4DDSA

Ctx-m-9 class a beta-lactamase complexed with compound 11
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
260
structure length
260
Chain Sequence
b'AVQQKLAALEKSSGGRLGVALIDTADNTQVLYRGDERFPMCSTSKVMAAAAVLKQSETQKQLLNQPVEIKPADLVNYNPIAEKHVNGTMTLAELSAAALQYSDNTAMNKLIAQLGGPGGVTAFARAIGDETFRLDRTEPTLNTAIPGDPRDTTTPRAMAQTLRQLTLGHALGETQRAQLVTWLKGNTTGAASIRAGLPTSWTAGDKTGSGDYGTTNDIAVIWPQGRAPLVLVTYFTQPQQNAESRRDVLASAARIIAEGL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase
publication title Structure-Based Design of Potent and Ligand-Efficient Inhibitors of CTX-M Class A Beta-Lactamase
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/hydrolase inhibitor
total genus 95
structure length 260
sequence length 260
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2012-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4ddsA00
3PTEA 4WELA 3AGDA 4JF5A 4KQQA 2XFSA 3IWIA 3ITBA 2JBFA 1YM1A 5GHXA 3TG9A 3IWQA 5AQAA 1KGEA 4KZ4A 3A3DA 4R0QA 2WKEA 1G6AA 3IH9A 4Y7PA 3RJUA 3ITAA 1BLPA 4OPYA 1H8YA 1IYSA 4KZ6A 1OMEA 3PAGA 4EBLA 3LCEA 2WGIA 3OPPA 2H5SA 4ZJ3A 2P74A 2XR0A 1JTDA 3NBLA 4UA9A 1IELA 5GLCA 2IWDA 2HDRA 2Y2KA 3GVBA 3B3XA 2X01A 1BLCA 1ESIA 5FAPA 4DDSA 4WEJA 5A92A 1SDEA 4K0XA 2QMIA 4JF6A 4JXVA 3OCLA 4EUZA 2RL3A 5A91A 4E3MA 5EE8A 2WGVA 2GDNA 3V50A 3ZVWA 1K57A 2HP6A 3C7VA 3BFGA 2P9VB 2X02A 5EPHA 1YLTA 2Y91A 2Y55A 5FSRA 1K54A 5G18A 5FI7A 1FR6A 1K55A 3ZFZA 1LL9A 4E3OA 2WADA 1CI8A 1KGFA 2DNSA 4PM7A 3WS2A 3S22A 1PWGA 5GLDA 1YT4A 1ALQA 3FWLA 3HLBA 1FQGA 1XGJA 3OPLA 4JXWA 3RXXA 2EX9A 3S1YA 4S2MA 4FD8A 3OCNA 3WRTA 2XQZA 3SH8A 4X68A 1CEFA 4BLMA 3UO9A 2G2UA 3Q1FA 4WBGA 2UWXA 4LCLA 2ZC3B 1EWZA 1TVFA 1NZOA 1RP5A 4OOYA 4PM8A 4A5RA 1O7EA 3BECA 3FV7A 4MBKA 4DRTA 1MY8A 5EOOA 5CGSA 3M6HA 4QY5A 3ISGA 4GKUA 4KZBA 4BENA 3GTCA 5DTSA 3G2YA 2C5WB 1FCNA 2JC7A 4KG6A 3NDGA 5E2EA 5FQJA 2WAEA 2X71A 1L2SA 1KE4A 3E2LA 1IYOA 4GB7A 4QJGA 4DKIA 3GQZA 1H8ZA 4XXRA 4X53A 5FDHA 2Y2NA 1K56D 5E43A 4LV3A 4WZ5A 1FCOA 5FI6A 3OPHA 4RA7A 4B4XA 4OQIA 1IKIA 5EECA 3VOZA 4BJPA 3ZG5A 2FFFB 1JWPA 2WYXA 5FQQA 5CHMA 2XDMA 2ZQ8A 3VMAA 4OPZA 4B4ZA 3DTMA 2XH9A 4WZ4A 2Y2HA 3UPNA 3UPOA 1YQSA 4X6TA 4GDNA 1K4FA 5AQBA 5CTMA 1MWSA 3G35A 5M18A 4F94A 1SKFA 1ES5A 2WGWA 4O7DA 5KMWA 3O3VA 1ONGA 4LV0A 1BSGA 3W4QA 3ZG0A 4E3KA 4GD8A 3IF6A 1GHMA 4C75A 3PBRA 2JE5A 4IVKA 4DF6A 3HREA 4S2NA 4EBPA 1SCWA 2ZQ7A 1IYQA 2ZM8A 4IEDA 1NRFA 3BM6A 4K91A 4DE2A 1TDLA 5D3OA 5EVIB 2VGJA 5FQMA 4MLLA 4OQGA 2Z2MB 1BTLA 2ZQDA 4PPRA 3IF5A 2ZC5B 1MWTA 3QNCA 4JXGA 3MZEA 5TGFA 3MXRA 4R1GA 2XD5A 1L0GA 1MWRA 2ZM2A 5HAIA 3NCKA 4E3IA 4Q8IA 1KVLA 2VGKA 2ZQCA 2HPBA 5HAPA 4OPQA 1AXBA 3IH8A 4YINA 3LY4A 3VSLA 3BFDA 3MFDA 4KZ7A 5FI2A 4PM9A 2Q9MA 3N8LA 1ES2A 3W4PA 3BFCA 3UDFA 4E3JA 5HL1A 2R9WA 1PZOA 3HL9A 1ERMA 3BLMA 1HVBA 4LENA 4OP8A 2V20A 3WS4A 5TR7A 3DWZA 4GNUA 4QD4A 1WE4A 4GZBA 4K0WA 1YLJA 2Y4AA 5E2GA 5CTNA 4KG5A 1W5DA 3ZG9B 3PBSA 4N1HA 4PM5A 2ZC7A 3IXHA 4PMAA 4N9KA 5DF8A 4ZJ1A 1LI9A 4DE1A 4LV2A 3VOYA 2IWCA 2JCHA 2WGWB 3DW0A 3HLGA 5F1GA 5CEBA 1LL5A 1K57C 1W79A 4OVDA 1GCEA 1YLWA 2V2FF 1J9MA 2OLUA 4E6XA 3LEZA 3LO7A 4WMCD 1M40A 4E3LA 3ZDJA 3GMWA 3BFEA 1ESUA 1K54C 5FA7A 4FSFA 1YLPA 2EFUA 1K55C 2WKIA 5EVID 3V3RA 2ZC6B 4U0TA 1I2WA 1PI5A 3WS0A 4X55A 3ZVTA 2HDSA 2V1ZA 1NY0A 1PW8A 3IXBA 4DDYA 4UHUA 5HW3A 2ZQ9A 4S2PA 3HLWA 3GSGA 4JLFA 2ZMAA 1KE3A 1E25A 1NJ4A 2HP9A 3OPRA 3Q07A 4OQ0A 3MBZA 5CGXA 3V39A 4RX3A 1HZOA 4GD6A 5DTTA 1MXOA 3GR2A 3G32A 5AQ9A 2EX8A 4QY6A 5EVIC 5CHJA 1ES3A 3WWXA 1E3UD 5DF7A 4QHCA 3ZGAB 3NC8A 4KQRA 4OOLA 2H10A 4ID4A 2HDQA 5HARA 5I94A 5TFQA 1CK3A 4NK3A 2Y2QA 4N1XA 1NYMA 3A3EA 3O87A 1DY6A 1JTGA 1PYYA 4JF4A 5F1FA 3V5MA 5E2HA 5KSHA 1GHIA 3I7JA 3ZNYA 3UY6A 1G68A 4CJNA 4YFMA 1JWZA 1QMEA 4JPMA 4Y0TA 4PM6A 3TOIA 3UE3A 2DRWA 4MNRA 2OLVA 4OOMA 1BUEA 1MKIA 4QB8A 3HLEA 2Y2LA 4BD1A 5EOEA 4BQMA 5KSCA 1YLZA 4P87A 2RCXA 1S0WA 4S2LA 3FYZA 4WM9A 1FOFA 5DF9A 1LHYA 3V3SA 3P09A 4XUXA 3UNWA 3WRZA 3IXDA 3CG5A 4XUZA 3WS5A 2QZ6A 4BL2A 2ZQAA 1GA9A 1NYYA 2Y2IA 2C6WB 4FH4A 1IEMA 3PAEA 4LV1A 1RGZA 1C3BA 4U0XA 4X69A 1DJAA 5CHUA 4JBFA 4U3TA 3MKFA 2ZC4B 3NI9A 3PBTA 4JXSA 4S2JA 1KE0A 1Q2QA 3P98A 4OQHA 2EX6A 3LY3A 3WS1A 1EI5A 2Y2MA 4KQOA 5GHZA 5GHYA 2B5RA 4P6BA 2CC1A 3HUMA 4DXBA 1E4DA 3G34A 3UDIA 2H0YA 2WZZA 2ZJ9A 1GA0A 3D4FA 5GLAA 5A93A 1NZUA 3ZCZA 3GRJA 5CGWA 3PBNA 5F83A 5J8XA 4C6YA 3SOIA 3UDXA 3Q81A 5FQIA 5FAQA 5JYPA 1KDWA 1W8QA 3FKWA 3RXWA 5FATA 5U47A 1KDSA 1BULA 1K6SA 2Y2PA 4QU3A 3UPPA 5A90A 2XF3A 3DWKA 3EQVA 2XGNA 4DE0A 1W8YA 1BLHA 3IHBA 4Z9QA 3GV9A 4OPRA 1Z6FA 3MKEA 1YLYA 4ZTKA 4N92A 1XA1A 4JKTA 5EVLA 5FAOA 4EBNA 5HAQA 1PWCA 1XP4A 1KVMA 1TDGA 2BG1A 2P9VA 3QNBA 5CRFA 3N8SA 5M19A 1I2SA 2E8IA 5E2FA 4RYEA 4KZ8A 3AGEA 2G2WA 1XXMA 3N7WA 4KZ9A 1WYCA 4E6WA 1CI9A 3IHAA 3G2ZA 2EXAA 3NY4A 2HDUA 3E2KA 3HVFA 2XFTA 4L0LA 5EUAA 2J7VA 1FR1A 1PIOA 4GDBA 3G4PA 4GN2A 3S4XA 1EROA 3Q7VA 4KZ3A 4E3NA 4R3JA 1H5XA 2Q9NA 3FZCA 4BL3A 3BLSA 1PWDA 3IF6B 4KENB 3OZHA 1VQQA 1O07A 3HLFA 3Q82A 4WYYA 2XK1A 4X56A 4OLGA 4IBXA 2EXBA 3G30A 4R4SA 3O88A 3ZHHA 1PW1A 4ZAMA 4DXCA 3CMZA 1JWVA 3MZDA 4FCFA 3Q7ZA 4B88A 1L0DA 4UA7A 1ES4A 4P85A 1SHVA 1L0EA 3VP0A 1N4OA 3OC2A 1XA7A 5FASA 2WKHA 4OKPA 4FH2A 5CXWA 1JVJA 3A3FA 2Y2OA 5JYOA 5FQ9A 1Y54A 3PBOA 5IHVA 2XD1A 1KGGA 4OONA 1IYPA 4M3KA 3M2KA 3FKVA 3NIAA 5DTKA 1CEGA 3SS4A 2PBYA 3N6IA 1XPBA 2J9PA 2ZLYA 4N9LA 2EFXA 2FFYA 3EQUA 4ZJ2A 3BEBA 3C4PA 3HUNA 4KZAA 1ZG4A 1TEMA 1N9BA 4OP5A 4R23A 3W4OA 3UE1A 2XEPA 1W7FA 4S2IA 1ZC2A 3NDEA 4RVAA 1RCJA 4HBTA 2DCFA 3PBQA 4LCMA 4Y0OA 2A3UA 1LI0A 1K38A 4NETA 2PU2A 2WK0A 3VP1A 4MBHA 2WAFA 2Y59A 4MEZA 2BLSA 2EX2A 3Q7VB 2WUQA 2OSUA 3BYDA 4R4RA 4WZ5C 4Y0UA 1GHPA 2R9XA 3M6BA 5GL9A 3IWOA 4WMCA 1RGYA 3VP3A 2XLNA 3SH9A 4EV4A 2J8YA 5HFOA 1HTZA 4OH0A 1ONHA 1XGIA 5EVIA 3VSKA 4P0MA 3O86A 3SS3A 4EWFA 1FSWA 3N8RA 1QMFA 2OV5A 1XX2A 1PI4A 4HEFA 4IBRA 1SDNA 3A3JA 2ZD8A 1FSYA 4S2OA 4BD0A 1PZPA 3C7UA 1K25A 3IF6C 4HBUA 2ZM0A 2IWBA 4KZ5A 1L0FA 5BOHA 1WYBA 3BRMA 4S2NC 1ZG6A 5CECA 4S2KA 3VP4A 4WEKA 3BFFA 5FQKA 1HD8A 3UN7A 2H0TA 1I5QA 4ZBEA 4R3BA 2J9OA 4CPKA 1E3UA 2HP5A 1M6KA 2A49A 3HUOA 1MBLA 1YMXA 4ZDXA 5L2FA 4UAAA 5CERA 1BT5A 3CJMA 2PU4A 5AQ7A 5CEDA 3MZFA 1ERQA 1U60A 5M1AA 3CZDA 1K6RA 3G31A 4D2OA 3W8KA 1BLSA 1DJCA 4RX2A 4MBFA 2I72A 3ZG7B 1S6RA 3VP2A 1IKGA 3SS5A 3MXSA 4UA6A 2Y2GA 3VFHA 3QHYA 1Q2PA 3TSGA 3A3IA 3ZG8B 4KG2A 2Y2JA 1ZKJA 4IVIA 5GLBA 1DJBA 3SH7A 2Z2LB 3IT9A 4OLDA 3VFFA 5DVAA 3C4OA 3HLDA 3M2JA 3N4IA 3HLCA 5F82A 1NXYA 4HESA 1MWUA 1XKZA 5HX9A 3ZNTA 3C5AA 3HBRA 3JYIA 4GOGA 1K4EA 4C3QA 1K56A 3UE0A 2QPNA 4DE3A 1FCMA 1BZAA 1VM1A 1YMSA 3IXGA 2WZXA 3AGFA 1MPLA 3IQAA 1LLBA 4H8RA 5KZHA 4EQIA
chains in the Genus database with same CATH superfamily
3PTEA 4JF5A 1CJFA 2PRFA 3IWIA 3D9YA 1P0ZA 2D02A 3IWQA 2HJ9C 2LB5A 3A3DA 1H8MA 2FH5A 4Y7PA 3MQOA 2WKPA 1H8YA 4KZ6A 5DKKA 3LI8A 1LSXA 2H5SA 3R4KA 1IELA 4ETXA 5GLCA 3E4OA 3KYEA 3W2ZA 3KSHA 3GVBA 4FUWA 5AVFA 5HPIA 2VV7A 1BLCA 5FAPA 3ULFA 1OJGA 3OCLA 4EUZA 5EE8A 3HJKA 2WGVA 3ZVWA 1YLTA 2NUPC 1K54A 3ZFZA 4E3OA 3E4PA 2OAQ1 1YT4A 3OPLA 3S1YA 4S2MA 3SH8A 2G7UA 1CEFA 4BLMA 4WBGA 4LCLA 1EWZA 1NZOA 2BASA 1VETB 2HV1A 4KZBA 1A0KA 5DTSA 5EM0A 4X1MA 2E8JA 2JC7A 4F3LB 2WAEA 1IYOA 5FDSA 4GB7A 4QJGA 4DKIA 2O9CA 1T19A 3MXQA 4Q0HA 4X53A 2Y2NA 4OQIA 1IKIA 5EECA 3IX3A 2W1RA 5FQQA 1IOUA 2ZQ8A 2XH9A 3UPNA 5HPFA 2KLIA 4MN6A 3E4QA 5AQBA 4F94A 4O7DA 5KMWA 3O3VA 3BQ8A 4GD8A 1F98A 3MMHA 2W0NA 4CQHA 4S2NA 4EBPA 2ZQ7A 3HJIA 5F68A 3A0RA 3NOTC 4K91A 5EVIB 2J80A 2B18A 3OLOA 5G4ZA 4OQGA 2Z2MB 3MQ0A 2ZC5B 1MWTA 3K3CA 3NCKA 4E3IA 3IH8A 3LR5A 4IJGA 4KZ7A 1ES2A 3BFCA 3EWKA 3F1PA 4OP8A 5TBMA 3WS4A 3DWZA 4GZBA 5FEGA 1YLJA 2Y4AA 5HD3A 2FZ0A 1S4SA 2ZC7A 3LIAA 3A0SA 5F1GA 5AVEA 1W79A 2V0WA 4E6XA 5J4EA 3LEZA 3LO7A 4WMCD 1M40A 4E3LA 3ZDJA 3BFEA 5FA7A 4JGRA 5EVID 3WS0A 4U0TA 3D3OA 3KSIA 2QJ5A 4NXGA 2PR6A 3IXBA 4UEYA 3GSGA 5CGXA 3OPRA 2P04A 3GR2A 2EX8A 1E3UD 5DF7A 3ZGAB 3NC8A 4KQRA 3F1PB 3UB7A 5TFQA 3RFBA 1NYMA 5TBMB 5E2HA 4UQIS 2PD8A 3IBRA 1G68A 4EU0A 1QMEA 2VJWA 4Y0TA 3KSGA 4LGWA 3CUEA 2OLVA 4WLAA 5DKLA 4Y15A 1S0WA 3UNWA 3WRZA 3WS5A 4BL2A 2ZQAA 1GA9A 2XRNA 2INWA 2J3WA 4LV1A 1RGZA 1DJAA 4HH2A 4JBFA 2ZC4B 4S2JA 1KE0A 1Q2QA 4OQHA 5GHYA 4HQAA 4P6BA 2CC1A 3B42A 1E4DA 1OTIA 1NZUA 5IU1A 3KO6A 5HSQA 5FQIA 2YKFA 2VEAA 2K31A 1W8QA 1TS0A 5C5KA 1K6SA 5A90A 3EQVA 2XGNA 1BLHA 4Z9QA 3GV9A 4ARZA 1XP4A 2BG1A 3QNBA 4Y2FA 3BJNA 4H6JA 1W63M 3B33A 4E6WA 3N7WA 3IHAA 3G2ZA 2EXAA 3L7HA 3E2KA 3HVFA 5EUAA 1FR1A 5KIZA 5LBRA 4KZ3A 4E3NA 1H5XA 3BLSA 3IF6B 4KENB 5A8BA 1O07A 1PFLA 3HLFA 2XK1A 4OLGA 2GX5A 3ZHHA 2QWSA 3MZDA 1KOUA 1SHVA 3BW6A 3VP0A 3OC2A 5CXWA 5FQ9A 3H82B 5EVEA 5IHVA 4NEED 5DTKA 1GSWA 3N6IA 4ARZB 2FFYA 3TW8A 3BEBA 3HUNA 4OP5A 4KZAA 4R23A 2VV6A 3UE1A 3EEHA 4S2IA 3NDEA 4M4XA 2DCFA 3PBQA 4KQDA 1LI0A 4NETA 4P6ZM 3VP1A 4MBHA 2B95A 2EX2A 2WUQA 2R9XA 3M6BA 1YPRA 1OTAA 2J8YA 2JHEA 4P0MA 1FSWA 3EOIA 4WF0A 2OV5A 1XX2A 4HEFA 3A3JA 4FTXA 1FSYA 4S2OA 4BD0A 1PZPA 3KYZA 5HWVA 1XFQA 1HD8A 2H0TA 4R3BA 1M6KA 2A49A 5L2FA 4IUKA 4RX2A 2V8FA 3CI6A 4LRXC 3SS5A 4PKYA 3TSGA 3ZG8B 4KG2A 2Y2JA 2HGVA 5GLBA 3SH7A 4PHTA 5L07A 4G3WA 5DVAA 3H7WA 3M2JA 3HLCA 4XT2A 5HX9A 3KYQA 1K4EA 5MC7A 4EEUA 1ODVA 1BZAA 4H8RA 4B9OA 1LSWA 5KZHA 4EQIA 4WELA 2OWJA 3AGDA 2XFSA 3T4SA 3ITBA 2JBFA 2LB9A 1P9WA 3DTKA 3T4KA 2W3GA 1W63Q 2MJ6A 4O01A 2WGIA 4ZJ3A 3NBLA 4GS9A 3OOVA 2IWDA 3B47A 2HDRA 1SZVA 2Y2KA 5L8MA 3U4LP 4HIAA 4R70A 5A92A 2VGLS 2QMIA 4JF6A 4XT2B 2GDNA 3V50A 1K57A 3BFGA 2P9VB 2X02A 5EPHA 2Y55A 1UWNX 5FSRA 1SKOB 2OOLA 2DNSA 1PWGA 4NG2A 1ALQA 3HLBA 1XGJA 2EX9A 3WRTA 4FD8A 3OCNA 1J3WA 2XQZA 3Q1FA 2AVXA 3L9KA 1RP5A 4OOYA 2GNXA 4GS9B 4FOFA 2V1AA 5DJUA 5EOOA 3M6HA 3GTCA 3ZQ5A 3G2YA 2HJEA 2VLGA 2QHKA 1AWIA 1FCNA 5E2EA 5FQJA 2X71A 1L2SA 3R7WA 3O5YA 2ACGA 4EW7A 1FCOA 4B4XA 2WKRA 3ZG5A 2FFFB 2WYXA 5CHMA 5F69A 4WZ4A 4DJ2A 5FEFA 2Y2HA 3UPOA 1YQSA 5M18A 4II7A 1ES5A 4E3KA 1CF0A 4R6LA 3MFXA 3PBRA 4DF6A 3HREA 1SCWA 2VKSA 1NRFA 1LSVA 5D3OA 4MLLA 2ZL1A 2ZQDA 1LL8A 3IF5A 3T4QA 4JXGA 4R1GA 5HAIA 3P01A 4Q8IA 3CLOA 2ZQCA 2HPBA 4JGOA 4PAUA 1MZUA 3BFDA 3R7WB 2Q9MA 3LR0A 3F1OB 2V20A 5TR7A 4QD4A 5E2GA 4K0WA 1G5UA 4DMZA 3ZG9B 4N1HA 4PM5A 3IXHA 4N9KA 5DF8A 4DE1A 1S1YA 2JCHA 5CEBA 1LL5A 2V2FF 1J9MA 3MJQA 1K54C 3SZTA 4FSFA 1YLPA 4K08A 2WKIA 3V3RA 2ZC6B 1DP9A 4X55A 4Q0JA 2ZL1B 3LIEA 4DDYA 4UHUA 2V8CA 1S4RA 2HF6A 4S2PA 5HW3A 3HLWA 3QP2A 5DTTA 1MXOA 5EVIC 3WWXA 1K0KA 4AFIA 4OOLA 4ID4A 3FPVA 1CK3A 4NK3A 3NOPC 2O9AA 3O87A 5F1FA 1JTGA 3UY6A 4YFMA 1HLUP 4PM6A 1N9NA 3UE3A 5HWWA 2UV0E 4OOMA 1BUEA 4QB8A 3HLEA 4BD1A 5EOEA 4BQMA 5KSCA 1YLZA 2RCXA 4S2LA 2JKGA 3FYZA 4WM9A 5DF9A 1LHYA 3LIDA 3IXDA 3S7NA 4HH3A 4I38A 1FIKA 3S7OA 1IEMA 4PKYG 3PAEA 3IX8A 4X69A 4I3AA 3NI9A 3PBTA 3TJZC 3NJAA 1NLZA 2EX6A 2L4RA 2B5RA 5L09A 4HJ4A 4DXBA 3UDIA 3V67A 3D4FA 3ZCZA 2Y79A 5J8XA 4C6YA 4HJ3A 3LR4A 3Q81A 3K2NA 5FAQA 3FKWA 3F1NA 4GHIA 4BMWA 2PT7A 2XF3A 4DE0A 3BQAA 1Z6FA 2EWVA 1DP6A 4N92A 1BYWA 4EBNA 2QJ7A 1PWCA 2B02A 1KVMA 4RYEA 4KZ8A 3NY4A 3G4PA 4WUJA 1GSVA 3FZCA 4WYYA 4IBXA 4R4SA 3JVVA 1PW1A 3CMZA 1ES4A 3GECA 1N4OA 4OKPA 4FH2A 1JVJA 2Y2OA 5JYOA 3U2AA 1KGGA 1IYPA 4M3KA 1CEGA 2PBYA 2J9PA 2ZLYA 4N9LA 2EFXA 4ZJ2A 4EUVA 3C4PA 1ZG4A 1TEMA 3W4OA 3CUEC 1ZC2A 4RVAA 2W3EA 2A3UA 1K38A 1G6OA 2WK0A 1UGUA 4WZ5C 2V1BA 3BYDA 4HI4A 5GL9A 4MMNA 1RGYA 3SH9A 4EV4A 3VSKA 2PYPA 3O86A 3SS3A 4EWFA 3N8RA 1QMFA 1SDNA 5IT5A 4NXBA 3IF6C 1K25A 4HBUA 2V9AA 2ZM0A 2IWBA 3S7PA 3BRMA 4WN5A 3BFFA 5FQKA 4CPKA 4Y13A 2PBDP 1OJ5A 2HP5A 3HUOA 4UAAA 4X1LA 4UQIM 4MDZA 3CZDA 3G31A 1BLSA 3ZG7B 2EWWA 2I72A 3VP2A 1IKGA 1Q2PA 1VEUA 3A3IA 3DBAA 4O8GA 4QPRA 4EXOA 2R78A 2M1CA 1DJBA 2K7SA 3IT9A 3VFFA 1MWUA 4E04A 1XJ2A 3ZNTA 3C5AA 3HBRA 4GOGA 4C3QA 1P97A 3UE0A 1YMSA 1MPLA 4KQQA 1OPXA 5GHXA 1YM1A 4R3AA 5AQAA 3UE6A 4R0QA 3RJUA 3ITAA 1BLPA 1IYSA 3JVUA 1OMEA 3PAGA 3LCEA 2P74A 2XR0A 1JTDA 2O9BA 1VEUB 5IS1A 3B3XA 3DAVA 4Y3IA 2X01A 3LICA 3PR6A 3FPWA 4WEJA 5EV0A 5K5BA 4EERA 2RL3A 2ZOHA 4E3MA 3NULA 4CLCA 4MN5A 2XA7S 4H6JB 4IUHA 4NKPA 4YOFA 1K55A 2WADA 1CI8A 1XFNA 3D72A 4PM7A 3S22A 4ZRRA 1FQGA 4NXEA 2J3TD 1OTEA 3E98A 1OT9A 3UO9A 2ZC3B 1TVFA 2A24A 4PM8A 3LIBA 4A5RA 2OWHA 1O7EA 3DTIA 4MBKA 4DRTA 1MY8A 5CGSA 4GKUA 4MN7A 3RH8B 4I39A 4KG6A 4JGQA 3CPTA 1YSQA 2K2NA 2XA7M 5FDHA 1Y28A 2ZMFA 4LV3A 5FI6A 3OPHA 2QKPA 4CLCB 3VOZA 4BJPA 3SW1A 2PD7A 1TS8A 1T1AA 2XDMA 1OTBA 3DTMA 3MQQA 3E0YA 4X6TA 1K4FA 4MCWA 3PHYA 2W3DA 1ONGA 4LV0A 1BSGA 3W4QA 3ZG0A 2H28A 1GHMA 3P7NA 2JE5A 4EETB 2A24B 4IEDA 1T18A 2KOIA 3BM6A 5EM1A 1TDLA 2VGJA 3ZYTA 5FQMA 1BTLA 4PPRA 3QNCA 5TGFA 1S67L 3K3DA 4HOIA 2XD5A 2ZM2A 1KVLA 2VGKA 5HAPA 5G4YA 1AXBA 4YINA 3VSLA 3CPTB 5FI2A 4PM9A 1TS7A 2PAVP 4E3JA 5HL1A 3CWFA 2R9WA 3HL9A 3BLMA 4LENA 1YSPA 1WE4A 5CTNA 3PBSA 2IWCA 3HLGA 2HZ5A 1K57C 3H7WB 4O0PA 3EGXC 4OVDA 1GCEA 1YLWA 4EEPA 3GMWA 4YWZA 1ESUA 4HNBA 1FILA 4KUOA 3T4LA 3PXPA 2HDSA 1NY0A 1PW8A 5M19A 1KE3A 1E25A 1NJ4A 3Q07A 4OQ0A 3MBZA 3V39A 1HZOA 2L1MA 5FL3A 2KDKA 4GD6A 4RQ9A 2Y8HA 4QY6A 2W3HA 1XJ6A 4IHQA 3UB5P 3NHQA 4YNRA 2H10A 5HARA 4N1XA 1TS6A 2VK3A 1GHIA 3ZNYA 1YKDA 2ZMVA 2VGLM 4JPMA 2Y2LA 2PDRA 5AJGA 2KX6A 1X0OA 3CG5A 4XUZA 1NYYA 2Y2IA 2C6WB 3T1QB 1VHMA 1C3BA 4U0XA 3UMDA 3IBJA 2M7UA 4JXSA 4Y5FA 1STZA 1EI5A 4KQOA 2Q0OA 3UB9A 3G34A 2WZZA 1GA0A 4Y17A 5A93A 1XJ3A 3GRJA 5CGWA 3PBNA 5F83A 5HZHA 3C38A 3QP4A 3TE8A 1KDWA 3RXWA 5FATA 5U47A 1BULA 4QU3A 1G28A 4G3KA 3LYXA 1W8YA 4OPRA 1DP8A 1YLYA 1XA1A 5FAOA 5HAQA 4BBUA 1MC0A 1TDGA 4D60A 5CRFA 2G2WA 4KZ9A 1WYCA 3ICYA 3UB8A 2XFTA 2WKQA 2J7VA 4DJ3A 2W27A 4GDBA 4GN2A 3S4XA 5J3WA 3Q7VA 4R3JA 2Q9NA 4BL3A 1PWDA 3LUQA 3Q82A 1IFQA 4LRZE 4X56A 2EXBA 3EGDC 1VETA 4WL9A 1TF1A 3Q7ZA 4B88A 1L0DA 4UA7A 4P85A 5FASA 2WKHA 4F3LA 3A3FA 3PBOA 3JPUA 2XD1A 4LFUA 1S66L 3FKVA 3NIAA 4L9FA 1N9BA 1V9ZA 1W7FA 1ZTUA 1RCJA 2Y59A 4R4RA 2BLSA 3Q7VB 2OSUA 1N9LA 4WMCA 2XLNA 2PYRA 5L10A 1F9IA 4OH0A 1ONHA 1XGIA 5EVIA 3QP6A 3T50A 2BTFP 3C7UA 1NRJA 3UMEA 4KZ5A 5BOHA 1WYBA 4S2NC 1ZG6A 3OBFA 5CECA 4S2KA 3UN7A 4ZBEA 3VOLA 2J9OA 1E3UA 3LI9A 1YMXA 1BT5A 3CJMA 5AQ7A 1ERQA 2I9VA 2PR5A 1DJCA 1S6RA 3CAXA 3MXSA 3VFHA 2Y2GA 3QHYA 4IVIA 3T4JA 1LT0A 3HLDA 3N4IA 5F82A 3T1RA 2XROA 3JYIA 5CX7A 1K56A 4ETZA 3QP1A 2QPNA 4L9GA 1EW0A 3KX0X 1LLBA 3QP8A 2O0YA 4HP9A 4LPZA 1XJ4A 1PNEA 3TG9A 1KGEA 4KZ4A 3T4TA 2WKEA 1G6AA 5DJTA 3IH9A 2M7VA 4OPYA 5EFWA 1ZHHB 4EBLA 3OPPA 4UA9A 1MKMA 1T1BA 1D1JA 1ESIA 3F1NB 4DDSA 3NECA 4GHIB 3CITA 1SDEA 4K0XA 1CQAA 4JXVA 5A91A 4EESA 2HP6A 3C7VA 3T4OA 2P08A 2Y91A 5G18A 1T1CA 5FI7A 1FR6A 5HWTA 2OAP1 1LL9A 1KGFA 4BBTA 3WS2A 5GLDA 5J7EA 4HHDA 3FWLA 4JXWA 3RXXA 4BBVA 4X68A 3MR0A 2G2UA 2DMWA 2UWXA 3BECA 3FV7A 3VE3A 4QY5A 3ISGA 4BENA 3UB6A 2J3TC 1OTDA 2W1TA 2C5WB 3NDGA 5HDCA 1F2KA 1KE4A 3E2LA 3GQZA 1H8ZA 4XXRA 5E43A 1K56D 4WZ5A 4RA7A 1NWZA 1JWPA 3IX4A 4I3JA 3T1XA 3VMAA 4OPZA 4B4ZA 1OT6A 4GDNA 2ZBBA 5CTMA 1MWSA 3C8CA 3G35A 1SKFA 2WGWA 2GJ3A 3IF6A 3T12B 4C75A 4IVKA 4EQ1A 3NOUC 1IYQA 4HY8A 2ZM8A 4DE2A 4Z1WA 5HDSA 1UWPX 2O99A 3HCYA 2NUTC 3PYPA 3MZEA 3MXRA 3BY9A 4QWOA 2W1TB 1L0GA 1MWRA 1V9YA 4L9EA 2CMNA 4I3IA 3H82A 4OPQA 4X25A 3LY4A 3MFDA 4ME4A 3N8LA 4Q0IA 3W4PA 3UDFA 1PZOA 3IS2A 1ERMA 1HVBA 4GNUA 1D7EA 4KG5A 1W5DA 4PMAA 3C2WA 3EEAA 1LI9A 4ZJ1A 4LV2A 4R38A 3VOYA 2WGWB 3DW0A 2XSSA 5HD5A 4CLCC 1WA9A 4P6ZS 2EA9A 2OLUA 2V0UA 2EFUA 1K55C 1I2WA 1PI5A 1NLYA 3ZVTA 2V1ZA 1DRMA 5F5YA 3A0VA 2ZQ9A 4JLFA 2ZMAA 2HP9A 1JNUA 4RX3A 4HP4A 4LRYC 3VV4A 2JKTM 3G32A 5AQ9A 4CLCE 5CHJA 1ES3A 4QHCA 2JKRM 3LEQA 2HDQA 4ESPA 5I94A 3IS2B 2Y2QA 3MS6A 4NXFA 2D01A 3A3EA 1DY6A 1PYYA 4JF4A 5HL6A 3V5MA 2JN7A 2GZAA 5KSHA 3I7JA 4CJNA 1JWZA 3TOIA 2DRWA 3TRCA 2VA0A 4MNRA 1MKIA 4P87A 1FOFA 3BY8A 2PHYA 4GJ4A 3V3SA 3P09A 4XUXA 2QZ6A 3LR3A 2L0WA 4FH4A 1P9RA 2JKFA 5CHUA 4U3TA 3MKFA 2QYBA 2VZWA 3P98A 3LY3A 3WS1A 2Y2MA 5GHZA 3S7QA 3HUMA 4HJ6A 1H3QA 4GCZA 2H0YA 5GLAA 2ZJ9A 4B93A 2A2LA 5DFYA 4GW9A 3SOIA 3UDXA 3H9WA 5JYPA 2Z6CA 4LLOB 1KDSA 2Y2PA 3UPPA 3DWKA 3RTYA 3IHBA 3MKEA 4ZTKA 2IA2A 3FG8A 4JKTA 5EVLA 5F6AA 4G3VA 2P9VA 3G6OA 4CLCD 3N8SA 1I2SA 2E8IA 5E2FA 3AGEA 1XXMA 3MSHA 1CI9A 1TD5A 4KUKA 5HDDA 2HDUA 1SKOA 4L0LA 1PIOA 1H0MA 1EROA 3C30A 5I5LA 3OZHA 1VQQA 2P7JA 2W3FA 3G30A 3O88A 3BWLA 4ZAMA 3VE4A 4DXCA 1JWVA 2VX8A 4FCFA 3T1SA 2Z6DA 1L0EA 1XA7A 1D06A 5TJJA 1S1ZA 3LFVA 2ZOIA 1Y54A 1F5MA 4OONA 3M2KA 3SS4A 3QP5A 1XPBA 3EQUA 2XEPA 1PRQA 4HBTA 4DN0A 4LCMA 4Y0OA 1Z09A 1Y4OA 2PU2A 4I5SA 3DTEA 2WAFA 4MEZA 3KSFA 4Y0UA 1GHPA 3IWOA 3VP3A 3FC7A 5HFOA 1HTZA 3LIFA 2VV8A 1PI4A 4IBRA 3CHWP 2ZD8A 4JGPA 1L0FA 3VP4A 4WEKA 1I5QA 1YAXA 1MBLA 1N9OA 4ZDXA 5CERA 5CEDA 2PU4A 3F1OA 3GDIA 3MZFA 4BWIA 1GSXA 1U60A 5M1AA 4D2OA 1K6RA 3W8KA 4MBFA 2YKHA 4UA6A 1ZKJA 4GLQA 2JKTI 2Z2LB 3MF0A 4OLDA 3C4OA 2JKRI 1NXYA 3LGOA 4HESA 5DFXA 1L3LA 1XKZA 1ACFA 4DE3A 1VB6A 1FCMA 1VM1A 3IXGA 2WZXA 3AGFA 3IQAA
chains in the Genus database with same CATH topology
3PTEA 4WELA 3AGDA 4JF5A 4KQQA 2XFSA 3IWIA 3ITBA 2JBFA 1YM1A 5GHXA 3TG9A 3IWQA 5AQAA 1KGEA 4KZ4A 3A3DA 4R0QA 2WKEA 1G6AA 3IH9A 4Y7PA 3RJUA 3ITAA 1BLPA 4OPYA 1H8YA 1IYSA 4KZ6A 1OMEA 3PAGA 4EBLA 3LCEA 2WGIA 3OPPA 2H5SA 4ZJ3A 2P74A 2XR0A 1JTDA 3NBLA 4UA9A 1IELA 5GLCA 2IWDA 2HDRA 2Y2KA 3GVBA 3B3XA 2X01A 1BLCA 1ESIA 5FAPA 4DDSA 4WEJA 5A92A 1SDEA 4K0XA 2QMIA 4JF6A 4JXVA 3OCLA 4EUZA 2RL3A 5A91A 4E3MA 5EE8A 2WGVA 2GDNA 3V50A 3ZVWA 1K57A 2HP6A 3C7VA 3BFGA 2P9VB 2X02A 5EPHA 1YLTA 2Y91A 2Y55A 5FSRA 1K54A 5G18A 5FI7A 1FR6A 1K55A 3ZFZA 1LL9A 4E3OA 2WADA 1CI8A 1KGFA 2DNSA 4PM7A 3WS2A 3S22A 1PWGA 5GLDA 1YT4A 1ALQA 3FWLA 3HLBA 1FQGA 1XGJA 3OPLA 4JXWA 3RXXA 2EX9A 3S1YA 4S2MA 4FD8A 3OCNA 3WRTA 2XQZA 3SH8A 4X68A 1CEFA 4BLMA 3UO9A 2G2UA 3Q1FA 4WBGA 2UWXA 4LCLA 2ZC3B 1EWZA 1TVFA 1NZOA 1RP5A 4OOYA 4PM8A 4A5RA 1O7EA 3BECA 3FV7A 4MBKA 4DRTA 1MY8A 5EOOA 5CGSA 3M6HA 4QY5A 3ISGA 4GKUA 4KZBA 4BENA 3GTCA 5DTSA 3G2YA 2C5WB 1FCNA 2JC7A 4KG6A 3NDGA 5E2EA 5FQJA 2WAEA 2X71A 1L2SA 1KE4A 3E2LA 1IYOA 4GB7A 4QJGA 4DKIA 3GQZA 1H8ZA 4XXRA 4X53A 5FDHA 2Y2NA 1K56D 5E43A 4LV3A 4WZ5A 1FCOA 5FI6A 3OPHA 4RA7A 4B4XA 4OQIA 1IKIA 5EECA 3VOZA 4BJPA 3ZG5A 2FFFB 1JWPA 2WYXA 5FQQA 5CHMA 2XDMA 2ZQ8A 3VMAA 4OPZA 4B4ZA 3DTMA 2XH9A 4WZ4A 2Y2HA 3UPNA 3UPOA 1YQSA 4X6TA 4GDNA 1K4FA 5AQBA 5CTMA 1MWSA 3G35A 5M18A 4F94A 1SKFA 1ES5A 2WGWA 4O7DA 5KMWA 3O3VA 1ONGA 4LV0A 1BSGA 3W4QA 3ZG0A 4E3KA 4GD8A 3IF6A 1GHMA 4C75A 3PBRA 2JE5A 4IVKA 4DF6A 3HREA 4S2NA 4EBPA 1SCWA 2ZQ7A 1IYQA 2ZM8A 4IEDA 1NRFA 3BM6A 4K91A 4DE2A 1TDLA 5D3OA 5EVIB 2VGJA 5FQMA 4MLLA 4OQGA 2Z2MB 1BTLA 2ZQDA 4PPRA 3IF5A 2ZC5B 1MWTA 3QNCA 4JXGA 3MZEA 5TGFA 3MXRA 4R1GA 2XD5A 1L0GA 1MWRA 2ZM2A 5HAIA 3NCKA 4E3IA 4Q8IA 1KVLA 2VGKA 2ZQCA 2HPBA 5HAPA 4OPQA 1AXBA 3IH8A 4YINA 3LY4A 3VSLA 3BFDA 3MFDA 4KZ7A 5FI2A 4PM9A 2Q9MA 3N8LA 1ES2A 3W4PA 3BFCA 3UDFA 4E3JA 5HL1A 2R9WA 1PZOA 3HL9A 1ERMA 3BLMA 1HVBA 4LENA 4OP8A 2V20A 3WS4A 5TR7A 3DWZA 4GNUA 4QD4A 1WE4A 4GZBA 4K0WA 1YLJA 2Y4AA 5E2GA 5CTNA 4KG5A 1W5DA 3ZG9B 3PBSA 4N1HA 4PM5A 2ZC7A 3IXHA 4PMAA 4N9KA 5DF8A 4ZJ1A 1LI9A 4DE1A 4LV2A 3VOYA 2IWCA 2JCHA 2WGWB 3DW0A 3HLGA 5F1GA 5CEBA 1LL5A 1K57C 1W79A 4OVDA 1GCEA 1YLWA 2V2FF 1J9MA 2OLUA 4E6XA 3LEZA 3LO7A 4WMCD 1M40A 4E3LA 3ZDJA 3GMWA 3BFEA 1ESUA 1K54C 5FA7A 4FSFA 1YLPA 2EFUA 1K55C 2WKIA 5EVID 3V3RA 2ZC6B 4U0TA 1I2WA 1PI5A 3WS0A 4X55A 3ZVTA 2HDSA 2V1ZA 1NY0A 1PW8A 3IXBA 4DDYA 4UHUA 5HW3A 2ZQ9A 4S2PA 3HLWA 3GSGA 4JLFA 2ZMAA 1KE3A 1E25A 1NJ4A 2HP9A 3OPRA 3Q07A 4OQ0A 3MBZA 5CGXA 3V39A 4RX3A 1HZOA 4GD6A 5DTTA 1MXOA 3GR2A 3G32A 5AQ9A 2EX8A 4QY6A 5EVIC 5CHJA 1ES3A 3WWXA 1E3UD 5DF7A 4QHCA 3ZGAB 3NC8A 4KQRA 4OOLA 2H10A 4ID4A 2HDQA 5HARA 5I94A 5TFQA 1CK3A 4NK3A 2Y2QA 4N1XA 1NYMA 3A3EA 3O87A 1DY6A 1JTGA 1PYYA 4JF4A 5F1FA 3V5MA 5E2HA 5KSHA 1GHIA 3I7JA 3ZNYA 3UY6A 1G68A 4CJNA 4YFMA 1JWZA 1QMEA 4JPMA 4Y0TA 4PM6A 3TOIA 3UE3A 2DRWA 4MNRA 2OLVA 4OOMA 1BUEA 1MKIA 4QB8A 3HLEA 2Y2LA 4BD1A 5EOEA 4BQMA 5KSCA 1YLZA 4P87A 2RCXA 1S0WA 4S2LA 3FYZA 4WM9A 1FOFA 5DF9A 1LHYA 3V3SA 3P09A 4XUXA 3UNWA 3WRZA 3IXDA 3CG5A 4XUZA 3WS5A 2QZ6A 4BL2A 2ZQAA 1GA9A 1NYYA 2Y2IA 2C6WB 4FH4A 1IEMA 3PAEA 4LV1A 1RGZA 1C3BA 4U0XA 4X69A 1DJAA 5CHUA 4JBFA 4U3TA 3MKFA 2ZC4B 3NI9A 3PBTA 4JXSA 4S2JA 1KE0A 1Q2QA 3P98A 4OQHA 2EX6A 3LY3A 3WS1A 1EI5A 2Y2MA 4KQOA 5GHZA 5GHYA 2B5RA 4P6BA 2CC1A 3HUMA 4DXBA 1E4DA 3G34A 3UDIA 2H0YA 2WZZA 2ZJ9A 1GA0A 3D4FA 5GLAA 5A93A 1NZUA 3ZCZA 3GRJA 5CGWA 3PBNA 5F83A 5J8XA 4C6YA 3SOIA 3UDXA 3Q81A 5FQIA 5FAQA 5JYPA 1KDWA 1W8QA 3FKWA 3RXWA 5FATA 5U47A 1KDSA 1BULA 1K6SA 2Y2PA 4QU3A 3UPPA 5A90A 2XF3A 3DWKA 3EQVA 2XGNA 4DE0A 1W8YA 1BLHA 3IHBA 4Z9QA 3GV9A 4OPRA 1Z6FA 3MKEA 1YLYA 4ZTKA 4N92A 1XA1A 4JKTA 5EVLA 5FAOA 4EBNA 5HAQA 1PWCA 1XP4A 1KVMA 1TDGA 2BG1A 2P9VA 3QNBA 5CRFA 3N8SA 5M19A 1I2SA 2E8IA 5E2FA 4RYEA 4KZ8A 3AGEA 2G2WA 1XXMA 3N7WA 4KZ9A 1WYCA 4E6WA 1CI9A 3IHAA 3G2ZA 2EXAA 3NY4A 2HDUA 3E2KA 3HVFA 2XFTA 4L0LA 5EUAA 2J7VA 1FR1A 1PIOA 4GDBA 3G4PA 4GN2A 3S4XA 1EROA 3Q7VA 4KZ3A 4E3NA 4R3JA 1H5XA 2Q9NA 3FZCA 4BL3A 3BLSA 1PWDA 3IF6B 4KENB 3OZHA 1VQQA 1O07A 3HLFA 3Q82A 4WYYA 2XK1A 4X56A 4OLGA 4IBXA 2EXBA 3G30A 4R4SA 3O88A 3ZHHA 1PW1A 4ZAMA 4DXCA 3CMZA 1JWVA 3MZDA 4FCFA 3Q7ZA 4B88A 1L0DA 4UA7A 1ES4A 4P85A 1SHVA 1L0EA 3VP0A 1N4OA 3OC2A 1XA7A 5FASA 2WKHA 4OKPA 4FH2A 5CXWA 1JVJA 3A3FA 2Y2OA 5JYOA 5FQ9A 1Y54A 3PBOA 5IHVA 2XD1A 1KGGA 4OONA 1IYPA 4M3KA 3M2KA 3FKVA 3NIAA 5DTKA 1CEGA 3SS4A 2PBYA 3N6IA 1XPBA 2J9PA 2ZLYA 4N9LA 2EFXA 2FFYA 3EQUA 4ZJ2A 3BEBA 3C4PA 3HUNA 4KZAA 1ZG4A 1TEMA 1N9BA 4OP5A 4R23A 3W4OA 3UE1A 2XEPA 1W7FA 4S2IA 1ZC2A 3NDEA 4RVAA 1RCJA 4HBTA 2DCFA 3PBQA 4LCMA 4Y0OA 2A3UA 1LI0A 1K38A 4NETA 2PU2A 2WK0A 3VP1A 4MBHA 2WAFA 2Y59A 4MEZA 2BLSA 2EX2A 3Q7VB 2WUQA 2OSUA 3BYDA 4R4RA 4WZ5C 4Y0UA 1GHPA 2R9XA 3M6BA 5GL9A 3IWOA 4WMCA 1RGYA 3VP3A 2XLNA 3SH9A 4EV4A 2J8YA 5HFOA 1HTZA 4OH0A 1ONHA 1XGIA 5EVIA 3VSKA 4P0MA 3O86A 3SS3A 4EWFA 1FSWA 3N8RA 1QMFA 2OV5A 1XX2A 1PI4A 4HEFA 4IBRA 1SDNA 3A3JA 2ZD8A 1FSYA 4S2OA 4BD0A 1PZPA 3C7UA 1K25A 3IF6C 4HBUA 2ZM0A 2IWBA 4KZ5A 1L0FA 5BOHA 1WYBA 3BRMA 4S2NC 1ZG6A 5CECA 4S2KA 3VP4A 4WEKA 3BFFA 5FQKA 1HD8A 3UN7A 2H0TA 1I5QA 4ZBEA 4R3BA 2J9OA 4CPKA 1E3UA 2HP5A 1M6KA 2A49A 3HUOA 1MBLA 1YMXA 4ZDXA 5L2FA 4UAAA 5CERA 1BT5A 3CJMA 2PU4A 5AQ7A 5CEDA 3MZFA 1ERQA 1U60A 5M1AA 3CZDA 1K6RA 3G31A 4D2OA 3W8KA 1BLSA 1DJCA 4RX2A 4MBFA 2I72A 3ZG7B 1S6RA 3VP2A 1IKGA 3SS5A 3MXSA 4UA6A 2Y2GA 3VFHA 3QHYA 1Q2PA 3TSGA 3A3IA 3ZG8B 4KG2A 2Y2JA 1ZKJA 4IVIA 5GLBA 1DJBA 3SH7A 2Z2LB 3IT9A 4OLDA 3VFFA 5DVAA 3C4OA 3HLDA 3M2JA 3N4IA 3HLCA 5F82A 1NXYA 4HESA 1MWUA 1XKZA 5HX9A 3ZNTA 3C5AA 3HBRA 3JYIA 4GOGA 1K4EA 4C3QA 1K56A 3UE0A 2QPNA 4DE3A 1FCMA 1BZAA 1VM1A 1YMSA 3IXGA 2WZXA 3AGFA 1MPLA 3IQAA 1LLBA 4H8RA 5KZHA 4EQIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PTE A;  4WEL A;  3AGD A;  4JF5 A;  4KQQ A;  2XFS A;  3IWI A;  3ITB A;  2JBF A;  1YM1 A;  5GHX A;  3TG9 A;  3IWQ A;  5AQA A;  1KGE A;  4KZ4 A;  3A3D A;  4R0Q A;  2WKE A;  1G6A A;  3IH9 A;  4Y7P A;  3RJU A;  3ITA A;  1BLP A;  4OPY A;  1H8Y A;  1IYS A;  4KZ6 A;  1OME A;  3PAG A;  4EBL A;  3LCE A;  2WGI A;  3OPP A;  2H5S A;  4ZJ3 A;  2P74 A;  2XR0 A;  1JTD A;  3NBL A;  4UA9 A;  1IEL A;  5GLC A;  2IWD A;  2HDR A;  2Y2K A;  3GVB A;  3B3X A;  2X01 A;  1BLC A;  1ESI A;  5FAP A;  4DDS A;  4WEJ A;  5A92 A;  1SDE A;  4K0X A;  2QMI A;  4JF6 A;  4JXV A;  3OCL A;  4EUZ A;  2RL3 A;  5A91 A;  4E3M A;  5EE8 A;  2WGV A;  2GDN A;  3V50 A;  3ZVW A;  1K57 A;  2HP6 A;  3C7V A;  3BFG A;  2P9V B;  2X02 A;  5EPH A;  1YLT A;  2Y91 A;  2Y55 A;  5FSR A;  1K54 A;  5G18 A;  5FI7 A;  1FR6 A;  1K55 A;  3ZFZ A;  1LL9 A;  4E3O A;  2WAD A;  1CI8 A;  1KGF A;  2DNS A;  4PM7 A;  3WS2 A;  3S22 A;  1PWG A;  5GLD A;  1YT4 A;  1ALQ A;  3FWL A;  3HLB A;  1FQG A;  1XGJ A;  3OPL A;  4JXW A;  3RXX A;  2EX9 A;  3S1Y A;  4S2M A;  4FD8 A;  3OCN A;  3WRT A;  2XQZ A;  3SH8 A;  4X68 A;  1CEF A;  4BLM A;  3UO9 A;  2G2U A;  3Q1F A;  4WBG A;  2UWX A;  4LCL A;  2ZC3 B;  1EWZ A;  1TVF A;  1NZO A;  1RP5 A;  4OOY A;  4PM8 A;  4A5R A;  1O7E A;  3BEC A;  3FV7 A;  4MBK A;  4DRT A;  1MY8 A;  5EOO A;  5CGS A;  3M6H A;  4QY5 A;  3ISG A;  4GKU A;  4KZB A;  4BEN A;  3GTC A;  5DTS A;  3G2Y A;  2C5W B;  1FCN A;  2JC7 A;  4KG6 A;  3NDG A;  5E2E A;  5FQJ A;  2WAE A;  2X71 A;  1L2S A;  1KE4 A;  3E2L A;  1IYO A;  4GB7 A;  4QJG A;  4DKI A;  3GQZ A;  1H8Z A;  4XXR A;  4X53 A;  5FDH A;  2Y2N A;  1K56 D;  5E43 A;  4LV3 A;  4WZ5 A;  1FCO A;  5FI6 A;  3OPH A;  4RA7 A;  4B4X A;  4OQI A;  1IKI A;  5EEC A;  3VOZ A;  4BJP A;  3ZG5 A;  2FFF B;  1JWP A;  2WYX A;  5FQQ A;  5CHM A;  2XDM A;  2ZQ8 A;  3VMA A;  4OPZ A;  4B4Z A;  3DTM A;  2XH9 A;  4WZ4 A;  2Y2H A;  3UPN A;  3UPO A;  1YQS A;  4X6T A;  4GDN A;  1K4F A;  5AQB A;  5CTM A;  1MWS A;  3G35 A;  5M18 A;  4F94 A;  1SKF A;  1ES5 A;  2WGW A;  4O7D A;  5KMW A;  3O3V A;  1ONG A;  4LV0 A;  1BSG A;  3W4Q A;  3ZG0 A;  4E3K A;  4GD8 A;  3IF6 A;  1GHM A;  4C75 A;  3PBR A;  2JE5 A;  4IVK A;  4DF6 A;  3HRE A;  4S2N A;  4EBP A;  1SCW A;  2ZQ7 A;  1IYQ A;  2ZM8 A;  4IED A;  1NRF A;  3BM6 A;  4K91 A;  4DE2 A;  1TDL A;  5D3O A;  5EVI B;  2VGJ A;  5FQM A;  4MLL A;  4OQG A;  2Z2M B;  1BTL A;  2ZQD A;  4PPR A;  3IF5 A;  2ZC5 B;  1MWT A;  3QNC A;  4JXG A;  3MZE A;  5TGF A;  3MXR A;  4R1G A;  2XD5 A;  1L0G A;  1MWR A;  2ZM2 A;  5HAI A;  3NCK A;  4E3I A;  4Q8I A;  1KVL A;  2VGK A;  2ZQC A;  2HPB A;  5HAP A;  4OPQ A;  1AXB A;  3IH8 A;  4YIN A;  3LY4 A;  3VSL A;  3BFD A;  3MFD A;  4KZ7 A;  5FI2 A;  4PM9 A;  2Q9M A;  3N8L A;  1ES2 A;  3W4P A;  3BFC A;  3UDF A;  4E3J A;  5HL1 A;  2R9W A;  1PZO A;  3HL9 A;  1ERM A;  3BLM A;  1HVB A;  4LEN A;  4OP8 A;  2V20 A;  3WS4 A;  5TR7 A;  3DWZ A;  4GNU A;  4QD4 A;  1WE4 A;  4GZB A;  4K0W A;  1YLJ A;  2Y4A A;  5E2G A;  5CTN A;  4KG5 A;  1W5D A;  3ZG9 B;  3PBS A;  4N1H A;  4PM5 A;  2ZC7 A;  3IXH A;  4PMA A;  4N9K A;  5DF8 A;  4ZJ1 A;  1LI9 A;  4DE1 A;  4LV2 A;  3VOY A;  2IWC A;  2JCH A;  2WGW B;  3DW0 A;  3HLG A;  5F1G A;  5CEB A;  1LL5 A;  1K57 C;  1W79 A;  4OVD A;  1GCE A;  1YLW A;  2V2F F;  1J9M A;  2OLU A;  4E6X A;  3LEZ A;  3LO7 A;  4WMC D;  1M40 A;  4E3L A;  3ZDJ A;  3GMW A;  3BFE A;  1ESU A;  1K54 C;  5FA7 A;  4FSF A;  1YLP A;  2EFU A;  1K55 C;  2WKI A;  5EVI D;  3V3R A;  2ZC6 B;  4U0T A;  1I2W A;  1PI5 A;  3WS0 A;  4X55 A;  3ZVT A;  2HDS A;  2V1Z A;  1NY0 A;  1PW8 A;  3IXB A;  4DDY A;  4UHU A;  5HW3 A;  2ZQ9 A;  4S2P A;  3HLW A;  3GSG A;  4JLF A;  2ZMA A;  1KE3 A;  1E25 A;  1NJ4 A;  2HP9 A;  3OPR A;  3Q07 A;  4OQ0 A;  3MBZ A;  5CGX A;  3V39 A;  4RX3 A;  1HZO A;  4GD6 A;  5DTT A;  1MXO A;  3GR2 A;  3G32 A;  5AQ9 A;  2EX8 A;  4QY6 A;  5EVI C;  5CHJ A;  1ES3 A;  3WWX A;  1E3U D;  5DF7 A;  4QHC A;  3ZGA B;  3NC8 A;  4KQR A;  4OOL A;  2H10 A;  4ID4 A;  2HDQ A;  5HAR A;  5I94 A;  5TFQ A;  1CK3 A;  4NK3 A;  2Y2Q A;  4N1X A;  1NYM A;  3A3E A;  3O87 A;  1DY6 A;  1JTG A;  1PYY A;  4JF4 A;  5F1F A;  3V5M A;  5E2H A;  5KSH A;  1GHI A;  3I7J A;  3ZNY A;  3UY6 A;  1G68 A;  4CJN A;  4YFM A;  1JWZ A;  1QME A;  4JPM A;  4Y0T A;  4PM6 A;  3TOI A;  3UE3 A;  2DRW A;  4MNR A;  2OLV A;  4OOM A;  1BUE A;  1MKI A;  4QB8 A;  3HLE A;  2Y2L A;  4BD1 A;  5EOE A;  4BQM A;  5KSC A;  1YLZ A;  4P87 A;  2RCX A;  1S0W A;  4S2L A;  3FYZ A;  4WM9 A;  1FOF A;  5DF9 A;  1LHY A;  3V3S A;  3P09 A;  4XUX A;  3UNW A;  3WRZ A;  3IXD A;  3CG5 A;  4XUZ A;  3WS5 A;  2QZ6 A;  4BL2 A;  2ZQA A;  1GA9 A;  1NYY A;  2Y2I A;  2C6W B;  4FH4 A;  1IEM A;  3PAE A;  4LV1 A;  1RGZ A;  1C3B A;  4U0X A;  4X69 A;  1DJA A;  5CHU A;  4JBF A;  4U3T A;  3MKF A;  2ZC4 B;  3NI9 A;  3PBT A;  4JXS A;  4S2J A;  1KE0 A;  1Q2Q A;  3P98 A;  4OQH A;  2EX6 A;  3LY3 A;  3WS1 A;  1EI5 A;  2Y2M A;  4KQO A;  5GHZ A;  5GHY A;  2B5R A;  4P6B A;  2CC1 A;  3HUM A;  4DXB A;  1E4D A;  3G34 A;  3UDI A;  2H0Y A;  2WZZ A;  2ZJ9 A;  1GA0 A;  3D4F A;  5GLA A;  5A93 A;  1NZU A;  3ZCZ A;  3GRJ A;  5CGW A;  3PBN A;  5F83 A;  5J8X A;  4C6Y A;  3SOI A;  3UDX A;  3Q81 A;  5FQI A;  5FAQ A;  5JYP A;  1KDW A;  1W8Q A;  3FKW A;  3RXW A;  5FAT A;  5U47 A;  1KDS A;  1BUL A;  1K6S A;  2Y2P A;  4QU3 A;  3UPP A;  5A90 A;  2XF3 A;  3DWK A;  3EQV A;  2XGN A;  4DE0 A;  1W8Y A;  1BLH A;  3IHB A;  4Z9Q A;  3GV9 A;  4OPR A;  1Z6F A;  3MKE A;  1YLY A;  4ZTK A;  4N92 A;  1XA1 A;  4JKT A;  5EVL A;  5FAO A;  4EBN A;  5HAQ A;  1PWC A;  1XP4 A;  1KVM A;  1TDG A;  2BG1 A;  2P9V A;  3QNB A;  5CRF A;  3N8S A;  5M19 A;  1I2S A;  2E8I A;  5E2F A;  4RYE A;  4KZ8 A;  3AGE A;  2G2W A;  1XXM A;  3N7W A;  4KZ9 A;  1WYC A;  4E6W A;  1CI9 A;  3IHA A;  3G2Z A;  2EXA A;  3NY4 A;  2HDU A;  3E2K A;  3HVF A;  2XFT A;  4L0L A;  5EUA A;  2J7V A;  1FR1 A;  1PIO A;  4GDB A;  3G4P A;  4GN2 A;  3S4X A;  1ERO A;  3Q7V A;  4KZ3 A;  4E3N A;  4R3J A;  1H5X A;  2Q9N A;  3FZC A;  4BL3 A;  3BLS A;  1PWD A;  3IF6 B;  4KEN B;  3OZH A;  1VQQ A;  1O07 A;  3HLF A;  3Q82 A;  4WYY A;  2XK1 A;  4X56 A;  4OLG A;  4IBX A;  2EXB A;  3G30 A;  4R4S A;  3O88 A;  3ZHH A;  1PW1 A;  4ZAM A;  4DXC A;  3CMZ A;  1JWV A;  3MZD A;  4FCF A;  3Q7Z A;  4B88 A;  1L0D A;  4UA7 A;  1ES4 A;  4P85 A;  1SHV A;  1L0E A;  3VP0 A;  1N4O A;  3OC2 A;  1XA7 A;  5FAS A;  2WKH A;  4OKP A;  4FH2 A;  5CXW A;  1JVJ A;  3A3F A;  2Y2O A;  5JYO A;  5FQ9 A;  1Y54 A;  3PBO A;  5IHV A;  2XD1 A;  1KGG A;  4OON A;  1IYP A;  4M3K A;  3M2K A;  3FKV A;  3NIA A;  5DTK A;  1CEG A;  3SS4 A;  2PBY A;  3N6I A;  1XPB A;  2J9P A;  2ZLY A;  4N9L A;  2EFX A;  2FFY A;  3EQU A;  4ZJ2 A;  3BEB A;  3C4P A;  3HUN A;  4KZA A;  1ZG4 A;  1TEM A;  1N9B A;  4OP5 A;  4R23 A;  3W4O A;  3UE1 A;  2XEP A;  1W7F A;  4S2I A;  1ZC2 A;  3NDE A;  4RVA A;  1RCJ A;  4HBT A;  2DCF A;  3PBQ A;  4LCM A;  4Y0O A;  2A3U A;  1LI0 A;  1K38 A;  4NET A;  2PU2 A;  2WK0 A;  3VP1 A;  4MBH A;  2WAF A;  2Y59 A;  4MEZ A;  2BLS A;  2EX2 A;  3Q7V B;  2WUQ A;  2OSU A;  3BYD A;  4R4R A;  4WZ5 C;  4Y0U A;  1GHP A;  2R9X A;  3M6B A;  5GL9 A;  3IWO A;  4WMC A;  1RGY A;  3VP3 A;  2XLN A;  3SH9 A;  4EV4 A;  2J8Y A;  5HFO A;  1HTZ A;  4OH0 A;  1ONH A;  1XGI A;  5EVI A;  3VSK A;  4P0M A;  3O86 A;  3SS3 A;  4EWF A;  1FSW A;  3N8R A;  1QMF A;  2OV5 A;  1XX2 A;  1PI4 A;  4HEF A;  4IBR A;  1SDN A;  3A3J A;  2ZD8 A;  1FSY A;  4S2O A;  4BD0 A;  1PZP A;  3C7U A;  1K25 A;  3IF6 C;  4HBU A;  2ZM0 A;  2IWB A;  4KZ5 A;  1L0F A;  5BOH A;  1WYB A;  3BRM A;  4S2N C;  1ZG6 A;  5CEC A;  4S2K A;  3VP4 A;  4WEK A;  3BFF A;  5FQK A;  1HD8 A;  3UN7 A;  2H0T A;  1I5Q A;  4ZBE A;  4R3B A;  2J9O A;  4CPK A;  1E3U A;  2HP5 A;  1M6K A;  2A49 A;  3HUO A;  1MBL A;  1YMX A;  4ZDX A;  5L2F A;  4UAA A;  5CER A;  1BT5 A;  3CJM A;  2PU4 A;  5AQ7 A;  5CED A;  3MZF A;  1ERQ A;  1U60 A;  5M1A A;  3CZD A;  1K6R A;  3G31 A;  4D2O A;  3W8K A;  1BLS A;  1DJC A;  4RX2 A;  4MBF A;  2I72 A;  3ZG7 B;  1S6R A;  3VP2 A;  1IKG A;  3SS5 A;  3MXS A;  4UA6 A;  2Y2G A;  3VFH A;  3QHY A;  1Q2P A;  3TSG A;  3A3I A;  3ZG8 B;  4KG2 A;  2Y2J A;  1ZKJ A;  4IVI A;  5GLB A;  1DJB A;  3SH7 A;  2Z2L B;  3IT9 A;  4OLD A;  3VFF A;  5DVA A;  3C4O A;  3HLD A;  3M2J A;  3N4I A;  3HLC A;  5F82 A;  1NXY A;  4HES A;  1MWU A;  1XKZ A;  5HX9 A;  3ZNT A;  3C5A A;  3HBR A;  3JYI A;  4GOG A;  1K4E A;  4C3Q A;  1K56 A;  3UE0 A;  2QPN A;  4DE3 A;  1FCM A;  1BZA A;  1VM1 A;  1YMS A;  3IXG A;  2WZX A;  3AGF A;  1MPL A;  3IQA A;  1LLB A;  4H8R A;  5KZH A;  4EQI A; 
#chains in the Genus database with same CATH topology
 3PTE A;  4JF5 A;  1CJF A;  2PRF A;  3IWI A;  3D9Y A;  1P0Z A;  2D02 A;  3IWQ A;  2HJ9 C;  2LB5 A;  3A3D A;  1H8M A;  2FH5 A;  4Y7P A;  3MQO A;  2WKP A;  1H8Y A;  4KZ6 A;  5DKK A;  3LI8 A;  1LSX A;  2H5S A;  3R4K A;  1IEL A;  4ETX A;  5GLC A;  3E4O A;  3KYE A;  3W2Z A;  3KSH A;  3GVB A;  4FUW A;  5AVF A;  5HPI A;  2VV7 A;  1BLC A;  5FAP A;  3ULF A;  1OJG A;  3OCL A;  4EUZ A;  5EE8 A;  3HJK A;  2WGV A;  3ZVW A;  1YLT A;  2NUP C;  1K54 A;  3ZFZ A;  4E3O A;  3E4P A;  2OAQ 1;  1YT4 A;  3OPL A;  3S1Y A;  4S2M A;  3SH8 A;  2G7U A;  1CEF A;  4BLM A;  4WBG A;  4LCL A;  1EWZ A;  1NZO A;  2BAS A;  1VET B;  2HV1 A;  4KZB A;  1A0K A;  5DTS A;  5EM0 A;  4X1M A;  2E8J A;  2JC7 A;  4F3L B;  2WAE A;  1IYO A;  5FDS A;  4GB7 A;  4QJG A;  4DKI A;  2O9C A;  1T19 A;  3MXQ A;  4Q0H A;  4X53 A;  2Y2N A;  4OQI A;  1IKI A;  5EEC A;  3IX3 A;  2W1R A;  5FQQ A;  1IOU A;  2ZQ8 A;  2XH9 A;  3UPN A;  5HPF A;  2KLI A;  4MN6 A;  3E4Q A;  5AQB A;  4F94 A;  4O7D A;  5KMW A;  3O3V A;  3BQ8 A;  4GD8 A;  1F98 A;  3MMH A;  2W0N A;  4CQH A;  4S2N A;  4EBP A;  2ZQ7 A;  3HJI A;  5F68 A;  3A0R A;  3NOT C;  4K91 A;  5EVI B;  2J80 A;  2B18 A;  3OLO A;  5G4Z A;  4OQG A;  2Z2M B;  3MQ0 A;  2ZC5 B;  1MWT A;  3K3C A;  3NCK A;  4E3I A;  3IH8 A;  3LR5 A;  4IJG A;  4KZ7 A;  1ES2 A;  3BFC A;  3EWK A;  3F1P A;  4OP8 A;  5TBM A;  3WS4 A;  3DWZ A;  4GZB A;  5FEG A;  1YLJ A;  2Y4A A;  5HD3 A;  2FZ0 A;  1S4S A;  2ZC7 A;  3LIA A;  3A0S A;  5F1G A;  5AVE A;  1W79 A;  2V0W A;  4E6X A;  5J4E A;  3LEZ A;  3LO7 A;  4WMC D;  1M40 A;  4E3L A;  3ZDJ A;  3BFE A;  5FA7 A;  4JGR A;  5EVI D;  3WS0 A;  4U0T A;  3D3O A;  3KSI A;  2QJ5 A;  4NXG A;  2PR6 A;  3IXB A;  4UEY A;  3GSG A;  5CGX A;  3OPR A;  2P04 A;  3GR2 A;  2EX8 A;  1E3U D;  5DF7 A;  3ZGA B;  3NC8 A;  4KQR A;  3F1P B;  3UB7 A;  5TFQ A;  3RFB A;  1NYM A;  5TBM B;  5E2H A;  4UQI S;  2PD8 A;  3IBR A;  1G68 A;  4EU0 A;  1QME A;  2VJW A;  4Y0T A;  3KSG A;  4LGW A;  3CUE A;  2OLV A;  4WLA A;  5DKL A;  4Y15 A;  1S0W A;  3UNW A;  3WRZ A;  3WS5 A;  4BL2 A;  2ZQA A;  1GA9 A;  2XRN A;  2INW A;  2J3W A;  4LV1 A;  1RGZ A;  1DJA A;  4HH2 A;  4JBF A;  2ZC4 B;  4S2J A;  1KE0 A;  1Q2Q A;  4OQH A;  5GHY A;  4HQA A;  4P6B A;  2CC1 A;  3B42 A;  1E4D A;  1OTI A;  1NZU A;  5IU1 A;  3KO6 A;  5HSQ A;  5FQI A;  2YKF A;  2VEA A;  2K31 A;  1W8Q A;  1TS0 A;  5C5K A;  1K6S A;  5A90 A;  3EQV A;  2XGN A;  1BLH A;  4Z9Q A;  3GV9 A;  4ARZ A;  1XP4 A;  2BG1 A;  3QNB A;  4Y2F A;  3BJN A;  4H6J A;  1W63 M;  3B33 A;  4E6W A;  3N7W A;  3IHA A;  3G2Z A;  2EXA A;  3L7H A;  3E2K A;  3HVF A;  5EUA A;  1FR1 A;  5KIZ A;  5LBR A;  4KZ3 A;  4E3N A;  1H5X A;  3BLS A;  3IF6 B;  4KEN B;  5A8B A;  1O07 A;  1PFL A;  3HLF A;  2XK1 A;  4OLG A;  2GX5 A;  3ZHH A;  2QWS A;  3MZD A;  1KOU A;  1SHV A;  3BW6 A;  3VP0 A;  3OC2 A;  5CXW A;  5FQ9 A;  3H82 B;  5EVE A;  5IHV A;  4NEE D;  5DTK A;  1GSW A;  3N6I A;  4ARZ B;  2FFY A;  3TW8 A;  3BEB A;  3HUN A;  4OP5 A;  4KZA A;  4R23 A;  2VV6 A;  3UE1 A;  3EEH A;  4S2I A;  3NDE A;  4M4X A;  2DCF A;  3PBQ A;  4KQD A;  1LI0 A;  4NET A;  4P6Z M;  3VP1 A;  4MBH A;  2B95 A;  2EX2 A;  2WUQ A;  2R9X A;  3M6B A;  1YPR A;  1OTA A;  2J8Y A;  2JHE A;  4P0M A;  1FSW A;  3EOI A;  4WF0 A;  2OV5 A;  1XX2 A;  4HEF A;  3A3J A;  4FTX A;  1FSY A;  4S2O A;  4BD0 A;  1PZP A;  3KYZ A;  5HWV A;  1XFQ A;  1HD8 A;  2H0T A;  4R3B A;  1M6K A;  2A49 A;  5L2F A;  4IUK A;  4RX2 A;  2V8F A;  3CI6 A;  4LRX C;  3SS5 A;  4PKY A;  3TSG A;  3ZG8 B;  4KG2 A;  2Y2J A;  2HGV A;  5GLB A;  3SH7 A;  4PHT A;  5L07 A;  4G3W A;  5DVA A;  3H7W A;  3M2J A;  3HLC A;  4XT2 A;  5HX9 A;  3KYQ A;  1K4E A;  5MC7 A;  4EEU A;  1ODV A;  1BZA A;  4H8R A;  4B9O A;  1LSW A;  5KZH A;  4EQI A;  4WEL A;  2OWJ A;  3AGD A;  2XFS A;  3T4S A;  3ITB A;  2JBF A;  2LB9 A;  1P9W A;  3DTK A;  3T4K A;  2W3G A;  1W63 Q;  2MJ6 A;  4O01 A;  2WGI A;  4ZJ3 A;  3NBL A;  4GS9 A;  3OOV A;  2IWD A;  3B47 A;  2HDR A;  1SZV A;  2Y2K A;  5L8M A;  3U4L P;  4HIA A;  4R70 A;  5A92 A;  2VGL S;  2QMI A;  4JF6 A;  4XT2 B;  2GDN A;  3V50 A;  1K57 A;  3BFG A;  2P9V B;  2X02 A;  5EPH A;  2Y55 A;  1UWN X;  5FSR A;  1SKO B;  2OOL A;  2DNS A;  1PWG A;  4NG2 A;  1ALQ A;  3HLB A;  1XGJ A;  2EX9 A;  3WRT A;  4FD8 A;  3OCN A;  1J3W A;  2XQZ A;  3Q1F A;  2AVX A;  3L9K A;  1RP5 A;  4OOY A;  2GNX A;  4GS9 B;  4FOF A;  2V1A A;  5DJU A;  5EOO A;  3M6H A;  3GTC A;  3ZQ5 A;  3G2Y A;  2HJE A;  2VLG A;  2QHK A;  1AWI A;  1FCN A;  5E2E A;  5FQJ A;  2X71 A;  1L2S A;  3R7W A;  3O5Y A;  2ACG A;  4EW7 A;  1FCO A;  4B4X A;  2WKR A;  3ZG5 A;  2FFF B;  2WYX A;  5CHM A;  5F69 A;  4WZ4 A;  4DJ2 A;  5FEF A;  2Y2H A;  3UPO A;  1YQS A;  5M18 A;  4II7 A;  1ES5 A;  4E3K A;  1CF0 A;  4R6L A;  3MFX A;  3PBR A;  4DF6 A;  3HRE A;  1SCW A;  2VKS A;  1NRF A;  1LSV A;  5D3O A;  4MLL A;  2ZL1 A;  2ZQD A;  1LL8 A;  3IF5 A;  3T4Q A;  4JXG A;  4R1G A;  5HAI A;  3P01 A;  4Q8I A;  3CLO A;  2ZQC A;  2HPB A;  4JGO A;  4PAU A;  1MZU A;  3BFD A;  3R7W B;  2Q9M A;  3LR0 A;  3F1O B;  2V20 A;  5TR7 A;  4QD4 A;  5E2G A;  4K0W A;  1G5U A;  4DMZ A;  3ZG9 B;  4N1H A;  4PM5 A;  3IXH A;  4N9K A;  5DF8 A;  4DE1 A;  1S1Y A;  2JCH A;  5CEB A;  1LL5 A;  2V2F F;  1J9M A;  3MJQ A;  1K54 C;  3SZT A;  4FSF A;  1YLP A;  4K08 A;  2WKI A;  3V3R A;  2ZC6 B;  1DP9 A;  4X55 A;  4Q0J A;  2ZL1 B;  3LIE A;  4DDY A;  4UHU A;  2V8C A;  1S4R A;  2HF6 A;  4S2P A;  5HW3 A;  3HLW A;  3QP2 A;  5DTT A;  1MXO A;  5EVI C;  3WWX A;  1K0K A;  4AFI A;  4OOL A;  4ID4 A;  3FPV A;  1CK3 A;  4NK3 A;  3NOP C;  2O9A A;  3O87 A;  5F1F A;  1JTG A;  3UY6 A;  4YFM A;  1HLU P;  4PM6 A;  1N9N A;  3UE3 A;  5HWW A;  2UV0 E;  4OOM A;  1BUE A;  4QB8 A;  3HLE A;  4BD1 A;  5EOE A;  4BQM A;  5KSC A;  1YLZ A;  2RCX A;  4S2L A;  2JKG A;  3FYZ A;  4WM9 A;  5DF9 A;  1LHY A;  3LID A;  3IXD A;  3S7N A;  4HH3 A;  4I38 A;  1FIK A;  3S7O A;  1IEM A;  4PKY G;  3PAE A;  3IX8 A;  4X69 A;  4I3A A;  3NI9 A;  3PBT A;  3TJZ C;  3NJA A;  1NLZ A;  2EX6 A;  2L4R A;  2B5R A;  5L09 A;  4HJ4 A;  4DXB A;  3UDI A;  3V67 A;  3D4F A;  3ZCZ A;  2Y79 A;  5J8X A;  4C6Y A;  4HJ3 A;  3LR4 A;  3Q81 A;  3K2N A;  5FAQ A;  3FKW A;  3F1N A;  4GHI A;  4BMW A;  2PT7 A;  2XF3 A;  4DE0 A;  3BQA A;  1Z6F A;  2EWV A;  1DP6 A;  4N92 A;  1BYW A;  4EBN A;  2QJ7 A;  1PWC A;  2B02 A;  1KVM A;  4RYE A;  4KZ8 A;  3NY4 A;  3G4P A;  4WUJ A;  1GSV A;  3FZC A;  4WYY A;  4IBX A;  4R4S A;  3JVV A;  1PW1 A;  3CMZ A;  1ES4 A;  3GEC A;  1N4O A;  4OKP A;  4FH2 A;  1JVJ A;  2Y2O A;  5JYO A;  3U2A A;  1KGG A;  1IYP A;  4M3K A;  1CEG A;  2PBY A;  2J9P A;  2ZLY A;  4N9L A;  2EFX A;  4ZJ2 A;  4EUV A;  3C4P A;  1ZG4 A;  1TEM A;  3W4O A;  3CUE C;  1ZC2 A;  4RVA A;  2W3E A;  2A3U A;  1K38 A;  1G6O A;  2WK0 A;  1UGU A;  4WZ5 C;  2V1B A;  3BYD A;  4HI4 A;  5GL9 A;  4MMN A;  1RGY A;  3SH9 A;  4EV4 A;  3VSK A;  2PYP A;  3O86 A;  3SS3 A;  4EWF A;  3N8R A;  1QMF A;  1SDN A;  5IT5 A;  4NXB A;  3IF6 C;  1K25 A;  4HBU A;  2V9A A;  2ZM0 A;  2IWB A;  3S7P A;  3BRM A;  4WN5 A;  3BFF A;  5FQK A;  4CPK A;  4Y13 A;  2PBD P;  1OJ5 A;  2HP5 A;  3HUO A;  4UAA A;  4X1L A;  4UQI M;  4MDZ A;  3CZD A;  3G31 A;  1BLS A;  3ZG7 B;  2EWW A;  2I72 A;  3VP2 A;  1IKG A;  1Q2P A;  1VEU A;  3A3I A;  3DBA A;  4O8G A;  4QPR A;  4EXO A;  2R78 A;  2M1C A;  1DJB A;  2K7S A;  3IT9 A;  3VFF A;  1MWU A;  4E04 A;  1XJ2 A;  3ZNT A;  3C5A A;  3HBR A;  4GOG A;  4C3Q A;  1P97 A;  3UE0 A;  1YMS A;  1MPL A;  4KQQ A;  1OPX A;  5GHX A;  1YM1 A;  4R3A A;  5AQA A;  3UE6 A;  4R0Q A;  3RJU A;  3ITA A;  1BLP A;  1IYS A;  3JVU A;  1OME A;  3PAG A;  3LCE A;  2P74 A;  2XR0 A;  1JTD A;  2O9B A;  1VEU B;  5IS1 A;  3B3X A;  3DAV A;  4Y3I A;  2X01 A;  3LIC A;  3PR6 A;  3FPW A;  4WEJ A;  5EV0 A;  5K5B A;  4EER A;  2RL3 A;  2ZOH A;  4E3M A;  3NUL A;  4CLC A;  4MN5 A;  2XA7 S;  4H6J B;  4IUH A;  4NKP A;  4YOF A;  1K55 A;  2WAD A;  1CI8 A;  1XFN A;  3D72 A;  4PM7 A;  3S22 A;  4ZRR A;  1FQG A;  4NXE A;  2J3T D;  1OTE A;  3E98 A;  1OT9 A;  3UO9 A;  2ZC3 B;  1TVF A;  2A24 A;  4PM8 A;  3LIB A;  4A5R A;  2OWH A;  1O7E A;  3DTI A;  4MBK A;  4DRT A;  1MY8 A;  5CGS A;  4GKU A;  4MN7 A;  3RH8 B;  4I39 A;  4KG6 A;  4JGQ A;  3CPT A;  1YSQ A;  2K2N A;  2XA7 M;  5FDH A;  1Y28 A;  2ZMF A;  4LV3 A;  5FI6 A;  3OPH A;  2QKP A;  4CLC B;  3VOZ A;  4BJP A;  3SW1 A;  2PD7 A;  1TS8 A;  1T1A A;  2XDM A;  1OTB A;  3DTM A;  3MQQ A;  3E0Y A;  4X6T A;  1K4F A;  4MCW A;  3PHY A;  2W3D A;  1ONG A;  4LV0 A;  1BSG A;  3W4Q A;  3ZG0 A;  2H28 A;  1GHM A;  3P7N A;  2JE5 A;  4EET B;  2A24 B;  4IED A;  1T18 A;  2KOI A;  3BM6 A;  5EM1 A;  1TDL A;  2VGJ A;  3ZYT A;  5FQM A;  1BTL A;  4PPR A;  3QNC A;  5TGF A;  1S67 L;  3K3D A;  4HOI A;  2XD5 A;  2ZM2 A;  1KVL A;  2VGK A;  5HAP A;  5G4Y A;  1AXB A;  4YIN A;  3VSL A;  3CPT B;  5FI2 A;  4PM9 A;  1TS7 A;  2PAV P;  4E3J A;  5HL1 A;  3CWF A;  2R9W A;  3HL9 A;  3BLM A;  4LEN A;  1YSP A;  1WE4 A;  5CTN A;  3PBS A;  2IWC A;  3HLG A;  2HZ5 A;  1K57 C;  3H7W B;  4O0P A;  3EGX C;  4OVD A;  1GCE A;  1YLW A;  4EEP A;  3GMW A;  4YWZ A;  1ESU A;  4HNB A;  1FIL A;  4KUO A;  3T4L A;  3PXP A;  2HDS A;  1NY0 A;  1PW8 A;  5M19 A;  1KE3 A;  1E25 A;  1NJ4 A;  3Q07 A;  4OQ0 A;  3MBZ A;  3V39 A;  1HZO A;  2L1M A;  5FL3 A;  2KDK A;  4GD6 A;  4RQ9 A;  2Y8H A;  4QY6 A;  2W3H A;  1XJ6 A;  4IHQ A;  3UB5 P;  3NHQ A;  4YNR A;  2H10 A;  5HAR A;  4N1X A;  1TS6 A;  2VK3 A;  1GHI A;  3ZNY A;  1YKD A;  2ZMV A;  2VGL M;  4JPM A;  2Y2L A;  2PDR A;  5AJG A;  2KX6 A;  1X0O A;  3CG5 A;  4XUZ A;  1NYY A;  2Y2I A;  2C6W B;  3T1Q B;  1VHM A;  1C3B A;  4U0X A;  3UMD A;  3IBJ A;  2M7U A;  4JXS A;  4Y5F A;  1STZ A;  1EI5 A;  4KQO A;  2Q0O A;  3UB9 A;  3G34 A;  2WZZ A;  1GA0 A;  4Y17 A;  5A93 A;  1XJ3 A;  3GRJ A;  5CGW A;  3PBN A;  5F83 A;  5HZH A;  3C38 A;  3QP4 A;  3TE8 A;  1KDW A;  3RXW A;  5FAT A;  5U47 A;  1BUL A;  4QU3 A;  1G28 A;  4G3K A;  3LYX A;  1W8Y A;  4OPR A;  1DP8 A;  1YLY A;  1XA1 A;  5FAO A;  5HAQ A;  4BBU A;  1MC0 A;  1TDG A;  4D60 A;  5CRF A;  2G2W A;  4KZ9 A;  1WYC A;  3ICY A;  3UB8 A;  2XFT A;  2WKQ A;  2J7V A;  4DJ3 A;  2W27 A;  4GDB A;  4GN2 A;  3S4X A;  5J3W A;  3Q7V A;  4R3J A;  2Q9N A;  4BL3 A;  1PWD A;  3LUQ A;  3Q82 A;  1IFQ A;  4LRZ E;  4X56 A;  2EXB A;  3EGD C;  1VET A;  4WL9 A;  1TF1 A;  3Q7Z A;  4B88 A;  1L0D A;  4UA7 A;  4P85 A;  5FAS A;  2WKH A;  4F3L A;  3A3F A;  3PBO A;  3JPU A;  2XD1 A;  4LFU A;  1S66 L;  3FKV A;  3NIA A;  4L9F A;  1N9B A;  1V9Z A;  1W7F A;  1ZTU A;  1RCJ A;  2Y59 A;  4R4R A;  2BLS A;  3Q7V B;  2OSU A;  1N9L A;  4WMC A;  2XLN A;  2PYR A;  5L10 A;  1F9I A;  4OH0 A;  1ONH A;  1XGI A;  5EVI A;  3QP6 A;  3T50 A;  2BTF P;  3C7U A;  1NRJ A;  3UME A;  4KZ5 A;  5BOH A;  1WYB A;  4S2N C;  1ZG6 A;  3OBF A;  5CEC A;  4S2K A;  3UN7 A;  4ZBE A;  3VOL A;  2J9O A;  1E3U A;  3LI9 A;  1YMX A;  1BT5 A;  3CJM A;  5AQ7 A;  1ERQ A;  2I9V A;  2PR5 A;  1DJC A;  1S6R A;  3CAX A;  3MXS A;  3VFH A;  2Y2G A;  3QHY A;  4IVI A;  3T4J A;  1LT0 A;  3HLD A;  3N4I A;  5F82 A;  3T1R A;  2XRO A;  3JYI A;  5CX7 A;  1K56 A;  4ETZ A;  3QP1 A;  2QPN A;  4L9G A;  1EW0 A;  3KX0 X;  1LLB A;  3QP8 A;  2O0Y A;  4HP9 A;  4LPZ A;  1XJ4 A;  1PNE A;  3TG9 A;  1KGE A;  4KZ4 A;  3T4T A;  2WKE A;  1G6A A;  5DJT A;  3IH9 A;  2M7V A;  4OPY A;  5EFW A;  1ZHH B;  4EBL A;  3OPP A;  4UA9 A;  1MKM A;  1T1B A;  1D1J A;  1ESI A;  3F1N B;  4DDS A;  3NEC A;  4GHI B;  3CIT A;  1SDE A;  4K0X A;  1CQA A;  4JXV A;  5A91 A;  4EES A;  2HP6 A;  3C7V A;  3T4O A;  2P08 A;  2Y91 A;  5G18 A;  1T1C A;  5FI7 A;  1FR6 A;  5HWT A;  2OAP 1;  1LL9 A;  1KGF A;  4BBT A;  3WS2 A;  5GLD A;  5J7E A;  4HHD A;  3FWL A;  4JXW A;  3RXX A;  4BBV A;  4X68 A;  3MR0 A;  2G2U A;  2DMW A;  2UWX A;  3BEC A;  3FV7 A;  3VE3 A;  4QY5 A;  3ISG A;  4BEN A;  3UB6 A;  2J3T C;  1OTD A;  2W1T A;  2C5W B;  3NDG A;  5HDC A;  1F2K A;  1KE4 A;  3E2L A;  3GQZ A;  1H8Z A;  4XXR A;  5E43 A;  1K56 D;  4WZ5 A;  4RA7 A;  1NWZ A;  1JWP A;  3IX4 A;  4I3J A;  3T1X A;  3VMA A;  4OPZ A;  4B4Z A;  1OT6 A;  4GDN A;  2ZBB A;  5CTM A;  1MWS A;  3C8C A;  3G35 A;  1SKF A;  2WGW A;  2GJ3 A;  3IF6 A;  3T12 B;  4C75 A;  4IVK A;  4EQ1 A;  3NOU C;  1IYQ A;  4HY8 A;  2ZM8 A;  4DE2 A;  4Z1W A;  5HDS A;  1UWP X;  2O99 A;  3HCY A;  2NUT C;  3PYP A;  3MZE A;  3MXR A;  3BY9 A;  4QWO A;  2W1T B;  1L0G A;  1MWR A;  1V9Y A;  4L9E A;  2CMN A;  4I3I A;  3H82 A;  4OPQ A;  4X25 A;  3LY4 A;  3MFD A;  4ME4 A;  3N8L A;  4Q0I A;  3W4P A;  3UDF A;  1PZO A;  3IS2 A;  1ERM A;  1HVB A;  4GNU A;  1D7E A;  4KG5 A;  1W5D A;  4PMA A;  3C2W A;  3EEA A;  1LI9 A;  4ZJ1 A;  4LV2 A;  4R38 A;  3VOY A;  2WGW B;  3DW0 A;  2XSS A;  5HD5 A;  4CLC C;  1WA9 A;  4P6Z S;  2EA9 A;  2OLU A;  2V0U A;  2EFU A;  1K55 C;  1I2W A;  1PI5 A;  1NLY A;  3ZVT A;  2V1Z A;  1DRM A;  5F5Y A;  3A0V A;  2ZQ9 A;  4JLF A;  2ZMA A;  2HP9 A;  1JNU A;  4RX3 A;  4HP4 A;  4LRY C;  3VV4 A;  2JKT M;  3G32 A;  5AQ9 A;  4CLC E;  5CHJ A;  1ES3 A;  4QHC A;  2JKR M;  3LEQ A;  2HDQ A;  4ESP A;  5I94 A;  3IS2 B;  2Y2Q A;  3MS6 A;  4NXF A;  2D01 A;  3A3E A;  1DY6 A;  1PYY A;  4JF4 A;  5HL6 A;  3V5M A;  2JN7 A;  2GZA A;  5KSH A;  3I7J A;  4CJN A;  1JWZ A;  3TOI A;  2DRW A;  3TRC A;  2VA0 A;  4MNR A;  1MKI A;  4P87 A;  1FOF A;  3BY8 A;  2PHY A;  4GJ4 A;  3V3S A;  3P09 A;  4XUX A;  2QZ6 A;  3LR3 A;  2L0W A;  4FH4 A;  1P9R A;  2JKF A;  5CHU A;  4U3T A;  3MKF A;  2QYB A;  2VZW A;  3P98 A;  3LY3 A;  3WS1 A;  2Y2M A;  5GHZ A;  3S7Q A;  3HUM A;  4HJ6 A;  1H3Q A;  4GCZ A;  2H0Y A;  5GLA A;  2ZJ9 A;  4B93 A;  2A2L A;  5DFY A;  4GW9 A;  3SOI A;  3UDX A;  3H9W A;  5JYP A;  2Z6C A;  4LLO B;  1KDS A;  2Y2P A;  3UPP A;  3DWK A;  3RTY A;  3IHB A;  3MKE A;  4ZTK A;  2IA2 A;  3FG8 A;  4JKT A;  5EVL A;  5F6A A;  4G3V A;  2P9V A;  3G6O A;  4CLC D;  3N8S A;  1I2S A;  2E8I A;  5E2F A;  3AGE A;  1XXM A;  3MSH A;  1CI9 A;  1TD5 A;  4KUK A;  5HDD A;  2HDU A;  1SKO A;  4L0L A;  1PIO A;  1H0M A;  1ERO A;  3C30 A;  5I5L A;  3OZH A;  1VQQ A;  2P7J A;  2W3F A;  3G30 A;  3O88 A;  3BWL A;  4ZAM A;  3VE4 A;  4DXC A;  1JWV A;  2VX8 A;  4FCF A;  3T1S A;  2Z6D A;  1L0E A;  1XA7 A;  1D06 A;  5TJJ A;  1S1Z A;  3LFV A;  2ZOI A;  1Y54 A;  1F5M A;  4OON A;  3M2K A;  3SS4 A;  3QP5 A;  1XPB A;  3EQU A;  2XEP A;  1PRQ A;  4HBT A;  4DN0 A;  4LCM A;  4Y0O A;  1Z09 A;  1Y4O A;  2PU2 A;  4I5S A;  3DTE A;  2WAF A;  4MEZ A;  3KSF A;  4Y0U A;  1GHP A;  3IWO A;  3VP3 A;  3FC7 A;  5HFO A;  1HTZ A;  3LIF A;  2VV8 A;  1PI4 A;  4IBR A;  3CHW P;  2ZD8 A;  4JGP A;  1L0F A;  3VP4 A;  4WEK A;  1I5Q A;  1YAX A;  1MBL A;  1N9O A;  4ZDX A;  5CER A;  5CED A;  2PU4 A;  3F1O A;  3GDI A;  3MZF A;  4BWI A;  1GSX A;  1U60 A;  5M1A A;  4D2O A;  1K6R A;  3W8K A;  4MBF A;  2YKH A;  4UA6 A;  1ZKJ A;  4GLQ A;  2JKT I;  2Z2L B;  3MF0 A;  4OLD A;  3C4O A;  2JKR I;  1NXY A;  3LGO A;  4HES A;  5DFX A;  1L3L A;  1XKZ A;  1ACF A;  4DE3 A;  1VB6 A;  1FCM A;  1VM1 A;  3IXG A;  2WZX A;  3AGF A;  3IQA A; 
#chains in the Genus database with same CATH homology
 3PTE A;  4WEL A;  3AGD A;  4JF5 A;  4KQQ A;  2XFS A;  3IWI A;  3ITB A;  2JBF A;  1YM1 A;  5GHX A;  3TG9 A;  3IWQ A;  5AQA A;  1KGE A;  4KZ4 A;  3A3D A;  4R0Q A;  2WKE A;  1G6A A;  3IH9 A;  4Y7P A;  3RJU A;  3ITA A;  1BLP A;  4OPY A;  1H8Y A;  1IYS A;  4KZ6 A;  1OME A;  3PAG A;  4EBL A;  3LCE A;  2WGI A;  3OPP A;  2H5S A;  4ZJ3 A;  2P74 A;  2XR0 A;  1JTD A;  3NBL A;  4UA9 A;  1IEL A;  5GLC A;  2IWD A;  2HDR A;  2Y2K A;  3GVB A;  3B3X A;  2X01 A;  1BLC A;  1ESI A;  5FAP A;  4DDS A;  4WEJ A;  5A92 A;  1SDE A;  4K0X A;  2QMI A;  4JF6 A;  4JXV A;  3OCL A;  4EUZ A;  2RL3 A;  5A91 A;  4E3M A;  5EE8 A;  2WGV A;  2GDN A;  3V50 A;  3ZVW A;  1K57 A;  2HP6 A;  3C7V A;  3BFG A;  2P9V B;  2X02 A;  5EPH A;  1YLT A;  2Y91 A;  2Y55 A;  5FSR A;  1K54 A;  5G18 A;  5FI7 A;  1FR6 A;  1K55 A;  3ZFZ A;  1LL9 A;  4E3O A;  2WAD A;  1CI8 A;  1KGF A;  2DNS A;  4PM7 A;  3WS2 A;  3S22 A;  1PWG A;  5GLD A;  1YT4 A;  1ALQ A;  3FWL A;  3HLB A;  1FQG A;  1XGJ A;  3OPL A;  4JXW A;  3RXX A;  2EX9 A;  3S1Y A;  4S2M A;  4FD8 A;  3OCN A;  3WRT A;  2XQZ A;  3SH8 A;  4X68 A;  1CEF A;  4BLM A;  3UO9 A;  2G2U A;  3Q1F A;  4WBG A;  2UWX A;  4LCL A;  2ZC3 B;  1EWZ A;  1TVF A;  1NZO A;  1RP5 A;  4OOY A;  4PM8 A;  4A5R A;  1O7E A;  3BEC A;  3FV7 A;  4MBK A;  4DRT A;  1MY8 A;  5EOO A;  5CGS A;  3M6H A;  4QY5 A;  3ISG A;  4GKU A;  4KZB A;  4BEN A;  3GTC A;  5DTS A;  3G2Y A;  2C5W B;  1FCN A;  2JC7 A;  4KG6 A;  3NDG A;  5E2E A;  5FQJ A;  2WAE A;  2X71 A;  1L2S A;  1KE4 A;  3E2L A;  1IYO A;  4GB7 A;  4QJG A;  4DKI A;  3GQZ A;  1H8Z A;  4XXR A;  4X53 A;  5FDH A;  2Y2N A;  1K56 D;  5E43 A;  4LV3 A;  4WZ5 A;  1FCO A;  5FI6 A;  3OPH A;  4RA7 A;  4B4X A;  4OQI A;  1IKI A;  5EEC A;  3VOZ A;  4BJP A;  3ZG5 A;  2FFF B;  1JWP A;  2WYX A;  5FQQ A;  5CHM A;  2XDM A;  2ZQ8 A;  3VMA A;  4OPZ A;  4B4Z A;  3DTM A;  2XH9 A;  4WZ4 A;  2Y2H A;  3UPN A;  3UPO A;  1YQS A;  4X6T A;  4GDN A;  1K4F A;  5AQB A;  5CTM A;  1MWS A;  3G35 A;  5M18 A;  4F94 A;  1SKF A;  1ES5 A;  2WGW A;  4O7D A;  5KMW A;  3O3V A;  1ONG A;  4LV0 A;  1BSG A;  3W4Q A;  3ZG0 A;  4E3K A;  4GD8 A;  3IF6 A;  1GHM A;  4C75 A;  3PBR A;  2JE5 A;  4IVK A;  4DF6 A;  3HRE A;  4S2N A;  4EBP A;  1SCW A;  2ZQ7 A;  1IYQ A;  2ZM8 A;  4IED A;  1NRF A;  3BM6 A;  4K91 A;  4DE2 A;  1TDL A;  5D3O A;  5EVI B;  2VGJ A;  5FQM A;  4MLL A;  4OQG A;  2Z2M B;  1BTL A;  2ZQD A;  4PPR A;  3IF5 A;  2ZC5 B;  1MWT A;  3QNC A;  4JXG A;  3MZE A;  5TGF A;  3MXR A;  4R1G A;  2XD5 A;  1L0G A;  1MWR A;  2ZM2 A;  5HAI A;  3NCK A;  4E3I A;  4Q8I A;  1KVL A;  2VGK A;  2ZQC A;  2HPB A;  5HAP A;  4OPQ A;  1AXB A;  3IH8 A;  4YIN A;  3LY4 A;  3VSL A;  3BFD A;  3MFD A;  4KZ7 A;  5FI2 A;  4PM9 A;  2Q9M A;  3N8L A;  1ES2 A;  3W4P A;  3BFC A;  3UDF A;  4E3J A;  5HL1 A;  2R9W A;  1PZO A;  3HL9 A;  1ERM A;  3BLM A;  1HVB A;  4LEN A;  4OP8 A;  2V20 A;  3WS4 A;  5TR7 A;  3DWZ A;  4GNU A;  4QD4 A;  1WE4 A;  4GZB A;  4K0W A;  1YLJ A;  2Y4A A;  5E2G A;  5CTN A;  4KG5 A;  1W5D A;  3ZG9 B;  3PBS A;  4N1H A;  4PM5 A;  2ZC7 A;  3IXH A;  4PMA A;  4N9K A;  5DF8 A;  4ZJ1 A;  1LI9 A;  4DE1 A;  4LV2 A;  3VOY A;  2IWC A;  2JCH A;  2WGW B;  3DW0 A;  3HLG A;  5F1G A;  5CEB A;  1LL5 A;  1K57 C;  1W79 A;  4OVD A;  1GCE A;  1YLW A;  2V2F F;  1J9M A;  2OLU A;  4E6X A;  3LEZ A;  3LO7 A;  4WMC D;  1M40 A;  4E3L A;  3ZDJ A;  3GMW A;  3BFE A;  1ESU A;  1K54 C;  5FA7 A;  4FSF A;  1YLP A;  2EFU A;  1K55 C;  2WKI A;  5EVI D;  3V3R A;  2ZC6 B;  4U0T A;  1I2W A;  1PI5 A;  3WS0 A;  4X55 A;  3ZVT A;  2HDS A;  2V1Z A;  1NY0 A;  1PW8 A;  3IXB A;  4DDY A;  4UHU A;  5HW3 A;  2ZQ9 A;  4S2P A;  3HLW A;  3GSG A;  4JLF A;  2ZMA A;  1KE3 A;  1E25 A;  1NJ4 A;  2HP9 A;  3OPR A;  3Q07 A;  4OQ0 A;  3MBZ A;  5CGX A;  3V39 A;  4RX3 A;  1HZO A;  4GD6 A;  5DTT A;  1MXO A;  3GR2 A;  3G32 A;  5AQ9 A;  2EX8 A;  4QY6 A;  5EVI C;  5CHJ A;  1ES3 A;  3WWX A;  1E3U D;  5DF7 A;  4QHC A;  3ZGA B;  3NC8 A;  4KQR A;  4OOL A;  2H10 A;  4ID4 A;  2HDQ A;  5HAR A;  5I94 A;  5TFQ A;  1CK3 A;  4NK3 A;  2Y2Q A;  4N1X A;  1NYM A;  3A3E A;  3O87 A;  1DY6 A;  1JTG A;  1PYY A;  4JF4 A;  5F1F A;  3V5M A;  5E2H A;  5KSH A;  1GHI A;  3I7J A;  3ZNY A;  3UY6 A;  1G68 A;  4CJN A;  4YFM A;  1JWZ A;  1QME A;  4JPM A;  4Y0T A;  4PM6 A;  3TOI A;  3UE3 A;  2DRW A;  4MNR A;  2OLV A;  4OOM A;  1BUE A;  1MKI A;  4QB8 A;  3HLE A;  2Y2L A;  4BD1 A;  5EOE A;  4BQM A;  5KSC A;  1YLZ A;  4P87 A;  2RCX A;  1S0W A;  4S2L A;  3FYZ A;  4WM9 A;  1FOF A;  5DF9 A;  1LHY A;  3V3S A;  3P09 A;  4XUX A;  3UNW A;  3WRZ A;  3IXD A;  3CG5 A;  4XUZ A;  3WS5 A;  2QZ6 A;  4BL2 A;  2ZQA A;  1GA9 A;  1NYY A;  2Y2I A;  2C6W B;  4FH4 A;  1IEM A;  3PAE A;  4LV1 A;  1RGZ A;  1C3B A;  4U0X A;  4X69 A;  1DJA A;  5CHU A;  4JBF A;  4U3T A;  3MKF A;  2ZC4 B;  3NI9 A;  3PBT A;  4JXS A;  4S2J A;  1KE0 A;  1Q2Q A;  3P98 A;  4OQH A;  2EX6 A;  3LY3 A;  3WS1 A;  1EI5 A;  2Y2M A;  4KQO A;  5GHZ A;  5GHY A;  2B5R A;  4P6B A;  2CC1 A;  3HUM A;  4DXB A;  1E4D A;  3G34 A;  3UDI A;  2H0Y A;  2WZZ A;  2ZJ9 A;  1GA0 A;  3D4F A;  5GLA A;  5A93 A;  1NZU A;  3ZCZ A;  3GRJ A;  5CGW A;  3PBN A;  5F83 A;  5J8X A;  4C6Y A;  3SOI A;  3UDX A;  3Q81 A;  5FQI A;  5FAQ A;  5JYP A;  1KDW A;  1W8Q A;  3FKW A;  3RXW A;  5FAT A;  5U47 A;  1KDS A;  1BUL A;  1K6S A;  2Y2P A;  4QU3 A;  3UPP A;  5A90 A;  2XF3 A;  3DWK A;  3EQV A;  2XGN A;  4DE0 A;  1W8Y A;  1BLH A;  3IHB A;  4Z9Q A;  3GV9 A;  4OPR A;  1Z6F A;  3MKE A;  1YLY A;  4ZTK A;  4N92 A;  1XA1 A;  4JKT A;  5EVL A;  5FAO A;  4EBN A;  5HAQ A;  1PWC A;  1XP4 A;  1KVM A;  1TDG A;  2BG1 A;  2P9V A;  3QNB A;  5CRF A;  3N8S A;  5M19 A;  1I2S A;  2E8I A;  5E2F A;  4RYE A;  4KZ8 A;  3AGE A;  2G2W A;  1XXM A;  3N7W A;  4KZ9 A;  1WYC A;  4E6W A;  1CI9 A;  3IHA A;  3G2Z A;  2EXA A;  3NY4 A;  2HDU A;  3E2K A;  3HVF A;  2XFT A;  4L0L A;  5EUA A;  2J7V A;  1FR1 A;  1PIO A;  4GDB A;  3G4P A;  4GN2 A;  3S4X A;  1ERO A;  3Q7V A;  4KZ3 A;  4E3N A;  4R3J A;  1H5X A;  2Q9N A;  3FZC A;  4BL3 A;  3BLS A;  1PWD A;  3IF6 B;  4KEN B;  3OZH A;  1VQQ A;  1O07 A;  3HLF A;  3Q82 A;  4WYY A;  2XK1 A;  4X56 A;  4OLG A;  4IBX A;  2EXB A;  3G30 A;  4R4S A;  3O88 A;  3ZHH A;  1PW1 A;  4ZAM A;  4DXC A;  3CMZ A;  1JWV A;  3MZD A;  4FCF A;  3Q7Z A;  4B88 A;  1L0D A;  4UA7 A;  1ES4 A;  4P85 A;  1SHV A;  1L0E A;  3VP0 A;  1N4O A;  3OC2 A;  1XA7 A;  5FAS A;  2WKH A;  4OKP A;  4FH2 A;  5CXW A;  1JVJ A;  3A3F A;  2Y2O A;  5JYO A;  5FQ9 A;  1Y54 A;  3PBO A;  5IHV A;  2XD1 A;  1KGG A;  4OON A;  1IYP A;  4M3K A;  3M2K A;  3FKV A;  3NIA A;  5DTK A;  1CEG A;  3SS4 A;  2PBY A;  3N6I A;  1XPB A;  2J9P A;  2ZLY A;  4N9L A;  2EFX A;  2FFY A;  3EQU A;  4ZJ2 A;  3BEB A;  3C4P A;  3HUN A;  4KZA A;  1ZG4 A;  1TEM A;  1N9B A;  4OP5 A;  4R23 A;  3W4O A;  3UE1 A;  2XEP A;  1W7F A;  4S2I A;  1ZC2 A;  3NDE A;  4RVA A;  1RCJ A;  4HBT A;  2DCF A;  3PBQ A;  4LCM A;  4Y0O A;  2A3U A;  1LI0 A;  1K38 A;  4NET A;  2PU2 A;  2WK0 A;  3VP1 A;  4MBH A;  2WAF A;  2Y59 A;  4MEZ A;  2BLS A;  2EX2 A;  3Q7V B;  2WUQ A;  2OSU A;  3BYD A;  4R4R A;  4WZ5 C;  4Y0U A;  1GHP A;  2R9X A;  3M6B A;  5GL9 A;  3IWO A;  4WMC A;  1RGY A;  3VP3 A;  2XLN A;  3SH9 A;  4EV4 A;  2J8Y A;  5HFO A;  1HTZ A;  4OH0 A;  1ONH A;  1XGI A;  5EVI A;  3VSK A;  4P0M A;  3O86 A;  3SS3 A;  4EWF A;  1FSW A;  3N8R A;  1QMF A;  2OV5 A;  1XX2 A;  1PI4 A;  4HEF A;  4IBR A;  1SDN A;  3A3J A;  2ZD8 A;  1FSY A;  4S2O A;  4BD0 A;  1PZP A;  3C7U A;  1K25 A;  3IF6 C;  4HBU A;  2ZM0 A;  2IWB A;  4KZ5 A;  1L0F A;  5BOH A;  1WYB A;  3BRM A;  4S2N C;  1ZG6 A;  5CEC A;  4S2K A;  3VP4 A;  4WEK A;  3BFF A;  5FQK A;  1HD8 A;  3UN7 A;  2H0T A;  1I5Q A;  4ZBE A;  4R3B A;  2J9O A;  4CPK A;  1E3U A;  2HP5 A;  1M6K A;  2A49 A;  3HUO A;  1MBL A;  1YMX A;  4ZDX A;  5L2F A;  4UAA A;  5CER A;  1BT5 A;  3CJM A;  2PU4 A;  5AQ7 A;  5CED A;  3MZF A;  1ERQ A;  1U60 A;  5M1A A;  3CZD A;  1K6R A;  3G31 A;  4D2O A;  3W8K A;  1BLS A;  1DJC A;  4RX2 A;  4MBF A;  2I72 A;  3ZG7 B;  1S6R A;  3VP2 A;  1IKG A;  3SS5 A;  3MXS A;  4UA6 A;  2Y2G A;  3VFH A;  3QHY A;  1Q2P A;  3TSG A;  3A3I A;  3ZG8 B;  4KG2 A;  2Y2J A;  1ZKJ A;  4IVI A;  5GLB A;  1DJB A;  3SH7 A;  2Z2L B;  3IT9 A;  4OLD A;  3VFF A;  5DVA A;  3C4O A;  3HLD A;  3M2J A;  3N4I A;  3HLC A;  5F82 A;  1NXY A;  4HES A;  1MWU A;  1XKZ A;  5HX9 A;  3ZNT A;  3C5A A;  3HBR A;  3JYI A;  4GOG A;  1K4E A;  4C3Q A;  1K56 A;  3UE0 A;  2QPN A;  4DE3 A;  1FCM A;  1BZA A;  1VM1 A;  1YMS A;  3IXG A;  2WZX A;  3AGF A;  1MPL A;  3IQA A;  1LLB A;  4H8R A;  5KZH A;  4EQI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...