYTA 4PAMA 3GLFE 4ZCIA 5G3ZA 5TV2A 3W6PA 5LB2A 1QHYA 1XD8A 3VNUA 4DSUA 3X2SA 3AEZA 1CRQA 2CVHA 4PSVA 1OH5A 5JJKA 1GG2A 1OKKD 4IRUB 5F9FA 2BBWA 1ZP6A 2X2EA 1KDRA 1LF5A 3L8ZA 3E70C 1VMAA 3GLIE 2O0KA 3LVQE 2AFHE 3MG9A 3NXSA 2DWOA 1ZRHA 3RABA 4EDHA 2KBFA 4ZI2A 3LX5A 3W5IA 2J7PA 1G19A 1AZTA 2RGDA 2XTNA 1Z47A 2W6JA 2VTKA 3QXJA 4LJAA 5P21A 3OZXA 2IF0A 4TMWA 3NEJA 2GXQA 1G64A 1U8ZA 1G3MA 4OQNA 4C7OA 1I4DD 4M9ZA 4C0BA 4RD4A 2IX3A 2O8FB 2BM0A 2O8DB 4BLOA 5J4HA 3GJ5A 1JBKA 5AK0A 1II8A 3W8NA 3VU9B 1NRJB 2V6IA 5EE3A 1YRBA 2CVFA 1VTKA 4M9XA 1OPXA 2WWFA 4PFSA 4JKIA 1GILA 3LW8A 5AR1A 4AKEA 2ZTSA 1G7CA 3D6TB 1E3MA 1N0VC 1AQUA 1S96A 3QKUA 1JI0A 1E2FA 2HDNB 2AN9A 2NQ2C 1ANKA 3AF3A 2YYZA 3THOA 3ZYCA 4MH0R 4BPBA 1CF4A 2CNWA 1WXQA 2ZE7A 2D62A 4DZZA 1XDBA 1ZNXA 2H8KA 1E1QD 5FOVA 1KI6A 3PEWA 1CJUC 1E9DA 4ZCLA 2BMJA 3F3YA 1F60A 2ZJBA 1D5CA 3U2QA 1NN1A 2A5FA 3VNVA 2XTZA 4LJ5A 1CBUA 3L0OA 5CB8A 4DB2A 2PCLA 1F6BA 1KO1A 2CE7A 1O87A 2JGNA 2EYUA 1KDPA 3JZAA 2W6IA 3KZ1E 3GJXC 3MFYA 4HATA 4LYAA 3BWDD 5EZ6B 1FUKA 2IC5A 4BGDA 1J2JA 1XEXB 2NTYC 3AKCA 1EG7A 4HZIA 4NZYA 4TL6A 3U3RA 3TQFA 4GRAA 1ZD9A 4MKGA 1R0XA 1P9WA 3OHMA 5JWOA 1MRSA 5ELXA 4TLCA 2Z4RA 1FTSA 4XSGA 3A1TA 1D9ZA 1OXXK 3SFVA 4BFVA 3VR1A 3AF4A 3O8BA 4JL8A 3T15A 4EPYA 1E2MA 3CX7A 1JPNA 3WP1B 2VP6A 1R2QA 1CKEA 1H8EA 3CWQA 1TEXA 4KAXA 1W46A 3A1WA 2NG1A 2ZANA 3WYFA 1G5PA 1DEKA 2OT3B 4AC9A 4RKFA 1Q1BA 721PA 4PXAA 1A82A 3AF0A 3TH5A 3VKHA 1YZTA 3EIQA 1W4AA 1Z22A 2YINC 1LV7A 2RKOA 4JLKA 2FDCA 5L3SB 2ODNA 2HXSA 1RC8A 1MRNA 2DFLA 3DEFA 4B6EA 2VBCA 3BE4A 4UNPA 2BDTA 2JCSA 4LJ7A 3CH5A 4V0LA 3R9WA 2Q3HA 3AF2A 4PC6A 3JVUA 3W3ZB 5E95A 3SZRA 2XTMA 1G41A 5FPYA 4AURA 4LPKA 4KVAA 5B57C 1X1RA 2CXXA 1E99A 2V7QA 4OK6A 3A8TA 2JJ2A 2WMOB 1N3BA 3B1WA 1E2JA 2F3RA 1F3OA 3EZ2A 2QG6A 3HR8A 3P20A 4QG7A 4WZ6A 4X8OA 4M1SA 5AJZA 5JWRA 4P31A 3PUYA 1G9XA 2VPPA 3B1VA 1IN7A 1BKDR 1N6LA 1G4AE 2FFHA 1I2DA 2X1VA 3BJIC 3AUYA 3CKLA 1GKYA 4DRZA 1TX4B 1XNJA 3R7WB 3QI2A 4QM6A 2XX3A 5KU1A 2VF7A 4Q1CA 2IYLD 1EFRA 1T3HA 2ZJ2A 3NC0C 1Q44A 4Q00A 4PHFA 2GF0A 1NSTA 5KDDA 1D2MA 4HAVA 3DKPA 4BFXA 2V8OA 3QBVA 1G5RA 3LWNA 1AGRA 2Q3FA 5KDLA 4Q4HA 3I62A 4ABYA 4PO8A 5E7MA 4QRHA 2CHQA 3H1TA 4QHSA 5EXSA 3QPUA 5FOSA 2EYQA 4EQ6B 2ZS9A 3KFXA 4QXAA 1G8YA 3PUXA 3Q5DA 2AL7A 3FTQA 1FTNA 3H2YA 4Q48A 2G77B 2CK3A 3KKMA 3NTUA 1ZUHA 2EWVA 4S2EA 4AWXA 4RZUA 5DYIA 4B47A 3MD0A 5C18A 4JMPA 1Q3TA 2OSBA 1GKIA 1E9BA 1N5JA 3VTKA 3ASZA 1V5WA 1SVMA 4OQLA 2VYFA 3QY0A 4TYQA 3SC3A 1XWIA 2J45A 4RFSB 5KSOA 5JECA 3K70B 3Q85A 2GHIA 1XTIA 2GCPA 1N6NA 2GBLA 3SU8A 2QT1A 1TUIA 3GFOA 4G3XA 3KB2A 4ZKEA 2XXAA 8OHMA 5J40A 3WNBA 1L4UA 2NO1A 3L8YA 2QAJA 2Q9BA 4ZIRB 1YZNA 2ERYA 1TQDA 2OFXA 4AG5A 2WMNB 2WWXA 4NTZA 3ZIAD 4M1TA 1CJVC 1TUEA 1N0UA 2JLSA 5D3QA 1W48A 1PUJA 2HF9A 1OXTA 1N5KA 3QQ5A 2DHRA 1ONBA 4O25A 3QPWA 4QGGA 4LRWA 1NVVR 1TNDA 1KI4A 1KNXA 2GEDA 3IPYA 2HLDD 3UWOA 4HB2A 2JLYA 1RJ9A 4L9WA 2NPFA 3RS0A 3RWMB 1XCGB 5HKKA 4CT5A 3TIFA 2G3YA 4ZKDA 3THYB 2HJVA 5CITA 2ZRNA 4MYHA 1EFHA 1UKVY 2ZUDA 4ZI3A 2BEKA 2ZRGA 1VIAA 4PHTA 4JIMA 4NCKA 3IHWA 1SGWA 2BOVA 2YVUA 4FMCF 4DWJA 3IILA 4WVFA 4O3MA 4YMWA 2WV9A 1A7JA 4MRNA 2D3WA 4X8LA 5K8IA 1YVDA 1WMSA 1ZC4A 4B33A 1N5LA 3GLHE 1IQPA 3E1SA 1JR3A 1NVUQ 2QSZA 3FHCB 1RVDA 3Q5EA 1OXVA 3H0KA 2EWWA 1S0UA 5E7JA 2BKEA 4FXPA 2ZAOA 4NKRA 5SZKB 3T1OA 4D6PA 1YKSA 2ZJOA 2ZEJA 3J81k 1W4BA 2HXYA 2O8EB 1TPZA 5EUQB 1Z63A 1YQTA 3BFXA 2QTVB 3EX7C 2FGKA 1RKBA 1ZNWA 3N70A 1RPZA 2O8DA 2OHFA 4P4UA 1KSFX 1SVOA 1Z06A 3O8DA 4FCVA 4KO8A 2J0SA 2V1UA 4DDUA 2CLCX 4AKGA 4I1VA 2YOHA 3RS3A 5J4LA
chains in the Genus database with same CATH superfamily
3IUSA 2XLBA 3QVSA 1ZKMA 1LUAA 4K6FA 1KE1A 2J6IA 4RA6A 3IR7A 1E0KA 2JH8A 4XWGA 2AN5A 3ITEA 1SIUA 1XEWY 4KXFB 4ND7A 4OHUA 1E3IA 1N2BA 4GT1A 1Q83A 2HQSA 3CJMA 5DNYB 1E58A 1AS3A 4CXMA 3ADOA 1M6WA 2PZ8A 3VQTA 2WHXA 1PBTA 4LGMA 3TE8A 1FDUA 5B30A 1PX0A 3OKCA 1DLIA 5CLJA 3FYDA 3FBTA 3HB4X 1YB7A 4Y6SA 5GONB 1DQSA 1J5PA 4GM1A 3HXMA 4OI2A 2WILA 3V7FA 1E3SA 2NPOA 5LQKA 5T67A 2AI3A 5CNKA 1YLTA 1B0UA 3ZGXA 2VEOA 3LIDA 3DW0A 4KLRA 4OPZA 4UU8A 2V4ZA 1U11A 4MV7A 1LI9A 3E1GA 5D1HA 4C21A 1NBAA 1HYBA 4CGZA 2JIZD 3DVQX 1BMDA 3K9CA 4D6YA 5FLKA 4E1VA 2RHLA 3JWEA 3VPGA 2FRXA 2O6HA 2IHTA 3OEED 4UM5A 2BH9A 4I1UA 4HR7A 2JJ1D 3NW9A 3RJ9A 3E4CA 1RD4A 3EXEB 4UCFA 2CV1A 1USIA 4EZBA 4HX2A 4UTRA 3V3KA 1HORA 1MOZA 3EOZA 3W2EA 4FHFA 4FHZA 1Z17A 5D86A 5JZVA 1KI3A 4KU4A 1XRSB 3VV3A 3EIFA 3UMBA 2JH9A 3UUWA 2NM0A 4GHWA 3H4MA 1IOZA 4DR2B 1HE8B 2DFNA 1HNZB 1D4ZA 5AOVA 2JARA 2XGSA 4OYHA 1AXBA 4ZICA 2VFAA 3S1AA 5F9HA 2BZGA 1KE3A 1P1HA 1IBMB 2AMFA 4DE3A 4C6TB 1BX0A 2OGWA 4L5AA 1A9PA 1HOXA 3OAAD 4TV8A 2J0UB 3BEBA 1ZJ4A 5LQNA 5CNMA 4Q4AB 5T4FA 2I1LA 3RIXA 2ZBDA 1EGMB 2I9VA 2WZCA 3CA8A 2IJGX 2AYZA 5LCXA 1FMJA 4II2A 2W4QA 1JVSA 1UT6A 1EWZA 1RYEA 2WJ4A 1E69A 3MS7A 5HVNA 2HUPA 3A2MA 1EX1A 4M8IA 5B3JC 4Q47A 2PX4A 3FD8A 3L0IB 2NZJA 2WF5A 2ZWPA 1S4RA 5HF8A 4NDZA 4RQUA 1JSZA 3RUIA 1CHNA 2PZFA 4AMBA 1NJ1A 3LAWA 4MQMA 1E2KA 1NM5A 4N12A 2F6RA 3A3NA 4ZJ3A 5LLDA 5AM1A 1PV2A 4UM8B 4MS4A 1NW4A 3LR5A 4YJ3B 1ZBDA 1V1JA 5I4BA 1GU1A 3DNFA 4NBUA 3T7IA 1IYQA 2V6FA 5DJTA 4EGAA 1KE2A 3QA9A 1D2AA 1DT3A 2HQ1A 2WQZA 4FOFA 1X80B 2A67A 1THTA 4BMYA 3GVPA 1RXEA 5LR6A 2X01A 4QEKA 3EEHA 1NXQA 2PMDA 3ZCVA 4N6GA 3AR2A 1DTWA 3TW6A 4WLEA 4X3CA 3H86A 4KIGA 5EJ7A 1FDVA 5CJJA 2GXAA 3MAGA 2KWIA 2VPXA 1C7JA 3N6RA 2V58A 4ZJPA 3MRTA 3T4SA 3Q7PA 1DUSA 4X1YB 1KJ9A 4ALJA 1O6BA 3SF0A 5G0VA 3TW8B 4LV5B 4JROA 3BGVA 2IT1A 3QYAA 5F82A 4MWTA 3VSCA 3REGA 1QQBA 4L8WB 2MSEB 3FOFC 2YOGA 1MX1A 4RCZA 2F90A 2X42A 5AM0A 3DEKA 2WWRA 2G8LA 2W6ZA 4IRXA 3LPAA 5C0OE 4JGIA 5BQ5A 4BMXA 5FI3A 1M2VB 3EQ8A 2AZXA 1L3IA 4WK6A 4X6YA 2GJ9A 4I46A 1MABA 3IQXA 3IP9A 4BJHB 1KAHA 1QMGA 2JFNA 3GYBA 2XCIA 4UNNA 1MKMA 4D0SA 3D7NA 4CQMB 3K0FA 2QOEA 3HACA 5JPDA 3NECA 5K45A 1BYUA 4LVCA 1IZ7A 3UAWA 3U4LP 5KOHB 1K54C 3LT1A 2Y0EA 4XEHA 1HNNA 2C9YA 3U60B 5CD9A 1RBZA 4S1WA 3GCXA 1J21A 5F1KA 1R0KA 1A5SB 3LU1A 2BTFP 2CNWD 5GOTA 3ZUPA 3T5GA 1C3BA 2DQSA 4HJRA 1TD9A 5KI6A 4AD8A 2ZTVA 1SU4A 1W36C 2O8FA 2PL9A 4OBEA 2ZAMA 1Y5IA 3MTQA 3GDWA 2DPLA 2V0CA 2JS7A 3S1YA 2FAXA 3DBOB 2ODWA 3RB8A 1XB2A 1YS1X 4RV5A 3RGWS 1J97A 3TQRA 3C48A 4EHJA 4RNDB 3TTUA 1UC9A 3BREA 4EMTA 3MWKA 5INTA 3I1IA 2GJ8A 3HBFA 2JLVA 3K09A 2IBMA 5E7QA 1QB7A 4GPTA 2VXBA 4YLEA 3UIEA 4YMIA 5CYFA 4RQBA 2QRJA 3ORYA 3TLXA 4ZTZB 3ZI0A 1HLFA 2W1TB 5DIZA 1FSFA 3VSBA 3VOSA 4Q0MA 3HKEA 5EIOA 3PC8C 1LC3A 1HMPA 1G8SA 5T4EA 4MYRA 4B32A 4OP2A 1ZU5A 4LDJA 3UAXA 3H6GA 4JVSB 2CK3D 3R0JA 5SZIA 1YMVA 3FHLA 1ZGGA 2VRBA 3L7OA 3AL0C 5CXUA 4X93A 2QRZA 4FFVA 3EHEA 2Y67A 2O3UA 4DUYB 4GDMA 3STYA 2ZB4A 2ZYHA 2JJQA 4LTMA 4JI6B 1SXQA 2AV6A 3QI7A 1QC5A 4XQ9A 4WLOA 4TN5A 3FNRA 5GV7A 3N8IA 3FB1A 2PUCA 4I1IA 4EA9A 3KOUA 3VAAA 3UH1A 2NO9A 3A4NA 3UB8A 1L6RA 5HKAA 4UATA 1KVUA 2V97A 1V6AA 3NHSA 4KTTE 2VT3A 3H2BA 5TJJA 3SZOA 5BV0A 5HNKA 5HSQA 3T06B 3CUTA 1KP9A 5KQSA 4YP7A 2ECQA 1R6AA 4CIBA 4ZK2A 1VHTA 3P2YA 2TMKA 2HCFA 2ZSFA 5DF9A 3ZQ4A 1W5TA 4R3WA 1TIKA 2Q49A 3HZHA 3WKBA 5BVGB 1PT6A 2D1SA 1UXHA 1UBNA 3UT5A 1JXAA 1V4NA 5KQRA 1QAQA 3YASA 1BVRA 1CDZA 4PCAA 4QUKA 1PVDA 5IVHA 1B7GO 2PE5A 4LZLA 3I3SR 3MJHA 3VP0A 5BOSB 13PKA 4D81A 3EGCA 4LVNA 2MSKA 2YMLA 2PX2A 4BTVA 5BW6B 5MN4A 5K8UA 1UJMA 3ZWCA 1L5GB 3UMDA 2P6PA 2V59A 4C29A 1YE8A 4S1PA 4GDNA 2CXSA 4OQZA 3ZWBA 2IUTA 2DHDA 4FZJA 3FDZA 2HMVA 3NOTC 4WJKB 1K06A 2CHGA 5K99A 5LOVF 3BY8A 1YXMA 2VAPA 1I10A 4DYDA 5M2QA 5BQPA 1WW2A 2Q4OA 2ZMFA 4C20A 4X94A 3D3WA 3I9LA 2BCGY 3LZDA 2EG9A 3PT9A 4OMFG 3S55A 3OCXA 5LM3A 2QQ0A 4GSLA 1UKEA 4BPRA 3GRYA 3ICVA 2O0MA 4R2KA 2EX1A 3WOHA 1LSUA 2GNPA 4KYVA 4DDMA 1ZTUA 1SA0A 1XYYA 2PZKA 2JB9A 4F5ZA 5JQGA 3MRXA 3FHTA 1QYXA 5JTTA 1PJTA 1SK8A 4F4IA 3TQSA 1HSZA 1MC0A 1I6LA 5TX7A 1K55A 1UANA 3PXXA 1T5OA 3LUAA 2WWTA 1KYZA 4S1TA 4P36A 3ZG6A 3ZNNA 3OJ0A 1PWXA 4KAAA 3P2JA 1QQ6A 2P3QA 4HRXA 1XEFA 3TQQA 3BH7A 4B0OA 2HMUA 2ATXA 3PC6A 2IPLA 2Q0QA 3GGPA 1CJMA 1IY1A 5BUZA 1NXWA 3QPBA 1XZJA 1KFEB 4B4ZA 2QXYA 3CLOA 4KQ9A 2XZOA 4JI8B 4MA4A 4IWYA 2VHZA 4W7HA 3FTPA 2QX4A 1W0KA 1FRQA 1C9KA 3RIHA 1MRZA 4Y1FA 5ER6A 1QIHA 2QRNA 4XW2A 4JITA 1D4AA 2OSUA 4B73A 3LUBA 3DF7A 4C2TA 2CMDA 3BX1A 1VDMA 4HXYA 5L53A 1M1NA 2AEJA 4BNFA 3HL4A 3OWOA 1G0NA 3IH9A 4IJKA 3FGPA 1PJQA 4KFRA 3GLQA 5LLTA 2YHSA 2UVPA 2QAIA 4TS9A 1HBJA 2X6RA 2ADFA 3BWEA 3IDZA 3SBDA 3WIDA 1QE3A 2JD1A 1U8AA 1NXXA 1XN1A 5ALLA 2PRYA 3QMMA 1SQSA 4L8FA 2O8BA 4WLFA 1UFQA 5KOJA 1KGFA 2EP7A 2I9PA 5IT0A 1J9EA 2NX2A 1W4RA 3QVTA 3LRPA 4RKWA 3EODA 4GMGA 4GBMA 2ZCVA 1U1DA 2OYCA 4CDRA 5F1FA 1KSJA 4EHHA 3S68A 5FWXB 3F9RA 2JPDA 4RE5A 4OP3A 4TL7A 3I45A 4A5OA 1XZQA 2MT9A 2VPTA 3M1YA 3FOBA 3KP1A 1E9FA 1TB4A 5GJWC 4PPQA 4PYNA 2UXDB 1TTTA 5CTAA 5AW7A 2A1UA 4GZ6A 2IYUA 3T1QB 5AKLA 2GJ3A 1DRUA 3BVPA 5KC8A 4BL2A 1BXGA 2H00A 3QP9A 3GEHA 3T50A 4BNHA 2FSVA 4UZFA 3SYKA 2XCOA 3JW8A 3MVEA 2CLKB 1ORIA 2X8JB 4BKPA 5CFOA 5F23A 4II3A 1KKLA 4NE2A 2O0YA 4NXGA 2O0JA 2ECKA 4C0SA 4BQPA 1DAEA 1EK2A 2J5RA 1QLJA 4D3DA 3ROFA 4GEGA 3RPEA 3QBEA 5K51A 3MRSA 3UDFA 4U2EA 3F6SA 4A7PA 1RR6A 1UBFA 3NUQA 2WKQA 1TF1A 4DCGA 3FWLA 2P74A 3RS5A 3E7FA 1OYYA 2C7VA 1ORTA 3NGMA 3EW9A 5KYXB 3LEQA 5FLEX 3WLNA 1T19A 1S2GA 5FBZA 3KR0A 1GL6A 1T5IA 4GGOA 3TR5A 3G35A 4EEPA 5FD8A 2XYGA 1EU1A 2C5EA 4B6OA 4S1NA 1SQFA 1T5HX 4Z49A 1JG1A 1FCOA 3H04A 5CT9A 2YDYA 3CXUA 4RH3A 2BGNA 5E6SB 1N4DA 2LPMA 2P9JA 1TA9A 3HG7A 4QUIA 1DQZA 4BY9E 5DCLA 2JAQA 4ZEWA 3C3MA 3RK4A 5CDGA 3VDRA 4GN2A 3EZ9A 1N1GA 4HEHA 1SCDA 2X0EA 2W4MA 1TM7E 1NX9A 3F2IA 1ICEA 2AQIA 3QYFA 2IXEA 1CR0A 4PHCA 1IH8A 1DSSG 4E2FA 3OZWA 2B9EA 5JH7F 1FDOA 3R5TA 3PCRB 3BXPA 3WRYA 1QHSA 2BGWA 1R16A 2E21A 2FF7A 1V7PC 3CLTD 1ODSA 3S4XA 2Z8XA 1UZLA 1D6SA 4NFYA 2QAGC 3C8ZA 2XLCA 1TT5B 3ROTA 3SW1A 2D59A 4I5GA 5DCWA 1ETUA 4DCMA 2Q6VA 3TJZA 3JQBC 2Y1LA 3OOJA 1YQEA 2C4VA 5KVSA 1L5MA 2YHAA 1XLVA 2ZM0A 4MR7A 3GA0A 3VPCA 1SUAA 4RJTA 1LK0A 5DNVA 3CO0S 4GM4A 2JFUA 4AJLA 5FUXA 4TV9B 3RD5A 3K1YA 3MMPA 3W79A 3UJBA 4KAFA 5K1ZA 4QTUB 2DPHA 3DD1A 3KYCB 1RRKA 1A98A 4HRYA 4R71A 1KWGA 2R78A 5SYAA 4ESEA 5EHGA 3M34A 1DC8A 2ZSDA 4PHHA 5IX8A 4NY1A 2OTCA 1O3YA 4CF5A 3P0IA 4F2WA 5DHRA 5JISA 3KT0A 2J9XB 2FRVA 3PAEA 1WPXA 4J0CA 3K2IA 2VLIA 3AWIA 3M2JA 2BSXA 2F62A 2DBZA 3FDJA 2HF2A 6ADHA 1NW3A 4OBXA 3PGLA 4UA7A 1L0BA 2B8EA 2CVHA 2X58A 5JJKA 1OKKD 1I1QB 1VMAA 1MXOA 1Q1GA 2AFHE 4YASA 3UUEA 3KKKA 1ZRHA 5F21A 3RABA 2XCTB 1G19A 4R51A 1PFWA 2GBFA 2BTEA 2W6JA 3QXJA 3GLTA 3I2KA 2LTAA 4JODA 3T5AA 3EWKA 5C3UA 2BM0A 1JQAA 1CS0A 1BA3A 1NJ2A 3OQIB 4BWGA 1YS6A 4OQGA 1N0VC 2DY0A 1CQWA 3LY7A 1ANKA 1CF4A 1SWVA 4IZIA 1M2NA 1CJUC 4TXLA 1PGPA 3DYBA 4E15A 4FKBA 3HVKA 3JQ8A 3RAJA 1KO1A 2JGNA 3F5DA 2A86A 3TQFA 4XFJA 3GUHA 2Z4RA 1GCEA 2PBYA 3OFJA 2W8BB 3VR1A 1H85A 3CX7A 3ZQKA 1M0SA 4MUEA 3FFWA 2CL5A 2QXUA 3V2GA 4MINA 4PFJA 4LXIA 1KOGA 4RLFA 2G04A 5LZ2A 1DWPA 1X7DA 3HR4A 4AN4A 4JGOA 1OBOA 4KQWA 1M2WA 2B25A 3OUZA 3UUGA 1Z8NA 4P31A 1XRPA 5HA5A 1G9XA 4DWOA 2RJOA 3OKFA 2PPLA 3D4OA 5BRJA 1GFSA 1QFMA 1AHHA 1T3HA 2VDVE 2UUAB 2FUG6 2J3QA 2GF0A 1QTIA 5ALVA 1OLUA 4OJTA 3PJDA 1YI1A 3R7BA 4EQ6B 4BYMA 3Q5DA 2O1WA 4P3OA 4OGWA 3NTUA 2GCGA 2ET6A 4DGSA 3ISVA 2QV0A 3K1AB 3SU8A 4IG9A 2IPXA 1KJ8A 1ECLA 8OHMA 5E6UA 5T5QA 3OQMA 2AZDA 2Q9BA 2ERYA 3I39X 3GFFA 3LOPA 2X41A 2JI7A 3RWMB 2ZRNA 1SUEA 3KYDB 1GFZA 4DUZB 4PG6A 1MWSA 4MV3A 1WAMA 1F8FA 2X8LA 4X8LA 4HBZA 1MEOA 3AHJA 2GFHA 5TQ2A 5JXWA 3T3IA 2HXYA 3SXJA 4PFKA 3BFXA 1O57A 2J9ZB 2QTVB 2JRLA 3RC2A 1KSFX 5HM6A 4EI8A 5B7GA 5BW5A 5KEIA 4KLNA 1MF7A 3S2ZA 2EJTA 1I32A 1T9DA 5C8YA 3BORA 1BU8A 4LECA 3ISGA 4NBNA 2PUEA 4E32A 3CO5A 3VKGA 3U1TA 1BN7A 4PIPA 5CDFE 4WTOA 4BNTA 1W7AA 4AP9A 4MV5A 2V6MA 2JIQA 4OXYA 4BZXA 4DCNA 2J6CA 4IIDA 3BSYA 5A06A 1MZPA 3OCYA 3LEZA 1DKPA 1CF2O 3ZK7A 5TBMB 4K9OA 4WY2A 2WSSA 1KVRA 4C0JA 5EVEA 1DKMA 1NFRA 4AROA 4XCXA 1XEAA 4Y0VA 4OOMA 4N5NA 2B37A 4DT1B 4B75A 2OCGA 1GSXA 1DDIA 2LGJA 3VDQA 4J29A 1UWPX 4G0QA 3L82B 3L06A 4XGIA 5HX7A 3ZZUA 1OXUA 3UF0A 3V1KA 4OP8A 5CLFA 4JWKA 1J1ZA 2DPMA 1ZKJA 2X3UA 2BFFA 1AXRA 1TO6A 2F1IA 1S2LA 1XAIA 1P7VA 2CJWB 2ZYVX 1IRXA 3BZUA 1S7CA 2P4HX 1AA9A 1O54A 3DEYX 3AR4A 5PNTA 1VB3A 1ENYA 1OIWA 4XVRA 3W6UA 4QFDA 1TGYA 3VPXA 3PLRA 2W5UA 3NRCA 4EXOA 3FYSA 4LNAA 2GCEA 2RAPA 4JUBA 3QLTA 3BAZA 4RK4A 4OQYA 1MC8A 4UBMA 2X76A 5E2HA 4FT4A 3MJSA 4UMFA 4ZQGA 1G7RA 2Y1GA 1RXUA 2E87A 1G66A 4FNMA 3BFCA 4NCHA 5JJ5A 4CMGA 1IELA 4OQPA 4BZQA 4E5SA 1DOAA 4IRMA 1HT0A 2XRMA 1YSCA 1PVVA 3KSAC 1E2PA 3LDHA 2XMRA 1UJ5A 4N3AA 2FFQA 4WGFA 3DLHA 4M22A 3SF8B 1P0CA 2I8CA 4H4EA 4QHTA 3QHPA 2XB9A 2Y99A 5B3AA 5L45A 1WOMA 3INGA 1JTGA 3GLFA 4S12A 3BIWA 3DBLA 4D02A 3ZGOA 3OIGA 1OXBB 3LHIA 5KYKA 3DP7A 2Q9AA 2VJOA 3DAPA 2I4RA 4X90A 4XUCA 1PWEA 1ULBA 2FMIA 5IKXA 3LLSA 4ZJ2A 5THXA 3NDBB 4RC9A 1SZJG 4M6WA 5TXGA 1Y8QA 3HUUA 1CFZA 1YA8A 3VKUA 4F6RA 2ONZA 1N5RA 4W5NA 3M2TA 1SXPA 2JCVA 3W8FA 3BJRA 3U2AA 4OHXA 1GZVA 1QRAA 3OPPA 4A73A 3NKVA 4RMJA 1SQ5A 1PHPA 1F6WA 1NU8A 1ODIA 3M0EA 2Q3LA 2BBTA 4RLSA 3FTEA 4Q7QA 3F5QA 2O48X 3U4CA 2Z4SA 1S02A 4X64B 5AVYA 1P7YA 2WU8A 3A3JA 3I5AA 2ZOIA 2WTNA 3KTAB 3D43A 1DO0A 4E3ZA 1H2RS 2P9FA 2LW7A 3L84A 1CIJA 3BE6A 1H42A 3LC1O 2GK7A 3WGYA 2C6WB 3WKCA 3OLXA 4D8XA 3FKWA 5C1PA 1MR3F 3OCNA 1JTFA 3ICWA 1YU6A 2ONYA 2R7MA 4KIWA 2XXBA 1P4RA 1L0GA 3U48A 2AI1A 3JPYA 2IUSA 5JEDA 3DD5A 2HSJA 4LFUA 4G5OA 3TSWA 4TV8F 4YJGB 3NATA 5KYNA 1GGEA 2WNSA 1O4VA 2VIIA 4CUZA 1NVAA 3NBKA 2KM1A 4ZAMA 2BGTA 1AKMA 2Q21A 1JG3A 2VJMB 4CIDA 1AS2A 2IZ6A 1DJPA 4BO1A 1XTRA 5EGNA 4F3TA 2B7BA 3DKIA 2QEQA 3GRPA 3K1JA 4U9HS 4X0EA 4XJTA 2EZTA 4WZAB 1QCYA 1I7PA 1G8AA 3W5SA 1RRPA 1YNSA 2ZB3A 4REQB 3NYIA 2PANA 2D13A 3AR5A 3H8SA 4X1IA 4Y7CA 2ORIA 4MKFA 1LSXA 1W25A 1B6GA 4F4CA 5CP8A 3OIFA 3F3KA 4Z99A 3OU6A 5FQKA 1JAHA 3E0QA 3ABRB 4BEJA 4YACA 2W2LD 3ZXUB 4K91A 2XODA 4HP4A 1EX6A 2K31A 4AW9A 1VFNA 1PR9A 3BUSA 4QYXA 3KYIB 3TQCA 1PQPA 3ZVLA 5LUAA 2GESA 3PUJA 3F5SA 2HHJA 2YS6A 4MVCA 4JLNA 3LR3A 3AHIA 1J39A 4UEQA 3JX9A 3ZLBA 1JHQA 1XCJA 2QUBA 4WI1A 3ES9A 4QPNA 4BZPA 5CA1A 3WS7A 1Z5ZA 1X7YB 5IYZB 5TEWA 3MA0A 16PKA 3AUJB 2GCOA 1UOOA 4EYQA 1A88A 3RSHA 1TVFA 4QHYA 1G20B 1Y34E 3KLOA 4MQEB 4IQFA 5BSMA 3BL5A 2C4TA 1PU2A 3VO2A 4G9BA 3N0TA 1F6DA 4HYYA 1WCYA 4GR9A 4IEEA 4O4JF 4I9FA 1VP9A 4KUKA 2JW5A 1EB8A 1JX6A 4M60A 5K9ZA 1OZ0A 4GJ4A 4N41A 2UZ0A 3PTEA 3IVAA 1NW6A 2BHSA 4KH1A 5BMVB 1COZA 1CIPA 2RGEA 1MFZA 3K2QA 1VIYA 3L1VA 1XXMA 1O0BA 1W0JD 3LBYA 4G81A 4ZCSA 2HA0A 1YVPA 3MTDA 1U7PA 1RE1A 4R40A 1ENPA 3S7NA 2J4CA 3ICCA 1DPFA 2F43A 1PT8A 2J87A 1JE0A 2NZYA 3WGZA 1KZGB 1BLPA 4WXPA 3UB2A 2ETXA 4J0FA 3R74A 5L9AA 1KEKA 2XGGA 1O96A 1ZC3A 2I29A 1S9DA 4NVRA 1N2SA 4TPKA 2I8LA 2YWDA 3PBQA 4P4GA 3CLUD 2AD1A 4G8BA 1L1RA 4WBGA 2ANBA 1DI0A 5HFJA 1ZEMA 3R6DA 4KYUA 3I8OA 4U2DA 3ZY3A 4B74A 1XAHA 5HFOA 4QL3A 3PZBA 1WCIB 4EJSB 1KPHA 2EX0A 1TU3A 3RU2A 1FS5A 5JZ9A 1WSAA 4P7GA 2Z09A 1OT6A 1JLHA 1N0HA 1NI4A 2ZI7A 1ZNZA 3A0UA 2M2IA 3VO1A 3ZWDA 1A9ZA 3BK2A 1N5MA 1BVYF 4P0QB 4JLVA 1WMFA 4MIYA 3H11B 3TPCA 3QELA 2VLGA 2I7TA 1V3UA 1JGTA 4MX8A 4LHXA 1AQNA 1NLMA 1F8GA 1L5VA 2GN4A 4HNSA 1HQYE 1QAOA 4XT2A 1BXRB 3NUZA 4EITA 1Z26A 3CNOA 3U3KA 1ADYA 5EY5B 1X7GA 1G0OA 3H99A 4YRRA 5ICMA 2WK0A 1A8SA 1JG6A 3Q9SA 3ZHXA 2NT4A 4M9SA 2PY6A 1I4TD 4QUEA 3AXSA 4QATA 3H0CA 1ZMOA 2ZYIA 3H5OA 4QPPA 3I28A 1H6CA 3L01A 4UTOA 2I1QA 3QPVA 4ND4A 4LCLA 1EUCB 2G70A 4S2MA 3S29A 5L8MA 5HF6A 1AV6A 5I9LA 1UBRS 5PGMA 4LSWA 4DMZA 4AQDA 3BTVA 2BGUA 4MEJA 4DE5A 1RE0A 4I8DA 1R8YA 2W2MA 3CJRA 1G3RA 3L3BA 4O4LB 3KYZA 3QVUA 1IBKB 4KZBA 3WBJA 4PPYA 4UUAA 4BLSA 1X7HA 4ARAA 5AOAA 5ADHA 4I66A 2JNWA 2AZTA 5BSGA 4R38A 4Z2YA 4M76B 4X20A 4BV2A 2WJIA 4ZYZA 3GV9A 2G08A 4O5AA 3OI7A 4W9MC 4DMKA 1TTPB 4KG2A 3SQLA 2HA2A 4MUBA 4JJEA 3TN7A 4FEEA 3I2HA 4Z9FA 5K2OA 1FFXB 2F59A 3LLMA 4NH0A 3B7WA 3BGSA 2JKFA 3KKOA 5CBPA 3AJRA 4QYMA 5C1DA 2QGNA 1I8TA 8GPBA 1G9SA 5DN6A 1EXMA 3VP1A 1TQ8A 1AQJA 2QNRA 4ZVNA 1GZSA 1BKSB 3WYBA 1Y7IA 1J7JA 4Q12A 3RVOA 3TLZA 3ZOKA 4LF4B 4X60A 2YN2A 4WCFA 5DLEA 5L7TA 3IAXA 3HGMA 1T3GA 5CEFA 4DF6A 1Q5PA 5DJ5A 3D0RA 1LSOA 2YWGA 2XDQA 2V4UA 3UTCA 4YCSA 2IU6A 2WD9A 3NDEA 4MA5A 1LBTA 3RRMA 5I3CA 1UWKA 1B4DA 4I9GA 4L9FA 1RQXA 2W4IA 5TMPA 4EF5A 2XBUA 2B99A 4HMPA 3MUOA 4ID3A 3WXMA 4XVCA 4YTEA 1G42A 4I4LA 2ZXUA 3M5PA 4A2PA 5ALKA 4ETXA 1VCNA 3EOIA 3ZW7A 4MUMA 1CEYA 3OEHA 3AFMA 3ITAA 5DULA 1DEHA 4CDNA 4KMMA 3JQAD 4C76A 4UM9B 2CL6X 5ICSA 2O2DA 2YNMD 5JQGF 3ZZ0A 2RI1A 4MUKA 5CGXA 4D5GA 4BS9A 3C6QA 3KJXA 3T1XA 1KYVA 3USZA 4H4CA 2YCBA 2B7LA 4XDZA 4Q21A 3SEFA 4UTVA 3F9IA 4M98A 2Q2WA 4UXHA 4ARBA 3TVDA 2IWBA 4IX9A 4GZBA 2FFJA 1T1AA 2X8AA 3NAQA 2PKQO 3F6CA 3KXDA 2R3SA 3K0SA 2QP4A 1RPJA 4WNCA 2PR2A 3DQZA 4DSTA 2G09A 1FX1A 2KDKA 3V9PA 3V8NA 3ZKWB 3VR3A 5LBRA 4ARZB 4EGCB 1JDTA 1ZD3A 3ULKA 4MYDA 2A5JA 1HEIA 1M34B 1RFGE 4P53A 3GYGA 2F17A 5TNXA 2Q07A 1QU2A 1BFUA 1AA6A 4RD6A 1C1XB 1S2DA 1D9XA 3DOOA 4DV2B 4KJZA 2OLUA 3HFSA 2V7GA 3PHBE 2ZM2A 3NZEA 2C42A 1HLPA 4GVLA 1PRQA 3P8ZA 4MPPA 2FFRA 4PBRA 2ZQ9A 2ZUCA 4MUGA 4DIEA 4P7BA 3CVWA 1SXJC 3BGIA 2OBNA 2PGAA 1TVMA 4QUJA 2P65A 1L5OA 2WFMA 5GLAA 3Q6MA 1G4HA 3QU2A 4FHDA 1WE4A 2Q1YA 4GVXA 4L07A 5BWNA 1NYYA 4RVSA 4UAUA 3K0CA 2ZBFA 1USWA 1X7ZA 5LDGA 2H57A 1XJ0A 4RA9B 4TMTA 3O9ZA 1S4QA 2YZNA 2Q6KA 4DRYA 5LU9A 1HFKA 1IKIA 1G60A 5EEGA 4ZI7B 5C35A 4HMOA 1M7BA 2O2YA 2NZWA 5E4TA 4EESA 3G1UA 3ZQUA 1AUQA 4R1TA 4XM2A 1VE1A 2HEIA 3N0VA 3CUKA 4WMCA 4UHEA 3DCJA 1GR0A 4ID9A 2J3TC 2Z9BA 2ZI5A 1RXYA 3EYWA 2GPJA 3IGFA 3GO4A 2GYUA 1UKZA 4PVDA 3IQIX 3OT1A 4OL0A 3V1MA 2Y91A 1EGVB 5AI4A 1A9XA 1QYRA 1AGPA 4ZDKA 1E77A 1IMJA 1HA3A 2N9UA 5DKFA 3WMXA 2Y77A 3KRTA 4M1QA 2FKNA 1LPPA 2Q3BA 1EK1A 3UJNA 2PUFA 5TFQA 3Q9NA 3C14C 5I9MA 5HAPA 1R18A 3U7RA 4P4SA 5A6SA 4ZQIA 1LBHA 5IXJA 2CCGA 1SBZA 2ZVJA 2DFDA 3PPWA 1IBLB 1XP4A 5K01A 4DG9A 3AY0A 4S1VA 2DCUA 2J4FA 1JR3D 2PXAA 4BC1A 1XTZA 2DOKA 3NDIA 1DWUA 1RYNA 1KJIA 3UG6A 2YKHA 4RW0A 1SXHA 2FFBA 1T9BA 4WBNB 3DZGA 4LJ8A 3OQNA 4E04A 3ZY2A 2Y0PA 1QQTA 3PD0A 2EVWX 4H7FA 3RKSA 3FLEA 4F97A 3GJ6A 5DLQC 2ZL1B 3F9CA 2A2ZA 2N1BA 2B4TO 1ZK1A 1NVEA 2OYSA 3A9CA 4KK4A 5IBRA 4Q4JA 5JCOA 5FXMA 1X87A 2R9WA 4B2IA 3LVRE 3TOXA 3JYPA 2H92A 4US2R 3I3OA 4PAOA 3LUPA 1Q6YA 1QR6A 1IDN1 1CP2A 4RZSA 1JH9A 4JXKA 3ESBA 2D4AA 1KK0A 2DWUA 1CS4C 2R751 4K26A 5D8DA 4FMBB 3JAKB 2PGJA 4RZ2A 4L0CA 5J2TA 3D7KA 1H2AS 3RK1A 1KRHA 2XNCA 3ND7A 1V16A 5LC1A 3D6VA 5IM5A 4M0DA 4JL5A 4JBGA 4KODA 3S7PA 1DJBA 2E4VA 3L1JA 4FNAA 4PLFA 1XROA 5KS2A 4BECA 2I8AA 2OCAA 4V1CI 1WXHA 1YKDA 3PNMA 3A6LA 3LJKA 1E9CA 1QOPB 1RJ9B 2Y1WA 1RRGA 2VS1A 2CE2X 2ACVA 5J1SB 4B3GA 4KCGA 4EFKA 4RMHA 1QOZA 4LE0A 4XCQA 5F9FA 2HDUA 3ON5A 2RHTA 3NXSA 5GHXA 1JHOA 3MFQA 2J5KA 4DDHA 1R9NA 3ELYA 4RPGA 4FYKA 2ZSIA 2GXQA 3ITKA 1G64A 3ZCXA 1G3MA 1N7IA 4BKUA 1TDGA 1C0LA 4DADA 5AK0A 1II8A 2HW8A 1V8PA 4X95A 4AKEA 1S96A 1IUKA 1Z37A 1PIWA 2NO4A 1KI6A 4DY6A 4QUBA 5BQXA 3IXMA 1NN1A 3L0OA 1L9XA 2N47A 3SGLA 4FTWA 2ZBGA 1OAOA 4BGDA 4B4DA 3SKVA 2H9AA 1W5EA 1NUHA 4EG5A 4CJXA 4FZ5A 1MRSA 1KDZA 1GPNA 2XA9A 3ILVA 4R9SA 4MLLA 2ZRQA 2VP6A 1XLTA 1GAXA 4I8IA 1GGNA 4PS0A 1LTKA 2C4HA 4FK8A 1DEKA 4B6SA 4IHJB 3VKHA 4O1MA 3EUWA 1UMBB 3DTVA 1WZCA 5EWJA 5LKAA 4NV1A 4LJ7A 1BDIA 3W3ZB 3V32A 4O4JA 1X1RA 1FJXA 3G9XA 4JI1B 4LF7B 4KSYA 4M7PA 3NONA 4DRZA 2FHPA 3IF5A 1YAHA 1OTHA 3NHWA 3C4VA 1ACMA 3LWNA 3OZRA 2CHQA 2CLLB 3QPUA 4H2DA 1V9ZA 3P0HA 2CFIA 1JEYA 5BSEA 4NICA 3FTQA 1C1HA 2G77B 1ZUHA 4FYPA 2R5NA 2BFOA 1WETA 1Q3TA 2A9QA 1E9BA 1ZPDA 4Y2SA 3VYWA 1XWIA 4JC4A 3O3VA 1P0QA 3BHJA 3WK7A 2YHIB 3SY8A 1DQYA 4E0BA 1XZNA 3GT7A 4PM8A 3VYSB 3R0XA 1SGWA 1QMPA 4P87A 4XWYA 4L02A 1VFPA 2LDXA 4NCXA 3RIYA 3C38A 3UE0A 1KYQA 1JSCA 4D6PA 2ZEJA 3AUKA 3W5BA 3N70A 3DZFA 2QLTA 1IQ0A 3A1EA 4FILA 4AKGA 2L0WA 3HGQA 5M29A 2F3PA 2FWIA 2I2CA 1YPRA 1ESDA 5ENVA 2NU6A 3PPVA 3PHIA 3ZZ1A 1EK5A 4ZO6A 2OGZA 3HJGA 4AZ0B 4HWSA 1O94C 5FI1B 3DR3A 4M8SA 1ML4A 4IDFA 3AM5A 2G9RA 4X65B 2GX5A 1KJZA 3AOGA 4UVHA 3UAYA 3WMRA 1VLQA 3P4UA 2J3EA 3ZBPA 1CUSA 1K4YA 1LI7A 2ZBQA 1XHLA 3HRIA 3GNSA 1LQ2A 4F3LA 3LI2A 3PGKA 3PDJA 5BW4A 1I2WA 5EG5A 3L4BA 1NP7A 3CTMA 2H6EA 3PXDA 1GZHB 4RU1A 2JATA 3NHJA 4J3JA 3PIRA 2OQRA 2IITA 5FEUA 3HH8A 4UOEA 4EB0A 1E9SA 5HQTA 1JJIA 1MDFA 4KX3A 4ZVOA 2ZE8A 1ZVVA 1E2LA 1E4DA 3LGOA 4R23A 3CIOA 3KSHA 1NHWA 4J03A 5HD5A 1W85A 3QG1A 2AVXA 2HJWA 2PIDA 3JQFA 3KXPA 3OPLA 3MUFA 1AUOA 4OKNA 2PBDP 1YZGA 2Y1XA 5DKLA 3PD1A 4YRLA 5BMOA 5C8YF 2AC7A 1K86A 3T3EA 2E89A 1M1YB 3C16C 4OA8A 1ADJA 4WN9B 1X8XA 1N32B 2OHXA 3BH6A 3MINB 4LC9A 3P9ZA 2QMHA 3ESZA 2VO1A 5F6AA 2P4SA 4RV9A 4W8OA 2VDUE 3RYHB 1SKUA 5LZ4A 5M18A 4W6ZA 3NIDB 4GOMD 3PR2B 1VRVA 4AMGA 4IQ4A 4EY5A 4NCAA 3GRJA 5FYDA 2WJWA 3QP8A 4AM8A 3QV1A 4GG1A 3HJRA 4BBVA 1FDIA 2BEWA 2WSBA 5ALHA 2XYPA 1QVWA 2DKOA 3QOWA 4QU5A 2C8KA 3UPUA 2P1RA 1BVUA 1ENOA 4MR8A 2I3AA 2XITA 5CFNA 1HF3A 1GR1A 4HDMB 1G5HA 3CKMA 1WLYA 3KAPA 1D8TA 1FL9A 1RJFA 1RNLA 1ZMTA 2WLTA 2YWBA 3HJFA 4UZSA 1X1AA 1JIXA 1JXOA 2RC6A 3N0WA 3T9DA 1QFZA 1C0EA 1PR6A 3O8LA 2P1DA 3FWZA 3BS4A 3BWBA 1YZ3A 4W82A 4XUZA 3UNXA 2G9VA 3F1LA 5GLBA 4R7TA 2FK7A 3RQIA 1RWVA 2ZVPX 3GIWA 4Q15A 2RSLA 1GPUA 2DPYA 2QUZA 4LGVA 4NXMB 4GF5A 2BGMA 4L28A 3ICEA 1WD5A 3PI7A 1DARA 2B20A 4EBLA 1NGSA 3U0VA 4UFOA 4JD5A 2ZXFA 2OBMA 1LDMA 1JJ7A 1NSYA 2ZT6A 1T8UA 5HX9A 1Z08A 2R7LA 2R96A 2J0VA 2ZYRA 4QVIA 1EUZA 1OOEA 5EYPB 1SVWA 2YIJA 2ZE6A 3W2FA 2PT6A 2QLLA 3NP9A 1TJPB 1C30B 1W36B 2IHNA 2FX2A 4F2DA 1T2NA 1OTYA 4OAOA 4W63A 4C4XA 3A9WA 3IVXA 5H3LA 2X4LA 4DNOA 4JP8A 2GLUA 3I76A 1JR4A 2V1BA 5D51S 4ZC8A 1SU7A 2RI6A 5B2ZA 2F8LA 2C5SA 2ZBRA 1B1AA 1PYYA