3WS0A

N288q-n321q mutant beta-lactamase derived from chromohalobacter sp.560 (condition-1a)
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
357
structure length
357
Chain Sequence
QTREVLDPIVASLMEAQQIPGMAIALVRPEGTTISHYGAADRETGTPVDDDTLFEIGSLSKTLTATLASLAEVEGKLDFDAPVSRYLPELEGSAFDDISGLNLGTHTGGGLPLFVPDEVTDRASLMAWYREWQPTEPIGESRTYSNLGIGLLGLETAASLDGEFVPTMRAKVLAPLGMQDTWYDVPEARMADYAMGEDKDGQPTRVSPGVLDDEAYGIKTTAADLAKLVRANLHLADVDAELQQAIDATRQGHYRVGDMTQALIWEQYSLPVAPETLRAGQGYDMILEPNAAEALEPPQSPRDDVWVNKTGSTQGFGGYIVMLPGKHTGLVMLANKNYPNDARVEAAYRILSGLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a highly acidic beta-lactamase from the moderate halophile Chromohalobacter sp. 560 and the discovery of a Cs(+)-selective binding site
pubmed doi rcsb
source organism Chromohalobacter sp. 560
molecule tags Hydrolase
molecule keywords Beta-lactamase
total genus 120
structure length 357
sequence length 357
chains with identical sequence B, C
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2014-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3ws0A00
1ESIA 1NXYA 2XEPA 1FSWA 3O87A 1N9BA 5E43A 3S1YA 2QZ6A 5GL9A 5I94A 1XGIA 4KQQA 2WKEA 2Y2QA 3EQVA 3VP2A 2HP9A 2EFUA 1S0WA 2A3UA 3O86A 5DF8A 3V3SA 4JF6A 3WRZA 4Y0OA 4RX3A 1ZKJA 1SCWA 4K91A 5FQIA 4UA6A 5HFOA 2G2UA 3IQAA 4S2LA 2OSUA 1PWDA 1MPLA 3BRMA 1YLTA 3PBTA 5E2GA 2ZM8A 4OONA 3ITBA 3LY4A 1IYOA 5DTTA 4UHUA 5HW3A 3E2LA 2Y2OA 4KZAA 1YLJA 3DTMA 3HLWA 1MWRA 3G4PA 4PM7A 1FCNA 3MBZA 3UNWA 1YLPA 3VOZA 2HDRA 1MWSA 3LY3A 1Z6FA 2Y59A 4U0XA 5FI7A 3GVBA 2ZQ9A 3ZNYA 4S2NA 5CHUA 3UPOA 1BLSA 4E3OA 2XR0A 1G6AA 3NI9A 4EQIA 4JBFA 3VP0A 3MZFA 5HAIA 1HD8A 1MKIA 1FOFA 4DE2A 4KZ8A 5A93A 3GRJA 3G32A 1HVBA 1KE3A 4KZBA 5HAPA 3VSKA 2J9PA 2J8YA 5CTNA 5CERA 2EX2A 2G2WA 1PW1A 4CPKA 2Y2MA 3HUMA 4Y7PA 5EUAA 3SOIA 3WS5A 3UE1A 2WADA 3W4OA 1MY8A 3NY4A 5AQ7A 4ZJ1A 4Y0TA 3AGDA 1W5DA 2XGNA 3RXWA 2DRWA 1GHMA 3BEBA 5F1GA 3NDGA 2I72A 3DWZA 5M1AA 5E2FA 5AQBA 3UPPA 5GLAA 3BFFA 3SS3A 1K6RA 3G31A 3WS2A 4JXVA 3HUOA 3M6HA 2WKHA 4B4XA 4GD6A 3GV9A 5EE8A 4EBPA 1N4OA 1XPBA 4ZJ3A 2OLUA 1TVFA 1ES5A 2Q9MA 5AQAA 3WS4A 3G30A 3ISGA 2JBFA 1ONGA 5FDHA 4FD8A 5F83A 1JWZA 4GDNA 2Y55A 3GQZA 1RCJA 4OPQA 4OPRA 2PU2A 4OOLA 3UO9A 2R9WA 1H8YA 3UN7A 1WE4A 4E3KA 3PBRA 2VGKA 1BLHA 1NJ4A 1PZPA 3Q81A 4DE0A 2HDUA 1I2WA 1WYCA 3WWXA 1E3UA 3BYDA 3AGEA 4PPRA 2QMIA 3FKWA 1ES3A 1PIOA 3SH8A 3FZCA 2BG1A 4OKPA 3NC8A 1BZAA 2DCFA 3LCEA 1GCEA 4E6XA 4EWFA 5FAOA 2H0YA 2P74A 2Y2GA 1ZG4A 3OPHA 3WS0A 3MZEA 3TSGA 5FASA 1L0EA 3D4FA 2WKIA 1NYYA 3G34A 5FQQA 5A92A 4QB8A 4OPZA 3PAEA 4N92A 3IF6B 2ZQDA 1YMXA 1NZOA 5CGWA 2PU4A 4WMCA 1JTDA 2WGWA 2RCXA 3IT9A 4IEDA 3V50A 1SDNA 2HPBA 4WEKA 3N8LA 4JXSA 5FQMA 1E4DA 4R4RA 1KGEA 4QD4A 3LEZA 4GDBA 4WYYA 5A90A 5KZHA 3C7VA 2EFXA 3UPNA 1BSGA 2ZQAA 4IVIA 2WZZA 5FA7A 1K6SA 1CK3A 3NIAA 3OPLA 4JF4A 1ONHA 2JE5A 2WGWB 4E3MA 4OQIA 4UA9A 2ZQ7A 2XDMA 4C6YA 2WUQA 3HLBA 2WGVA 3MKFA 1Y54A 4YFMA 4MBHA 4BL2A 3RXXA 4WELA 4S2KA 4X56A 5E2HA 1XA7A 3V5MA 3TG9A 4DRTA 4IBXA 1PZOA 4KQRA 3P09A 1IYQA 4WZ5C 3VMAA 4EBLA 4ZJ2A 2JC7A 1DJCA 3OC2A 3OPPA 5HAQA 1YLZA 5CHJA 4XUXA 4OOMA 4PM8A 4ZBEA 1FCOA 5EOEA 1MWUA 2ZC5B 1SHVA 3Q7VB 3VP4A 4X53A 3ZG7B 2XH9A 1XX2A 3MXSA 2Y2IA 4P85A 1K55A 1OMEA 1W79A 2Y2NA 3IF6C 3CMZA 2Y4AA 1IEMA 3Q82A 4MBFA 2Y2LA 1FQGA 2XFTA 4E6WA 3QNCA 4ZTKA 3W8KA 4L0LA 4N1HA 5M19A 1ES2A 2ZC7A 3IHAA 1LHYA 3HLGA 2UWXA 2FFYA 1ALQA 3IH9A 4LCMA 3PBSA 5IHVA 1FR6A 4MBKA 3IH8A 4LCLA 1ES4A 1BTLA 3PBNA 3IHBA 5FI2A 2XK1A 4MNRA 1XP4A 3VP3A 3ZFZA 1MBLA 1PI4A 1AXBA 4KG2A 4WM9A 1JVJA 1KDSA 4IBRA 5JYOA 1CI9A 2C5WB 3ZG9B 5M18A 2IWBA 4GN2A 1CEFA 4RVAA 2OLVA 5CTMA 4GKUA 1DY6A 4K0WA 1YM1A 2H0TA 2Q9NA 2X02A 5TFQA 1ERQA 1TEMA 1TDGA 2Y91A 2HDQA 4DE3A 3C5AA 3VP1A 3PAGA 3HBRA 1GA9A 4Z9QA 5FI6A 3TOIA 2XQZA 1C3BA 4EBNA 1GA0A 1W7FA 4MLLA 5J8XA 2X71A 4OP5A 1PW8A 3SS5A 4WEJA 4KG5A 4LENA 1XKZA 1PI5A 4OLGA 3VFFA 4PM5A 1MXOA 1QMFA 4X55A 1K57C 2ZQ8A 3GMWA 5GHXA 3ZCZA 5F82A 5FQ9A 1LI0A 4N1XA 1IKGA 3UE0A 2H5SA 5GHYA 2V2FF 3N6IA 5KSCA 3E2KA 5CEDA 1G68A 2RL3A 4BD1A 1NZUA 3A3FA 4HBTA 1NY0A 3A3EA 5DVAA 2XF3A 4MEZA 4C3QA 3SH7A 2Y2HA 3M2KA 1SDEA 4ID4A 4KENB 1K56A 1K4EA 2V20A 5DF7A 1JTGA 3G2YA 4QHCA 2CC1A 2J7VA 3RJUA 2HDSA 2IWDA 3HLCA 3ZG0A 4CJNA 1XXMA 4DDYA 5JYPA 4S2OA 3ZGAB 1JWVA 2JCHA 4GD8A 5U47A 1L0DA 1H8ZA 3FYZA 1EWZA 4OH0A 3AGFA 4OPYA 1BUEA 5DTKA 3ZVWA 4RX2A 4QU3A 3BM6A 3BFCA 1NYMA 3NCKA 4RA7A 5EVIB 1M6KA 4GB7A 3S22A 1WYBA 4PM9A 4U3TA 1XA1A 1NRFA 3A3IA 3M6BA 2ZMAA 1RGZA 4R3BA 4YINA 3N8RA 4U0TA 5EVLA 3IWIA 3Q7VA 5KSHA 2WK0A 2H10A 2R9XA 2ZC6B 5A91A 4D2OA 3PBQA 3GSGA 3NDEA 4UAAA 5AQ9A 3MFDA 2Y2KA 1K57A 5EECA 3MXRA 3N4IA 5CXWA 1HZOA 4DXCA 3WS1A 4Q8IA 4P6BA 2XD5A 1SKFA 1CEGA 4K0XA 5CGSA 4A5RA 3A3JA 1FCMA 2QPNA 4JPMA 2J9OA 1LLBA 5CHMA 4E3NA 4R0QA 2ZQCA 1LL5A 1PWGA 3CJMA 4KZ6A 4OLDA 1GHPA 3G35A 4N9KA 4QY5A 3WRTA 2VGJA 2HP6A 4KQOA 1I5QA 5TR7A 3VSLA 3IWQA 3HVFA 4BLMA 2BLSA 1KE4A 3QNBA 4NK3A 3CZDA 5F1FA 3ZHHA 5BOHA 3IXGA 4DDSA 3BFEA 1CI8A 2E8IA 2ZM2A 3OPRA 3O3VA 4GNUA 4JKTA 1S6RA 4FSFA 1EROA 2ZLYA 4X6TA 5D3OA 1ZC2A 5KMWA 4DE1A 4XXRA 1Q2QA 1O7EA 1K56D 2Z2MB 4PMAA 4E3IA 3OZHA 3A3DA 4S2PA 2Z2LB 4FH2A 1U60A 3HL9A 5HL1A 3UY6A 1DJAA 1PWCA 1RP5A 3DWKA 4ZDXA 2A49A 1K55C 3GTCA 3IF6A 5GLDA 4B88A 2XFSA 5CGXA 4KG6A 1FSYA 1L0FA 1BT5A 3IWOA 1MWTA 1XGJA 4IVKA 4NETA 5CRFA 5DF9A 4WMCD 2EXAA 4OQ0A 2IWCA 4GOGA 3Q7ZA 2Y2JA 4JXGA 3HREA 1QMEA 2ZC4B 3N8SA 4BJPA 4E3LA 1IKIA 4M3KA 4F94A 2GDNA 5L2FA 4XUZA 3HUNA 1K38A 3UDXA 2X01A 1KVLA 3IXBA 4KZ5A 3ZG5A 1LI9A 2ZD8A 3G2ZA 4OQGA 2WGIA 1J9MA 3ZVTA 1KGFA 3PBOA 4KZ3A 4P87A 1L2SA 4LV2A 5DTSA 5FQJA 1BLCA 1E3UD 1K54A 1KDWA 3ZDJA 4C75A 1M40A 4LV1A 5E2EA 1GHIA 1JWPA 4ZAMA 1E25A 1K4FA 4RYEA 5GLCA 3HLDA 4EUZA 4LV0A 3PTEA 4OOYA 1ERMA 2EXBA 1I2SA 3I7JA 4Y0UA 3OCLA 5FATA 3UDFA 4LV3A 4EV4A 5HARA 1TDLA 2ZC3B 1KE0A 1KGGA 1VQQA 4KZ7A 5EVIC 5CEBA 1W8YA 3C4OA 1K54C 1KVMA 3BLSA 2B5RA 1HTZA 4R3JA 3Q1FA 4R1GA 4R4SA 3SH9A 1VM1A 4B4ZA 2EX8A 5FAQA 2C6WB 4P0MA 2V1ZA 1PYYA 1YLYA 3IF5A 4DKIA 1W8QA 1L0GA 4WZ4A 2Y2PA 1K25A 3IXDA 2EX9A 4WBGA 4X69A 1IYPA 3EQUA 2WAFA 5FAPA 3FWLA 3GR2A 5TGFA 4H8RA 4PM6A 4QJGA 1LL9A 3V39A 1FR1A 4HBUA 5HX9A 5EVID 2DNSA 3MZDA 4JF5A 5GLBA 2FFFB 4S2JA 5G18A 4BL3A 3NBLA 1H5XA 1ZG6A 2HP5A 3S4XA 3ITAA 4OQHA 3W4QA 3V3RA 3M2JA 2OV5A 3ZG8B 2WZXA 4OVDA 3ZNTA 2P9VB 4HEFA 4FH4A 2XLNA 1O07A 3DW0A 4QY6A 4S2IA 4BENA 4GZBA 4DF6A 3VFHA 3W4PA 4OP8A 4KZ9A 2WAEA 4DXBA 3OCNA 3IXHA 4R23A 2P9VA 3UDIA 1Q2PA 1DJBA 3FV7A 3MKEA 3QHYA 4JLFA 2EX6A 3N7WA 4FCFA 4UA7A 4WZ5A 2PBYA 3VOYA 4BQMA 5CECA 3P98A 1RGYA 1YQSA 3UE3A 2ZJ9A 3C4PA 4JXWA 3B3XA 5FSRA 4BD0A 4X68A 1BLPA 4KZ4A 1YMSA 1YT4A 5GHZA 1EI5A 5EVIA 3BFGA 5FQKA 3LO7A 4N9LA 2ZM0A 3BLMA 1IELA 1BULA 1IYSA 3SS4A 1YLWA 3BFDA 4HESA 3CG5A 3FKVA 1ESUA 3Q07A 2XD1A 5EPHA 4S2NC 2WYXA 3HLEA 3HLFA 3BECA 3O88A 5EOOA 4O7DA 3JYIA 4S2MA 3C7UA 4E3JA
chains in the Genus database with same CATH superfamily
1NXYA 5E43A 3E0YA 3O87A 3HCYA 3MXQA 3LR3A 5GL9A 3ZYTA 4PKYA 5FEFA 3EQVA 3VP2A 3O86A 5DF8A 3WRZA 4RX3A 1SCWA 3HJKA 4UA6A 2K31A 4S2LA 1MPLA 3PBTA 4OONA 3P01A 5DTTA 3E2LA 3LEQA 2Y2OA 2YKFA 3EEHA 3HLWA 5DFXA 1MWRA 4JGPA 3VOZA 1Z6FA 5FI7A 2XR0A 3NI9A 4FUWA 4JBFA 5HAIA 3IX8A 1GSVA 5G4ZA 4DE2A 3MSHA 2W27A 3GRJA 4YNRA 2J9PA 5CERA 4CPKA 3HUMA 2WADA 1MY8A 1W5DA 3JVUA 4I39A 1GHMA 3CI6A 1K6RA 3WS2A 4WF0A 5EE8A 2EWWA 3CUEC 4JGOA 3G30A 4EXOA 4FD8A 5F83A 4JGQA 1GSWA 4OPRA 4OOLA 1H8YA 3UN7A 3PBRA 4DE0A 1WYCA 4PPRA 3IBJA 1ES3A 1PIOA 3ICYA 5G4YA 3UB9A 3FZCA 3NC8A 1BZAA 4EWFA 4LLOB 2H0YA 2P74A 3KSGA 3KYZA 3OPHA 2M7VA 3MZEA 2B18A 3QP1A 5FASA 3D4FA 1NYYA 2OWJA 1JTDA 2WGWA 3OLOA 3U2AA 2HPBA 3N8LA 1XJ4A 4R4RA 3CPTA 4QD4A 4GDBA 4WYYA 5A90A 1MZUA 1BSGA 2ZQAA 4IVIA 3QP6A 5FA7A 4LRYC 1ONHA 2LB5A 4E3MA 2VGLS 4OQIA 4UA9A 5HWWA 3HLBA 2YKHA 5L07A 4X56A 4S2KA 3V5MA 4EBLA 4QWOA 4ZJ2A 2JC7A 4H6JA 3CITA 4XUXA 2FZ0A 4PHTA 3H9WA 4P85A 1W79A 2VV7A 1IOUA 2Y4AA 3BY9A 3Q82A 2Y2LA 4Y17A 4WN5A 2V8CA 2PHYA 4ZTKA 3W8KA 2UWXA 3PBSA 4MBKA 5FI2A 2QJ7A 1ES4A 1BTLA 3PBNA 3LYXA 3OBFA 1PI4A 4WM9A 3SZTA 1JVJA 5M18A 4MN6A 1CEFA 5HDCA 1DY6A 4K0WA 2QHKA 4HHDA 1ERQA 2HDQA 3PAGA 3TOIA 5FI6A 1W7FA 5J8XA 4IUHA 2EWVA 1PI5A 2PAVP 1QMFA 4X1LA 4X55A 2V0WA 2QJ5A 4NXEA 2E8JA 1LI0A 4UQIM 1T1CA 5TBMA 3N6IA 5KSCA 2A2LA 2EA9A 5CEDA 1NY0A 4EQ1A 5DVAA 1K4EA 2V20A 5DF7A 4QHCA 2J7VA 3ZG0A 1S1ZA 2HDSA 3HLCA 1P97A 4S2OA 1L0DA 3NULA 4OH0A 3AGFA 5HWTA 2W1TB 3CAXA 3BFCA 5AVEA 3S22A 1XA1A 3T50A 3M6BA 1RGZA 4R3BA 5FL3A 4U0TA 5EVLA 5A91A 3CWFA 4D2OA 3MFDA 5DKKA 3KSFA 4DXCA 1SKFA 1JNUA 4ME4A 2OOLA 4NXFA 5CHMA 1X0OA 1LL5A 1PWGA 3CJMA 4OLDA 1GHPA 2VGJA 2Y8HA 1I5QA 4KUKA 3EGXC 3CZDA 3H7WB 5BOHA 3RH8B 1CI8A 2K7SA 2ZM2A 4GNUA 4BMWA 1EROA 3MS6A 4R6LA 5EM1A 3H7WA 3MMHA 4FH2A 3IF6A 4MN7A 4GJ4A 2XFSA 5CGXA 5E2HA 1PRQA 1VETA 2A24A 4WMCD 3A0RA 3N8SA 4BJPA 4XUZA 3HUNA 1K38A 3IXBA 3ZG5A 1LI9A 4DN0A 1J9MA 4P87A 1L2SA 5DTSA 2XRNA 1KDWA 1JWPA 4LV0A 2Z6CA 4FTXA 4OOYA 1YAXA 4Y15A 5FATA 4EV4A 5HARA 2L1MA 5EVIC 5CEBA 1W8YA 5DJUA 1K54C 1KVMA 3BJNA 1VM1A 2C6WB 1PYYA 1YLYA 3IF5A 5HPFA 4DKIA 1F9IA 3IXDA 4X69A 4WBGA 5FAPA 2PD8A 2AVXA 5TGFA 2MJ6A 1LL9A 4HBUA 4JF5A 5GLBA 3NBLA 2HP5A 2ZL1B 4NXBA 3V3RA 3M2JA 2OV5A 2IA2A 2ZBBA 2VJWA 4Z1WA 3DW0A 4BENA 4CQHA 3IXHA 3MKEA 3LIAA 2VEAA 3QHYA 4UEYA 3W2ZA 2ZJ9A 5EVEA 3B3XA 5FSRA 1BLPA 5GHZA 5EVIA 3BFGA 5FQKA 2ZM0A 4R70A 1IYSA 4AFIA 4HESA 4X25A 2WYXA 3HLEA 3S7QA 1DP9A 3DTIA 3C7UA 4E3JA 3HJIA 1ESIA 1OJGA 1FSWA 2QZ6A 2G7UA 5I94A 5L8MA 2EFUA 3K3CA 3T1XA 1ODVA 4X1MA 5FQIA 4GHIA 1D1JA 2G2UA 5F6AA 5E2GA 1D06A 4KZAA 3G4PA 4PM7A 4RQ9A 2KLIA 3UNWA 5KIZA 1YLPA 1MWSA 2VGLM 1LSVA 1G6AA 3IS2B 4EQIA 2XROA 4KZ8A 3G32A 1HVBA 1KE3A 4KZBA 4BWIA 3VSKA 2J8YA 1AWIA 3C38A 5CTNA 4NEED 2G2WA 3IS2A 3SOIA 3W4OA 4Y0TA 5AQ7A 3JPUA 3RXWA 1DP8A 5M1AA 3NDGA 2I72A 5E2FA 4HH2A 5AQBA 3SS3A 3NOTC 3UB7A 2JKFA 3G31A 2JKRM 4JXVA 3M6HA 4ZJ3A 3UB6A 2Q9MA 3LIFA 3WS4A 3PXPA 3H82A 1ONGA 1ZTUA 1P0ZA 3GQZA 4OPQA 2PU2A 5CX7A 1LSXA 3KYEA 1PZPA 3UMEA 2HDUA 1E3UA 3BYDA 3NHQA 3AGEA 3FKWA 3E4PA 2BG1A 3K3DA 3LCEA 1GCEA 4WL9A 2Y2GA 5IS1A 3WS0A 4L9GA 3TSGA 1L0EA 5A92A 4OPZA 1STZA 3PAEA 2PU4A 4K08A 4WMCA 3IT9A 3V50A 3T4SA 2FH5A 4WEKA 5K5BA 1E4DA 3C7VA 2EFXA 2P08A 2OAQ1 2WZZA 1K6SA 1CK3A 3NIAA 3OPLA 4DJ3A 2JE5A 2WGWB 2OAP1 4M4XA 4C6YA 2QYBA 2WGVA 4EW7A 4YFMA 2VK3A 3RXXA 4IBXA 3BY8A 1PZOA 1LL8A 3P09A 1IYQA 3VMAA 3EGDC 3OC2A 5CHJA 4PM8A 2J3WA 5EOEA 3B33A 3NJAA 1SHVA 4HP4A 3JVVA 3ZG7B 3MXSA 2W1RA 2DMWA 3IF6C 1IEMA 1FQGA 2VV6A 1K0KA 3G6OA 3IHAA 3HLGA 2FFYA 4NXGA 4LCMA 4NKPA 2XK1A 4MNRA 4KG2A 1KDSA 4IBRA 4GN2A 2Y91A 4HJ3A 4Z9QA 1GA9A 3S7NA 2XQZA 5J3WA 3OOVA 4OP5A 1PW8A 3SS5A 4WEJA 1S4SA 1YKDA 1XKZA 3VFFA 3S7PA 1K57C 3ZCZA 5FQ9A 1VETB 1IKGA 2H5SA 5GHYA 2V2FF 1TF1A 4BD1A 3A3FA 3UB8A 3T1RA 2XF3A 3MF0A 4MEZA 4C3QA 4LFUA 5J7EA 2IWDA 5JYPA 4MCWA 5DTKA 4RX2A 3BM6A 1NYMA 2O9BA 3NCKA 4GB7A 5AVFA 2HGVA 3A3IA 4YINA 4GW9A 2WK0A 2V1AA 3PBQA 5EECA 3WS1A 2XD5A 5C5KA 4E3NA 1BYWA 2ZQCA 3PYPA 4ETXA 3E4QA 3MJQA 4KQOA 3FG8A 2P04A 2BLSA 2V9AA 3ZHHA 1Y4OA 4MMNA 3IX4A 4DDSA 2E8IA 1LT0A 4JKTA 2ZOIA 2PD7A 4X6TA 2ZLYA 1OTEA 1Q2QA 1K56D 2Z2MB 5TBMB 4S2PA 1U60A 2BASA 3SW1A 3D9YA 3DWKA 1RP5A 3FPWA 4B88A 1K55C 3KSHA 1FSYA 1L0FA 1SKOA 3IWOA 1MWTA 4NETA 5J4EA 5DF9A 1CJFA 2VZWA 5DJTA 2EXAA 4OQ0A 2IWCA 4GOGA 2ACGA 4JXGA 4E3LA 3B47A 2ZC4B 4WLAA 1IKIA 2Y79A 4BBVA 3UDXA 2O0YA 1KVLA 4KZ5A 4OQGA 2WGIA 4LV2A 1T1BA 3ZDJA 1E3UD 1M40A 4LV1A 5E2EA 4ZAMA 3MR0A 1E25A 4RYEA 4L9EA 4E04A 2V1BA 5GLCA 3T4JA 1Z09A 3C30A 1UWNX 1EW0A 3T12B 1OT6A 5HDSA 3UDFA 4BBTA 4I3IA 3BLSA 1T18A 4R3JA 4R1GA 5EV0A 4B4ZA 2EX8A 2PR6A 4WZ4A 2EX9A 3EQUA 1NLZA 2J3TC 3BQAA 4H8RA 5HX9A 4L9FA 2FFFB 4S2JA 4BL3A 1H5XA 5FDSA 3W4QA 1FIKA 3ZG8B 4OVDA 2P9VB 4ARZB 1ACFA 4UQIS 1VEUB 3LFVA 4HEFA 3CUEA 4FH4A 1O07A 1H8MA 4GZBA 3VFHA 2JHEA 3FV7A 1DJBA 3H82B 2NUTC 2EX6A 2D01A 4UA7A 4ZRRA 1MKMA 4JXWA 1MC0A 5HD5A 3TE8A 3D3OA 4X68A 4KZ4A 1YMSA 2KDKA 4G3WA 3LO7A 1IELA 1BULA 1ESUA 3KYQA 4S2NC 2ZMVA 5EOOA 3JYIA 4S2MA 3PR6A 3TJZC 4CLCB 3F1NA 2HP9A 2A3UA 4JF6A 1ZKJA 1VHMA 3FC7A 1PWDA 3BRMA 1WA9A 1YLTA 4P6ZS 3LY4A 4UHUA 5HW3A 1S4RA 1YLJA 3DTMA 2Q0OA 3T1QB 3LIEA 1FCNA 1TS6A 3LY3A 3GVBA 3ZNYA 1OJ5A 4S2NA 3UPOA 1BLSA 4E3OA 3VP0A 3MZFA 1FOFA 3LI8A 1PW1A 2Y2MA 5EUAA 3UE1A 2QWSA 3NY4A 3UPPA 5HSQA 3DWZA 5GLAA 3BFFA 3DBAA 4B4XA 2WKHA 4GD6A 3GV9A 1IFQA 1N4OA 2OLUA 1TVFA 3ISGA 2JBFA 5FDHA 4GDNA 5TJJA 5HPIA 1XFQA 2Y55A 2R9WA 3UB5P 1TS7A 4E3KA 1I2WA 3T4TA 2LB9A 3SH8A 5DFYA 2DCFA 3VOLA 2HJ9C 3LR5A 5FAOA 3BQ8A 3RFBA 2VA0A 3G34A 5FQQA 4KQDA 4QB8A 4O0PA 3IF6B 2M1CA 1YMXA 1Y28A 4IUKA 5L10A 3F1PB 4ETZA 4IEDA 1SDNA 5FQMA 4JXSA 3LEZA 3LIDA 2J3TD 3NOUC 4FOFA 1V9YA 1OTAA 2XDMA 2ZQ7A 1SKOB 3MKFA 1Y54A 4MBHA 2JKTI 3MFXA 4KQRA 4YOFA 2Z6DA 3C8CA 3CLOA 4EETB 3BWLA 1YLZA 5HAQA 2W3DA 4OOMA 4ZBEA 1FCOA 4Y3IA 1MWUA 2ZC5B 5F5YA 1P9WA 1XJ6A 3VP4A 4X53A 2Y2IA 1K55A 2Y2NA 3DTEA 4MBFA 2XFTA 2JKGA 3QNCA 3F1OB 4L0LA 4N1HA 2JKTM 5M19A 1ES2A 4II7A 3T4OA 5IHVA 1ALQA 4Q8IA 1FR6A 3IHBA 4HJ6A 1XP4A 1AXBA 5I5LA 1CI9A 2C5WB 1V9ZA 2OLVA 3R4KA 3UMDA 4GKUA 4Y2FA 3T4QA 2X02A 5TFQA 1TEMA 3KO6A 1GSXA 1GA0A 4MLLA 2X71A 3LI9A 1XFNA 4NG2A 3BW6A 2J80A 4OLGA 4HJ4A 4PM5A 1FILA 3DAVA 1MXOA 1NRJA 2ZQ8A 5GHXA 4G3KA 2B02A 4N1XA 3UE0A 4KUOA 4HBTA 3A3EA 4DJ2A 2GX5A 3M2KA 1SDEA 3B42A 1K56A 4DE3A 2CC1A 4CJNA 3E4OA 5HD3A 5EFWA 1H8ZA 1N9OA 1TS8A 1EWZA 4BBUA 3ZVWA 4GS9A 4RA7A 1M6KA 1WYBA 3VE4A 4PM9A 3QP2A 4U3TA 1L3LA 2PT7A 2W3GA 2ZMAA 3IWIA 2R9XA 2W1TA 2ZC6B 4UAAA 3NDEA 2V0UA 5AQ9A 1K57A 3R7WA 3MXRA 2GJ3A 4A5RA 1H0MA 3A3JA 4JPMA 2J9OA 1T1AA 4WUJA 4KZ6A 4N9KA 3VSLA 1SZVA 4GLQA 5F1FA 3LUQA 3UE6A 3OPRA 3O3VA 3ULFA 1S6RA 1ZC2A 4DE1A 4XXRA 2H28A 3D72A 4I5SA 1O7EA 5IU1A 3C2WA 4E3IA 4HNBA 3UY6A 1DJAA 1PWCA 3MQQA 4EU0A 4B93A 1DP6A 4KG6A 1XGJA 4IVKA 4D60A 1UWPX 2Y2JA 3HREA 1QMEA 3LIBA 4F94A 5L2FA 4M3KA 2GDNA 2ZD8A 3G2ZA 2P7JA 2ZOHA 3PBOA 5FQJA 1BLCA 4C75A 3S7OA 3HLDA 4HY8A 1P9RA 4F3LA 2VKSA 2EXBA 1I2SA 3I7JA 4PAUA 2W3FA 4YWZA 4MDZA 2ZC3B 1VQQA 4Y5FA 3P7NA 3C4OA 2B5RA 3VE3A 1UGUA 1YSQA 2V1ZA 2R78A 2O9CA 3A0SA 2Y2PA 5F69A 3GECA 2WAFA 2KOIA 4PM6A 3V39A 1W63M 4EERA 5EVID 3MZDA 2UV0E 5G18A 3CPTB 4OQHA 2INWA 2QKPA 2ZL1A 4QY6A 5LBRA 3DTKA 4XT2A 4KZ9A 2WAEA 2PBDP 2P9VA 2JN7A 2W3HA 4Y13A 1Q2PA 3O5YA 4WZ5A 4Q0IA 5CECA 2PBYA 4BQMA 1NWZA 3P98A 4HI4A 1RGYA 1YQSA 3C4PA 2VX8A 1YT4A 4IHQA 4LGWA 3QP8A 5HDDA 4PKYG 3SS4A 1YLWA 3Q07A 1G5UA 3NOPC 1A0KA 3HLFA 3O88A 3NECA 2XEPA 1N9BA 3S1YA 1XGIA 4B9OA 4KQQA 2WKEA 2Y2QA 3VV4A 3F1OA 1F5MA 1S0WA 2M7UA 3V3SA 3L7HA 3R7WB 4Y0OA 4K91A 5HFOA 3IQAA 2OSUA 1XJ3A 2ZM8A 3ITBA 1IYOA 4I3JA 2D02A 2PR5A 3MBZA 4P6ZM 2V8FA 2HDRA 4U0XA 2Y59A 5L09A 2ZQ9A 2XSSA 5CHUA 3MQ0A 4CLCD 3EEAA 1HD8A 1MKIA 1YPRA 2HV1A 2W0NA 5A93A 2HF6A 1F2KA 5HAPA 3LR0A 2EX2A 4QPRA 3WS5A 4Y7PA 4I38A 3EWKA 4ZJ1A 3AGDA 2XGNA 2DRWA 5F1GA 3BEBA 3QP5A 3HUOA 4EBPA 3K2NA 1XPBA 4GCZA 1ES5A 5AQAA 1JWZA 2O9AA 1RCJA 2B95A 3UO9A 1WE4A 1BLHA 2VGKA 1NJ4A 5MC7A 3Q81A 3WWXA 2GZAA 2L0WA 2QMIA 4OKPA 2PYRA 1HLUP 5HL6A 4E6XA 1TS0A 1ZG4A 1OTIA 3CHWP 3A0VA 2WKIA 2WKQA 1KOUA 4N92A 4Q0JA 4HP9A 2ZQDA 1NZOA 5CGWA 2RCXA 4CLCA 2WKPA 4LPZA 1OT9A 1KGEA 5KZHA 2XA7S 3UPNA 4JF4A 3IX3A 3F1PA 2WUQA 4BL2A 5AJGA 1S67L 4XT2B 4HOIA 4WELA 2HZ5A 1XA7A 3TG9A 4DRTA 4WZ5C 4R3AA 1DJCA 3OPPA 1D7EA 1W63Q 3Q7VB 2XH9A 1XX2A 4HIAA 1OMEA 3CMZA 4LRXC 4E6WA 1S1YA 2VV8A 3KX0X 2GNXA 2ZC7A 3MQOA 1LHYA 3IH9A 3IH8A 4LCLA 3PHYA 3VP3A 3ZFZA 1MBLA 4EUVA 4F3LB 4HQAA 5DKLA 3ZG9B 5HZHA 5JYOA 2IWBA 4RVAA 5FEGA 5CTMA 1PFLA 1YM1A 2H0TA 2Q9NA 3EOIA 1TDGA 3T4LA 2PRFA 3C5AA 3U4LP 3VP1A 3HBRA 3F1NB 1C3BA 4EBNA 4KG5A 4LENA 3GMWA 5EM0A 5F82A 2KX6A 1CQAA 3E2KA 1G68A 2RL3A 1NZUA 3ZQ5A 2PYPA 2L4RA 3SH7A 2Y2HA 4ID4A 4ARZA 4GS9B 4KENB 3T4KA 1JTGA 3G2YA 3RJUA 4DDYA 1XXMA 3ZGAB 1JWVA 2JCHA 1TD5A 4GD8A 5U47A 3FYZA 4OPYA 1BUEA 4QU3A 4EESA 5EVIB 4H6JB 4EEPA 1NRFA 3N8RA 5KSHA 3Q7VA 2H10A 1ZHHB 3GSGA 4Q0HA 2Y2KA 3N4IA 4IJGA 5CXWA 1HZOA 4P6BA 1CEGA 4K0XA 5CGSA 1FCMA 2QPNA 1N9LA 1LLBA 4R0QA 4EEUA 2VLGA 3G35A 4QY5A 4GHIB 3WRTA 2I9VA 2HP6A 5TR7A 3IWQA 3HVFA 4BLMA 3QNBA 1KE4A 1T19A 4NK3A 3IXGA 3BFEA 1PNEA 4HH3A 5HWVA 4FSFA 2K2NA 5D3OA 5KMWA 1G6OA 4R38A 4PMAA 1S66L 3OZHA 1N9NA 3A3DA 2HJEA 2Z2LB 3HL9A 5HL1A 1OTDA 4ZDXA 2A49A 3GTCA 4O8GA 5GLDA 1BT5A 5CRFA 4G3VA 1VEUA 3Q7ZA 1F98A 2OWHA 3TRCA 2X01A 5IT5A 3KSIA 3LGOA 3ZVTA 3FPVA 1KGFA 4KZ3A 1K54A 4I3AA 1GHIA 2O99A 1K4FA 4JGRA 4EUZA 5F68A 3PTEA 1ERMA 3GDIA 4Y0UA 3OCLA 4LV3A 1TDLA 4KZ7A 1KE0A 1KGGA 3E98A 4CLCC 1OTBA 1HTZA 3Q1FA 4R4SA 3SH9A 2CMNA 5FAQA 1DRMA 4P0MA 4O01A 1W8QA 4MN5A 1L0GA 1K25A 3IBRA 1IYPA 1H3QA 3FWLA 3GR2A 1VB6A 3TW8A 4QJGA 1FR1A 2DNSA 1G28A 1ZG6A 4DMZA 3QP4A 3S4XA 3ITAA 1LSWA 2WZXA 3ZNTA 2W3EA 3L9KA 3RTYA 2WKRA 2XLNA 4S2IA 3LICA 4DF6A 2BTFP 3W4PA 4OP8A 3V67A 4DXBA 3OCNA 1YSPA 4R23A 3UDIA 5A8BA 2JKRI 3LR4A 4JLFA 2XA7M 3N7WA 4FCFA 1NLYA 2PDRA 3VOYA 1OPXA 4LRZE 3UE3A 4BD0A 4CLCE 1EI5A 4ESPA 1XJ2A 2NUPC 3T1SA 4N9LA 3BLMA 2A24B 2ZMFA 3BFDA 3CG5A 3FKVA 2XD1A 5EPHA 1J3WA 3BECA 1CF0A 4O7DA
chains in the Genus database with same CATH topology
1ESIA 1NXYA 2XEPA 1FSWA 3O87A 1N9BA 5E43A 3S1YA 2QZ6A 5GL9A 5I94A 1XGIA 4KQQA 2WKEA 2Y2QA 3EQVA 3VP2A 2HP9A 2EFUA 1S0WA 2A3UA 3O86A 5DF8A 3V3SA 4JF6A 3WRZA 4Y0OA 4RX3A 1ZKJA 1SCWA 4K91A 5FQIA 4UA6A 5HFOA 2G2UA 3IQAA 4S2LA 2OSUA 1PWDA 1MPLA 3BRMA 1YLTA 3PBTA 5E2GA 2ZM8A 4OONA 3ITBA 3LY4A 1IYOA 5DTTA 4UHUA 5HW3A 3E2LA 2Y2OA 4KZAA 1YLJA 3DTMA 3HLWA 1MWRA 3G4PA 4PM7A 1FCNA 3MBZA 3UNWA 1YLPA 3VOZA 2HDRA 1MWSA 3LY3A 1Z6FA 2Y59A 4U0XA 5FI7A 3GVBA 2ZQ9A 3ZNYA 4S2NA 5CHUA 3UPOA 1BLSA 4E3OA 2XR0A 1G6AA 3NI9A 4EQIA 4JBFA 3VP0A 3MZFA 5HAIA 1HD8A 1MKIA 1FOFA 4DE2A 4KZ8A 5A93A 3GRJA 3G32A 1HVBA 1KE3A 4KZBA 5HAPA 3VSKA 2J9PA 2J8YA 5CTNA 5CERA 2EX2A 2G2WA 1PW1A 4CPKA 2Y2MA 3HUMA 4Y7PA 5EUAA 3SOIA 3WS5A 3UE1A 2WADA 3W4OA 1MY8A 3NY4A 5AQ7A 4ZJ1A 4Y0TA 3AGDA 1W5DA 2XGNA 3RXWA 2DRWA 1GHMA 3BEBA 5F1GA 3NDGA 2I72A 3DWZA 5M1AA 5E2FA 5AQBA 3UPPA 5GLAA 3BFFA 3SS3A 1K6RA 3G31A 3WS2A 4JXVA 3HUOA 3M6HA 2WKHA 4B4XA 4GD6A 3GV9A 5EE8A 4EBPA 1N4OA 1XPBA 4ZJ3A 2OLUA 1TVFA 1ES5A 2Q9MA 5AQAA 3WS4A 3G30A 3ISGA 2JBFA 1ONGA 5FDHA 4FD8A 5F83A 1JWZA 4GDNA 2Y55A 3GQZA 1RCJA 4OPQA 4OPRA 2PU2A 4OOLA 3UO9A 2R9WA 1H8YA 3UN7A 1WE4A 4E3KA 3PBRA 2VGKA 1BLHA 1NJ4A 1PZPA 3Q81A 4DE0A 2HDUA 1I2WA 1WYCA 3WWXA 1E3UA 3BYDA 3AGEA 4PPRA 2QMIA 3FKWA 1ES3A 1PIOA 3SH8A 3FZCA 2BG1A 4OKPA 3NC8A 1BZAA 2DCFA 3LCEA 1GCEA 4E6XA 4EWFA 5FAOA 2H0YA 2P74A 2Y2GA 1ZG4A 3OPHA 3WS0A 3MZEA 3TSGA 5FASA 1L0EA 3D4FA 2WKIA 1NYYA 3G34A 5FQQA 5A92A 4QB8A 4OPZA 3PAEA 4N92A 3IF6B 2ZQDA 1YMXA 1NZOA 5CGWA 2PU4A 4WMCA 1JTDA 2WGWA 2RCXA 3IT9A 4IEDA 3V50A 1SDNA 2HPBA 4WEKA 3N8LA 4JXSA 5FQMA 1E4DA 4R4RA 1KGEA 4QD4A 3LEZA 4GDBA 4WYYA 5A90A 5KZHA 3C7VA 2EFXA 3UPNA 1BSGA 2ZQAA 4IVIA 2WZZA 5FA7A 1K6SA 1CK3A 3NIAA 3OPLA 4JF4A 1ONHA 2JE5A 2WGWB 4E3MA 4OQIA 4UA9A 2ZQ7A 2XDMA 4C6YA 2WUQA 3HLBA 2WGVA 3MKFA 1Y54A 4YFMA 4MBHA 4BL2A 3RXXA 4WELA 4S2KA 4X56A 5E2HA 1XA7A 3V5MA 3TG9A 4DRTA 4IBXA 1PZOA 4KQRA 3P09A 1IYQA 4WZ5C 3VMAA 4EBLA 4ZJ2A 2JC7A 1DJCA 3OC2A 3OPPA 5HAQA 1YLZA 5CHJA 4XUXA 4OOMA 4PM8A 4ZBEA 1FCOA 5EOEA 1MWUA 2ZC5B 1SHVA 3Q7VB 3VP4A 4X53A 3ZG7B 2XH9A 1XX2A 3MXSA 2Y2IA 4P85A 1K55A 1OMEA 1W79A 2Y2NA 3IF6C 3CMZA 2Y4AA 1IEMA 3Q82A 4MBFA 2Y2LA 1FQGA 2XFTA 4E6WA 3QNCA 4ZTKA 3W8KA 4L0LA 4N1HA 5M19A 1ES2A 2ZC7A 3IHAA 1LHYA 3HLGA 2UWXA 2FFYA 1ALQA 3IH9A 4LCMA 3PBSA 5IHVA 1FR6A 4MBKA 3IH8A 4LCLA 1ES4A 1BTLA 3PBNA 3IHBA 5FI2A 2XK1A 4MNRA 1XP4A 3VP3A 3ZFZA 1MBLA 1PI4A 1AXBA 4KG2A 4WM9A 1JVJA 1KDSA 4IBRA 5JYOA 1CI9A 2C5WB 3ZG9B 5M18A 2IWBA 4GN2A 1CEFA 4RVAA 2OLVA 5CTMA 4GKUA 1DY6A 4K0WA 1YM1A 2H0TA 2Q9NA 2X02A 5TFQA 1ERQA 1TEMA 1TDGA 2Y91A 2HDQA 4DE3A 3C5AA 3VP1A 3PAGA 3HBRA 1GA9A 4Z9QA 5FI6A 3TOIA 2XQZA 1C3BA 4EBNA 1GA0A 1W7FA 4MLLA 5J8XA 2X71A 4OP5A 1PW8A 3SS5A 4WEJA 4KG5A 4LENA 1XKZA 1PI5A 4OLGA 3VFFA 4PM5A 1MXOA 1QMFA 4X55A 1K57C 2ZQ8A 3GMWA 5GHXA 3ZCZA 5F82A 5FQ9A 1LI0A 4N1XA 1IKGA 3UE0A 2H5SA 5GHYA 2V2FF 3N6IA 5KSCA 3E2KA 5CEDA 1G68A 2RL3A 4BD1A 1NZUA 3A3FA 4HBTA 1NY0A 3A3EA 5DVAA 2XF3A 4MEZA 4C3QA 3SH7A 2Y2HA 3M2KA 1SDEA 4ID4A 4KENB 1K56A 1K4EA 2V20A 5DF7A 1JTGA 3G2YA 4QHCA 2CC1A 2J7VA 3RJUA 2HDSA 2IWDA 3HLCA 3ZG0A 4CJNA 1XXMA 4DDYA 5JYPA 4S2OA 3ZGAB 1JWVA 2JCHA 4GD8A 5U47A 1L0DA 1H8ZA 3FYZA 1EWZA 4OH0A 3AGFA 4OPYA 1BUEA 5DTKA 3ZVWA 4RX2A 4QU3A 3BM6A 3BFCA 1NYMA 3NCKA 4RA7A 5EVIB 1M6KA 4GB7A 3S22A 1WYBA 4PM9A 4U3TA 1XA1A 1NRFA 3A3IA 3M6BA 2ZMAA 1RGZA 4R3BA 4YINA 3N8RA 4U0TA 5EVLA 3IWIA 3Q7VA 5KSHA 2WK0A 2H10A 2R9XA 2ZC6B 5A91A 4D2OA 3PBQA 3GSGA 3NDEA 4UAAA 5AQ9A 3MFDA 2Y2KA 1K57A 5EECA 3MXRA 3N4IA 5CXWA 1HZOA 4DXCA 3WS1A 4Q8IA 4P6BA 2XD5A 1SKFA 1CEGA 4K0XA 5CGSA 4A5RA 3A3JA 1FCMA 2QPNA 4JPMA 2J9OA 1LLBA 5CHMA 4E3NA 4R0QA 2ZQCA 1LL5A 1PWGA 3CJMA 4KZ6A 4OLDA 1GHPA 3G35A 4N9KA 4QY5A 3WRTA 2VGJA 2HP6A 4KQOA 1I5QA 5TR7A 3VSLA 3IWQA 3HVFA 4BLMA 2BLSA 1KE4A 3QNBA 4NK3A 3CZDA 5F1FA 3ZHHA 5BOHA 3IXGA 4DDSA 3BFEA 1CI8A 2E8IA 2ZM2A 3OPRA 3O3VA 4GNUA 4JKTA 1S6RA 4FSFA 1EROA 2ZLYA 4X6TA 5D3OA 1ZC2A 5KMWA 4DE1A 4XXRA 1Q2QA 1O7EA 1K56D 2Z2MB 4PMAA 4E3IA 3OZHA 3A3DA 4S2PA 2Z2LB 4FH2A 1U60A 3HL9A 5HL1A 3UY6A 1DJAA 1PWCA 1RP5A 3DWKA 4ZDXA 2A49A 1K55C 3GTCA 3IF6A 5GLDA 4B88A 2XFSA 5CGXA 4KG6A 1FSYA 1L0FA 1BT5A 3IWOA 1MWTA 1XGJA 4IVKA 4NETA 5CRFA 5DF9A 4WMCD 2EXAA 4OQ0A 2IWCA 4GOGA 3Q7ZA 2Y2JA 4JXGA 3HREA 1QMEA 2ZC4B 3N8SA 4BJPA 4E3LA 1IKIA 4M3KA 4F94A 2GDNA 5L2FA 4XUZA 3HUNA 1K38A 3UDXA 2X01A 1KVLA 3IXBA 4KZ5A 3ZG5A 1LI9A 2ZD8A 3G2ZA 4OQGA 2WGIA 1J9MA 3ZVTA 1KGFA 3PBOA 4KZ3A 4P87A 1L2SA 4LV2A 5DTSA 5FQJA 1BLCA 1E3UD 1K54A 1KDWA 3ZDJA 4C75A 1M40A 4LV1A 5E2EA 1GHIA 1JWPA 4ZAMA 1E25A 1K4FA 4RYEA 5GLCA 3HLDA 4EUZA 4LV0A 3PTEA 4OOYA 1ERMA 2EXBA 1I2SA 3I7JA 4Y0UA 3OCLA 5FATA 3UDFA 4LV3A 4EV4A 5HARA 1TDLA 2ZC3B 1KE0A 1KGGA 1VQQA 4KZ7A 5EVIC 5CEBA 1W8YA 3C4OA 1K54C 1KVMA 3BLSA 2B5RA 1HTZA 4R3JA 3Q1FA 4R1GA 4R4SA 3SH9A 1VM1A 4B4ZA 2EX8A 5FAQA 2C6WB 4P0MA 2V1ZA 1PYYA 1YLYA 3IF5A 4DKIA 1W8QA 1L0GA 4WZ4A 2Y2PA 1K25A 3IXDA 2EX9A 4WBGA 4X69A 1IYPA 3EQUA 2WAFA 5FAPA 3FWLA 3GR2A 5TGFA 4H8RA 4PM6A 4QJGA 1LL9A 3V39A 1FR1A 4HBUA 5HX9A 5EVID 2DNSA 3MZDA 4JF5A 5GLBA 2FFFB 4S2JA 5G18A 4BL3A 3NBLA 1H5XA 1ZG6A 2HP5A 3S4XA 3ITAA 4OQHA 3W4QA 3V3RA 3M2JA 2OV5A 3ZG8B 2WZXA 4OVDA 3ZNTA 2P9VB 4HEFA 4FH4A 2XLNA 1O07A 3DW0A 4QY6A 4S2IA 4BENA 4GZBA 4DF6A 3VFHA 3W4PA 4OP8A 4KZ9A 2WAEA 4DXBA 3OCNA 3IXHA 4R23A 2P9VA 3UDIA 1Q2PA 1DJBA 3FV7A 3MKEA 3QHYA 4JLFA 2EX6A 3N7WA 4FCFA 4UA7A 4WZ5A 2PBYA 3VOYA 4BQMA 5CECA 3P98A 1RGYA 1YQSA 3UE3A 2ZJ9A 3C4PA 4JXWA 3B3XA 5FSRA 4BD0A 4X68A 1BLPA 4KZ4A 1YMSA 1YT4A 5GHZA 1EI5A 5EVIA 3BFGA 5FQKA 3LO7A 4N9LA 2ZM0A 3BLMA 1IELA 1BULA 1IYSA 3SS4A 1YLWA 3BFDA 4HESA 3CG5A 3FKVA 1ESUA 3Q07A 2XD1A 5EPHA 4S2NC 2WYXA 3HLEA 3HLFA 3BECA 3O88A 5EOOA 4O7DA 3JYIA 4S2MA 3C7UA 4E3JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ESI A;  1NXY A;  2XEP A;  1FSW A;  3O87 A;  1N9B A;  5E43 A;  3S1Y A;  2QZ6 A;  5GL9 A;  5I94 A;  1XGI A;  4KQQ A;  2WKE A;  2Y2Q A;  3EQV A;  3VP2 A;  2HP9 A;  2EFU A;  1S0W A;  2A3U A;  3O86 A;  5DF8 A;  3V3S A;  4JF6 A;  3WRZ A;  4Y0O A;  4RX3 A;  1ZKJ A;  1SCW A;  4K91 A;  5FQI A;  4UA6 A;  5HFO A;  2G2U A;  3IQA A;  4S2L A;  2OSU A;  1PWD A;  1MPL A;  3BRM A;  1YLT A;  3PBT A;  5E2G A;  2ZM8 A;  4OON A;  3ITB A;  3LY4 A;  1IYO A;  5DTT A;  4UHU A;  5HW3 A;  3E2L A;  2Y2O A;  4KZA A;  1YLJ A;  3DTM A;  3HLW A;  1MWR A;  3G4P A;  4PM7 A;  1FCN A;  3MBZ A;  3UNW A;  1YLP A;  3VOZ A;  2HDR A;  1MWS A;  3LY3 A;  1Z6F A;  2Y59 A;  4U0X A;  5FI7 A;  3GVB A;  2ZQ9 A;  3ZNY A;  4S2N A;  5CHU A;  3UPO A;  1BLS A;  4E3O A;  2XR0 A;  1G6A A;  3NI9 A;  4EQI A;  4JBF A;  3VP0 A;  3MZF A;  5HAI A;  1HD8 A;  1MKI A;  1FOF A;  4DE2 A;  4KZ8 A;  5A93 A;  3GRJ A;  3G32 A;  1HVB A;  1KE3 A;  4KZB A;  5HAP A;  3VSK A;  2J9P A;  2J8Y A;  5CTN A;  5CER A;  2EX2 A;  2G2W A;  1PW1 A;  4CPK A;  2Y2M A;  3HUM A;  4Y7P A;  5EUA A;  3SOI A;  3WS5 A;  3UE1 A;  2WAD A;  3W4O A;  1MY8 A;  3NY4 A;  5AQ7 A;  4ZJ1 A;  4Y0T A;  3AGD A;  1W5D A;  2XGN A;  3RXW A;  2DRW A;  1GHM A;  3BEB A;  5F1G A;  3NDG A;  2I72 A;  3DWZ A;  5M1A A;  5E2F A;  5AQB A;  3UPP A;  5GLA A;  3BFF A;  3SS3 A;  1K6R A;  3G31 A;  3WS2 A;  4JXV A;  3HUO A;  3M6H A;  2WKH A;  4B4X A;  4GD6 A;  3GV9 A;  5EE8 A;  4EBP A;  1N4O A;  1XPB A;  4ZJ3 A;  2OLU A;  1TVF A;  1ES5 A;  2Q9M A;  5AQA A;  3WS4 A;  3G30 A;  3ISG A;  2JBF A;  1ONG A;  5FDH A;  4FD8 A;  5F83 A;  1JWZ A;  4GDN A;  2Y55 A;  3GQZ A;  1RCJ A;  4OPQ A;  4OPR A;  2PU2 A;  4OOL A;  3UO9 A;  2R9W A;  1H8Y A;  3UN7 A;  1WE4 A;  4E3K A;  3PBR A;  2VGK A;  1BLH A;  1NJ4 A;  1PZP A;  3Q81 A;  4DE0 A;  2HDU A;  1I2W A;  1WYC A;  3WWX A;  1E3U A;  3BYD A;  3AGE A;  4PPR A;  2QMI A;  3FKW A;  1ES3 A;  1PIO A;  3SH8 A;  3FZC A;  2BG1 A;  4OKP A;  3NC8 A;  1BZA A;  2DCF A;  3LCE A;  1GCE A;  4E6X A;  4EWF A;  5FAO A;  2H0Y A;  2P74 A;  2Y2G A;  1ZG4 A;  3OPH A;  3WS0 A;  3MZE A;  3TSG A;  5FAS A;  1L0E A;  3D4F A;  2WKI A;  1NYY A;  3G34 A;  5FQQ A;  5A92 A;  4QB8 A;  4OPZ A;  3PAE A;  4N92 A;  3IF6 B;  2ZQD A;  1YMX A;  1NZO A;  5CGW A;  2PU4 A;  4WMC A;  1JTD A;  2WGW A;  2RCX A;  3IT9 A;  4IED A;  3V50 A;  1SDN A;  2HPB A;  4WEK A;  3N8L A;  4JXS A;  5FQM A;  1E4D A;  4R4R A;  1KGE A;  4QD4 A;  3LEZ A;  4GDB A;  4WYY A;  5A90 A;  5KZH A;  3C7V A;  2EFX A;  3UPN A;  1BSG A;  2ZQA A;  4IVI A;  2WZZ A;  5FA7 A;  1K6S A;  1CK3 A;  3NIA A;  3OPL A;  4JF4 A;  1ONH A;  2JE5 A;  2WGW B;  4E3M A;  4OQI A;  4UA9 A;  2ZQ7 A;  2XDM A;  4C6Y A;  2WUQ A;  3HLB A;  2WGV A;  3MKF A;  1Y54 A;  4YFM A;  4MBH A;  4BL2 A;  3RXX A;  4WEL A;  4S2K A;  4X56 A;  5E2H A;  1XA7 A;  3V5M A;  3TG9 A;  4DRT A;  4IBX A;  1PZO A;  4KQR A;  3P09 A;  1IYQ A;  4WZ5 C;  3VMA A;  4EBL A;  4ZJ2 A;  2JC7 A;  1DJC A;  3OC2 A;  3OPP A;  5HAQ A;  1YLZ A;  5CHJ A;  4XUX A;  4OOM A;  4PM8 A;  4ZBE A;  1FCO A;  5EOE A;  1MWU A;  2ZC5 B;  1SHV A;  3Q7V B;  3VP4 A;  4X53 A;  3ZG7 B;  2XH9 A;  1XX2 A;  3MXS A;  2Y2I A;  4P85 A;  1K55 A;  1OME A;  1W79 A;  2Y2N A;  3IF6 C;  3CMZ A;  2Y4A A;  1IEM A;  3Q82 A;  4MBF A;  2Y2L A;  1FQG A;  2XFT A;  4E6W A;  3QNC A;  4ZTK A;  3W8K A;  4L0L A;  4N1H A;  5M19 A;  1ES2 A;  2ZC7 A;  3IHA A;  1LHY A;  3HLG A;  2UWX A;  2FFY A;  1ALQ A;  3IH9 A;  4LCM A;  3PBS A;  5IHV A;  1FR6 A;  4MBK A;  3IH8 A;  4LCL A;  1ES4 A;  1BTL A;  3PBN A;  3IHB A;  5FI2 A;  2XK1 A;  4MNR A;  1XP4 A;  3VP3 A;  3ZFZ A;  1MBL A;  1PI4 A;  1AXB A;  4KG2 A;  4WM9 A;  1JVJ A;  1KDS A;  4IBR A;  5JYO A;  1CI9 A;  2C5W B;  3ZG9 B;  5M18 A;  2IWB A;  4GN2 A;  1CEF A;  4RVA A;  2OLV A;  5CTM A;  4GKU A;  1DY6 A;  4K0W A;  1YM1 A;  2H0T A;  2Q9N A;  2X02 A;  5TFQ A;  1ERQ A;  1TEM A;  1TDG A;  2Y91 A;  2HDQ A;  4DE3 A;  3C5A A;  3VP1 A;  3PAG A;  3HBR A;  1GA9 A;  4Z9Q A;  5FI6 A;  3TOI A;  2XQZ A;  1C3B A;  4EBN A;  1GA0 A;  1W7F A;  4MLL A;  5J8X A;  2X71 A;  4OP5 A;  1PW8 A;  3SS5 A;  4WEJ A;  4KG5 A;  4LEN A;  1XKZ A;  1PI5 A;  4OLG A;  3VFF A;  4PM5 A;  1MXO A;  1QMF A;  4X55 A;  1K57 C;  2ZQ8 A;  3GMW A;  5GHX A;  3ZCZ A;  5F82 A;  5FQ9 A;  1LI0 A;  4N1X A;  1IKG A;  3UE0 A;  2H5S A;  5GHY A;  2V2F F;  3N6I A;  5KSC A;  3E2K A;  5CED A;  1G68 A;  2RL3 A;  4BD1 A;  1NZU A;  3A3F A;  4HBT A;  1NY0 A;  3A3E A;  5DVA A;  2XF3 A;  4MEZ A;  4C3Q A;  3SH7 A;  2Y2H A;  3M2K A;  1SDE A;  4ID4 A;  4KEN B;  1K56 A;  1K4E A;  2V20 A;  5DF7 A;  1JTG A;  3G2Y A;  4QHC A;  2CC1 A;  2J7V A;  3RJU A;  2HDS A;  2IWD A;  3HLC A;  3ZG0 A;  4CJN A;  1XXM A;  4DDY A;  5JYP A;  4S2O A;  3ZGA B;  1JWV A;  2JCH A;  4GD8 A;  5U47 A;  1L0D A;  1H8Z A;  3FYZ A;  1EWZ A;  4OH0 A;  3AGF A;  4OPY A;  1BUE A;  5DTK A;  3ZVW A;  4RX2 A;  4QU3 A;  3BM6 A;  3BFC A;  1NYM A;  3NCK A;  4RA7 A;  5EVI B;  1M6K A;  4GB7 A;  3S22 A;  1WYB A;  4PM9 A;  4U3T A;  1XA1 A;  1NRF A;  3A3I A;  3M6B A;  2ZMA A;  1RGZ A;  4R3B A;  4YIN A;  3N8R A;  4U0T A;  5EVL A;  3IWI A;  3Q7V A;  5KSH A;  2WK0 A;  2H10 A;  2R9X A;  2ZC6 B;  5A91 A;  4D2O A;  3PBQ A;  3GSG A;  3NDE A;  4UAA A;  5AQ9 A;  3MFD A;  2Y2K A;  1K57 A;  5EEC A;  3MXR A;  3N4I A;  5CXW A;  1HZO A;  4DXC A;  3WS1 A;  4Q8I A;  4P6B A;  2XD5 A;  1SKF A;  1CEG A;  4K0X A;  5CGS A;  4A5R A;  3A3J A;  1FCM A;  2QPN A;  4JPM A;  2J9O A;  1LLB A;  5CHM A;  4E3N A;  4R0Q A;  2ZQC A;  1LL5 A;  1PWG A;  3CJM A;  4KZ6 A;  4OLD A;  1GHP A;  3G35 A;  4N9K A;  4QY5 A;  3WRT A;  2VGJ A;  2HP6 A;  4KQO A;  1I5Q A;  5TR7 A;  3VSL A;  3IWQ A;  3HVF A;  4BLM A;  2BLS A;  1KE4 A;  3QNB A;  4NK3 A;  3CZD A;  5F1F A;  3ZHH A;  5BOH A;  3IXG A;  4DDS A;  3BFE A;  1CI8 A;  2E8I A;  2ZM2 A;  3OPR A;  3O3V A;  4GNU A;  4JKT A;  1S6R A;  4FSF A;  1ERO A;  2ZLY A;  4X6T A;  5D3O A;  1ZC2 A;  5KMW A;  4DE1 A;  4XXR A;  1Q2Q A;  1O7E A;  1K56 D;  2Z2M B;  4PMA A;  4E3I A;  3OZH A;  3A3D A;  4S2P A;  2Z2L B;  4FH2 A;  1U60 A;  3HL9 A;  5HL1 A;  3UY6 A;  1DJA A;  1PWC A;  1RP5 A;  3DWK A;  4ZDX A;  2A49 A;  1K55 C;  3GTC A;  3IF6 A;  5GLD A;  4B88 A;  2XFS A;  5CGX A;  4KG6 A;  1FSY A;  1L0F A;  1BT5 A;  3IWO A;  1MWT A;  1XGJ A;  4IVK A;  4NET A;  5CRF A;  5DF9 A;  4WMC D;  2EXA A;  4OQ0 A;  2IWC A;  4GOG A;  3Q7Z A;  2Y2J A;  4JXG A;  3HRE A;  1QME A;  2ZC4 B;  3N8S A;  4BJP A;  4E3L A;  1IKI A;  4M3K A;  4F94 A;  2GDN A;  5L2F A;  4XUZ A;  3HUN A;  1K38 A;  3UDX A;  2X01 A;  1KVL A;  3IXB A;  4KZ5 A;  3ZG5 A;  1LI9 A;  2ZD8 A;  3G2Z A;  4OQG A;  2WGI A;  1J9M A;  3ZVT A;  1KGF A;  3PBO A;  4KZ3 A;  4P87 A;  1L2S A;  4LV2 A;  5DTS A;  5FQJ A;  1BLC A;  1E3U D;  1K54 A;  1KDW A;  3ZDJ A;  4C75 A;  1M40 A;  4LV1 A;  5E2E A;  1GHI A;  1JWP A;  4ZAM A;  1E25 A;  1K4F A;  4RYE A;  5GLC A;  3HLD A;  4EUZ A;  4LV0 A;  3PTE A;  4OOY A;  1ERM A;  2EXB A;  1I2S A;  3I7J A;  4Y0U A;  3OCL A;  5FAT A;  3UDF A;  4LV3 A;  4EV4 A;  5HAR A;  1TDL A;  2ZC3 B;  1KE0 A;  1KGG A;  1VQQ A;  4KZ7 A;  5EVI C;  5CEB A;  1W8Y A;  3C4O A;  1K54 C;  1KVM A;  3BLS A;  2B5R A;  1HTZ A;  4R3J A;  3Q1F A;  4R1G A;  4R4S A;  3SH9 A;  1VM1 A;  4B4Z A;  2EX8 A;  5FAQ A;  2C6W B;  4P0M A;  2V1Z A;  1PYY A;  1YLY A;  3IF5 A;  4DKI A;  1W8Q A;  1L0G A;  4WZ4 A;  2Y2P A;  1K25 A;  3IXD A;  2EX9 A;  4WBG A;  4X69 A;  1IYP A;  3EQU A;  2WAF A;  5FAP A;  3FWL A;  3GR2 A;  5TGF A;  4H8R A;  4PM6 A;  4QJG A;  1LL9 A;  3V39 A;  1FR1 A;  4HBU A;  5HX9 A;  5EVI D;  2DNS A;  3MZD A;  4JF5 A;  5GLB A;  2FFF B;  4S2J A;  5G18 A;  4BL3 A;  3NBL A;  1H5X A;  1ZG6 A;  2HP5 A;  3S4X A;  3ITA A;  4OQH A;  3W4Q A;  3V3R A;  3M2J A;  2OV5 A;  3ZG8 B;  2WZX A;  4OVD A;  3ZNT A;  2P9V B;  4HEF A;  4FH4 A;  2XLN A;  1O07 A;  3DW0 A;  4QY6 A;  4S2I A;  4BEN A;  4GZB A;  4DF6 A;  3VFH A;  3W4P A;  4OP8 A;  4KZ9 A;  2WAE A;  4DXB A;  3OCN A;  3IXH A;  4R23 A;  2P9V A;  3UDI A;  1Q2P A;  1DJB A;  3FV7 A;  3MKE A;  3QHY A;  4JLF A;  2EX6 A;  3N7W A;  4FCF A;  4UA7 A;  4WZ5 A;  2PBY A;  3VOY A;  4BQM A;  5CEC A;  3P98 A;  1RGY A;  1YQS A;  3UE3 A;  2ZJ9 A;  3C4P A;  4JXW A;  3B3X A;  5FSR A;  4BD0 A;  4X68 A;  1BLP A;  4KZ4 A;  1YMS A;  1YT4 A;  5GHZ A;  1EI5 A;  5EVI A;  3BFG A;  5FQK A;  3LO7 A;  4N9L A;  2ZM0 A;  3BLM A;  1IEL A;  1BUL A;  1IYS A;  3SS4 A;  1YLW A;  3BFD A;  4HES A;  3CG5 A;  3FKV A;  1ESU A;  3Q07 A;  2XD1 A;  5EPH A;  4S2N C;  2WYX A;  3HLE A;  3HLF A;  3BEC A;  3O88 A;  5EOO A;  4O7D A;  3JYI A;  4S2M A;  3C7U A;  4E3J A; 
#chains in the Genus database with same CATH topology
 1NXY A;  5E43 A;  3E0Y A;  3O87 A;  3HCY A;  3MXQ A;  3LR3 A;  5GL9 A;  3ZYT A;  4PKY A;  5FEF A;  3EQV A;  3VP2 A;  3O86 A;  5DF8 A;  3WRZ A;  4RX3 A;  1SCW A;  3HJK A;  4UA6 A;  2K31 A;  4S2L A;  1MPL A;  3PBT A;  4OON A;  3P01 A;  5DTT A;  3E2L A;  3LEQ A;  2Y2O A;  2YKF A;  3EEH A;  3HLW A;  5DFX A;  1MWR A;  4JGP A;  3VOZ A;  1Z6F A;  5FI7 A;  2XR0 A;  3NI9 A;  4FUW A;  4JBF A;  5HAI A;  3IX8 A;  1GSV A;  5G4Z A;  4DE2 A;  3MSH A;  2W27 A;  3GRJ A;  4YNR A;  2J9P A;  5CER A;  4CPK A;  3HUM A;  2WAD A;  1MY8 A;  1W5D A;  3JVU A;  4I39 A;  1GHM A;  3CI6 A;  1K6R A;  3WS2 A;  4WF0 A;  5EE8 A;  2EWW A;  3CUE C;  4JGO A;  3G30 A;  4EXO A;  4FD8 A;  5F83 A;  4JGQ A;  1GSW A;  4OPR A;  4OOL A;  1H8Y A;  3UN7 A;  3PBR A;  4DE0 A;  1WYC A;  4PPR A;  3IBJ A;  1ES3 A;  1PIO A;  3ICY A;  5G4Y A;  3UB9 A;  3FZC A;  3NC8 A;  1BZA A;  4EWF A;  4LLO B;  2H0Y A;  2P74 A;  3KSG A;  3KYZ A;  3OPH A;  2M7V A;  3MZE A;  2B18 A;  3QP1 A;  5FAS A;  3D4F A;  1NYY A;  2OWJ A;  1JTD A;  2WGW A;  3OLO A;  3U2A A;  2HPB A;  3N8L A;  1XJ4 A;  4R4R A;  3CPT A;  4QD4 A;  4GDB A;  4WYY A;  5A90 A;  1MZU A;  1BSG A;  2ZQA A;  4IVI A;  3QP6 A;  5FA7 A;  4LRY C;  1ONH A;  2LB5 A;  4E3M A;  2VGL S;  4OQI A;  4UA9 A;  5HWW A;  3HLB A;  2YKH A;  5L07 A;  4X56 A;  4S2K A;  3V5M A;  4EBL A;  4QWO A;  4ZJ2 A;  2JC7 A;  4H6J A;  3CIT A;  4XUX A;  2FZ0 A;  4PHT A;  3H9W A;  4P85 A;  1W79 A;  2VV7 A;  1IOU A;  2Y4A A;  3BY9 A;  3Q82 A;  2Y2L A;  4Y17 A;  4WN5 A;  2V8C A;  2PHY A;  4ZTK A;  3W8K A;  2UWX A;  3PBS A;  4MBK A;  5FI2 A;  2QJ7 A;  1ES4 A;  1BTL A;  3PBN A;  3LYX A;  3OBF A;  1PI4 A;  4WM9 A;  3SZT A;  1JVJ A;  5M18 A;  4MN6 A;  1CEF A;  5HDC A;  1DY6 A;  4K0W A;  2QHK A;  4HHD A;  1ERQ A;  2HDQ A;  3PAG A;  3TOI A;  5FI6 A;  1W7F A;  5J8X A;  4IUH A;  2EWV A;  1PI5 A;  2PAV P;  1QMF A;  4X1L A;  4X55 A;  2V0W A;  2QJ5 A;  4NXE A;  2E8J A;  1LI0 A;  4UQI M;  1T1C A;  5TBM A;  3N6I A;  5KSC A;  2A2L A;  2EA9 A;  5CED A;  1NY0 A;  4EQ1 A;  5DVA A;  1K4E A;  2V20 A;  5DF7 A;  4QHC A;  2J7V A;  3ZG0 A;  1S1Z A;  2HDS A;  3HLC A;  1P97 A;  4S2O A;  1L0D A;  3NUL A;  4OH0 A;  3AGF A;  5HWT A;  2W1T B;  3CAX A;  3BFC A;  5AVE A;  3S22 A;  1XA1 A;  3T50 A;  3M6B A;  1RGZ A;  4R3B A;  5FL3 A;  4U0T A;  5EVL A;  5A91 A;  3CWF A;  4D2O A;  3MFD A;  5DKK A;  3KSF A;  4DXC A;  1SKF A;  1JNU A;  4ME4 A;  2OOL A;  4NXF A;  5CHM A;  1X0O A;  1LL5 A;  1PWG A;  3CJM A;  4OLD A;  1GHP A;  2VGJ A;  2Y8H A;  1I5Q A;  4KUK A;  3EGX C;  3CZD A;  3H7W B;  5BOH A;  3RH8 B;  1CI8 A;  2K7S A;  2ZM2 A;  4GNU A;  4BMW A;  1ERO A;  3MS6 A;  4R6L A;  5EM1 A;  3H7W A;  3MMH A;  4FH2 A;  3IF6 A;  4MN7 A;  4GJ4 A;  2XFS A;  5CGX A;  5E2H A;  1PRQ A;  1VET A;  2A24 A;  4WMC D;  3A0R A;  3N8S A;  4BJP A;  4XUZ A;  3HUN A;  1K38 A;  3IXB A;  3ZG5 A;  1LI9 A;  4DN0 A;  1J9M A;  4P87 A;  1L2S A;  5DTS A;  2XRN A;  1KDW A;  1JWP A;  4LV0 A;  2Z6C A;  4FTX A;  4OOY A;  1YAX A;  4Y15 A;  5FAT A;  4EV4 A;  5HAR A;  2L1M A;  5EVI C;  5CEB A;  1W8Y A;  5DJU A;  1K54 C;  1KVM A;  3BJN A;  1VM1 A;  2C6W B;  1PYY A;  1YLY A;  3IF5 A;  5HPF A;  4DKI A;  1F9I A;  3IXD A;  4X69 A;  4WBG A;  5FAP A;  2PD8 A;  2AVX A;  5TGF A;  2MJ6 A;  1LL9 A;  4HBU A;  4JF5 A;  5GLB A;  3NBL A;  2HP5 A;  2ZL1 B;  4NXB A;  3V3R A;  3M2J A;  2OV5 A;  2IA2 A;  2ZBB A;  2VJW A;  4Z1W A;  3DW0 A;  4BEN A;  4CQH A;  3IXH A;  3MKE A;  3LIA A;  2VEA A;  3QHY A;  4UEY A;  3W2Z A;  2ZJ9 A;  5EVE A;  3B3X A;  5FSR A;  1BLP A;  5GHZ A;  5EVI A;  3BFG A;  5FQK A;  2ZM0 A;  4R70 A;  1IYS A;  4AFI A;  4HES A;  4X25 A;  2WYX A;  3HLE A;  3S7Q A;  1DP9 A;  3DTI A;  3C7U A;  4E3J A;  3HJI A;  1ESI A;  1OJG A;  1FSW A;  2QZ6 A;  2G7U A;  5I94 A;  5L8M A;  2EFU A;  3K3C A;  3T1X A;  1ODV A;  4X1M A;  5FQI A;  4GHI A;  1D1J A;  2G2U A;  5F6A A;  5E2G A;  1D06 A;  4KZA A;  3G4P A;  4PM7 A;  4RQ9 A;  2KLI A;  3UNW A;  5KIZ A;  1YLP A;  1MWS A;  2VGL M;  1LSV A;  1G6A A;  3IS2 B;  4EQI A;  2XRO A;  4KZ8 A;  3G32 A;  1HVB A;  1KE3 A;  4KZB A;  4BWI A;  3VSK A;  2J8Y A;  1AWI A;  3C38 A;  5CTN A;  4NEE D;  2G2W A;  3IS2 A;  3SOI A;  3W4O A;  4Y0T A;  5AQ7 A;  3JPU A;  3RXW A;  1DP8 A;  5M1A A;  3NDG A;  2I72 A;  5E2F A;  4HH2 A;  5AQB A;  3SS3 A;  3NOT C;  3UB7 A;  2JKF A;  3G31 A;  2JKR M;  4JXV A;  3M6H A;  4ZJ3 A;  3UB6 A;  2Q9M A;  3LIF A;  3WS4 A;  3PXP A;  3H82 A;  1ONG A;  1ZTU A;  1P0Z A;  3GQZ A;  4OPQ A;  2PU2 A;  5CX7 A;  1LSX A;  3KYE A;  1PZP A;  3UME A;  2HDU A;  1E3U A;  3BYD A;  3NHQ A;  3AGE A;  3FKW A;  3E4P A;  2BG1 A;  3K3D A;  3LCE A;  1GCE A;  4WL9 A;  2Y2G A;  5IS1 A;  3WS0 A;  4L9G A;  3TSG A;  1L0E A;  5A92 A;  4OPZ A;  1STZ A;  3PAE A;  2PU4 A;  4K08 A;  4WMC A;  3IT9 A;  3V50 A;  3T4S A;  2FH5 A;  4WEK A;  5K5B A;  1E4D A;  3C7V A;  2EFX A;  2P08 A;  2OAQ 1;  2WZZ A;  1K6S A;  1CK3 A;  3NIA A;  3OPL A;  4DJ3 A;  2JE5 A;  2WGW B;  2OAP 1;  4M4X A;  4C6Y A;  2QYB A;  2WGV A;  4EW7 A;  4YFM A;  2VK3 A;  3RXX A;  4IBX A;  3BY8 A;  1PZO A;  1LL8 A;  3P09 A;  1IYQ A;  3VMA A;  3EGD C;  3OC2 A;  5CHJ A;  4PM8 A;  2J3W A;  5EOE A;  3B33 A;  3NJA A;  1SHV A;  4HP4 A;  3JVV A;  3ZG7 B;  3MXS A;  2W1R A;  2DMW A;  3IF6 C;  1IEM A;  1FQG A;  2VV6 A;  1K0K A;  3G6O A;  3IHA A;  3HLG A;  2FFY A;  4NXG A;  4LCM A;  4NKP A;  2XK1 A;  4MNR A;  4KG2 A;  1KDS A;  4IBR A;  4GN2 A;  2Y91 A;  4HJ3 A;  4Z9Q A;  1GA9 A;  3S7N A;  2XQZ A;  5J3W A;  3OOV A;  4OP5 A;  1PW8 A;  3SS5 A;  4WEJ A;  1S4S A;  1YKD A;  1XKZ A;  3VFF A;  3S7P A;  1K57 C;  3ZCZ A;  5FQ9 A;  1VET B;  1IKG A;  2H5S A;  5GHY A;  2V2F F;  1TF1 A;  4BD1 A;  3A3F A;  3UB8 A;  3T1R A;  2XF3 A;  3MF0 A;  4MEZ A;  4C3Q A;  4LFU A;  5J7E A;  2IWD A;  5JYP A;  4MCW A;  5DTK A;  4RX2 A;  3BM6 A;  1NYM A;  2O9B A;  3NCK A;  4GB7 A;  5AVF A;  2HGV A;  3A3I A;  4YIN A;  4GW9 A;  2WK0 A;  2V1A A;  3PBQ A;  5EEC A;  3WS1 A;  2XD5 A;  5C5K A;  4E3N A;  1BYW A;  2ZQC A;  3PYP A;  4ETX A;  3E4Q A;  3MJQ A;  4KQO A;  3FG8 A;  2P04 A;  2BLS A;  2V9A A;  3ZHH A;  1Y4O A;  4MMN A;  3IX4 A;  4DDS A;  2E8I A;  1LT0 A;  4JKT A;  2ZOI A;  2PD7 A;  4X6T A;  2ZLY A;  1OTE A;  1Q2Q A;  1K56 D;  2Z2M B;  5TBM B;  4S2P A;  1U60 A;  2BAS A;  3SW1 A;  3D9Y A;  3DWK A;  1RP5 A;  3FPW A;  4B88 A;  1K55 C;  3KSH A;  1FSY A;  1L0F A;  1SKO A;  3IWO A;  1MWT A;  4NET A;  5J4E A;  5DF9 A;  1CJF A;  2VZW A;  5DJT A;  2EXA A;  4OQ0 A;  2IWC A;  4GOG A;  2ACG A;  4JXG A;  4E3L A;  3B47 A;  2ZC4 B;  4WLA A;  1IKI A;  2Y79 A;  4BBV A;  3UDX A;  2O0Y A;  1KVL A;  4KZ5 A;  4OQG A;  2WGI A;  4LV2 A;  1T1B A;  3ZDJ A;  1E3U D;  1M40 A;  4LV1 A;  5E2E A;  4ZAM A;  3MR0 A;  1E25 A;  4RYE A;  4L9E A;  4E04 A;  2V1B A;  5GLC A;  3T4J A;  1Z09 A;  3C30 A;  1UWN X;  1EW0 A;  3T12 B;  1OT6 A;  5HDS A;  3UDF A;  4BBT A;  4I3I A;  3BLS A;  1T18 A;  4R3J A;  4R1G A;  5EV0 A;  4B4Z A;  2EX8 A;  2PR6 A;  4WZ4 A;  2EX9 A;  3EQU A;  1NLZ A;  2J3T C;  3BQA A;  4H8R A;  5HX9 A;  4L9F A;  2FFF B;  4S2J A;  4BL3 A;  1H5X A;  5FDS A;  3W4Q A;  1FIK A;  3ZG8 B;  4OVD A;  2P9V B;  4ARZ B;  1ACF A;  4UQI S;  1VEU B;  3LFV A;  4HEF A;  3CUE A;  4FH4 A;  1O07 A;  1H8M A;  4GZB A;  3VFH A;  2JHE A;  3FV7 A;  1DJB A;  3H82 B;  2NUT C;  2EX6 A;  2D01 A;  4UA7 A;  4ZRR A;  1MKM A;  4JXW A;  1MC0 A;  5HD5 A;  3TE8 A;  3D3O A;  4X68 A;  4KZ4 A;  1YMS A;  2KDK A;  4G3W A;  3LO7 A;  1IEL A;  1BUL A;  1ESU A;  3KYQ A;  4S2N C;  2ZMV A;  5EOO A;  3JYI A;  4S2M A;  3PR6 A;  3TJZ C;  4CLC B;  3F1N A;  2HP9 A;  2A3U A;  4JF6 A;  1ZKJ A;  1VHM A;  3FC7 A;  1PWD A;  3BRM A;  1WA9 A;  1YLT A;  4P6Z S;  3LY4 A;  4UHU A;  5HW3 A;  1S4R A;  1YLJ A;  3DTM A;  2Q0O A;  3T1Q B;  3LIE A;  1FCN A;  1TS6 A;  3LY3 A;  3GVB A;  3ZNY A;  1OJ5 A;  4S2N A;  3UPO A;  1BLS A;  4E3O A;  3VP0 A;  3MZF A;  1FOF A;  3LI8 A;  1PW1 A;  2Y2M A;  5EUA A;  3UE1 A;  2QWS A;  3NY4 A;  3UPP A;  5HSQ A;  3DWZ A;  5GLA A;  3BFF A;  3DBA A;  4B4X A;  2WKH A;  4GD6 A;  3GV9 A;  1IFQ A;  1N4O A;  2OLU A;  1TVF A;  3ISG A;  2JBF A;  5FDH A;  4GDN A;  5TJJ A;  5HPI A;  1XFQ A;  2Y55 A;  2R9W A;  3UB5 P;  1TS7 A;  4E3K A;  1I2W A;  3T4T A;  2LB9 A;  3SH8 A;  5DFY A;  2DCF A;  3VOL A;  2HJ9 C;  3LR5 A;  5FAO A;  3BQ8 A;  3RFB A;  2VA0 A;  3G34 A;  5FQQ A;  4KQD A;  4QB8 A;  4O0P A;  3IF6 B;  2M1C A;  1YMX A;  1Y28 A;  4IUK A;  5L10 A;  3F1P B;  4ETZ A;  4IED A;  1SDN A;  5FQM A;  4JXS A;  3LEZ A;  3LID A;  2J3T D;  3NOU C;  4FOF A;  1V9Y A;  1OTA A;  2XDM A;  2ZQ7 A;  1SKO B;  3MKF A;  1Y54 A;  4MBH A;  2JKT I;  3MFX A;  4KQR A;  4YOF A;  2Z6D A;  3C8C A;  3CLO A;  4EET B;  3BWL A;  1YLZ A;  5HAQ A;  2W3D A;  4OOM A;  4ZBE A;  1FCO A;  4Y3I A;  1MWU A;  2ZC5 B;  5F5Y A;  1P9W A;  1XJ6 A;  3VP4 A;  4X53 A;  2Y2I A;  1K55 A;  2Y2N A;  3DTE A;  4MBF A;  2XFT A;  2JKG A;  3QNC A;  3F1O B;  4L0L A;  4N1H A;  2JKT M;  5M19 A;  1ES2 A;  4II7 A;  3T4O A;  5IHV A;  1ALQ A;  4Q8I A;  1FR6 A;  3IHB A;  4HJ6 A;  1XP4 A;  1AXB A;  5I5L A;  1CI9 A;  2C5W B;  1V9Z A;  2OLV A;  3R4K A;  3UMD A;  4GKU A;  4Y2F A;  3T4Q A;  2X02 A;  5TFQ A;  1TEM A;  3KO6 A;  1GSX A;  1GA0 A;  4MLL A;  2X71 A;  3LI9 A;  1XFN A;  4NG2 A;  3BW6 A;  2J80 A;  4OLG A;  4HJ4 A;  4PM5 A;  1FIL A;  3DAV A;  1MXO A;  1NRJ A;  2ZQ8 A;  5GHX A;  4G3K A;  2B02 A;  4N1X A;  3UE0 A;  4KUO A;  4HBT A;  3A3E A;  4DJ2 A;  2GX5 A;  3M2K A;  1SDE A;  3B42 A;  1K56 A;  4DE3 A;  2CC1 A;  4CJN A;  3E4O A;  5HD3 A;  5EFW A;  1H8Z A;  1N9O A;  1TS8 A;  1EWZ A;  4BBU A;  3ZVW A;  4GS9 A;  4RA7 A;  1M6K A;  1WYB A;  3VE4 A;  4PM9 A;  3QP2 A;  4U3T A;  1L3L A;  2PT7 A;  2W3G A;  2ZMA A;  3IWI A;  2R9X A;  2W1T A;  2ZC6 B;  4UAA A;  3NDE A;  2V0U A;  5AQ9 A;  1K57 A;  3R7W A;  3MXR A;  2GJ3 A;  4A5R A;  1H0M A;  3A3J A;  4JPM A;  2J9O A;  1T1A A;  4WUJ A;  4KZ6 A;  4N9K A;  3VSL A;  1SZV A;  4GLQ A;  5F1F A;  3LUQ A;  3UE6 A;  3OPR A;  3O3V A;  3ULF A;  1S6R A;  1ZC2 A;  4DE1 A;  4XXR A;  2H28 A;  3D72 A;  4I5S A;  1O7E A;  5IU1 A;  3C2W A;  4E3I A;  4HNB A;  3UY6 A;  1DJA A;  1PWC A;  3MQQ A;  4EU0 A;  4B93 A;  1DP6 A;  4KG6 A;  1XGJ A;  4IVK A;  4D60 A;  1UWP X;  2Y2J A;  3HRE A;  1QME A;  3LIB A;  4F94 A;  5L2F A;  4M3K A;  2GDN A;  2ZD8 A;  3G2Z A;  2P7J A;  2ZOH A;  3PBO A;  5FQJ A;  1BLC A;  4C75 A;  3S7O A;  3HLD A;  4HY8 A;  1P9R A;  4F3L A;  2VKS A;  2EXB A;  1I2S A;  3I7J A;  4PAU A;  2W3F A;  4YWZ A;  4MDZ A;  2ZC3 B;  1VQQ A;  4Y5F A;  3P7N A;  3C4O A;  2B5R A;  3VE3 A;  1UGU A;  1YSQ A;  2V1Z A;  2R78 A;  2O9C A;  3A0S A;  2Y2P A;  5F69 A;  3GEC A;  2WAF A;  2KOI A;  4PM6 A;  3V39 A;  1W63 M;  4EER A;  5EVI D;  3MZD A;  2UV0 E;  5G18 A;  3CPT B;  4OQH A;  2INW A;  2QKP A;  2ZL1 A;  4QY6 A;  5LBR A;  3DTK A;  4XT2 A;  4KZ9 A;  2WAE A;  2PBD P;  2P9V A;  2JN7 A;  2W3H A;  4Y13 A;  1Q2P A;  3O5Y A;  4WZ5 A;  4Q0I A;  5CEC A;  2PBY A;  4BQM A;  1NWZ A;  3P98 A;  4HI4 A;  1RGY A;  1YQS A;  3C4P A;  2VX8 A;  1YT4 A;  4IHQ A;  4LGW A;  3QP8 A;  5HDD A;  4PKY G;  3SS4 A;  1YLW A;  3Q07 A;  1G5U A;  3NOP C;  1A0K A;  3HLF A;  3O88 A;  3NEC A;  2XEP A;  1N9B A;  3S1Y A;  1XGI A;  4B9O A;  4KQQ A;  2WKE A;  2Y2Q A;  3VV4 A;  3F1O A;  1F5M A;  1S0W A;  2M7U A;  3V3S A;  3L7H A;  3R7W B;  4Y0O A;  4K91 A;  5HFO A;  3IQA A;  2OSU A;  1XJ3 A;  2ZM8 A;  3ITB A;  1IYO A;  4I3J A;  2D02 A;  2PR5 A;  3MBZ A;  4P6Z M;  2V8F A;  2HDR A;  4U0X A;  2Y59 A;  5L09 A;  2ZQ9 A;  2XSS A;  5CHU A;  3MQ0 A;  4CLC D;  3EEA A;  1HD8 A;  1MKI A;  1YPR A;  2HV1 A;  2W0N A;  5A93 A;  2HF6 A;  1F2K A;  5HAP A;  3LR0 A;  2EX2 A;  4QPR A;  3WS5 A;  4Y7P A;  4I38 A;  3EWK A;  4ZJ1 A;  3AGD A;  2XGN A;  2DRW A;  5F1G A;  3BEB A;  3QP5 A;  3HUO A;  4EBP A;  3K2N A;  1XPB A;  4GCZ A;  1ES5 A;  5AQA A;  1JWZ A;  2O9A A;  1RCJ A;  2B95 A;  3UO9 A;  1WE4 A;  1BLH A;  2VGK A;  1NJ4 A;  5MC7 A;  3Q81 A;  3WWX A;  2GZA A;  2L0W A;  2QMI A;  4OKP A;  2PYR A;  1HLU P;  5HL6 A;  4E6X A;  1TS0 A;  1ZG4 A;  1OTI A;  3CHW P;  3A0V A;  2WKI A;  2WKQ A;  1KOU A;  4N92 A;  4Q0J A;  4HP9 A;  2ZQD A;  1NZO A;  5CGW A;  2RCX A;  4CLC A;  2WKP A;  4LPZ A;  1OT9 A;  1KGE A;  5KZH A;  2XA7 S;  3UPN A;  4JF4 A;  3IX3 A;  3F1P A;  2WUQ A;  4BL2 A;  5AJG A;  1S67 L;  4XT2 B;  4HOI A;  4WEL A;  2HZ5 A;  1XA7 A;  3TG9 A;  4DRT A;  4WZ5 C;  4R3A A;  1DJC A;  3OPP A;  1D7E A;  1W63 Q;  3Q7V B;  2XH9 A;  1XX2 A;  4HIA A;  1OME A;  3CMZ A;  4LRX C;  4E6W A;  1S1Y A;  2VV8 A;  3KX0 X;  2GNX A;  2ZC7 A;  3MQO A;  1LHY A;  3IH9 A;  3IH8 A;  4LCL A;  3PHY A;  3VP3 A;  3ZFZ A;  1MBL A;  4EUV A;  4F3L B;  4HQA A;  5DKL A;  3ZG9 B;  5HZH A;  5JYO A;  2IWB A;  4RVA A;  5FEG A;  5CTM A;  1PFL A;  1YM1 A;  2H0T A;  2Q9N A;  3EOI A;  1TDG A;  3T4L A;  2PRF A;  3C5A A;  3U4L P;  3VP1 A;  3HBR A;  3F1N B;  1C3B A;  4EBN A;  4KG5 A;  4LEN A;  3GMW A;  5EM0 A;  5F82 A;  2KX6 A;  1CQA A;  3E2K A;  1G68 A;  2RL3 A;  1NZU A;  3ZQ5 A;  2PYP A;  2L4R A;  3SH7 A;  2Y2H A;  4ID4 A;  4ARZ A;  4GS9 B;  4KEN B;  3T4K A;  1JTG A;  3G2Y A;  3RJU A;  4DDY A;  1XXM A;  3ZGA B;  1JWV A;  2JCH A;  1TD5 A;  4GD8 A;  5U47 A;  3FYZ A;  4OPY A;  1BUE A;  4QU3 A;  4EES A;  5EVI B;  4H6J B;  4EEP A;  1NRF A;  3N8R A;  5KSH A;  3Q7V A;  2H10 A;  1ZHH B;  3GSG A;  4Q0H A;  2Y2K A;  3N4I A;  4IJG A;  5CXW A;  1HZO A;  4P6B A;  1CEG A;  4K0X A;  5CGS A;  1FCM A;  2QPN A;  1N9L A;  1LLB A;  4R0Q A;  4EEU A;  2VLG A;  3G35 A;  4QY5 A;  4GHI B;  3WRT A;  2I9V A;  2HP6 A;  5TR7 A;  3IWQ A;  3HVF A;  4BLM A;  3QNB A;  1KE4 A;  1T19 A;  4NK3 A;  3IXG A;  3BFE A;  1PNE A;  4HH3 A;  5HWV A;  4FSF A;  2K2N A;  5D3O A;  5KMW A;  1G6O A;  4R38 A;  4PMA A;  1S66 L;  3OZH A;  1N9N A;  3A3D A;  2HJE A;  2Z2L B;  3HL9 A;  5HL1 A;  1OTD A;  4ZDX A;  2A49 A;  3GTC A;  4O8G A;  5GLD A;  1BT5 A;  5CRF A;  4G3V A;  1VEU A;  3Q7Z A;  1F98 A;  2OWH A;  3TRC A;  2X01 A;  5IT5 A;  3KSI A;  3LGO A;  3ZVT A;  3FPV A;  1KGF A;  4KZ3 A;  1K54 A;  4I3A A;  1GHI A;  2O99 A;  1K4F A;  4JGR A;  4EUZ A;  5F68 A;  3PTE A;  1ERM A;  3GDI A;  4Y0U A;  3OCL A;  4LV3 A;  1TDL A;  4KZ7 A;  1KE0 A;  1KGG A;  3E98 A;  4CLC C;  1OTB A;  1HTZ A;  3Q1F A;  4R4S A;  3SH9 A;  2CMN A;  5FAQ A;  1DRM A;  4P0M A;  4O01 A;  1W8Q A;  4MN5 A;  1L0G A;  1K25 A;  3IBR A;  1IYP A;  1H3Q A;  3FWL A;  3GR2 A;  1VB6 A;  3TW8 A;  4QJG A;  1FR1 A;  2DNS A;  1G28 A;  1ZG6 A;  4DMZ A;  3QP4 A;  3S4X A;  3ITA A;  1LSW A;  2WZX A;  3ZNT A;  2W3E A;  3L9K A;  3RTY A;  2WKR A;  2XLN A;  4S2I A;  3LIC A;  4DF6 A;  2BTF P;  3W4P A;  4OP8 A;  3V67 A;  4DXB A;  3OCN A;  1YSP A;  4R23 A;  3UDI A;  5A8B A;  2JKR I;  3LR4 A;  4JLF A;  2XA7 M;  3N7W A;  4FCF A;  1NLY A;  2PDR A;  3VOY A;  1OPX A;  4LRZ E;  3UE3 A;  4BD0 A;  4CLC E;  1EI5 A;  4ESP A;  1XJ2 A;  2NUP C;  3T1S A;  4N9L A;  3BLM A;  2A24 B;  2ZMF A;  3BFD A;  3CG5 A;  3FKV A;  2XD1 A;  5EPH A;  1J3W A;  3BEC A;  1CF0 A;  4O7D A; 
#chains in the Genus database with same CATH homology
 1ESI A;  1NXY A;  2XEP A;  1FSW A;  3O87 A;  1N9B A;  5E43 A;  3S1Y A;  2QZ6 A;  5GL9 A;  5I94 A;  1XGI A;  4KQQ A;  2WKE A;  2Y2Q A;  3EQV A;  3VP2 A;  2HP9 A;  2EFU A;  1S0W A;  2A3U A;  3O86 A;  5DF8 A;  3V3S A;  4JF6 A;  3WRZ A;  4Y0O A;  4RX3 A;  1ZKJ A;  1SCW A;  4K91 A;  5FQI A;  4UA6 A;  5HFO A;  2G2U A;  3IQA A;  4S2L A;  2OSU A;  1PWD A;  1MPL A;  3BRM A;  1YLT A;  3PBT A;  5E2G A;  2ZM8 A;  4OON A;  3ITB A;  3LY4 A;  1IYO A;  5DTT A;  4UHU A;  5HW3 A;  3E2L A;  2Y2O A;  4KZA A;  1YLJ A;  3DTM A;  3HLW A;  1MWR A;  3G4P A;  4PM7 A;  1FCN A;  3MBZ A;  3UNW A;  1YLP A;  3VOZ A;  2HDR A;  1MWS A;  3LY3 A;  1Z6F A;  2Y59 A;  4U0X A;  5FI7 A;  3GVB A;  2ZQ9 A;  3ZNY A;  4S2N A;  5CHU A;  3UPO A;  1BLS A;  4E3O A;  2XR0 A;  1G6A A;  3NI9 A;  4EQI A;  4JBF A;  3VP0 A;  3MZF A;  5HAI A;  1HD8 A;  1MKI A;  1FOF A;  4DE2 A;  4KZ8 A;  5A93 A;  3GRJ A;  3G32 A;  1HVB A;  1KE3 A;  4KZB A;  5HAP A;  3VSK A;  2J9P A;  2J8Y A;  5CTN A;  5CER A;  2EX2 A;  2G2W A;  1PW1 A;  4CPK A;  2Y2M A;  3HUM A;  4Y7P A;  5EUA A;  3SOI A;  3WS5 A;  3UE1 A;  2WAD A;  3W4O A;  1MY8 A;  3NY4 A;  5AQ7 A;  4ZJ1 A;  4Y0T A;  3AGD A;  1W5D A;  2XGN A;  3RXW A;  2DRW A;  1GHM A;  3BEB A;  5F1G A;  3NDG A;  2I72 A;  3DWZ A;  5M1A A;  5E2F A;  5AQB A;  3UPP A;  5GLA A;  3BFF A;  3SS3 A;  1K6R A;  3G31 A;  3WS2 A;  4JXV A;  3HUO A;  3M6H A;  2WKH A;  4B4X A;  4GD6 A;  3GV9 A;  5EE8 A;  4EBP A;  1N4O A;  1XPB A;  4ZJ3 A;  2OLU A;  1TVF A;  1ES5 A;  2Q9M A;  5AQA A;  3WS4 A;  3G30 A;  3ISG A;  2JBF A;  1ONG A;  5FDH A;  4FD8 A;  5F83 A;  1JWZ A;  4GDN A;  2Y55 A;  3GQZ A;  1RCJ A;  4OPQ A;  4OPR A;  2PU2 A;  4OOL A;  3UO9 A;  2R9W A;  1H8Y A;  3UN7 A;  1WE4 A;  4E3K A;  3PBR A;  2VGK A;  1BLH A;  1NJ4 A;  1PZP A;  3Q81 A;  4DE0 A;  2HDU A;  1I2W A;  1WYC A;  3WWX A;  1E3U A;  3BYD A;  3AGE A;  4PPR A;  2QMI A;  3FKW A;  1ES3 A;  1PIO A;  3SH8 A;  3FZC A;  2BG1 A;  4OKP A;  3NC8 A;  1BZA A;  2DCF A;  3LCE A;  1GCE A;  4E6X A;  4EWF A;  5FAO A;  2H0Y A;  2P74 A;  2Y2G A;  1ZG4 A;  3OPH A;  3WS0 A;  3MZE A;  3TSG A;  5FAS A;  1L0E A;  3D4F A;  2WKI A;  1NYY A;  3G34 A;  5FQQ A;  5A92 A;  4QB8 A;  4OPZ A;  3PAE A;  4N92 A;  3IF6 B;  2ZQD A;  1YMX A;  1NZO A;  5CGW A;  2PU4 A;  4WMC A;  1JTD A;  2WGW A;  2RCX A;  3IT9 A;  4IED A;  3V50 A;  1SDN A;  2HPB A;  4WEK A;  3N8L A;  4JXS A;  5FQM A;  1E4D A;  4R4R A;  1KGE A;  4QD4 A;  3LEZ A;  4GDB A;  4WYY A;  5A90 A;  5KZH A;  3C7V A;  2EFX A;  3UPN A;  1BSG A;  2ZQA A;  4IVI A;  2WZZ A;  5FA7 A;  1K6S A;  1CK3 A;  3NIA A;  3OPL A;  4JF4 A;  1ONH A;  2JE5 A;  2WGW B;  4E3M A;  4OQI A;  4UA9 A;  2ZQ7 A;  2XDM A;  4C6Y A;  2WUQ A;  3HLB A;  2WGV A;  3MKF A;  1Y54 A;  4YFM A;  4MBH A;  4BL2 A;  3RXX A;  4WEL A;  4S2K A;  4X56 A;  5E2H A;  1XA7 A;  3V5M A;  3TG9 A;  4DRT A;  4IBX A;  1PZO A;  4KQR A;  3P09 A;  1IYQ A;  4WZ5 C;  3VMA A;  4EBL A;  4ZJ2 A;  2JC7 A;  1DJC A;  3OC2 A;  3OPP A;  5HAQ A;  1YLZ A;  5CHJ A;  4XUX A;  4OOM A;  4PM8 A;  4ZBE A;  1FCO A;  5EOE A;  1MWU A;  2ZC5 B;  1SHV A;  3Q7V B;  3VP4 A;  4X53 A;  3ZG7 B;  2XH9 A;  1XX2 A;  3MXS A;  2Y2I A;  4P85 A;  1K55 A;  1OME A;  1W79 A;  2Y2N A;  3IF6 C;  3CMZ A;  2Y4A A;  1IEM A;  3Q82 A;  4MBF A;  2Y2L A;  1FQG A;  2XFT A;  4E6W A;  3QNC A;  4ZTK A;  3W8K A;  4L0L A;  4N1H A;  5M19 A;  1ES2 A;  2ZC7 A;  3IHA A;  1LHY A;  3HLG A;  2UWX A;  2FFY A;  1ALQ A;  3IH9 A;  4LCM A;  3PBS A;  5IHV A;  1FR6 A;  4MBK A;  3IH8 A;  4LCL A;  1ES4 A;  1BTL A;  3PBN A;  3IHB A;  5FI2 A;  2XK1 A;  4MNR A;  1XP4 A;  3VP3 A;  3ZFZ A;  1MBL A;  1PI4 A;  1AXB A;  4KG2 A;  4WM9 A;  1JVJ A;  1KDS A;  4IBR A;  5JYO A;  1CI9 A;  2C5W B;  3ZG9 B;  5M18 A;  2IWB A;  4GN2 A;  1CEF A;  4RVA A;  2OLV A;  5CTM A;  4GKU A;  1DY6 A;  4K0W A;  1YM1 A;  2H0T A;  2Q9N A;  2X02 A;  5TFQ A;  1ERQ A;  1TEM A;  1TDG A;  2Y91 A;  2HDQ A;  4DE3 A;  3C5A A;  3VP1 A;  3PAG A;  3HBR A;  1GA9 A;  4Z9Q A;  5FI6 A;  3TOI A;  2XQZ A;  1C3B A;  4EBN A;  1GA0 A;  1W7F A;  4MLL A;  5J8X A;  2X71 A;  4OP5 A;  1PW8 A;  3SS5 A;  4WEJ A;  4KG5 A;  4LEN A;  1XKZ A;  1PI5 A;  4OLG A;  3VFF A;  4PM5 A;  1MXO A;  1QMF A;  4X55 A;  1K57 C;  2ZQ8 A;  3GMW A;  5GHX A;  3ZCZ A;  5F82 A;  5FQ9 A;  1LI0 A;  4N1X A;  1IKG A;  3UE0 A;  2H5S A;  5GHY A;  2V2F F;  3N6I A;  5KSC A;  3E2K A;  5CED A;  1G68 A;  2RL3 A;  4BD1 A;  1NZU A;  3A3F A;  4HBT A;  1NY0 A;  3A3E A;  5DVA A;  2XF3 A;  4MEZ A;  4C3Q A;  3SH7 A;  2Y2H A;  3M2K A;  1SDE A;  4ID4 A;  4KEN B;  1K56 A;  1K4E A;  2V20 A;  5DF7 A;  1JTG A;  3G2Y A;  4QHC A;  2CC1 A;  2J7V A;  3RJU A;  2HDS A;  2IWD A;  3HLC A;  3ZG0 A;  4CJN A;  1XXM A;  4DDY A;  5JYP A;  4S2O A;  3ZGA B;  1JWV A;  2JCH A;  4GD8 A;  5U47 A;  1L0D A;  1H8Z A;  3FYZ A;  1EWZ A;  4OH0 A;  3AGF A;  4OPY A;  1BUE A;  5DTK A;  3ZVW A;  4RX2 A;  4QU3 A;  3BM6 A;  3BFC A;  1NYM A;  3NCK A;  4RA7 A;  5EVI B;  1M6K A;  4GB7 A;  3S22 A;  1WYB A;  4PM9 A;  4U3T A;  1XA1 A;  1NRF A;  3A3I A;  3M6B A;  2ZMA A;  1RGZ A;  4R3B A;  4YIN A;  3N8R A;  4U0T A;  5EVL A;  3IWI A;  3Q7V A;  5KSH A;  2WK0 A;  2H10 A;  2R9X A;  2ZC6 B;  5A91 A;  4D2O A;  3PBQ A;  3GSG A;  3NDE A;  4UAA A;  5AQ9 A;  3MFD A;  2Y2K A;  1K57 A;  5EEC A;  3MXR A;  3N4I A;  5CXW A;  1HZO A;  4DXC A;  3WS1 A;  4Q8I A;  4P6B A;  2XD5 A;  1SKF A;  1CEG A;  4K0X A;  5CGS A;  4A5R A;  3A3J A;  1FCM A;  2QPN A;  4JPM A;  2J9O A;  1LLB A;  5CHM A;  4E3N A;  4R0Q A;  2ZQC A;  1LL5 A;  1PWG A;  3CJM A;  4KZ6 A;  4OLD A;  1GHP A;  3G35 A;  4N9K A;  4QY5 A;  3WRT A;  2VGJ A;  2HP6 A;  4KQO A;  1I5Q A;  5TR7 A;  3VSL A;  3IWQ A;  3HVF A;  4BLM A;  2BLS A;  1KE4 A;  3QNB A;  4NK3 A;  3CZD A;  5F1F A;  3ZHH A;  5BOH A;  3IXG A;  4DDS A;  3BFE A;  1CI8 A;  2E8I A;  2ZM2 A;  3OPR A;  3O3V A;  4GNU A;  4JKT A;  1S6R A;  4FSF A;  1ERO A;  2ZLY A;  4X6T A;  5D3O A;  1ZC2 A;  5KMW A;  4DE1 A;  4XXR A;  1Q2Q A;  1O7E A;  1K56 D;  2Z2M B;  4PMA A;  4E3I A;  3OZH A;  3A3D A;  4S2P A;  2Z2L B;  4FH2 A;  1U60 A;  3HL9 A;  5HL1 A;  3UY6 A;  1DJA A;  1PWC A;  1RP5 A;  3DWK A;  4ZDX A;  2A49 A;  1K55 C;  3GTC A;  3IF6 A;  5GLD A;  4B88 A;  2XFS A;  5CGX A;  4KG6 A;  1FSY A;  1L0F A;  1BT5 A;  3IWO A;  1MWT A;  1XGJ A;  4IVK A;  4NET A;  5CRF A;  5DF9 A;  4WMC D;  2EXA A;  4OQ0 A;  2IWC A;  4GOG A;  3Q7Z A;  2Y2J A;  4JXG A;  3HRE A;  1QME A;  2ZC4 B;  3N8S A;  4BJP A;  4E3L A;  1IKI A;  4M3K A;  4F94 A;  2GDN A;  5L2F A;  4XUZ A;  3HUN A;  1K38 A;  3UDX A;  2X01 A;  1KVL A;  3IXB A;  4KZ5 A;  3ZG5 A;  1LI9 A;  2ZD8 A;  3G2Z A;  4OQG A;  2WGI A;  1J9M A;  3ZVT A;  1KGF A;  3PBO A;  4KZ3 A;  4P87 A;  1L2S A;  4LV2 A;  5DTS A;  5FQJ A;  1BLC A;  1E3U D;  1K54 A;  1KDW A;  3ZDJ A;  4C75 A;  1M40 A;  4LV1 A;  5E2E A;  1GHI A;  1JWP A;  4ZAM A;  1E25 A;  1K4F A;  4RYE A;  5GLC A;  3HLD A;  4EUZ A;  4LV0 A;  3PTE A;  4OOY A;  1ERM A;  2EXB A;  1I2S A;  3I7J A;  4Y0U A;  3OCL A;  5FAT A;  3UDF A;  4LV3 A;  4EV4 A;  5HAR A;  1TDL A;  2ZC3 B;  1KE0 A;  1KGG A;  1VQQ A;  4KZ7 A;  5EVI C;  5CEB A;  1W8Y A;  3C4O A;  1K54 C;  1KVM A;  3BLS A;  2B5R A;  1HTZ A;  4R3J A;  3Q1F A;  4R1G A;  4R4S A;  3SH9 A;  1VM1 A;  4B4Z A;  2EX8 A;  5FAQ A;  2C6W B;  4P0M A;  2V1Z A;  1PYY A;  1YLY A;  3IF5 A;  4DKI A;  1W8Q A;  1L0G A;  4WZ4 A;  2Y2P A;  1K25 A;  3IXD A;  2EX9 A;  4WBG A;  4X69 A;  1IYP A;  3EQU A;  2WAF A;  5FAP A;  3FWL A;  3GR2 A;  5TGF A;  4H8R A;  4PM6 A;  4QJG A;  1LL9 A;  3V39 A;  1FR1 A;  4HBU A;  5HX9 A;  5EVI D;  2DNS A;  3MZD A;  4JF5 A;  5GLB A;  2FFF B;  4S2J A;  5G18 A;  4BL3 A;  3NBL A;  1H5X A;  1ZG6 A;  2HP5 A;  3S4X A;  3ITA A;  4OQH A;  3W4Q A;  3V3R A;  3M2J A;  2OV5 A;  3ZG8 B;  2WZX A;  4OVD A;  3ZNT A;  2P9V B;  4HEF A;  4FH4 A;  2XLN A;  1O07 A;  3DW0 A;  4QY6 A;  4S2I A;  4BEN A;  4GZB A;  4DF6 A;  3VFH A;  3W4P A;  4OP8 A;  4KZ9 A;  2WAE A;  4DXB A;  3OCN A;  3IXH A;  4R23 A;  2P9V A;  3UDI A;  1Q2P A;  1DJB A;  3FV7 A;  3MKE A;  3QHY A;  4JLF A;  2EX6 A;  3N7W A;  4FCF A;  4UA7 A;  4WZ5 A;  2PBY A;  3VOY A;  4BQM A;  5CEC A;  3P98 A;  1RGY A;  1YQS A;  3UE3 A;  2ZJ9 A;  3C4P A;  4JXW A;  3B3X A;  5FSR A;  4BD0 A;  4X68 A;  1BLP A;  4KZ4 A;  1YMS A;  1YT4 A;  5GHZ A;  1EI5 A;  5EVI A;  3BFG A;  5FQK A;  3LO7 A;  4N9L A;  2ZM0 A;  3BLM A;  1IEL A;  1BUL A;  1IYS A;  3SS4 A;  1YLW A;  3BFD A;  4HES A;  3CG5 A;  3FKV A;  1ESU A;  3Q07 A;  2XD1 A;  5EPH A;  4S2N C;  2WYX A;  3HLE A;  3HLF A;  3BEC A;  3O88 A;  5EOO A;  4O7D A;  3JYI A;  4S2M A;  3C7U A;  4E3J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...