4DDSA

Ctx-m-9 class a beta-lactamase complexed with compound 11
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
260
structure length
260
Chain Sequence
AVQQKLAALEKSSGGRLGVALIDTADNTQVLYRGDERFPMCSTSKVMAAAAVLKQSETQKQLLNQPVEIKPADLVNYNPIAEKHVNGTMTLAELSAAALQYSDNTAMNKLIAQLGGPGGVTAFARAIGDETFRLDRTEPTLNTAIPGDPRDTTTPRAMAQTLRQLTLGHALGETQRAQLVTWLKGNTTGAASIRAGLPTSWTAGDKTGSGDYGTTNDIAVIWPQGRAPLVLVTYFTQPQQNAESRRDVLASAARIIAEGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase
publication title Structure-Based Design of Potent and Ligand-Efficient Inhibitors of CTX-M Class A Beta-Lactamase
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/hydrolase inhibitor
total genus 95
structure length 260
sequence length 260
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2012-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4ddsA00
5M1AA 3PTEA 4QJGA 3HLDA 4P85A 5D3OA 3SH9A 5CGXA 1CI8A 1GA9A 3W8KA 3ZNYA 3HLBA 3OPLA 2C5WB 2PU2A 4MEZA 1H8ZA 4QHCA 3Q82A 3HUMA 1WYBA 5CTNA 4OPYA 2Y2NA 4U0TA 1JWVA 4JLFA 4E3NA 1C3BA 3ZVWA 5E2GA 3B3XA 4K0XA 1LL9A 1EWZA 4NETA 4UA7A 5FQKA 5FQJA 3RJUA 2WKHA 4N9KA 5G18A 4OP5A 1BSGA 2EX6A 5CHMA 1NYMA 3W4PA 4BENA 5CECA 1YQSA 1JVJA 2EFXA 2HDUA 1IYOA 4DXBA 4KG6A 4N1XA 1FR6A 4KG2A 1FCOA 1E4DA 3UDIA 3W4OA 2V20A 4E3MA 1XGIA 5A92A 4C6YA 1J9MA 2OV5A 1K54A 2Y91A 4BL3A 2J9PA 5KZHA 1NY0A 3BFCA 4FH2A 2Z2LB 1GHMA 3G31A 1GHIA 2IWDA 1BLCA 4OVDA 4QD4A 1N9BA 1S0WA 1U60A 2H10A 4R3JA 1E3UA 1CI9A 3PAGA 1NZUA 2WZZA 1NJ4A 3BRMA 3N7WA 4WELA 4R0QA 3A3JA 1G68A 1MWSA 4N92A 3FKWA 4N9LA 3Q1FA 3ZNTA 4B4ZA 5IHVA 4KZ6A 1XX2A 1YMSA 4S2IA 4X53A 3Q7VA 4GDBA 2Y2OA 3OPRA 4OQIA 3A3EA 4U0XA 3V50A 3Q7VB 4N1HA 5EPHA 2UWXA 3N4IA 2WZXA 2Y2LA 1L0EA 3SOIA 1KGEA 4PM6A 3VOYA 1RP5A 3C7VA 3MBZA 2RL3A 1XGJA 1PZOA 3TOIA 3VP4A 3AGDA 2OSUA 4GOGA 3ZG7B 4IBXA 5TFQA 3Q7ZA 4RX2A 4OQGA 1ONGA 4OLDA 4JXVA 5BOHA 1NYYA 5KSCA 4KQOA 2H0TA 3HL9A 3OC2A 4X6TA 2EXBA 1ES4A 2PBYA 4KZBA 5CERA 4GB7A 2J7VA 3C4OA 1CK3A 1H5XA 2QMIA 3NC8A 3HUNA 3NY4A 5CGSA 4JBFA 4JXWA 2Y55A 1PIOA 4JF6A 3AGEA 3G34A 4NK3A 2XEPA 3A3IA 2Q9MA 4OPZA 2WADA 5GL9A 4OOMA 5AQBA 1FR1A 4ID4A 4UA9A 4XXRA 2VGJA 2Y2KA 3LO7A 4MBHA 1BLHA 3DWKA 3ZG8B 5AQ9A 3HLEA 4RYEA 2XGNA 5FATA 1KVLA 2EXAA 3UPOA 1E25A 2GDNA 1NZOA 2WGWA 1SDNA 2FFYA 4BLMA 2WGIA 5FAPA 1DJAA 1L0DA 2WGWB 1K4FA 3LY4A 2H0YA 3OCNA 4X69A 2ZMAA 5EVLA 1IYPA 1SDEA 3V39A 3DWZA 4WM9A 4XUZA 3BYDA 4DRTA 3UPNA 1FQGA 2Y2QA 1GHPA 1TEMA 1MWRA 3C5AA 3V5MA 4OONA 1SCWA 4QU3A 3UY6A 2CC1A 2JCHA 4PM9A 4WZ5A 1MWUA 2HDSA 3BFEA 1Q2QA 3O3VA 3ITBA 4WMCD 3UE1A 3FYZA 3GQZA 3GSGA 4UA6A 3HLCA 1HD8A 1W5DA 2Y59A 1MPLA 1LHYA 4KZAA 4WEJA 2ZC6B 4JPMA 2H5SA 3UE3A 5L2FA 4S2JA 1ERQA 2DCFA 3SS5A 4KZ9A 4LV0A 2Y2MA 3IF6C 3IXGA 1L2SA 4UHUA 5DF8A 3W4QA 3BLMA 1ZC2A 3ISGA 5HAQA 4S2PA 4QY6A 4A5RA 1BULA 3VSLA 3MKEA 1ES2A 1AXBA 1M40A 4PPRA 1YLWA 2Y4AA 4ZJ3A 4WBGA 4KENB 4CPKA 4DF6A 1IYQA 2ZC7A 3A3FA 4RA7A 5FQMA 4H8RA 4P0MA 5EE8A 5A90A 3PBRA 1LI0A 1MY8A 4LV3A 5EOEA 3VFHA 1FSYA 3ITAA 3UPPA 2A49A 4E3LA 1BUEA 2P9VA 2QPNA 4R3BA 4KZ8A 4OP8A 3BM6A 2P9VB 2IWCA 3QHYA 3P98A 4X68A 3ZCZA 3G35A 1PYYA 3QNBA 3ZVTA 3VP2A 4D2OA 4EWFA 2Y2GA 3O86A 1I2WA 2X01A 3LEZA 1DJCA 4LCLA 3ZHHA 2Z2MB 4S2NC 4LV2A 2Y2PA 1CEFA 1BLPA 1PI5A 3BEBA 3GR2A 4MBFA 2WAFA 5GLBA 1PW8A 2ZD8A 3BFGA 1PWDA 3P09A 1ALQA 3PBQA 3NBLA 1IELA 1YMXA 5CHUA 3D4FA 1PWGA 1DY6A 2ZQDA 3PBSA 3IHBA 4WZ4A 3UE0A 2ZQAA 5DTTA 2E8IA 1KE3A 4ZJ1A 1XPBA 2PU4A 1VQQA 5EVIC 3CZDA 4RVAA 4S2MA 1JTDA 3GVBA 4L0LA 4KG5A 2XDMA 4EBNA 2EX2A 4JXSA 4Y0TA 3M2KA 4DE0A 2ZQ9A 3MZDA 4P6BA 4S2KA 3VP1A 4HBTA 3QNCA 5HL1A 4GD6A 1SKFA 2J8YA 1XA1A 5F1GA 4GZBA 1HTZA 1K57C 3HLFA 4KZ4A 4R23A 1K56D 1ESIA 4JF5A 4B4XA 3IT9A 4IBRA 4GN2A 2EFUA 1E3UD 2Y2JA 4ZTKA 3IXBA 5JYPA 5HAPA 1HZOA 1KE0A 4ZAMA 4HESA 3OPPA 4F94A 5FQQA 3VSKA 2Y2HA 5DVAA 1HVBA 2ZQCA 5EVID 1FCNA 5CGWA 3C4PA 5DTSA 1K25A 5U47A 3WS2A 3GV9A 2BLSA 3LCEA 4DE2A 4GNUA 1YLTA 3I7JA 1WYCA 1ERMA 4UAAA 2EX9A 5A93A 4OKPA 1SHVA 1YLPA 5FI6A 3RXWA 4OQHA 2ZM0A 5CEDA 5HX9A 1KDWA 2HDRA 1QMFA 5FSRA 3V3SA 3DW0A 4E6XA 5GLDA 4OOYA 1ESUA 3CG5A 1ONHA 3MKFA 4BD0A 4Y0UA 1FCMA 3CMZA 1NRFA 4HEFA 4R4SA 1IYSA 3S1YA 1YLZA 1PI4A 2B5RA 4C75A 4Y7PA 2WGVA 5AQ7A 3ZGAB 4Z9QA 5E43A 3G32A 1M6KA 3IH9A 1W8QA 4FH4A 2OLVA 3Q07A 5CHJA 3MXSA 2V2FF 3VP3A 1LI9A 1Z6FA 2G2UA 3PBTA 4O7DA 3SH7A 1KDSA 2XR0A 4K0WA 1EI5A 1L0GA 2WKIA 3HLWA 5F1FA 1K55C 1N4OA 3RXXA 1IKGA 2Y2IA 2XLNA 4IEDA 2P74A 1YLJA 4X55A 3UDXA 3PBOA 4BL2A 2XF3A 4BD1A 3VOZA 2ZM2A 2BG1A 4Y0OA 1W79A 3E2LA 1MKIA 4X56A 3UO9A 3N6IA 1YLYA 4EV4A 3MZEA 3UN7A 3BLSA 3NI9A 1YM1A 4JF4A 3IXDA 3IF5A 4PM5A 1LL5A 3DTMA 5HAIA 1IKIA 3GRJA 4PM8A 3SS4A 2HP9A 1TDLA 1BZAA 3BFDA 5FQ9A 2JE5A 2DNSA 3NDEA 5TR7A 3S22A 2C6WB 2JC7A 3BFFA 3OPHA 5DF7A 5GHZA 4E3OA 2X02A 3LY3A 2RCXA 5HFOA 1RCJA 4ZBEA 2WUQA 3N8RA 3HREA 1CEGA 3PAEA 3FV7A 5TGFA 3E2KA 5CXWA 1TDGA 2I72A 4IVKA 4DE1A 2XH9A 1KVMA 1KGGA 3IF6A 4HBUA 3WS5A 5CTMA 1Q2PA 3IF6B 5EUAA 2HP6A 1PWCA 3AGFA 4JXGA 5KSHA 1JWPA 1K6RA 5FI2A 3WS0A 1YT4A 3IWIA 4DDSA 5FASA 4OH0A 2QZ6A 1ES3A 4QB8A 2X71A 4LV1A 5AQAA 4Q8IA 3TG9A 2ZC3B 2ZM8A 3C7UA 4M3KA 1NXYA 1O7EA 4QY5A 4B88A 5CEBA 2FFFB 2VGKA 2DRWA 5CRFA 5GLCA 3VMAA 4FCFA 4JKTA 1K54C 4KQRA 1BT5A 4KZ7A 4E3IA 1PW1A 1W8YA 3SS3A 1JWZA 1XA7A 4KQQA 5F82A 5DF9A 4WEKA 4EBPA 4XUXA 5DTKA 2G2WA 3S4XA 3V3RA 5J8XA 2HP5A 2HDQA 4GD8A 4P87A 2WYXA 2Q9NA 4IVIA 1JTGA 1O07A 3TSGA 4S2NA 3IH8A 4OPQA 1L0FA 2WAEA 2XFTA 3GMWA 1K56A 5KMWA 1ZKJA 4KZ5A 2WKEA 4YFMA 4OOLA 4YINA 1LLBA 4BJPA 1DJBA 3IHAA 4R4RA 2R9WA 4C3QA 2ZJ9A 3VP0A 1GCEA 1KGFA 4RX3A 1K4EA 2XD1A 2ZQ8A 3PBNA 2XQZA 3G2YA 3IWOA 5EVIA 4ZDXA 5E2HA 4FSFA 3WWXA 4DXCA 3M2JA 1WE4A 1K6SA 5EVIB 4KZ3A 3WRTA 2WK0A 2J9OA 3IXHA 5FQIA 3HBRA 3ZG9B 1TVFA 1K57A 4BQMA 3GTCA 5FI7A 4EUZA 1W7FA 4WYYA 2ZC4B 1FSWA 2EX8A 4MNRA 4OQ0A 3ZDJA 4DE3A 3FKVA 4GKUA 5M19A 1GA0A 1RGYA 5GHXA 3UDFA 5JYOA 1FOFA 1RGZA 1G6AA 5FDHA 1XKZA 4DDYA 5FAOA 3ZG5A 3EQUA 3ZG0A 1XXMA 1ES5A 4ZJ2A 3FWLA 3N8LA 4S2OA 5A91A 1MWTA 3HVFA 3MXRA 3G4PA 5FAQA 2ZC5B 4WMCA 3G30A 4EBLA 3FZCA 4PMAA 5FA7A 4CJNA 3BECA 3NCKA 4PM7A 3WS4A 4E3KA 3EQVA 1PZPA 3M6HA 4K91A 4MBKA 1QMEA 1Y54A 3HUOA 1I2SA 3MFDA 3O88A 1VM1A 4MLLA 1I5QA 3M6BA 3NDGA 3IQAA 1EROA 2JBFA 4E6WA 3MZFA 1K38A 2HPBA 1ZG4A 2ZQ7A 3NIAA 1MXOA 3G2ZA 5M18A 5HARA 4R1GA 5I94A 4LENA 4WZ5C 3WS1A 1XP4A 4S2LA 3VFFA 5EECA 3CJMA 1MBLA 2OLUA 3UNWA 3HLGA 5HW3A 5E2EA 5EOOA 2A3UA 3A3DA 3OCLA 1S6RA 2IWBA 5GLAA 4EQIA 4LCMA 2R9XA 3OZHA 5E2FA 2XK1A 1BLSA 1BTLA 1IEMA 1K55A 2XFSA 1H8YA 5F83A 4E3JA 3IWQA 4FD8A 3ZFZA 3WRZA 2ZLYA 3SH8A 3N8SA 1OMEA 4U3TA 4GDNA 4OPRA 3O87A 1KE4A 2V1ZA 4OLGA 5GHYA 1ZG6A 2XD5A 3JYIA 4DKIA 3Q81A
chains in the Genus database with same CATH superfamily
2ZBBA 2FZ0A 1GA9A 2C5WB 4K08A 1H8ZA 3Q82A 4OPYA 1JWVA 2H28A 4JLFA 1C3BA 1LL9A 3VE4A 5AVFA 4EEPA 3T4TA 4UA7A 1BSGA 1NYMA 5TJJA 2XSSA 1FR6A 3IX8A 3LIBA 3KSFA 5KZHA 3BFCA 2Z2LB 1JNUA 1S0WA 4N92A 3FKWA 4B4ZA 3Q1FA 5IHVA 1XX2A 1YMSA 3Q7VA 2Y2OA 4OQIA 3FPVA 3F1OB 2J3WA 4WLAA 3MBZA 2I9VA 4P6ZS 2RL3A 1PZOA 3TOIA 3VP4A 2OSUA 4RX2A 2EA9A 5BOHA 1NYYA 4ARZA 2O0YA 3HL9A 3OOVA 3OC2A 4X6TA 3UMEA 1ES4A 3KX0X 4GB7A 3C4OA 1CK3A 3NY4A 4JXWA 2W3GA 4X1LA 2WADA 5GL9A 4OOMA 5AQBA 1FR1A 3JVVA 4XXRA 3LO7A 2Y2KA 3ZG8B 4I5SA 2V1AA 3CAXA 5G4YA 4JGQA 1L0DA 4MCWA 3BY8A 2ZMFA 1TS0A 4R6LA 4X69A 5EVLA 1TD5A 4WM9A 3OLOA 1VETB 2HDSA 4WMCD 3UE1A 3FYZA 3GQZA 3EOIA 1W5DA 2OAP1 2Y59A 2ZC6B 3P7NA 4ME4A 4PKYA 5J7EA 1OTAA 4L9GA 4KZ9A 2Y2MA 1SKOB 3IF6C 4EXOA 3BLMA 3GDIA 1P97A 1ES2A 4ZJ3A 3G6OA 4BBUA 4H8RA 5EE8A 1F9IA 2PD8A 1BUEA 2P7JA 2QKPA 2P9VB 3P98A 4X68A 3W2ZA 2VLGA 1AWIA 3G35A 1PYYA 3ZVTA 4LRXC 3VP2A 3MQQA 3ZHHA 2Z2MB 4LV2A 2Y2PA 1CEFA 3BQ8A 4MBFA 2WAFA 3LYXA 1PWDA 1ALQA 3PBQA 3NBLA 1IELA 2KX6A 2ZQDA 3KYQA 1UWPX 1T1AA 2PU4A 3CZDA 1F5MA 5DKKA 1JTDA 3GVBA 4L0LA 1CQAA 4BBVA 2QWSA 3M2KA 3S7OA 2VV6A 1SKFA 2W3EA 4GZBA 5HD5A 4KZ4A 4B4XA 3IT9A 4IJGA 4YOFA 1KE0A 5FQQA 3VSKA 2JN7A 2Y2HA 3A0VA 4HI4A 2ZQCA 5EVID 2XROA 1YLTA 3RH8B 4CLCD 1YLPA 1QMFA 2L4RA 5GLDA 4OOYA 5FL3A 3CG5A 1ONHA 3R4KA 5EM1A 4R4SA 1IYSA 1YLZA 1PI4A 3PYPA 1VB6A 5AQ7A 1W8QA 3B33A 2GZAA 1Z6FA 2G2UA 1XJ3A 1KDSA 2WKIA 1N4OA 1IKGA 3LUQA 2P74A 2XF3A 4BD1A 3VOZA 2BG1A 4Y0OA 3N6IA 1GSVA 2Y79A 2B95A 1YM1A 4PM5A 1LL5A 2OOLA 3KYZA 2W1TA 2HV1A 3LR0A 1Y4OA 3S7QA 2A24B 3FV7A 3E2KA 4X25A 5CXWA 3RFBA 5J3WA 4HBUA 5HPFA 1OTBA 3UB8A 5CTMA 1Q2PA 4JXGA 1JWPA 1PNEA 1YT4A 5FASA 4OH0A 2ZC3B 3C7UA 4QY5A 4L9EA 2VGKA 2DRWA 5CRFA 3BWLA 5DFXA 5GLCA 4FCFA 4KQRA 3MS6A 4WEKA 4XUXA 2O9BA 3S4XA 3V3RA 4DJ3A 2HP5A 2PYRA 4GD8A 4IVIA 4S2NA 3IH8A 2WAEA 2HF6A 2XFTA 3GMWA 4IUKA 1ZKJA 2HZ5A 4OOLA 3HJIA 4YINA 1LLBA 4GHIB 5J4EA 2R9WA 2Q0OA 4RX3A 5EVIA 2ZQ8A 3PBNA 5E2HA 3DAVA 1VHMA 4KZ3A 4CLCA 2WK0A 2ZOIA 3IXHA 3HBRA 3GTCA 3T1QB 4WYYA 4OQ0A 4DE3A 1RGYA 2VJWA 3LIEA 1RGZA 5FDHA 2M7UA 4DDYA 5FAOA 5L10A 3N8LA 3MXRA 4LRZE 1GSXA 3BECA 3WS4A 4E3KA 2BTFP 3JVUA 1VM1A 4MLLA 1I5QA 1EROA 2JBFA 5M18A 1ZG4A 3G2ZA 1G5UA 1P9RA 1XP4A 3K3DA 3CJMA 3E4PA 4Q0IA 5HW3A 4GS9B 2IWBA 4FTXA 5GLAA 4LCMA 2R9XA 3S7PA 4UQIM 1BTLA 1DP6A 2XFSA 1H8YA 3IWQA 3MQOA 3WRZA 3U4LP 3SH8A 2B18A 4U3TA 4OPRA 5KIZA 3CUEA 2XD5A 4JGRA 4XUZA 3Q81A 5M1AA 3PTEA 4QJGA 5D3OA 2QJ7A 3ZNYA 3BW6A 3HUMA 1WYBA 3ZVWA 4NETA 4CLCE 2JKRI 4OP5A 2P04A 1YQSA 1JVJA 2V0UA 2DMWA 4EESA 1VEUB 4N1XA 4E3MA 2UV0E 3LR3A 1XGIA 4BL3A 2J9PA 4FH2A 4LFUA 4G3KA 3EGDC 1GHIA 2IWDA 1BLCA 4OVDA 2JKRM 2H10A 1U60A 1CI9A 3N7WA 1NJ4A 1G68A 4X53A 3F1OA 3OPRA 3T50A 5EPHA 4Y15A 2UWXA 1T1BA 4YWZA 4PM6A 1RP5A 4I39A 1XGJA 4XT2B 1GSWA 3KSIA 1ONGA 1PFLA 3DTIA 4JXVA 2W3DA 4QPRA 3CITA 2PR6A 4B9OA 5IT5A 5CX7A 2PBYA 5CERA 2Z6CA 2QMIA 4FOFA 4JBFA 3T1SA 3AGEA 3G34A 1XJ2A 5F68A 3F1PB 1TS7A 4OPZA 1MZUA 4ID4A 1UGUA 3HCYA 5FDSA 4HIAA 4L9FA 3HLEA 2K2NA 5FATA 2V8FA 2XA7S 4IHQA 5FAPA 4NXBA 2WGWB 2ZMAA 1IYPA 4Y2FA 2K7SA 1VETA 3BYDA 1SZVA 5L07A 1D7EA 1MWRA 4OONA 2JCHA 4WZ5A 3BFEA 3ITBA 3GSGA 2CMNA 2WKQA 3HLCA 1NRJA 1F98A 4Y5FA 2GJ3A 4WEJA 4KZAA 5HZHA 4JPMA 1SKOA 4KQDA 3UE3A 3SS5A 2M7VA 4LV0A 3T4JA 3W4QA 3F1NB 4A5RA 3VSLA 1YLWA 4KENB 4DF6A 1IYQA 2ZC7A 5FQMA 4X1MA 4P0MA 1MY8A 1V9YA 4LV3A 4WF0A 1FSYA 2P9VA 4OP8A 3BM6A 3NOPC 2W3FA 3ZCZA 2BASA 4IUHA 1XJ4A 4HQAA 4Q0HA 5C5KA 1YAXA 2X01A 2QHKA 2PBDP 1PI5A 3BEBA 3B42A 4ESPA 1PWGA 1P0ZA 3PBSA 3IHBA 2L1MA 5DTTA 1D1JA 4ZJ1A 3CPTB 1DRMA 4DE0A 3VP1A 5F1GA 5I5LA 1HTZA 1K57C 1NLYA 3C38A 1ESIA 3H9WA 4JF5A 3UE6A 2EFUA 1E3UD 3LR4A 5HWWA 5HAPA 4HESA 3OPPA 3T4OA 4O8GA 1FCNA 3C4PA 4EERA 2BLSA 4DE2A 3LI8A 1WYCA 4UAAA 1XFQA 3VOLA 5EV0A 5DKLA 5HDSA 5CEDA 5HX9A 3V3SA 2NUPC 2M1CA 2ZL1B 4BD0A 1FCMA 2QJ5A 3CMZA 1NRFA 1OPXA 4C75A 4Y7PA 3H82B 3ZGAB 1M6KA 2OLVA 3MXSA 2V2FF 3NULA 3LFVA 4I38A 4PKYG 2XR0A 4K0WA 1L0GA 3B47A 3LI9A 3HLWA 3C30A 1K55C 1YLJA 3PBOA 1MKIA 4X56A 3KYEA 3NI9A 4JF4A 5HAIA 4CQHA 3TRCA 3SS4A 1T1CA 3E4QA 5TR7A 3BFFA 4Y3IA 2X02A 5HFOA 2A24A 3FPWA 3N8RA 1CEGA 5TGFA 4DE1A 2I72A 2XH9A 2YKFA 3MSHA 3IF6B 2HP6A 3AGFA 5FEFA 2VKSA 4HP4A 5FI2A 2QZ6A 4R3AA 1P9WA 4M3KA 1O7EA 4B88A 5CEBA 3TJZC 1LSWA 3LR5A 3VMAA 3H7WB 4KZ7A 3NHQA 3SS3A 1JWZA 1XA7A 5F82A 2O99A 5DF9A 4EBPA 5DTKA 5J8XA 2HDQA 3IBRA 4P87A 2WYXA 4DN0A 1T18A 3T12B 4I3JA 4GHIA 2VGLM 4KZ5A 2KDKA 3IHAA 2ZJ9A 2HGVA 1GCEA 5HWVA 2XD1A 5AJGA 3IWOA 2W1RA 4FSFA 3WWXA 2FH5A 4DXCA 3M2JA 1K6SA 1Z09A 3O5YA 1Y28A 5DFYA 2J9OA 1OTIA 3ZG9B 4GW9A 1TVFA 4NXEA 3D9YA 2V8CA 4EUZA 5HD3A 1W7FA 2ZC4B 1IFQA 3A0SA 3QP1A 5M19A 3CLOA 4ZJ2A 3FWLA 2KOIA 3G4PA 4WMCA 1TF1A 4I3IA 4PM7A 3EQVA 5TBMB 4EW7A 1Y54A 3HUOA 3MFDA 3NDGA 3IQAA 2ZQ7A 1S1ZA 4H6JB 2OWJA 4S2LA 3LEQA 5EECA 4GS9A 3LIDA 1V9ZA 3UNWA 1TS6A 3A3DA 3OCLA 4E04A 3A0RA 3EEHA 5E2FA 3HJKA 3PXPA 3SW1A 4E3JA 1OTDA 4EQ1A 4GDNA 4MN5A 2V1ZA 1LL8A 3JYIA 3MF0A 1BYWA 3HLDA 4P85A 5CGXA 1CI8A 2VA0A 3W8KA 4MEZA 3MQ0A 2Y2NA 4PAUA 3B3XA 4K0XA 1EWZA 1YPRA 1PRQA 5FQJA 1OJ5A 4N9KA 5G18A 5CHMA 4BENA 5CECA 1VEUA 3EWKA 2EFXA 5HDCA 4F3LB 4KG6A 4WN5A 3UDIA 1FCOA 1E4DA 2V20A 4MN7A 2G7UA 5A92A 4C6YA 1YSQA 2LB5A 1K54A 3E0YA 2AVXA 4MMNA 1ACFA 3PAGA 1NZUA 2EWWA 2WZZA 3A3JA 4N9LA 3UB9A 4GDBA 3QP4A 3FC7A 4G3VA 3V50A 3N4IA 1CF0A 1L0EA 1KGEA 4XT2A 3C7VA 3MMHA 3JPUA 4GOGA 3Q7ZA 4OLDA 4HNBA 5KSCA 4KQOA 2WKRA 2H0TA 1CJFA 2W3HA 2EXBA 4RQ9A 1J3WA 1H5XA 5CGSA 3HUNA 3F1PA 1PIOA 4JF6A 3MFXA 3ZQ5A 3A3IA 2PR5A 2Q9MA 2HJEA 4ETZA 4UA9A 1OTEA 1YSPA 2VGJA 3DWKA 2XGNA 2VV8A 3UPOA 2GDNA 1LT0A 2WGWA 2FFYA 2L0WA 4NXFA 3OCNA 3V39A 1S4RA 4DRTA 1TEMA 5LBRA 1STZA 4QU3A 4PM9A 1MWUA 3O3VA 3CWFA 4UA6A 2P08A 1MPLA 3IBJA 2JKFA 2H5SA 3F1NA 4UHUA 5HAQA 3ISGA 2ZOHA 4S2PA 4QY6A 4QWOA 4NG2A 1S1YA 4PPRA 4ETXA 4CPKA 4KUOA 5F6AA 3A3FA 4RA7A 4UQIS 1NWZA 4EUVA 5A90A 3PBRA 1LI0A 3C2WA 3VFHA 3QP6A 4D60A 2QPNA 4R3BA 3LIAA 4II7A 3QHYA 2IWCA 1OT6A 3QNBA 1N9OA 2V0WA 4D2OA 2Y2GA 1I2WA 4LCLA 1YKDA 4S2NC 3GR2A 4WL9A 4KUKA 2INWA 2ZD8A 3BFGA 3P09A 5AVEA 3D4FA 4R38A 3UE0A 2ZQAA 1KE3A 1XPBA 3CPTA 5EVIC 5DJTA 4HY8A 4M4XA 4RVAA 5HSQA 4S2MA 4EETB 4CLCC 4EBNA 4Y0TA 2ZQ9A 3MZDA 4S2KA 4HBTA 1N9NA 5HL1A 4GD6A 2Z6DA 4Y17A 3S7NA 1IOUA 3T1XA 5EFWA 5JYPA 5IS1A 4F94A 5F5YA 1HVBA 4O0PA 5CGWA 1X0OA 5DTSA 1K25A 5L8MA 3WS2A 3GV9A 3LCEA 3I7JA 1XJ6A 4OKPA 3IS2B 3CI6A 1KDWA 3R7WB 2HDRA 5FSRA 2ZL1A 4BBTA 4E6XA 3MJQA 1ESUA 1H8MA 3MKFA 1H3QA 3H82A 4HEFA 3S1YA 2B5RA 3IH9A 3VP3A 3Q07A 1LI9A 3PBTA 1G6OA 3LIFA 1K0KA 3UDXA 4BL2A 2JHEA 2OWHA 1W79A 3E2LA 5G4ZA 1YLYA 4EV4A 3BLSA 3CUEC 1A0KA 2J80A 3IF5A 1TDLA 1BZAA 3BFDA 5FQ9A 3NDEA 2C6WB 3OPHA 1S66L 5GHZA 4E3OA 2VZWA 2RCXA 2B02A 3KSHA 3HREA 3KSGA 2KLIA 1EW0A 3DBAA 3T4KA 1TDGA 4IVKA 3T4SA 4DMZA 1KVMA 3IF6A 3WS5A 3K3CA 3OBFA 5KSHA 1K6RA 1D06A 3WS0A 4WUJA 2VEAA 2D02A 4QB8A 2X71A 2ZM8A 1NXYA 2V9AA 2FFFB 3H7WA 4BMWA 4Y13A 1BT5A 1W8YA 2K31A 4KQQA 4P6ZM 1UWNX 2Q9NA 4OPQA 1L0FA 1LSXA 4NKPA 2JKTI 1HLUP 1DJBA 3T1RA 4C3QA 4R70A 3VP0A 3UB7A 1K4EA 2XQZA 3G2YA 1WE4A 3WRTA 2JKTM 4BQMA 4HOIA 1MC0A 4MNRA 3ZDJA 3FKVA 5GHXA 2MJ6A 3UDFA 5JYOA 1FOFA 1XKZA 4HHDA 2PHYA 3ZG5A 3NOUC 3EQUA 3ZG0A 1OT9A 4S2OA 3HVFA 1ODVA 5FAQA 4HP9A 4PMAA 5FA7A 5TBMA 3PR6A 1QMEA 1L3LA 1N9LA 4E6WA 3MZFA 4H6JA 1K38A 3NIAA 5HARA 3IX4A 5I94A 4LENA 4WZ5C 3VFFA 2EWVA 5E2EA 2A3UA 3E4OA 1S6RA 4EQIA 1W63M 2O9AA 5F83A 4FD8A 3ZFZA 2J3TC 3V67A 2V1BA 1KE4A 4DKIA 3SH9A 3HLBA 3OPLA 4HJ3A 2PU2A 4QHCA 5CTNA 3ICYA 4U0TA 4E3NA 2GX5A 5E2GA 5F69A 1DP8A 5FQKA 3VV4A 3RJUA 2WKHA 2EX6A 4F3LA 3W4PA 2HDUA 1IYOA 4DXBA 3W4OA 4KG2A 2VK3A 1MKMA 4HH3A 1W63Q 5HWTA 1J9MA 2OV5A 2Y91A 1NY0A 3NOTC 3FG8A 1GHMA 3G31A 3NJAA 3MR0A 4QD4A 1N9BA 3UMDA 4R3JA 3LGOA 1E3UA 4GJ4A 3BRMA 2O9CA 4R0QA 2VV7A 4WELA 1MWSA 1FIKA 3ZNTA 4KZ6A 2PD7A 4S2IA 4U0XA 3A3EA 3Q7VB 4N1HA 2WZXA 4Q0JA 2Y2LA 3SOIA 3VOYA 4BWIA 2HJ9C 2NUTC 3AGDA 4GLQA 3ZG7B 4IBXA 5TFQA 4HJ4A 2PT7A 4OQGA 4MN6A 3DTKA 2JKGA 2VGLS 4ARZB 3EEAA 4KZBA 2J7VA 3NC8A 5EM0A 2Y55A 2W27A 3BY9A 4NK3A 3D72A 2XEPA 3QP2A 4MBHA 1BLHA 5AQ9A 3MXQA 4RYEA 1G28A 1KVLA 2EXAA 3T4QA 1E25A 1NZOA 1OJGA 2LB9A 1SDNA 4BLMA 2WGIA 1DJAA 1K4FA 3LY4A 2H0YA 4NXGA 1SDEA 3DWZA 3UPNA 1FQGA 2Y2QA 3L9KA 1GHPA 3C5AA 3V5MA 1SCWA 3UY6A 3E98A 2CC1A 1Q2QA 4PHTA 3U2AA 3VE3A 1ZHHB 1HD8A 1LHYA 2PAVP 3BQAA 5L2FA 4S2JA 1ERQA 2DCFA 5DF8A 3IXGA 1L2SA 4HJ6A 3K2NA 1ZC2A 3D3OA 3BJNA 1BULA 3MKEA 1AXBA 1M40A 1ZTUA 2Y4AA 4WBGA 4LLOB 5EOEA 2IA2A 3IX3A 3ITAA 3UPPA 2A49A 4E3LA 4KZ8A 4MDZA 4EEUA 1NLZA 4AFIA 4EWFA 5EVEA 3O86A 3QP8A 3LEZA 1DJCA 2YKHA 5HPIA 1BLPA 5GLBA 1PW8A 2W0NA 4LPZA 1YMXA 5CHUA 1LSVA 4I3AA 1DY6A 3ZYTA 4GCZA 4WZ4A 3LICA 2E8IA 1VQQA 4KG5A 4EU0A 2XDMA 2EX2A 4JXSA 4P6BA 3QNCA 1WA9A 2J8YA 1XA1A 3HLFA 4R23A 1K56D 3NECA 1TS8A 4GN2A 4IBRA 2Y2JA 4ZTKA 2XRNA 3C8CA 3IXBA 1HZOA 4ZAMA 5DVAA 3P01A 4G3WA 1XFNA 5U47A 4UEYA 4GNUA 1S4SA 1ERMA 3IS2A 3QP5A 2EX9A 5A93A 2PRFA 3R7WA 1SHVA 5IU1A 5FI6A 3RXWA 1F2KA 4OQHA 2ZM0A 3RTYA 3DW0A 4Y0UA 2WGVA 3EGXC 4Z9QA 5E43A 3G32A 4FH4A 5CHJA 5HL6A 4O7DA 3SH7A 5FEGA 1EI5A 4NEED 5K5BA 5F1FA 3RXXA 2Y2IA 2XLNA 4IEDA 4X55A 2ZM2A 3UO9A 3MZEA 3L7HA 3UN7A 4DJ2A 3IXDA 3DTMA 1IKIA 3GRJA 4PM8A 2HP9A 2JE5A 2DNSA 3S22A 2JC7A 5DF7A 2E8JA 3LY3A 2VX8A 1RCJA 4ZBEA 2W1TB 2WUQA 4B93A 3PAEA 4HH2A 4ZRRA 1KGGA 5DJUA 5EUAA 1PWCA 3IWIA 4JGPA 4DDSA 1ES3A 4YNRA 2OAQ1 4LGWA 4LV1A 5AQAA 4Q8IA 3TG9A 3TE8A 5L09A 2J3TD 3CHWP 5MC7A 3DTEA 4JKTA 1K54C 2R78A 4E3IA 1DP9A 1PW1A 2G2WA 3GECA 1JTGA 1O07A 3TSGA 1K56A 5KMWA 2WKEA 4YFMA 3T4LA 1S67L 4BJPA 4R4RA 3PHYA 1KGFA 5HDDA 4ZDXA 1KOUA 2WKPA 5EVIB 4CLCB 5FQIA 1H0MA 1K57A 2PDRA 2ACGA 2XA7M 5FI7A 1FSWA 2EX8A 3TW8A 4GKUA 1GA0A 4JGOA 1G6AA 1T19A 5A8BA 1XXMA 1ES5A 5A91A 1MWTA 4Z1WA 2ZC5B 3G30A 4EBLA 3FZCA 4CJNA 3SZTA 2ZMVA 3NCKA 2A2LA 1PZPA 3M6HA 4K91A 4MBKA 1I2SA 3O88A 2Y8HA 3KO6A 3M6BA 2HPBA 1MXOA 4R1GA 3WS1A 1MBLA 2OLUA 3HLGA 4LRYC 5EOOA 2GNXA 4FUWA 3OZHA 2PYPA 2XK1A 1BLSA 4O01A 1IEMA 1K55A 1FILA 2ZLYA 3N8SA 1OMEA 2QYBA 3O87A 3ULFA 4OLGA 5GHYA 3UB5P 1ZG6A 2D01A 3UB6A
chains in the Genus database with same CATH topology
5M1AA 3PTEA 4QJGA 3HLDA 4P85A 5D3OA 3SH9A 5CGXA 1CI8A 1GA9A 3W8KA 3ZNYA 3HLBA 3OPLA 2C5WB 2PU2A 4MEZA 1H8ZA 4QHCA 3Q82A 3HUMA 1WYBA 5CTNA 4OPYA 2Y2NA 4U0TA 1JWVA 4JLFA 4E3NA 1C3BA 3ZVWA 5E2GA 3B3XA 4K0XA 1LL9A 1EWZA 4NETA 4UA7A 5FQKA 5FQJA 3RJUA 2WKHA 4N9KA 5G18A 4OP5A 1BSGA 2EX6A 5CHMA 1NYMA 3W4PA 4BENA 5CECA 1YQSA 1JVJA 2EFXA 2HDUA 1IYOA 4DXBA 4KG6A 4N1XA 1FR6A 4KG2A 1FCOA 1E4DA 3UDIA 3W4OA 2V20A 4E3MA 1XGIA 5A92A 4C6YA 1J9MA 2OV5A 1K54A 2Y91A 4BL3A 2J9PA 5KZHA 1NY0A 3BFCA 4FH2A 2Z2LB 1GHMA 3G31A 1GHIA 2IWDA 1BLCA 4OVDA 4QD4A 1N9BA 1S0WA 1U60A 2H10A 4R3JA 1E3UA 1CI9A 3PAGA 1NZUA 2WZZA 1NJ4A 3BRMA 3N7WA 4WELA 4R0QA 3A3JA 1G68A 1MWSA 4N92A 3FKWA 4N9LA 3Q1FA 3ZNTA 4B4ZA 5IHVA 4KZ6A 1XX2A 1YMSA 4S2IA 4X53A 3Q7VA 4GDBA 2Y2OA 3OPRA 4OQIA 3A3EA 4U0XA 3V50A 3Q7VB 4N1HA 5EPHA 2UWXA 3N4IA 2WZXA 2Y2LA 1L0EA 3SOIA 1KGEA 4PM6A 3VOYA 1RP5A 3C7VA 3MBZA 2RL3A 1XGJA 1PZOA 3TOIA 3VP4A 3AGDA 2OSUA 4GOGA 3ZG7B 4IBXA 5TFQA 3Q7ZA 4RX2A 4OQGA 1ONGA 4OLDA 4JXVA 5BOHA 1NYYA 5KSCA 4KQOA 2H0TA 3HL9A 3OC2A 4X6TA 2EXBA 1ES4A 2PBYA 4KZBA 5CERA 4GB7A 2J7VA 3C4OA 1CK3A 1H5XA 2QMIA 3NC8A 3HUNA 3NY4A 5CGSA 4JBFA 4JXWA 2Y55A 1PIOA 4JF6A 3AGEA 3G34A 4NK3A 2XEPA 3A3IA 2Q9MA 4OPZA 2WADA 5GL9A 4OOMA 5AQBA 1FR1A 4ID4A 4UA9A 4XXRA 2VGJA 2Y2KA 3LO7A 4MBHA 1BLHA 3DWKA 3ZG8B 5AQ9A 3HLEA 4RYEA 2XGNA 5FATA 1KVLA 2EXAA 3UPOA 1E25A 2GDNA 1NZOA 2WGWA 1SDNA 2FFYA 4BLMA 2WGIA 5FAPA 1DJAA 1L0DA 2WGWB 1K4FA 3LY4A 2H0YA 3OCNA 4X69A 2ZMAA 5EVLA 1IYPA 1SDEA 3V39A 3DWZA 4WM9A 4XUZA 3BYDA 4DRTA 3UPNA 1FQGA 2Y2QA 1GHPA 1TEMA 1MWRA 3C5AA 3V5MA 4OONA 1SCWA 4QU3A 3UY6A 2CC1A 2JCHA 4PM9A 4WZ5A 1MWUA 2HDSA 3BFEA 1Q2QA 3O3VA 3ITBA 4WMCD 3UE1A 3FYZA 3GQZA 3GSGA 4UA6A 3HLCA 1HD8A 1W5DA 2Y59A 1MPLA 1LHYA 4KZAA 4WEJA 2ZC6B 4JPMA 2H5SA 3UE3A 5L2FA 4S2JA 1ERQA 2DCFA 3SS5A 4KZ9A 4LV0A 2Y2MA 3IF6C 3IXGA 1L2SA 4UHUA 5DF8A 3W4QA 3BLMA 1ZC2A 3ISGA 5HAQA 4S2PA 4QY6A 4A5RA 1BULA 3VSLA 3MKEA 1ES2A 1AXBA 1M40A 4PPRA 1YLWA 2Y4AA 4ZJ3A 4WBGA 4KENB 4CPKA 4DF6A 1IYQA 2ZC7A 3A3FA 4RA7A 5FQMA 4H8RA 4P0MA 5EE8A 5A90A 3PBRA 1LI0A 1MY8A 4LV3A 5EOEA 3VFHA 1FSYA 3ITAA 3UPPA 2A49A 4E3LA 1BUEA 2P9VA 2QPNA 4R3BA 4KZ8A 4OP8A 3BM6A 2P9VB 2IWCA 3QHYA 3P98A 4X68A 3ZCZA 3G35A 1PYYA 3QNBA 3ZVTA 3VP2A 4D2OA 4EWFA 2Y2GA 3O86A 1I2WA 2X01A 3LEZA 1DJCA 4LCLA 3ZHHA 2Z2MB 4S2NC 4LV2A 2Y2PA 1CEFA 1BLPA 1PI5A 3BEBA 3GR2A 4MBFA 2WAFA 5GLBA 1PW8A 2ZD8A 3BFGA 1PWDA 3P09A 1ALQA 3PBQA 3NBLA 1IELA 1YMXA 5CHUA 3D4FA 1PWGA 1DY6A 2ZQDA 3PBSA 3IHBA 4WZ4A 3UE0A 2ZQAA 5DTTA 2E8IA 1KE3A 4ZJ1A 1XPBA 2PU4A 1VQQA 5EVIC 3CZDA 4RVAA 4S2MA 1JTDA 3GVBA 4L0LA 4KG5A 2XDMA 4EBNA 2EX2A 4JXSA 4Y0TA 3M2KA 4DE0A 2ZQ9A 3MZDA 4P6BA 4S2KA 3VP1A 4HBTA 3QNCA 5HL1A 4GD6A 1SKFA 2J8YA 1XA1A 5F1GA 4GZBA 1HTZA 1K57C 3HLFA 4KZ4A 4R23A 1K56D 1ESIA 4JF5A 4B4XA 3IT9A 4IBRA 4GN2A 2EFUA 1E3UD 2Y2JA 4ZTKA 3IXBA 5JYPA 5HAPA 1HZOA 1KE0A 4ZAMA 4HESA 3OPPA 4F94A 5FQQA 3VSKA 2Y2HA 5DVAA 1HVBA 2ZQCA 5EVID 1FCNA 5CGWA 3C4PA 5DTSA 1K25A 5U47A 3WS2A 3GV9A 2BLSA 3LCEA 4DE2A 4GNUA 1YLTA 3I7JA 1WYCA 1ERMA 4UAAA 2EX9A 5A93A 4OKPA 1SHVA 1YLPA 5FI6A 3RXWA 4OQHA 2ZM0A 5CEDA 5HX9A 1KDWA 2HDRA 1QMFA 5FSRA 3V3SA 3DW0A 4E6XA 5GLDA 4OOYA 1ESUA 3CG5A 1ONHA 3MKFA 4BD0A 4Y0UA 1FCMA 3CMZA 1NRFA 4HEFA 4R4SA 1IYSA 3S1YA 1YLZA 1PI4A 2B5RA 4C75A 4Y7PA 2WGVA 5AQ7A 3ZGAB 4Z9QA 5E43A 3G32A 1M6KA 3IH9A 1W8QA 4FH4A 2OLVA 3Q07A 5CHJA 3MXSA 2V2FF 3VP3A 1LI9A 1Z6FA 2G2UA 3PBTA 4O7DA 3SH7A 1KDSA 2XR0A 4K0WA 1EI5A 1L0GA 2WKIA 3HLWA 5F1FA 1K55C 1N4OA 3RXXA 1IKGA 2Y2IA 2XLNA 4IEDA 2P74A 1YLJA 4X55A 3UDXA 3PBOA 4BL2A 2XF3A 4BD1A 3VOZA 2ZM2A 2BG1A 4Y0OA 1W79A 3E2LA 1MKIA 4X56A 3UO9A 3N6IA 1YLYA 4EV4A 3MZEA 3UN7A 3BLSA 3NI9A 1YM1A 4JF4A 3IXDA 3IF5A 4PM5A 1LL5A 3DTMA 5HAIA 1IKIA 3GRJA 4PM8A 3SS4A 2HP9A 1TDLA 1BZAA 3BFDA 5FQ9A 2JE5A 2DNSA 3NDEA 5TR7A 3S22A 2C6WB 2JC7A 3BFFA 3OPHA 5DF7A 5GHZA 4E3OA 2X02A 3LY3A 2RCXA 5HFOA 1RCJA 4ZBEA 2WUQA 3N8RA 3HREA 1CEGA 3PAEA 3FV7A 5TGFA 3E2KA 5CXWA 1TDGA 2I72A 4IVKA 4DE1A 2XH9A 1KVMA 1KGGA 3IF6A 4HBUA 3WS5A 5CTMA 1Q2PA 3IF6B 5EUAA 2HP6A 1PWCA 3AGFA 4JXGA 5KSHA 1JWPA 1K6RA 5FI2A 3WS0A 1YT4A 3IWIA 4DDSA 5FASA 4OH0A 2QZ6A 1ES3A 4QB8A 2X71A 4LV1A 5AQAA 4Q8IA 3TG9A 2ZC3B 2ZM8A 3C7UA 4M3KA 1NXYA 1O7EA 4QY5A 4B88A 5CEBA 2FFFB 2VGKA 2DRWA 5CRFA 5GLCA 3VMAA 4FCFA 4JKTA 1K54C 4KQRA 1BT5A 4KZ7A 4E3IA 1PW1A 1W8YA 3SS3A 1JWZA 1XA7A 4KQQA 5F82A 5DF9A 4WEKA 4EBPA 4XUXA 5DTKA 2G2WA 3S4XA 3V3RA 5J8XA 2HP5A 2HDQA 4GD8A 4P87A 2WYXA 2Q9NA 4IVIA 1JTGA 1O07A 3TSGA 4S2NA 3IH8A 4OPQA 1L0FA 2WAEA 2XFTA 3GMWA 1K56A 5KMWA 1ZKJA 4KZ5A 2WKEA 4YFMA 4OOLA 4YINA 1LLBA 4BJPA 1DJBA 3IHAA 4R4RA 2R9WA 4C3QA 2ZJ9A 3VP0A 1GCEA 1KGFA 4RX3A 1K4EA 2XD1A 2ZQ8A 3PBNA 2XQZA 3G2YA 3IWOA 5EVIA 4ZDXA 5E2HA 4FSFA 3WWXA 4DXCA 3M2JA 1WE4A 1K6SA 5EVIB 4KZ3A 3WRTA 2WK0A 2J9OA 3IXHA 5FQIA 3HBRA 3ZG9B 1TVFA 1K57A 4BQMA 3GTCA 5FI7A 4EUZA 1W7FA 4WYYA 2ZC4B 1FSWA 2EX8A 4MNRA 4OQ0A 3ZDJA 4DE3A 3FKVA 4GKUA 5M19A 1GA0A 1RGYA 5GHXA 3UDFA 5JYOA 1FOFA 1RGZA 1G6AA 5FDHA 1XKZA 4DDYA 5FAOA 3ZG5A 3EQUA 3ZG0A 1XXMA 1ES5A 4ZJ2A 3FWLA 3N8LA 4S2OA 5A91A 1MWTA 3HVFA 3MXRA 3G4PA 5FAQA 2ZC5B 4WMCA 3G30A 4EBLA 3FZCA 4PMAA 5FA7A 4CJNA 3BECA 3NCKA 4PM7A 3WS4A 4E3KA 3EQVA 1PZPA 3M6HA 4K91A 4MBKA 1QMEA 1Y54A 3HUOA 1I2SA 3MFDA 3O88A 1VM1A 4MLLA 1I5QA 3M6BA 3NDGA 3IQAA 1EROA 2JBFA 4E6WA 3MZFA 1K38A 2HPBA 1ZG4A 2ZQ7A 3NIAA 1MXOA 3G2ZA 5M18A 5HARA 4R1GA 5I94A 4LENA 4WZ5C 3WS1A 1XP4A 4S2LA 3VFFA 5EECA 3CJMA 1MBLA 2OLUA 3UNWA 3HLGA 5HW3A 5E2EA 5EOOA 2A3UA 3A3DA 3OCLA 1S6RA 2IWBA 5GLAA 4EQIA 4LCMA 2R9XA 3OZHA 5E2FA 2XK1A 1BLSA 1BTLA 1IEMA 1K55A 2XFSA 1H8YA 5F83A 4E3JA 3IWQA 4FD8A 3ZFZA 3WRZA 2ZLYA 3SH8A 3N8SA 1OMEA 4U3TA 4GDNA 4OPRA 3O87A 1KE4A 2V1ZA 4OLGA 5GHYA 1ZG6A 2XD5A 3JYIA 4DKIA 3Q81A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5M1A A;  3PTE A;  4QJG A;  3HLD A;  4P85 A;  5D3O A;  3SH9 A;  5CGX A;  1CI8 A;  1GA9 A;  3W8K A;  3ZNY A;  3HLB A;  3OPL A;  2C5W B;  2PU2 A;  4MEZ A;  1H8Z A;  4QHC A;  3Q82 A;  3HUM A;  1WYB A;  5CTN A;  4OPY A;  2Y2N A;  4U0T A;  1JWV A;  4JLF A;  4E3N A;  1C3B A;  3ZVW A;  5E2G A;  3B3X A;  4K0X A;  1LL9 A;  1EWZ A;  4NET A;  4UA7 A;  5FQK A;  5FQJ A;  3RJU A;  2WKH A;  4N9K A;  5G18 A;  4OP5 A;  1BSG A;  2EX6 A;  5CHM A;  1NYM A;  3W4P A;  4BEN A;  5CEC A;  1YQS A;  1JVJ A;  2EFX A;  2HDU A;  1IYO A;  4DXB A;  4KG6 A;  4N1X A;  1FR6 A;  4KG2 A;  1FCO A;  1E4D A;  3UDI A;  3W4O A;  2V20 A;  4E3M A;  1XGI A;  5A92 A;  4C6Y A;  1J9M A;  2OV5 A;  1K54 A;  2Y91 A;  4BL3 A;  2J9P A;  5KZH A;  1NY0 A;  3BFC A;  4FH2 A;  2Z2L B;  1GHM A;  3G31 A;  1GHI A;  2IWD A;  1BLC A;  4OVD A;  4QD4 A;  1N9B A;  1S0W A;  1U60 A;  2H10 A;  4R3J A;  1E3U A;  1CI9 A;  3PAG A;  1NZU A;  2WZZ A;  1NJ4 A;  3BRM A;  3N7W A;  4WEL A;  4R0Q A;  3A3J A;  1G68 A;  1MWS A;  4N92 A;  3FKW A;  4N9L A;  3Q1F A;  3ZNT A;  4B4Z A;  5IHV A;  4KZ6 A;  1XX2 A;  1YMS A;  4S2I A;  4X53 A;  3Q7V A;  4GDB A;  2Y2O A;  3OPR A;  4OQI A;  3A3E A;  4U0X A;  3V50 A;  3Q7V B;  4N1H A;  5EPH A;  2UWX A;  3N4I A;  2WZX A;  2Y2L A;  1L0E A;  3SOI A;  1KGE A;  4PM6 A;  3VOY A;  1RP5 A;  3C7V A;  3MBZ A;  2RL3 A;  1XGJ A;  1PZO A;  3TOI A;  3VP4 A;  3AGD A;  2OSU A;  4GOG A;  3ZG7 B;  4IBX A;  5TFQ A;  3Q7Z A;  4RX2 A;  4OQG A;  1ONG A;  4OLD A;  4JXV A;  5BOH A;  1NYY A;  5KSC A;  4KQO A;  2H0T A;  3HL9 A;  3OC2 A;  4X6T A;  2EXB A;  1ES4 A;  2PBY A;  4KZB A;  5CER A;  4GB7 A;  2J7V A;  3C4O A;  1CK3 A;  1H5X A;  2QMI A;  3NC8 A;  3HUN A;  3NY4 A;  5CGS A;  4JBF A;  4JXW A;  2Y55 A;  1PIO A;  4JF6 A;  3AGE A;  3G34 A;  4NK3 A;  2XEP A;  3A3I A;  2Q9M A;  4OPZ A;  2WAD A;  5GL9 A;  4OOM A;  5AQB A;  1FR1 A;  4ID4 A;  4UA9 A;  4XXR A;  2VGJ A;  2Y2K A;  3LO7 A;  4MBH A;  1BLH A;  3DWK A;  3ZG8 B;  5AQ9 A;  3HLE A;  4RYE A;  2XGN A;  5FAT A;  1KVL A;  2EXA A;  3UPO A;  1E25 A;  2GDN A;  1NZO A;  2WGW A;  1SDN A;  2FFY A;  4BLM A;  2WGI A;  5FAP A;  1DJA A;  1L0D A;  2WGW B;  1K4F A;  3LY4 A;  2H0Y A;  3OCN A;  4X69 A;  2ZMA A;  5EVL A;  1IYP A;  1SDE A;  3V39 A;  3DWZ A;  4WM9 A;  4XUZ A;  3BYD A;  4DRT A;  3UPN A;  1FQG A;  2Y2Q A;  1GHP A;  1TEM A;  1MWR A;  3C5A A;  3V5M A;  4OON A;  1SCW A;  4QU3 A;  3UY6 A;  2CC1 A;  2JCH A;  4PM9 A;  4WZ5 A;  1MWU A;  2HDS A;  3BFE A;  1Q2Q A;  3O3V A;  3ITB A;  4WMC D;  3UE1 A;  3FYZ A;  3GQZ A;  3GSG A;  4UA6 A;  3HLC A;  1HD8 A;  1W5D A;  2Y59 A;  1MPL A;  1LHY A;  4KZA A;  4WEJ A;  2ZC6 B;  4JPM A;  2H5S A;  3UE3 A;  5L2F A;  4S2J A;  1ERQ A;  2DCF A;  3SS5 A;  4KZ9 A;  4LV0 A;  2Y2M A;  3IF6 C;  3IXG A;  1L2S A;  4UHU A;  5DF8 A;  3W4Q A;  3BLM A;  1ZC2 A;  3ISG A;  5HAQ A;  4S2P A;  4QY6 A;  4A5R A;  1BUL A;  3VSL A;  3MKE A;  1ES2 A;  1AXB A;  1M40 A;  4PPR A;  1YLW A;  2Y4A A;  4ZJ3 A;  4WBG A;  4KEN B;  4CPK A;  4DF6 A;  1IYQ A;  2ZC7 A;  3A3F A;  4RA7 A;  5FQM A;  4H8R A;  4P0M A;  5EE8 A;  5A90 A;  3PBR A;  1LI0 A;  1MY8 A;  4LV3 A;  5EOE A;  3VFH A;  1FSY A;  3ITA A;  3UPP A;  2A49 A;  4E3L A;  1BUE A;  2P9V A;  2QPN A;  4R3B A;  4KZ8 A;  4OP8 A;  3BM6 A;  2P9V B;  2IWC A;  3QHY A;  3P98 A;  4X68 A;  3ZCZ A;  3G35 A;  1PYY A;  3QNB A;  3ZVT A;  3VP2 A;  4D2O A;  4EWF A;  2Y2G A;  3O86 A;  1I2W A;  2X01 A;  3LEZ A;  1DJC A;  4LCL A;  3ZHH A;  2Z2M B;  4S2N C;  4LV2 A;  2Y2P A;  1CEF A;  1BLP A;  1PI5 A;  3BEB A;  3GR2 A;  4MBF A;  2WAF A;  5GLB A;  1PW8 A;  2ZD8 A;  3BFG A;  1PWD A;  3P09 A;  1ALQ A;  3PBQ A;  3NBL A;  1IEL A;  1YMX A;  5CHU A;  3D4F A;  1PWG A;  1DY6 A;  2ZQD A;  3PBS A;  3IHB A;  4WZ4 A;  3UE0 A;  2ZQA A;  5DTT A;  2E8I A;  1KE3 A;  4ZJ1 A;  1XPB A;  2PU4 A;  1VQQ A;  5EVI C;  3CZD A;  4RVA A;  4S2M A;  1JTD A;  3GVB A;  4L0L A;  4KG5 A;  2XDM A;  4EBN A;  2EX2 A;  4JXS A;  4Y0T A;  3M2K A;  4DE0 A;  2ZQ9 A;  3MZD A;  4P6B A;  4S2K A;  3VP1 A;  4HBT A;  3QNC A;  5HL1 A;  4GD6 A;  1SKF A;  2J8Y A;  1XA1 A;  5F1G A;  4GZB A;  1HTZ A;  1K57 C;  3HLF A;  4KZ4 A;  4R23 A;  1K56 D;  1ESI A;  4JF5 A;  4B4X A;  3IT9 A;  4IBR A;  4GN2 A;  2EFU A;  1E3U D;  2Y2J A;  4ZTK A;  3IXB A;  5JYP A;  5HAP A;  1HZO A;  1KE0 A;  4ZAM A;  4HES A;  3OPP A;  4F94 A;  5FQQ A;  3VSK A;  2Y2H A;  5DVA A;  1HVB A;  2ZQC A;  5EVI D;  1FCN A;  5CGW A;  3C4P A;  5DTS A;  1K25 A;  5U47 A;  3WS2 A;  3GV9 A;  2BLS A;  3LCE A;  4DE2 A;  4GNU A;  1YLT A;  3I7J A;  1WYC A;  1ERM A;  4UAA A;  2EX9 A;  5A93 A;  4OKP A;  1SHV A;  1YLP A;  5FI6 A;  3RXW A;  4OQH A;  2ZM0 A;  5CED A;  5HX9 A;  1KDW A;  2HDR A;  1QMF A;  5FSR A;  3V3S A;  3DW0 A;  4E6X A;  5GLD A;  4OOY A;  1ESU A;  3CG5 A;  1ONH A;  3MKF A;  4BD0 A;  4Y0U A;  1FCM A;  3CMZ A;  1NRF A;  4HEF A;  4R4S A;  1IYS A;  3S1Y A;  1YLZ A;  1PI4 A;  2B5R A;  4C75 A;  4Y7P A;  2WGV A;  5AQ7 A;  3ZGA B;  4Z9Q A;  5E43 A;  3G32 A;  1M6K A;  3IH9 A;  1W8Q A;  4FH4 A;  2OLV A;  3Q07 A;  5CHJ A;  3MXS A;  2V2F F;  3VP3 A;  1LI9 A;  1Z6F A;  2G2U A;  3PBT A;  4O7D A;  3SH7 A;  1KDS A;  2XR0 A;  4K0W A;  1EI5 A;  1L0G A;  2WKI A;  3HLW A;  5F1F A;  1K55 C;  1N4O A;  3RXX A;  1IKG A;  2Y2I A;  2XLN A;  4IED A;  2P74 A;  1YLJ A;  4X55 A;  3UDX A;  3PBO A;  4BL2 A;  2XF3 A;  4BD1 A;  3VOZ A;  2ZM2 A;  2BG1 A;  4Y0O A;  1W79 A;  3E2L A;  1MKI A;  4X56 A;  3UO9 A;  3N6I A;  1YLY A;  4EV4 A;  3MZE A;  3UN7 A;  3BLS A;  3NI9 A;  1YM1 A;  4JF4 A;  3IXD A;  3IF5 A;  4PM5 A;  1LL5 A;  3DTM A;  5HAI A;  1IKI A;  3GRJ A;  4PM8 A;  3SS4 A;  2HP9 A;  1TDL A;  1BZA A;  3BFD A;  5FQ9 A;  2JE5 A;  2DNS A;  3NDE A;  5TR7 A;  3S22 A;  2C6W B;  2JC7 A;  3BFF A;  3OPH A;  5DF7 A;  5GHZ A;  4E3O A;  2X02 A;  3LY3 A;  2RCX A;  5HFO A;  1RCJ A;  4ZBE A;  2WUQ A;  3N8R A;  3HRE A;  1CEG A;  3PAE A;  3FV7 A;  5TGF A;  3E2K A;  5CXW A;  1TDG A;  2I72 A;  4IVK A;  4DE1 A;  2XH9 A;  1KVM A;  1KGG A;  3IF6 A;  4HBU A;  3WS5 A;  5CTM A;  1Q2P A;  3IF6 B;  5EUA A;  2HP6 A;  1PWC A;  3AGF A;  4JXG A;  5KSH A;  1JWP A;  1K6R A;  5FI2 A;  3WS0 A;  1YT4 A;  3IWI A;  4DDS A;  5FAS A;  4OH0 A;  2QZ6 A;  1ES3 A;  4QB8 A;  2X71 A;  4LV1 A;  5AQA A;  4Q8I A;  3TG9 A;  2ZC3 B;  2ZM8 A;  3C7U A;  4M3K A;  1NXY A;  1O7E A;  4QY5 A;  4B88 A;  5CEB A;  2FFF B;  2VGK A;  2DRW A;  5CRF A;  5GLC A;  3VMA A;  4FCF A;  4JKT A;  1K54 C;  4KQR A;  1BT5 A;  4KZ7 A;  4E3I A;  1PW1 A;  1W8Y A;  3SS3 A;  1JWZ A;  1XA7 A;  4KQQ A;  5F82 A;  5DF9 A;  4WEK A;  4EBP A;  4XUX A;  5DTK A;  2G2W A;  3S4X A;  3V3R A;  5J8X A;  2HP5 A;  2HDQ A;  4GD8 A;  4P87 A;  2WYX A;  2Q9N A;  4IVI A;  1JTG A;  1O07 A;  3TSG A;  4S2N A;  3IH8 A;  4OPQ A;  1L0F A;  2WAE A;  2XFT A;  3GMW A;  1K56 A;  5KMW A;  1ZKJ A;  4KZ5 A;  2WKE A;  4YFM A;  4OOL A;  4YIN A;  1LLB A;  4BJP A;  1DJB A;  3IHA A;  4R4R A;  2R9W A;  4C3Q A;  2ZJ9 A;  3VP0 A;  1GCE A;  1KGF A;  4RX3 A;  1K4E A;  2XD1 A;  2ZQ8 A;  3PBN A;  2XQZ A;  3G2Y A;  3IWO A;  5EVI A;  4ZDX A;  5E2H A;  4FSF A;  3WWX A;  4DXC A;  3M2J A;  1WE4 A;  1K6S A;  5EVI B;  4KZ3 A;  3WRT A;  2WK0 A;  2J9O A;  3IXH A;  5FQI A;  3HBR A;  3ZG9 B;  1TVF A;  1K57 A;  4BQM A;  3GTC A;  5FI7 A;  4EUZ A;  1W7F A;  4WYY A;  2ZC4 B;  1FSW A;  2EX8 A;  4MNR A;  4OQ0 A;  3ZDJ A;  4DE3 A;  3FKV A;  4GKU A;  5M19 A;  1GA0 A;  1RGY A;  5GHX A;  3UDF A;  5JYO A;  1FOF A;  1RGZ A;  1G6A A;  5FDH A;  1XKZ A;  4DDY A;  5FAO A;  3ZG5 A;  3EQU A;  3ZG0 A;  1XXM A;  1ES5 A;  4ZJ2 A;  3FWL A;  3N8L A;  4S2O A;  5A91 A;  1MWT A;  3HVF A;  3MXR A;  3G4P A;  5FAQ A;  2ZC5 B;  4WMC A;  3G30 A;  4EBL A;  3FZC A;  4PMA A;  5FA7 A;  4CJN A;  3BEC A;  3NCK A;  4PM7 A;  3WS4 A;  4E3K A;  3EQV A;  1PZP A;  3M6H A;  4K91 A;  4MBK A;  1QME A;  1Y54 A;  3HUO A;  1I2S A;  3MFD A;  3O88 A;  1VM1 A;  4MLL A;  1I5Q A;  3M6B A;  3NDG A;  3IQA A;  1ERO A;  2JBF A;  4E6W A;  3MZF A;  1K38 A;  2HPB A;  1ZG4 A;  2ZQ7 A;  3NIA A;  1MXO A;  3G2Z A;  5M18 A;  5HAR A;  4R1G A;  5I94 A;  4LEN A;  4WZ5 C;  3WS1 A;  1XP4 A;  4S2L A;  3VFF A;  5EEC A;  3CJM A;  1MBL A;  2OLU A;  3UNW A;  3HLG A;  5HW3 A;  5E2E A;  5EOO A;  2A3U A;  3A3D A;  3OCL A;  1S6R A;  2IWB A;  5GLA A;  4EQI A;  4LCM A;  2R9X A;  3OZH A;  5E2F A;  2XK1 A;  1BLS A;  1BTL A;  1IEM A;  1K55 A;  2XFS A;  1H8Y A;  5F83 A;  4E3J A;  3IWQ A;  4FD8 A;  3ZFZ A;  3WRZ A;  2ZLY A;  3SH8 A;  3N8S A;  1OME A;  4U3T A;  4GDN A;  4OPR A;  3O87 A;  1KE4 A;  2V1Z A;  4OLG A;  5GHY A;  1ZG6 A;  2XD5 A;  3JYI A;  4DKI A;  3Q81 A; 
#chains in the Genus database with same CATH topology
 2ZBB A;  2FZ0 A;  1GA9 A;  2C5W B;  4K08 A;  1H8Z A;  3Q82 A;  4OPY A;  1JWV A;  2H28 A;  4JLF A;  1C3B A;  1LL9 A;  3VE4 A;  5AVF A;  4EEP A;  3T4T A;  4UA7 A;  1BSG A;  1NYM A;  5TJJ A;  2XSS A;  1FR6 A;  3IX8 A;  3LIB A;  3KSF A;  5KZH A;  3BFC A;  2Z2L B;  1JNU A;  1S0W A;  4N92 A;  3FKW A;  4B4Z A;  3Q1F A;  5IHV A;  1XX2 A;  1YMS A;  3Q7V A;  2Y2O A;  4OQI A;  3FPV A;  3F1O B;  2J3W A;  4WLA A;  3MBZ A;  2I9V A;  4P6Z S;  2RL3 A;  1PZO A;  3TOI A;  3VP4 A;  2OSU A;  4RX2 A;  2EA9 A;  5BOH A;  1NYY A;  4ARZ A;  2O0Y A;  3HL9 A;  3OOV A;  3OC2 A;  4X6T A;  3UME A;  1ES4 A;  3KX0 X;  4GB7 A;  3C4O A;  1CK3 A;  3NY4 A;  4JXW A;  2W3G A;  4X1L A;  2WAD A;  5GL9 A;  4OOM A;  5AQB A;  1FR1 A;  3JVV A;  4XXR A;  3LO7 A;  2Y2K A;  3ZG8 B;  4I5S A;  2V1A A;  3CAX A;  5G4Y A;  4JGQ A;  1L0D A;  4MCW A;  3BY8 A;  2ZMF A;  1TS0 A;  4R6L A;  4X69 A;  5EVL A;  1TD5 A;  4WM9 A;  3OLO A;  1VET B;  2HDS A;  4WMC D;  3UE1 A;  3FYZ A;  3GQZ A;  3EOI A;  1W5D A;  2OAP 1;  2Y59 A;  2ZC6 B;  3P7N A;  4ME4 A;  4PKY A;  5J7E A;  1OTA A;  4L9G A;  4KZ9 A;  2Y2M A;  1SKO B;  3IF6 C;  4EXO A;  3BLM A;  3GDI A;  1P97 A;  1ES2 A;  4ZJ3 A;  3G6O A;  4BBU A;  4H8R A;  5EE8 A;  1F9I A;  2PD8 A;  1BUE A;  2P7J A;  2QKP A;  2P9V B;  3P98 A;  4X68 A;  3W2Z A;  2VLG A;  1AWI A;  3G35 A;  1PYY A;  3ZVT A;  4LRX C;  3VP2 A;  3MQQ A;  3ZHH A;  2Z2M B;  4LV2 A;  2Y2P A;  1CEF A;  3BQ8 A;  4MBF A;  2WAF A;  3LYX A;  1PWD A;  1ALQ A;  3PBQ A;  3NBL A;  1IEL A;  2KX6 A;  2ZQD A;  3KYQ A;  1UWP X;  1T1A A;  2PU4 A;  3CZD A;  1F5M A;  5DKK A;  1JTD A;  3GVB A;  4L0L A;  1CQA A;  4BBV A;  2QWS A;  3M2K A;  3S7O A;  2VV6 A;  1SKF A;  2W3E A;  4GZB A;  5HD5 A;  4KZ4 A;  4B4X A;  3IT9 A;  4IJG A;  4YOF A;  1KE0 A;  5FQQ A;  3VSK A;  2JN7 A;  2Y2H A;  3A0V A;  4HI4 A;  2ZQC A;  5EVI D;  2XRO A;  1YLT A;  3RH8 B;  4CLC D;  1YLP A;  1QMF A;  2L4R A;  5GLD A;  4OOY A;  5FL3 A;  3CG5 A;  1ONH A;  3R4K A;  5EM1 A;  4R4S A;  1IYS A;  1YLZ A;  1PI4 A;  3PYP A;  1VB6 A;  5AQ7 A;  1W8Q A;  3B33 A;  2GZA A;  1Z6F A;  2G2U A;  1XJ3 A;  1KDS A;  2WKI A;  1N4O A;  1IKG A;  3LUQ A;  2P74 A;  2XF3 A;  4BD1 A;  3VOZ A;  2BG1 A;  4Y0O A;  3N6I A;  1GSV A;  2Y79 A;  2B95 A;  1YM1 A;  4PM5 A;  1LL5 A;  2OOL A;  3KYZ A;  2W1T A;  2HV1 A;  3LR0 A;  1Y4O A;  3S7Q A;  2A24 B;  3FV7 A;  3E2K A;  4X25 A;  5CXW A;  3RFB A;  5J3W A;  4HBU A;  5HPF A;  1OTB A;  3UB8 A;  5CTM A;  1Q2P A;  4JXG A;  1JWP A;  1PNE A;  1YT4 A;  5FAS A;  4OH0 A;  2ZC3 B;  3C7U A;  4QY5 A;  4L9E A;  2VGK A;  2DRW A;  5CRF A;  3BWL A;  5DFX A;  5GLC A;  4FCF A;  4KQR A;  3MS6 A;  4WEK A;  4XUX A;  2O9B A;  3S4X A;  3V3R A;  4DJ3 A;  2HP5 A;  2PYR A;  4GD8 A;  4IVI A;  4S2N A;  3IH8 A;  2WAE A;  2HF6 A;  2XFT A;  3GMW A;  4IUK A;  1ZKJ A;  2HZ5 A;  4OOL A;  3HJI A;  4YIN A;  1LLB A;  4GHI B;  5J4E A;  2R9W A;  2Q0O A;  4RX3 A;  5EVI A;  2ZQ8 A;  3PBN A;  5E2H A;  3DAV A;  1VHM A;  4KZ3 A;  4CLC A;  2WK0 A;  2ZOI A;  3IXH A;  3HBR A;  3GTC A;  3T1Q B;  4WYY A;  4OQ0 A;  4DE3 A;  1RGY A;  2VJW A;  3LIE A;  1RGZ A;  5FDH A;  2M7U A;  4DDY A;  5FAO A;  5L10 A;  3N8L A;  3MXR A;  4LRZ E;  1GSX A;  3BEC A;  3WS4 A;  4E3K A;  2BTF P;  3JVU A;  1VM1 A;  4MLL A;  1I5Q A;  1ERO A;  2JBF A;  5M18 A;  1ZG4 A;  3G2Z A;  1G5U A;  1P9R A;  1XP4 A;  3K3D A;  3CJM A;  3E4P A;  4Q0I A;  5HW3 A;  4GS9 B;  2IWB A;  4FTX A;  5GLA A;  4LCM A;  2R9X A;  3S7P A;  4UQI M;  1BTL A;  1DP6 A;  2XFS A;  1H8Y A;  3IWQ A;  3MQO A;  3WRZ A;  3U4L P;  3SH8 A;  2B18 A;  4U3T A;  4OPR A;  5KIZ A;  3CUE A;  2XD5 A;  4JGR A;  4XUZ A;  3Q81 A;  5M1A A;  3PTE A;  4QJG A;  5D3O A;  2QJ7 A;  3ZNY A;  3BW6 A;  3HUM A;  1WYB A;  3ZVW A;  4NET A;  4CLC E;  2JKR I;  4OP5 A;  2P04 A;  1YQS A;  1JVJ A;  2V0U A;  2DMW A;  4EES A;  1VEU B;  4N1X A;  4E3M A;  2UV0 E;  3LR3 A;  1XGI A;  4BL3 A;  2J9P A;  4FH2 A;  4LFU A;  4G3K A;  3EGD C;  1GHI A;  2IWD A;  1BLC A;  4OVD A;  2JKR M;  2H10 A;  1U60 A;  1CI9 A;  3N7W A;  1NJ4 A;  1G68 A;  4X53 A;  3F1O A;  3OPR A;  3T50 A;  5EPH A;  4Y15 A;  2UWX A;  1T1B A;  4YWZ A;  4PM6 A;  1RP5 A;  4I39 A;  1XGJ A;  4XT2 B;  1GSW A;  3KSI A;  1ONG A;  1PFL A;  3DTI A;  4JXV A;  2W3D A;  4QPR A;  3CIT A;  2PR6 A;  4B9O A;  5IT5 A;  5CX7 A;  2PBY A;  5CER A;  2Z6C A;  2QMI A;  4FOF A;  4JBF A;  3T1S A;  3AGE A;  3G34 A;  1XJ2 A;  5F68 A;  3F1P B;  1TS7 A;  4OPZ A;  1MZU A;  4ID4 A;  1UGU A;  3HCY A;  5FDS A;  4HIA A;  4L9F A;  3HLE A;  2K2N A;  5FAT A;  2V8F A;  2XA7 S;  4IHQ A;  5FAP A;  4NXB A;  2WGW B;  2ZMA A;  1IYP A;  4Y2F A;  2K7S A;  1VET A;  3BYD A;  1SZV A;  5L07 A;  1D7E A;  1MWR A;  4OON A;  2JCH A;  4WZ5 A;  3BFE A;  3ITB A;  3GSG A;  2CMN A;  2WKQ A;  3HLC A;  1NRJ A;  1F98 A;  4Y5F A;  2GJ3 A;  4WEJ A;  4KZA A;  5HZH A;  4JPM A;  1SKO A;  4KQD A;  3UE3 A;  3SS5 A;  2M7V A;  4LV0 A;  3T4J A;  3W4Q A;  3F1N B;  4A5R A;  3VSL A;  1YLW A;  4KEN B;  4DF6 A;  1IYQ A;  2ZC7 A;  5FQM A;  4X1M A;  4P0M A;  1MY8 A;  1V9Y A;  4LV3 A;  4WF0 A;  1FSY A;  2P9V A;  4OP8 A;  3BM6 A;  3NOP C;  2W3F A;  3ZCZ A;  2BAS A;  4IUH A;  1XJ4 A;  4HQA A;  4Q0H A;  5C5K A;  1YAX A;  2X01 A;  2QHK A;  2PBD P;  1PI5 A;  3BEB A;  3B42 A;  4ESP A;  1PWG A;  1P0Z A;  3PBS A;  3IHB A;  2L1M A;  5DTT A;  1D1J A;  4ZJ1 A;  3CPT B;  1DRM A;  4DE0 A;  3VP1 A;  5F1G A;  5I5L A;  1HTZ A;  1K57 C;  1NLY A;  3C38 A;  1ESI A;  3H9W A;  4JF5 A;  3UE6 A;  2EFU A;  1E3U D;  3LR4 A;  5HWW A;  5HAP A;  4HES A;  3OPP A;  3T4O A;  4O8G A;  1FCN A;  3C4P A;  4EER A;  2BLS A;  4DE2 A;  3LI8 A;  1WYC A;  4UAA A;  1XFQ A;  3VOL A;  5EV0 A;  5DKL A;  5HDS A;  5CED A;  5HX9 A;  3V3S A;  2NUP C;  2M1C A;  2ZL1 B;  4BD0 A;  1FCM A;  2QJ5 A;  3CMZ A;  1NRF A;  1OPX A;  4C75 A;  4Y7P A;  3H82 B;  3ZGA B;  1M6K A;  2OLV A;  3MXS A;  2V2F F;  3NUL A;  3LFV A;  4I38 A;  4PKY G;  2XR0 A;  4K0W A;  1L0G A;  3B47 A;  3LI9 A;  3HLW A;  3C30 A;  1K55 C;  1YLJ A;  3PBO A;  1MKI A;  4X56 A;  3KYE A;  3NI9 A;  4JF4 A;  5HAI A;  4CQH A;  3TRC A;  3SS4 A;  1T1C A;  3E4Q A;  5TR7 A;  3BFF A;  4Y3I A;  2X02 A;  5HFO A;  2A24 A;  3FPW A;  3N8R A;  1CEG A;  5TGF A;  4DE1 A;  2I72 A;  2XH9 A;  2YKF A;  3MSH A;  3IF6 B;  2HP6 A;  3AGF A;  5FEF A;  2VKS A;  4HP4 A;  5FI2 A;  2QZ6 A;  4R3A A;  1P9W A;  4M3K A;  1O7E A;  4B88 A;  5CEB A;  3TJZ C;  1LSW A;  3LR5 A;  3VMA A;  3H7W B;  4KZ7 A;  3NHQ A;  3SS3 A;  1JWZ A;  1XA7 A;  5F82 A;  2O99 A;  5DF9 A;  4EBP A;  5DTK A;  5J8X A;  2HDQ A;  3IBR A;  4P87 A;  2WYX A;  4DN0 A;  1T18 A;  3T12 B;  4I3J A;  4GHI A;  2VGL M;  4KZ5 A;  2KDK A;  3IHA A;  2ZJ9 A;  2HGV A;  1GCE A;  5HWV A;  2XD1 A;  5AJG A;  3IWO A;  2W1R A;  4FSF A;  3WWX A;  2FH5 A;  4DXC A;  3M2J A;  1K6S A;  1Z09 A;  3O5Y A;  1Y28 A;  5DFY A;  2J9O A;  1OTI A;  3ZG9 B;  4GW9 A;  1TVF A;  4NXE A;  3D9Y A;  2V8C A;  4EUZ A;  5HD3 A;  1W7F A;  2ZC4 B;  1IFQ A;  3A0S A;  3QP1 A;  5M19 A;  3CLO A;  4ZJ2 A;  3FWL A;  2KOI A;  3G4P A;  4WMC A;  1TF1 A;  4I3I A;  4PM7 A;  3EQV A;  5TBM B;  4EW7 A;  1Y54 A;  3HUO A;  3MFD A;  3NDG A;  3IQA A;  2ZQ7 A;  1S1Z A;  4H6J B;  2OWJ A;  4S2L A;  3LEQ A;  5EEC A;  4GS9 A;  3LID A;  1V9Z A;  3UNW A;  1TS6 A;  3A3D A;  3OCL A;  4E04 A;  3A0R A;  3EEH A;  5E2F A;  3HJK A;  3PXP A;  3SW1 A;  4E3J A;  1OTD A;  4EQ1 A;  4GDN A;  4MN5 A;  2V1Z A;  1LL8 A;  3JYI A;  3MF0 A;  1BYW A;  3HLD A;  4P85 A;  5CGX A;  1CI8 A;  2VA0 A;  3W8K A;  4MEZ A;  3MQ0 A;  2Y2N A;  4PAU A;  3B3X A;  4K0X A;  1EWZ A;  1YPR A;  1PRQ A;  5FQJ A;  1OJ5 A;  4N9K A;  5G18 A;  5CHM A;  4BEN A;  5CEC A;  1VEU A;  3EWK A;  2EFX A;  5HDC A;  4F3L B;  4KG6 A;  4WN5 A;  3UDI A;  1FCO A;  1E4D A;  2V20 A;  4MN7 A;  2G7U A;  5A92 A;  4C6Y A;  1YSQ A;  2LB5 A;  1K54 A;  3E0Y A;  2AVX A;  4MMN A;  1ACF A;  3PAG A;  1NZU A;  2EWW A;  2WZZ A;  3A3J A;  4N9L A;  3UB9 A;  4GDB A;  3QP4 A;  3FC7 A;  4G3V A;  3V50 A;  3N4I A;  1CF0 A;  1L0E A;  1KGE A;  4XT2 A;  3C7V A;  3MMH A;  3JPU A;  4GOG A;  3Q7Z A;  4OLD A;  4HNB A;  5KSC A;  4KQO A;  2WKR A;  2H0T A;  1CJF A;  2W3H A;  2EXB A;  4RQ9 A;  1J3W A;  1H5X A;  5CGS A;  3HUN A;  3F1P A;  1PIO A;  4JF6 A;  3MFX A;  3ZQ5 A;  3A3I A;  2PR5 A;  2Q9M A;  2HJE A;  4ETZ A;  4UA9 A;  1OTE A;  1YSP A;  2VGJ A;  3DWK A;  2XGN A;  2VV8 A;  3UPO A;  2GDN A;  1LT0 A;  2WGW A;  2FFY A;  2L0W A;  4NXF A;  3OCN A;  3V39 A;  1S4R A;  4DRT A;  1TEM A;  5LBR A;  1STZ A;  4QU3 A;  4PM9 A;  1MWU A;  3O3V A;  3CWF A;  4UA6 A;  2P08 A;  1MPL A;  3IBJ A;  2JKF A;  2H5S A;  3F1N A;  4UHU A;  5HAQ A;  3ISG A;  2ZOH A;  4S2P A;  4QY6 A;  4QWO A;  4NG2 A;  1S1Y A;  4PPR A;  4ETX A;  4CPK A;  4KUO A;  5F6A A;  3A3F A;  4RA7 A;  4UQI S;  1NWZ A;  4EUV A;  5A90 A;  3PBR A;  1LI0 A;  3C2W A;  3VFH A;  3QP6 A;  4D60 A;  2QPN A;  4R3B A;  3LIA A;  4II7 A;  3QHY A;  2IWC A;  1OT6 A;  3QNB A;  1N9O A;  2V0W A;  4D2O A;  2Y2G A;  1I2W A;  4LCL A;  1YKD A;  4S2N C;  3GR2 A;  4WL9 A;  4KUK A;  2INW A;  2ZD8 A;  3BFG A;  3P09 A;  5AVE A;  3D4F A;  4R38 A;  3UE0 A;  2ZQA A;  1KE3 A;  1XPB A;  3CPT A;  5EVI C;  5DJT A;  4HY8 A;  4M4X A;  4RVA A;  5HSQ A;  4S2M A;  4EET B;  4CLC C;  4EBN A;  4Y0T A;  2ZQ9 A;  3MZD A;  4S2K A;  4HBT A;  1N9N A;  5HL1 A;  4GD6 A;  2Z6D A;  4Y17 A;  3S7N A;  1IOU A;  3T1X A;  5EFW A;  5JYP A;  5IS1 A;  4F94 A;  5F5Y A;  1HVB A;  4O0P A;  5CGW A;  1X0O A;  5DTS A;  1K25 A;  5L8M A;  3WS2 A;  3GV9 A;  3LCE A;  3I7J A;  1XJ6 A;  4OKP A;  3IS2 B;  3CI6 A;  1KDW A;  3R7W B;  2HDR A;  5FSR A;  2ZL1 A;  4BBT A;  4E6X A;  3MJQ A;  1ESU A;  1H8M A;  3MKF A;  1H3Q A;  3H82 A;  4HEF A;  3S1Y A;  2B5R A;  3IH9 A;  3VP3 A;  3Q07 A;  1LI9 A;  3PBT A;  1G6O A;  3LIF A;  1K0K A;  3UDX A;  4BL2 A;  2JHE A;  2OWH A;  1W79 A;  3E2L A;  5G4Z A;  1YLY A;  4EV4 A;  3BLS A;  3CUE C;  1A0K A;  2J80 A;  3IF5 A;  1TDL A;  1BZA A;  3BFD A;  5FQ9 A;  3NDE A;  2C6W B;  3OPH A;  1S66 L;  5GHZ A;  4E3O A;  2VZW A;  2RCX A;  2B02 A;  3KSH A;  3HRE A;  3KSG A;  2KLI A;  1EW0 A;  3DBA A;  3T4K A;  1TDG A;  4IVK A;  3T4S A;  4DMZ A;  1KVM A;  3IF6 A;  3WS5 A;  3K3C A;  3OBF A;  5KSH A;  1K6R A;  1D06 A;  3WS0 A;  4WUJ A;  2VEA A;  2D02 A;  4QB8 A;  2X71 A;  2ZM8 A;  1NXY A;  2V9A A;  2FFF B;  3H7W A;  4BMW A;  4Y13 A;  1BT5 A;  1W8Y A;  2K31 A;  4KQQ A;  4P6Z M;  1UWN X;  2Q9N A;  4OPQ A;  1L0F A;  1LSX A;  4NKP A;  2JKT I;  1HLU P;  1DJB A;  3T1R A;  4C3Q A;  4R70 A;  3VP0 A;  3UB7 A;  1K4E A;  2XQZ A;  3G2Y A;  1WE4 A;  3WRT A;  2JKT M;  4BQM A;  4HOI A;  1MC0 A;  4MNR A;  3ZDJ A;  3FKV A;  5GHX A;  2MJ6 A;  3UDF A;  5JYO A;  1FOF A;  1XKZ A;  4HHD A;  2PHY A;  3ZG5 A;  3NOU C;  3EQU A;  3ZG0 A;  1OT9 A;  4S2O A;  3HVF A;  1ODV A;  5FAQ A;  4HP9 A;  4PMA A;  5FA7 A;  5TBM A;  3PR6 A;  1QME A;  1L3L A;  1N9L A;  4E6W A;  3MZF A;  4H6J A;  1K38 A;  3NIA A;  5HAR A;  3IX4 A;  5I94 A;  4LEN A;  4WZ5 C;  3VFF A;  2EWV A;  5E2E A;  2A3U A;  3E4O A;  1S6R A;  4EQI A;  1W63 M;  2O9A A;  5F83 A;  4FD8 A;  3ZFZ A;  2J3T C;  3V67 A;  2V1B A;  1KE4 A;  4DKI A;  3SH9 A;  3HLB A;  3OPL A;  4HJ3 A;  2PU2 A;  4QHC A;  5CTN A;  3ICY A;  4U0T A;  4E3N A;  2GX5 A;  5E2G A;  5F69 A;  1DP8 A;  5FQK A;  3VV4 A;  3RJU A;  2WKH A;  2EX6 A;  4F3L A;  3W4P A;  2HDU A;  1IYO A;  4DXB A;  3W4O A;  4KG2 A;  2VK3 A;  1MKM A;  4HH3 A;  1W63 Q;  5HWT A;  1J9M A;  2OV5 A;  2Y91 A;  1NY0 A;  3NOT C;  3FG8 A;  1GHM A;  3G31 A;  3NJA A;  3MR0 A;  4QD4 A;  1N9B A;  3UMD A;  4R3J A;  3LGO A;  1E3U A;  4GJ4 A;  3BRM A;  2O9C A;  4R0Q A;  2VV7 A;  4WEL A;  1MWS A;  1FIK A;  3ZNT A;  4KZ6 A;  2PD7 A;  4S2I A;  4U0X A;  3A3E A;  3Q7V B;  4N1H A;  2WZX A;  4Q0J A;  2Y2L A;  3SOI A;  3VOY A;  4BWI A;  2HJ9 C;  2NUT C;  3AGD A;  4GLQ A;  3ZG7 B;  4IBX A;  5TFQ A;  4HJ4 A;  2PT7 A;  4OQG A;  4MN6 A;  3DTK A;  2JKG A;  2VGL S;  4ARZ B;  3EEA A;  4KZB A;  2J7V A;  3NC8 A;  5EM0 A;  2Y55 A;  2W27 A;  3BY9 A;  4NK3 A;  3D72 A;  2XEP A;  3QP2 A;  4MBH A;  1BLH A;  5AQ9 A;  3MXQ A;  4RYE A;  1G28 A;  1KVL A;  2EXA A;  3T4Q A;  1E25 A;  1NZO A;  1OJG A;  2LB9 A;  1SDN A;  4BLM A;  2WGI A;  1DJA A;  1K4F A;  3LY4 A;  2H0Y A;  4NXG A;  1SDE A;  3DWZ A;  3UPN A;  1FQG A;  2Y2Q A;  3L9K A;  1GHP A;  3C5A A;  3V5M A;  1SCW A;  3UY6 A;  3E98 A;  2CC1 A;  1Q2Q A;  4PHT A;  3U2A A;  3VE3 A;  1ZHH B;  1HD8 A;  1LHY A;  2PAV P;  3BQA A;  5L2F A;  4S2J A;  1ERQ A;  2DCF A;  5DF8 A;  3IXG A;  1L2S A;  4HJ6 A;  3K2N A;  1ZC2 A;  3D3O A;  3BJN A;  1BUL A;  3MKE A;  1AXB A;  1M40 A;  1ZTU A;  2Y4A A;  4WBG A;  4LLO B;  5EOE A;  2IA2 A;  3IX3 A;  3ITA A;  3UPP A;  2A49 A;  4E3L A;  4KZ8 A;  4MDZ A;  4EEU A;  1NLZ A;  4AFI A;  4EWF A;  5EVE A;  3O86 A;  3QP8 A;  3LEZ A;  1DJC A;  2YKH A;  5HPI A;  1BLP A;  5GLB A;  1PW8 A;  2W0N A;  4LPZ A;  1YMX A;  5CHU A;  1LSV A;  4I3A A;  1DY6 A;  3ZYT A;  4GCZ A;  4WZ4 A;  3LIC A;  2E8I A;  1VQQ A;  4KG5 A;  4EU0 A;  2XDM A;  2EX2 A;  4JXS A;  4P6B A;  3QNC A;  1WA9 A;  2J8Y A;  1XA1 A;  3HLF A;  4R23 A;  1K56 D;  3NEC A;  1TS8 A;  4GN2 A;  4IBR A;  2Y2J A;  4ZTK A;  2XRN A;  3C8C A;  3IXB A;  1HZO A;  4ZAM A;  5DVA A;  3P01 A;  4G3W A;  1XFN A;  5U47 A;  4UEY A;  4GNU A;  1S4S A;  1ERM A;  3IS2 A;  3QP5 A;  2EX9 A;  5A93 A;  2PRF A;  3R7W A;  1SHV A;  5IU1 A;  5FI6 A;  3RXW A;  1F2K A;  4OQH A;  2ZM0 A;  3RTY A;  3DW0 A;  4Y0U A;  2WGV A;  3EGX C;  4Z9Q A;  5E43 A;  3G32 A;  4FH4 A;  5CHJ A;  5HL6 A;  4O7D A;  3SH7 A;  5FEG A;  1EI5 A;  4NEE D;  5K5B A;  5F1F A;  3RXX A;  2Y2I A;  2XLN A;  4IED A;  4X55 A;  2ZM2 A;  3UO9 A;  3MZE A;  3L7H A;  3UN7 A;  4DJ2 A;  3IXD A;  3DTM A;  1IKI A;  3GRJ A;  4PM8 A;  2HP9 A;  2JE5 A;  2DNS A;  3S22 A;  2JC7 A;  5DF7 A;  2E8J A;  3LY3 A;  2VX8 A;  1RCJ A;  4ZBE A;  2W1T B;  2WUQ A;  4B93 A;  3PAE A;  4HH2 A;  4ZRR A;  1KGG A;  5DJU A;  5EUA A;  1PWC A;  3IWI A;  4JGP A;  4DDS A;  1ES3 A;  4YNR A;  2OAQ 1;  4LGW A;  4LV1 A;  5AQA A;  4Q8I A;  3TG9 A;  3TE8 A;  5L09 A;  2J3T D;  3CHW P;  5MC7 A;  3DTE A;  4JKT A;  1K54 C;  2R78 A;  4E3I A;  1DP9 A;  1PW1 A;  2G2W A;  3GEC A;  1JTG A;  1O07 A;  3TSG A;  1K56 A;  5KMW A;  2WKE A;  4YFM A;  3T4L A;  1S67 L;  4BJP A;  4R4R A;  3PHY A;  1KGF A;  5HDD A;  4ZDX A;  1KOU A;  2WKP A;  5EVI B;  4CLC B;  5FQI A;  1H0M A;  1K57 A;  2PDR A;  2ACG A;  2XA7 M;  5FI7 A;  1FSW A;  2EX8 A;  3TW8 A;  4GKU A;  1GA0 A;  4JGO A;  1G6A A;  1T19 A;  5A8B A;  1XXM A;  1ES5 A;  5A91 A;  1MWT A;  4Z1W A;  2ZC5 B;  3G30 A;  4EBL A;  3FZC A;  4CJN A;  3SZT A;  2ZMV A;  3NCK A;  2A2L A;  1PZP A;  3M6H A;  4K91 A;  4MBK A;  1I2S A;  3O88 A;  2Y8H A;  3KO6 A;  3M6B A;  2HPB A;  1MXO A;  4R1G A;  3WS1 A;  1MBL A;  2OLU A;  3HLG A;  4LRY C;  5EOO A;  2GNX A;  4FUW A;  3OZH A;  2PYP A;  2XK1 A;  1BLS A;  4O01 A;  1IEM A;  1K55 A;  1FIL A;  2ZLY A;  3N8S A;  1OME A;  2QYB A;  3O87 A;  3ULF A;  4OLG A;  5GHY A;  3UB5 P;  1ZG6 A;  2D01 A;  3UB6 A; 
#chains in the Genus database with same CATH homology
 5M1A A;  3PTE A;  4QJG A;  3HLD A;  4P85 A;  5D3O A;  3SH9 A;  5CGX A;  1CI8 A;  1GA9 A;  3W8K A;  3ZNY A;  3HLB A;  3OPL A;  2C5W B;  2PU2 A;  4MEZ A;  1H8Z A;  4QHC A;  3Q82 A;  3HUM A;  1WYB A;  5CTN A;  4OPY A;  2Y2N A;  4U0T A;  1JWV A;  4JLF A;  4E3N A;  1C3B A;  3ZVW A;  5E2G A;  3B3X A;  4K0X A;  1LL9 A;  1EWZ A;  4NET A;  4UA7 A;  5FQK A;  5FQJ A;  3RJU A;  2WKH A;  4N9K A;  5G18 A;  4OP5 A;  1BSG A;  2EX6 A;  5CHM A;  1NYM A;  3W4P A;  4BEN A;  5CEC A;  1YQS A;  1JVJ A;  2EFX A;  2HDU A;  1IYO A;  4DXB A;  4KG6 A;  4N1X A;  1FR6 A;  4KG2 A;  1FCO A;  1E4D A;  3UDI A;  3W4O A;  2V20 A;  4E3M A;  1XGI A;  5A92 A;  4C6Y A;  1J9M A;  2OV5 A;  1K54 A;  2Y91 A;  4BL3 A;  2J9P A;  5KZH A;  1NY0 A;  3BFC A;  4FH2 A;  2Z2L B;  1GHM A;  3G31 A;  1GHI A;  2IWD A;  1BLC A;  4OVD A;  4QD4 A;  1N9B A;  1S0W A;  1U60 A;  2H10 A;  4R3J A;  1E3U A;  1CI9 A;  3PAG A;  1NZU A;  2WZZ A;  1NJ4 A;  3BRM A;  3N7W A;  4WEL A;  4R0Q A;  3A3J A;  1G68 A;  1MWS A;  4N92 A;  3FKW A;  4N9L A;  3Q1F A;  3ZNT A;  4B4Z A;  5IHV A;  4KZ6 A;  1XX2 A;  1YMS A;  4S2I A;  4X53 A;  3Q7V A;  4GDB A;  2Y2O A;  3OPR A;  4OQI A;  3A3E A;  4U0X A;  3V50 A;  3Q7V B;  4N1H A;  5EPH A;  2UWX A;  3N4I A;  2WZX A;  2Y2L A;  1L0E A;  3SOI A;  1KGE A;  4PM6 A;  3VOY A;  1RP5 A;  3C7V A;  3MBZ A;  2RL3 A;  1XGJ A;  1PZO A;  3TOI A;  3VP4 A;  3AGD A;  2OSU A;  4GOG A;  3ZG7 B;  4IBX A;  5TFQ A;  3Q7Z A;  4RX2 A;  4OQG A;  1ONG A;  4OLD A;  4JXV A;  5BOH A;  1NYY A;  5KSC A;  4KQO A;  2H0T A;  3HL9 A;  3OC2 A;  4X6T A;  2EXB A;  1ES4 A;  2PBY A;  4KZB A;  5CER A;  4GB7 A;  2J7V A;  3C4O A;  1CK3 A;  1H5X A;  2QMI A;  3NC8 A;  3HUN A;  3NY4 A;  5CGS A;  4JBF A;  4JXW A;  2Y55 A;  1PIO A;  4JF6 A;  3AGE A;  3G34 A;  4NK3 A;  2XEP A;  3A3I A;  2Q9M A;  4OPZ A;  2WAD A;  5GL9 A;  4OOM A;  5AQB A;  1FR1 A;  4ID4 A;  4UA9 A;  4XXR A;  2VGJ A;  2Y2K A;  3LO7 A;  4MBH A;  1BLH A;  3DWK A;  3ZG8 B;  5AQ9 A;  3HLE A;  4RYE A;  2XGN A;  5FAT A;  1KVL A;  2EXA A;  3UPO A;  1E25 A;  2GDN A;  1NZO A;  2WGW A;  1SDN A;  2FFY A;  4BLM A;  2WGI A;  5FAP A;  1DJA A;  1L0D A;  2WGW B;  1K4F A;  3LY4 A;  2H0Y A;  3OCN A;  4X69 A;  2ZMA A;  5EVL A;  1IYP A;  1SDE A;  3V39 A;  3DWZ A;  4WM9 A;  4XUZ A;  3BYD A;  4DRT A;  3UPN A;  1FQG A;  2Y2Q A;  1GHP A;  1TEM A;  1MWR A;  3C5A A;  3V5M A;  4OON A;  1SCW A;  4QU3 A;  3UY6 A;  2CC1 A;  2JCH A;  4PM9 A;  4WZ5 A;  1MWU A;  2HDS A;  3BFE A;  1Q2Q A;  3O3V A;  3ITB A;  4WMC D;  3UE1 A;  3FYZ A;  3GQZ A;  3GSG A;  4UA6 A;  3HLC A;  1HD8 A;  1W5D A;  2Y59 A;  1MPL A;  1LHY A;  4KZA A;  4WEJ A;  2ZC6 B;  4JPM A;  2H5S A;  3UE3 A;  5L2F A;  4S2J A;  1ERQ A;  2DCF A;  3SS5 A;  4KZ9 A;  4LV0 A;  2Y2M A;  3IF6 C;  3IXG A;  1L2S A;  4UHU A;  5DF8 A;  3W4Q A;  3BLM A;  1ZC2 A;  3ISG A;  5HAQ A;  4S2P A;  4QY6 A;  4A5R A;  1BUL A;  3VSL A;  3MKE A;  1ES2 A;  1AXB A;  1M40 A;  4PPR A;  1YLW A;  2Y4A A;  4ZJ3 A;  4WBG A;  4KEN B;  4CPK A;  4DF6 A;  1IYQ A;  2ZC7 A;  3A3F A;  4RA7 A;  5FQM A;  4H8R A;  4P0M A;  5EE8 A;  5A90 A;  3PBR A;  1LI0 A;  1MY8 A;  4LV3 A;  5EOE A;  3VFH A;  1FSY A;  3ITA A;  3UPP A;  2A49 A;  4E3L A;  1BUE A;  2P9V A;  2QPN A;  4R3B A;  4KZ8 A;  4OP8 A;  3BM6 A;  2P9V B;  2IWC A;  3QHY A;  3P98 A;  4X68 A;  3ZCZ A;  3G35 A;  1PYY A;  3QNB A;  3ZVT A;  3VP2 A;  4D2O A;  4EWF A;  2Y2G A;  3O86 A;  1I2W A;  2X01 A;  3LEZ A;  1DJC A;  4LCL A;  3ZHH A;  2Z2M B;  4S2N C;  4LV2 A;  2Y2P A;  1CEF A;  1BLP A;  1PI5 A;  3BEB A;  3GR2 A;  4MBF A;  2WAF A;  5GLB A;  1PW8 A;  2ZD8 A;  3BFG A;  1PWD A;  3P09 A;  1ALQ A;  3PBQ A;  3NBL A;  1IEL A;  1YMX A;  5CHU A;  3D4F A;  1PWG A;  1DY6 A;  2ZQD A;  3PBS A;  3IHB A;  4WZ4 A;  3UE0 A;  2ZQA A;  5DTT A;  2E8I A;  1KE3 A;  4ZJ1 A;  1XPB A;  2PU4 A;  1VQQ A;  5EVI C;  3CZD A;  4RVA A;  4S2M A;  1JTD A;  3GVB A;  4L0L A;  4KG5 A;  2XDM A;  4EBN A;  2EX2 A;  4JXS A;  4Y0T A;  3M2K A;  4DE0 A;  2ZQ9 A;  3MZD A;  4P6B A;  4S2K A;  3VP1 A;  4HBT A;  3QNC A;  5HL1 A;  4GD6 A;  1SKF A;  2J8Y A;  1XA1 A;  5F1G A;  4GZB A;  1HTZ A;  1K57 C;  3HLF A;  4KZ4 A;  4R23 A;  1K56 D;  1ESI A;  4JF5 A;  4B4X A;  3IT9 A;  4IBR A;  4GN2 A;  2EFU A;  1E3U D;  2Y2J A;  4ZTK A;  3IXB A;  5JYP A;  5HAP A;  1HZO A;  1KE0 A;  4ZAM A;  4HES A;  3OPP A;  4F94 A;  5FQQ A;  3VSK A;  2Y2H A;  5DVA A;  1HVB A;  2ZQC A;  5EVI D;  1FCN A;  5CGW A;  3C4P A;  5DTS A;  1K25 A;  5U47 A;  3WS2 A;  3GV9 A;  2BLS A;  3LCE A;  4DE2 A;  4GNU A;  1YLT A;  3I7J A;  1WYC A;  1ERM A;  4UAA A;  2EX9 A;  5A93 A;  4OKP A;  1SHV A;  1YLP A;  5FI6 A;  3RXW A;  4OQH A;  2ZM0 A;  5CED A;  5HX9 A;  1KDW A;  2HDR A;  1QMF A;  5FSR A;  3V3S A;  3DW0 A;  4E6X A;  5GLD A;  4OOY A;  1ESU A;  3CG5 A;  1ONH A;  3MKF A;  4BD0 A;  4Y0U A;  1FCM A;  3CMZ A;  1NRF A;  4HEF A;  4R4S A;  1IYS A;  3S1Y A;  1YLZ A;  1PI4 A;  2B5R A;  4C75 A;  4Y7P A;  2WGV A;  5AQ7 A;  3ZGA B;  4Z9Q A;  5E43 A;  3G32 A;  1M6K A;  3IH9 A;  1W8Q A;  4FH4 A;  2OLV A;  3Q07 A;  5CHJ A;  3MXS A;  2V2F F;  3VP3 A;  1LI9 A;  1Z6F A;  2G2U A;  3PBT A;  4O7D A;  3SH7 A;  1KDS A;  2XR0 A;  4K0W A;  1EI5 A;  1L0G A;  2WKI A;  3HLW A;  5F1F A;  1K55 C;  1N4O A;  3RXX A;  1IKG A;  2Y2I A;  2XLN A;  4IED A;  2P74 A;  1YLJ A;  4X55 A;  3UDX A;  3PBO A;  4BL2 A;  2XF3 A;  4BD1 A;  3VOZ A;  2ZM2 A;  2BG1 A;  4Y0O A;  1W79 A;  3E2L A;  1MKI A;  4X56 A;  3UO9 A;  3N6I A;  1YLY A;  4EV4 A;  3MZE A;  3UN7 A;  3BLS A;  3NI9 A;  1YM1 A;  4JF4 A;  3IXD A;  3IF5 A;  4PM5 A;  1LL5 A;  3DTM A;  5HAI A;  1IKI A;  3GRJ A;  4PM8 A;  3SS4 A;  2HP9 A;  1TDL A;  1BZA A;  3BFD A;  5FQ9 A;  2JE5 A;  2DNS A;  3NDE A;  5TR7 A;  3S22 A;  2C6W B;  2JC7 A;  3BFF A;  3OPH A;  5DF7 A;  5GHZ A;  4E3O A;  2X02 A;  3LY3 A;  2RCX A;  5HFO A;  1RCJ A;  4ZBE A;  2WUQ A;  3N8R A;  3HRE A;  1CEG A;  3PAE A;  3FV7 A;  5TGF A;  3E2K A;  5CXW A;  1TDG A;  2I72 A;  4IVK A;  4DE1 A;  2XH9 A;  1KVM A;  1KGG A;  3IF6 A;  4HBU A;  3WS5 A;  5CTM A;  1Q2P A;  3IF6 B;  5EUA A;  2HP6 A;  1PWC A;  3AGF A;  4JXG A;  5KSH A;  1JWP A;  1K6R A;  5FI2 A;  3WS0 A;  1YT4 A;  3IWI A;  4DDS A;  5FAS A;  4OH0 A;  2QZ6 A;  1ES3 A;  4QB8 A;  2X71 A;  4LV1 A;  5AQA A;  4Q8I A;  3TG9 A;  2ZC3 B;  2ZM8 A;  3C7U A;  4M3K A;  1NXY A;  1O7E A;  4QY5 A;  4B88 A;  5CEB A;  2FFF B;  2VGK A;  2DRW A;  5CRF A;  5GLC A;  3VMA A;  4FCF A;  4JKT A;  1K54 C;  4KQR A;  1BT5 A;  4KZ7 A;  4E3I A;  1PW1 A;  1W8Y A;  3SS3 A;  1JWZ A;  1XA7 A;  4KQQ A;  5F82 A;  5DF9 A;  4WEK A;  4EBP A;  4XUX A;  5DTK A;  2G2W A;  3S4X A;  3V3R A;  5J8X A;  2HP5 A;  2HDQ A;  4GD8 A;  4P87 A;  2WYX A;  2Q9N A;  4IVI A;  1JTG A;  1O07 A;  3TSG A;  4S2N A;  3IH8 A;  4OPQ A;  1L0F A;  2WAE A;  2XFT A;  3GMW A;  1K56 A;  5KMW A;  1ZKJ A;  4KZ5 A;  2WKE A;  4YFM A;  4OOL A;  4YIN A;  1LLB A;  4BJP A;  1DJB A;  3IHA A;  4R4R A;  2R9W A;  4C3Q A;  2ZJ9 A;  3VP0 A;  1GCE A;  1KGF A;  4RX3 A;  1K4E A;  2XD1 A;  2ZQ8 A;  3PBN A;  2XQZ A;  3G2Y A;  3IWO A;  5EVI A;  4ZDX A;  5E2H A;  4FSF A;  3WWX A;  4DXC A;  3M2J A;  1WE4 A;  1K6S A;  5EVI B;  4KZ3 A;  3WRT A;  2WK0 A;  2J9O A;  3IXH A;  5FQI A;  3HBR A;  3ZG9 B;  1TVF A;  1K57 A;  4BQM A;  3GTC A;  5FI7 A;  4EUZ A;  1W7F A;  4WYY A;  2ZC4 B;  1FSW A;  2EX8 A;  4MNR A;  4OQ0 A;  3ZDJ A;  4DE3 A;  3FKV A;  4GKU A;  5M19 A;  1GA0 A;  1RGY A;  5GHX A;  3UDF A;  5JYO A;  1FOF A;  1RGZ A;  1G6A A;  5FDH A;  1XKZ A;  4DDY A;  5FAO A;  3ZG5 A;  3EQU A;  3ZG0 A;  1XXM A;  1ES5 A;  4ZJ2 A;  3FWL A;  3N8L A;  4S2O A;  5A91 A;  1MWT A;  3HVF A;  3MXR A;  3G4P A;  5FAQ A;  2ZC5 B;  4WMC A;  3G30 A;  4EBL A;  3FZC A;  4PMA A;  5FA7 A;  4CJN A;  3BEC A;  3NCK A;  4PM7 A;  3WS4 A;  4E3K A;  3EQV A;  1PZP A;  3M6H A;  4K91 A;  4MBK A;  1QME A;  1Y54 A;  3HUO A;  1I2S A;  3MFD A;  3O88 A;  1VM1 A;  4MLL A;  1I5Q A;  3M6B A;  3NDG A;  3IQA A;  1ERO A;  2JBF A;  4E6W A;  3MZF A;  1K38 A;  2HPB A;  1ZG4 A;  2ZQ7 A;  3NIA A;  1MXO A;  3G2Z A;  5M18 A;  5HAR A;  4R1G A;  5I94 A;  4LEN A;  4WZ5 C;  3WS1 A;  1XP4 A;  4S2L A;  3VFF A;  5EEC A;  3CJM A;  1MBL A;  2OLU A;  3UNW A;  3HLG A;  5HW3 A;  5E2E A;  5EOO A;  2A3U A;  3A3D A;  3OCL A;  1S6R A;  2IWB A;  5GLA A;  4EQI A;  4LCM A;  2R9X A;  3OZH A;  5E2F A;  2XK1 A;  1BLS A;  1BTL A;  1IEM A;  1K55 A;  2XFS A;  1H8Y A;  5F83 A;  4E3J A;  3IWQ A;  4FD8 A;  3ZFZ A;  3WRZ A;  2ZLY A;  3SH8 A;  3N8S A;  1OME A;  4U3T A;  4GDN A;  4OPR A;  3O87 A;  1KE4 A;  2V1Z A;  4OLG A;  5GHY A;  1ZG6 A;  2XD5 A;  3JYI A;  4DKI A;  3Q81 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...