4DDSA

Ctx-m-9 class a beta-lactamase complexed with compound 11
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
260
structure length
260
Chain Sequence
AVQQKLAALEKSSGGRLGVALIDTADNTQVLYRGDERFPMCSTSKVMAAAAVLKQSETQKQLLNQPVEIKPADLVNYNPIAEKHVNGTMTLAELSAAALQYSDNTAMNKLIAQLGGPGGVTAFARAIGDETFRLDRTEPTLNTAIPGDPRDTTTPRAMAQTLRQLTLGHALGETQRAQLVTWLKGNTTGAASIRAGLPTSWTAGDKTGSGDYGTTNDIAVIWPQGRAPLVLVTYFTQPQQNAESRRDVLASAARIIAEGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Beta-lactamase
publication title Structure-Based Design of Potent and Ligand-Efficient Inhibitors of CTX-M Class A Beta-Lactamase
pubmed doi rcsb
source organism Escherichia coli
total genus 95
structure length 260
sequence length 260
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2012-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4ddsA00
3MZEA 2Y2IA 4OOYA 1NJ4A 5G18A 3HLWA 1E4DA 4GDBA 1YM1A 3QNBA 3FWLA 3IWIA 3ISGA 3A3JA 4BENA 1MWTA 3IWQA 4PPRA 5M19A 4N1HA 1YLPA 4DDYA 1CEGA 4UA6A 3MFDA 1M6KA 5EVLA 1FOFA 1N9BA 4WM9A 1ZC2A 4K91A 1MY8A 1ONHA 3IF6A 5CXWA 3UDFA 3UDXA 3V5MA 1KGEA 4KENB 1FSYA 1FCNA 1YLTA 1AXBA 4KZBA 5AQ9A 2Y2PA 2BG1A 3DWKA 3M2KA 1BLCA 1K55A 4FH4A 4MBKA 4OQGA 4D2OA 4EBPA 2B5RA 1KVMA 3C4OA 3ZFZA 2EX9A 5DF7A 1O07A 1O7EA 1BZAA 2HP5A 2E8IA 4U3TA 3ZCZA 3UDIA 5FI2A 3HLCA 1GCEA 1S6RA 3OPPA 2OV5A 4WMCA 1Y54A 5FAPA 4WELA 1MWRA 3IHAA 2PU4A 5AQ7A 4QB8A 1J9MA 3QNCA 5GLAA 1LHYA 2ZC4B 4JPMA 4OVDA 4OP8A 2WYXA 5FQQA 4PM5A 5DVAA 3NI9A 3CJMA 3BFDA 1GA9A 3MXSA 2H0YA 2JC7A 2Y91A 2XF3A 5E2GA 4O7DA 2WAEA 2EXAA 4OPQA 2ZC3B 5HAPA 1DJAA 5EE8A 3DWZA 2G2WA 4IBXA 3O3VA 2IWCA 3VMAA 1K57C 4IBRA 3Q82A 4MBFA 4B4ZA 4KZAA 1L2SA 2WGVA 5CTMA 4BD1A 4N1XA 1SKFA 3PBRA 4DRTA 5FQJA 5JYOA 2QPNA 1SCWA 2XK1A 4WMCD 4U0TA 1WYBA 3GRJA 3MKEA 2XD5A 1IKGA 3UN7A 2RCXA 1JWVA 3IT9A 5AQBA 2EXBA 3IQAA 5F82A 1XA7A 3GVBA 3BFGA 4FD8A 4RA7A 3FYZA 3IH9A 5D3OA 2ZC6B 3FZCA 4OLDA 1XX2A 3MKFA 1XGIA 4KZ7A 5GHXA 3GTCA 4HBTA 2XEPA 4LCLA 2V1ZA 3S4XA 1CEFA 1KDWA 1YMXA 1ZG6A 3W4QA 4DE1A 5HL1A 3GMWA 2EX2A 4X55A 4UA7A 4KG5A 2WADA 1I5QA 3PBQA 1ERQA 4S2PA 4XUXA 5M1AA 4Q8IA 1HZOA 1KVLA 3WS4A 4DE0A 3BLMA 4DE2A 2X01A 4DKIA 3SOIA 3C4PA 3WS0A 4DXBA 1PZOA 1TDGA 2EX8A 2HDSA 3NC8A 4OP5A 3LEZA 4QD4A 4E3KA 1W7FA 4X6TA 2J9OA 3S22A 4GOGA 3MZDA 2R9WA 1KGFA 1PWCA 4OPZA 3VOYA 4LENA 4HEFA 2Z2LB 1W79A 3W4OA 1E25A 1K56D 4BD0A 2C6WB 4KZ4A 4CJNA 3VP0A 3Q7VA 3UY6A 2Y2QA 3QHYA 3FKVA 5DTKA 3UNWA 3SH8A 1ALQA 1M40A 1XP4A 4KQQA 5EOEA 5EUAA 5M18A 3AGDA 1IELA 4R0QA 2ZJ9A 3HREA 1NRFA 5KMWA 1NZUA 4KQOA 2XH9A 1TEMA 3NBLA 4DE3A 1PI5A 1K57A 3BFCA 2OLUA 4UA9A 4MEZA 4ID4A 3BFEA 4WZ4A 4DXCA 1YLZA 2Z2MB 2ZM8A 1Q2PA 4C6YA 1ES2A 4OQ0A 5CHMA 4P0MA 5CHJA 1DY6A 2R9XA 4JKTA 5JYPA 5EVIB 4F94A 4OKPA 1HVBA 3OCNA 1LI9A 2QZ6A 4PM9A 1YQSA 3MXRA 2Y55A 1XA1A 1ES4A 2ZQCA 4KZ9A 1Q2QA 4LV3A 3VOZA 5CEDA 2X71A 4N9KA 2XGNA 5CRFA 3HLGA 3ZVTA 4S2NC 2Y2KA 1FR1A 4MNRA 3IXGA 4PM8A 3CG5A 1QMEA 2XLNA 2Y4AA 3FV7A 3UE1A 4JXVA 4Y0UA 3V3SA 1PI4A 5FQMA 5A92A 4S2KA 5GHYA 5HARA 3ZG8B 4YFMA 2EX6A 1L0DA 4QY5A 4S2LA 1FCOA 2UWXA 3BM6A 5I94A 3WRTA 2WUQA 4RX3A 4OH0A 5FDHA 4R1GA 3NDEA 3E2KA 1IEMA 1W5DA 3UPPA 2ZC7A 5DF8A 3LCEA 4OPRA 5F1FA 1ESIA 4UHUA 5IHVA 1FQGA 4ZAMA 3AGEA 4X53A 1ES3A 3HL9A 4JBFA 3RXWA 1BTLA 5E2EA 4FCFA 1E3UA 1IYSA 1KDSA 3S1YA 5A90A 1RGYA 1BT5A 3DW0A 4R4RA 1JVJA 3ZGAB 1MWSA 2FFFB 2ZQ9A 3ZDJA 3IXBA 3G34A 2Q9NA 3WS5A 1PWGA 3VSKA 4E3NA 2Y2HA 3G32A 4N9LA 1PW8A 1H8YA 5DF9A 5FATA 4GD8A 4C3QA 1C3BA 3IXDA 1K25A 4GN2A 4FSFA 1L0GA 3BYDA 3HLBA 5FI6A 3ZG7B 4GD6A 1CI9A 1I2SA 5EVIC 3PBTA 1U60A 4E3MA 3NY4A 4U0XA 1WYCA 1GHPA 3OPLA 4P85A 4YINA 4Y0OA 1K4EA 2P9VB 3VSLA 2C5WB 1S0WA 1RGZA 3HUNA 1E3UD 2XFTA 5FQ9A 4JXSA 1XPBA 4L0LA 5CTNA 4EV4A 3BRMA 1K6RA 2X02A 3BEBA 5FA7A 3Q07A 3GV9A 4DDSA 1XKZA 4HBUA 1K56A 3BFFA 1EROA 3VFFA 2Y2MA 4LCMA 2CC1A 4S2NA 1H5XA 2Y2OA 1NY0A 5HX9A 1K54C 3HLDA 1ERMA 1SDEA 3CZDA 4GB7A 5F1GA 4ZDXA 5CERA 3MBZA 2Y2NA 1TDLA 2WKEA 5HFOA 1K38A 3EQVA 5GLCA 3ITAA 1LL5A 2QMIA 4HESA 2A3UA 2FFYA 3UO9A 4XUZA 4WYYA 1IYPA 3PBSA 3TSGA 3ZNYA 1PW1A 4LV0A 4Z9QA 4FH2A 1PIOA 1IYOA 4JXGA 5CHUA 3C7VA 1LLBA 3WS2A 5A93A 3V50A 3ZG5A 5CEBA 1NYYA 3HUMA 3N8SA 2P74A 1YLYA 1IKIA 3HVFA 3NDGA 3V39A 4BQMA 3E2LA 3ZNTA 4E3JA 5CGXA 4S2JA 4WEKA 1LL9A 4R4SA 1L0EA 2DRWA 3Q1FA 4OOLA 3IH8A 5EOOA 1QMFA 2HDQA 3VP4A 2ZQ7A 2H10A 4GKUA 5KSCA 1HD8A 4Y0TA 3BECA 3IF5A 5GLDA 4GNUA 2IWBA 5DTTA 1IYQA 3NIAA 2EFXA 3PBNA 1XGJA 5TGFA 3VP2A 4R3JA 2Y2LA 3ZG0A 1ZG4A 3HLEA 2WGWB 3D4FA 1CK3A 4S2MA 5FSRA 3VFHA 1FSWA 5EVIA 2ZQDA 1BLHA 3N7WA 3SS3A 2HDRA 2Q9MA 4E6XA 1PZPA 2WKHA 5GLBA 2V20A 5KZHA 4E3OA 4ZTKA 4GDNA 4KZ5A 3JYIA 3BLSA 3N4IA 3M6HA 2ZLYA 3PTEA 4Y7PA 5E43A 1GA0A 1BLPA 2WK0A 3UPOA 4X56A 5FAOA 4P87A 4M3KA 3G2ZA 1BULA 1YLJA 2V2FF 3TOIA 3MZFA 2I72A 2DCFA 1K54A 5E2FA 4ZJ3A 4OQHA 2OSUA 4H8RA 3GSGA 3ZHHA 3ZG9B 1NZOA 3CMZA 3GQZA 5EVID 2XD1A 4ZBEA 4BL2A 2H0TA 3G2YA 1KE4A 2HPBA 3WWXA 2DNSA 1YLWA 5A91A 3A3EA 1SHVA 4P6BA 4EBLA 4OQIA 1XXMA 1TVFA 1BUEA 1H8ZA 3M6BA 1W8QA 2VGKA 1MWUA 3G30A 3WRZA 1FCMA 4EQIA 1ES5A 2ZQ8A 4JLFA 5CGSA 3VP1A 3G31A 4X68A 3ZVWA 1YMSA 3P98A 4RYEA 5L2FA 1Z6FA 4C75A 1DJCA 5J8XA 3G35A 2WZXA 4WZ5C 3IF6B 2HDUA 3V3RA 2ZM2A 3RJUA 3HUOA 2ZD8A 5FQIA 2XQZA 4DF6A 1PYYA 4XXRA 2HP6A 4QU3A 3O86A 3PAGA 2Y2JA 3P09A 2JCHA 2H5SA 2GDNA 3A3IA 4OLGA 4QHCA 4R23A 4WBGA 4QJGA 4A5RA 2G2UA 2P9VA 3IXHA 1RP5A 1N4OA 3SH9A 4ZJ2A 3A3FA 1DJBA 3OZHA 3PAEA 1CI8A 4IVIA 1SDNA 2WZZA 3HLFA 3EQUA 1K6SA 1JWPA 5FAQA 4KZ6A 3OC2A 5AQAA 1VQQA 1NXYA 2XR0A 1MXOA 1OMEA 1VM1A 4RVAA 4JF6A 4ZJ1A 4BJPA 2ZM0A 1K4FA 3FKWA 4KZ3A 4PM6A 3UE0A 3M2JA 2WGIA 3N6IA 5TFQA 1MBLA 1ONGA 2VGJA 4MBHA 3VP3A 1G68A 5FASA 4BLMA 5E2HA 2IWDA 1ZKJA 3OPHA 3ITBA 1PWDA 1MKIA 5F83A 3IHBA 1BSGA 1EWZA 3GR2A 4OPYA 3SS4A 2J7VA 4OOMA 3UE3A 3OPRA 4LV2A 1JWZA 2WAFA 4JXWA 3W4PA 3RXXA 5KSHA 2PBYA 2A49A 3NCKA 1KGGA 4E3LA 4NK3A 1G6AA 4EBNA 2BLSA 2ZMAA 3IWOA 4BL3A 4B4XA 5CECA 1GHIA 3IF6C 4CPKA 4R3BA 5TR7A 4JF4A 3G4PA 3HBRA 2XDMA 1RCJA 4JF5A 4QY6A 4WEJA 4NETA 1JTDA 4E6WA 5FQKA 4EUZA 1K55C 1ESUA 3PBOA 4OONA 4PMAA 4WZ5A 3OCLA 1YT4A 3DTMA 2ZQAA 2RL3A 5GL9A 1LI0A 3SS5A 1W8YA 2WGWA 1BLSA 4KQRA 3A3DA 5BOHA 2XFSA 2J8YA 5GHZA 2J9PA 5U47A 3WS1A 4GZBA 4S2OA 2Y59A 2JE5A 3UPNA 4LV1A 5FI7A 4UAAA 1KE3A 1KE0A 5EECA 4KG6A 3Q7VB 5CGWA 4X69A 4K0XA 3W8KA 3C5AA 3Q7ZA 4K0WA 1WE4A 3LO7A 5HAIA 4KZ8A 1HTZA 4PM7A 3LY3A 3TG9A 5DTSA 5HW3A 3N8RA 3N8LA 3I7JA 3O88A 4KG2A 2EFUA 3B3XA 3AGFA 4MLLA 2JBFA 1GHMA 4B88A 4E3IA 1I2WA 3C7UA 2OLVA 2Y2GA 2ZC5B 3LY4A 3Q81A 4IEDA 4IVKA 1FR6A 4N92A 4S2IA 3SH7A 5HAQA 2PU2A 4EWFA 1L0FA 1NYMA 2WKIA 4RX2A 2HP9A 1JTGA 5EPHA 1EI5A 1MPLA 3O87A
chains in the Genus database with same CATH superfamily
3MZEA 3LIBA 4OOYA 1NJ4A 3A3JA 4BENA 3IWQA 5M19A 1YLPA 1X0OA 4UA6A 2OWJA 3B33A 1N9BA 4WM9A 1IOUA 2VEAA 4ZRRA 4HH2A 1FCNA 3D72A 1OT6A 2XA7S 2BG1A 3UB6A 1IFQA 2B5RA 3C4OA 2EX9A 1O7EA 3ZCZA 3HLCA 1GCEA 2GJ3A 3OPPA 5FAPA 4LPZA 5AQ7A 3QNCA 3EEAA 5A8BA 2H0YA 4EERA 3CUEA 2XF3A 2WAEA 2EXAA 4OPQA 4IBXA 3O3VA 4KZAA 1SKFA 1SCWA 3VE3A 1WYBA 1DP9A 1W63M 5AQBA 3IS2A 5F82A 3GVBA 4FD8A 2WKPA 4RA7A 3FYZA 1T19A 4OLDA 1XX2A 1XGIA 3KSFA 4HBTA 1KDWA 5I5LA 5HL1A 5M1AA 1ERQA 2O9CA 3NECA 4EXOA 3C4PA 3WS0A 3TE8A 1PZOA 3NC8A 5MC7A 4QD4A 1KGFA 3C30A 3NJAA 1L3LA 3R4KA 4P6ZM 3W4OA 4CJNA 3FG8A 3VP0A 4LGWA 2OAQ1 1ALQA 1M40A 5EUAA 4CLCA 2HF6A 1IELA 4R0QA 3HREA 1NRFA 3K2NA 4DE3A 3A0RA 1W63Q 2VV7A 1K57A 3BFCA 2OLUA 4UA9A 4MEZA 4WZ4A 3BFEA 1ES2A 1N9NA 3MQOA 3DTKA 2R9XA 5JYPA 4CLCE 4PM9A 1LI9A 5IT5A 3C38A 2Y55A 1XA1A 1ES4A 1Q2QA 4R70A 1MC0A 2GZAA 2XGNA 5CRFA 3ZVTA 4EUVA 1FR1A 1YSQA 3F1OB 3CG5A 3CAXA 3UE1A 1OTAA 5FQMA 3K3DA 2PR6A 4DMZA 4R3AA 4M4XA 4BBTA 4HJ6A 3WRTA 1IEMA 1W5DA 2O0YA 2ZC7A 1N9LA 1FQGA 4ZAMA 3AGEA 4X53A 2HV1A 3HJIA 4JBFA 3RXWA 5E2EA 1SKOB 2UV0E 1E3UA 1BT5A 2VKSA 1JVJA 3IBRA 3LIEA 2FFFB 3ZDJA 2V0UA 1H8YA 4GD8A 1C3BA 1K25A 4GN2A 1L0GA 3BYDA 4GD6A 1I2SA 5EVIC 3PBTA 5L8MA 1F2KA 3VSLA 1HLUP 1S0WA 1OTDA 3HUNA 2W27A 4EV4A 4JGPA 2VV6A 2CC1A 3IX4A 4NXFA 1PRQA 5HX9A 5F6AA 3S7OA 4ZDXA 3MBZA 2WKEA 3EQVA 4XUZA 3LI9A 1PW1A 1PIOA 1IYOA 4MN5A 4I5SA 3C7VA 5A93A 3V50A 5CEBA 3HUMA 4FTXA 3HVFA 3V39A 3ZNTA 4S2JA 4WEKA 2JKTI 5FDSA 4OOLA 3H7WB 3Q1FA 5DKKA 5EOOA 2B18A 5KSCA 4Y0TA 3T4LA 3PBNA 1OPXA 1CK3A 2ZQDA 3SS3A 2BASA 1V9YA 4MN6A 3U2AA 5KZHA 2PHYA 2A24B 4HNBA 5FAOA 4P87A 1YLJA 3MZFA 4H8RA 3CMZA 3GQZA 1XJ3A 3QP5A 4I3IA 2J3WA 3A3EA 4P6BA 4EBLA 1XXMA 1BUEA 3OLOA 3G30A 2VV8A 1FCMA 4EQIA 1G6OA 2EA9A 4X68A 4Y17A 3QP4A 1OTBA 1YMSA 3P98A 5L2FA 4HQAA 2J3TD 3G35A 2WZXA 2HDUA 3T12B 4DF6A 2XSSA 1S4RA 1NRJA 3T1QB 2H5SA 2GDNA 3A3IA 4R23A 4WBGA 4QJGA 2A2LA 2P9VA 1N4OA 4HP4A 2VJWA 2WZZA 3RFBA 4Q0JA 1VQQA 2XR0A 2FZ0A 4I3JA 4ZJ1A 3CPTA 1MBLA 1VEUA 4AFIA 1ZKJA 4BBVA 1BSGA 5EV0A 3SS4A 1OJ5A 2J7VA 1KOUA 3KSGA 3IS2B 4LRZE 5KSHA 2PBYA 4E3LA 2ZMAA 3MFXA 4CPKA 2OWHA 2HJ9C 3HBRA 2XDMA 4JF5A 4QY6A 1Y28A 1K55C 1ESUA 3PBOA 4IUKA 4WZ5A 3OCLA 1YT4A 3DTMA 2Y79A 3E4PA 4KQRA 5BOHA 4KUKA 5U47A 3WS1A 2OAP1 3UPNA 5K5BA 4D60A 4X69A 4B93A 1G28A 3W8KA 3Q7ZA 4X1LA 2PD8A 1T1AA 3MR0A 1LSXA 2XRNA 3DTIA 3N8RA 3N8LA 3O88A 5F68A 4CLCB 4B88A 4MLLA 1TS7A 2OLVA 2Y2GA 2W3EA 4EWFA 3PYPA 5EFWA 4JGOA 1JTGA 5EPHA 4JGQA 3CHWP 2KX6A 3IX8A 3FWLA 3ICYA 4L9GA 1MWTA 4PPRA 3TRCA 1M6KA 3E98A 4LFUA 3JVVA 1MY8A 3IF6A 4KENB 3KYQA 2Y2PA 4OQGA 3DWKA 3M2KA 4MBKA 4EBPA 2HP5A 2E8IA 4U3TA 3UDIA 2OV5A 1Y54A 4WELA 1GSVA 2PU4A 1J9MA 4EEPA 2O9AA 1N9OA 4OVDA 5FQQA 3NHQA 1GA9A 2ZC3B 4HOIA 5EE8A 2G2WA 3VMAA 1J3WA 4IBRA 3KSHA 2VX8A 4DRTA 5FQJA 2XK1A 4U0TA 1NLZA 4R6LA 1IKGA 3IT9A 1JWVA 3IQAA 2NUPC 3S7NA 1VETB 3D3OA 3GTCA 3V67A 2XEPA 4LCLA 2V1ZA 3W4QA 4DE1A 4WLAA 4KG5A 2WADA 3TW8A 4XUXA 1KVLA 4YWZA 4DE0A 3BLMA 4IJGA 4DKIA 1TDGA 2JHEA 3LEZA 3JVUA 5EVEA 4X6TA 3S22A 1F98A 4GOGA 2GNXA 1S1ZA 4HEFA 5DJUA 2C6WB 4RQ9A 3Q7VA 3OBFA 3C8CA 5EOEA 3MQQA 3AGDA 3D9YA 4NEED 4KQOA 4L9EA 1TEMA 4HY8A 1PI5A 1S4SA 1CJFA 4ID4A 4DXCA 2Z2MB 1Q2PA 1GSWA 4OQ0A 1DY6A 3BY9A 4JKTA 2W3FA 3MXRA 2ZQCA 1P9RA 4WN5A 4N9KA 1QMEA 2Y4AA 3LGOA 2M7UA 4S2KA 5HARA 2EX6A 1L0DA 4S2LA 1FCOA 3BY8A 3CWFA 2UWXA 5FL3A 5I94A 4RX3A 3UB5P 4OH0A 4MN7A 4R1GA 5FDHA 2PAVP 1STZA 5DF8A 4OPRA 3NULA 2WKRA 4ARZA 1ES3A 1IYSA 3S1YA 5A90A 3DW0A 1AWIA 3BW6A 1MWSA 3IXBA 3G34A 3WS5A 1PWGA 3G32A 5L09A 4FSFA 3ZG7B 3HLBA 4E3MA 3FPVA 4U0XA 1GHPA 3GDIA 2MJ6A 4YINA 4Y0OA 1K4EA 1YKDA 2P9VB 2C5WB 2INWA 3LIAA 1XPBA 3BRMA 2X02A 2HZ5A 4ETZA 1K56A 5HPIA 1EROA 5HD5A 2Y2MA 4LCMA 4S2NA 3CPTB 4EU0A 2Y2OA 3HLDA 3KYEA 1ERMA 1VEUB 2Y2NA 3MMHA 1LL5A 4HESA 2PD7A 1EW0A 5F69A 4I3AA 2ZOIA 5HPFA 3ZG5A 1YLYA 1IKIA 2L1MA 5CGXA 1F9IA 4Y3IA 1LL9A 4R4SA 1GSXA 2DRWA 3UMDA 2H10A 2Y8HA 4GNUA 3KSIA 1IYQA 3NIAA 2EFXA 5TGFA 3F1PA 4R3JA 3ZG0A 1ZG4A 3HLEA 3T4KA 3MXQA 5FSRA 1FSWA 4E04A 3P7NA 2V20A 4F3LB 4KZ5A 5HWTA 3M6HA 5E43A 5TBMB 4X56A 2V8CA 4M3KA 5EM1A 1BULA 2V2FF 2XROA 1K54A 5E2FA 3S7PA 4OQHA 3R7WA 3ZHHA 5EVID 2XD1A 4ZBEA 2H0TA 3G2YA 2Z6DA 2DNSA 2I9VA 4OQIA 3FPWA 3M6BA 1ZHHB 2Q0OA 1W8QA 4GLQA 1CF0A 1MWUA 3BQAA 2ZQ8A 4JLFA 3G31A 3ZVWA 4EEUA 3FC7A 1PFLA 4RYEA 1OTEA 1Z6FA 1DJCA 4YNRA 3IF6B 2ZM2A 3RJUA 3HUOA 3BWLA 5FQIA 2XQZA 1PYYA 3O86A 3PAGA 3T1XA 2Y2JA 3P09A 3VV4A 4A5RA 2G2UA 3IXHA 1RP5A 3A3FA 4YOFA 2FH5A 3OZHA 1CI8A 1UGUA 2KLIA 3CITA 1JWPA 3H82A 5AQAA 2B95A 2QWSA 5DJTA 3QP1A 1MXOA 3HJKA 3KX0X 3MJQA 2WGIA 3N6IA 5TFQA 1YSPA 1G68A 2M7VA 1A0KA 2IWDA 5F83A 5TJJA 3JPUA 3GR2A 4L9FA 3UE3A 4LV2A 1CQAA 4B9OA 3IBJA 1KGGA 3NOUC 4NK3A 4EBNA 2BLSA 1ODVA 4GW9A 4R38A 4R3BA 4JF4A 1H3QA 1JTDA 4EUZA 4WL9A 2ZQAA 1XJ2A 3F1NA 4Y15A 2J8YA 2J9PA 2M1CA 3QP2A 1KE3A 3Q7VB 3C5AA 4K0WA 2Z6CA 3CUEC 5HAIA 5HW3A 3T4JA 3I7JA 4KG2A 2JBFA 1GHMA 5C5KA 3C7UA 2ZC5B 3LY4A 4IEDA 3OOVA 2H28A 1FR6A 4IVKA 5HAQA 3VOLA 3T1SA 5HL6A 1DRMA 4RX2A 3MSHA 3O87A 4HHDA 3DBAA 5G18A 3HLWA 2KOIA 1YM1A 4CLCD 3ISGA 3IX3A 5EM0A 2EWWA 4DDYA 2PRFA 1FOFA 1ZC2A 3UDXA 1KGEA 1FSYA 4LLOB 1YLTA 1AXBA 2BTFP 4QWOA 1S66L 5AQ9A 1Y4OA 4FH4A 2PDRA 4D2OA 1KVMA 2E8JA 5DF7A 2JKRM 1BZAA 1XJ4A 1XFNA 3IHAA 2LB9A 5G4YA 4JPMA 4ARZB 4OP8A 4PM5A 4CLCC 1H8MA 5DFYA 3NI9A 2JC7A 3LR4A 4O7DA 3GECA 1FIKA 4O8GA 5HAPA 1K57C 3EOIA 3Q82A 4MBFA 1L2SA 5CTMA 3SW1A 5JYOA 2QPNA 4WMCD 4KUOA 3CI6A 3ZQ5A 2RCXA 2EXBA 1XA7A 2KDKA 3BFGA 3IH9A 1S67L 4ETXA 4HP9A 2W3DA 3S4XA 1CEFA 1YMXA 3GMWA 1I5QA 3PBQA 4S2PA 3LYXA 2OOLA 4DE2A 2X01A 4DXBA 3LR5A 2EX8A 2HDSA 4K08A 5L07A 4E3KA 3NOTC 2B02A 2R9WA 1PWCA 4OPZA 1T1CA 2ZMFA 3LI8A 4LENA 3VOYA 5J7EA 1E25A 4KZ4A 4H6JA 3UY6A 2J80A 3FKVA 5DTKA 3SH8A 1XP4A 4KQQA 2WKQA 1D06A 2JKRI 2ZJ9A 1NZUA 2XH9A 3NBLA 2HJEA 1YLZA 3F1PB 2VGLM 5CHMA 4P0MA 4F94A 5KIZA 2QZ6A 1YQSA 2CMNA 4QPRA 1WA9A 5CEDA 2X71A 3HLGA 2W1TA 2Y2KA 3UB9A 3IXGA 1DP8A 5FEFA 4FUWA 4JXVA 4Y0UA 2ZL1A 3T4TA 1PI4A 3L9KA 2VA0A 5A92A 5GHYA 3ZG8B 2W1RA 3R7WB 3CLOA 2WUQA 3NDEA 3UPPA 4HI4A 5F1FA 1ESIA 3HL9A 1KDSA 1RGYA 3ZGAB 2K2NA 2Q9NA 3VSKA 4E3NA 1PW8A 5FATA 4C3QA 1OJGA 1V9ZA 2VK3A 3IXDA 1VB6A 1CI9A 1U60A 3H9WA 3LR0A 5FQ9A 3H82B 3BEBA 5FA7A 3Q07A 4DDSA 4HBUA 3BFFA 3VFFA 1H5XA 1NY0A 1SDEA 4KQDA 3CZDA 2PR5A 5HFOA 1K38A 5GLCA 3LUQA 4II7A 3ITAA 4PHTA 2PBDP 3MF0A 2QMIA 2A3UA 2FFYA 3TSGA 3E0YA 4LV0A 4FH2A 4JXGA 4BWIA 1LLBA 3WS2A 2P74A 3NDGA 2PYRA 4BQMA 3E2LA 1L0EA 3VP4A 3IH8A 1QMFA 4HJ3A 2VGLS 2ZQ7A 4GKUA 4PKYA 3BECA 5GLDA 1PNEA 2IWBA 2JN7A 2Y2LA 3EGXC 3D4FA 4GHIA 3T50A 4EETB 5EVIA 3F1NB 1BLHA 3N7WA 4DJ2A 3KO6A 1PZPA 2A24A 4ZTKA 4GDNA 3JYIA 3BLSA 3N4IA 3PTEA 1GA0A 1BLPA 3G2ZA 4PAUA 4ZJ3A 2OSUA 4JGRA 5HDDA 3ZG9B 4WUJA 2V0WA 4GJ4A 5HDCA 4BL2A 1YLWA 5A91A 3LFVA 1H8ZA 4ESPA 4XT2A 2VGKA 1ES5A 5CGSA 5HDSA 5AVEA 4PKYG 5J8XA 4WZ5C 3UMEA 4OLGA 5J3WA 2K7SA 2IA2A 1NWZA 3EQUA 5FAQA 4KZ6A 3OC2A 1NXYA 1VM1A 4JF6A 4LRYC 4BJPA 4Q0HA 2QHKA 3UE0A 3M2JA 4NKPA 5CX7A 2VGJA 4BLMA 4O0PA 3ITBA 1PWDA 1MKIA 3IHBA 1T1BA 1JWZA 2WAFA 4JXWA 1Z09A 3W4PA 1TS0A 1ZTUA 3TJZC 4B4XA 5CECA 3IF6C 5J4EA 3G4PA 1RCJA 3EEHA 4WEJA 4NETA 4E6WA 2HGVA 3B42A 4OONA 2G7UA 2QYBA 4GS9A 4MDZA 2P08A 5HWVA 1W8YA 2WGWA 3MS6A 1BLSA 2XFSA 4EW7A 2R78A 2JE5A 2O9BA 4UAAA 3RH8B 5EECA 4KG6A 4H6JB 2VLGA 4K0XA 3K3CA 4IHQA 3LO7A 4EESA 1HTZA 4PM7A 3UB7A 1NLYA 2EFUA 3B3XA 1T18A 1I2WA 4N92A 4BMWA 3BJNA 2PYPA 1F5MA 1NYMA 2WKIA 2HP9A 1EI5A 3LIFA 2Y2IA 4UEYA 1E4DA 4GDBA 3QNBA 3IWIA 4DJ3A 3C2WA 1XJ6A 4N1HA 1CEGA 3MFDA 1UWPX 4Z1WA 5EVLA 4K91A 1ONHA 5CXWA 3V5MA 4DN0A 2P04A 3UDFA 2W1TB 1TF1A 4KZBA 1BLCA 1K55A 2JKTM 3PXPA 1P9WA 2ZL1B 3PHYA 3ZFZA 5FEGA 1O07A 3U4LP 2AVXA 5FI2A 1S6RA 3B47A 4WMCA 2L0WA 1MWRA 2VZWA 4QB8A 1LT0A 5GLAA 1D7EA 1LHYA 1MKMA 2ZC4B 2WYXA 5DVAA 3CJMA 3BFDA 4HJ4A 3MXSA 2Y91A 5E2GA 3VE4A 1DJAA 3DWZA 5LBRA 2IWCA 5L10A 4B4ZA 4BD1A 2WGVA 4N1XA 3PBRA 2W3GA 3DAVA 3GRJA 3MKEA 2XD5A 3UN7A 1VETA 3KYZA 1MZUA 5D3OA 2ZC6B 3FZCA 3T4SA 3MKFA 4KZ7A 5GHXA 3ULFA 4NG2A 4Q0IA 4UQIM 1ZG6A 2EX2A 4X55A 4UA7A 4Q8IA 1HZOA 3WS4A 3PR6A 1H0MA 3SOIA 2V1AA 4HIAA 4P6ZS 4OP5A 1LL8A 4Y2FA 1W7FA 1G5UA 2J9OA 1P97A 3MZDA 4ME4A 2W3HA 3LEQA 3UB8A 2Z2LB 1W79A 3G6OA 1K56D 4BD0A 2Y2QA 3QHYA 3UNWA 2V8FA 4IUHA 5M18A 1OTIA 5KMWA 4X25A 3RTYA 2YKHA 4I38A 2ZM8A 2K31A 4C6YA 5CHJA 4GHIB 5EVIB 1YPRA 1HVBA 3OCNA 4OKPA 4KZ9A 4LV3A 3VOZA 1TS8A 3EWKA 4WF0A 4S2NC 4X1MA 4MNRA 4PM8A 2XLNA 3FV7A 1XFQA 3V3SA 1LSVA 4YFMA 3A0SA 4QY5A 2L4RA 3BM6A 2EWVA 2YKFA 3E2KA 1D1JA 4LRXC 3LCEA 4UHUA 5IHVA 2D02A 4XT2B 2ZBBA 1BTLA 4FCFA 4R4RA 5F5YA 3T1RA 2ZQ9A 3EGDC 5IS1A 2Y2HA 4N9LA 2QKPA 5DF9A 1FILA 5FI6A 4MCWA 1UWNX 3NY4A 3DTEA 1WYCA 3OPLA 4P85A 4UQIS 1RGZA 1E3UD 2XFTA 1TD5A 4JXSA 4L0LA 1S1YA 5CTNA 1K6RA 3GV9A 1XKZA 5AJGA 3ZYTA 5HD3A 3BQ8A 4CQHA 2J3TC 4NXBA 1K54C 4GB7A 2D01A 5F1GA 4FOFA 2LB5A 5CERA 4G3VA 1TDLA 3UO9A 4WYYA 1IYPA 3PBSA 3ZNYA 4Z9QA 5DKLA 5CHUA 2JKGA 1NYYA 3N8SA 4E3JA 2HDQA 1HD8A 2O99A 3IF5A 5DTTA 3VP2A 1XGJA 4GS9B 3T4QA 2V9AA 2WGWB 4S2MA 3VFHA 3A0VA 4F3LA 2HDRA 2Q9MA 4E6XA 2WKHA 5GLBA 2W0NA 3S7QA 1ACFA 5TBMA 4E3OA 3O5YA 1LSWA 2ZLYA 4Y7PA 2WK0A 3F1OA 3UPOA 4I39A 1TS6A 4O01A 1VHMA 3TOIA 2I72A 2DCFA 3GSGA 1NZOA 4Y5FA 1KE4A 2HPBA 3WWXA 1SHVA 4G3WA 1TVFA 5HSQA 3WRZA 1SKOA 3VP1A 4Y13A 1K0KA 2JKFA 2ZOHA 4G3KA 4C75A 3MQ0A 3V3RA 3HCYA 2ZD8A 2NUTC 4XXRA 2HP6A 4QU3A 5HZHA 2JCHA 4QHCA 1OT9A 2XA7M 4EQ1A 4BBUA 2ACGA 3P01A 1SZVA 2QJ5A 4ZJ2A 1DJBA 3PAEA 3E4OA 4IVIA 3SH9A 1SDNA 3HLFA 1K6SA 3LR3A 3W2ZA 1OMEA 4RVAA 1YAXA 1BYWA 2ZM0A 1K4FA 3FKWA 4KZ3A 4PM6A 2GX5A 5HWWA 1ONGA 4MBHA 1P0ZA 3VP3A 5FASA 5E2HA 3OPHA 3LIDA 4NXGA 1EWZA 4OPYA 4OOMA 3OPRA 3RXXA 2A49A 3QP6A 3NCKA 3QP8A 1G6AA 4MMNA 3IWOA 4BL3A 1GHIA 3SZTA 5TR7A 4NXEA 3H7WA 5FQKA 4PMAA 3NOPC 2RL3A 5GL9A 1LI0A 3E4QA 3SS5A 3A3DA 4HH3A 3L7HA 5GHZA 4GZBA 4S2OA 5G4ZA 2Y59A 4LV1A 5FI7A 1KE0A 5CGWA 5DFXA 2DMWA 1WE4A 2V1BA 4KZ8A 3LY3A 3TG9A 5DTSA 4GCZA 2P7JA 2ZMVA 3UE6A 3AGFA 4E3IA 3Q81A 5IU1A 3SH7A 4S2IA 2QJ7A 2PU2A 3LICA 5AVFA 2PT7A 1L0FA 1DP6A 3T4OA 1MPLA 1JNUA
chains in the Genus database with same CATH topology
3MZEA 2Y2IA 4OOYA 1NJ4A 5G18A 3HLWA 1E4DA 4GDBA 1YM1A 3QNBA 3FWLA 3IWIA 3ISGA 3A3JA 4BENA 1MWTA 3IWQA 4PPRA 5M19A 4N1HA 1YLPA 4DDYA 1CEGA 4UA6A 3MFDA 1M6KA 5EVLA 1FOFA 1N9BA 4WM9A 1ZC2A 4K91A 1MY8A 1ONHA 3IF6A 5CXWA 3UDFA 3UDXA 3V5MA 1KGEA 4KENB 1FSYA 1FCNA 1YLTA 1AXBA 4KZBA 5AQ9A 2Y2PA 2BG1A 3DWKA 3M2KA 1BLCA 1K55A 4FH4A 4MBKA 4OQGA 4D2OA 4EBPA 2B5RA 1KVMA 3C4OA 3ZFZA 2EX9A 5DF7A 1O07A 1O7EA 1BZAA 2HP5A 2E8IA 4U3TA 3ZCZA 3UDIA 5FI2A 3HLCA 1GCEA 1S6RA 3OPPA 2OV5A 4WMCA 1Y54A 5FAPA 4WELA 1MWRA 3IHAA 2PU4A 5AQ7A 4QB8A 1J9MA 3QNCA 5GLAA 1LHYA 2ZC4B 4JPMA 4OVDA 4OP8A 2WYXA 5FQQA 4PM5A 5DVAA 3NI9A 3CJMA 3BFDA 1GA9A 3MXSA 2H0YA 2JC7A 2Y91A 2XF3A 5E2GA 4O7DA 2WAEA 2EXAA 4OPQA 2ZC3B 5HAPA 1DJAA 5EE8A 3DWZA 2G2WA 4IBXA 3O3VA 2IWCA 3VMAA 1K57C 4IBRA 3Q82A 4MBFA 4B4ZA 4KZAA 1L2SA 2WGVA 5CTMA 4BD1A 4N1XA 1SKFA 3PBRA 4DRTA 5FQJA 5JYOA 2QPNA 1SCWA 2XK1A 4WMCD 4U0TA 1WYBA 3GRJA 3MKEA 2XD5A 1IKGA 3UN7A 2RCXA 1JWVA 3IT9A 5AQBA 2EXBA 3IQAA 5F82A 1XA7A 3GVBA 3BFGA 4FD8A 4RA7A 3FYZA 3IH9A 5D3OA 2ZC6B 3FZCA 4OLDA 1XX2A 3MKFA 1XGIA 4KZ7A 5GHXA 3GTCA 4HBTA 2XEPA 4LCLA 2V1ZA 3S4XA 1CEFA 1KDWA 1YMXA 1ZG6A 3W4QA 4DE1A 5HL1A 3GMWA 2EX2A 4X55A 4UA7A 4KG5A 2WADA 1I5QA 3PBQA 1ERQA 4S2PA 4XUXA 5M1AA 4Q8IA 1HZOA 1KVLA 3WS4A 4DE0A 3BLMA 4DE2A 2X01A 4DKIA 3SOIA 3C4PA 3WS0A 4DXBA 1PZOA 1TDGA 2EX8A 2HDSA 3NC8A 4OP5A 3LEZA 4QD4A 4E3KA 1W7FA 4X6TA 2J9OA 3S22A 4GOGA 3MZDA 2R9WA 1KGFA 1PWCA 4OPZA 3VOYA 4LENA 4HEFA 2Z2LB 1W79A 3W4OA 1E25A 1K56D 4BD0A 2C6WB 4KZ4A 4CJNA 3VP0A 3Q7VA 3UY6A 2Y2QA 3QHYA 3FKVA 5DTKA 3UNWA 3SH8A 1ALQA 1M40A 1XP4A 4KQQA 5EOEA 5EUAA 5M18A 3AGDA 1IELA 4R0QA 2ZJ9A 3HREA 1NRFA 5KMWA 1NZUA 4KQOA 2XH9A 1TEMA 3NBLA 4DE3A 1PI5A 1K57A 3BFCA 2OLUA 4UA9A 4MEZA 4ID4A 3BFEA 4WZ4A 4DXCA 1YLZA 2Z2MB 2ZM8A 1Q2PA 4C6YA 1ES2A 4OQ0A 5CHMA 4P0MA 5CHJA 1DY6A 2R9XA 4JKTA 5JYPA 5EVIB 4F94A 4OKPA 1HVBA 3OCNA 1LI9A 2QZ6A 4PM9A 1YQSA 3MXRA 2Y55A 1XA1A 1ES4A 2ZQCA 4KZ9A 1Q2QA 4LV3A 3VOZA 5CEDA 2X71A 4N9KA 2XGNA 5CRFA 3HLGA 3ZVTA 4S2NC 2Y2KA 1FR1A 4MNRA 3IXGA 4PM8A 3CG5A 1QMEA 2XLNA 2Y4AA 3FV7A 3UE1A 4JXVA 4Y0UA 3V3SA 1PI4A 5FQMA 5A92A 4S2KA 5GHYA 5HARA 3ZG8B 4YFMA 2EX6A 1L0DA 4QY5A 4S2LA 1FCOA 2UWXA 3BM6A 5I94A 3WRTA 2WUQA 4RX3A 4OH0A 5FDHA 4R1GA 3NDEA 3E2KA 1IEMA 1W5DA 3UPPA 2ZC7A 5DF8A 3LCEA 4OPRA 5F1FA 1ESIA 4UHUA 5IHVA 1FQGA 4ZAMA 3AGEA 4X53A 1ES3A 3HL9A 4JBFA 3RXWA 1BTLA 5E2EA 4FCFA 1E3UA 1IYSA 1KDSA 3S1YA 5A90A 1RGYA 1BT5A 3DW0A 4R4RA 1JVJA 3ZGAB 1MWSA 2FFFB 2ZQ9A 3ZDJA 3IXBA 3G34A 2Q9NA 3WS5A 1PWGA 3VSKA 4E3NA 2Y2HA 3G32A 4N9LA 1PW8A 1H8YA 5DF9A 5FATA 4GD8A 4C3QA 1C3BA 3IXDA 1K25A 4GN2A 4FSFA 1L0GA 3BYDA 3HLBA 5FI6A 3ZG7B 4GD6A 1CI9A 1I2SA 5EVIC 3PBTA 1U60A 4E3MA 3NY4A 4U0XA 1WYCA 1GHPA 3OPLA 4P85A 4YINA 4Y0OA 1K4EA 2P9VB 3VSLA 2C5WB 1S0WA 1RGZA 3HUNA 1E3UD 2XFTA 5FQ9A 4JXSA 1XPBA 4L0LA 5CTNA 4EV4A 3BRMA 1K6RA 2X02A 3BEBA 5FA7A 3Q07A 3GV9A 4DDSA 1XKZA 4HBUA 1K56A 3BFFA 1EROA 3VFFA 2Y2MA 4LCMA 2CC1A 4S2NA 1H5XA 2Y2OA 1NY0A 5HX9A 1K54C 3HLDA 1ERMA 1SDEA 3CZDA 4GB7A 5F1GA 4ZDXA 5CERA 3MBZA 2Y2NA 1TDLA 2WKEA 5HFOA 1K38A 3EQVA 5GLCA 3ITAA 1LL5A 2QMIA 4HESA 2A3UA 2FFYA 3UO9A 4XUZA 4WYYA 1IYPA 3PBSA 3TSGA 3ZNYA 1PW1A 4LV0A 4Z9QA 4FH2A 1PIOA 1IYOA 4JXGA 5CHUA 3C7VA 1LLBA 3WS2A 5A93A 3V50A 3ZG5A 5CEBA 1NYYA 3HUMA 3N8SA 2P74A 1YLYA 1IKIA 3HVFA 3NDGA 3V39A 4BQMA 3E2LA 3ZNTA 4E3JA 5CGXA 4S2JA 4WEKA 1LL9A 4R4SA 1L0EA 2DRWA 3Q1FA 4OOLA 3IH8A 5EOOA 1QMFA 2HDQA 3VP4A 2ZQ7A 2H10A 4GKUA 5KSCA 1HD8A 4Y0TA 3BECA 3IF5A 5GLDA 4GNUA 2IWBA 5DTTA 1IYQA 3NIAA 2EFXA 3PBNA 1XGJA 5TGFA 3VP2A 4R3JA 2Y2LA 3ZG0A 1ZG4A 3HLEA 2WGWB 3D4FA 1CK3A 4S2MA 5FSRA 3VFHA 1FSWA 5EVIA 2ZQDA 1BLHA 3N7WA 3SS3A 2HDRA 2Q9MA 4E6XA 1PZPA 2WKHA 5GLBA 2V20A 5KZHA 4E3OA 4ZTKA 4GDNA 4KZ5A 3JYIA 3BLSA 3N4IA 3M6HA 2ZLYA 3PTEA 4Y7PA 5E43A 1GA0A 1BLPA 2WK0A 3UPOA 4X56A 5FAOA 4P87A 4M3KA 3G2ZA 1BULA 1YLJA 2V2FF 3TOIA 3MZFA 2I72A 2DCFA 1K54A 5E2FA 4ZJ3A 4OQHA 2OSUA 4H8RA 3GSGA 3ZHHA 3ZG9B 1NZOA 3CMZA 3GQZA 5EVID 2XD1A 4ZBEA 4BL2A 2H0TA 3G2YA 1KE4A 2HPBA 3WWXA 2DNSA 1YLWA 5A91A 3A3EA 1SHVA 4P6BA 4EBLA 4OQIA 1XXMA 1TVFA 1BUEA 1H8ZA 3M6BA 1W8QA 2VGKA 1MWUA 3G30A 3WRZA 1FCMA 4EQIA 1ES5A 2ZQ8A 4JLFA 5CGSA 3VP1A 3G31A 4X68A 3ZVWA 1YMSA 3P98A 4RYEA 5L2FA 1Z6FA 4C75A 1DJCA 5J8XA 3G35A 2WZXA 4WZ5C 3IF6B 2HDUA 3V3RA 2ZM2A 3RJUA 3HUOA 2ZD8A 5FQIA 2XQZA 4DF6A 1PYYA 4XXRA 2HP6A 4QU3A 3O86A 3PAGA 2Y2JA 3P09A 2JCHA 2H5SA 2GDNA 3A3IA 4OLGA 4QHCA 4R23A 4WBGA 4QJGA 4A5RA 2G2UA 2P9VA 3IXHA 1RP5A 1N4OA 3SH9A 4ZJ2A 3A3FA 1DJBA 3OZHA 3PAEA 1CI8A 4IVIA 1SDNA 2WZZA 3HLFA 3EQUA 1K6SA 1JWPA 5FAQA 4KZ6A 3OC2A 5AQAA 1VQQA 1NXYA 2XR0A 1MXOA 1OMEA 1VM1A 4RVAA 4JF6A 4ZJ1A 4BJPA 2ZM0A 1K4FA 3FKWA 4KZ3A 4PM6A 3UE0A 3M2JA 2WGIA 3N6IA 5TFQA 1MBLA 1ONGA 2VGJA 4MBHA 3VP3A 1G68A 5FASA 4BLMA 5E2HA 2IWDA 1ZKJA 3OPHA 3ITBA 1PWDA 1MKIA 5F83A 3IHBA 1BSGA 1EWZA 3GR2A 4OPYA 3SS4A 2J7VA 4OOMA 3UE3A 3OPRA 4LV2A 1JWZA 2WAFA 4JXWA 3W4PA 3RXXA 5KSHA 2PBYA 2A49A 3NCKA 1KGGA 4E3LA 4NK3A 1G6AA 4EBNA 2BLSA 2ZMAA 3IWOA 4BL3A 4B4XA 5CECA 1GHIA 3IF6C 4CPKA 4R3BA 5TR7A 4JF4A 3G4PA 3HBRA 2XDMA 1RCJA 4JF5A 4QY6A 4WEJA 4NETA 1JTDA 4E6WA 5FQKA 4EUZA 1K55C 1ESUA 3PBOA 4OONA 4PMAA 4WZ5A 3OCLA 1YT4A 3DTMA 2ZQAA 2RL3A 5GL9A 1LI0A 3SS5A 1W8YA 2WGWA 1BLSA 4KQRA 3A3DA 5BOHA 2XFSA 2J8YA 5GHZA 2J9PA 5U47A 3WS1A 4GZBA 4S2OA 2Y59A 2JE5A 3UPNA 4LV1A 5FI7A 4UAAA 1KE3A 1KE0A 5EECA 4KG6A 3Q7VB 5CGWA 4X69A 4K0XA 3W8KA 3C5AA 3Q7ZA 4K0WA 1WE4A 3LO7A 5HAIA 4KZ8A 1HTZA 4PM7A 3LY3A 3TG9A 5DTSA 5HW3A 3N8RA 3N8LA 3I7JA 3O88A 4KG2A 2EFUA 3B3XA 3AGFA 4MLLA 2JBFA 1GHMA 4B88A 4E3IA 1I2WA 3C7UA 2OLVA 2Y2GA 2ZC5B 3LY4A 3Q81A 4IEDA 4IVKA 1FR6A 4N92A 4S2IA 3SH7A 5HAQA 2PU2A 4EWFA 1L0FA 1NYMA 2WKIA 4RX2A 2HP9A 1JTGA 5EPHA 1EI5A 1MPLA 3O87A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MZE A;  2Y2I A;  4OOY A;  1NJ4 A;  5G18 A;  3HLW A;  1E4D A;  4GDB A;  1YM1 A;  3QNB A;  3FWL A;  3IWI A;  3ISG A;  3A3J A;  4BEN A;  1MWT A;  3IWQ A;  4PPR A;  5M19 A;  4N1H A;  1YLP A;  4DDY A;  1CEG A;  4UA6 A;  3MFD A;  1M6K A;  5EVL A;  1FOF A;  1N9B A;  4WM9 A;  1ZC2 A;  4K91 A;  1MY8 A;  1ONH A;  3IF6 A;  5CXW A;  3UDF A;  3UDX A;  3V5M A;  1KGE A;  4KEN B;  1FSY A;  1FCN A;  1YLT A;  1AXB A;  4KZB A;  5AQ9 A;  2Y2P A;  2BG1 A;  3DWK A;  3M2K A;  1BLC A;  1K55 A;  4FH4 A;  4MBK A;  4OQG A;  4D2O A;  4EBP A;  2B5R A;  1KVM A;  3C4O A;  3ZFZ A;  2EX9 A;  5DF7 A;  1O07 A;  1O7E A;  1BZA A;  2HP5 A;  2E8I A;  4U3T A;  3ZCZ A;  3UDI A;  5FI2 A;  3HLC A;  1GCE A;  1S6R A;  3OPP A;  2OV5 A;  4WMC A;  1Y54 A;  5FAP A;  4WEL A;  1MWR A;  3IHA A;  2PU4 A;  5AQ7 A;  4QB8 A;  1J9M A;  3QNC A;  5GLA A;  1LHY A;  2ZC4 B;  4JPM A;  4OVD A;  4OP8 A;  2WYX A;  5FQQ A;  4PM5 A;  5DVA A;  3NI9 A;  3CJM A;  3BFD A;  1GA9 A;  3MXS A;  2H0Y A;  2JC7 A;  2Y91 A;  2XF3 A;  5E2G A;  4O7D A;  2WAE A;  2EXA A;  4OPQ A;  2ZC3 B;  5HAP A;  1DJA A;  5EE8 A;  3DWZ A;  2G2W A;  4IBX A;  3O3V A;  2IWC A;  3VMA A;  1K57 C;  4IBR A;  3Q82 A;  4MBF A;  4B4Z A;  4KZA A;  1L2S A;  2WGV A;  5CTM A;  4BD1 A;  4N1X A;  1SKF A;  3PBR A;  4DRT A;  5FQJ A;  5JYO A;  2QPN A;  1SCW A;  2XK1 A;  4WMC D;  4U0T A;  1WYB A;  3GRJ A;  3MKE A;  2XD5 A;  1IKG A;  3UN7 A;  2RCX A;  1JWV A;  3IT9 A;  5AQB A;  2EXB A;  3IQA A;  5F82 A;  1XA7 A;  3GVB A;  3BFG A;  4FD8 A;  4RA7 A;  3FYZ A;  3IH9 A;  5D3O A;  2ZC6 B;  3FZC A;  4OLD A;  1XX2 A;  3MKF A;  1XGI A;  4KZ7 A;  5GHX A;  3GTC A;  4HBT A;  2XEP A;  4LCL A;  2V1Z A;  3S4X A;  1CEF A;  1KDW A;  1YMX A;  1ZG6 A;  3W4Q A;  4DE1 A;  5HL1 A;  3GMW A;  2EX2 A;  4X55 A;  4UA7 A;  4KG5 A;  2WAD A;  1I5Q A;  3PBQ A;  1ERQ A;  4S2P A;  4XUX A;  5M1A A;  4Q8I A;  1HZO A;  1KVL A;  3WS4 A;  4DE0 A;  3BLM A;  4DE2 A;  2X01 A;  4DKI A;  3SOI A;  3C4P A;  3WS0 A;  4DXB A;  1PZO A;  1TDG A;  2EX8 A;  2HDS A;  3NC8 A;  4OP5 A;  3LEZ A;  4QD4 A;  4E3K A;  1W7F A;  4X6T A;  2J9O A;  3S22 A;  4GOG A;  3MZD A;  2R9W A;  1KGF A;  1PWC A;  4OPZ A;  3VOY A;  4LEN A;  4HEF A;  2Z2L B;  1W79 A;  3W4O A;  1E25 A;  1K56 D;  4BD0 A;  2C6W B;  4KZ4 A;  4CJN A;  3VP0 A;  3Q7V A;  3UY6 A;  2Y2Q A;  3QHY A;  3FKV A;  5DTK A;  3UNW A;  3SH8 A;  1ALQ A;  1M40 A;  1XP4 A;  4KQQ A;  5EOE A;  5EUA A;  5M18 A;  3AGD A;  1IEL A;  4R0Q A;  2ZJ9 A;  3HRE A;  1NRF A;  5KMW A;  1NZU A;  4KQO A;  2XH9 A;  1TEM A;  3NBL A;  4DE3 A;  1PI5 A;  1K57 A;  3BFC A;  2OLU A;  4UA9 A;  4MEZ A;  4ID4 A;  3BFE A;  4WZ4 A;  4DXC A;  1YLZ A;  2Z2M B;  2ZM8 A;  1Q2P A;  4C6Y A;  1ES2 A;  4OQ0 A;  5CHM A;  4P0M A;  5CHJ A;  1DY6 A;  2R9X A;  4JKT A;  5JYP A;  5EVI B;  4F94 A;  4OKP A;  1HVB A;  3OCN A;  1LI9 A;  2QZ6 A;  4PM9 A;  1YQS A;  3MXR A;  2Y55 A;  1XA1 A;  1ES4 A;  2ZQC A;  4KZ9 A;  1Q2Q A;  4LV3 A;  3VOZ A;  5CED A;  2X71 A;  4N9K A;  2XGN A;  5CRF A;  3HLG A;  3ZVT A;  4S2N C;  2Y2K A;  1FR1 A;  4MNR A;  3IXG A;  4PM8 A;  3CG5 A;  1QME A;  2XLN A;  2Y4A A;  3FV7 A;  3UE1 A;  4JXV A;  4Y0U A;  3V3S A;  1PI4 A;  5FQM A;  5A92 A;  4S2K A;  5GHY A;  5HAR A;  3ZG8 B;  4YFM A;  2EX6 A;  1L0D A;  4QY5 A;  4S2L A;  1FCO A;  2UWX A;  3BM6 A;  5I94 A;  3WRT A;  2WUQ A;  4RX3 A;  4OH0 A;  5FDH A;  4R1G A;  3NDE A;  3E2K A;  1IEM A;  1W5D A;  3UPP A;  2ZC7 A;  5DF8 A;  3LCE A;  4OPR A;  5F1F A;  1ESI A;  4UHU A;  5IHV A;  1FQG A;  4ZAM A;  3AGE A;  4X53 A;  1ES3 A;  3HL9 A;  4JBF A;  3RXW A;  1BTL A;  5E2E A;  4FCF A;  1E3U A;  1IYS A;  1KDS A;  3S1Y A;  5A90 A;  1RGY A;  1BT5 A;  3DW0 A;  4R4R A;  1JVJ A;  3ZGA B;  1MWS A;  2FFF B;  2ZQ9 A;  3ZDJ A;  3IXB A;  3G34 A;  2Q9N A;  3WS5 A;  1PWG A;  3VSK A;  4E3N A;  2Y2H A;  3G32 A;  4N9L A;  1PW8 A;  1H8Y A;  5DF9 A;  5FAT A;  4GD8 A;  4C3Q A;  1C3B A;  3IXD A;  1K25 A;  4GN2 A;  4FSF A;  1L0G A;  3BYD A;  3HLB A;  5FI6 A;  3ZG7 B;  4GD6 A;  1CI9 A;  1I2S A;  5EVI C;  3PBT A;  1U60 A;  4E3M A;  3NY4 A;  4U0X A;  1WYC A;  1GHP A;  3OPL A;  4P85 A;  4YIN A;  4Y0O A;  1K4E A;  2P9V B;  3VSL A;  2C5W B;  1S0W A;  1RGZ A;  3HUN A;  1E3U D;  2XFT A;  5FQ9 A;  4JXS A;  1XPB A;  4L0L A;  5CTN A;  4EV4 A;  3BRM A;  1K6R A;  2X02 A;  3BEB A;  5FA7 A;  3Q07 A;  3GV9 A;  4DDS A;  1XKZ A;  4HBU A;  1K56 A;  3BFF A;  1ERO A;  3VFF A;  2Y2M A;  4LCM A;  2CC1 A;  4S2N A;  1H5X A;  2Y2O A;  1NY0 A;  5HX9 A;  1K54 C;  3HLD A;  1ERM A;  1SDE A;  3CZD A;  4GB7 A;  5F1G A;  4ZDX A;  5CER A;  3MBZ A;  2Y2N A;  1TDL A;  2WKE A;  5HFO A;  1K38 A;  3EQV A;  5GLC A;  3ITA A;  1LL5 A;  2QMI A;  4HES A;  2A3U A;  2FFY A;  3UO9 A;  4XUZ A;  4WYY A;  1IYP A;  3PBS A;  3TSG A;  3ZNY A;  1PW1 A;  4LV0 A;  4Z9Q A;  4FH2 A;  1PIO A;  1IYO A;  4JXG A;  5CHU A;  3C7V A;  1LLB A;  3WS2 A;  5A93 A;  3V50 A;  3ZG5 A;  5CEB A;  1NYY A;  3HUM A;  3N8S A;  2P74 A;  1YLY A;  1IKI A;  3HVF A;  3NDG A;  3V39 A;  4BQM A;  3E2L A;  3ZNT A;  4E3J A;  5CGX A;  4S2J A;  4WEK A;  1LL9 A;  4R4S A;  1L0E A;  2DRW A;  3Q1F A;  4OOL A;  3IH8 A;  5EOO A;  1QMF A;  2HDQ A;  3VP4 A;  2ZQ7 A;  2H10 A;  4GKU A;  5KSC A;  1HD8 A;  4Y0T A;  3BEC A;  3IF5 A;  5GLD A;  4GNU A;  2IWB A;  5DTT A;  1IYQ A;  3NIA A;  2EFX A;  3PBN A;  1XGJ A;  5TGF A;  3VP2 A;  4R3J A;  2Y2L A;  3ZG0 A;  1ZG4 A;  3HLE A;  2WGW B;  3D4F A;  1CK3 A;  4S2M A;  5FSR A;  3VFH A;  1FSW A;  5EVI A;  2ZQD A;  1BLH A;  3N7W A;  3SS3 A;  2HDR A;  2Q9M A;  4E6X A;  1PZP A;  2WKH A;  5GLB A;  2V20 A;  5KZH A;  4E3O A;  4ZTK A;  4GDN A;  4KZ5 A;  3JYI A;  3BLS A;  3N4I A;  3M6H A;  2ZLY A;  3PTE A;  4Y7P A;  5E43 A;  1GA0 A;  1BLP A;  2WK0 A;  3UPO A;  4X56 A;  5FAO A;  4P87 A;  4M3K A;  3G2Z A;  1BUL A;  1YLJ A;  2V2F F;  3TOI A;  3MZF A;  2I72 A;  2DCF A;  1K54 A;  5E2F A;  4ZJ3 A;  4OQH A;  2OSU A;  4H8R A;  3GSG A;  3ZHH A;  3ZG9 B;  1NZO A;  3CMZ A;  3GQZ A;  5EVI D;  2XD1 A;  4ZBE A;  4BL2 A;  2H0T A;  3G2Y A;  1KE4 A;  2HPB A;  3WWX A;  2DNS A;  1YLW A;  5A91 A;  3A3E A;  1SHV A;  4P6B A;  4EBL A;  4OQI A;  1XXM A;  1TVF A;  1BUE A;  1H8Z A;  3M6B A;  1W8Q A;  2VGK A;  1MWU A;  3G30 A;  3WRZ A;  1FCM A;  4EQI A;  1ES5 A;  2ZQ8 A;  4JLF A;  5CGS A;  3VP1 A;  3G31 A;  4X68 A;  3ZVW A;  1YMS A;  3P98 A;  4RYE A;  5L2F A;  1Z6F A;  4C75 A;  1DJC A;  5J8X A;  3G35 A;  2WZX A;  4WZ5 C;  3IF6 B;  2HDU A;  3V3R A;  2ZM2 A;  3RJU A;  3HUO A;  2ZD8 A;  5FQI A;  2XQZ A;  4DF6 A;  1PYY A;  4XXR A;  2HP6 A;  4QU3 A;  3O86 A;  3PAG A;  2Y2J A;  3P09 A;  2JCH A;  2H5S A;  2GDN A;  3A3I A;  4OLG A;  4QHC A;  4R23 A;  4WBG A;  4QJG A;  4A5R A;  2G2U A;  2P9V A;  3IXH A;  1RP5 A;  1N4O A;  3SH9 A;  4ZJ2 A;  3A3F A;  1DJB A;  3OZH A;  3PAE A;  1CI8 A;  4IVI A;  1SDN A;  2WZZ A;  3HLF A;  3EQU A;  1K6S A;  1JWP A;  5FAQ A;  4KZ6 A;  3OC2 A;  5AQA A;  1VQQ A;  1NXY A;  2XR0 A;  1MXO A;  1OME A;  1VM1 A;  4RVA A;  4JF6 A;  4ZJ1 A;  4BJP A;  2ZM0 A;  1K4F A;  3FKW A;  4KZ3 A;  4PM6 A;  3UE0 A;  3M2J A;  2WGI A;  3N6I A;  5TFQ A;  1MBL A;  1ONG A;  2VGJ A;  4MBH A;  3VP3 A;  1G68 A;  5FAS A;  4BLM A;  5E2H A;  2IWD A;  1ZKJ A;  3OPH A;  3ITB A;  1PWD A;  1MKI A;  5F83 A;  3IHB A;  1BSG A;  1EWZ A;  3GR2 A;  4OPY A;  3SS4 A;  2J7V A;  4OOM A;  3UE3 A;  3OPR A;  4LV2 A;  1JWZ A;  2WAF A;  4JXW A;  3W4P A;  3RXX A;  5KSH A;  2PBY A;  2A49 A;  3NCK A;  1KGG A;  4E3L A;  4NK3 A;  1G6A A;  4EBN A;  2BLS A;  2ZMA A;  3IWO A;  4BL3 A;  4B4X A;  5CEC A;  1GHI A;  3IF6 C;  4CPK A;  4R3B A;  5TR7 A;  4JF4 A;  3G4P A;  3HBR A;  2XDM A;  1RCJ A;  4JF5 A;  4QY6 A;  4WEJ A;  4NET A;  1JTD A;  4E6W A;  5FQK A;  4EUZ A;  1K55 C;  1ESU A;  3PBO A;  4OON A;  4PMA A;  4WZ5 A;  3OCL A;  1YT4 A;  3DTM A;  2ZQA A;  2RL3 A;  5GL9 A;  1LI0 A;  3SS5 A;  1W8Y A;  2WGW A;  1BLS A;  4KQR A;  3A3D A;  5BOH A;  2XFS A;  2J8Y A;  5GHZ A;  2J9P A;  5U47 A;  3WS1 A;  4GZB A;  4S2O A;  2Y59 A;  2JE5 A;  3UPN A;  4LV1 A;  5FI7 A;  4UAA A;  1KE3 A;  1KE0 A;  5EEC A;  4KG6 A;  3Q7V B;  5CGW A;  4X69 A;  4K0X A;  3W8K A;  3C5A A;  3Q7Z A;  4K0W A;  1WE4 A;  3LO7 A;  5HAI A;  4KZ8 A;  1HTZ A;  4PM7 A;  3LY3 A;  3TG9 A;  5DTS A;  5HW3 A;  3N8R A;  3N8L A;  3I7J A;  3O88 A;  4KG2 A;  2EFU A;  3B3X A;  3AGF A;  4MLL A;  2JBF A;  1GHM A;  4B88 A;  4E3I A;  1I2W A;  3C7U A;  2OLV A;  2Y2G A;  2ZC5 B;  3LY4 A;  3Q81 A;  4IED A;  4IVK A;  1FR6 A;  4N92 A;  4S2I A;  3SH7 A;  5HAQ A;  2PU2 A;  4EWF A;  1L0F A;  1NYM A;  2WKI A;  4RX2 A;  2HP9 A;  1JTG A;  5EPH A;  1EI5 A;  1MPL A;  3O87 A; 
#chains in the Genus database with same CATH topology
 3MZE A;  3LIB A;  4OOY A;  1NJ4 A;  3A3J A;  4BEN A;  3IWQ A;  5M19 A;  1YLP A;  1X0O A;  4UA6 A;  2OWJ A;  3B33 A;  1N9B A;  4WM9 A;  1IOU A;  2VEA A;  4ZRR A;  4HH2 A;  1FCN A;  3D72 A;  1OT6 A;  2XA7 S;  2BG1 A;  3UB6 A;  1IFQ A;  2B5R A;  3C4O A;  2EX9 A;  1O7E A;  3ZCZ A;  3HLC A;  1GCE A;  2GJ3 A;  3OPP A;  5FAP A;  4LPZ A;  5AQ7 A;  3QNC A;  3EEA A;  5A8B A;  2H0Y A;  4EER A;  3CUE A;  2XF3 A;  2WAE A;  2EXA A;  4OPQ A;  4IBX A;  3O3V A;  4KZA A;  1SKF A;  1SCW A;  3VE3 A;  1WYB A;  1DP9 A;  1W63 M;  5AQB A;  3IS2 A;  5F82 A;  3GVB A;  4FD8 A;  2WKP A;  4RA7 A;  3FYZ A;  1T19 A;  4OLD A;  1XX2 A;  1XGI A;  3KSF A;  4HBT A;  1KDW A;  5I5L A;  5HL1 A;  5M1A A;  1ERQ A;  2O9C A;  3NEC A;  4EXO A;  3C4P A;  3WS0 A;  3TE8 A;  1PZO A;  3NC8 A;  5MC7 A;  4QD4 A;  1KGF A;  3C30 A;  3NJA A;  1L3L A;  3R4K A;  4P6Z M;  3W4O A;  4CJN A;  3FG8 A;  3VP0 A;  4LGW A;  2OAQ 1;  1ALQ A;  1M40 A;  5EUA A;  4CLC A;  2HF6 A;  1IEL A;  4R0Q A;  3HRE A;  1NRF A;  3K2N A;  4DE3 A;  3A0R A;  1W63 Q;  2VV7 A;  1K57 A;  3BFC A;  2OLU A;  4UA9 A;  4MEZ A;  4WZ4 A;  3BFE A;  1ES2 A;  1N9N A;  3MQO A;  3DTK A;  2R9X A;  5JYP A;  4CLC E;  4PM9 A;  1LI9 A;  5IT5 A;  3C38 A;  2Y55 A;  1XA1 A;  1ES4 A;  1Q2Q A;  4R70 A;  1MC0 A;  2GZA A;  2XGN A;  5CRF A;  3ZVT A;  4EUV A;  1FR1 A;  1YSQ A;  3F1O B;  3CG5 A;  3CAX A;  3UE1 A;  1OTA A;  5FQM A;  3K3D A;  2PR6 A;  4DMZ A;  4R3A A;  4M4X A;  4BBT A;  4HJ6 A;  3WRT A;  1IEM A;  1W5D A;  2O0Y A;  2ZC7 A;  1N9L A;  1FQG A;  4ZAM A;  3AGE A;  4X53 A;  2HV1 A;  3HJI A;  4JBF A;  3RXW A;  5E2E A;  1SKO B;  2UV0 E;  1E3U A;  1BT5 A;  2VKS A;  1JVJ A;  3IBR A;  3LIE A;  2FFF B;  3ZDJ A;  2V0U A;  1H8Y A;  4GD8 A;  1C3B A;  1K25 A;  4GN2 A;  1L0G A;  3BYD A;  4GD6 A;  1I2S A;  5EVI C;  3PBT A;  5L8M A;  1F2K A;  3VSL A;  1HLU P;  1S0W A;  1OTD A;  3HUN A;  2W27 A;  4EV4 A;  4JGP A;  2VV6 A;  2CC1 A;  3IX4 A;  4NXF A;  1PRQ A;  5HX9 A;  5F6A A;  3S7O A;  4ZDX A;  3MBZ A;  2WKE A;  3EQV A;  4XUZ A;  3LI9 A;  1PW1 A;  1PIO A;  1IYO A;  4MN5 A;  4I5S A;  3C7V A;  5A93 A;  3V50 A;  5CEB A;  3HUM A;  4FTX A;  3HVF A;  3V39 A;  3ZNT A;  4S2J A;  4WEK A;  2JKT I;  5FDS A;  4OOL A;  3H7W B;  3Q1F A;  5DKK A;  5EOO A;  2B18 A;  5KSC A;  4Y0T A;  3T4L A;  3PBN A;  1OPX A;  1CK3 A;  2ZQD A;  3SS3 A;  2BAS A;  1V9Y A;  4MN6 A;  3U2A A;  5KZH A;  2PHY A;  2A24 B;  4HNB A;  5FAO A;  4P87 A;  1YLJ A;  3MZF A;  4H8R A;  3CMZ A;  3GQZ A;  1XJ3 A;  3QP5 A;  4I3I A;  2J3W A;  3A3E A;  4P6B A;  4EBL A;  1XXM A;  1BUE A;  3OLO A;  3G30 A;  2VV8 A;  1FCM A;  4EQI A;  1G6O A;  2EA9 A;  4X68 A;  4Y17 A;  3QP4 A;  1OTB A;  1YMS A;  3P98 A;  5L2F A;  4HQA A;  2J3T D;  3G35 A;  2WZX A;  2HDU A;  3T12 B;  4DF6 A;  2XSS A;  1S4R A;  1NRJ A;  3T1Q B;  2H5S A;  2GDN A;  3A3I A;  4R23 A;  4WBG A;  4QJG A;  2A2L A;  2P9V A;  1N4O A;  4HP4 A;  2VJW A;  2WZZ A;  3RFB A;  4Q0J A;  1VQQ A;  2XR0 A;  2FZ0 A;  4I3J A;  4ZJ1 A;  3CPT A;  1MBL A;  1VEU A;  4AFI A;  1ZKJ A;  4BBV A;  1BSG A;  5EV0 A;  3SS4 A;  1OJ5 A;  2J7V A;  1KOU A;  3KSG A;  3IS2 B;  4LRZ E;  5KSH A;  2PBY A;  4E3L A;  2ZMA A;  3MFX A;  4CPK A;  2OWH A;  2HJ9 C;  3HBR A;  2XDM A;  4JF5 A;  4QY6 A;  1Y28 A;  1K55 C;  1ESU A;  3PBO A;  4IUK A;  4WZ5 A;  3OCL A;  1YT4 A;  3DTM A;  2Y79 A;  3E4P A;  4KQR A;  5BOH A;  4KUK A;  5U47 A;  3WS1 A;  2OAP 1;  3UPN A;  5K5B A;  4D60 A;  4X69 A;  4B93 A;  1G28 A;  3W8K A;  3Q7Z A;  4X1L A;  2PD8 A;  1T1A A;  3MR0 A;  1LSX A;  2XRN A;  3DTI A;  3N8R A;  3N8L A;  3O88 A;  5F68 A;  4CLC B;  4B88 A;  4MLL A;  1TS7 A;  2OLV A;  2Y2G A;  2W3E A;  4EWF A;  3PYP A;  5EFW A;  4JGO A;  1JTG A;  5EPH A;  4JGQ A;  3CHW P;  2KX6 A;  3IX8 A;  3FWL A;  3ICY A;  4L9G A;  1MWT A;  4PPR A;  3TRC A;  1M6K A;  3E98 A;  4LFU A;  3JVV A;  1MY8 A;  3IF6 A;  4KEN B;  3KYQ A;  2Y2P A;  4OQG A;  3DWK A;  3M2K A;  4MBK A;  4EBP A;  2HP5 A;  2E8I A;  4U3T A;  3UDI A;  2OV5 A;  1Y54 A;  4WEL A;  1GSV A;  2PU4 A;  1J9M A;  4EEP A;  2O9A A;  1N9O A;  4OVD A;  5FQQ A;  3NHQ A;  1GA9 A;  2ZC3 B;  4HOI A;  5EE8 A;  2G2W A;  3VMA A;  1J3W A;  4IBR A;  3KSH A;  2VX8 A;  4DRT A;  5FQJ A;  2XK1 A;  4U0T A;  1NLZ A;  4R6L A;  1IKG A;  3IT9 A;  1JWV A;  3IQA A;  2NUP C;  3S7N A;  1VET B;  3D3O A;  3GTC A;  3V67 A;  2XEP A;  4LCL A;  2V1Z A;  3W4Q A;  4DE1 A;  4WLA A;  4KG5 A;  2WAD A;  3TW8 A;  4XUX A;  1KVL A;  4YWZ A;  4DE0 A;  3BLM A;  4IJG A;  4DKI A;  1TDG A;  2JHE A;  3LEZ A;  3JVU A;  5EVE A;  4X6T A;  3S22 A;  1F98 A;  4GOG A;  2GNX A;  1S1Z A;  4HEF A;  5DJU A;  2C6W B;  4RQ9 A;  3Q7V A;  3OBF A;  3C8C A;  5EOE A;  3MQQ A;  3AGD A;  3D9Y A;  4NEE D;  4KQO A;  4L9E A;  1TEM A;  4HY8 A;  1PI5 A;  1S4S A;  1CJF A;  4ID4 A;  4DXC A;  2Z2M B;  1Q2P A;  1GSW A;  4OQ0 A;  1DY6 A;  3BY9 A;  4JKT A;  2W3F A;  3MXR A;  2ZQC A;  1P9R A;  4WN5 A;  4N9K A;  1QME A;  2Y4A A;  3LGO A;  2M7U A;  4S2K A;  5HAR A;  2EX6 A;  1L0D A;  4S2L A;  1FCO A;  3BY8 A;  3CWF A;  2UWX A;  5FL3 A;  5I94 A;  4RX3 A;  3UB5 P;  4OH0 A;  4MN7 A;  4R1G A;  5FDH A;  2PAV P;  1STZ A;  5DF8 A;  4OPR A;  3NUL A;  2WKR A;  4ARZ A;  1ES3 A;  1IYS A;  3S1Y A;  5A90 A;  3DW0 A;  1AWI A;  3BW6 A;  1MWS A;  3IXB A;  3G34 A;  3WS5 A;  1PWG A;  3G32 A;  5L09 A;  4FSF A;  3ZG7 B;  3HLB A;  4E3M A;  3FPV A;  4U0X A;  1GHP A;  3GDI A;  2MJ6 A;  4YIN A;  4Y0O A;  1K4E A;  1YKD A;  2P9V B;  2C5W B;  2INW A;  3LIA A;  1XPB A;  3BRM A;  2X02 A;  2HZ5 A;  4ETZ A;  1K56 A;  5HPI A;  1ERO A;  5HD5 A;  2Y2M A;  4LCM A;  4S2N A;  3CPT B;  4EU0 A;  2Y2O A;  3HLD A;  3KYE A;  1ERM A;  1VEU B;  2Y2N A;  3MMH A;  1LL5 A;  4HES A;  2PD7 A;  1EW0 A;  5F69 A;  4I3A A;  2ZOI A;  5HPF A;  3ZG5 A;  1YLY A;  1IKI A;  2L1M A;  5CGX A;  1F9I A;  4Y3I A;  1LL9 A;  4R4S A;  1GSX A;  2DRW A;  3UMD A;  2H10 A;  2Y8H A;  4GNU A;  3KSI A;  1IYQ A;  3NIA A;  2EFX A;  5TGF A;  3F1P A;  4R3J A;  3ZG0 A;  1ZG4 A;  3HLE A;  3T4K A;  3MXQ A;  5FSR A;  1FSW A;  4E04 A;  3P7N A;  2V20 A;  4F3L B;  4KZ5 A;  5HWT A;  3M6H A;  5E43 A;  5TBM B;  4X56 A;  2V8C A;  4M3K A;  5EM1 A;  1BUL A;  2V2F F;  2XRO A;  1K54 A;  5E2F A;  3S7P A;  4OQH A;  3R7W A;  3ZHH A;  5EVI D;  2XD1 A;  4ZBE A;  2H0T A;  3G2Y A;  2Z6D A;  2DNS A;  2I9V A;  4OQI A;  3FPW A;  3M6B A;  1ZHH B;  2Q0O A;  1W8Q A;  4GLQ A;  1CF0 A;  1MWU A;  3BQA A;  2ZQ8 A;  4JLF A;  3G31 A;  3ZVW A;  4EEU A;  3FC7 A;  1PFL A;  4RYE A;  1OTE A;  1Z6F A;  1DJC A;  4YNR A;  3IF6 B;  2ZM2 A;  3RJU A;  3HUO A;  3BWL A;  5FQI A;  2XQZ A;  1PYY A;  3O86 A;  3PAG A;  3T1X A;  2Y2J A;  3P09 A;  3VV4 A;  4A5R A;  2G2U A;  3IXH A;  1RP5 A;  3A3F A;  4YOF A;  2FH5 A;  3OZH A;  1CI8 A;  1UGU A;  2KLI A;  3CIT A;  1JWP A;  3H82 A;  5AQA A;  2B95 A;  2QWS A;  5DJT A;  3QP1 A;  1MXO A;  3HJK A;  3KX0 X;  3MJQ A;  2WGI A;  3N6I A;  5TFQ A;  1YSP A;  1G68 A;  2M7V A;  1A0K A;  2IWD A;  5F83 A;  5TJJ A;  3JPU A;  3GR2 A;  4L9F A;  3UE3 A;  4LV2 A;  1CQA A;  4B9O A;  3IBJ A;  1KGG A;  3NOU C;  4NK3 A;  4EBN A;  2BLS A;  1ODV A;  4GW9 A;  4R38 A;  4R3B A;  4JF4 A;  1H3Q A;  1JTD A;  4EUZ A;  4WL9 A;  2ZQA A;  1XJ2 A;  3F1N A;  4Y15 A;  2J8Y A;  2J9P A;  2M1C A;  3QP2 A;  1KE3 A;  3Q7V B;  3C5A A;  4K0W A;  2Z6C A;  3CUE C;  5HAI A;  5HW3 A;  3T4J A;  3I7J A;  4KG2 A;  2JBF A;  1GHM A;  5C5K A;  3C7U A;  2ZC5 B;  3LY4 A;  4IED A;  3OOV A;  2H28 A;  1FR6 A;  4IVK A;  5HAQ A;  3VOL A;  3T1S A;  5HL6 A;  1DRM A;  4RX2 A;  3MSH A;  3O87 A;  4HHD A;  3DBA A;  5G18 A;  3HLW A;  2KOI A;  1YM1 A;  4CLC D;  3ISG A;  3IX3 A;  5EM0 A;  2EWW A;  4DDY A;  2PRF A;  1FOF A;  1ZC2 A;  3UDX A;  1KGE A;  1FSY A;  4LLO B;  1YLT A;  1AXB A;  2BTF P;  4QWO A;  1S66 L;  5AQ9 A;  1Y4O A;  4FH4 A;  2PDR A;  4D2O A;  1KVM A;  2E8J A;  5DF7 A;  2JKR M;  1BZA A;  1XJ4 A;  1XFN A;  3IHA A;  2LB9 A;  5G4Y A;  4JPM A;  4ARZ B;  4OP8 A;  4PM5 A;  4CLC C;  1H8M A;  5DFY A;  3NI9 A;  2JC7 A;  3LR4 A;  4O7D A;  3GEC A;  1FIK A;  4O8G A;  5HAP A;  1K57 C;  3EOI A;  3Q82 A;  4MBF A;  1L2S A;  5CTM A;  3SW1 A;  5JYO A;  2QPN A;  4WMC D;  4KUO A;  3CI6 A;  3ZQ5 A;  2RCX A;  2EXB A;  1XA7 A;  2KDK A;  3BFG A;  3IH9 A;  1S67 L;  4ETX A;  4HP9 A;  2W3D A;  3S4X A;  1CEF A;  1YMX A;  3GMW A;  1I5Q A;  3PBQ A;  4S2P A;  3LYX A;  2OOL A;  4DE2 A;  2X01 A;  4DXB A;  3LR5 A;  2EX8 A;  2HDS A;  4K08 A;  5L07 A;  4E3K A;  3NOT C;  2B02 A;  2R9W A;  1PWC A;  4OPZ A;  1T1C A;  2ZMF A;  3LI8 A;  4LEN A;  3VOY A;  5J7E A;  1E25 A;  4KZ4 A;  4H6J A;  3UY6 A;  2J80 A;  3FKV A;  5DTK A;  3SH8 A;  1XP4 A;  4KQQ A;  2WKQ A;  1D06 A;  2JKR I;  2ZJ9 A;  1NZU A;  2XH9 A;  3NBL A;  2HJE A;  1YLZ A;  3F1P B;  2VGL M;  5CHM A;  4P0M A;  4F94 A;  5KIZ A;  2QZ6 A;  1YQS A;  2CMN A;  4QPR A;  1WA9 A;  5CED A;  2X71 A;  3HLG A;  2W1T A;  2Y2K A;  3UB9 A;  3IXG A;  1DP8 A;  5FEF A;  4FUW A;  4JXV A;  4Y0U A;  2ZL1 A;  3T4T A;  1PI4 A;  3L9K A;  2VA0 A;  5A92 A;  5GHY A;  3ZG8 B;  2W1R A;  3R7W B;  3CLO A;  2WUQ A;  3NDE A;  3UPP A;  4HI4 A;  5F1F A;  1ESI A;  3HL9 A;  1KDS A;  1RGY A;  3ZGA B;  2K2N A;  2Q9N A;  3VSK A;  4E3N A;  1PW8 A;  5FAT A;  4C3Q A;  1OJG A;  1V9Z A;  2VK3 A;  3IXD A;  1VB6 A;  1CI9 A;  1U60 A;  3H9W A;  3LR0 A;  5FQ9 A;  3H82 B;  3BEB A;  5FA7 A;  3Q07 A;  4DDS A;  4HBU A;  3BFF A;  3VFF A;  1H5X A;  1NY0 A;  1SDE A;  4KQD A;  3CZD A;  2PR5 A;  5HFO A;  1K38 A;  5GLC A;  3LUQ A;  4II7 A;  3ITA A;  4PHT A;  2PBD P;  3MF0 A;  2QMI A;  2A3U A;  2FFY A;  3TSG A;  3E0Y A;  4LV0 A;  4FH2 A;  4JXG A;  4BWI A;  1LLB A;  3WS2 A;  2P74 A;  3NDG A;  2PYR A;  4BQM A;  3E2L A;  1L0E A;  3VP4 A;  3IH8 A;  1QMF A;  4HJ3 A;  2VGL S;  2ZQ7 A;  4GKU A;  4PKY A;  3BEC A;  5GLD A;  1PNE A;  2IWB A;  2JN7 A;  2Y2L A;  3EGX C;  3D4F A;  4GHI A;  3T50 A;  4EET B;  5EVI A;  3F1N B;  1BLH A;  3N7W A;  4DJ2 A;  3KO6 A;  1PZP A;  2A24 A;  4ZTK A;  4GDN A;  3JYI A;  3BLS A;  3N4I A;  3PTE A;  1GA0 A;  1BLP A;  3G2Z A;  4PAU A;  4ZJ3 A;  2OSU A;  4JGR A;  5HDD A;  3ZG9 B;  4WUJ A;  2V0W A;  4GJ4 A;  5HDC A;  4BL2 A;  1YLW A;  5A91 A;  3LFV A;  1H8Z A;  4ESP A;  4XT2 A;  2VGK A;  1ES5 A;  5CGS A;  5HDS A;  5AVE A;  4PKY G;  5J8X A;  4WZ5 C;  3UME A;  4OLG A;  5J3W A;  2K7S A;  2IA2 A;  1NWZ A;  3EQU A;  5FAQ A;  4KZ6 A;  3OC2 A;  1NXY A;  1VM1 A;  4JF6 A;  4LRY C;  4BJP A;  4Q0H A;  2QHK A;  3UE0 A;  3M2J A;  4NKP A;  5CX7 A;  2VGJ A;  4BLM A;  4O0P A;  3ITB A;  1PWD A;  1MKI A;  3IHB A;  1T1B A;  1JWZ A;  2WAF A;  4JXW A;  1Z09 A;  3W4P A;  1TS0 A;  1ZTU A;  3TJZ C;  4B4X A;  5CEC A;  3IF6 C;  5J4E A;  3G4P A;  1RCJ A;  3EEH A;  4WEJ A;  4NET A;  4E6W A;  2HGV A;  3B42 A;  4OON A;  2G7U A;  2QYB A;  4GS9 A;  4MDZ A;  2P08 A;  5HWV A;  1W8Y A;  2WGW A;  3MS6 A;  1BLS A;  2XFS A;  4EW7 A;  2R78 A;  2JE5 A;  2O9B A;  4UAA A;  3RH8 B;  5EEC A;  4KG6 A;  4H6J B;  2VLG A;  4K0X A;  3K3C A;  4IHQ A;  3LO7 A;  4EES A;  1HTZ A;  4PM7 A;  3UB7 A;  1NLY A;  2EFU A;  3B3X A;  1T18 A;  1I2W A;  4N92 A;  4BMW A;  3BJN A;  2PYP A;  1F5M A;  1NYM A;  2WKI A;  2HP9 A;  1EI5 A;  3LIF A;  2Y2I A;  4UEY A;  1E4D A;  4GDB A;  3QNB A;  3IWI A;  4DJ3 A;  3C2W A;  1XJ6 A;  4N1H A;  1CEG A;  3MFD A;  1UWP X;  4Z1W A;  5EVL A;  4K91 A;  1ONH A;  5CXW A;  3V5M A;  4DN0 A;  2P04 A;  3UDF A;  2W1T B;  1TF1 A;  4KZB A;  1BLC A;  1K55 A;  2JKT M;  3PXP A;  1P9W A;  2ZL1 B;  3PHY A;  3ZFZ A;  5FEG A;  1O07 A;  3U4L P;  2AVX A;  5FI2 A;  1S6R A;  3B47 A;  4WMC A;  2L0W A;  1MWR A;  2VZW A;  4QB8 A;  1LT0 A;  5GLA A;  1D7E A;  1LHY A;  1MKM A;  2ZC4 B;  2WYX A;  5DVA A;  3CJM A;  3BFD A;  4HJ4 A;  3MXS A;  2Y91 A;  5E2G A;  3VE4 A;  1DJA A;  3DWZ A;  5LBR A;  2IWC A;  5L10 A;  4B4Z A;  4BD1 A;  2WGV A;  4N1X A;  3PBR A;  2W3G A;  3DAV A;  3GRJ A;  3MKE A;  2XD5 A;  3UN7 A;  1VET A;  3KYZ A;  1MZU A;  5D3O A;  2ZC6 B;  3FZC A;  3T4S A;  3MKF A;  4KZ7 A;  5GHX A;  3ULF A;  4NG2 A;  4Q0I A;  4UQI M;  1ZG6 A;  2EX2 A;  4X55 A;  4UA7 A;  4Q8I A;  1HZO A;  3WS4 A;  3PR6 A;  1H0M A;  3SOI A;  2V1A A;  4HIA A;  4P6Z S;  4OP5 A;  1LL8 A;  4Y2F A;  1W7F A;  1G5U A;  2J9O A;  1P97 A;  3MZD A;  4ME4 A;  2W3H A;  3LEQ A;  3UB8 A;  2Z2L B;  1W79 A;  3G6O A;  1K56 D;  4BD0 A;  2Y2Q A;  3QHY A;  3UNW A;  2V8F A;  4IUH A;  5M18 A;  1OTI A;  5KMW A;  4X25 A;  3RTY A;  2YKH A;  4I38 A;  2ZM8 A;  2K31 A;  4C6Y A;  5CHJ A;  4GHI B;  5EVI B;  1YPR A;  1HVB A;  3OCN A;  4OKP A;  4KZ9 A;  4LV3 A;  3VOZ A;  1TS8 A;  3EWK A;  4WF0 A;  4S2N C;  4X1M A;  4MNR A;  4PM8 A;  2XLN A;  3FV7 A;  1XFQ A;  3V3S A;  1LSV A;  4YFM A;  3A0S A;  4QY5 A;  2L4R A;  3BM6 A;  2EWV A;  2YKF A;  3E2K A;  1D1J A;  4LRX C;  3LCE A;  4UHU A;  5IHV A;  2D02 A;  4XT2 B;  2ZBB A;  1BTL A;  4FCF A;  4R4R A;  5F5Y A;  3T1R A;  2ZQ9 A;  3EGD C;  5IS1 A;  2Y2H A;  4N9L A;  2QKP A;  5DF9 A;  1FIL A;  5FI6 A;  4MCW A;  1UWN X;  3NY4 A;  3DTE A;  1WYC A;  3OPL A;  4P85 A;  4UQI S;  1RGZ A;  1E3U D;  2XFT A;  1TD5 A;  4JXS A;  4L0L A;  1S1Y A;  5CTN A;  1K6R A;  3GV9 A;  1XKZ A;  5AJG A;  3ZYT A;  5HD3 A;  3BQ8 A;  4CQH A;  2J3T C;  4NXB A;  1K54 C;  4GB7 A;  2D01 A;  5F1G A;  4FOF A;  2LB5 A;  5CER A;  4G3V A;  1TDL A;  3UO9 A;  4WYY A;  1IYP A;  3PBS A;  3ZNY A;  4Z9Q A;  5DKL A;  5CHU A;  2JKG A;  1NYY A;  3N8S A;  4E3J A;  2HDQ A;  1HD8 A;  2O99 A;  3IF5 A;  5DTT A;  3VP2 A;  1XGJ A;  4GS9 B;  3T4Q A;  2V9A A;  2WGW B;  4S2M A;  3VFH A;  3A0V A;  4F3L A;  2HDR A;  2Q9M A;  4E6X A;  2WKH A;  5GLB A;  2W0N A;  3S7Q A;  1ACF A;  5TBM A;  4E3O A;  3O5Y A;  1LSW A;  2ZLY A;  4Y7P A;  2WK0 A;  3F1O A;  3UPO A;  4I39 A;  1TS6 A;  4O01 A;  1VHM A;  3TOI A;  2I72 A;  2DCF A;  3GSG A;  1NZO A;  4Y5F A;  1KE4 A;  2HPB A;  3WWX A;  1SHV A;  4G3W A;  1TVF A;  5HSQ A;  3WRZ A;  1SKO A;  3VP1 A;  4Y13 A;  1K0K A;  2JKF A;  2ZOH A;  4G3K A;  4C75 A;  3MQ0 A;  3V3R A;  3HCY A;  2ZD8 A;  2NUT C;  4XXR A;  2HP6 A;  4QU3 A;  5HZH A;  2JCH A;  4QHC A;  1OT9 A;  2XA7 M;  4EQ1 A;  4BBU A;  2ACG A;  3P01 A;  1SZV A;  2QJ5 A;  4ZJ2 A;  1DJB A;  3PAE A;  3E4O A;  4IVI A;  3SH9 A;  1SDN A;  3HLF A;  1K6S A;  3LR3 A;  3W2Z A;  1OME A;  4RVA A;  1YAX A;  1BYW A;  2ZM0 A;  1K4F A;  3FKW A;  4KZ3 A;  4PM6 A;  2GX5 A;  5HWW A;  1ONG A;  4MBH A;  1P0Z A;  3VP3 A;  5FAS A;  5E2H A;  3OPH A;  3LID A;  4NXG A;  1EWZ A;  4OPY A;  4OOM A;  3OPR A;  3RXX A;  2A49 A;  3QP6 A;  3NCK A;  3QP8 A;  1G6A A;  4MMN A;  3IWO A;  4BL3 A;  1GHI A;  3SZT A;  5TR7 A;  4NXE A;  3H7W A;  5FQK A;  4PMA A;  3NOP C;  2RL3 A;  5GL9 A;  1LI0 A;  3E4Q A;  3SS5 A;  3A3D A;  4HH3 A;  3L7H A;  5GHZ A;  4GZB A;  4S2O A;  5G4Z A;  2Y59 A;  4LV1 A;  5FI7 A;  1KE0 A;  5CGW A;  5DFX A;  2DMW A;  1WE4 A;  2V1B A;  4KZ8 A;  3LY3 A;  3TG9 A;  5DTS A;  4GCZ A;  2P7J A;  2ZMV A;  3UE6 A;  3AGF A;  4E3I A;  3Q81 A;  5IU1 A;  3SH7 A;  4S2I A;  2QJ7 A;  2PU2 A;  3LIC A;  5AVF A;  2PT7 A;  1L0F A;  1DP6 A;  3T4O A;  1MPL A;  1JNU A; 
#chains in the Genus database with same CATH homology
 3MZE A;  2Y2I A;  4OOY A;  1NJ4 A;  5G18 A;  3HLW A;  1E4D A;  4GDB A;  1YM1 A;  3QNB A;  3FWL A;  3IWI A;  3ISG A;  3A3J A;  4BEN A;  1MWT A;  3IWQ A;  4PPR A;  5M19 A;  4N1H A;  1YLP A;  4DDY A;  1CEG A;  4UA6 A;  3MFD A;  1M6K A;  5EVL A;  1FOF A;  1N9B A;  4WM9 A;  1ZC2 A;  4K91 A;  1MY8 A;  1ONH A;  3IF6 A;  5CXW A;  3UDF A;  3UDX A;  3V5M A;  1KGE A;  4KEN B;  1FSY A;  1FCN A;  1YLT A;  1AXB A;  4KZB A;  5AQ9 A;  2Y2P A;  2BG1 A;  3DWK A;  3M2K A;  1BLC A;  1K55 A;  4FH4 A;  4MBK A;  4OQG A;  4D2O A;  4EBP A;  2B5R A;  1KVM A;  3C4O A;  3ZFZ A;  2EX9 A;  5DF7 A;  1O07 A;  1O7E A;  1BZA A;  2HP5 A;  2E8I A;  4U3T A;  3ZCZ A;  3UDI A;  5FI2 A;  3HLC A;  1GCE A;  1S6R A;  3OPP A;  2OV5 A;  4WMC A;  1Y54 A;  5FAP A;  4WEL A;  1MWR A;  3IHA A;  2PU4 A;  5AQ7 A;  4QB8 A;  1J9M A;  3QNC A;  5GLA A;  1LHY A;  2ZC4 B;  4JPM A;  4OVD A;  4OP8 A;  2WYX A;  5FQQ A;  4PM5 A;  5DVA A;  3NI9 A;  3CJM A;  3BFD A;  1GA9 A;  3MXS A;  2H0Y A;  2JC7 A;  2Y91 A;  2XF3 A;  5E2G A;  4O7D A;  2WAE A;  2EXA A;  4OPQ A;  2ZC3 B;  5HAP A;  1DJA A;  5EE8 A;  3DWZ A;  2G2W A;  4IBX A;  3O3V A;  2IWC A;  3VMA A;  1K57 C;  4IBR A;  3Q82 A;  4MBF A;  4B4Z A;  4KZA A;  1L2S A;  2WGV A;  5CTM A;  4BD1 A;  4N1X A;  1SKF A;  3PBR A;  4DRT A;  5FQJ A;  5JYO A;  2QPN A;  1SCW A;  2XK1 A;  4WMC D;  4U0T A;  1WYB A;  3GRJ A;  3MKE A;  2XD5 A;  1IKG A;  3UN7 A;  2RCX A;  1JWV A;  3IT9 A;  5AQB A;  2EXB A;  3IQA A;  5F82 A;  1XA7 A;  3GVB A;  3BFG A;  4FD8 A;  4RA7 A;  3FYZ A;  3IH9 A;  5D3O A;  2ZC6 B;  3FZC A;  4OLD A;  1XX2 A;  3MKF A;  1XGI A;  4KZ7 A;  5GHX A;  3GTC A;  4HBT A;  2XEP A;  4LCL A;  2V1Z A;  3S4X A;  1CEF A;  1KDW A;  1YMX A;  1ZG6 A;  3W4Q A;  4DE1 A;  5HL1 A;  3GMW A;  2EX2 A;  4X55 A;  4UA7 A;  4KG5 A;  2WAD A;  1I5Q A;  3PBQ A;  1ERQ A;  4S2P A;  4XUX A;  5M1A A;  4Q8I A;  1HZO A;  1KVL A;  3WS4 A;  4DE0 A;  3BLM A;  4DE2 A;  2X01 A;  4DKI A;  3SOI A;  3C4P A;  3WS0 A;  4DXB A;  1PZO A;  1TDG A;  2EX8 A;  2HDS A;  3NC8 A;  4OP5 A;  3LEZ A;  4QD4 A;  4E3K A;  1W7F A;  4X6T A;  2J9O A;  3S22 A;  4GOG A;  3MZD A;  2R9W A;  1KGF A;  1PWC A;  4OPZ A;  3VOY A;  4LEN A;  4HEF A;  2Z2L B;  1W79 A;  3W4O A;  1E25 A;  1K56 D;  4BD0 A;  2C6W B;  4KZ4 A;  4CJN A;  3VP0 A;  3Q7V A;  3UY6 A;  2Y2Q A;  3QHY A;  3FKV A;  5DTK A;  3UNW A;  3SH8 A;  1ALQ A;  1M40 A;  1XP4 A;  4KQQ A;  5EOE A;  5EUA A;  5M18 A;  3AGD A;  1IEL A;  4R0Q A;  2ZJ9 A;  3HRE A;  1NRF A;  5KMW A;  1NZU A;  4KQO A;  2XH9 A;  1TEM A;  3NBL A;  4DE3 A;  1PI5 A;  1K57 A;  3BFC A;  2OLU A;  4UA9 A;  4MEZ A;  4ID4 A;  3BFE A;  4WZ4 A;  4DXC A;  1YLZ A;  2Z2M B;  2ZM8 A;  1Q2P A;  4C6Y A;  1ES2 A;  4OQ0 A;  5CHM A;  4P0M A;  5CHJ A;  1DY6 A;  2R9X A;  4JKT A;  5JYP A;  5EVI B;  4F94 A;  4OKP A;  1HVB A;  3OCN A;  1LI9 A;  2QZ6 A;  4PM9 A;  1YQS A;  3MXR A;  2Y55 A;  1XA1 A;  1ES4 A;  2ZQC A;  4KZ9 A;  1Q2Q A;  4LV3 A;  3VOZ A;  5CED A;  2X71 A;  4N9K A;  2XGN A;  5CRF A;  3HLG A;  3ZVT A;  4S2N C;  2Y2K A;  1FR1 A;  4MNR A;  3IXG A;  4PM8 A;  3CG5 A;  1QME A;  2XLN A;  2Y4A A;  3FV7 A;  3UE1 A;  4JXV A;  4Y0U A;  3V3S A;  1PI4 A;  5FQM A;  5A92 A;  4S2K A;  5GHY A;  5HAR A;  3ZG8 B;  4YFM A;  2EX6 A;  1L0D A;  4QY5 A;  4S2L A;  1FCO A;  2UWX A;  3BM6 A;  5I94 A;  3WRT A;  2WUQ A;  4RX3 A;  4OH0 A;  5FDH A;  4R1G A;  3NDE A;  3E2K A;  1IEM A;  1W5D A;  3UPP A;  2ZC7 A;  5DF8 A;  3LCE A;  4OPR A;  5F1F A;  1ESI A;  4UHU A;  5IHV A;  1FQG A;  4ZAM A;  3AGE A;  4X53 A;  1ES3 A;  3HL9 A;  4JBF A;  3RXW A;  1BTL A;  5E2E A;  4FCF A;  1E3U A;  1IYS A;  1KDS A;  3S1Y A;  5A90 A;  1RGY A;  1BT5 A;  3DW0 A;  4R4R A;  1JVJ A;  3ZGA B;  1MWS A;  2FFF B;  2ZQ9 A;  3ZDJ A;  3IXB A;  3G34 A;  2Q9N A;  3WS5 A;  1PWG A;  3VSK A;  4E3N A;  2Y2H A;  3G32 A;  4N9L A;  1PW8 A;  1H8Y A;  5DF9 A;  5FAT A;  4GD8 A;  4C3Q A;  1C3B A;  3IXD A;  1K25 A;  4GN2 A;  4FSF A;  1L0G A;  3BYD A;  3HLB A;  5FI6 A;  3ZG7 B;  4GD6 A;  1CI9 A;  1I2S A;  5EVI C;  3PBT A;  1U60 A;  4E3M A;  3NY4 A;  4U0X A;  1WYC A;  1GHP A;  3OPL A;  4P85 A;  4YIN A;  4Y0O A;  1K4E A;  2P9V B;  3VSL A;  2C5W B;  1S0W A;  1RGZ A;  3HUN A;  1E3U D;  2XFT A;  5FQ9 A;  4JXS A;  1XPB A;  4L0L A;  5CTN A;  4EV4 A;  3BRM A;  1K6R A;  2X02 A;  3BEB A;  5FA7 A;  3Q07 A;  3GV9 A;  4DDS A;  1XKZ A;  4HBU A;  1K56 A;  3BFF A;  1ERO A;  3VFF A;  2Y2M A;  4LCM A;  2CC1 A;  4S2N A;  1H5X A;  2Y2O A;  1NY0 A;  5HX9 A;  1K54 C;  3HLD A;  1ERM A;  1SDE A;  3CZD A;  4GB7 A;  5F1G A;  4ZDX A;  5CER A;  3MBZ A;  2Y2N A;  1TDL A;  2WKE A;  5HFO A;  1K38 A;  3EQV A;  5GLC A;  3ITA A;  1LL5 A;  2QMI A;  4HES A;  2A3U A;  2FFY A;  3UO9 A;  4XUZ A;  4WYY A;  1IYP A;  3PBS A;  3TSG A;  3ZNY A;  1PW1 A;  4LV0 A;  4Z9Q A;  4FH2 A;  1PIO A;  1IYO A;  4JXG A;  5CHU A;  3C7V A;  1LLB A;  3WS2 A;  5A93 A;  3V50 A;  3ZG5 A;  5CEB A;  1NYY A;  3HUM A;  3N8S A;  2P74 A;  1YLY A;  1IKI A;  3HVF A;  3NDG A;  3V39 A;  4BQM A;  3E2L A;  3ZNT A;  4E3J A;  5CGX A;  4S2J A;  4WEK A;  1LL9 A;  4R4S A;  1L0E A;  2DRW A;  3Q1F A;  4OOL A;  3IH8 A;  5EOO A;  1QMF A;  2HDQ A;  3VP4 A;  2ZQ7 A;  2H10 A;  4GKU A;  5KSC A;  1HD8 A;  4Y0T A;  3BEC A;  3IF5 A;  5GLD A;  4GNU A;  2IWB A;  5DTT A;  1IYQ A;  3NIA A;  2EFX A;  3PBN A;  1XGJ A;  5TGF A;  3VP2 A;  4R3J A;  2Y2L A;  3ZG0 A;  1ZG4 A;  3HLE A;  2WGW B;  3D4F A;  1CK3 A;  4S2M A;  5FSR A;  3VFH A;  1FSW A;  5EVI A;  2ZQD A;  1BLH A;  3N7W A;  3SS3 A;  2HDR A;  2Q9M A;  4E6X A;  1PZP A;  2WKH A;  5GLB A;  2V20 A;  5KZH A;  4E3O A;  4ZTK A;  4GDN A;  4KZ5 A;  3JYI A;  3BLS A;  3N4I A;  3M6H A;  2ZLY A;  3PTE A;  4Y7P A;  5E43 A;  1GA0 A;  1BLP A;  2WK0 A;  3UPO A;  4X56 A;  5FAO A;  4P87 A;  4M3K A;  3G2Z A;  1BUL A;  1YLJ A;  2V2F F;  3TOI A;  3MZF A;  2I72 A;  2DCF A;  1K54 A;  5E2F A;  4ZJ3 A;  4OQH A;  2OSU A;  4H8R A;  3GSG A;  3ZHH A;  3ZG9 B;  1NZO A;  3CMZ A;  3GQZ A;  5EVI D;  2XD1 A;  4ZBE A;  4BL2 A;  2H0T A;  3G2Y A;  1KE4 A;  2HPB A;  3WWX A;  2DNS A;  1YLW A;  5A91 A;  3A3E A;  1SHV A;  4P6B A;  4EBL A;  4OQI A;  1XXM A;  1TVF A;  1BUE A;  1H8Z A;  3M6B A;  1W8Q A;  2VGK A;  1MWU A;  3G30 A;  3WRZ A;  1FCM A;  4EQI A;  1ES5 A;  2ZQ8 A;  4JLF A;  5CGS A;  3VP1 A;  3G31 A;  4X68 A;  3ZVW A;  1YMS A;  3P98 A;  4RYE A;  5L2F A;  1Z6F A;  4C75 A;  1DJC A;  5J8X A;  3G35 A;  2WZX A;  4WZ5 C;  3IF6 B;  2HDU A;  3V3R A;  2ZM2 A;  3RJU A;  3HUO A;  2ZD8 A;  5FQI A;  2XQZ A;  4DF6 A;  1PYY A;  4XXR A;  2HP6 A;  4QU3 A;  3O86 A;  3PAG A;  2Y2J A;  3P09 A;  2JCH A;  2H5S A;  2GDN A;  3A3I A;  4OLG A;  4QHC A;  4R23 A;  4WBG A;  4QJG A;  4A5R A;  2G2U A;  2P9V A;  3IXH A;  1RP5 A;  1N4O A;  3SH9 A;  4ZJ2 A;  3A3F A;  1DJB A;  3OZH A;  3PAE A;  1CI8 A;  4IVI A;  1SDN A;  2WZZ A;  3HLF A;  3EQU A;  1K6S A;  1JWP A;  5FAQ A;  4KZ6 A;  3OC2 A;  5AQA A;  1VQQ A;  1NXY A;  2XR0 A;  1MXO A;  1OME A;  1VM1 A;  4RVA A;  4JF6 A;  4ZJ1 A;  4BJP A;  2ZM0 A;  1K4F A;  3FKW A;  4KZ3 A;  4PM6 A;  3UE0 A;  3M2J A;  2WGI A;  3N6I A;  5TFQ A;  1MBL A;  1ONG A;  2VGJ A;  4MBH A;  3VP3 A;  1G68 A;  5FAS A;  4BLM A;  5E2H A;  2IWD A;  1ZKJ A;  3OPH A;  3ITB A;  1PWD A;  1MKI A;  5F83 A;  3IHB A;  1BSG A;  1EWZ A;  3GR2 A;  4OPY A;  3SS4 A;  2J7V A;  4OOM A;  3UE3 A;  3OPR A;  4LV2 A;  1JWZ A;  2WAF A;  4JXW A;  3W4P A;  3RXX A;  5KSH A;  2PBY A;  2A49 A;  3NCK A;  1KGG A;  4E3L A;  4NK3 A;  1G6A A;  4EBN A;  2BLS A;  2ZMA A;  3IWO A;  4BL3 A;  4B4X A;  5CEC A;  1GHI A;  3IF6 C;  4CPK A;  4R3B A;  5TR7 A;  4JF4 A;  3G4P A;  3HBR A;  2XDM A;  1RCJ A;  4JF5 A;  4QY6 A;  4WEJ A;  4NET A;  1JTD A;  4E6W A;  5FQK A;  4EUZ A;  1K55 C;  1ESU A;  3PBO A;  4OON A;  4PMA A;  4WZ5 A;  3OCL A;  1YT4 A;  3DTM A;  2ZQA A;  2RL3 A;  5GL9 A;  1LI0 A;  3SS5 A;  1W8Y A;  2WGW A;  1BLS A;  4KQR A;  3A3D A;  5BOH A;  2XFS A;  2J8Y A;  5GHZ A;  2J9P A;  5U47 A;  3WS1 A;  4GZB A;  4S2O A;  2Y59 A;  2JE5 A;  3UPN A;  4LV1 A;  5FI7 A;  4UAA A;  1KE3 A;  1KE0 A;  5EEC A;  4KG6 A;  3Q7V B;  5CGW A;  4X69 A;  4K0X A;  3W8K A;  3C5A A;  3Q7Z A;  4K0W A;  1WE4 A;  3LO7 A;  5HAI A;  4KZ8 A;  1HTZ A;  4PM7 A;  3LY3 A;  3TG9 A;  5DTS A;  5HW3 A;  3N8R A;  3N8L A;  3I7J A;  3O88 A;  4KG2 A;  2EFU A;  3B3X A;  3AGF A;  4MLL A;  2JBF A;  1GHM A;  4B88 A;  4E3I A;  1I2W A;  3C7U A;  2OLV A;  2Y2G A;  2ZC5 B;  3LY4 A;  3Q81 A;  4IED A;  4IVK A;  1FR6 A;  4N92 A;  4S2I A;  3SH7 A;  5HAQ A;  2PU2 A;  4EWF A;  1L0F A;  1NYM A;  2WKI A;  4RX2 A;  2HP9 A;  1JTG A;  5EPH A;  1EI5 A;  1MPL A;  3O87 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...