4DDSA

Ctx-m-9 class a beta-lactamase complexed with compound 11
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
260
structure length
260
Chain Sequence
AVQQKLAALEKSSGGRLGVALIDTADNTQVLYRGDERFPMCSTSKVMAAAAVLKQSETQKQLLNQPVEIKPADLVNYNPIAEKHVNGTMTLAELSAAALQYSDNTAMNKLIAQLGGPGGVTAFARAIGDETFRLDRTEPTLNTAIPGDPRDTTTPRAMAQTLRQLTLGHALGETQRAQLVTWLKGNTTGAASIRAGLPTSWTAGDKTGSGDYGTTNDIAVIWPQGRAPLVLVTYFTQPQQNAESRRDVLASAARIIAEGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-Based Design of Potent and Ligand-Efficient Inhibitors of CTX-M Class A Beta-Lactamase
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Beta-lactamase
total genus 95
structure length 260
sequence length 260
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2012-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4ddsA00
4R4RA 5GLDA 4JKTA 5KSHA 4S2OA 3Q07A 1MWUA 2EX9A 5DF8A 1K6RA 3ZGAB 3ITAA 4MLLA 5FI6A 5E2EA 4EUZA 1Z6FA 4KZ7A 1ONHA 3OZHA 3EQVA 5CGXA 5GL9A 2XR0A 1K6SA 1TVFA 4N9KA 4X6TA 3HLGA 1IEMA 4M3KA 3WS4A 1ES3A 1K55A 1KE0A 4E6XA 5EVIB 3ISGA 4KQOA 1ZG4A 4CJNA 2WKHA 5CHJA 2I72A 4KENB 5CGSA 3QNCA 2C5WB 3UO9A 1PYYA 2P74A 3NC8A 3BECA 4FH2A 4GDNA 5FQMA 5FQIA 1YMSA 3PTEA 1TEMA 3CG5A 1KE3A 4EV4A 1K25A 3OCNA 4KZ5A 4KG6A 3FYZA 1M6KA 4NK3A 5FI7A 1K54A 5AQBA 4DE1A 3HLEA 2HDQA 5DTKA 4WBGA 2XH9A 1K56A 3PAEA 1XX2A 5EVIA 4S2JA 4ZDXA 3DWKA 3FWLA 1E3UD 1K57A 4MBHA 4S2NC 4JXWA 2WAEA 2ZQCA 3CJMA 3FKVA 1IYOA 2ZC6B 1GA0A 1K38A 1G6AA 1NZOA 4GDBA 3NY4A 4Z9QA 4E3IA 4ZJ1A 4KZ4A 2XF3A 2ZQ7A 1XA1A 3OPHA 3Q82A 1GHMA 3IWQA 1FOFA 4N92A 3AGFA 4UA6A 3BRMA 3HUNA 4OOYA 4E3MA 4GOGA 4EWFA 1WE4A 4X68A 2QZ6A 5DF9A 4RX2A 2V1ZA 5AQ9A 3A3IA 1CEGA 1EWZA 1I2SA 3BFEA 1W79A 1XGIA 4JPMA 3UPNA 1LI9A 1QMFA 3V3SA 3UDIA 4N1XA 1FCMA 1Q2PA 3N4IA 1FR6A 1ZG6A 4KG5A 3Q7ZA 1N4OA 4PM6A 5F1GA 3A3DA 1JWPA 5FQQA 1YM1A 5EE8A 1JTGA 2ZM8A 5E43A 5D3OA 4RYEA 3HLDA 4LENA 4B4ZA 4E3OA 2HP6A 2Y2JA 2Y2QA 5FAOA 1MWRA 4DDSA 1K56D 5GLCA 4B4XA 3GVBA 3RXWA 4WEJA 1NJ4A 1SDEA 2WAFA 1PIOA 4MNRA 4RA7A 4S2PA 3WRZA 4KZ8A 4JLFA 3Q7VA 1H8ZA 1K4FA 1BULA 2WK0A 1J9MA 3ZFZA 3WS5A 3N6IA 4JF4A 1ES5A 1AXBA 1JTDA 1RGZA 4FSFA 1MBLA 4GKUA 4LV0A 1H8YA 1GA9A 1NXYA 1XGJA 5DVAA 1HVBA 4X55A 2ZC7A 1O7EA 4BD0A 2B5RA 2Y4AA 4WZ5A 2C6WB 4YFMA 2Y2OA 3W8KA 1BUEA 1W8YA 5GLAA 3HREA 5FATA 4EBPA 1PWGA 4P0MA 2JC7A 4HBUA 3MKEA 4X53A 4S2MA 1BT5A 2EFUA 3BFFA 4JXSA 4DKIA 2PU4A 2J9PA 1CI8A 4OLGA 1CEFA 1JWVA 3MXRA 2HP5A 4R0QA 2HP9A 3NCKA 2G2WA 3UY6A 4OOLA 3GSGA 4Y0UA 5HAPA 1ZC2A 4OOMA 5J8XA 1W5DA 1XKZA 1BTLA 1W8QA 2QMIA 3A3JA 3CMZA 4R1GA 1Y54A 4S2LA 5EOEA 4RX3A 5F1FA 1S6RA 1IKIA 1FR1A 4BJPA 2RCXA 3IHBA 2H0TA 1MWSA 3WS0A 3N8LA 4DXCA 4XXRA 4DF6A 1SHVA 1GCEA 5KMWA 1JWZA 3GTCA 4UA7A 4OLDA 4HEFA 2XEPA 1FCNA 5CERA 4DE0A 2WGIA 2XD1A 4UA9A 5EVIC 1MKIA 3O87A 3UE1A 1LI0A 2XLNA 1IYQA 2EXAA 2EX8A 2IWDA 3HUOA 4OQHA 3ZG8B 2ZC5B 5HW3A 3UDFA 3ZNTA 3SS5A 1M40A 4QHCA 4ZAMA 4PM7A 2V2FF 4E6WA 2V20A 1ESUA 4OPZA 3O86A 3IHAA 3UN7A 1WYBA 4PMAA 3OCLA 1N9BA 3VP1A 4WEKA 1PZPA 1EROA 2ZLYA 1MWTA 3BFGA 2XFSA 4R3JA 5FA7A 3Q7VB 4OQ0A 3G2ZA 3G2YA 3DTMA 3LCEA 4BLMA 2XK1A 2Y2LA 3C5AA 3IH9A 4X69A 1ERMA 5CRFA 1MXOA 3MBZA 4IVKA 2ZM2A 2H0YA 5E2FA 3P98A 5CEBA 3PBSA 3NI9A 4JF6A 4IBRA 4OP5A 1FCOA 1L0DA 3C7VA 3ZVTA 2Y2PA 4Y0TA 2Z2LB 2Y59A 3M2JA 3W4OA 3WS1A 1GHIA 3IWIA 1YLJA 5FSRA 1KGFA 2X02A 3G35A 4PM5A 5AQAA 4DE2A 4JF5A 4QB8A 4C3QA 1VQQA 1JVJA 2H10A 3IQAA 3S22A 1I5QA 1ALQA 2Y2HA 3D4FA 5M1AA 4E3LA 4U0TA 3ZG7B 2HDUA 3UDXA 2DNSA 3RJUA 2ZJ9A 5FQJA 3SOIA 3G4PA 4X56A 3HLCA 5F83A 4EQIA 4KQQA 5IHVA 5M18A 4YINA 2J8YA 2Y2KA 3TOIA 3BEBA 2Q9MA 2Y2GA 3BFDA 4DDYA 2GDNA 1I2WA 2Y2MA 1Q2QA 4EBNA 5HL1A 1YLZA 3MZFA 3QNBA 4ID4A 4WZ5C 3VOZA 4R23A 3SS4A 3UPOA 3ZG5A 5EOOA 2R9XA 2IWCA 2X71A 2FFFB 1RGYA 3BLMA 3LO7A 2E8IA 3GMWA 3B3XA 2XDMA 4GD6A 1RP5A 4WZ4A 5EVID 3PAGA 4RVAA 5CXWA 1IELA 1L2SA 5GLBA 1ESIA 4KZBA 1WYCA 3TG9A 3G34A 2ZQAA 3NBLA 4OPYA 3PBTA 4XUXA 2ZC3B 4PM8A 1PWCA 2Z2MB 3OPRA 4QU3A 3GQZA 3FV7A 3A3EA 1BZAA 4OH0A 3ZCZA 1PW8A 1L0FA 4ZTKA 3LY4A 2HPBA 1NYMA 4KZAA 5JYOA 4R3BA 1H5XA 1NYYA 2X01A 3IT9A 3N7WA 2Y2IA 3NIAA 4S2KA 4Q8IA 4UAAA 5CEDA 1GHPA 3IXGA 4LV3A 1LL5A 2DCFA 3IXHA 5FI2A 4ZJ2A 3E2KA 1LL9A 1HD8A 3GV9A 3G32A 4KG2A 3IXDA 5HX9A 1FSWA 2CC1A 4R4SA 4JXVA 1SCWA 4P87A 5L2FA 2WADA 3SH7A 1LLBA 2DRWA 2VGKA 4UHUA 1E4DA 3BM6A 5CTMA 3UE3A 2WKEA 3IF6B 1KGGA 1DJCA 4P85A 2ZMAA 3VMAA 3W4QA 4OPRA 2ZC4B 5U47A 1YLWA 2A3UA 2RL3A 3Q81A 4ZJ3A 3MZEA 3ZG0A 1OMEA 1KDWA 4BENA 4N9LA 3UE0A 3VP0A 4OQGA 1YLYA 3V39A 1ZKJA 3ZG9B 3S1YA 3ZNYA 4GB7A 4D2OA 2OSUA 3BLSA 3E2LA 4E3KA 4HESA 1XPBA 2BG1A 1XP4A 5A90A 3M6BA 1BLSA 3VP3A 3LEZA 1TDLA 2WGVA 4IBXA 5CHMA 4QJGA 5CHUA 1KE4A 2P9VA 1YT4A 4A5RA 1G68A 4K0XA 1MY8A 4OP8A 3TSGA 5KSCA 5EECA 5FQ9A 5I94A 1FQGA 4K91A 2XQZA 4N1HA 4HBTA 3UNWA 1ONGA 5EUAA 2R9WA 2WGWA 1PI5A 2Y91A 3GRJA 3O3VA 4PPRA 2HDRA 5GHXA 4Y7PA 1KVMA 4U0XA 4U3TA 5FAQA 4NETA 5DTSA 5FQKA 1BLCA 1QMEA 2FFYA 2PU2A 3WWXA 4KZ3A 3PBNA 4BL2A 3MFDA 4KZ6A 2OLUA 2WZZA 2OV5A 2ZQDA 1IKGA 1YQSA 5CGWA 5F82A 4E3JA 5HAQA 1ERQA 2EX6A 3HL9A 1O07A 3NDEA 3C4PA 2A49A 1ES4A 2WZXA 1NZUA 3HVFA 3OPPA 4WM9A 4B88A 3IF5A 4O7DA 4OPQA 4IEDA 5GHZA 1E3UA 1SKFA 2QPNA 1SDNA 2XFTA 1HTZA 5EPHA 4BQMA 4MBKA 3FZCA 3HLBA 3N8RA 3WS2A 5A91A 1DY6A 1EI5A 3BFCA 1S0WA 4LV1A 1L0EA 3G30A 3VOYA 2IWBA 4XUZA 4BD1A 4P6BA 3OC2A 2JE5A 1PW1A 4GNUA 3ZDJA 5AQ7A 3HUMA 1XXMA 4F94A 2EX2A 2WGWB 4FH4A 3IWOA 4WMCA 3W4PA 3CZDA 1E25A 4OKPA 5HFOA 4PM9A 2BLSA 1C3BA 5EVLA 1MPLA 1PWDA 3PBQA 5TGFA 3G31A 4ZBEA 2WKIA 4IVIA 2J7VA 3WRTA 5GHYA 4OONA 3IH8A 3SH8A 1K54C 2Y55A 1NRFA 3MXSA 3PBRA 1PZOA 3DW0A 3LY3A 3OPLA 3DWZA 1CK3A 3MZDA 4FCFA 4KQRA 2EXBA 3S4XA 1NY0A 1IYSA 3V3RA 4S2NA 4S2IA 2XD5A 4QD4A 1YLTA 3VSLA 4K0WA 1KVLA 5FASA 4LCMA 2Y2NA 2Q9NA 1K4EA 3IF6C 3VSKA 4BL3A 4LCLA 3P09A 2PBYA 2HDSA 5A92A 3I7JA 5E2GA 1K55C 1DJBA 3O88A 4WYYA 5DF7A 3VP2A 1YMXA 2WYXA 1PI4A 4JBFA 5A93A 1XA7A 5CECA 1KGEA 3PBOA 3ZVWA 2P9VB 4E3NA 5JYPA 4LV2A 1RCJA 3C7UA 3MKFA 3SS3A 2JBFA 4QY5A 1HZOA 1L0GA 4KZ9A 3IF6A 4GN2A 3ZHHA 4DXBA 3M6HA 2ZQ9A 4C75A 1KDSA 4FD8A 1BSGA 4WELA 3SH9A 5DTTA 1CI9A 3JYIA 2J9OA 5FDHA 3EQUA 1YLPA 2OLVA 1U60A 3A3FA 4JXGA 3M2KA 3N8SA 1IYPA 3NDGA 4MEZA 5HAIA 3C4OA 5BOHA 2ZQ8A 5CTNA 3V50A 4C6YA 3ITBA 3AGDA 2UWXA 1TDGA 3HBRA 2H5SA 4DRTA 5M19A 5KZHA 1LHYA 3AGEA 3IXBA 4OVDA 2XGNA 3VFFA 3HLFA 2WUQA 5FAPA 3HLWA 4GD8A 4GZBA 1FSYA 3Q1FA 4H8RA 1BLHA 3RXXA 2ZD8A 3V5MA 3VP4A 2ZM0A 3VFHA 1W7FA 1K57C 2EFXA 4QY6A 3QHYA 4EBLA 5G18A 2G2UA 1ES2A 3GR2A 5E2HA 5TFQA 4CPKA 1VM1A 3FKWA 1DJAA 4Y0OA 4OQIA 4DE3A 5TR7A 1BLPA 2VGJA 5HARA 2JCHA 3UPPA 4WMCD 3BYDA 4MBFA 4L0LA
chains in the Genus database with same CATH superfamily
4R4RA 5GLDA 4JKTA 3B33A 2EX9A 1K6RA 3ZGAB 1ONHA 2E8JA 5L8MA 2OWHA 3E4OA 1K6SA 4N9KA 4X6TA 3HLGA 1ES3A 4E6XA 4CJNA 3MFXA 3TRCA 5CGSA 4DMZA 4YWZA 3BECA 5FQIA 4ESPA 1A0KA 1KE3A 3OCNA 1DRMA 3A0VA 3FYZA 1K54A 4DE1A 3HLEA 5EVIA 1W63M 3DWKA 4R3AA 4GS9B 2W27A 3QP6A 4JXWA 4UQIS 1XA1A 4EEPA 4N92A 3HUNA 4BMWA 4E3MA 4X68A 1V9YA 2QZ6A 3UMEA 1OPXA 5AQ9A 1W79A 3G6OA 3LI9A 2O9AA 3F1NA 1FCMA 1Q2PA 2ZOIA 1PRQA 3N4IA 5FQQA 3IBJA 3EWKA 4RYEA 1VETA 1MWRA 5GLCA 3K2NA 2WAFA 1PIOA 4EETB 4JLFA 4ZRRA 4PKYG 2WK0A 4JF4A 4MN5A 4FSFA 1RGZA 1O7EA 4O8GA 4PKYA 2C6WB 1UWPX 4YFMA 3W8KA 3MKEA 4X53A 5EVEA 2EFUA 4DKIA 2PU4A 1CI8A 4OLGA 1CEFA 2VLGA 3IX4A 1JWVA 3MXRA 4R0QA 3UY6A 2QHKA 3GSGA 5HAPA 4GHIA 2M7UA 4PHTA 4P6ZM 1XKZA 2QMIA 5FEFA 3UB5P 2VGLS 1FIKA 3WS0A 2V0UA 3GTCA 5F6AA 2PHYA 1FCNA 2XD1A 1PFLA 3KX0X 5EVIC 1MKIA 3O87A 2Q0OA 2XLNA 2EX8A 2KOIA 5DKKA 1LL8A 1XJ4A 1OTDA 2FZ0A 5HW3A 2XSSA 4PM7A 5C5KA 4HY8A 3LEQA 1ESUA 4OPZA 3UN7A 4PMAA 4WEKA 3BQ8A 1PZPA 1MWTA 1OTEA 1AWIA 4L9EA 4X1LA 3G2ZA 4LRXC 5HL6A 4ME4A 4IVKA 5CEBA 3PBSA 3NI9A 2JKGA 3C7VA 2KDKA 3EGDC 3M2JA 3RFBA 1GHIA 5DFXA 3LIEA 4PM5A 4DE2A 1SKOA 1VQQA 1ALQA 5J3WA 2ZMFA 2FH5A 5A8BA 4U0TA 4JGOA 4Y2FA 4X56A 4DJ2A 4I38A 3D3OA 5IHVA 5M18A 3BEBA 2Q9MA 3BFDA 4DDYA 2GDNA 4G3VA 3VOLA 1Q2QA 4EBNA 5HL1A 1ACFA 3MZFA 2A24B 4ID4A 3VOZA 1RGYA 3B3XA 3L7HA 4GD6A 4WZ4A 3PAGA 1W63Q 1L2SA 2M1CA 1ESIA 5GLBA 1STZA 3T4TA 3TG9A 3PBTA 1S1ZA 4XUXA 1PWCA 3MJQA 3GQZA 2PBDP 1L0FA 2L0WA 4ZTKA 1P9RA 4Y17A 4B9OA 5DJTA 3N7WA 2VEAA 4X1MA 5CEDA 3IXGA 2IA2A 4LV3A 3H9WA 2DCFA 3ZYTA 4ZJ2A 3SW1A 2M7VA 3T4SA 3GV9A 1FSWA 5HWTA 2H28A 1T1AA 4B93A 5EFWA 1OJ5A 3W4QA 5U47A 1F5MA 5L10A 2A3UA 3MZEA 1KDWA 2ZMVA 4OQGA 2O99A 3V39A 3RTYA 3ZNYA 2A2LA 4GB7A 5DKLA 4E3KA 3MR0A 4HESA 1XP4A 1XJ2A 5A90A 1NLZA 3M6BA 1BLSA 1LT0A 1OTIA 1TDLA 3BQAA 5CHUA 2P9VA 3S7OA 1DP8A 1G68A 2NUPC 4K0XA 5KSCA 4OP8A 5I94A 3UNWA 5EUAA 2R9WA 2Y91A 4EXOA 1D06A 4Y7PA 5FQKA 2PU2A 4BL2A 2WZZA 4E3JA 1ERQA 2PAVP 2EX6A 1SZVA 1ES4A 3F1OA 4B88A 4IEDA 3FPWA 1SDNA 5EPHA 4P6ZS 4BQMA 3FZCA 3WS2A 5A91A 1DY6A 3BFCA 4LV1A 1BYWA 2IWBA 4BD1A 3LIDA 3OC2A 4F3LA 3A0RA 3H7WA 4FH4A 3LFVA 2JKTI 4XT2B 5EVLA 1MPLA 1PWDA 4ZBEA 2G7UA 2J7VA 4OONA 2GZAA 2QWSA 2B02A 4FCFA 2EXBA 1IYSA 3V3RA 2XD5A 1YLTA 3NOUC 1OJGA 3MXQA 3MMHA 3VSKA 3P09A 2PBYA 2VV6A 2HDSA 1K55C 5DF7A 1IFQA 3O88A 4DJ3A 5A93A 5CECA 2WYXA 4JBFA 3IX3A 2VA0A 3PBOA 4NXGA 3CWFA 4E3NA 3OLOA 3MKFA 4FOFA 4QY5A 3IF6A 4DXBA 4C75A 1BSGA 3B42A 5IT5A 5DTTA 3M2KA 1G5UA 4WL9A 4NKPA 3HJIA 4DRTA 1LHYA 4GD8A 4GZBA 1TS8A 5TBMA 2XA7M 2ZD8A 3V5MA 3VP4A 3VFHA 3MQQA 4O01A 2EFXA 2XRNA 3IS2B 2G2UA 1ES2A 4HIAA 1VM1A 3LR4A 3D72A 4Y0OA 1HLUP 3NOTC 3T4QA 4DE3A 2VGJA 1J3WA 2JCHA 2Y79A 3BYDA 4S2OA 4ARZB 2HJ9C 3ITAA 4MLLA 3W2ZA 3LGOA 5CGXA 5GL9A 2XR0A 1IEMA 4M3KA 3T4KA 5EVIB 2BTFP 2WKHA 1G6OA 2I72A 2VV8A 3LUQA 4KQDA 3QNCA 2C5WB 4DN0A 3UO9A 2P74A 3NC8A 4FH2A 4GDNA 5FQMA 3T1RA 4H6JA 4EV4A 1K25A 1M6KA 3UB9A 1N9LA 2HF6A 4XT2A 3FWLA 4NEED 5HPFA 4S2NC 3CJMA 3KSFA 3S7QA 1NZOA 2Y8HA 4E3IA 4KZ4A 2LB5A 2XF3A 1GHMA 1FOFA 5HZHA 4EWFA 4CLCA 5DF9A 2V1ZA 1CEGA 3BFEA 1XGIA 2INWA 3JPUA 2VKSA 4PAUA 3V3SA 4MDZA 4N1XA 1GSWA 2V8FA 1FR6A 4KG5A 2JKTM 5EE8A 2K2NA 4FTXA 4LENA 2HP6A 2Y2JA 4HNBA 5FAOA 4B4XA 3RXWA 1NJ4A 4S2PA 4GW9A 3WRZA 3CLOA 1K4FA 1S1YA 2I9VA 3F1NB 3ZFZA 2W3DA 4AFIA 1Z09A 1T18A 1NXYA 4NXBA 2ZC7A 4X55A 2W1RA 5L09A 2Y4AA 4JGRA 1YSPA 1W8YA 2JC7A 4HBUA 4S2MA 3BFFA 4HHDA 3NCKA 5F69A 3T4JA 4Y0UA 5J8XA 4OOMA 1W5DA 1BTLA 4S2LA 5HSQA 2WKRA 3IHBA 2HV1A 3LYXA 2YKHA 3DBAA 3N8LA 2JN7A 2XEPA 5CERA 1VHMA 4DE0A 4UA9A 2ZL1B 1IYQA 4OQHA 1M40A 4ZAMA 2ZBBA 2V2FF 3O86A 1N9NA 3IHAA 1WYBA 3OCLA 4CLCE 1EROA 5DJUA 3R7WB 3R4KA 3G2YA 4BLMA 3C5AA 2W3HA 3MQ0A 2VJWA 5F5YA 4WF0A 5E2FA 3P98A 1XJ6A 4IBRA 3ZVTA 4Y3IA 3W4OA 2VV7A 3G35A 3QP5A 2BASA 4C3QA 3IQAA 1JVJA 3S22A 3D4FA 2Y2HA 5M1AA 3GECA 1CJFA 3DTEA 3ZG7B 2HDUA 3RJUA 3SOIA 4EESA 3ZQ5A 3UB8A 2Y2KA 3TOIA 4Y13A 2Y2GA 3P01A 2Y2MA 3CUEA 3QNBA 4HJ4A 3DAVA 2J80A 5EOOA 2X71A 2FFFB 3H82B 2XDMA 1VB6A 5CXWA 1IELA 3F1OB 4PM8A 4QU3A 2Z6DA 4OH0A 2K7SA 2QKPA 1NYMA 5JYOA 2HZ5A 4BBVA 5TBMB 2X01A 1D7EA 3NIAA 2V1AA 4Q8IA 4BBUA 1GHPA 3IS2A 4LFUA 5FI2A 3E2KA 1HD8A 5I5LA 1LSWA 3G32A 4KG2A 5HX9A 3C8CA 1SCWA 4YNRA 3BY9A 5L2FA 2W0NA 1F98A 2WKEA 3IF6B 1KGGA 1DJCA 2HGVA 4OPRA 2RL3A 4ZJ3A 4BENA 2D01A 1YLYA 3GDIA 3QP2A 2BG1A 4LPZA 4IBXA 5CHMA 3R7WA 4QJGA 3U2AA 3TW8A 5EECA 2XQZA 4N1HA 1IOUA 4QPRA 2WGWA 1PI5A 2O0YA 5GHXA 1KVMA 5FAQA 1XFNA 3WWXA 3PBNA 4HH2A 3MFDA 4KZ6A 2OLUA 1IKGA 1YQSA 5CGWA 1ZHHB 3C4PA 1NZUA 3EGXC 3OPPA 1XFQA 2QPNA 2XFTA 5FDSA 1EI5A 1P9WA 2ZOHA 3VOYA 4XUZA 2PT7A 3F1PB 4P6BA 2JE5A 4GNUA 4GJ4A 3UB6A 5AQ7A 1XXMA 2EX2A 3W4PA 4HJ3A 1E25A 1LSXA 4PM9A 5TGFA 1C3BA 4HQAA 3HCYA 3SH8A 1MC0A 3DW0A 4BWIA 5KIZA 4UQIM 3S4XA 1NRJA 4GHIB 4R38A 2Y2NA 1K4EA 1DJBA 3KSIA 2P9VB 4I39A 5JYPA 3T12B 4F3LB 1HZOA 2VX8A 3ZHHA 2ZQ9A 3SH9A 1CI9A 2J9OA 4X25A 3EQUA 3ULFA 1FILA 1U60A 3A3FA 4BBTA 4MEZA 3C4OA 2ZQ8A 5CTNA 3V50A 3ITBA 3AGDA 2UWXA 3C30A 1TDGA 3NJAA 2H5SA 1Y4OA 5KZHA 3AGEA 1CQAA 2WUQA 5FAPA 3HLWA 3UE6A 4H8RA 3RXXA 4GLQA 1K57C 4EBLA 2OOLA 2MJ6A 5G18A 3GR2A 5E2HA 5TFQA 3FKWA 1DJAA 2VZWA 4IUHA 4OQIA 5AVEA 3B47A 4MBFA 5KSHA 3Q07A 1MWUA 4R6LA 3JVUA 5DF8A 5FI6A 5E2EA 1Z6FA 4KZ7A 3EQVA 1OTBA 2W1TA 3ISGA 4KQOA 4RQ9A 5HDDA 1PYYA 2LB9A 1YMSA 3CG5A 3TJZC 4KG6A 4NK3A 4ETZA 4Q0HA 4WBGA 1K56A 1XX2A 2HJEA 4ZDXA 1K57A 2B18A 1H3QA 2WAEA 2PYRA 2DMWA 1G6AA 2AVXA 5CX7A 3NY4A 3EOIA 2UV0E 3OPHA 3Q82A 3KO6A 3BRMA 3FG8A 3IX8A 5HPIA 4L9FA 4Z1WA 4RX2A 1EWZA 1CF0A 3UPNA 4GS9A 1LI9A 2QJ7A 5J4EA 1V9ZA 3UDIA 4IUKA 3KYZA 1ZG6A 2PR5A 3Q7ZA 1N4OA 5F1GA 3VE3A 3A3DA 1YM1A 4CLCC 5D3OA 3HLDA 4B4ZA 4DDSA 3GVBA 4WUJA 4WEJA 3Q7VA 4MN7A 4HH3A 1J9MA 3WS5A 3N6IA 1ES5A 4LV0A 2EA9A 1MBLA 4GKUA 3L9KA 1GA9A 5DVAA 1HVBA 2EWWA 4WZ5A 2Y2OA 1BUEA 3HREA 5FATA 3LIBA 2VGLM 3LR3A 1BT5A 4D60A 2G2WA 1S4SA 4WLAA 4R1GA 1W8QA 5EOEA 4G3KA 1S6RA 1IKIA 1FR1A 4UEYA 4DXCA 3CPTA 4DF6A 4I5SA 1SHVA 1GCEA 4MMNA 4UA7A 4HEFA 3H82A 3E4QA 5K5BA 3UE1A 2EXAA 3HUOA 2IWDA 2ZC5B 3UDFA 4EEUA 2KX6A 5HDCA 4JGPA 4E6WA 2V20A 3T1QB 3K3DA 2PD8A 1N9BA 3VP1A 3TE8A 4R3JA 4OQ0A 2L4RA 3LCEA 2Y2LA 3IH9A 5CRFA 1ERMA 4CLCD 3RH8B 4Y15A 1MXOA 4EQ1A 2ZM2A 4JF6A 1WA9A 4OP5A 3CPTB 4Y0TA 2Z2LB 5FEGA 3IWIA 1YLJA 1KGFA 2X02A 4CLCB 4JF5A 1VEUB 3PR6A 2ZJ9A 3G4PA 4EQIA 4KQQA 3S7PA 1YLZA 1T1CA 1G28A 4WZ5C 4R23A 2IWCA 4HP9A 2R9XA 3BLMA 3LO7A 2E8IA 3GMWA 3T4LA 5EM0A 1RP5A 3V67A 3H7WB 2J3TC 4RVAA 4KZBA 3G34A 3NBLA 4OPYA 1TS7A 2PDRA 2Z2MB 1S4RA 3O5YA 3OPRA 4Q0IA 3A3EA 1BZAA 1PW8A 3PHYA 3LICA 2YKFA 2HPBA 4R3BA 1H5XA 3IT9A 2Y2IA 3QP4A 4JXVA 1YPRA 2WADA 3SH7A 2DRWA 2W3GA 2NUTC 3VMAA 2ZC4B 3Q81A 3ZG0A 2JHEA 1OMEA 4N9LA 3VP0A 3ZG9B 1ZKJA 4D2OA 2OSUA 2P08A 3BLSA 3FC7A 2P7JA 3LEZA 2WGVA 1MY8A 3TSGA 4I3JA 5FQ9A 1S66L 1FQGA 5HD3A 3E4PA 3GRJA 4U3TA 1JNUA 1BLCA 1QMEA 2FFYA 2V0WA 4KZ3A 2ZQDA 5F82A 2GJ3A 5HAQA 2L1MA 3EEAA 3NDEA 2WZXA 2D02A 5AJGA 1E3UA 4MBKA 3MS6A 3N8RA 1X0OA 1SKOB 3G30A 3NOPC 1K0KA 5G4ZA 3QP8A 3HUMA 4F94A 2WGWB 3CHWP 4WMCA 1YSQA 4OKPA 3T4OA 2BLSA 2WKIA 4IVIA 3WRTA 3LIAA 5GHYA 4HJ6A 4EW7A 3IH8A 1K54C 2ACGA 5AVFA 4K08A 1NRFA 3MXSA 3LY3A 1CK3A 4KQRA 2V8CA 1NY0A 3NECA 3VSLA 5FASA 4K0WA 4LCMA 2O9BA 2Q9NA 4BL3A 2V1BA 5TJJA 4LCLA 5F68A 1OT6A 5A92A 5E2GA 3VP2A 4L9GA 1PI4A 3ZVWA 3C7UA 2JBFA 1L0GA 4GN2A 1H8MA 4FD8A 5FL3A 2CMNA 3NHQA 1TS6A 4LGWA 1YLPA 4JXGA 1UWNX 1IYPA 2A24A 4C6YA 3MSHA 1N9OA 4HP4A 3IXBA 2XGNA 3VFFA 3HLFA 4FUWA 4ARZA 3JVVA 3Q1FA 1BLHA 4I3IA 2QYBA 2XA7S 4MCWA 4LRYC 5HARA 5HWVA 4WMCD 4L0LA 2KLIA 4EUZA 3CI6A 3OZHA 1LSVA 1TVFA 3LIFA 3WS4A 1K55A 1KE0A 2OWJA 4CQHA 1ZG4A 5DFYA 5CHJA 1GSXA 4KENB 3PTEA 1TEMA 1MKMA 4KZ5A 5FI7A 5AQBA 2HDQA 3S7NA 5DTKA 2EWVA 2XH9A 4E04A 3D9YA 3PAEA 3CAXA 4S2JA 1E3UD 4MBHA 2ZQCA 3T1XA 3FKVA 1IYOA 2ZC6B 1GA0A 1K38A 4GDBA 4Z9QA 2W3EA 4ZJ1A 1UGUA 2ZQ7A 2J3WA 3IWQA 3AGFA 4UA6A 3EEHA 3BWLA 4OOYA 4GOGA 3A0SA 2XROA 2J3TD 1WE4A 3SZTA 3A3IA 1I2SA 4JPMA 1TF1A 1VEUA 1QMFA 2W3FA 4NXFA 2PR6A 4PM6A 1MZUA 3LI8A 1JWPA 3KYQA 1JTGA 2ZM8A 1NLYA 5E43A 4E3OA 2Y2QA 1K56D 2QJ5A 1SDEA 4MNRA 4RA7A 4KZ8A 1H8ZA 1BULA 1AXBA 1JTDA 4NXEA 1H8YA 1XGJA 4G3WA 4BD0A 4H6JB 1P0ZA 2B5RA 3QP1A 4LRZE 2Z6CA 1OT9A 5GLAA 4EBPA 1PWGA 1ODVA 4P0MA 5J7EA 4JXSA 2J9PA 2HP5A 2HP9A 4OOLA 4QWOA 1ZC2A 4MN6A 3CMZA 3A3JA 1Y54A 4RX3A 5F1FA 4BJPA 5L07A 2RCXA 1DP9A 3FPVA 2H0TA 1MWSA 3KYEA 4XXRA 5KMWA 1JWZA 1H0MA 4LLOB 4OLDA 1YAXA 2WGIA 3KSHA 1LI0A 1EW0A 3ZG8B 3HJKA 4EUVA 3ZNTA 1NWZA 3SS5A 4EERA 4QHCA 2PRFA 2W1TB 4R70A 3UB7A 4KUOA 2PYPA 3C38A 2ZLYA 3BFGA 2XFSA 5FA7A 3Q7VB 3DTMA 2XK1A 4X69A 2OAQ1 2B95A 3MBZA 2H0YA 4HOIA 1FCOA 1L0DA 3C2WA 5IS1A 2Y2PA 3WS1A 2Y59A 5MC7A 5FSRA 1T1BA 5AQAA 4IJGA 4QB8A 2H10A 1I5QA 4E3LA 3UDXA 2DNSA 3BW6A 5FQJA 3HLCA 5F83A 4YINA 2J8YA 4Y5FA 3U4LP 1I2WA 3UPOA 3SS4A 3ZG5A 1GSVA 5EVID 4YOFA 5EV0A 2V9AA 1WYCA 1Y28A 2ZQAA 2ZC3B 1F2KA 3FV7A 3ZCZA 1L3LA 3LY4A 2WKQA 4KZAA 3DTKA 2ZL1A 1NYYA 3KSGA 4S2KA 4UAAA 1LL5A 3IXHA 1PNEA 3IBRA 1LL9A 3OBFA 3IXDA 3BY8A 3LR0A 2CC1A 4R4SA 2JKRI 4P87A 1DP6A 1LLBA 3T1SA 2VGKA 4UHUA 1E4DA 4EU0A 3BM6A 3E98A 5CTMA 3UE3A 4Q0JA 4P85A 2ZMAA 1YLWA 3DTIA 3NULA 3UE0A 3S1YA 3E2LA 1D1JA 1S67L 1XPBA 3CUEC 2K31A 3ICYA 4I3AA 3VP3A 3VE4A 1KE4A 1YT4A 4A5RA 2JKFA 4K91A 4HBTA 1ONGA 1KOUA 3MQOA 4KUKA 3O3VA 4PPRA 4WN5A 2HDRA 4U0XA 1TD5A 4NETA 5DTSA 3OOVA 5EM1A 5LBRA 2OV5A 2PD7A 5IU1A 3HL9A 1O07A 2A49A 4WM9A 3HVFA 3IF5A 4O7DA 4HI4A 4OPQA 5GHZA 1SKFA 2O9CA 2WKPA 1HTZA 3HLBA 2OAP1 1S0WA 1L0EA 5HDSA 1PW1A 3ZDJA 4GCZA 1ZTUA 3IWOA 3CZDA 5HFOA 4JGQA 3UMDA 3PBQA 3G31A 2Y55A 3E0YA 3PBRA 1PZOA 3OPLA 3DWZA 1F9IA 3MZDA 4S2NA 4S2IA 4QD4A 1T19A 1KVLA 2P04A 3IF6C 2JKRM 1P97A 2VK3A 4NG2A 3I7JA 3T50A 4WYYA 2GX5A 1YMXA 1XA7A 1KGEA 1OTAA 4LV2A 1RCJA 3SS3A 3K3CA 4KZ9A 3M6HA 1KDSA 4WELA 3CITA 3JYIA 5FDHA 5G4YA 4II7A 1VETB 5HWWA 3BJNA 2OLVA 1YKDA 3PYPA 5HAIA 3N8SA 3NDGA 3VV4A 5BOHA 4O0PA 3HBRA 5M19A 3LR5A 4OVDA 3P7NA 1FSYA 5HD5A 2GNXA 2ZM0A 3MF0A 4IHQA 1W7FA 4M4XA 4QY6A 2R78A 3QHYA 4CPKA 4ETXA 1XJ3A 3PXPA 5TR7A 3F1PA 1BLPA 1TS0A 3UPPA
chains in the Genus database with same CATH topology
4R4RA 5GLDA 4JKTA 5KSHA 4S2OA 3Q07A 1MWUA 2EX9A 5DF8A 1K6RA 3ZGAB 3ITAA 4MLLA 5FI6A 5E2EA 4EUZA 1Z6FA 4KZ7A 1ONHA 3OZHA 3EQVA 5CGXA 5GL9A 2XR0A 1K6SA 1TVFA 4N9KA 4X6TA 3HLGA 1IEMA 4M3KA 3WS4A 1ES3A 1K55A 1KE0A 4E6XA 5EVIB 3ISGA 4KQOA 1ZG4A 4CJNA 2WKHA 5CHJA 2I72A 4KENB 5CGSA 3QNCA 2C5WB 3UO9A 1PYYA 2P74A 3NC8A 3BECA 4FH2A 4GDNA 5FQMA 5FQIA 1YMSA 3PTEA 1TEMA 3CG5A 1KE3A 4EV4A 1K25A 3OCNA 4KZ5A 4KG6A 3FYZA 1M6KA 4NK3A 5FI7A 1K54A 5AQBA 4DE1A 3HLEA 2HDQA 5DTKA 4WBGA 2XH9A 1K56A 3PAEA 1XX2A 5EVIA 4S2JA 4ZDXA 3DWKA 3FWLA 1E3UD 1K57A 4MBHA 4S2NC 4JXWA 2WAEA 2ZQCA 3CJMA 3FKVA 1IYOA 2ZC6B 1GA0A 1K38A 1G6AA 1NZOA 4GDBA 3NY4A 4Z9QA 4E3IA 4ZJ1A 4KZ4A 2XF3A 2ZQ7A 1XA1A 3OPHA 3Q82A 1GHMA 3IWQA 1FOFA 4N92A 3AGFA 4UA6A 3BRMA 3HUNA 4OOYA 4E3MA 4GOGA 4EWFA 1WE4A 4X68A 2QZ6A 5DF9A 4RX2A 2V1ZA 5AQ9A 3A3IA 1CEGA 1EWZA 1I2SA 3BFEA 1W79A 1XGIA 4JPMA 3UPNA 1LI9A 1QMFA 3V3SA 3UDIA 4N1XA 1FCMA 1Q2PA 3N4IA 1FR6A 1ZG6A 4KG5A 3Q7ZA 1N4OA 4PM6A 5F1GA 3A3DA 1JWPA 5FQQA 1YM1A 5EE8A 1JTGA 2ZM8A 5E43A 5D3OA 4RYEA 3HLDA 4LENA 4B4ZA 4E3OA 2HP6A 2Y2JA 2Y2QA 5FAOA 1MWRA 4DDSA 1K56D 5GLCA 4B4XA 3GVBA 3RXWA 4WEJA 1NJ4A 1SDEA 2WAFA 1PIOA 4MNRA 4RA7A 4S2PA 3WRZA 4KZ8A 4JLFA 3Q7VA 1H8ZA 1K4FA 1BULA 2WK0A 1J9MA 3ZFZA 3WS5A 3N6IA 4JF4A 1ES5A 1AXBA 1JTDA 1RGZA 4FSFA 1MBLA 4GKUA 4LV0A 1H8YA 1GA9A 1NXYA 1XGJA 5DVAA 1HVBA 4X55A 2ZC7A 1O7EA 4BD0A 2B5RA 2Y4AA 4WZ5A 2C6WB 4YFMA 2Y2OA 3W8KA 1BUEA 1W8YA 5GLAA 3HREA 5FATA 4EBPA 1PWGA 4P0MA 2JC7A 4HBUA 3MKEA 4X53A 4S2MA 1BT5A 2EFUA 3BFFA 4JXSA 4DKIA 2PU4A 2J9PA 1CI8A 4OLGA 1CEFA 1JWVA 3MXRA 2HP5A 4R0QA 2HP9A 3NCKA 2G2WA 3UY6A 4OOLA 3GSGA 4Y0UA 5HAPA 1ZC2A 4OOMA 5J8XA 1W5DA 1XKZA 1BTLA 1W8QA 2QMIA 3A3JA 3CMZA 4R1GA 1Y54A 4S2LA 5EOEA 4RX3A 5F1FA 1S6RA 1IKIA 1FR1A 4BJPA 2RCXA 3IHBA 2H0TA 1MWSA 3WS0A 3N8LA 4DXCA 4XXRA 4DF6A 1SHVA 1GCEA 5KMWA 1JWZA 3GTCA 4UA7A 4OLDA 4HEFA 2XEPA 1FCNA 5CERA 4DE0A 2WGIA 2XD1A 4UA9A 5EVIC 1MKIA 3O87A 3UE1A 1LI0A 2XLNA 1IYQA 2EXAA 2EX8A 2IWDA 3HUOA 4OQHA 3ZG8B 2ZC5B 5HW3A 3UDFA 3ZNTA 3SS5A 1M40A 4QHCA 4ZAMA 4PM7A 2V2FF 4E6WA 2V20A 1ESUA 4OPZA 3O86A 3IHAA 3UN7A 1WYBA 4PMAA 3OCLA 1N9BA 3VP1A 4WEKA 1PZPA 1EROA 2ZLYA 1MWTA 3BFGA 2XFSA 4R3JA 5FA7A 3Q7VB 4OQ0A 3G2ZA 3G2YA 3DTMA 3LCEA 4BLMA 2XK1A 2Y2LA 3C5AA 3IH9A 4X69A 1ERMA 5CRFA 1MXOA 3MBZA 4IVKA 2ZM2A 2H0YA 5E2FA 3P98A 5CEBA 3PBSA 3NI9A 4JF6A 4IBRA 4OP5A 1FCOA 1L0DA 3C7VA 3ZVTA 2Y2PA 4Y0TA 2Z2LB 2Y59A 3M2JA 3W4OA 3WS1A 1GHIA 3IWIA 1YLJA 5FSRA 1KGFA 2X02A 3G35A 4PM5A 5AQAA 4DE2A 4JF5A 4QB8A 4C3QA 1VQQA 1JVJA 2H10A 3IQAA 3S22A 1I5QA 1ALQA 2Y2HA 3D4FA 5M1AA 4E3LA 4U0TA 3ZG7B 2HDUA 3UDXA 2DNSA 3RJUA 2ZJ9A 5FQJA 3SOIA 3G4PA 4X56A 3HLCA 5F83A 4EQIA 4KQQA 5IHVA 5M18A 4YINA 2J8YA 2Y2KA 3TOIA 3BEBA 2Q9MA 2Y2GA 3BFDA 4DDYA 2GDNA 1I2WA 2Y2MA 1Q2QA 4EBNA 5HL1A 1YLZA 3MZFA 3QNBA 4ID4A 4WZ5C 3VOZA 4R23A 3SS4A 3UPOA 3ZG5A 5EOOA 2R9XA 2IWCA 2X71A 2FFFB 1RGYA 3BLMA 3LO7A 2E8IA 3GMWA 3B3XA 2XDMA 4GD6A 1RP5A 4WZ4A 5EVID 3PAGA 4RVAA 5CXWA 1IELA 1L2SA 5GLBA 1ESIA 4KZBA 1WYCA 3TG9A 3G34A 2ZQAA 3NBLA 4OPYA 3PBTA 4XUXA 2ZC3B 4PM8A 1PWCA 2Z2MB 3OPRA 4QU3A 3GQZA 3FV7A 3A3EA 1BZAA 4OH0A 3ZCZA 1PW8A 1L0FA 4ZTKA 3LY4A 2HPBA 1NYMA 4KZAA 5JYOA 4R3BA 1H5XA 1NYYA 2X01A 3IT9A 3N7WA 2Y2IA 3NIAA 4S2KA 4Q8IA 4UAAA 5CEDA 1GHPA 3IXGA 4LV3A 1LL5A 2DCFA 3IXHA 5FI2A 4ZJ2A 3E2KA 1LL9A 1HD8A 3GV9A 3G32A 4KG2A 3IXDA 5HX9A 1FSWA 2CC1A 4R4SA 4JXVA 1SCWA 4P87A 5L2FA 2WADA 3SH7A 1LLBA 2DRWA 2VGKA 4UHUA 1E4DA 3BM6A 5CTMA 3UE3A 2WKEA 3IF6B 1KGGA 1DJCA 4P85A 2ZMAA 3VMAA 3W4QA 4OPRA 2ZC4B 5U47A 1YLWA 2A3UA 2RL3A 3Q81A 4ZJ3A 3MZEA 3ZG0A 1OMEA 1KDWA 4BENA 4N9LA 3UE0A 3VP0A 4OQGA 1YLYA 3V39A 1ZKJA 3ZG9B 3S1YA 3ZNYA 4GB7A 4D2OA 2OSUA 3BLSA 3E2LA 4E3KA 4HESA 1XPBA 2BG1A 1XP4A 5A90A 3M6BA 1BLSA 3VP3A 3LEZA 1TDLA 2WGVA 4IBXA 5CHMA 4QJGA 5CHUA 1KE4A 2P9VA 1YT4A 4A5RA 1G68A 4K0XA 1MY8A 4OP8A 3TSGA 5KSCA 5EECA 5FQ9A 5I94A 1FQGA 4K91A 2XQZA 4N1HA 4HBTA 3UNWA 1ONGA 5EUAA 2R9WA 2WGWA 1PI5A 2Y91A 3GRJA 3O3VA 4PPRA 2HDRA 5GHXA 4Y7PA 1KVMA 4U0XA 4U3TA 5FAQA 4NETA 5DTSA 5FQKA 1BLCA 1QMEA 2FFYA 2PU2A 3WWXA 4KZ3A 3PBNA 4BL2A 3MFDA 4KZ6A 2OLUA 2WZZA 2OV5A 2ZQDA 1IKGA 1YQSA 5CGWA 5F82A 4E3JA 5HAQA 1ERQA 2EX6A 3HL9A 1O07A 3NDEA 3C4PA 2A49A 1ES4A 2WZXA 1NZUA 3HVFA 3OPPA 4WM9A 4B88A 3IF5A 4O7DA 4OPQA 4IEDA 5GHZA 1E3UA 1SKFA 2QPNA 1SDNA 2XFTA 1HTZA 5EPHA 4BQMA 4MBKA 3FZCA 3HLBA 3N8RA 3WS2A 5A91A 1DY6A 1EI5A 3BFCA 1S0WA 4LV1A 1L0EA 3G30A 3VOYA 2IWBA 4XUZA 4BD1A 4P6BA 3OC2A 2JE5A 1PW1A 4GNUA 3ZDJA 5AQ7A 3HUMA 1XXMA 4F94A 2EX2A 2WGWB 4FH4A 3IWOA 4WMCA 3W4PA 3CZDA 1E25A 4OKPA 5HFOA 4PM9A 2BLSA 1C3BA 5EVLA 1MPLA 1PWDA 3PBQA 5TGFA 3G31A 4ZBEA 2WKIA 4IVIA 2J7VA 3WRTA 5GHYA 4OONA 3IH8A 3SH8A 1K54C 2Y55A 1NRFA 3MXSA 3PBRA 1PZOA 3DW0A 3LY3A 3OPLA 3DWZA 1CK3A 3MZDA 4FCFA 4KQRA 2EXBA 3S4XA 1NY0A 1IYSA 3V3RA 4S2NA 4S2IA 2XD5A 4QD4A 1YLTA 3VSLA 4K0WA 1KVLA 5FASA 4LCMA 2Y2NA 2Q9NA 1K4EA 3IF6C 3VSKA 4BL3A 4LCLA 3P09A 2PBYA 2HDSA 5A92A 3I7JA 5E2GA 1K55C 1DJBA 3O88A 4WYYA 5DF7A 3VP2A 1YMXA 2WYXA 1PI4A 4JBFA 5A93A 1XA7A 5CECA 1KGEA 3PBOA 3ZVWA 2P9VB 4E3NA 5JYPA 4LV2A 1RCJA 3C7UA 3MKFA 3SS3A 2JBFA 4QY5A 1HZOA 1L0GA 4KZ9A 3IF6A 4GN2A 3ZHHA 4DXBA 3M6HA 2ZQ9A 4C75A 1KDSA 4FD8A 1BSGA 4WELA 3SH9A 5DTTA 1CI9A 3JYIA 2J9OA 5FDHA 3EQUA 1YLPA 2OLVA 1U60A 3A3FA 4JXGA 3M2KA 3N8SA 1IYPA 3NDGA 4MEZA 5HAIA 3C4OA 5BOHA 2ZQ8A 5CTNA 3V50A 4C6YA 3ITBA 3AGDA 2UWXA 1TDGA 3HBRA 2H5SA 4DRTA 5M19A 5KZHA 1LHYA 3AGEA 3IXBA 4OVDA 2XGNA 3VFFA 3HLFA 2WUQA 5FAPA 3HLWA 4GD8A 4GZBA 1FSYA 3Q1FA 4H8RA 1BLHA 3RXXA 2ZD8A 3V5MA 3VP4A 2ZM0A 3VFHA 1W7FA 1K57C 2EFXA 4QY6A 3QHYA 4EBLA 5G18A 2G2UA 1ES2A 3GR2A 5E2HA 5TFQA 4CPKA 1VM1A 3FKWA 1DJAA 4Y0OA 4OQIA 4DE3A 5TR7A 1BLPA 2VGJA 5HARA 2JCHA 3UPPA 4WMCD 3BYDA 4MBFA 4L0LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R4R A;  5GLD A;  4JKT A;  5KSH A;  4S2O A;  3Q07 A;  1MWU A;  2EX9 A;  5DF8 A;  1K6R A;  3ZGA B;  3ITA A;  4MLL A;  5FI6 A;  5E2E A;  4EUZ A;  1Z6F A;  4KZ7 A;  1ONH A;  3OZH A;  3EQV A;  5CGX A;  5GL9 A;  2XR0 A;  1K6S A;  1TVF A;  4N9K A;  4X6T A;  3HLG A;  1IEM A;  4M3K A;  3WS4 A;  1ES3 A;  1K55 A;  1KE0 A;  4E6X A;  5EVI B;  3ISG A;  4KQO A;  1ZG4 A;  4CJN A;  2WKH A;  5CHJ A;  2I72 A;  4KEN B;  5CGS A;  3QNC A;  2C5W B;  3UO9 A;  1PYY A;  2P74 A;  3NC8 A;  3BEC A;  4FH2 A;  4GDN A;  5FQM A;  5FQI A;  1YMS A;  3PTE A;  1TEM A;  3CG5 A;  1KE3 A;  4EV4 A;  1K25 A;  3OCN A;  4KZ5 A;  4KG6 A;  3FYZ A;  1M6K A;  4NK3 A;  5FI7 A;  1K54 A;  5AQB A;  4DE1 A;  3HLE A;  2HDQ A;  5DTK A;  4WBG A;  2XH9 A;  1K56 A;  3PAE A;  1XX2 A;  5EVI A;  4S2J A;  4ZDX A;  3DWK A;  3FWL A;  1E3U D;  1K57 A;  4MBH A;  4S2N C;  4JXW A;  2WAE A;  2ZQC A;  3CJM A;  3FKV A;  1IYO A;  2ZC6 B;  1GA0 A;  1K38 A;  1G6A A;  1NZO A;  4GDB A;  3NY4 A;  4Z9Q A;  4E3I A;  4ZJ1 A;  4KZ4 A;  2XF3 A;  2ZQ7 A;  1XA1 A;  3OPH A;  3Q82 A;  1GHM A;  3IWQ A;  1FOF A;  4N92 A;  3AGF A;  4UA6 A;  3BRM A;  3HUN A;  4OOY A;  4E3M A;  4GOG A;  4EWF A;  1WE4 A;  4X68 A;  2QZ6 A;  5DF9 A;  4RX2 A;  2V1Z A;  5AQ9 A;  3A3I A;  1CEG A;  1EWZ A;  1I2S A;  3BFE A;  1W79 A;  1XGI A;  4JPM A;  3UPN A;  1LI9 A;  1QMF A;  3V3S A;  3UDI A;  4N1X A;  1FCM A;  1Q2P A;  3N4I A;  1FR6 A;  1ZG6 A;  4KG5 A;  3Q7Z A;  1N4O A;  4PM6 A;  5F1G A;  3A3D A;  1JWP A;  5FQQ A;  1YM1 A;  5EE8 A;  1JTG A;  2ZM8 A;  5E43 A;  5D3O A;  4RYE A;  3HLD A;  4LEN A;  4B4Z A;  4E3O A;  2HP6 A;  2Y2J A;  2Y2Q A;  5FAO A;  1MWR A;  4DDS A;  1K56 D;  5GLC A;  4B4X A;  3GVB A;  3RXW A;  4WEJ A;  1NJ4 A;  1SDE A;  2WAF A;  1PIO A;  4MNR A;  4RA7 A;  4S2P A;  3WRZ A;  4KZ8 A;  4JLF A;  3Q7V A;  1H8Z A;  1K4F A;  1BUL A;  2WK0 A;  1J9M A;  3ZFZ A;  3WS5 A;  3N6I A;  4JF4 A;  1ES5 A;  1AXB A;  1JTD A;  1RGZ A;  4FSF A;  1MBL A;  4GKU A;  4LV0 A;  1H8Y A;  1GA9 A;  1NXY A;  1XGJ A;  5DVA A;  1HVB A;  4X55 A;  2ZC7 A;  1O7E A;  4BD0 A;  2B5R A;  2Y4A A;  4WZ5 A;  2C6W B;  4YFM A;  2Y2O A;  3W8K A;  1BUE A;  1W8Y A;  5GLA A;  3HRE A;  5FAT A;  4EBP A;  1PWG A;  4P0M A;  2JC7 A;  4HBU A;  3MKE A;  4X53 A;  4S2M A;  1BT5 A;  2EFU A;  3BFF A;  4JXS A;  4DKI A;  2PU4 A;  2J9P A;  1CI8 A;  4OLG A;  1CEF A;  1JWV A;  3MXR A;  2HP5 A;  4R0Q A;  2HP9 A;  3NCK A;  2G2W A;  3UY6 A;  4OOL A;  3GSG A;  4Y0U A;  5HAP A;  1ZC2 A;  4OOM A;  5J8X A;  1W5D A;  1XKZ A;  1BTL A;  1W8Q A;  2QMI A;  3A3J A;  3CMZ A;  4R1G A;  1Y54 A;  4S2L A;  5EOE A;  4RX3 A;  5F1F A;  1S6R A;  1IKI A;  1FR1 A;  4BJP A;  2RCX A;  3IHB A;  2H0T A;  1MWS A;  3WS0 A;  3N8L A;  4DXC A;  4XXR A;  4DF6 A;  1SHV A;  1GCE A;  5KMW A;  1JWZ A;  3GTC A;  4UA7 A;  4OLD A;  4HEF A;  2XEP A;  1FCN A;  5CER A;  4DE0 A;  2WGI A;  2XD1 A;  4UA9 A;  5EVI C;  1MKI A;  3O87 A;  3UE1 A;  1LI0 A;  2XLN A;  1IYQ A;  2EXA A;  2EX8 A;  2IWD A;  3HUO A;  4OQH A;  3ZG8 B;  2ZC5 B;  5HW3 A;  3UDF A;  3ZNT A;  3SS5 A;  1M40 A;  4QHC A;  4ZAM A;  4PM7 A;  2V2F F;  4E6W A;  2V20 A;  1ESU A;  4OPZ A;  3O86 A;  3IHA A;  3UN7 A;  1WYB A;  4PMA A;  3OCL A;  1N9B A;  3VP1 A;  4WEK A;  1PZP A;  1ERO A;  2ZLY A;  1MWT A;  3BFG A;  2XFS A;  4R3J A;  5FA7 A;  3Q7V B;  4OQ0 A;  3G2Z A;  3G2Y A;  3DTM A;  3LCE A;  4BLM A;  2XK1 A;  2Y2L A;  3C5A A;  3IH9 A;  4X69 A;  1ERM A;  5CRF A;  1MXO A;  3MBZ A;  4IVK A;  2ZM2 A;  2H0Y A;  5E2F A;  3P98 A;  5CEB A;  3PBS A;  3NI9 A;  4JF6 A;  4IBR A;  4OP5 A;  1FCO A;  1L0D A;  3C7V A;  3ZVT A;  2Y2P A;  4Y0T A;  2Z2L B;  2Y59 A;  3M2J A;  3W4O A;  3WS1 A;  1GHI A;  3IWI A;  1YLJ A;  5FSR A;  1KGF A;  2X02 A;  3G35 A;  4PM5 A;  5AQA A;  4DE2 A;  4JF5 A;  4QB8 A;  4C3Q A;  1VQQ A;  1JVJ A;  2H10 A;  3IQA A;  3S22 A;  1I5Q A;  1ALQ A;  2Y2H A;  3D4F A;  5M1A A;  4E3L A;  4U0T A;  3ZG7 B;  2HDU A;  3UDX A;  2DNS A;  3RJU A;  2ZJ9 A;  5FQJ A;  3SOI A;  3G4P A;  4X56 A;  3HLC A;  5F83 A;  4EQI A;  4KQQ A;  5IHV A;  5M18 A;  4YIN A;  2J8Y A;  2Y2K A;  3TOI A;  3BEB A;  2Q9M A;  2Y2G A;  3BFD A;  4DDY A;  2GDN A;  1I2W A;  2Y2M A;  1Q2Q A;  4EBN A;  5HL1 A;  1YLZ A;  3MZF A;  3QNB A;  4ID4 A;  4WZ5 C;  3VOZ A;  4R23 A;  3SS4 A;  3UPO A;  3ZG5 A;  5EOO A;  2R9X A;  2IWC A;  2X71 A;  2FFF B;  1RGY A;  3BLM A;  3LO7 A;  2E8I A;  3GMW A;  3B3X A;  2XDM A;  4GD6 A;  1RP5 A;  4WZ4 A;  5EVI D;  3PAG A;  4RVA A;  5CXW A;  1IEL A;  1L2S A;  5GLB A;  1ESI A;  4KZB A;  1WYC A;  3TG9 A;  3G34 A;  2ZQA A;  3NBL A;  4OPY A;  3PBT A;  4XUX A;  2ZC3 B;  4PM8 A;  1PWC A;  2Z2M B;  3OPR A;  4QU3 A;  3GQZ A;  3FV7 A;  3A3E A;  1BZA A;  4OH0 A;  3ZCZ A;  1PW8 A;  1L0F A;  4ZTK A;  3LY4 A;  2HPB A;  1NYM A;  4KZA A;  5JYO A;  4R3B A;  1H5X A;  1NYY A;  2X01 A;  3IT9 A;  3N7W A;  2Y2I A;  3NIA A;  4S2K A;  4Q8I A;  4UAA A;  5CED A;  1GHP A;  3IXG A;  4LV3 A;  1LL5 A;  2DCF A;  3IXH A;  5FI2 A;  4ZJ2 A;  3E2K A;  1LL9 A;  1HD8 A;  3GV9 A;  3G32 A;  4KG2 A;  3IXD A;  5HX9 A;  1FSW A;  2CC1 A;  4R4S A;  4JXV A;  1SCW A;  4P87 A;  5L2F A;  2WAD A;  3SH7 A;  1LLB A;  2DRW A;  2VGK A;  4UHU A;  1E4D A;  3BM6 A;  5CTM A;  3UE3 A;  2WKE A;  3IF6 B;  1KGG A;  1DJC A;  4P85 A;  2ZMA A;  3VMA A;  3W4Q A;  4OPR A;  2ZC4 B;  5U47 A;  1YLW A;  2A3U A;  2RL3 A;  3Q81 A;  4ZJ3 A;  3MZE A;  3ZG0 A;  1OME A;  1KDW A;  4BEN A;  4N9L A;  3UE0 A;  3VP0 A;  4OQG A;  1YLY A;  3V39 A;  1ZKJ A;  3ZG9 B;  3S1Y A;  3ZNY A;  4GB7 A;  4D2O A;  2OSU A;  3BLS A;  3E2L A;  4E3K A;  4HES A;  1XPB A;  2BG1 A;  1XP4 A;  5A90 A;  3M6B A;  1BLS A;  3VP3 A;  3LEZ A;  1TDL A;  2WGV A;  4IBX A;  5CHM A;  4QJG A;  5CHU A;  1KE4 A;  2P9V A;  1YT4 A;  4A5R A;  1G68 A;  4K0X A;  1MY8 A;  4OP8 A;  3TSG A;  5KSC A;  5EEC A;  5FQ9 A;  5I94 A;  1FQG A;  4K91 A;  2XQZ A;  4N1H A;  4HBT A;  3UNW A;  1ONG A;  5EUA A;  2R9W A;  2WGW A;  1PI5 A;  2Y91 A;  3GRJ A;  3O3V A;  4PPR A;  2HDR A;  5GHX A;  4Y7P A;  1KVM A;  4U0X A;  4U3T A;  5FAQ A;  4NET A;  5DTS A;  5FQK A;  1BLC A;  1QME A;  2FFY A;  2PU2 A;  3WWX A;  4KZ3 A;  3PBN A;  4BL2 A;  3MFD A;  4KZ6 A;  2OLU A;  2WZZ A;  2OV5 A;  2ZQD A;  1IKG A;  1YQS A;  5CGW A;  5F82 A;  4E3J A;  5HAQ A;  1ERQ A;  2EX6 A;  3HL9 A;  1O07 A;  3NDE A;  3C4P A;  2A49 A;  1ES4 A;  2WZX A;  1NZU A;  3HVF A;  3OPP A;  4WM9 A;  4B88 A;  3IF5 A;  4O7D A;  4OPQ A;  4IED A;  5GHZ A;  1E3U A;  1SKF A;  2QPN A;  1SDN A;  2XFT A;  1HTZ A;  5EPH A;  4BQM A;  4MBK A;  3FZC A;  3HLB A;  3N8R A;  3WS2 A;  5A91 A;  1DY6 A;  1EI5 A;  3BFC A;  1S0W A;  4LV1 A;  1L0E A;  3G30 A;  3VOY A;  2IWB A;  4XUZ A;  4BD1 A;  4P6B A;  3OC2 A;  2JE5 A;  1PW1 A;  4GNU A;  3ZDJ A;  5AQ7 A;  3HUM A;  1XXM A;  4F94 A;  2EX2 A;  2WGW B;  4FH4 A;  3IWO A;  4WMC A;  3W4P A;  3CZD A;  1E25 A;  4OKP A;  5HFO A;  4PM9 A;  2BLS A;  1C3B A;  5EVL A;  1MPL A;  1PWD A;  3PBQ A;  5TGF A;  3G31 A;  4ZBE A;  2WKI A;  4IVI A;  2J7V A;  3WRT A;  5GHY A;  4OON A;  3IH8 A;  3SH8 A;  1K54 C;  2Y55 A;  1NRF A;  3MXS A;  3PBR A;  1PZO A;  3DW0 A;  3LY3 A;  3OPL A;  3DWZ A;  1CK3 A;  3MZD A;  4FCF A;  4KQR A;  2EXB A;  3S4X A;  1NY0 A;  1IYS A;  3V3R A;  4S2N A;  4S2I A;  2XD5 A;  4QD4 A;  1YLT A;  3VSL A;  4K0W A;  1KVL A;  5FAS A;  4LCM A;  2Y2N A;  2Q9N A;  1K4E A;  3IF6 C;  3VSK A;  4BL3 A;  4LCL A;  3P09 A;  2PBY A;  2HDS A;  5A92 A;  3I7J A;  5E2G A;  1K55 C;  1DJB A;  3O88 A;  4WYY A;  5DF7 A;  3VP2 A;  1YMX A;  2WYX A;  1PI4 A;  4JBF A;  5A93 A;  1XA7 A;  5CEC A;  1KGE A;  3PBO A;  3ZVW A;  2P9V B;  4E3N A;  5JYP A;  4LV2 A;  1RCJ A;  3C7U A;  3MKF A;  3SS3 A;  2JBF A;  4QY5 A;  1HZO A;  1L0G A;  4KZ9 A;  3IF6 A;  4GN2 A;  3ZHH A;  4DXB A;  3M6H A;  2ZQ9 A;  4C75 A;  1KDS A;  4FD8 A;  1BSG A;  4WEL A;  3SH9 A;  5DTT A;  1CI9 A;  3JYI A;  2J9O A;  5FDH A;  3EQU A;  1YLP A;  2OLV A;  1U60 A;  3A3F A;  4JXG A;  3M2K A;  3N8S A;  1IYP A;  3NDG A;  4MEZ A;  5HAI A;  3C4O A;  5BOH A;  2ZQ8 A;  5CTN A;  3V50 A;  4C6Y A;  3ITB A;  3AGD A;  2UWX A;  1TDG A;  3HBR A;  2H5S A;  4DRT A;  5M19 A;  5KZH A;  1LHY A;  3AGE A;  3IXB A;  4OVD A;  2XGN A;  3VFF A;  3HLF A;  2WUQ A;  5FAP A;  3HLW A;  4GD8 A;  4GZB A;  1FSY A;  3Q1F A;  4H8R A;  1BLH A;  3RXX A;  2ZD8 A;  3V5M A;  3VP4 A;  2ZM0 A;  3VFH A;  1W7F A;  1K57 C;  2EFX A;  4QY6 A;  3QHY A;  4EBL A;  5G18 A;  2G2U A;  1ES2 A;  3GR2 A;  5E2H A;  5TFQ A;  4CPK A;  1VM1 A;  3FKW A;  1DJA A;  4Y0O A;  4OQI A;  4DE3 A;  5TR7 A;  1BLP A;  2VGJ A;  5HAR A;  2JCH A;  3UPP A;  4WMC D;  3BYD A;  4MBF A;  4L0L A; 
#chains in the Genus database with same CATH topology
 4R4R A;  5GLD A;  4JKT A;  3B33 A;  2EX9 A;  1K6R A;  3ZGA B;  1ONH A;  2E8J A;  5L8M A;  2OWH A;  3E4O A;  1K6S A;  4N9K A;  4X6T A;  3HLG A;  1ES3 A;  4E6X A;  4CJN A;  3MFX A;  3TRC A;  5CGS A;  4DMZ A;  4YWZ A;  3BEC A;  5FQI A;  4ESP A;  1A0K A;  1KE3 A;  3OCN A;  1DRM A;  3A0V A;  3FYZ A;  1K54 A;  4DE1 A;  3HLE A;  5EVI A;  1W63 M;  3DWK A;  4R3A A;  4GS9 B;  2W27 A;  3QP6 A;  4JXW A;  4UQI S;  1XA1 A;  4EEP A;  4N92 A;  3HUN A;  4BMW A;  4E3M A;  4X68 A;  1V9Y A;  2QZ6 A;  3UME A;  1OPX A;  5AQ9 A;  1W79 A;  3G6O A;  3LI9 A;  2O9A A;  3F1N A;  1FCM A;  1Q2P A;  2ZOI A;  1PRQ A;  3N4I A;  5FQQ A;  3IBJ A;  3EWK A;  4RYE A;  1VET A;  1MWR A;  5GLC A;  3K2N A;  2WAF A;  1PIO A;  4EET B;  4JLF A;  4ZRR A;  4PKY G;  2WK0 A;  4JF4 A;  4MN5 A;  4FSF A;  1RGZ A;  1O7E A;  4O8G A;  4PKY A;  2C6W B;  1UWP X;  4YFM A;  3W8K A;  3MKE A;  4X53 A;  5EVE A;  2EFU A;  4DKI A;  2PU4 A;  1CI8 A;  4OLG A;  1CEF A;  2VLG A;  3IX4 A;  1JWV A;  3MXR A;  4R0Q A;  3UY6 A;  2QHK A;  3GSG A;  5HAP A;  4GHI A;  2M7U A;  4PHT A;  4P6Z M;  1XKZ A;  2QMI A;  5FEF A;  3UB5 P;  2VGL S;  1FIK A;  3WS0 A;  2V0U A;  3GTC A;  5F6A A;  2PHY A;  1FCN A;  2XD1 A;  1PFL A;  3KX0 X;  5EVI C;  1MKI A;  3O87 A;  2Q0O A;  2XLN A;  2EX8 A;  2KOI A;  5DKK A;  1LL8 A;  1XJ4 A;  1OTD A;  2FZ0 A;  5HW3 A;  2XSS A;  4PM7 A;  5C5K A;  4HY8 A;  3LEQ A;  1ESU A;  4OPZ A;  3UN7 A;  4PMA A;  4WEK A;  3BQ8 A;  1PZP A;  1MWT A;  1OTE A;  1AWI A;  4L9E A;  4X1L A;  3G2Z A;  4LRX C;  5HL6 A;  4ME4 A;  4IVK A;  5CEB A;  3PBS A;  3NI9 A;  2JKG A;  3C7V A;  2KDK A;  3EGD C;  3M2J A;  3RFB A;  1GHI A;  5DFX A;  3LIE A;  4PM5 A;  4DE2 A;  1SKO A;  1VQQ A;  1ALQ A;  5J3W A;  2ZMF A;  2FH5 A;  5A8B A;  4U0T A;  4JGO A;  4Y2F A;  4X56 A;  4DJ2 A;  4I38 A;  3D3O A;  5IHV A;  5M18 A;  3BEB A;  2Q9M A;  3BFD A;  4DDY A;  2GDN A;  4G3V A;  3VOL A;  1Q2Q A;  4EBN A;  5HL1 A;  1ACF A;  3MZF A;  2A24 B;  4ID4 A;  3VOZ A;  1RGY A;  3B3X A;  3L7H A;  4GD6 A;  4WZ4 A;  3PAG A;  1W63 Q;  1L2S A;  2M1C A;  1ESI A;  5GLB A;  1STZ A;  3T4T A;  3TG9 A;  3PBT A;  1S1Z A;  4XUX A;  1PWC A;  3MJQ A;  3GQZ A;  2PBD P;  1L0F A;  2L0W A;  4ZTK A;  1P9R A;  4Y17 A;  4B9O A;  5DJT A;  3N7W A;  2VEA A;  4X1M A;  5CED A;  3IXG A;  2IA2 A;  4LV3 A;  3H9W A;  2DCF A;  3ZYT A;  4ZJ2 A;  3SW1 A;  2M7V A;  3T4S A;  3GV9 A;  1FSW A;  5HWT A;  2H28 A;  1T1A A;  4B93 A;  5EFW A;  1OJ5 A;  3W4Q A;  5U47 A;  1F5M A;  5L10 A;  2A3U A;  3MZE A;  1KDW A;  2ZMV A;  4OQG A;  2O99 A;  3V39 A;  3RTY A;  3ZNY A;  2A2L A;  4GB7 A;  5DKL A;  4E3K A;  3MR0 A;  4HES A;  1XP4 A;  1XJ2 A;  5A90 A;  1NLZ A;  3M6B A;  1BLS A;  1LT0 A;  1OTI A;  1TDL A;  3BQA A;  5CHU A;  2P9V A;  3S7O A;  1DP8 A;  1G68 A;  2NUP C;  4K0X A;  5KSC A;  4OP8 A;  5I94 A;  3UNW A;  5EUA A;  2R9W A;  2Y91 A;  4EXO A;  1D06 A;  4Y7P A;  5FQK A;  2PU2 A;  4BL2 A;  2WZZ A;  4E3J A;  1ERQ A;  2PAV P;  2EX6 A;  1SZV A;  1ES4 A;  3F1O A;  4B88 A;  4IED A;  3FPW A;  1SDN A;  5EPH A;  4P6Z S;  4BQM A;  3FZC A;  3WS2 A;  5A91 A;  1DY6 A;  3BFC A;  4LV1 A;  1BYW A;  2IWB A;  4BD1 A;  3LID A;  3OC2 A;  4F3L A;  3A0R A;  3H7W A;  4FH4 A;  3LFV A;  2JKT I;  4XT2 B;  5EVL A;  1MPL A;  1PWD A;  4ZBE A;  2G7U A;  2J7V A;  4OON A;  2GZA A;  2QWS A;  2B02 A;  4FCF A;  2EXB A;  1IYS A;  3V3R A;  2XD5 A;  1YLT A;  3NOU C;  1OJG A;  3MXQ A;  3MMH A;  3VSK A;  3P09 A;  2PBY A;  2VV6 A;  2HDS A;  1K55 C;  5DF7 A;  1IFQ A;  3O88 A;  4DJ3 A;  5A93 A;  5CEC A;  2WYX A;  4JBF A;  3IX3 A;  2VA0 A;  3PBO A;  4NXG A;  3CWF A;  4E3N A;  3OLO A;  3MKF A;  4FOF A;  4QY5 A;  3IF6 A;  4DXB A;  4C75 A;  1BSG A;  3B42 A;  5IT5 A;  5DTT A;  3M2K A;  1G5U A;  4WL9 A;  4NKP A;  3HJI A;  4DRT A;  1LHY A;  4GD8 A;  4GZB A;  1TS8 A;  5TBM A;  2XA7 M;  2ZD8 A;  3V5M A;  3VP4 A;  3VFH A;  3MQQ A;  4O01 A;  2EFX A;  2XRN A;  3IS2 B;  2G2U A;  1ES2 A;  4HIA A;  1VM1 A;  3LR4 A;  3D72 A;  4Y0O A;  1HLU P;  3NOT C;  3T4Q A;  4DE3 A;  2VGJ A;  1J3W A;  2JCH A;  2Y79 A;  3BYD A;  4S2O A;  4ARZ B;  2HJ9 C;  3ITA A;  4MLL A;  3W2Z A;  3LGO A;  5CGX A;  5GL9 A;  2XR0 A;  1IEM A;  4M3K A;  3T4K A;  5EVI B;  2BTF P;  2WKH A;  1G6O A;  2I72 A;  2VV8 A;  3LUQ A;  4KQD A;  3QNC A;  2C5W B;  4DN0 A;  3UO9 A;  2P74 A;  3NC8 A;  4FH2 A;  4GDN A;  5FQM A;  3T1R A;  4H6J A;  4EV4 A;  1K25 A;  1M6K A;  3UB9 A;  1N9L A;  2HF6 A;  4XT2 A;  3FWL A;  4NEE D;  5HPF A;  4S2N C;  3CJM A;  3KSF A;  3S7Q A;  1NZO A;  2Y8H A;  4E3I A;  4KZ4 A;  2LB5 A;  2XF3 A;  1GHM A;  1FOF A;  5HZH A;  4EWF A;  4CLC A;  5DF9 A;  2V1Z A;  1CEG A;  3BFE A;  1XGI A;  2INW A;  3JPU A;  2VKS A;  4PAU A;  3V3S A;  4MDZ A;  4N1X A;  1GSW A;  2V8F A;  1FR6 A;  4KG5 A;  2JKT M;  5EE8 A;  2K2N A;  4FTX A;  4LEN A;  2HP6 A;  2Y2J A;  4HNB A;  5FAO A;  4B4X A;  3RXW A;  1NJ4 A;  4S2P A;  4GW9 A;  3WRZ A;  3CLO A;  1K4F A;  1S1Y A;  2I9V A;  3F1N B;  3ZFZ A;  2W3D A;  4AFI A;  1Z09 A;  1T18 A;  1NXY A;  4NXB A;  2ZC7 A;  4X55 A;  2W1R A;  5L09 A;  2Y4A A;  4JGR A;  1YSP A;  1W8Y A;  2JC7 A;  4HBU A;  4S2M A;  3BFF A;  4HHD A;  3NCK A;  5F69 A;  3T4J A;  4Y0U A;  5J8X A;  4OOM A;  1W5D A;  1BTL A;  4S2L A;  5HSQ A;  2WKR A;  3IHB A;  2HV1 A;  3LYX A;  2YKH A;  3DBA A;  3N8L A;  2JN7 A;  2XEP A;  5CER A;  1VHM A;  4DE0 A;  4UA9 A;  2ZL1 B;  1IYQ A;  4OQH A;  1M40 A;  4ZAM A;  2ZBB A;  2V2F F;  3O86 A;  1N9N A;  3IHA A;  1WYB A;  3OCL A;  4CLC E;  1ERO A;  5DJU A;  3R7W B;  3R4K A;  3G2Y A;  4BLM A;  3C5A A;  2W3H A;  3MQ0 A;  2VJW A;  5F5Y A;  4WF0 A;  5E2F A;  3P98 A;  1XJ6 A;  4IBR A;  3ZVT A;  4Y3I A;  3W4O A;  2VV7 A;  3G35 A;  3QP5 A;  2BAS A;  4C3Q A;  3IQA A;  1JVJ A;  3S22 A;  3D4F A;  2Y2H A;  5M1A A;  3GEC A;  1CJF A;  3DTE A;  3ZG7 B;  2HDU A;  3RJU A;  3SOI A;  4EES A;  3ZQ5 A;  3UB8 A;  2Y2K A;  3TOI A;  4Y13 A;  2Y2G A;  3P01 A;  2Y2M A;  3CUE A;  3QNB A;  4HJ4 A;  3DAV A;  2J80 A;  5EOO A;  2X71 A;  2FFF B;  3H82 B;  2XDM A;  1VB6 A;  5CXW A;  1IEL A;  3F1O B;  4PM8 A;  4QU3 A;  2Z6D A;  4OH0 A;  2K7S A;  2QKP A;  1NYM A;  5JYO A;  2HZ5 A;  4BBV A;  5TBM B;  2X01 A;  1D7E A;  3NIA A;  2V1A A;  4Q8I A;  4BBU A;  1GHP A;  3IS2 A;  4LFU A;  5FI2 A;  3E2K A;  1HD8 A;  5I5L A;  1LSW A;  3G32 A;  4KG2 A;  5HX9 A;  3C8C A;  1SCW A;  4YNR A;  3BY9 A;  5L2F A;  2W0N A;  1F98 A;  2WKE A;  3IF6 B;  1KGG A;  1DJC A;  2HGV A;  4OPR A;  2RL3 A;  4ZJ3 A;  4BEN A;  2D01 A;  1YLY A;  3GDI A;  3QP2 A;  2BG1 A;  4LPZ A;  4IBX A;  5CHM A;  3R7W A;  4QJG A;  3U2A A;  3TW8 A;  5EEC A;  2XQZ A;  4N1H A;  1IOU A;  4QPR A;  2WGW A;  1PI5 A;  2O0Y A;  5GHX A;  1KVM A;  5FAQ A;  1XFN A;  3WWX A;  3PBN A;  4HH2 A;  3MFD A;  4KZ6 A;  2OLU A;  1IKG A;  1YQS A;  5CGW A;  1ZHH B;  3C4P A;  1NZU A;  3EGX C;  3OPP A;  1XFQ A;  2QPN A;  2XFT A;  5FDS A;  1EI5 A;  1P9W A;  2ZOH A;  3VOY A;  4XUZ A;  2PT7 A;  3F1P B;  4P6B A;  2JE5 A;  4GNU A;  4GJ4 A;  3UB6 A;  5AQ7 A;  1XXM A;  2EX2 A;  3W4P A;  4HJ3 A;  1E25 A;  1LSX A;  4PM9 A;  5TGF A;  1C3B A;  4HQA A;  3HCY A;  3SH8 A;  1MC0 A;  3DW0 A;  4BWI A;  5KIZ A;  4UQI M;  3S4X A;  1NRJ A;  4GHI B;  4R38 A;  2Y2N A;  1K4E A;  1DJB A;  3KSI A;  2P9V B;  4I39 A;  5JYP A;  3T12 B;  4F3L B;  1HZO A;  2VX8 A;  3ZHH A;  2ZQ9 A;  3SH9 A;  1CI9 A;  2J9O A;  4X25 A;  3EQU A;  3ULF A;  1FIL A;  1U60 A;  3A3F A;  4BBT A;  4MEZ A;  3C4O A;  2ZQ8 A;  5CTN A;  3V50 A;  3ITB A;  3AGD A;  2UWX A;  3C30 A;  1TDG A;  3NJA A;  2H5S A;  1Y4O A;  5KZH A;  3AGE A;  1CQA A;  2WUQ A;  5FAP A;  3HLW A;  3UE6 A;  4H8R A;  3RXX A;  4GLQ A;  1K57 C;  4EBL A;  2OOL A;  2MJ6 A;  5G18 A;  3GR2 A;  5E2H A;  5TFQ A;  3FKW A;  1DJA A;  2VZW A;  4IUH A;  4OQI A;  5AVE A;  3B47 A;  4MBF A;  5KSH A;  3Q07 A;  1MWU A;  4R6L A;  3JVU A;  5DF8 A;  5FI6 A;  5E2E A;  1Z6F A;  4KZ7 A;  3EQV A;  1OTB A;  2W1T A;  3ISG A;  4KQO A;  4RQ9 A;  5HDD A;  1PYY A;  2LB9 A;  1YMS A;  3CG5 A;  3TJZ C;  4KG6 A;  4NK3 A;  4ETZ A;  4Q0H A;  4WBG A;  1K56 A;  1XX2 A;  2HJE A;  4ZDX A;  1K57 A;  2B18 A;  1H3Q A;  2WAE A;  2PYR A;  2DMW A;  1G6A A;  2AVX A;  5CX7 A;  3NY4 A;  3EOI A;  2UV0 E;  3OPH A;  3Q82 A;  3KO6 A;  3BRM A;  3FG8 A;  3IX8 A;  5HPI A;  4L9F A;  4Z1W A;  4RX2 A;  1EWZ A;  1CF0 A;  3UPN A;  4GS9 A;  1LI9 A;  2QJ7 A;  5J4E A;  1V9Z A;  3UDI A;  4IUK A;  3KYZ A;  1ZG6 A;  2PR5 A;  3Q7Z A;  1N4O A;  5F1G A;  3VE3 A;  3A3D A;  1YM1 A;  4CLC C;  5D3O A;  3HLD A;  4B4Z A;  4DDS A;  3GVB A;  4WUJ A;  4WEJ A;  3Q7V A;  4MN7 A;  4HH3 A;  1J9M A;  3WS5 A;  3N6I A;  1ES5 A;  4LV0 A;  2EA9 A;  1MBL A;  4GKU A;  3L9K A;  1GA9 A;  5DVA A;  1HVB A;  2EWW A;  4WZ5 A;  2Y2O A;  1BUE A;  3HRE A;  5FAT A;  3LIB A;  2VGL M;  3LR3 A;  1BT5 A;  4D60 A;  2G2W A;  1S4S A;  4WLA A;  4R1G A;  1W8Q A;  5EOE A;  4G3K A;  1S6R A;  1IKI A;  1FR1 A;  4UEY A;  4DXC A;  3CPT A;  4DF6 A;  4I5S A;  1SHV A;  1GCE A;  4MMN A;  4UA7 A;  4HEF A;  3H82 A;  3E4Q A;  5K5B A;  3UE1 A;  2EXA A;  3HUO A;  2IWD A;  2ZC5 B;  3UDF A;  4EEU A;  2KX6 A;  5HDC A;  4JGP A;  4E6W A;  2V20 A;  3T1Q B;  3K3D A;  2PD8 A;  1N9B A;  3VP1 A;  3TE8 A;  4R3J A;  4OQ0 A;  2L4R A;  3LCE A;  2Y2L A;  3IH9 A;  5CRF A;  1ERM A;  4CLC D;  3RH8 B;  4Y15 A;  1MXO A;  4EQ1 A;  2ZM2 A;  4JF6 A;  1WA9 A;  4OP5 A;  3CPT B;  4Y0T A;  2Z2L B;  5FEG A;  3IWI A;  1YLJ A;  1KGF A;  2X02 A;  4CLC B;  4JF5 A;  1VEU B;  3PR6 A;  2ZJ9 A;  3G4P A;  4EQI A;  4KQQ A;  3S7P A;  1YLZ A;  1T1C A;  1G28 A;  4WZ5 C;  4R23 A;  2IWC A;  4HP9 A;  2R9X A;  3BLM A;  3LO7 A;  2E8I A;  3GMW A;  3T4L A;  5EM0 A;  1RP5 A;  3V67 A;  3H7W B;  2J3T C;  4RVA A;  4KZB A;  3G34 A;  3NBL A;  4OPY A;  1TS7 A;  2PDR A;  2Z2M B;  1S4R A;  3O5Y A;  3OPR A;  4Q0I A;  3A3E A;  1BZA A;  1PW8 A;  3PHY A;  3LIC A;  2YKF A;  2HPB A;  4R3B A;  1H5X A;  3IT9 A;  2Y2I A;  3QP4 A;  4JXV A;  1YPR A;  2WAD A;  3SH7 A;  2DRW A;  2W3G A;  2NUT C;  3VMA A;  2ZC4 B;  3Q81 A;  3ZG0 A;  2JHE A;  1OME A;  4N9L A;  3VP0 A;  3ZG9 B;  1ZKJ A;  4D2O A;  2OSU A;  2P08 A;  3BLS A;  3FC7 A;  2P7J A;  3LEZ A;  2WGV A;  1MY8 A;  3TSG A;  4I3J A;  5FQ9 A;  1S66 L;  1FQG A;  5HD3 A;  3E4P A;  3GRJ A;  4U3T A;  1JNU A;  1BLC A;  1QME A;  2FFY A;  2V0W A;  4KZ3 A;  2ZQD A;  5F82 A;  2GJ3 A;  5HAQ A;  2L1M A;  3EEA A;  3NDE A;  2WZX A;  2D02 A;  5AJG A;  1E3U A;  4MBK A;  3MS6 A;  3N8R A;  1X0O A;  1SKO B;  3G30 A;  3NOP C;  1K0K A;  5G4Z A;  3QP8 A;  3HUM A;  4F94 A;  2WGW B;  3CHW P;  4WMC A;  1YSQ A;  4OKP A;  3T4O A;  2BLS A;  2WKI A;  4IVI A;  3WRT A;  3LIA A;  5GHY A;  4HJ6 A;  4EW7 A;  3IH8 A;  1K54 C;  2ACG A;  5AVF A;  4K08 A;  1NRF A;  3MXS A;  3LY3 A;  1CK3 A;  4KQR A;  2V8C A;  1NY0 A;  3NEC A;  3VSL A;  5FAS A;  4K0W A;  4LCM A;  2O9B A;  2Q9N A;  4BL3 A;  2V1B A;  5TJJ A;  4LCL A;  5F68 A;  1OT6 A;  5A92 A;  5E2G A;  3VP2 A;  4L9G A;  1PI4 A;  3ZVW A;  3C7U A;  2JBF A;  1L0G A;  4GN2 A;  1H8M A;  4FD8 A;  5FL3 A;  2CMN A;  3NHQ A;  1TS6 A;  4LGW A;  1YLP A;  4JXG A;  1UWN X;  1IYP A;  2A24 A;  4C6Y A;  3MSH A;  1N9O A;  4HP4 A;  3IXB A;  2XGN A;  3VFF A;  3HLF A;  4FUW A;  4ARZ A;  3JVV A;  3Q1F A;  1BLH A;  4I3I A;  2QYB A;  2XA7 S;  4MCW A;  4LRY C;  5HAR A;  5HWV A;  4WMC D;  4L0L A;  2KLI A;  4EUZ A;  3CI6 A;  3OZH A;  1LSV A;  1TVF A;  3LIF A;  3WS4 A;  1K55 A;  1KE0 A;  2OWJ A;  4CQH A;  1ZG4 A;  5DFY A;  5CHJ A;  1GSX A;  4KEN B;  3PTE A;  1TEM A;  1MKM A;  4KZ5 A;  5FI7 A;  5AQB A;  2HDQ A;  3S7N A;  5DTK A;  2EWV A;  2XH9 A;  4E04 A;  3D9Y A;  3PAE A;  3CAX A;  4S2J A;  1E3U D;  4MBH A;  2ZQC A;  3T1X A;  3FKV A;  1IYO A;  2ZC6 B;  1GA0 A;  1K38 A;  4GDB A;  4Z9Q A;  2W3E A;  4ZJ1 A;  1UGU A;  2ZQ7 A;  2J3W A;  3IWQ A;  3AGF A;  4UA6 A;  3EEH A;  3BWL A;  4OOY A;  4GOG A;  3A0S A;  2XRO A;  2J3T D;  1WE4 A;  3SZT A;  3A3I A;  1I2S A;  4JPM A;  1TF1 A;  1VEU A;  1QMF A;  2W3F A;  4NXF A;  2PR6 A;  4PM6 A;  1MZU A;  3LI8 A;  1JWP A;  3KYQ A;  1JTG A;  2ZM8 A;  1NLY A;  5E43 A;  4E3O A;  2Y2Q A;  1K56 D;  2QJ5 A;  1SDE A;  4MNR A;  4RA7 A;  4KZ8 A;  1H8Z A;  1BUL A;  1AXB A;  1JTD A;  4NXE A;  1H8Y A;  1XGJ A;  4G3W A;  4BD0 A;  4H6J B;  1P0Z A;  2B5R A;  3QP1 A;  4LRZ E;  2Z6C A;  1OT9 A;  5GLA A;  4EBP A;  1PWG A;  1ODV A;  4P0M A;  5J7E A;  4JXS A;  2J9P A;  2HP5 A;  2HP9 A;  4OOL A;  4QWO A;  1ZC2 A;  4MN6 A;  3CMZ A;  3A3J A;  1Y54 A;  4RX3 A;  5F1F A;  4BJP A;  5L07 A;  2RCX A;  1DP9 A;  3FPV A;  2H0T A;  1MWS A;  3KYE A;  4XXR A;  5KMW A;  1JWZ A;  1H0M A;  4LLO B;  4OLD A;  1YAX A;  2WGI A;  3KSH A;  1LI0 A;  1EW0 A;  3ZG8 B;  3HJK A;  4EUV A;  3ZNT A;  1NWZ A;  3SS5 A;  4EER A;  4QHC A;  2PRF A;  2W1T B;  4R70 A;  3UB7 A;  4KUO A;  2PYP A;  3C38 A;  2ZLY A;  3BFG A;  2XFS A;  5FA7 A;  3Q7V B;  3DTM A;  2XK1 A;  4X69 A;  2OAQ 1;  2B95 A;  3MBZ A;  2H0Y A;  4HOI A;  1FCO A;  1L0D A;  3C2W A;  5IS1 A;  2Y2P A;  3WS1 A;  2Y59 A;  5MC7 A;  5FSR A;  1T1B A;  5AQA A;  4IJG A;  4QB8 A;  2H10 A;  1I5Q A;  4E3L A;  3UDX A;  2DNS A;  3BW6 A;  5FQJ A;  3HLC A;  5F83 A;  4YIN A;  2J8Y A;  4Y5F A;  3U4L P;  1I2W A;  3UPO A;  3SS4 A;  3ZG5 A;  1GSV A;  5EVI D;  4YOF A;  5EV0 A;  2V9A A;  1WYC A;  1Y28 A;  2ZQA A;  2ZC3 B;  1F2K A;  3FV7 A;  3ZCZ A;  1L3L A;  3LY4 A;  2WKQ A;  4KZA A;  3DTK A;  2ZL1 A;  1NYY A;  3KSG A;  4S2K A;  4UAA A;  1LL5 A;  3IXH A;  1PNE A;  3IBR A;  1LL9 A;  3OBF A;  3IXD A;  3BY8 A;  3LR0 A;  2CC1 A;  4R4S A;  2JKR I;  4P87 A;  1DP6 A;  1LLB A;  3T1S A;  2VGK A;  4UHU A;  1E4D A;  4EU0 A;  3BM6 A;  3E98 A;  5CTM A;  3UE3 A;  4Q0J A;  4P85 A;  2ZMA A;  1YLW A;  3DTI A;  3NUL A;  3UE0 A;  3S1Y A;  3E2L A;  1D1J A;  1S67 L;  1XPB A;  3CUE C;  2K31 A;  3ICY A;  4I3A A;  3VP3 A;  3VE4 A;  1KE4 A;  1YT4 A;  4A5R A;  2JKF A;  4K91 A;  4HBT A;  1ONG A;  1KOU A;  3MQO A;  4KUK A;  3O3V A;  4PPR A;  4WN5 A;  2HDR A;  4U0X A;  1TD5 A;  4NET A;  5DTS A;  3OOV A;  5EM1 A;  5LBR A;  2OV5 A;  2PD7 A;  5IU1 A;  3HL9 A;  1O07 A;  2A49 A;  4WM9 A;  3HVF A;  3IF5 A;  4O7D A;  4HI4 A;  4OPQ A;  5GHZ A;  1SKF A;  2O9C A;  2WKP A;  1HTZ A;  3HLB A;  2OAP 1;  1S0W A;  1L0E A;  5HDS A;  1PW1 A;  3ZDJ A;  4GCZ A;  1ZTU A;  3IWO A;  3CZD A;  5HFO A;  4JGQ A;  3UMD A;  3PBQ A;  3G31 A;  2Y55 A;  3E0Y A;  3PBR A;  1PZO A;  3OPL A;  3DWZ A;  1F9I A;  3MZD A;  4S2N A;  4S2I A;  4QD4 A;  1T19 A;  1KVL A;  2P04 A;  3IF6 C;  2JKR M;  1P97 A;  2VK3 A;  4NG2 A;  3I7J A;  3T50 A;  4WYY A;  2GX5 A;  1YMX A;  1XA7 A;  1KGE A;  1OTA A;  4LV2 A;  1RCJ A;  3SS3 A;  3K3C A;  4KZ9 A;  3M6H A;  1KDS A;  4WEL A;  3CIT A;  3JYI A;  5FDH A;  5G4Y A;  4II7 A;  1VET B;  5HWW A;  3BJN A;  2OLV A;  1YKD A;  3PYP A;  5HAI A;  3N8S A;  3NDG A;  3VV4 A;  5BOH A;  4O0P A;  3HBR A;  5M19 A;  3LR5 A;  4OVD A;  3P7N A;  1FSY A;  5HD5 A;  2GNX A;  2ZM0 A;  3MF0 A;  4IHQ A;  1W7F A;  4M4X A;  4QY6 A;  2R78 A;  3QHY A;  4CPK A;  4ETX A;  1XJ3 A;  3PXP A;  5TR7 A;  3F1P A;  1BLP A;  1TS0 A;  3UPP A; 
#chains in the Genus database with same CATH homology
 4R4R A;  5GLD A;  4JKT A;  5KSH A;  4S2O A;  3Q07 A;  1MWU A;  2EX9 A;  5DF8 A;  1K6R A;  3ZGA B;  3ITA A;  4MLL A;  5FI6 A;  5E2E A;  4EUZ A;  1Z6F A;  4KZ7 A;  1ONH A;  3OZH A;  3EQV A;  5CGX A;  5GL9 A;  2XR0 A;  1K6S A;  1TVF A;  4N9K A;  4X6T A;  3HLG A;  1IEM A;  4M3K A;  3WS4 A;  1ES3 A;  1K55 A;  1KE0 A;  4E6X A;  5EVI B;  3ISG A;  4KQO A;  1ZG4 A;  4CJN A;  2WKH A;  5CHJ A;  2I72 A;  4KEN B;  5CGS A;  3QNC A;  2C5W B;  3UO9 A;  1PYY A;  2P74 A;  3NC8 A;  3BEC A;  4FH2 A;  4GDN A;  5FQM A;  5FQI A;  1YMS A;  3PTE A;  1TEM A;  3CG5 A;  1KE3 A;  4EV4 A;  1K25 A;  3OCN A;  4KZ5 A;  4KG6 A;  3FYZ A;  1M6K A;  4NK3 A;  5FI7 A;  1K54 A;  5AQB A;  4DE1 A;  3HLE A;  2HDQ A;  5DTK A;  4WBG A;  2XH9 A;  1K56 A;  3PAE A;  1XX2 A;  5EVI A;  4S2J A;  4ZDX A;  3DWK A;  3FWL A;  1E3U D;  1K57 A;  4MBH A;  4S2N C;  4JXW A;  2WAE A;  2ZQC A;  3CJM A;  3FKV A;  1IYO A;  2ZC6 B;  1GA0 A;  1K38 A;  1G6A A;  1NZO A;  4GDB A;  3NY4 A;  4Z9Q A;  4E3I A;  4ZJ1 A;  4KZ4 A;  2XF3 A;  2ZQ7 A;  1XA1 A;  3OPH A;  3Q82 A;  1GHM A;  3IWQ A;  1FOF A;  4N92 A;  3AGF A;  4UA6 A;  3BRM A;  3HUN A;  4OOY A;  4E3M A;  4GOG A;  4EWF A;  1WE4 A;  4X68 A;  2QZ6 A;  5DF9 A;  4RX2 A;  2V1Z A;  5AQ9 A;  3A3I A;  1CEG A;  1EWZ A;  1I2S A;  3BFE A;  1W79 A;  1XGI A;  4JPM A;  3UPN A;  1LI9 A;  1QMF A;  3V3S A;  3UDI A;  4N1X A;  1FCM A;  1Q2P A;  3N4I A;  1FR6 A;  1ZG6 A;  4KG5 A;  3Q7Z A;  1N4O A;  4PM6 A;  5F1G A;  3A3D A;  1JWP A;  5FQQ A;  1YM1 A;  5EE8 A;  1JTG A;  2ZM8 A;  5E43 A;  5D3O A;  4RYE A;  3HLD A;  4LEN A;  4B4Z A;  4E3O A;  2HP6 A;  2Y2J A;  2Y2Q A;  5FAO A;  1MWR A;  4DDS A;  1K56 D;  5GLC A;  4B4X A;  3GVB A;  3RXW A;  4WEJ A;  1NJ4 A;  1SDE A;  2WAF A;  1PIO A;  4MNR A;  4RA7 A;  4S2P A;  3WRZ A;  4KZ8 A;  4JLF A;  3Q7V A;  1H8Z A;  1K4F A;  1BUL A;  2WK0 A;  1J9M A;  3ZFZ A;  3WS5 A;  3N6I A;  4JF4 A;  1ES5 A;  1AXB A;  1JTD A;  1RGZ A;  4FSF A;  1MBL A;  4GKU A;  4LV0 A;  1H8Y A;  1GA9 A;  1NXY A;  1XGJ A;  5DVA A;  1HVB A;  4X55 A;  2ZC7 A;  1O7E A;  4BD0 A;  2B5R A;  2Y4A A;  4WZ5 A;  2C6W B;  4YFM A;  2Y2O A;  3W8K A;  1BUE A;  1W8Y A;  5GLA A;  3HRE A;  5FAT A;  4EBP A;  1PWG A;  4P0M A;  2JC7 A;  4HBU A;  3MKE A;  4X53 A;  4S2M A;  1BT5 A;  2EFU A;  3BFF A;  4JXS A;  4DKI A;  2PU4 A;  2J9P A;  1CI8 A;  4OLG A;  1CEF A;  1JWV A;  3MXR A;  2HP5 A;  4R0Q A;  2HP9 A;  3NCK A;  2G2W A;  3UY6 A;  4OOL A;  3GSG A;  4Y0U A;  5HAP A;  1ZC2 A;  4OOM A;  5J8X A;  1W5D A;  1XKZ A;  1BTL A;  1W8Q A;  2QMI A;  3A3J A;  3CMZ A;  4R1G A;  1Y54 A;  4S2L A;  5EOE A;  4RX3 A;  5F1F A;  1S6R A;  1IKI A;  1FR1 A;  4BJP A;  2RCX A;  3IHB A;  2H0T A;  1MWS A;  3WS0 A;  3N8L A;  4DXC A;  4XXR A;  4DF6 A;  1SHV A;  1GCE A;  5KMW A;  1JWZ A;  3GTC A;  4UA7 A;  4OLD A;  4HEF A;  2XEP A;  1FCN A;  5CER A;  4DE0 A;  2WGI A;  2XD1 A;  4UA9 A;  5EVI C;  1MKI A;  3O87 A;  3UE1 A;  1LI0 A;  2XLN A;  1IYQ A;  2EXA A;  2EX8 A;  2IWD A;  3HUO A;  4OQH A;  3ZG8 B;  2ZC5 B;  5HW3 A;  3UDF A;  3ZNT A;  3SS5 A;  1M40 A;  4QHC A;  4ZAM A;  4PM7 A;  2V2F F;  4E6W A;  2V20 A;  1ESU A;  4OPZ A;  3O86 A;  3IHA A;  3UN7 A;  1WYB A;  4PMA A;  3OCL A;  1N9B A;  3VP1 A;  4WEK A;  1PZP A;  1ERO A;  2ZLY A;  1MWT A;  3BFG A;  2XFS A;  4R3J A;  5FA7 A;  3Q7V B;  4OQ0 A;  3G2Z A;  3G2Y A;  3DTM A;  3LCE A;  4BLM A;  2XK1 A;  2Y2L A;  3C5A A;  3IH9 A;  4X69 A;  1ERM A;  5CRF A;  1MXO A;  3MBZ A;  4IVK A;  2ZM2 A;  2H0Y A;  5E2F A;  3P98 A;  5CEB A;  3PBS A;  3NI9 A;  4JF6 A;  4IBR A;  4OP5 A;  1FCO A;  1L0D A;  3C7V A;  3ZVT A;  2Y2P A;  4Y0T A;  2Z2L B;  2Y59 A;  3M2J A;  3W4O A;  3WS1 A;  1GHI A;  3IWI A;  1YLJ A;  5FSR A;  1KGF A;  2X02 A;  3G35 A;  4PM5 A;  5AQA A;  4DE2 A;  4JF5 A;  4QB8 A;  4C3Q A;  1VQQ A;  1JVJ A;  2H10 A;  3IQA A;  3S22 A;  1I5Q A;  1ALQ A;  2Y2H A;  3D4F A;  5M1A A;  4E3L A;  4U0T A;  3ZG7 B;  2HDU A;  3UDX A;  2DNS A;  3RJU A;  2ZJ9 A;  5FQJ A;  3SOI A;  3G4P A;  4X56 A;  3HLC A;  5F83 A;  4EQI A;  4KQQ A;  5IHV A;  5M18 A;  4YIN A;  2J8Y A;  2Y2K A;  3TOI A;  3BEB A;  2Q9M A;  2Y2G A;  3BFD A;  4DDY A;  2GDN A;  1I2W A;  2Y2M A;  1Q2Q A;  4EBN A;  5HL1 A;  1YLZ A;  3MZF A;  3QNB A;  4ID4 A;  4WZ5 C;  3VOZ A;  4R23 A;  3SS4 A;  3UPO A;  3ZG5 A;  5EOO A;  2R9X A;  2IWC A;  2X71 A;  2FFF B;  1RGY A;  3BLM A;  3LO7 A;  2E8I A;  3GMW A;  3B3X A;  2XDM A;  4GD6 A;  1RP5 A;  4WZ4 A;  5EVI D;  3PAG A;  4RVA A;  5CXW A;  1IEL A;  1L2S A;  5GLB A;  1ESI A;  4KZB A;  1WYC A;  3TG9 A;  3G34 A;  2ZQA A;  3NBL A;  4OPY A;  3PBT A;  4XUX A;  2ZC3 B;  4PM8 A;  1PWC A;  2Z2M B;  3OPR A;  4QU3 A;  3GQZ A;  3FV7 A;  3A3E A;  1BZA A;  4OH0 A;  3ZCZ A;  1PW8 A;  1L0F A;  4ZTK A;  3LY4 A;  2HPB A;  1NYM A;  4KZA A;  5JYO A;  4R3B A;  1H5X A;  1NYY A;  2X01 A;  3IT9 A;  3N7W A;  2Y2I A;  3NIA A;  4S2K A;  4Q8I A;  4UAA A;  5CED A;  1GHP A;  3IXG A;  4LV3 A;  1LL5 A;  2DCF A;  3IXH A;  5FI2 A;  4ZJ2 A;  3E2K A;  1LL9 A;  1HD8 A;  3GV9 A;  3G32 A;  4KG2 A;  3IXD A;  5HX9 A;  1FSW A;  2CC1 A;  4R4S A;  4JXV A;  1SCW A;  4P87 A;  5L2F A;  2WAD A;  3SH7 A;  1LLB A;  2DRW A;  2VGK A;  4UHU A;  1E4D A;  3BM6 A;  5CTM A;  3UE3 A;  2WKE A;  3IF6 B;  1KGG A;  1DJC A;  4P85 A;  2ZMA A;  3VMA A;  3W4Q A;  4OPR A;  2ZC4 B;  5U47 A;  1YLW A;  2A3U A;  2RL3 A;  3Q81 A;  4ZJ3 A;  3MZE A;  3ZG0 A;  1OME A;  1KDW A;  4BEN A;  4N9L A;  3UE0 A;  3VP0 A;  4OQG A;  1YLY A;  3V39 A;  1ZKJ A;  3ZG9 B;  3S1Y A;  3ZNY A;  4GB7 A;  4D2O A;  2OSU A;  3BLS A;  3E2L A;  4E3K A;  4HES A;  1XPB A;  2BG1 A;  1XP4 A;  5A90 A;  3M6B A;  1BLS A;  3VP3 A;  3LEZ A;  1TDL A;  2WGV A;  4IBX A;  5CHM A;  4QJG A;  5CHU A;  1KE4 A;  2P9V A;  1YT4 A;  4A5R A;  1G68 A;  4K0X A;  1MY8 A;  4OP8 A;  3TSG A;  5KSC A;  5EEC A;  5FQ9 A;  5I94 A;  1FQG A;  4K91 A;  2XQZ A;  4N1H A;  4HBT A;  3UNW A;  1ONG A;  5EUA A;  2R9W A;  2WGW A;  1PI5 A;  2Y91 A;  3GRJ A;  3O3V A;  4PPR A;  2HDR A;  5GHX A;  4Y7P A;  1KVM A;  4U0X A;  4U3T A;  5FAQ A;  4NET A;  5DTS A;  5FQK A;  1BLC A;  1QME A;  2FFY A;  2PU2 A;  3WWX A;  4KZ3 A;  3PBN A;  4BL2 A;  3MFD A;  4KZ6 A;  2OLU A;  2WZZ A;  2OV5 A;  2ZQD A;  1IKG A;  1YQS A;  5CGW A;  5F82 A;  4E3J A;  5HAQ A;  1ERQ A;  2EX6 A;  3HL9 A;  1O07 A;  3NDE A;  3C4P A;  2A49 A;  1ES4 A;  2WZX A;  1NZU A;  3HVF A;  3OPP A;  4WM9 A;  4B88 A;  3IF5 A;  4O7D A;  4OPQ A;  4IED A;  5GHZ A;  1E3U A;  1SKF A;  2QPN A;  1SDN A;  2XFT A;  1HTZ A;  5EPH A;  4BQM A;  4MBK A;  3FZC A;  3HLB A;  3N8R A;  3WS2 A;  5A91 A;  1DY6 A;  1EI5 A;  3BFC A;  1S0W A;  4LV1 A;  1L0E A;  3G30 A;  3VOY A;  2IWB A;  4XUZ A;  4BD1 A;  4P6B A;  3OC2 A;  2JE5 A;  1PW1 A;  4GNU A;  3ZDJ A;  5AQ7 A;  3HUM A;  1XXM A;  4F94 A;  2EX2 A;  2WGW B;  4FH4 A;  3IWO A;  4WMC A;  3W4P A;  3CZD A;  1E25 A;  4OKP A;  5HFO A;  4PM9 A;  2BLS A;  1C3B A;  5EVL A;  1MPL A;  1PWD A;  3PBQ A;  5TGF A;  3G31 A;  4ZBE A;  2WKI A;  4IVI A;  2J7V A;  3WRT A;  5GHY A;  4OON A;  3IH8 A;  3SH8 A;  1K54 C;  2Y55 A;  1NRF A;  3MXS A;  3PBR A;  1PZO A;  3DW0 A;  3LY3 A;  3OPL A;  3DWZ A;  1CK3 A;  3MZD A;  4FCF A;  4KQR A;  2EXB A;  3S4X A;  1NY0 A;  1IYS A;  3V3R A;  4S2N A;  4S2I A;  2XD5 A;  4QD4 A;  1YLT A;  3VSL A;  4K0W A;  1KVL A;  5FAS A;  4LCM A;  2Y2N A;  2Q9N A;  1K4E A;  3IF6 C;  3VSK A;  4BL3 A;  4LCL A;  3P09 A;  2PBY A;  2HDS A;  5A92 A;  3I7J A;  5E2G A;  1K55 C;  1DJB A;  3O88 A;  4WYY A;  5DF7 A;  3VP2 A;  1YMX A;  2WYX A;  1PI4 A;  4JBF A;  5A93 A;  1XA7 A;  5CEC A;  1KGE A;  3PBO A;  3ZVW A;  2P9V B;  4E3N A;  5JYP A;  4LV2 A;  1RCJ A;  3C7U A;  3MKF A;  3SS3 A;  2JBF A;  4QY5 A;  1HZO A;  1L0G A;  4KZ9 A;  3IF6 A;  4GN2 A;  3ZHH A;  4DXB A;  3M6H A;  2ZQ9 A;  4C75 A;  1KDS A;  4FD8 A;  1BSG A;  4WEL A;  3SH9 A;  5DTT A;  1CI9 A;  3JYI A;  2J9O A;  5FDH A;  3EQU A;  1YLP A;  2OLV A;  1U60 A;  3A3F A;  4JXG A;  3M2K A;  3N8S A;  1IYP A;  3NDG A;  4MEZ A;  5HAI A;  3C4O A;  5BOH A;  2ZQ8 A;  5CTN A;  3V50 A;  4C6Y A;  3ITB A;  3AGD A;  2UWX A;  1TDG A;  3HBR A;  2H5S A;  4DRT A;  5M19 A;  5KZH A;  1LHY A;  3AGE A;  3IXB A;  4OVD A;  2XGN A;  3VFF A;  3HLF A;  2WUQ A;  5FAP A;  3HLW A;  4GD8 A;  4GZB A;  1FSY A;  3Q1F A;  4H8R A;  1BLH A;  3RXX A;  2ZD8 A;  3V5M A;  3VP4 A;  2ZM0 A;  3VFH A;  1W7F A;  1K57 C;  2EFX A;  4QY6 A;  3QHY A;  4EBL A;  5G18 A;  2G2U A;  1ES2 A;  3GR2 A;  5E2H A;  5TFQ A;  4CPK A;  1VM1 A;  3FKW A;  1DJA A;  4Y0O A;  4OQI A;  4DE3 A;  5TR7 A;  1BLP A;  2VGJ A;  5HAR A;  2JCH A;  3UPP A;  4WMC D;  3BYD A;  4MBF A;  4L0L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...