3WS0A

N288q-n321q mutant beta-lactamase derived from chromohalobacter sp.560 (condition-1a)
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
357
structure length
357
Chain Sequence
QTREVLDPIVASLMEAQQIPGMAIALVRPEGTTISHYGAADRETGTPVDDDTLFEIGSLSKTLTATLASLAEVEGKLDFDAPVSRYLPELEGSAFDDISGLNLGTHTGGGLPLFVPDEVTDRASLMAWYREWQPTEPIGESRTYSNLGIGLLGLETAASLDGEFVPTMRAKVLAPLGMQDTWYDVPEARMADYAMGEDKDGQPTRVSPGVLDDEAYGIKTTAADLAKLVRANLHLADVDAELQQAIDATRQGHYRVGDMTQALIWEQYSLPVAPETLRAGQGYDMILEPNAAEALEPPQSPRDDVWVNKTGSTQGFGGYIVMLPGKHTGLVMLANKNYPNDARVEAAYRILSGLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a highly acidic beta-lactamase from the moderate halophile Chromohalobacter sp. 560 and the discovery of a Cs(+)-selective binding site
pubmed doi rcsb
source organism Chromohalobacter sp. 560
molecule tags Hydrolase
molecule keywords Beta-lactamase
total genus 120
structure length 357
sequence length 357
chains with identical sequence B, C
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2014-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3ws0A00
4WBGA 4JXVA 1YLZA 4E3OA 4R0QA 4RX3A 2XFTA 3M6BA 3C7UA 3SS3A 5CEDA 5HL1A 1JWVA 1PIOA 1QMFA 1YM1A 4M3KA 1IEMA 3OPLA 4FH4A 4CPKA 2XGNA 1K25A 1NY0A 3GTCA 2WKEA 5EVIC 3GR2A 3EQUA 1K55C 1O7EA 4MLLA 2ZC7A 1BUEA 3HUOA 3OPHA 4MBHA 4Z9QA 4X56A 2ZJ9A 4WMCD 3BFGA 3UE3A 3E2KA 2EXBA 4U0XA 1L0DA 1U60A 1DJCA 1LL9A 2WKIA 5FSRA 4KG2A 5EVIB 2IWCA 1ES3A 3DWZA 3FWLA 1HZOA 4R23A 5CRFA 1PZOA 2Y2GA 3PBRA 5DTSA 5GLCA 4DRTA 4WZ5C 4ZJ1A 5CHUA 1RP5A 1W8YA 5E2GA 1NZUA 3HLCA 1LHYA 5GLAA 3WS1A 2IWBA 1XA1A 5FQIA 2JC7A 4DF6A 3UN7A 3ZNYA 1CI8A 1K55A 1XP4A 4GD8A 4KZ4A 5AQ9A 1M40A 2V20A 3ZG7B 1MY8A 1K54A 3GSGA 4C6YA 4S2NC 3DWKA 1XX2A 4BLMA 4JKTA 3FKWA 5KSCA 4S2OA 4MNRA 3FV7A 4UA9A 4ZJ3A 3ZHHA 3RXWA 2X01A 1K56A 5A93A 3PBOA 3O3VA 4GB7A 4PM9A 4PM7A 1EI5A 1Z6FA 5FQMA 5GL9A 4JLFA 1K4EA 2C6WB 2G2UA 1ZC2A 2Q9NA 3BFEA 1CK3A 4QY6A 4PM5A 4E3LA 4BJPA 5TR7A 4DE2A 2EX2A 3CZDA 1NXYA 2Y2PA 2Y2QA 4RA7A 1ES4A 4E3KA 4N1XA 4KZ3A 5CHMA 1L0GA 3FKVA 4WELA 3N7WA 4XXRA 1W8QA 1K6SA 1XGIA 3NY4A 4L0LA 3TG9A 5L2FA 2R9WA 4DE0A 1L2SA 3SOIA 2Y2OA 3Q07A 1YLPA 3Q7VA 4R4RA 4GNUA 1JTDA 4EBPA 1FCNA 1EROA 2QPNA 3GVBA 1MBLA 1RCJA 3IF5A 5CTMA 5GHXA 1I2WA 2E8IA 4GOGA 3UPOA 3IT9A 4KZ8A 2J9OA 5DF7A 4S2MA 1JWZA 1IYPA 2Y59A 1I5QA 3WWXA 3O86A 3IXDA 4S2KA 1XA7A 2BLSA 4LV0A 4KZAA 4YFMA 2HDQA 4PM6A 5I94A 3IQAA 1YLJA 4E6XA 2B5RA 5KMWA 4LV1A 4JBFA 5EVLA 3VSKA 1KVMA 1W79A 1E4DA 2HDRA 3VP2A 3SH8A 1MWSA 2V1ZA 2WADA 3PBSA 4OOLA 5FQKA 3UO9A 2HDUA 4WEJA 2Y2HA 2P74A 2BG1A 1YLTA 5M18A 1GHPA 4OP8A 4OQGA 1NYMA 5FQ9A 1CI9A 5JYOA 3OC2A 5AQBA 5JYPA 1E25A 5FAOA 3BFFA 2XH9A 3SH7A 4GKUA 1PI5A 4CJNA 3IXHA 1GHMA 4XUXA 1SHVA 3SS5A 4ZBEA 2ZC5B 3ZG0A 2EFXA 2WGVA 4BL3A 3HREA 4MEZA 3IHBA 4FSFA 3DTMA 4K0XA 4B88A 4OQ0A 2H5SA 1WYBA 4DE3A 5IHVA 2WKHA 1G68A 3M2KA 4OH0A 3IWQA 3G31A 4PM8A 4P6BA 2ZM2A 4OLDA 3OCLA 1C3BA 3N8RA 5CECA 5M1AA 1TDLA 1K4FA 4PPRA 1K56D 3NC8A 1ESUA 3IWOA 4BENA 4GDNA 4EBLA 5GLBA 3NIAA 4X68A 1KGGA 2R9XA 4N1HA 4NK3A 2Y2JA 3UPNA 4WMCA 5E2EA 2JBFA 5D3OA 4DDYA 5CERA 3ZG8B 3VP0A 4IBRA 4OQHA 1K57A 2IWDA 1ERQA 3A3DA 3ZFZA 1FCMA 2ZM8A 1NJ4A 2HPBA 2XD1A 1H8ZA 4OQIA 5A91A 3V5MA 1YLYA 4E3IA 3IF6A 5CHJA 1XGJA 2ZQ9A 3G2ZA 4S2PA 4B4ZA 1IELA 4FCFA 2ZQCA 3HLDA 4UA6A 1K54C 1PI4A 4U3TA 3OPRA 5E43A 2PBYA 5EUAA 5HFOA 1K57C 1LI0A 1W7FA 4QHCA 4EBNA 5F82A 2Y2KA 3UDIA 2ZQ7A 2ZC4B 4EQIA 4LV3A 4P87A 3CJMA 3GQZA 3UE1A 1FSWA 1O07A 3BFCA 3IH8A 4ZDXA 5EPHA 1VM1A 2Y2NA 3MXSA 4ID4A 5GHZA 3BLSA 4WZ5A 4GZBA 4RYEA 4ZTKA 2P9VA 1DY6A 2OV5A 1N4OA 4OPRA 3M6HA 3UDXA 2JCHA 5BOHA 4QY5A 4KZ9A 3TSGA 3UDFA 1JVJA 1JWPA 4S2LA 3WRZA 3B3XA 5KSHA 1MWTA 3ITBA 5CTNA 3BM6A 2Z2LB 3G34A 4KQQA 1LL5A 4OPQA 4R3BA 5GLDA 1ERMA 4OVDA 4DXCA 2EFUA 4KZBA 1BT5A 2RCXA 1WYCA 3GRJA 2EXAA 3WRTA 3VFHA 3BRMA 3HLBA 1XPBA 1TEMA 2I72A 2WYXA 5HAIA 2XFSA 4KENB 4HEFA 2OSUA 5G18A 5TGFA 2WAEA 3OZHA 5F83A 2WGIA 5A90A 1ZG6A 3IF6B 3O88A 4K91A 1N9BA 1TDGA 3IXBA 2WK0A 1RGZA 3IXGA 1GA9A 1K6RA 1TVFA 3PBTA 3PAEA 3AGDA 5FI2A 3ZVTA 2G2WA 3V39A 5EE8A 1FR6A 2ZQDA 1QMEA 3IF6C 3W4PA 4A5RA 1MKIA 2Y2LA 4EUZA 3MZDA 4DKIA 3VP4A 1YLWA 1PW8A 1PWDA 1W5DA 3SS4A 3D4FA 3MZFA 2GDNA 4R4SA 4LCLA 5KZHA 5DTKA 2DRWA 4WEKA 3W4QA 4WZ4A 1E3UD 5DF9A 1PWCA 1Q2QA 2Y91A 1MXOA 5HAPA 4GN2A 1PZPA 1YMXA 2DNSA 2QZ6A 3ISGA 3P98A 1ZKJA 3P09A 5AQAA 1MWRA 1VQQA 3G32A 4Y7PA 2RL3A 4K0WA 1BLCA 3GMWA 1ESIA 4F94A 4RX2A 3BECA 3BFDA 3C7VA 1K38A 4OLGA 4FD8A 5M19A 3Q1FA 4R1GA 1IYSA 1GA0A 1WE4A 4OPZA 4X6TA 5F1GA 1HD8A 5FATA 3PBNA 1J9MA 1S0WA 4IVIA 1NRFA 4QD4A 4S2JA 2CC1A 4E6WA 3HVFA 3ZG5A 3ZDJA 4JXGA 2XEPA 3A3IA 1YT4A 4H8RA 3VP1A 2XLNA 2H0TA 2ZMAA 3MBZA 4QB8A 1BSGA 2ZC6B 3ZVWA 5EOEA 5EECA 2WUQA 4E3JA 1FR1A 1NZOA 1IKIA 2ZQAA 3A3FA 5HARA 3HLEA 3VMAA 1PYYA 4OPYA 1G6AA 1Q2PA 4OOYA 1PWGA 1XKZA 3FYZA 2ZQ8A 3MKEA 3UNWA 1ONHA 3PAGA 1DJBA 1BZAA 4JXSA 3BYDA 2Q9MA 4IBXA 5AQ7A 3C4PA 1IKGA 2WAFA 4Y0UA 3LY4A 4YINA 1SCWA 1SDEA 2OLUA 1GCEA 4KQOA 4IVKA 1KVLA 1NYYA 2PU2A 2WZXA 3LY3A 4N9KA 2Y2IA 3OCNA 4GD6A 4NETA 2C5WB 2P9VB 4LCMA 5CGWA 3HLFA 3ITAA 5EOOA 1KDSA 3Q7ZA 5EVIA 3VSLA 4Y0TA 3PTEA 2X71A 3TOIA 2FFYA 4P85A 3WS0A 3UPPA 2FFFB 3NI9A 1H8YA 3W8KA 4UHUA 4PMAA 3A3EA 5HAQA 3SH9A 4HBUA 3WS2A 3ZG9B 2A49A 1FCOA 3C4OA 3IWIA 3GV9A 5FQQA 1ES5A 3NDEA 2HDSA 3Q81A 1YQSA 1BLPA 1L0FA 3Q7VB 3WS4A 4Q8IA 3PBQA 5EVID 4XUZA 1BLHA 4X69A 4N92A 4WM9A 4LENA 3HL9A 5DF8A 3UE0A 3Q82A 1IYQA 1HTZA 1BTLA 3N8LA 1YMSA 4KQRA 1SDNA 1KE3A 1MWUA 1ONGA 4MBFA 4GDBA 2PU4A 4S2NA 3VOZA 4D2OA 2OLVA 3V3RA 5CGXA 3A3JA 5U47A 3LCEA 4Y0OA 1IYOA 1MPLA 1SKFA 3WS5A 4BQMA 1H5XA 2J7VA 1KE0A 3G2YA 3C5AA 3ZCZA 4C75A 5F1FA 1AXBA 3HLWA 3LO7A 4JPMA 3RJUA 3HUMA 4MBKA 5HX9A 2X02A 5FAPA 2JE5A 3VOYA 3MKFA 4JF4A 5FA7A 3IH9A 5A92A 5GHYA 1RGYA 4N9LA 1DJAA 3E2LA 4OONA 2V2FF 3G4PA 3I7JA 2ZLYA 1KE4A 2XR0A 3JYIA 5CGSA 4DDSA 4BD1A 4KZ6A 3NCKA 3MFDA 4E3NA 1LI9A 2QMIA 2XQZA 1E3UA 5DVAA 5J8XA 5FQJA 1LLBA 4LV2A 1FSYA 2XF3A 1XXMA 1EWZA 4BL2A 3V50A 4HBTA 1I2SA 4OKPA 1CEGA 1KGFA 2Z2MB 1ALQA 3UY6A 1FOFA 5CEBA 2VGKA 1M6KA 2WZZA 2XDMA 3AGEA 3W4OA 4JXWA 3QNBA 2WGWB 3VP3A 4DXBA 2XD5A 2ZD8A 3N8SA 3MXRA 3AGFA 1ZG4A 3CMZA 1GHIA 3NBLA 3V3SA 2J9PA 3RXXA 3FZCA 3ZNTA 4JF6A 3IHAA 3MZEA 4X55A 4KG5A 2H10A 2VGJA 3N6IA 5FI6A 1KDWA 2DCFA 3BLMA 1BULA 2HP5A 4JF5A 4UAAA 3O87A 5HW3A 3VFFA 2EX8A 4S2IA 1PW1A 2ZM0A 1KGEA 2HP9A 3N4IA 4ZAMA 4UA7A 4C3QA 3QHYA 3ZGAB 3S1YA 2Y55A 2ZC3B 4O7DA 4B4XA 3QNCA 3EQVA 4P0MA 5E2HA 1S6RA 2Y2MA 4OP5A 5FDHA 4R3JA 2EX9A 2UWXA 5FASA 3HBRA 3G30A 3HUNA 4QU3A 4RVAA 3HLGA 5FAQA 5CXWA 3LEZA 1HVBA 5E2FA 2XK1A 4ZJ2A 4QJGA 3S4XA 5FI7A 2A3UA 4EV4A 3CG5A 2EX6A 4HESA 4IEDA 4X53A 2WGWA 4OOMA 5TFQA 4FH2A 2HP6A 3G35A 1Y54A 2H0YA 3BEBA 1BLSA 5DTTA 3M2JA 1ES2A 1OMEA 2J8YA 4BD0A 4EWFA 4U0TA 3NDGA 4DE1A 1FQGA 4KZ7A 4WYYA 3DW0A 1CEFA 1JTGA 4E3MA 3OPPA 4KZ5A 2Y4AA 3S22A 1L0EA 4KG6A
chains in the Genus database with same CATH superfamily
4RX3A 3M6BA 3C7UA 1PIOA 1QMFA 3MFXA 4FH4A 3GR2A 4FTXA 1W63M 2G7UA 5K5BA 3E2KA 5EVIB 2VGLS 3DWZA 4R23A 5CRFA 5DTSA 5CHUA 3HLCA 4Z1WA 1S4RA 3WS1A 1UWPX 5AQ9A 1SKOB 1XX2A 4BLMA 3W2ZA 4PM7A 3O3VA 1EI5A 1Z6FA 1K4EA 3BFEA 2OAQ1 4BJPA 1NXYA 1S4SA 2Y2QA 4RA7A 3LR0A 4E3KA 5CHMA 3FPWA 1L0GA 3LEQA 4WELA 3N7WA 5HL6A 5F68A 1W8QA 1K6SA 5L2FA 3SOIA 3MJQA 4H6JB 2QPNA 4JGOA 2E8IA 2KOIA 4GJ4A 5HDCA 4KZ8A 4GS9B 3UE6A 1JWZA 4K08A 1OTBA 1I5QA 1XA7A 5DFXA 4YFMA 5I94A 2NUTC 1YLJA 5KMWA 3VSKA 4RQ9A 1E4DA 1LL8A 3VP2A 2WADA 4WEJA 2J3TD 2P74A 4OP8A 5FQ9A 4I39A 3OC2A 5AQBA 1NLYA 5FAOA 4CJNA 1GSWA 2FZ0A 4XUXA 3SS5A 2ZC5B 5HPIA 3T4KA 1ODVA 4Y13A 2H5SA 1WYBA 1G68A 2Y8HA 1MZUA 3G31A 2QHKA 4OLDA 1K4FA 1LSVA 1K56D 2V9AA 2R9XA 2WKPA 1VEUB 2JBFA 3QP6A 4DDYA 3VP0A 2J3TC 4IBRA 1ERQA 2LB5A 1H8ZA 1XGJA 4B4ZA 5AVFA 1W7FA 3UDIA 5L10A 5HWWA 2ZC4B 4EQIA 3GQZA 4ZDXA 3OBFA 3MXSA 5EPHA 4BBVA 4ZTKA 4RYEA 1DY6A 2EWWA 4KZ9A 3T4OA 1JVJA 3B3XA 3ITBA 2Z2LB 2QJ7A 4OVDA 4I5SA 4KZBA 1BT5A 4EETB 3GRJA 3VFHA 1OPXA 1TEMA 2A2LA 2I72A 2XFSA 5G18A 2O0YA 3QP8A 3MS6A 3OZHA 1ZG6A 3F1NA 3IF6B 3O88A 4K91A 1N9BA 3IXBA 2VJWA 3AGDA 5FI2A 1LSWA 2G2WA 1KOUA 4HNBA 2VV7A 3MZDA 3IX8A 1W5DA 3MZFA 2AVXA 2GDNA 4R4SA 1SKOA 4WEKA 5DF9A 1Q2QA 5HAPA 1YMXA 2QZ6A 4LRXC 3QP1A 3P98A 5AQAA 2P04A 4Y7PA 2RL3A 4EERA 4K0WA 1ESIA 2WKQA 4RX2A 3BFDA 5HDSA 4OLGA 5M19A 5F1GA 4OPZA 3PBNA 1S0WA 4IVIA 1NRFA 3UB9A 2CC1A 3HVFA 2H28A 3VP1A 3K3CA 4QB8A 1UWNX 3ZVWA 2ZQAA 1IKIA 4PKYA 1XJ3A 4OPYA 1XKZA 1AWIA 1ONHA 1DP6A 2JKFA 3VV4A 3NECA 5L8MA 3B42A 1GCEA 4IVKA 1KVLA 1NYYA 2Y2IA 2C5WB 4CQHA 1XFNA 5EVIA 3HLFA 3ITAA 3Q7ZA 4Y0TA 4P85A 2FFFB 3NI9A 3GECA 4PAUA 4UHUA 1N9LA 3A3EA 1TF1A 3R4KA 2HJEA 3EWKA 3NULA 3NDEA 1YQSA 2BASA 3E4QA 4KUKA 3H82A 5DF8A 4QWOA 3Q82A 2PU4A 2D02A 3V3RA 3A3JA 3DTEA 1IYOA 1KE0A 3IS2B 1T19A 3JPUA 4CLCE 3RJUA 3HUMA 3VOYA 2MJ6A 4KUOA 4OONA 2UV0E 3MF0A 4AFIA 4BD1A 4KZ6A 1EW0A 2QMIA 4Y17A 5FQJA 4LV2A 2XF3A 2B95A 4I3IA 4OKPA 1CEGA 2ACGA 2W1RA 4IJGA 1OTIA 3UY6A 5CEBA 2WZZA 2XDMA 3AGEA 3F1PB 1Y4OA 4Q0IA 3N8SA 3UMDA 3AGFA 4DN0A 1DP8A 3RXXA 2L0WA 3IHAA 3MZEA 2H10A 5IS1A 1KDWA 2Z6DA 4DMZA 5HW3A 1KGEA 1T18A 4UA7A 1FIKA 3S1YA 4P6ZM 3GDIA 5F69A 3EQVA 4P0MA 5FDHA 4R3JA 2UWXA 4EEUA 4ZJ2A 4X53A 2WGWA 5TFQA 2L4RA 1F9IA 4MN7A 2B02A 2JKTI 3EOIA 5AJGA 2NUPC 2JHEA 1DRMA 1NRJA 4WBGA 4JXVA 2XFTA 1JWVA 2XRNA 1K25A 3P7NA 1NY0A 3GTCA 4WF0A 3C38A 3EQUA 2JKTM 4MLLA 3HUOA 1BUEA 3F1OA 4X56A 4WMCD 4U0XA 1L0DA 3E98A 1H0MA 1DJCA 1LL9A 5GLCA 2Y2GA 3CAXA 1JNUA 4WZ5C 4Y3IA 3MSHA 1W8YA 5E2GA 3ZNYA 1XP4A 3T1RA 3LIFA 1YPRA 2VKSA 1K54A 3GSGA 4C6YA 4JKTA 3T4QA 4QPRA 4CLCC 3UB7A 3PBOA 5FEFA 2JN7A 5FQMA 5HWVA 1ZC2A 3TE8A 4PM5A 4E3LA 5TR7A 4DE2A 3CZDA 2Y2PA 4HY8A 2PD8A 1DP9A 3KYEA 4KZ3A 4N1XA 1XJ2A 3ZYTA 4B9OA 2R9WA 4DE0A 2Y79A 3Q07A 4R4RA 4GNUA 1EROA 2INWA 4HOIA 1RCJA 5HSQA 3F1NB 3U2AA 1IYPA 2Y59A 4LV0A 4KZAA 2HDQA 2K7SA 4PM6A 1SZVA 1KVMA 1W79A 1X0OA 1S66L 5C5KA 2Y2HA 4I3JA 1GHPA 1VETA 2QYBA 5JYPA 4CLCA 2XH9A 4MDZA 1PI5A 1F98A 1SHVA 3O5YA 4ZBEA 4HHDA 3HREA 4E04A 4K0XA 4B88A 4OQ0A 4DE3A 2WKHA 2D01A 5FDSA 2KLIA 2O9AA 5CECA 5M1AA 3NC8A 1ESUA 4EBLA 1KGGA 3T4JA 3TW8A 3ZG8B 1OTDA 4G3VA 3C8CA 4OQHA 1K57A 3RFBA 2ZM8A 2XD1A 5A91A 4E3IA 1YLYA 3BJNA 3NOPC 5EFWA 4FCFA 2W3DA 1PI4A 4U3TA 1VB6A 5HFOA 5G4ZA 1LI0A 5L09A 4EBNA 2ZQ7A 4LV3A 4EESA 3H82B 1FSWA 1O07A 3BFCA 3IH8A 5GHZA 2Y2NA 4GHIA 2P9VA 2VEAA 3CUEA 2JCHA 5BOHA 4QY5A 3JVUA 3TSGA 2PR6A 3UDFA 2OWHA 5KSHA 1MWTA 3BM6A 3CHWP 3G34A 4GW9A 4DXCA 2EFUA 3WRTA 2ZMVA 1S67L 2WAEA 4HQAA 2WGIA 5A90A 2ZOIA 2V1BA 1RGZA 1G5UA 1OJ5A 1TVFA 2ZQDA 1QMEA 3IF6C 3W4PA 4A5RA 1MKIA 2Y2LA 4EUZA 4DKIA 3VP4A 1PWDA 3E4OA 4Y15A 1E3UD 3NOUC 2Y91A 1MXOA 3A0SA 3P09A 1CQAA 1P97A 4HH3A 2Z6CA 4F94A 1P9WA 3EEHA 2GZAA 3LUQA 1UGUA 4BBUA 4R1GA 1IYSA 1GA0A 1WE4A 4X6TA 5FATA 1HD8A 1J9MA 3F1OB 4G3KA 3H7WB 4JXGA 1YT4A 2HJ9C 1BSGA 1HLUP 3KSGA 5EECA 4E3JA 1NZOA 1L3LA 4JGPA 1G6AA 1Q2PA 3IBJA 4NXEA 3MKEA 1DJBA 2P08A 4IBXA 1T1CA 5AQ7A 2J3WA 1IKGA 2WAFA 3LY4A 2E8JA 4ZRRA 1SCWA 3UB6A 5DKLA 5CERA 2PU2A 1YSQA 3OCNA 4GD6A 3JVVA 5CGWA 1KDSA 3MR0A 3VSLA 2M7UA 2PAVP 3H7WA 4BWIA 3WS0A 3UPPA 5TBMB 5EVEA 3C4OA 4II7A 2HDSA 3B33A 3H9WA 3WS4A 5J3WA 4Q8IA 4X69A 4WM9A 3HL9A 3UE0A 1IYQA 4P6ZS 1BTLA 1D1JA 1LT0A 4HJ4A 3CLOA 1KE3A 4MBFA 4MN5A 4S2NA 3VOZA 3OOVA 3G6OA 1SKFA 4BQMA 2J7VA 1XJ6A 3G2YA 4JPMA 5HX9A 3EEAA 2JE5A 3MKFA 3LFVA 3IH9A 2XA7S 5A92A 1RGYA 1DJAA 3G4PA 3I7JA 2ZLYA 4DDSA 1OTAA 3NCKA 4JGRA 2XQZA 5DVAA 2QWSA 1XXMA 3FG8A 2M1CA 1V9YA 4HBTA 1I2SA 2VZWA 4M4XA 2PYPA 2W1TB 1M6KA 2A24B 4L9EA 4JXWA 3QNBA 2WGWB 2XD5A 4YOFA 2VX8A 1ZG4A 1GHIA 1T1AA 4JF6A 2VGJA 3N6IA 2DCFA 4UAAA 1BULA 4I3AA 4S2IA 1PW1A 4ZAMA 3N4IA 2HZ5A 3ZGAB 3IS2A 2Y55A 2HGVA 3S7NA 4B4XA 4XT2A 5E2HA 3TRCA 4OP5A 2V8CA 2EX9A 1TD5A 2XK1A 3S4XA 4EV4A 4FH2A 2HP6A 1Y54A 3BEBA 1NWZA 4CLCB 3BY9A 4D60A 4DE1A 3NDGA 2W3HA 4KZ7A 4WYYA 3DW0A 1JTGA 3LR5A 2CMNA 3CPTA 3OPPA 4KZ5A 4NXBA 3MQOA 5HL1A 3SS3A 5HD3A 5CEDA 5J4EA 1YM1A 3L9KA 1IEMA 3OPLA 4CPKA 4YWZA 3PHYA 4R3AA 1K55C 1O7EA 1A0KA 2ZC7A 3OPHA 1Y28A 4MBHA 3B47A 2EXBA 1U60A 4R6LA 2WKIA 4KG2A 1PZOA 3PBRA 4DRTA 1RP5A 2R78A 1NZUA 1LHYA 5GLAA 2IWBA 2M7VA 5FQIA 2JC7A 4DF6A 3UN7A 1K55A 4GD8A 1M40A 2V20A 3ZG7B 1MY8A 3DWKA 3HCYA 4DJ2A 2KX6A 4ZJ3A 3RXWA 4GB7A 4PM9A 5GL9A 3IX4A 2QJ5A 4JLFA 1CK3A 4QY6A 2JKRM 4F3LA 5L07A 3R7WB 4HP9A 3FKVA 4KQDA 1XGIA 3NY4A 4L0LA 2XSSA 2Y2OA 5DFYA 1YLPA 2HF6A 1JTDA 4Q0HA 4MN6A 1MBLA 5GHXA 3VE4A 5CTMA 1I2WA 1ZHHB 5CX7A 3UPOA 5DF7A 3DTKA 3MQQA 4S2MA 3O86A 1YAXA 3DBAA 3IQAA 5EVLA 3RH8B 2HDRA 2PR5A 4OOLA 5FQKA 3UO9A 2HDUA 3NOTC 1YLTA 4HJ6A 1NYMA 1TS6A 5JYOA 4PHTA 3UB5P 3TJZC 1E25A 2PBDP 3BFFA 4LLOB 5EM1A 4GKUA 3IXHA 4LRZE 3ICYA 4HH2A 4NEED 3ZG0A 4MEZA 4FSFA 2V0WA 1J3WA 5KIZA 4XT2B 3T50A 3M2KA 4OH0A 3IWQA 4PM8A 2ZM2A 2OWJA 3OCLA 3QP2A 4PPRA 2O9CA 3IWOA 4BENA 4GDNA 5HZHA 5GLBA 3NIAA 4N1HA 4NK3A 5E2EA 4GLQA 2IWDA 3A3DA 5CHJA 2ZQ9A 5EV0A 4IHQA 3HLDA 4UA6A 4UQIS 3U4LP 5EUAA 3OPRA 2PBYA 5J7EA 1K57C 4QHCA 4EXOA 2Y2KA 4I38A 3ULFA 4P87A 3DAVA 3VE3A 3UE1A 4H6JA 1VM1A 2OV5A 1N4OA 3LGOA 3M6HA 4S2LA 5CTNA 3DTIA 4O0PA 4EU0A 4R3BA 5DKKA 1TS7A 5AVEA 1WYCA 3HLBA 4Q0JA 1N9NA 2A24A 2WYXA 1S1YA 4O8GA 5TGFA 4BBTA 2W27A 4GCZA 3PYPA 4EUVA 3BW6A 3NJAA 1PFLA 1K6RA 2O9BA 4R38A 1F5MA 1OTEA 3ZVTA 3T4SA 3KO6A 2PDRA 3MXQA 1YLWA 1PW8A 3SS4A 5KZHA 4LCLA 2K31A 5HDDA 3HJIA 1TS0A 1PZPA 3ISGA 3IX3A 1ZKJA 1VQQA 3G32A 3UB8A 1BLCA 3GMWA 3LIEA 2OOLA 3C7VA 1FILA 1PNEA 1P9RA 2W3FA 2B18A 4QD4A 2VGLM 4E6WA 4HJ3A 3ZDJA 5TBMA 3EGDC 3A0RA 3QP4A 5FL3A 2XLNA 3MBZA 3IBRA 1FR1A 3A3FA 3VMAA 5HARA 3HLEA 1TS8A 1PYYA 4OOYA 3FYZA 3UNWA 3CI6A 1BZAA 4JXSA 2Q9MA 3C4PA 1MC0A 2VA0A 4Y0UA 3LY3A 2WZXA 4WLAA 4LCMA 4NXGA 3PTEA 3TOIA 2FFYA 3RTYA 4F3LB 3KX0X 4ARZA 2W3EA 3CUEC 3LICA 3BQ8A 3SH9A 3WS2A 3ZG9B 2A49A 1FCOA 4CLCD 1ES5A 2Q0OA 3Q81A 1BLPA 1L0FA 1CF0A 3Q7VB 3PBQA 5EVID 4XUZA 4LENA 4HIAA 3N8LA 4UQIM 1XJ4A 1XFQA 4D2OA 2OLVA 3LCEA 5HD5A 3WS5A 3C5AA 4C75A 5F1FA 4JF4A 2YKHA 1CJFA 5FA7A 2V2FF 1KE4A 3T1SA 3MFDA 4E3NA 1LI9A 1E3UA 3P01A 1LLBA 3T4TA 4FOFA 3V50A 5DJTA 2WKRA 1KGFA 2Z2MB 1FOFA 3PXPA 3VP3A 2ZD8A 3CWFA 3CMZA 3NBLA 3V3SA 3LIAA 3FZCA 5F6AA 1LSXA 2PT7A 4KG5A 3LR4A 5FI6A 3BLMA 4JF5A 1YKDA 4FUWA 3VFFA 2EX8A 4YNRA 2ZM0A 4O7DA 3QNCA 1GSVA 1S6RA 2Y2MA 4LRYC 3E4PA 2PRFA 1D06A 3G30A 3HUNA 4QU3A 4Y5FA 5CXWA 4MCWA 3LEZA 1HVBA 5HWTA 4QJGA 5FI7A 4B93A 2A3UA 3CG5A 4IEDA 4DJ3A 1VETB 4X1LA 2H0YA 1ES2A 1OMEA 4BD0A 4EWFA 4U0TA 1CEFA 4E3MA 2LB9A 2Y4AA 1L0EA 4KG6A 1YLZA 4E3OA 4R0QA 4M3KA 2XGNA 1T1BA 2WKEA 5EVIC 5MC7A 3KYQA 3T4LA 1IFQA 4Z9QA 3K3DA 2ZJ9A 3UE3A 3BFGA 4EW7A 4ME4A 3R7WA 5FSRA 4Y2FA 2IWCA 1ES3A 3FWLA 5U47A 1HZOA 2J80A 2VLGA 4NKPA 4ZJ1A 2YKFA 4G3WA 3T1XA 4R70A 5HPFA 1XA1A 1CI8A 4KZ4A 1K0KA 2XA7M 4S2NC 2FH5A 3FKWA 5KSCA 4S2OA 4HP4A 4MNRA 3FV7A 4UA9A 2ZL1B 5F5YA 4JGQA 3ZHHA 2X01A 1K56A 5A93A 1D7EA 2C6WB 2G2UA 2Q9NA 2ZBBA 2EX2A 1ES4A 4XXRA 1N9OA 3TG9A 2QKPA 1L2SA 2PHYA 3LI9A 3Q7VA 4EBPA 1FCNA 4IUHA 3GVBA 3IF5A 4GOGA 2XROA 3IT9A 2V1AA 1BYWA 2K2NA 2J9OA 5TJJA 3WWXA 3C2WA 4MMNA 3IXDA 4S2KA 2BLSA 1OT6A 1G28A 4E6XA 2B5RA 4LV1A 4JBFA 3SH8A 1MWSA 2V1ZA 3PBSA 2BG1A 5M18A 4OQGA 1CI9A 3ZQ5A 3SH7A 2GJ3A 1VHMA 3F1PA 1GHMA 2EFXA 2WGVA 4BL3A 3IHBA 3DTMA 5IHVA 4P6BA 1OT9A 1C3BA 3N8RA 1TDLA 4X68A 2Y2JA 3UPNA 4WMCA 5A8BA 5EM0A 5D3OA 1S1ZA 3T12B 3BQAA 3ZFZA 1FCMA 4OQIA 1NJ4A 2HPBA 4WL9A 3V5MA 2L1MA 3IF6A 3G2ZA 4S2PA 1IELA 2ZQCA 5IT5A 3S7QA 1K54C 5E43A 4UEYA 3KSFA 5F82A 3EGXC 3CJMA 4ID4A 3BLSA 4WZ5A 4GZBA 4EEPA 3S7OA 3UDXA 4OPRA 2PYRA 3SW1A 3LIBA 3WRZA 1JWPA 5IU1A 1YSPA 4KQQA 1PRQA 4ETZA 5GLDA 1LL5A 3C30A 2EWVA 1ERMA 3L7HA 4IUKA 4OPQA 5LBRA 4LPZA 3UMEA 4ESPA 2OAP1 2RCXA 3MMHA 2W0NA 2P7JA 2EXAA 2W1TA 3BRMA 1XPBA 1WA9A 3VOLA 2VK3A 5HAIA 4KENB 4HEFA 2OSUA 2BTFP 4WN5A 5F83A 3MQ0A 3PR6A 1TDGA 1H3QA 2WK0A 3IXGA 1GA9A 3PBTA 3PAEA 3V39A 2V8FA 5EE8A 1FR6A 1F2KA 3SZTA 3LYXA 2ZMFA 3D4FA 4GHIB 4NG2A 4O01A 1ZTUA 5DTKA 1VEUA 2DRWA 3W4QA 4WZ4A 3A0VA 1PWCA 4GN2A 2DNSA 2KDKA 4GS9A 1MWRA 1ACFA 3LIDA 4L9GA 3BECA 2JKGA 3D3OA 1K38A 2JKRI 4FD8A 3Q1FA 4X25A 4S2JA 2HV1A 3ZG5A 2I9VA 4ARZB 1MKMA 2XEPA 3A3IA 4H8RA 4ETXA 2H0TA 2ZMAA 3HJKA 1STZA 2ZC6B 5EOEA 2WUQA 4EQ1A 3LR3A 1PWGA 1G6OA 1IOUA 2ZQ8A 3PAGA 3BYDA 3BY8A 4YINA 1SDEA 2OLUA 4KQOA 3KSHA 4N9KA 4NETA 2P9VB 5EOOA 4NXFA 2X71A 2GNXA 3QP5A 4LGWA 1H8YA 3W8KA 2DMWA 4PMAA 5HAQA 4HBUA 3IWIA 3GV9A 5FQQA 2ZL1A 1BLHA 4N92A 4X1MA 3CITA 2VV6A 1HTZA 1YMSA 4KQRA 1SDNA 1MWUA 3NHQA 5G4YA 1ONGA 4GDBA 4LFUA 2GX5A 5CGXA 4Y0OA 3CPTB 1MPLA 3KSIA 1H5XA 3ZCZA 1AXBA 2V0UA 1V9ZA 3HLWA 3LO7A 1OJGA 4MBKA 2X02A 5FAPA 3OLOA 4WUJA 2W3GA 5GHYA 4N9LA 3LI8A 3E2LA 3JYIA 5CGSA 2XR0A 3FC7A 5J8XA 2EA9A 1NLZA 1FSYA 1EWZA 4BL2A 1ALQA 2VGKA 4PKYG 3D72A 3W4OA 4DXBA 5FEGA 3MXRA 3FPVA 2J9PA 3ZNTA 4X55A 4HI4A 3K2NA 2HP5A 3KYZA 3O87A 4C3QA 2HP9A 3QHYA 2IA2A 2ZC3B 1P0ZA 3E0YA 1GSXA 5I5LA 2PD7A 5FASA 3HBRA 3D9YA 4RVAA 3HLGA 5DJUA 5FAQA 5E2FA 4BMWA 2ZOHA 3S7PA 4HESA 2EX6A 2VV8A 3T1QB 4OOMA 3V67A 4L9FA 1Z09A 3G35A 5DTTA 1BLSA 3M2JA 2J8YA 1H8MA 3BWLA 1FQGA 2O99A 1W63Q 3S22A
chains in the Genus database with same CATH topology
4WBGA 4JXVA 1YLZA 4E3OA 4R0QA 4RX3A 2XFTA 3M6BA 3C7UA 3SS3A 5CEDA 5HL1A 1JWVA 1PIOA 1QMFA 1YM1A 4M3KA 1IEMA 3OPLA 4FH4A 4CPKA 2XGNA 1K25A 1NY0A 3GTCA 2WKEA 5EVIC 3GR2A 3EQUA 1K55C 1O7EA 4MLLA 2ZC7A 1BUEA 3HUOA 3OPHA 4MBHA 4Z9QA 4X56A 2ZJ9A 4WMCD 3BFGA 3UE3A 3E2KA 2EXBA 4U0XA 1L0DA 1U60A 1DJCA 1LL9A 2WKIA 5FSRA 4KG2A 5EVIB 2IWCA 1ES3A 3DWZA 3FWLA 1HZOA 4R23A 5CRFA 1PZOA 2Y2GA 3PBRA 5DTSA 5GLCA 4DRTA 4WZ5C 4ZJ1A 5CHUA 1RP5A 1W8YA 5E2GA 1NZUA 3HLCA 1LHYA 5GLAA 3WS1A 2IWBA 1XA1A 5FQIA 2JC7A 4DF6A 3UN7A 3ZNYA 1CI8A 1K55A 1XP4A 4GD8A 4KZ4A 5AQ9A 1M40A 2V20A 3ZG7B 1MY8A 1K54A 3GSGA 4C6YA 4S2NC 3DWKA 1XX2A 4BLMA 4JKTA 3FKWA 5KSCA 4S2OA 4MNRA 3FV7A 4UA9A 4ZJ3A 3ZHHA 3RXWA 2X01A 1K56A 5A93A 3PBOA 3O3VA 4GB7A 4PM9A 4PM7A 1EI5A 1Z6FA 5FQMA 5GL9A 4JLFA 1K4EA 2C6WB 2G2UA 1ZC2A 2Q9NA 3BFEA 1CK3A 4QY6A 4PM5A 4E3LA 4BJPA 5TR7A 4DE2A 2EX2A 3CZDA 1NXYA 2Y2PA 2Y2QA 4RA7A 1ES4A 4E3KA 4N1XA 4KZ3A 5CHMA 1L0GA 3FKVA 4WELA 3N7WA 4XXRA 1W8QA 1K6SA 1XGIA 3NY4A 4L0LA 3TG9A 5L2FA 2R9WA 4DE0A 1L2SA 3SOIA 2Y2OA 3Q07A 1YLPA 3Q7VA 4R4RA 4GNUA 1JTDA 4EBPA 1FCNA 1EROA 2QPNA 3GVBA 1MBLA 1RCJA 3IF5A 5CTMA 5GHXA 1I2WA 2E8IA 4GOGA 3UPOA 3IT9A 4KZ8A 2J9OA 5DF7A 4S2MA 1JWZA 1IYPA 2Y59A 1I5QA 3WWXA 3O86A 3IXDA 4S2KA 1XA7A 2BLSA 4LV0A 4KZAA 4YFMA 2HDQA 4PM6A 5I94A 3IQAA 1YLJA 4E6XA 2B5RA 5KMWA 4LV1A 4JBFA 5EVLA 3VSKA 1KVMA 1W79A 1E4DA 2HDRA 3VP2A 3SH8A 1MWSA 2V1ZA 2WADA 3PBSA 4OOLA 5FQKA 3UO9A 2HDUA 4WEJA 2Y2HA 2P74A 2BG1A 1YLTA 5M18A 1GHPA 4OP8A 4OQGA 1NYMA 5FQ9A 1CI9A 5JYOA 3OC2A 5AQBA 5JYPA 1E25A 5FAOA 3BFFA 2XH9A 3SH7A 4GKUA 1PI5A 4CJNA 3IXHA 1GHMA 4XUXA 1SHVA 3SS5A 4ZBEA 2ZC5B 3ZG0A 2EFXA 2WGVA 4BL3A 3HREA 4MEZA 3IHBA 4FSFA 3DTMA 4K0XA 4B88A 4OQ0A 2H5SA 1WYBA 4DE3A 5IHVA 2WKHA 1G68A 3M2KA 4OH0A 3IWQA 3G31A 4PM8A 4P6BA 2ZM2A 4OLDA 3OCLA 1C3BA 3N8RA 5CECA 5M1AA 1TDLA 1K4FA 4PPRA 1K56D 3NC8A 1ESUA 3IWOA 4BENA 4GDNA 4EBLA 5GLBA 3NIAA 4X68A 1KGGA 2R9XA 4N1HA 4NK3A 2Y2JA 3UPNA 4WMCA 5E2EA 2JBFA 5D3OA 4DDYA 5CERA 3ZG8B 3VP0A 4IBRA 4OQHA 1K57A 2IWDA 1ERQA 3A3DA 3ZFZA 1FCMA 2ZM8A 1NJ4A 2HPBA 2XD1A 1H8ZA 4OQIA 5A91A 3V5MA 1YLYA 4E3IA 3IF6A 5CHJA 1XGJA 2ZQ9A 3G2ZA 4S2PA 4B4ZA 1IELA 4FCFA 2ZQCA 3HLDA 4UA6A 1K54C 1PI4A 4U3TA 3OPRA 5E43A 2PBYA 5EUAA 5HFOA 1K57C 1LI0A 1W7FA 4QHCA 4EBNA 5F82A 2Y2KA 3UDIA 2ZQ7A 2ZC4B 4EQIA 4LV3A 4P87A 3CJMA 3GQZA 3UE1A 1FSWA 1O07A 3BFCA 3IH8A 4ZDXA 5EPHA 1VM1A 2Y2NA 3MXSA 4ID4A 5GHZA 3BLSA 4WZ5A 4GZBA 4RYEA 4ZTKA 2P9VA 1DY6A 2OV5A 1N4OA 4OPRA 3M6HA 3UDXA 2JCHA 5BOHA 4QY5A 4KZ9A 3TSGA 3UDFA 1JVJA 1JWPA 4S2LA 3WRZA 3B3XA 5KSHA 1MWTA 3ITBA 5CTNA 3BM6A 2Z2LB 3G34A 4KQQA 1LL5A 4OPQA 4R3BA 5GLDA 1ERMA 4OVDA 4DXCA 2EFUA 4KZBA 1BT5A 2RCXA 1WYCA 3GRJA 2EXAA 3WRTA 3VFHA 3BRMA 3HLBA 1XPBA 1TEMA 2I72A 2WYXA 5HAIA 2XFSA 4KENB 4HEFA 2OSUA 5G18A 5TGFA 2WAEA 3OZHA 5F83A 2WGIA 5A90A 1ZG6A 3IF6B 3O88A 4K91A 1N9BA 1TDGA 3IXBA 2WK0A 1RGZA 3IXGA 1GA9A 1K6RA 1TVFA 3PBTA 3PAEA 3AGDA 5FI2A 3ZVTA 2G2WA 3V39A 5EE8A 1FR6A 2ZQDA 1QMEA 3IF6C 3W4PA 4A5RA 1MKIA 2Y2LA 4EUZA 3MZDA 4DKIA 3VP4A 1YLWA 1PW8A 1PWDA 1W5DA 3SS4A 3D4FA 3MZFA 2GDNA 4R4SA 4LCLA 5KZHA 5DTKA 2DRWA 4WEKA 3W4QA 4WZ4A 1E3UD 5DF9A 1PWCA 1Q2QA 2Y91A 1MXOA 5HAPA 4GN2A 1PZPA 1YMXA 2DNSA 2QZ6A 3ISGA 3P98A 1ZKJA 3P09A 5AQAA 1MWRA 1VQQA 3G32A 4Y7PA 2RL3A 4K0WA 1BLCA 3GMWA 1ESIA 4F94A 4RX2A 3BECA 3BFDA 3C7VA 1K38A 4OLGA 4FD8A 5M19A 3Q1FA 4R1GA 1IYSA 1GA0A 1WE4A 4OPZA 4X6TA 5F1GA 1HD8A 5FATA 3PBNA 1J9MA 1S0WA 4IVIA 1NRFA 4QD4A 4S2JA 2CC1A 4E6WA 3HVFA 3ZG5A 3ZDJA 4JXGA 2XEPA 3A3IA 1YT4A 4H8RA 3VP1A 2XLNA 2H0TA 2ZMAA 3MBZA 4QB8A 1BSGA 2ZC6B 3ZVWA 5EOEA 5EECA 2WUQA 4E3JA 1FR1A 1NZOA 1IKIA 2ZQAA 3A3FA 5HARA 3HLEA 3VMAA 1PYYA 4OPYA 1G6AA 1Q2PA 4OOYA 1PWGA 1XKZA 3FYZA 2ZQ8A 3MKEA 3UNWA 1ONHA 3PAGA 1DJBA 1BZAA 4JXSA 3BYDA 2Q9MA 4IBXA 5AQ7A 3C4PA 1IKGA 2WAFA 4Y0UA 3LY4A 4YINA 1SCWA 1SDEA 2OLUA 1GCEA 4KQOA 4IVKA 1KVLA 1NYYA 2PU2A 2WZXA 3LY3A 4N9KA 2Y2IA 3OCNA 4GD6A 4NETA 2C5WB 2P9VB 4LCMA 5CGWA 3HLFA 3ITAA 5EOOA 1KDSA 3Q7ZA 5EVIA 3VSLA 4Y0TA 3PTEA 2X71A 3TOIA 2FFYA 4P85A 3WS0A 3UPPA 2FFFB 3NI9A 1H8YA 3W8KA 4UHUA 4PMAA 3A3EA 5HAQA 3SH9A 4HBUA 3WS2A 3ZG9B 2A49A 1FCOA 3C4OA 3IWIA 3GV9A 5FQQA 1ES5A 3NDEA 2HDSA 3Q81A 1YQSA 1BLPA 1L0FA 3Q7VB 3WS4A 4Q8IA 3PBQA 5EVID 4XUZA 1BLHA 4X69A 4N92A 4WM9A 4LENA 3HL9A 5DF8A 3UE0A 3Q82A 1IYQA 1HTZA 1BTLA 3N8LA 1YMSA 4KQRA 1SDNA 1KE3A 1MWUA 1ONGA 4MBFA 4GDBA 2PU4A 4S2NA 3VOZA 4D2OA 2OLVA 3V3RA 5CGXA 3A3JA 5U47A 3LCEA 4Y0OA 1IYOA 1MPLA 1SKFA 3WS5A 4BQMA 1H5XA 2J7VA 1KE0A 3G2YA 3C5AA 3ZCZA 4C75A 5F1FA 1AXBA 3HLWA 3LO7A 4JPMA 3RJUA 3HUMA 4MBKA 5HX9A 2X02A 5FAPA 2JE5A 3VOYA 3MKFA 4JF4A 5FA7A 3IH9A 5A92A 5GHYA 1RGYA 4N9LA 1DJAA 3E2LA 4OONA 2V2FF 3G4PA 3I7JA 2ZLYA 1KE4A 2XR0A 3JYIA 5CGSA 4DDSA 4BD1A 4KZ6A 3NCKA 3MFDA 4E3NA 1LI9A 2QMIA 2XQZA 1E3UA 5DVAA 5J8XA 5FQJA 1LLBA 4LV2A 1FSYA 2XF3A 1XXMA 1EWZA 4BL2A 3V50A 4HBTA 1I2SA 4OKPA 1CEGA 1KGFA 2Z2MB 1ALQA 3UY6A 1FOFA 5CEBA 2VGKA 1M6KA 2WZZA 2XDMA 3AGEA 3W4OA 4JXWA 3QNBA 2WGWB 3VP3A 4DXBA 2XD5A 2ZD8A 3N8SA 3MXRA 3AGFA 1ZG4A 3CMZA 1GHIA 3NBLA 3V3SA 2J9PA 3RXXA 3FZCA 3ZNTA 4JF6A 3IHAA 3MZEA 4X55A 4KG5A 2H10A 2VGJA 3N6IA 5FI6A 1KDWA 2DCFA 3BLMA 1BULA 2HP5A 4JF5A 4UAAA 3O87A 5HW3A 3VFFA 2EX8A 4S2IA 1PW1A 2ZM0A 1KGEA 2HP9A 3N4IA 4ZAMA 4UA7A 4C3QA 3QHYA 3ZGAB 3S1YA 2Y55A 2ZC3B 4O7DA 4B4XA 3QNCA 3EQVA 4P0MA 5E2HA 1S6RA 2Y2MA 4OP5A 5FDHA 4R3JA 2EX9A 2UWXA 5FASA 3HBRA 3G30A 3HUNA 4QU3A 4RVAA 3HLGA 5FAQA 5CXWA 3LEZA 1HVBA 5E2FA 2XK1A 4ZJ2A 4QJGA 3S4XA 5FI7A 2A3UA 4EV4A 3CG5A 2EX6A 4HESA 4IEDA 4X53A 2WGWA 4OOMA 5TFQA 4FH2A 2HP6A 3G35A 1Y54A 2H0YA 3BEBA 1BLSA 5DTTA 3M2JA 1ES2A 1OMEA 2J8YA 4BD0A 4EWFA 4U0TA 3NDGA 4DE1A 1FQGA 4KZ7A 4WYYA 3DW0A 1CEFA 1JTGA 4E3MA 3OPPA 4KZ5A 2Y4AA 3S22A 1L0EA 4KG6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WBG A;  4JXV A;  1YLZ A;  4E3O A;  4R0Q A;  4RX3 A;  2XFT A;  3M6B A;  3C7U A;  3SS3 A;  5CED A;  5HL1 A;  1JWV A;  1PIO A;  1QMF A;  1YM1 A;  4M3K A;  1IEM A;  3OPL A;  4FH4 A;  4CPK A;  2XGN A;  1K25 A;  1NY0 A;  3GTC A;  2WKE A;  5EVI C;  3GR2 A;  3EQU A;  1K55 C;  1O7E A;  4MLL A;  2ZC7 A;  1BUE A;  3HUO A;  3OPH A;  4MBH A;  4Z9Q A;  4X56 A;  2ZJ9 A;  4WMC D;  3BFG A;  3UE3 A;  3E2K A;  2EXB A;  4U0X A;  1L0D A;  1U60 A;  1DJC A;  1LL9 A;  2WKI A;  5FSR A;  4KG2 A;  5EVI B;  2IWC A;  1ES3 A;  3DWZ A;  3FWL A;  1HZO A;  4R23 A;  5CRF A;  1PZO A;  2Y2G A;  3PBR A;  5DTS A;  5GLC A;  4DRT A;  4WZ5 C;  4ZJ1 A;  5CHU A;  1RP5 A;  1W8Y A;  5E2G A;  1NZU A;  3HLC A;  1LHY A;  5GLA A;  3WS1 A;  2IWB A;  1XA1 A;  5FQI A;  2JC7 A;  4DF6 A;  3UN7 A;  3ZNY A;  1CI8 A;  1K55 A;  1XP4 A;  4GD8 A;  4KZ4 A;  5AQ9 A;  1M40 A;  2V20 A;  3ZG7 B;  1MY8 A;  1K54 A;  3GSG A;  4C6Y A;  4S2N C;  3DWK A;  1XX2 A;  4BLM A;  4JKT A;  3FKW A;  5KSC A;  4S2O A;  4MNR A;  3FV7 A;  4UA9 A;  4ZJ3 A;  3ZHH A;  3RXW A;  2X01 A;  1K56 A;  5A93 A;  3PBO A;  3O3V A;  4GB7 A;  4PM9 A;  4PM7 A;  1EI5 A;  1Z6F A;  5FQM A;  5GL9 A;  4JLF A;  1K4E A;  2C6W B;  2G2U A;  1ZC2 A;  2Q9N A;  3BFE A;  1CK3 A;  4QY6 A;  4PM5 A;  4E3L A;  4BJP A;  5TR7 A;  4DE2 A;  2EX2 A;  3CZD A;  1NXY A;  2Y2P A;  2Y2Q A;  4RA7 A;  1ES4 A;  4E3K A;  4N1X A;  4KZ3 A;  5CHM A;  1L0G A;  3FKV A;  4WEL A;  3N7W A;  4XXR A;  1W8Q A;  1K6S A;  1XGI A;  3NY4 A;  4L0L A;  3TG9 A;  5L2F A;  2R9W A;  4DE0 A;  1L2S A;  3SOI A;  2Y2O A;  3Q07 A;  1YLP A;  3Q7V A;  4R4R A;  4GNU A;  1JTD A;  4EBP A;  1FCN A;  1ERO A;  2QPN A;  3GVB A;  1MBL A;  1RCJ A;  3IF5 A;  5CTM A;  5GHX A;  1I2W A;  2E8I A;  4GOG A;  3UPO A;  3IT9 A;  4KZ8 A;  2J9O A;  5DF7 A;  4S2M A;  1JWZ A;  1IYP A;  2Y59 A;  1I5Q A;  3WWX A;  3O86 A;  3IXD A;  4S2K A;  1XA7 A;  2BLS A;  4LV0 A;  4KZA A;  4YFM A;  2HDQ A;  4PM6 A;  5I94 A;  3IQA A;  1YLJ A;  4E6X A;  2B5R A;  5KMW A;  4LV1 A;  4JBF A;  5EVL A;  3VSK A;  1KVM A;  1W79 A;  1E4D A;  2HDR A;  3VP2 A;  3SH8 A;  1MWS A;  2V1Z A;  2WAD A;  3PBS A;  4OOL A;  5FQK A;  3UO9 A;  2HDU A;  4WEJ A;  2Y2H A;  2P74 A;  2BG1 A;  1YLT A;  5M18 A;  1GHP A;  4OP8 A;  4OQG A;  1NYM A;  5FQ9 A;  1CI9 A;  5JYO A;  3OC2 A;  5AQB A;  5JYP A;  1E25 A;  5FAO A;  3BFF A;  2XH9 A;  3SH7 A;  4GKU A;  1PI5 A;  4CJN A;  3IXH A;  1GHM A;  4XUX A;  1SHV A;  3SS5 A;  4ZBE A;  2ZC5 B;  3ZG0 A;  2EFX A;  2WGV A;  4BL3 A;  3HRE A;  4MEZ A;  3IHB A;  4FSF A;  3DTM A;  4K0X A;  4B88 A;  4OQ0 A;  2H5S A;  1WYB A;  4DE3 A;  5IHV A;  2WKH A;  1G68 A;  3M2K A;  4OH0 A;  3IWQ A;  3G31 A;  4PM8 A;  4P6B A;  2ZM2 A;  4OLD A;  3OCL A;  1C3B A;  3N8R A;  5CEC A;  5M1A A;  1TDL A;  1K4F A;  4PPR A;  1K56 D;  3NC8 A;  1ESU A;  3IWO A;  4BEN A;  4GDN A;  4EBL A;  5GLB A;  3NIA A;  4X68 A;  1KGG A;  2R9X A;  4N1H A;  4NK3 A;  2Y2J A;  3UPN A;  4WMC A;  5E2E A;  2JBF A;  5D3O A;  4DDY A;  5CER A;  3ZG8 B;  3VP0 A;  4IBR A;  4OQH A;  1K57 A;  2IWD A;  1ERQ A;  3A3D A;  3ZFZ A;  1FCM A;  2ZM8 A;  1NJ4 A;  2HPB A;  2XD1 A;  1H8Z A;  4OQI A;  5A91 A;  3V5M A;  1YLY A;  4E3I A;  3IF6 A;  5CHJ A;  1XGJ A;  2ZQ9 A;  3G2Z A;  4S2P A;  4B4Z A;  1IEL A;  4FCF A;  2ZQC A;  3HLD A;  4UA6 A;  1K54 C;  1PI4 A;  4U3T A;  3OPR A;  5E43 A;  2PBY A;  5EUA A;  5HFO A;  1K57 C;  1LI0 A;  1W7F A;  4QHC A;  4EBN A;  5F82 A;  2Y2K A;  3UDI A;  2ZQ7 A;  2ZC4 B;  4EQI A;  4LV3 A;  4P87 A;  3CJM A;  3GQZ A;  3UE1 A;  1FSW A;  1O07 A;  3BFC A;  3IH8 A;  4ZDX A;  5EPH A;  1VM1 A;  2Y2N A;  3MXS A;  4ID4 A;  5GHZ A;  3BLS A;  4WZ5 A;  4GZB A;  4RYE A;  4ZTK A;  2P9V A;  1DY6 A;  2OV5 A;  1N4O A;  4OPR A;  3M6H A;  3UDX A;  2JCH A;  5BOH A;  4QY5 A;  4KZ9 A;  3TSG A;  3UDF A;  1JVJ A;  1JWP A;  4S2L A;  3WRZ A;  3B3X A;  5KSH A;  1MWT A;  3ITB A;  5CTN A;  3BM6 A;  2Z2L B;  3G34 A;  4KQQ A;  1LL5 A;  4OPQ A;  4R3B A;  5GLD A;  1ERM A;  4OVD A;  4DXC A;  2EFU A;  4KZB A;  1BT5 A;  2RCX A;  1WYC A;  3GRJ A;  2EXA A;  3WRT A;  3VFH A;  3BRM A;  3HLB A;  1XPB A;  1TEM A;  2I72 A;  2WYX A;  5HAI A;  2XFS A;  4KEN B;  4HEF A;  2OSU A;  5G18 A;  5TGF A;  2WAE A;  3OZH A;  5F83 A;  2WGI A;  5A90 A;  1ZG6 A;  3IF6 B;  3O88 A;  4K91 A;  1N9B A;  1TDG A;  3IXB A;  2WK0 A;  1RGZ A;  3IXG A;  1GA9 A;  1K6R A;  1TVF A;  3PBT A;  3PAE A;  3AGD A;  5FI2 A;  3ZVT A;  2G2W A;  3V39 A;  5EE8 A;  1FR6 A;  2ZQD A;  1QME A;  3IF6 C;  3W4P A;  4A5R A;  1MKI A;  2Y2L A;  4EUZ A;  3MZD A;  4DKI A;  3VP4 A;  1YLW A;  1PW8 A;  1PWD A;  1W5D A;  3SS4 A;  3D4F A;  3MZF A;  2GDN A;  4R4S A;  4LCL A;  5KZH A;  5DTK A;  2DRW A;  4WEK A;  3W4Q A;  4WZ4 A;  1E3U D;  5DF9 A;  1PWC A;  1Q2Q A;  2Y91 A;  1MXO A;  5HAP A;  4GN2 A;  1PZP A;  1YMX A;  2DNS A;  2QZ6 A;  3ISG A;  3P98 A;  1ZKJ A;  3P09 A;  5AQA A;  1MWR A;  1VQQ A;  3G32 A;  4Y7P A;  2RL3 A;  4K0W A;  1BLC A;  3GMW A;  1ESI A;  4F94 A;  4RX2 A;  3BEC A;  3BFD A;  3C7V A;  1K38 A;  4OLG A;  4FD8 A;  5M19 A;  3Q1F A;  4R1G A;  1IYS A;  1GA0 A;  1WE4 A;  4OPZ A;  4X6T A;  5F1G A;  1HD8 A;  5FAT A;  3PBN A;  1J9M A;  1S0W A;  4IVI A;  1NRF A;  4QD4 A;  4S2J A;  2CC1 A;  4E6W A;  3HVF A;  3ZG5 A;  3ZDJ A;  4JXG A;  2XEP A;  3A3I A;  1YT4 A;  4H8R A;  3VP1 A;  2XLN A;  2H0T A;  2ZMA A;  3MBZ A;  4QB8 A;  1BSG A;  2ZC6 B;  3ZVW A;  5EOE A;  5EEC A;  2WUQ A;  4E3J A;  1FR1 A;  1NZO A;  1IKI A;  2ZQA A;  3A3F A;  5HAR A;  3HLE A;  3VMA A;  1PYY A;  4OPY A;  1G6A A;  1Q2P A;  4OOY A;  1PWG A;  1XKZ A;  3FYZ A;  2ZQ8 A;  3MKE A;  3UNW A;  1ONH A;  3PAG A;  1DJB A;  1BZA A;  4JXS A;  3BYD A;  2Q9M A;  4IBX A;  5AQ7 A;  3C4P A;  1IKG A;  2WAF A;  4Y0U A;  3LY4 A;  4YIN A;  1SCW A;  1SDE A;  2OLU A;  1GCE A;  4KQO A;  4IVK A;  1KVL A;  1NYY A;  2PU2 A;  2WZX A;  3LY3 A;  4N9K A;  2Y2I A;  3OCN A;  4GD6 A;  4NET A;  2C5W B;  2P9V B;  4LCM A;  5CGW A;  3HLF A;  3ITA A;  5EOO A;  1KDS A;  3Q7Z A;  5EVI A;  3VSL A;  4Y0T A;  3PTE A;  2X71 A;  3TOI A;  2FFY A;  4P85 A;  3WS0 A;  3UPP A;  2FFF B;  3NI9 A;  1H8Y A;  3W8K A;  4UHU A;  4PMA A;  3A3E A;  5HAQ A;  3SH9 A;  4HBU A;  3WS2 A;  3ZG9 B;  2A49 A;  1FCO A;  3C4O A;  3IWI A;  3GV9 A;  5FQQ A;  1ES5 A;  3NDE A;  2HDS A;  3Q81 A;  1YQS A;  1BLP A;  1L0F A;  3Q7V B;  3WS4 A;  4Q8I A;  3PBQ A;  5EVI D;  4XUZ A;  1BLH A;  4X69 A;  4N92 A;  4WM9 A;  4LEN A;  3HL9 A;  5DF8 A;  3UE0 A;  3Q82 A;  1IYQ A;  1HTZ A;  1BTL A;  3N8L A;  1YMS A;  4KQR A;  1SDN A;  1KE3 A;  1MWU A;  1ONG A;  4MBF A;  4GDB A;  2PU4 A;  4S2N A;  3VOZ A;  4D2O A;  2OLV A;  3V3R A;  5CGX A;  3A3J A;  5U47 A;  3LCE A;  4Y0O A;  1IYO A;  1MPL A;  1SKF A;  3WS5 A;  4BQM A;  1H5X A;  2J7V A;  1KE0 A;  3G2Y A;  3C5A A;  3ZCZ A;  4C75 A;  5F1F A;  1AXB A;  3HLW A;  3LO7 A;  4JPM A;  3RJU A;  3HUM A;  4MBK A;  5HX9 A;  2X02 A;  5FAP A;  2JE5 A;  3VOY A;  3MKF A;  4JF4 A;  5FA7 A;  3IH9 A;  5A92 A;  5GHY A;  1RGY A;  4N9L A;  1DJA A;  3E2L A;  4OON A;  2V2F F;  3G4P A;  3I7J A;  2ZLY A;  1KE4 A;  2XR0 A;  3JYI A;  5CGS A;  4DDS A;  4BD1 A;  4KZ6 A;  3NCK A;  3MFD A;  4E3N A;  1LI9 A;  2QMI A;  2XQZ A;  1E3U A;  5DVA A;  5J8X A;  5FQJ A;  1LLB A;  4LV2 A;  1FSY A;  2XF3 A;  1XXM A;  1EWZ A;  4BL2 A;  3V50 A;  4HBT A;  1I2S A;  4OKP A;  1CEG A;  1KGF A;  2Z2M B;  1ALQ A;  3UY6 A;  1FOF A;  5CEB A;  2VGK A;  1M6K A;  2WZZ A;  2XDM A;  3AGE A;  3W4O A;  4JXW A;  3QNB A;  2WGW B;  3VP3 A;  4DXB A;  2XD5 A;  2ZD8 A;  3N8S A;  3MXR A;  3AGF A;  1ZG4 A;  3CMZ A;  1GHI A;  3NBL A;  3V3S A;  2J9P A;  3RXX A;  3FZC A;  3ZNT A;  4JF6 A;  3IHA A;  3MZE A;  4X55 A;  4KG5 A;  2H10 A;  2VGJ A;  3N6I A;  5FI6 A;  1KDW A;  2DCF A;  3BLM A;  1BUL A;  2HP5 A;  4JF5 A;  4UAA A;  3O87 A;  5HW3 A;  3VFF A;  2EX8 A;  4S2I A;  1PW1 A;  2ZM0 A;  1KGE A;  2HP9 A;  3N4I A;  4ZAM A;  4UA7 A;  4C3Q A;  3QHY A;  3ZGA B;  3S1Y A;  2Y55 A;  2ZC3 B;  4O7D A;  4B4X A;  3QNC A;  3EQV A;  4P0M A;  5E2H A;  1S6R A;  2Y2M A;  4OP5 A;  5FDH A;  4R3J A;  2EX9 A;  2UWX A;  5FAS A;  3HBR A;  3G30 A;  3HUN A;  4QU3 A;  4RVA A;  3HLG A;  5FAQ A;  5CXW A;  3LEZ A;  1HVB A;  5E2F A;  2XK1 A;  4ZJ2 A;  4QJG A;  3S4X A;  5FI7 A;  2A3U A;  4EV4 A;  3CG5 A;  2EX6 A;  4HES A;  4IED A;  4X53 A;  2WGW A;  4OOM A;  5TFQ A;  4FH2 A;  2HP6 A;  3G35 A;  1Y54 A;  2H0Y A;  3BEB A;  1BLS A;  5DTT A;  3M2J A;  1ES2 A;  1OME A;  2J8Y A;  4BD0 A;  4EWF A;  4U0T A;  3NDG A;  4DE1 A;  1FQG A;  4KZ7 A;  4WYY A;  3DW0 A;  1CEF A;  1JTG A;  4E3M A;  3OPP A;  4KZ5 A;  2Y4A A;  3S22 A;  1L0E A;  4KG6 A; 
#chains in the Genus database with same CATH topology
 4RX3 A;  3M6B A;  3C7U A;  1PIO A;  1QMF A;  3MFX A;  4FH4 A;  3GR2 A;  4FTX A;  1W63 M;  2G7U A;  5K5B A;  3E2K A;  5EVI B;  2VGL S;  3DWZ A;  4R23 A;  5CRF A;  5DTS A;  5CHU A;  3HLC A;  4Z1W A;  1S4R A;  3WS1 A;  1UWP X;  5AQ9 A;  1SKO B;  1XX2 A;  4BLM A;  3W2Z A;  4PM7 A;  3O3V A;  1EI5 A;  1Z6F A;  1K4E A;  3BFE A;  2OAQ 1;  4BJP A;  1NXY A;  1S4S A;  2Y2Q A;  4RA7 A;  3LR0 A;  4E3K A;  5CHM A;  3FPW A;  1L0G A;  3LEQ A;  4WEL A;  3N7W A;  5HL6 A;  5F68 A;  1W8Q A;  1K6S A;  5L2F A;  3SOI A;  3MJQ A;  4H6J B;  2QPN A;  4JGO A;  2E8I A;  2KOI A;  4GJ4 A;  5HDC A;  4KZ8 A;  4GS9 B;  3UE6 A;  1JWZ A;  4K08 A;  1OTB A;  1I5Q A;  1XA7 A;  5DFX A;  4YFM A;  5I94 A;  2NUT C;  1YLJ A;  5KMW A;  3VSK A;  4RQ9 A;  1E4D A;  1LL8 A;  3VP2 A;  2WAD A;  4WEJ A;  2J3T D;  2P74 A;  4OP8 A;  5FQ9 A;  4I39 A;  3OC2 A;  5AQB A;  1NLY A;  5FAO A;  4CJN A;  1GSW A;  2FZ0 A;  4XUX A;  3SS5 A;  2ZC5 B;  5HPI A;  3T4K A;  1ODV A;  4Y13 A;  2H5S A;  1WYB A;  1G68 A;  2Y8H A;  1MZU A;  3G31 A;  2QHK A;  4OLD A;  1K4F A;  1LSV A;  1K56 D;  2V9A A;  2R9X A;  2WKP A;  1VEU B;  2JBF A;  3QP6 A;  4DDY A;  3VP0 A;  2J3T C;  4IBR A;  1ERQ A;  2LB5 A;  1H8Z A;  1XGJ A;  4B4Z A;  5AVF A;  1W7F A;  3UDI A;  5L10 A;  5HWW A;  2ZC4 B;  4EQI A;  3GQZ A;  4ZDX A;  3OBF A;  3MXS A;  5EPH A;  4BBV A;  4ZTK A;  4RYE A;  1DY6 A;  2EWW A;  4KZ9 A;  3T4O A;  1JVJ A;  3B3X A;  3ITB A;  2Z2L B;  2QJ7 A;  4OVD A;  4I5S A;  4KZB A;  1BT5 A;  4EET B;  3GRJ A;  3VFH A;  1OPX A;  1TEM A;  2A2L A;  2I72 A;  2XFS A;  5G18 A;  2O0Y A;  3QP8 A;  3MS6 A;  3OZH A;  1ZG6 A;  3F1N A;  3IF6 B;  3O88 A;  4K91 A;  1N9B A;  3IXB A;  2VJW A;  3AGD A;  5FI2 A;  1LSW A;  2G2W A;  1KOU A;  4HNB A;  2VV7 A;  3MZD A;  3IX8 A;  1W5D A;  3MZF A;  2AVX A;  2GDN A;  4R4S A;  1SKO A;  4WEK A;  5DF9 A;  1Q2Q A;  5HAP A;  1YMX A;  2QZ6 A;  4LRX C;  3QP1 A;  3P98 A;  5AQA A;  2P04 A;  4Y7P A;  2RL3 A;  4EER A;  4K0W A;  1ESI A;  2WKQ A;  4RX2 A;  3BFD A;  5HDS A;  4OLG A;  5M19 A;  5F1G A;  4OPZ A;  3PBN A;  1S0W A;  4IVI A;  1NRF A;  3UB9 A;  2CC1 A;  3HVF A;  2H28 A;  3VP1 A;  3K3C A;  4QB8 A;  1UWN X;  3ZVW A;  2ZQA A;  1IKI A;  4PKY A;  1XJ3 A;  4OPY A;  1XKZ A;  1AWI A;  1ONH A;  1DP6 A;  2JKF A;  3VV4 A;  3NEC A;  5L8M A;  3B42 A;  1GCE A;  4IVK A;  1KVL A;  1NYY A;  2Y2I A;  2C5W B;  4CQH A;  1XFN A;  5EVI A;  3HLF A;  3ITA A;  3Q7Z A;  4Y0T A;  4P85 A;  2FFF B;  3NI9 A;  3GEC A;  4PAU A;  4UHU A;  1N9L A;  3A3E A;  1TF1 A;  3R4K A;  2HJE A;  3EWK A;  3NUL A;  3NDE A;  1YQS A;  2BAS A;  3E4Q A;  4KUK A;  3H82 A;  5DF8 A;  4QWO A;  3Q82 A;  2PU4 A;  2D02 A;  3V3R A;  3A3J A;  3DTE A;  1IYO A;  1KE0 A;  3IS2 B;  1T19 A;  3JPU A;  4CLC E;  3RJU A;  3HUM A;  3VOY A;  2MJ6 A;  4KUO A;  4OON A;  2UV0 E;  3MF0 A;  4AFI A;  4BD1 A;  4KZ6 A;  1EW0 A;  2QMI A;  4Y17 A;  5FQJ A;  4LV2 A;  2XF3 A;  2B95 A;  4I3I A;  4OKP A;  1CEG A;  2ACG A;  2W1R A;  4IJG A;  1OTI A;  3UY6 A;  5CEB A;  2WZZ A;  2XDM A;  3AGE A;  3F1P B;  1Y4O A;  4Q0I A;  3N8S A;  3UMD A;  3AGF A;  4DN0 A;  1DP8 A;  3RXX A;  2L0W A;  3IHA A;  3MZE A;  2H10 A;  5IS1 A;  1KDW A;  2Z6D A;  4DMZ A;  5HW3 A;  1KGE A;  1T18 A;  4UA7 A;  1FIK A;  3S1Y A;  4P6Z M;  3GDI A;  5F69 A;  3EQV A;  4P0M A;  5FDH A;  4R3J A;  2UWX A;  4EEU A;  4ZJ2 A;  4X53 A;  2WGW A;  5TFQ A;  2L4R A;  1F9I A;  4MN7 A;  2B02 A;  2JKT I;  3EOI A;  5AJG A;  2NUP C;  2JHE A;  1DRM A;  1NRJ A;  4WBG A;  4JXV A;  2XFT A;  1JWV A;  2XRN A;  1K25 A;  3P7N A;  1NY0 A;  3GTC A;  4WF0 A;  3C38 A;  3EQU A;  2JKT M;  4MLL A;  3HUO A;  1BUE A;  3F1O A;  4X56 A;  4WMC D;  4U0X A;  1L0D A;  3E98 A;  1H0M A;  1DJC A;  1LL9 A;  5GLC A;  2Y2G A;  3CAX A;  1JNU A;  4WZ5 C;  4Y3I A;  3MSH A;  1W8Y A;  5E2G A;  3ZNY A;  1XP4 A;  3T1R A;  3LIF A;  1YPR A;  2VKS A;  1K54 A;  3GSG A;  4C6Y A;  4JKT A;  3T4Q A;  4QPR A;  4CLC C;  3UB7 A;  3PBO A;  5FEF A;  2JN7 A;  5FQM A;  5HWV A;  1ZC2 A;  3TE8 A;  4PM5 A;  4E3L A;  5TR7 A;  4DE2 A;  3CZD A;  2Y2P A;  4HY8 A;  2PD8 A;  1DP9 A;  3KYE A;  4KZ3 A;  4N1X A;  1XJ2 A;  3ZYT A;  4B9O A;  2R9W A;  4DE0 A;  2Y79 A;  3Q07 A;  4R4R A;  4GNU A;  1ERO A;  2INW A;  4HOI A;  1RCJ A;  5HSQ A;  3F1N B;  3U2A A;  1IYP A;  2Y59 A;  4LV0 A;  4KZA A;  2HDQ A;  2K7S A;  4PM6 A;  1SZV A;  1KVM A;  1W79 A;  1X0O A;  1S66 L;  5C5K A;  2Y2H A;  4I3J A;  1GHP A;  1VET A;  2QYB A;  5JYP A;  4CLC A;  2XH9 A;  4MDZ A;  1PI5 A;  1F98 A;  1SHV A;  3O5Y A;  4ZBE A;  4HHD A;  3HRE A;  4E04 A;  4K0X A;  4B88 A;  4OQ0 A;  4DE3 A;  2WKH A;  2D01 A;  5FDS A;  2KLI A;  2O9A A;  5CEC A;  5M1A A;  3NC8 A;  1ESU A;  4EBL A;  1KGG A;  3T4J A;  3TW8 A;  3ZG8 B;  1OTD A;  4G3V A;  3C8C A;  4OQH A;  1K57 A;  3RFB A;  2ZM8 A;  2XD1 A;  5A91 A;  4E3I A;  1YLY A;  3BJN A;  3NOP C;  5EFW A;  4FCF A;  2W3D A;  1PI4 A;  4U3T A;  1VB6 A;  5HFO A;  5G4Z A;  1LI0 A;  5L09 A;  4EBN A;  2ZQ7 A;  4LV3 A;  4EES A;  3H82 B;  1FSW A;  1O07 A;  3BFC A;  3IH8 A;  5GHZ A;  2Y2N A;  4GHI A;  2P9V A;  2VEA A;  3CUE A;  2JCH A;  5BOH A;  4QY5 A;  3JVU A;  3TSG A;  2PR6 A;  3UDF A;  2OWH A;  5KSH A;  1MWT A;  3BM6 A;  3CHW P;  3G34 A;  4GW9 A;  4DXC A;  2EFU A;  3WRT A;  2ZMV A;  1S67 L;  2WAE A;  4HQA A;  2WGI A;  5A90 A;  2ZOI A;  2V1B A;  1RGZ A;  1G5U A;  1OJ5 A;  1TVF A;  2ZQD A;  1QME A;  3IF6 C;  3W4P A;  4A5R A;  1MKI A;  2Y2L A;  4EUZ A;  4DKI A;  3VP4 A;  1PWD A;  3E4O A;  4Y15 A;  1E3U D;  3NOU C;  2Y91 A;  1MXO A;  3A0S A;  3P09 A;  1CQA A;  1P97 A;  4HH3 A;  2Z6C A;  4F94 A;  1P9W A;  3EEH A;  2GZA A;  3LUQ A;  1UGU A;  4BBU A;  4R1G A;  1IYS A;  1GA0 A;  1WE4 A;  4X6T A;  5FAT A;  1HD8 A;  1J9M A;  3F1O B;  4G3K A;  3H7W B;  4JXG A;  1YT4 A;  2HJ9 C;  1BSG A;  1HLU P;  3KSG A;  5EEC A;  4E3J A;  1NZO A;  1L3L A;  4JGP A;  1G6A A;  1Q2P A;  3IBJ A;  4NXE A;  3MKE A;  1DJB A;  2P08 A;  4IBX A;  1T1C A;  5AQ7 A;  2J3W A;  1IKG A;  2WAF A;  3LY4 A;  2E8J A;  4ZRR A;  1SCW A;  3UB6 A;  5DKL A;  5CER A;  2PU2 A;  1YSQ A;  3OCN A;  4GD6 A;  3JVV A;  5CGW A;  1KDS A;  3MR0 A;  3VSL A;  2M7U A;  2PAV P;  3H7W A;  4BWI A;  3WS0 A;  3UPP A;  5TBM B;  5EVE A;  3C4O A;  4II7 A;  2HDS A;  3B33 A;  3H9W A;  3WS4 A;  5J3W A;  4Q8I A;  4X69 A;  4WM9 A;  3HL9 A;  3UE0 A;  1IYQ A;  4P6Z S;  1BTL A;  1D1J A;  1LT0 A;  4HJ4 A;  3CLO A;  1KE3 A;  4MBF A;  4MN5 A;  4S2N A;  3VOZ A;  3OOV A;  3G6O A;  1SKF A;  4BQM A;  2J7V A;  1XJ6 A;  3G2Y A;  4JPM A;  5HX9 A;  3EEA A;  2JE5 A;  3MKF A;  3LFV A;  3IH9 A;  2XA7 S;  5A92 A;  1RGY A;  1DJA A;  3G4P A;  3I7J A;  2ZLY A;  4DDS A;  1OTA A;  3NCK A;  4JGR A;  2XQZ A;  5DVA A;  2QWS A;  1XXM A;  3FG8 A;  2M1C A;  1V9Y A;  4HBT A;  1I2S A;  2VZW A;  4M4X A;  2PYP A;  2W1T B;  1M6K A;  2A24 B;  4L9E A;  4JXW A;  3QNB A;  2WGW B;  2XD5 A;  4YOF A;  2VX8 A;  1ZG4 A;  1GHI A;  1T1A A;  4JF6 A;  2VGJ A;  3N6I A;  2DCF A;  4UAA A;  1BUL A;  4I3A A;  4S2I A;  1PW1 A;  4ZAM A;  3N4I A;  2HZ5 A;  3ZGA B;  3IS2 A;  2Y55 A;  2HGV A;  3S7N A;  4B4X A;  4XT2 A;  5E2H A;  3TRC A;  4OP5 A;  2V8C A;  2EX9 A;  1TD5 A;  2XK1 A;  3S4X A;  4EV4 A;  4FH2 A;  2HP6 A;  1Y54 A;  3BEB A;  1NWZ A;  4CLC B;  3BY9 A;  4D60 A;  4DE1 A;  3NDG A;  2W3H A;  4KZ7 A;  4WYY A;  3DW0 A;  1JTG A;  3LR5 A;  2CMN A;  3CPT A;  3OPP A;  4KZ5 A;  4NXB A;  3MQO A;  5HL1 A;  3SS3 A;  5HD3 A;  5CED A;  5J4E A;  1YM1 A;  3L9K A;  1IEM A;  3OPL A;  4CPK A;  4YWZ A;  3PHY A;  4R3A A;  1K55 C;  1O7E A;  1A0K A;  2ZC7 A;  3OPH A;  1Y28 A;  4MBH A;  3B47 A;  2EXB A;  1U60 A;  4R6L A;  2WKI A;  4KG2 A;  1PZO A;  3PBR A;  4DRT A;  1RP5 A;  2R78 A;  1NZU A;  1LHY A;  5GLA A;  2IWB A;  2M7V A;  5FQI A;  2JC7 A;  4DF6 A;  3UN7 A;  1K55 A;  4GD8 A;  1M40 A;  2V20 A;  3ZG7 B;  1MY8 A;  3DWK A;  3HCY A;  4DJ2 A;  2KX6 A;  4ZJ3 A;  3RXW A;  4GB7 A;  4PM9 A;  5GL9 A;  3IX4 A;  2QJ5 A;  4JLF A;  1CK3 A;  4QY6 A;  2JKR M;  4F3L A;  5L07 A;  3R7W B;  4HP9 A;  3FKV A;  4KQD A;  1XGI A;  3NY4 A;  4L0L A;  2XSS A;  2Y2O A;  5DFY A;  1YLP A;  2HF6 A;  1JTD A;  4Q0H A;  4MN6 A;  1MBL A;  5GHX A;  3VE4 A;  5CTM A;  1I2W A;  1ZHH B;  5CX7 A;  3UPO A;  5DF7 A;  3DTK A;  3MQQ A;  4S2M A;  3O86 A;  1YAX A;  3DBA A;  3IQA A;  5EVL A;  3RH8 B;  2HDR A;  2PR5 A;  4OOL A;  5FQK A;  3UO9 A;  2HDU A;  3NOT C;  1YLT A;  4HJ6 A;  1NYM A;  1TS6 A;  5JYO A;  4PHT A;  3UB5 P;  3TJZ C;  1E25 A;  2PBD P;  3BFF A;  4LLO B;  5EM1 A;  4GKU A;  3IXH A;  4LRZ E;  3ICY A;  4HH2 A;  4NEE D;  3ZG0 A;  4MEZ A;  4FSF A;  2V0W A;  1J3W A;  5KIZ A;  4XT2 B;  3T50 A;  3M2K A;  4OH0 A;  3IWQ A;  4PM8 A;  2ZM2 A;  2OWJ A;  3OCL A;  3QP2 A;  4PPR A;  2O9C A;  3IWO A;  4BEN A;  4GDN A;  5HZH A;  5GLB A;  3NIA A;  4N1H A;  4NK3 A;  5E2E A;  4GLQ A;  2IWD A;  3A3D A;  5CHJ A;  2ZQ9 A;  5EV0 A;  4IHQ A;  3HLD A;  4UA6 A;  4UQI S;  3U4L P;  5EUA A;  3OPR A;  2PBY A;  5J7E A;  1K57 C;  4QHC A;  4EXO A;  2Y2K A;  4I38 A;  3ULF A;  4P87 A;  3DAV A;  3VE3 A;  3UE1 A;  4H6J A;  1VM1 A;  2OV5 A;  1N4O A;  3LGO A;  3M6H A;  4S2L A;  5CTN A;  3DTI A;  4O0P A;  4EU0 A;  4R3B A;  5DKK A;  1TS7 A;  5AVE A;  1WYC A;  3HLB A;  4Q0J A;  1N9N A;  2A24 A;  2WYX A;  1S1Y A;  4O8G A;  5TGF A;  4BBT A;  2W27 A;  4GCZ A;  3PYP A;  4EUV A;  3BW6 A;  3NJA A;  1PFL A;  1K6R A;  2O9B A;  4R38 A;  1F5M A;  1OTE A;  3ZVT A;  3T4S A;  3KO6 A;  2PDR A;  3MXQ A;  1YLW A;  1PW8 A;  3SS4 A;  5KZH A;  4LCL A;  2K31 A;  5HDD A;  3HJI A;  1TS0 A;  1PZP A;  3ISG A;  3IX3 A;  1ZKJ A;  1VQQ A;  3G32 A;  3UB8 A;  1BLC A;  3GMW A;  3LIE A;  2OOL A;  3C7V A;  1FIL A;  1PNE A;  1P9R A;  2W3F A;  2B18 A;  4QD4 A;  2VGL M;  4E6W A;  4HJ3 A;  3ZDJ A;  5TBM A;  3EGD C;  3A0R A;  3QP4 A;  5FL3 A;  2XLN A;  3MBZ A;  3IBR A;  1FR1 A;  3A3F A;  3VMA A;  5HAR A;  3HLE A;  1TS8 A;  1PYY A;  4OOY A;  3FYZ A;  3UNW A;  3CI6 A;  1BZA A;  4JXS A;  2Q9M A;  3C4P A;  1MC0 A;  2VA0 A;  4Y0U A;  3LY3 A;  2WZX A;  4WLA A;  4LCM A;  4NXG A;  3PTE A;  3TOI A;  2FFY A;  3RTY A;  4F3L B;  3KX0 X;  4ARZ A;  2W3E A;  3CUE C;  3LIC A;  3BQ8 A;  3SH9 A;  3WS2 A;  3ZG9 B;  2A49 A;  1FCO A;  4CLC D;  1ES5 A;  2Q0O A;  3Q81 A;  1BLP A;  1L0F A;  1CF0 A;  3Q7V B;  3PBQ A;  5EVI D;  4XUZ A;  4LEN A;  4HIA A;  3N8L A;  4UQI M;  1XJ4 A;  1XFQ A;  4D2O A;  2OLV A;  3LCE A;  5HD5 A;  3WS5 A;  3C5A A;  4C75 A;  5F1F A;  4JF4 A;  2YKH A;  1CJF A;  5FA7 A;  2V2F F;  1KE4 A;  3T1S A;  3MFD A;  4E3N A;  1LI9 A;  1E3U A;  3P01 A;  1LLB A;  3T4T A;  4FOF A;  3V50 A;  5DJT A;  2WKR A;  1KGF A;  2Z2M B;  1FOF A;  3PXP A;  3VP3 A;  2ZD8 A;  3CWF A;  3CMZ A;  3NBL A;  3V3S A;  3LIA A;  3FZC A;  5F6A A;  1LSX A;  2PT7 A;  4KG5 A;  3LR4 A;  5FI6 A;  3BLM A;  4JF5 A;  1YKD A;  4FUW A;  3VFF A;  2EX8 A;  4YNR A;  2ZM0 A;  4O7D A;  3QNC A;  1GSV A;  1S6R A;  2Y2M A;  4LRY C;  3E4P A;  2PRF A;  1D06 A;  3G30 A;  3HUN A;  4QU3 A;  4Y5F A;  5CXW A;  4MCW A;  3LEZ A;  1HVB A;  5HWT A;  4QJG A;  5FI7 A;  4B93 A;  2A3U A;  3CG5 A;  4IED A;  4DJ3 A;  1VET B;  4X1L A;  2H0Y A;  1ES2 A;  1OME A;  4BD0 A;  4EWF A;  4U0T A;  1CEF A;  4E3M A;  2LB9 A;  2Y4A A;  1L0E A;  4KG6 A;  1YLZ A;  4E3O A;  4R0Q A;  4M3K A;  2XGN A;  1T1B A;  2WKE A;  5EVI C;  5MC7 A;  3KYQ A;  3T4L A;  1IFQ A;  4Z9Q A;  3K3D A;  2ZJ9 A;  3UE3 A;  3BFG A;  4EW7 A;  4ME4 A;  3R7W A;  5FSR A;  4Y2F A;  2IWC A;  1ES3 A;  3FWL A;  5U47 A;  1HZO A;  2J80 A;  2VLG A;  4NKP A;  4ZJ1 A;  2YKF A;  4G3W A;  3T1X A;  4R70 A;  5HPF A;  1XA1 A;  1CI8 A;  4KZ4 A;  1K0K A;  2XA7 M;  4S2N C;  2FH5 A;  3FKW A;  5KSC A;  4S2O A;  4HP4 A;  4MNR A;  3FV7 A;  4UA9 A;  2ZL1 B;  5F5Y A;  4JGQ A;  3ZHH A;  2X01 A;  1K56 A;  5A93 A;  1D7E A;  2C6W B;  2G2U A;  2Q9N A;  2ZBB A;  2EX2 A;  1ES4 A;  4XXR A;  1N9O A;  3TG9 A;  2QKP A;  1L2S A;  2PHY A;  3LI9 A;  3Q7V A;  4EBP A;  1FCN A;  4IUH A;  3GVB A;  3IF5 A;  4GOG A;  2XRO A;  3IT9 A;  2V1A A;  1BYW A;  2K2N A;  2J9O A;  5TJJ A;  3WWX A;  3C2W A;  4MMN A;  3IXD A;  4S2K A;  2BLS A;  1OT6 A;  1G28 A;  4E6X A;  2B5R A;  4LV1 A;  4JBF A;  3SH8 A;  1MWS A;  2V1Z A;  3PBS A;  2BG1 A;  5M18 A;  4OQG A;  1CI9 A;  3ZQ5 A;  3SH7 A;  2GJ3 A;  1VHM A;  3F1P A;  1GHM A;  2EFX A;  2WGV A;  4BL3 A;  3IHB A;  3DTM A;  5IHV A;  4P6B A;  1OT9 A;  1C3B A;  3N8R A;  1TDL A;  4X68 A;  2Y2J A;  3UPN A;  4WMC A;  5A8B A;  5EM0 A;  5D3O A;  1S1Z A;  3T12 B;  3BQA A;  3ZFZ A;  1FCM A;  4OQI A;  1NJ4 A;  2HPB A;  4WL9 A;  3V5M A;  2L1M A;  3IF6 A;  3G2Z A;  4S2P A;  1IEL A;  2ZQC A;  5IT5 A;  3S7Q A;  1K54 C;  5E43 A;  4UEY A;  3KSF A;  5F82 A;  3EGX C;  3CJM A;  4ID4 A;  3BLS A;  4WZ5 A;  4GZB A;  4EEP A;  3S7O A;  3UDX A;  4OPR A;  2PYR A;  3SW1 A;  3LIB A;  3WRZ A;  1JWP A;  5IU1 A;  1YSP A;  4KQQ A;  1PRQ A;  4ETZ A;  5GLD A;  1LL5 A;  3C30 A;  2EWV A;  1ERM A;  3L7H A;  4IUK A;  4OPQ A;  5LBR A;  4LPZ A;  3UME A;  4ESP A;  2OAP 1;  2RCX A;  3MMH A;  2W0N A;  2P7J A;  2EXA A;  2W1T A;  3BRM A;  1XPB A;  1WA9 A;  3VOL A;  2VK3 A;  5HAI A;  4KEN B;  4HEF A;  2OSU A;  2BTF P;  4WN5 A;  5F83 A;  3MQ0 A;  3PR6 A;  1TDG A;  1H3Q A;  2WK0 A;  3IXG A;  1GA9 A;  3PBT A;  3PAE A;  3V39 A;  2V8F A;  5EE8 A;  1FR6 A;  1F2K A;  3SZT A;  3LYX A;  2ZMF A;  3D4F A;  4GHI B;  4NG2 A;  4O01 A;  1ZTU A;  5DTK A;  1VEU A;  2DRW A;  3W4Q A;  4WZ4 A;  3A0V A;  1PWC A;  4GN2 A;  2DNS A;  2KDK A;  4GS9 A;  1MWR A;  1ACF A;  3LID A;  4L9G A;  3BEC A;  2JKG A;  3D3O A;  1K38 A;  2JKR I;  4FD8 A;  3Q1F A;  4X25 A;  4S2J A;  2HV1 A;  3ZG5 A;  2I9V A;  4ARZ B;  1MKM A;  2XEP A;  3A3I A;  4H8R A;  4ETX A;  2H0T A;  2ZMA A;  3HJK A;  1STZ A;  2ZC6 B;  5EOE A;  2WUQ A;  4EQ1 A;  3LR3 A;  1PWG A;  1G6O A;  1IOU A;  2ZQ8 A;  3PAG A;  3BYD A;  3BY8 A;  4YIN A;  1SDE A;  2OLU A;  4KQO A;  3KSH A;  4N9K A;  4NET A;  2P9V B;  5EOO A;  4NXF A;  2X71 A;  2GNX A;  3QP5 A;  4LGW A;  1H8Y A;  3W8K A;  2DMW A;  4PMA A;  5HAQ A;  4HBU A;  3IWI A;  3GV9 A;  5FQQ A;  2ZL1 A;  1BLH A;  4N92 A;  4X1M A;  3CIT A;  2VV6 A;  1HTZ A;  1YMS A;  4KQR A;  1SDN A;  1MWU A;  3NHQ A;  5G4Y A;  1ONG A;  4GDB A;  4LFU A;  2GX5 A;  5CGX A;  4Y0O A;  3CPT B;  1MPL A;  3KSI A;  1H5X A;  3ZCZ A;  1AXB A;  2V0U A;  1V9Z A;  3HLW A;  3LO7 A;  1OJG A;  4MBK A;  2X02 A;  5FAP A;  3OLO A;  4WUJ A;  2W3G A;  5GHY A;  4N9L A;  3LI8 A;  3E2L A;  3JYI A;  5CGS A;  2XR0 A;  3FC7 A;  5J8X A;  2EA9 A;  1NLZ A;  1FSY A;  1EWZ A;  4BL2 A;  1ALQ A;  2VGK A;  4PKY G;  3D72 A;  3W4O A;  4DXB A;  5FEG A;  3MXR A;  3FPV A;  2J9P A;  3ZNT A;  4X55 A;  4HI4 A;  3K2N A;  2HP5 A;  3KYZ A;  3O87 A;  4C3Q A;  2HP9 A;  3QHY A;  2IA2 A;  2ZC3 B;  1P0Z A;  3E0Y A;  1GSX A;  5I5L A;  2PD7 A;  5FAS A;  3HBR A;  3D9Y A;  4RVA A;  3HLG A;  5DJU A;  5FAQ A;  5E2F A;  4BMW A;  2ZOH A;  3S7P A;  4HES A;  2EX6 A;  2VV8 A;  3T1Q B;  4OOM A;  3V67 A;  4L9F A;  1Z09 A;  3G35 A;  5DTT A;  1BLS A;  3M2J A;  2J8Y A;  1H8M A;  3BWL A;  1FQG A;  2O99 A;  1W63 Q;  3S22 A; 
#chains in the Genus database with same CATH homology
 4WBG A;  4JXV A;  1YLZ A;  4E3O A;  4R0Q A;  4RX3 A;  2XFT A;  3M6B A;  3C7U A;  3SS3 A;  5CED A;  5HL1 A;  1JWV A;  1PIO A;  1QMF A;  1YM1 A;  4M3K A;  1IEM A;  3OPL A;  4FH4 A;  4CPK A;  2XGN A;  1K25 A;  1NY0 A;  3GTC A;  2WKE A;  5EVI C;  3GR2 A;  3EQU A;  1K55 C;  1O7E A;  4MLL A;  2ZC7 A;  1BUE A;  3HUO A;  3OPH A;  4MBH A;  4Z9Q A;  4X56 A;  2ZJ9 A;  4WMC D;  3BFG A;  3UE3 A;  3E2K A;  2EXB A;  4U0X A;  1L0D A;  1U60 A;  1DJC A;  1LL9 A;  2WKI A;  5FSR A;  4KG2 A;  5EVI B;  2IWC A;  1ES3 A;  3DWZ A;  3FWL A;  1HZO A;  4R23 A;  5CRF A;  1PZO A;  2Y2G A;  3PBR A;  5DTS A;  5GLC A;  4DRT A;  4WZ5 C;  4ZJ1 A;  5CHU A;  1RP5 A;  1W8Y A;  5E2G A;  1NZU A;  3HLC A;  1LHY A;  5GLA A;  3WS1 A;  2IWB A;  1XA1 A;  5FQI A;  2JC7 A;  4DF6 A;  3UN7 A;  3ZNY A;  1CI8 A;  1K55 A;  1XP4 A;  4GD8 A;  4KZ4 A;  5AQ9 A;  1M40 A;  2V20 A;  3ZG7 B;  1MY8 A;  1K54 A;  3GSG A;  4C6Y A;  4S2N C;  3DWK A;  1XX2 A;  4BLM A;  4JKT A;  3FKW A;  5KSC A;  4S2O A;  4MNR A;  3FV7 A;  4UA9 A;  4ZJ3 A;  3ZHH A;  3RXW A;  2X01 A;  1K56 A;  5A93 A;  3PBO A;  3O3V A;  4GB7 A;  4PM9 A;  4PM7 A;  1EI5 A;  1Z6F A;  5FQM A;  5GL9 A;  4JLF A;  1K4E A;  2C6W B;  2G2U A;  1ZC2 A;  2Q9N A;  3BFE A;  1CK3 A;  4QY6 A;  4PM5 A;  4E3L A;  4BJP A;  5TR7 A;  4DE2 A;  2EX2 A;  3CZD A;  1NXY A;  2Y2P A;  2Y2Q A;  4RA7 A;  1ES4 A;  4E3K A;  4N1X A;  4KZ3 A;  5CHM A;  1L0G A;  3FKV A;  4WEL A;  3N7W A;  4XXR A;  1W8Q A;  1K6S A;  1XGI A;  3NY4 A;  4L0L A;  3TG9 A;  5L2F A;  2R9W A;  4DE0 A;  1L2S A;  3SOI A;  2Y2O A;  3Q07 A;  1YLP A;  3Q7V A;  4R4R A;  4GNU A;  1JTD A;  4EBP A;  1FCN A;  1ERO A;  2QPN A;  3GVB A;  1MBL A;  1RCJ A;  3IF5 A;  5CTM A;  5GHX A;  1I2W A;  2E8I A;  4GOG A;  3UPO A;  3IT9 A;  4KZ8 A;  2J9O A;  5DF7 A;  4S2M A;  1JWZ A;  1IYP A;  2Y59 A;  1I5Q A;  3WWX A;  3O86 A;  3IXD A;  4S2K A;  1XA7 A;  2BLS A;  4LV0 A;  4KZA A;  4YFM A;  2HDQ A;  4PM6 A;  5I94 A;  3IQA A;  1YLJ A;  4E6X A;  2B5R A;  5KMW A;  4LV1 A;  4JBF A;  5EVL A;  3VSK A;  1KVM A;  1W79 A;  1E4D A;  2HDR A;  3VP2 A;  3SH8 A;  1MWS A;  2V1Z A;  2WAD A;  3PBS A;  4OOL A;  5FQK A;  3UO9 A;  2HDU A;  4WEJ A;  2Y2H A;  2P74 A;  2BG1 A;  1YLT A;  5M18 A;  1GHP A;  4OP8 A;  4OQG A;  1NYM A;  5FQ9 A;  1CI9 A;  5JYO A;  3OC2 A;  5AQB A;  5JYP A;  1E25 A;  5FAO A;  3BFF A;  2XH9 A;  3SH7 A;  4GKU A;  1PI5 A;  4CJN A;  3IXH A;  1GHM A;  4XUX A;  1SHV A;  3SS5 A;  4ZBE A;  2ZC5 B;  3ZG0 A;  2EFX A;  2WGV A;  4BL3 A;  3HRE A;  4MEZ A;  3IHB A;  4FSF A;  3DTM A;  4K0X A;  4B88 A;  4OQ0 A;  2H5S A;  1WYB A;  4DE3 A;  5IHV A;  2WKH A;  1G68 A;  3M2K A;  4OH0 A;  3IWQ A;  3G31 A;  4PM8 A;  4P6B A;  2ZM2 A;  4OLD A;  3OCL A;  1C3B A;  3N8R A;  5CEC A;  5M1A A;  1TDL A;  1K4F A;  4PPR A;  1K56 D;  3NC8 A;  1ESU A;  3IWO A;  4BEN A;  4GDN A;  4EBL A;  5GLB A;  3NIA A;  4X68 A;  1KGG A;  2R9X A;  4N1H A;  4NK3 A;  2Y2J A;  3UPN A;  4WMC A;  5E2E A;  2JBF A;  5D3O A;  4DDY A;  5CER A;  3ZG8 B;  3VP0 A;  4IBR A;  4OQH A;  1K57 A;  2IWD A;  1ERQ A;  3A3D A;  3ZFZ A;  1FCM A;  2ZM8 A;  1NJ4 A;  2HPB A;  2XD1 A;  1H8Z A;  4OQI A;  5A91 A;  3V5M A;  1YLY A;  4E3I A;  3IF6 A;  5CHJ A;  1XGJ A;  2ZQ9 A;  3G2Z A;  4S2P A;  4B4Z A;  1IEL A;  4FCF A;  2ZQC A;  3HLD A;  4UA6 A;  1K54 C;  1PI4 A;  4U3T A;  3OPR A;  5E43 A;  2PBY A;  5EUA A;  5HFO A;  1K57 C;  1LI0 A;  1W7F A;  4QHC A;  4EBN A;  5F82 A;  2Y2K A;  3UDI A;  2ZQ7 A;  2ZC4 B;  4EQI A;  4LV3 A;  4P87 A;  3CJM A;  3GQZ A;  3UE1 A;  1FSW A;  1O07 A;  3BFC A;  3IH8 A;  4ZDX A;  5EPH A;  1VM1 A;  2Y2N A;  3MXS A;  4ID4 A;  5GHZ A;  3BLS A;  4WZ5 A;  4GZB A;  4RYE A;  4ZTK A;  2P9V A;  1DY6 A;  2OV5 A;  1N4O A;  4OPR A;  3M6H A;  3UDX A;  2JCH A;  5BOH A;  4QY5 A;  4KZ9 A;  3TSG A;  3UDF A;  1JVJ A;  1JWP A;  4S2L A;  3WRZ A;  3B3X A;  5KSH A;  1MWT A;  3ITB A;  5CTN A;  3BM6 A;  2Z2L B;  3G34 A;  4KQQ A;  1LL5 A;  4OPQ A;  4R3B A;  5GLD A;  1ERM A;  4OVD A;  4DXC A;  2EFU A;  4KZB A;  1BT5 A;  2RCX A;  1WYC A;  3GRJ A;  2EXA A;  3WRT A;  3VFH A;  3BRM A;  3HLB A;  1XPB A;  1TEM A;  2I72 A;  2WYX A;  5HAI A;  2XFS A;  4KEN B;  4HEF A;  2OSU A;  5G18 A;  5TGF A;  2WAE A;  3OZH A;  5F83 A;  2WGI A;  5A90 A;  1ZG6 A;  3IF6 B;  3O88 A;  4K91 A;  1N9B A;  1TDG A;  3IXB A;  2WK0 A;  1RGZ A;  3IXG A;  1GA9 A;  1K6R A;  1TVF A;  3PBT A;  3PAE A;  3AGD A;  5FI2 A;  3ZVT A;  2G2W A;  3V39 A;  5EE8 A;  1FR6 A;  2ZQD A;  1QME A;  3IF6 C;  3W4P A;  4A5R A;  1MKI A;  2Y2L A;  4EUZ A;  3MZD A;  4DKI A;  3VP4 A;  1YLW A;  1PW8 A;  1PWD A;  1W5D A;  3SS4 A;  3D4F A;  3MZF A;  2GDN A;  4R4S A;  4LCL A;  5KZH A;  5DTK A;  2DRW A;  4WEK A;  3W4Q A;  4WZ4 A;  1E3U D;  5DF9 A;  1PWC A;  1Q2Q A;  2Y91 A;  1MXO A;  5HAP A;  4GN2 A;  1PZP A;  1YMX A;  2DNS A;  2QZ6 A;  3ISG A;  3P98 A;  1ZKJ A;  3P09 A;  5AQA A;  1MWR A;  1VQQ A;  3G32 A;  4Y7P A;  2RL3 A;  4K0W A;  1BLC A;  3GMW A;  1ESI A;  4F94 A;  4RX2 A;  3BEC A;  3BFD A;  3C7V A;  1K38 A;  4OLG A;  4FD8 A;  5M19 A;  3Q1F A;  4R1G A;  1IYS A;  1GA0 A;  1WE4 A;  4OPZ A;  4X6T A;  5F1G A;  1HD8 A;  5FAT A;  3PBN A;  1J9M A;  1S0W A;  4IVI A;  1NRF A;  4QD4 A;  4S2J A;  2CC1 A;  4E6W A;  3HVF A;  3ZG5 A;  3ZDJ A;  4JXG A;  2XEP A;  3A3I A;  1YT4 A;  4H8R A;  3VP1 A;  2XLN A;  2H0T A;  2ZMA A;  3MBZ A;  4QB8 A;  1BSG A;  2ZC6 B;  3ZVW A;  5EOE A;  5EEC A;  2WUQ A;  4E3J A;  1FR1 A;  1NZO A;  1IKI A;  2ZQA A;  3A3F A;  5HAR A;  3HLE A;  3VMA A;  1PYY A;  4OPY A;  1G6A A;  1Q2P A;  4OOY A;  1PWG A;  1XKZ A;  3FYZ A;  2ZQ8 A;  3MKE A;  3UNW A;  1ONH A;  3PAG A;  1DJB A;  1BZA A;  4JXS A;  3BYD A;  2Q9M A;  4IBX A;  5AQ7 A;  3C4P A;  1IKG A;  2WAF A;  4Y0U A;  3LY4 A;  4YIN A;  1SCW A;  1SDE A;  2OLU A;  1GCE A;  4KQO A;  4IVK A;  1KVL A;  1NYY A;  2PU2 A;  2WZX A;  3LY3 A;  4N9K A;  2Y2I A;  3OCN A;  4GD6 A;  4NET A;  2C5W B;  2P9V B;  4LCM A;  5CGW A;  3HLF A;  3ITA A;  5EOO A;  1KDS A;  3Q7Z A;  5EVI A;  3VSL A;  4Y0T A;  3PTE A;  2X71 A;  3TOI A;  2FFY A;  4P85 A;  3WS0 A;  3UPP A;  2FFF B;  3NI9 A;  1H8Y A;  3W8K A;  4UHU A;  4PMA A;  3A3E A;  5HAQ A;  3SH9 A;  4HBU A;  3WS2 A;  3ZG9 B;  2A49 A;  1FCO A;  3C4O A;  3IWI A;  3GV9 A;  5FQQ A;  1ES5 A;  3NDE A;  2HDS A;  3Q81 A;  1YQS A;  1BLP A;  1L0F A;  3Q7V B;  3WS4 A;  4Q8I A;  3PBQ A;  5EVI D;  4XUZ A;  1BLH A;  4X69 A;  4N92 A;  4WM9 A;  4LEN A;  3HL9 A;  5DF8 A;  3UE0 A;  3Q82 A;  1IYQ A;  1HTZ A;  1BTL A;  3N8L A;  1YMS A;  4KQR A;  1SDN A;  1KE3 A;  1MWU A;  1ONG A;  4MBF A;  4GDB A;  2PU4 A;  4S2N A;  3VOZ A;  4D2O A;  2OLV A;  3V3R A;  5CGX A;  3A3J A;  5U47 A;  3LCE A;  4Y0O A;  1IYO A;  1MPL A;  1SKF A;  3WS5 A;  4BQM A;  1H5X A;  2J7V A;  1KE0 A;  3G2Y A;  3C5A A;  3ZCZ A;  4C75 A;  5F1F A;  1AXB A;  3HLW A;  3LO7 A;  4JPM A;  3RJU A;  3HUM A;  4MBK A;  5HX9 A;  2X02 A;  5FAP A;  2JE5 A;  3VOY A;  3MKF A;  4JF4 A;  5FA7 A;  3IH9 A;  5A92 A;  5GHY A;  1RGY A;  4N9L A;  1DJA A;  3E2L A;  4OON A;  2V2F F;  3G4P A;  3I7J A;  2ZLY A;  1KE4 A;  2XR0 A;  3JYI A;  5CGS A;  4DDS A;  4BD1 A;  4KZ6 A;  3NCK A;  3MFD A;  4E3N A;  1LI9 A;  2QMI A;  2XQZ A;  1E3U A;  5DVA A;  5J8X A;  5FQJ A;  1LLB A;  4LV2 A;  1FSY A;  2XF3 A;  1XXM A;  1EWZ A;  4BL2 A;  3V50 A;  4HBT A;  1I2S A;  4OKP A;  1CEG A;  1KGF A;  2Z2M B;  1ALQ A;  3UY6 A;  1FOF A;  5CEB A;  2VGK A;  1M6K A;  2WZZ A;  2XDM A;  3AGE A;  3W4O A;  4JXW A;  3QNB A;  2WGW B;  3VP3 A;  4DXB A;  2XD5 A;  2ZD8 A;  3N8S A;  3MXR A;  3AGF A;  1ZG4 A;  3CMZ A;  1GHI A;  3NBL A;  3V3S A;  2J9P A;  3RXX A;  3FZC A;  3ZNT A;  4JF6 A;  3IHA A;  3MZE A;  4X55 A;  4KG5 A;  2H10 A;  2VGJ A;  3N6I A;  5FI6 A;  1KDW A;  2DCF A;  3BLM A;  1BUL A;  2HP5 A;  4JF5 A;  4UAA A;  3O87 A;  5HW3 A;  3VFF A;  2EX8 A;  4S2I A;  1PW1 A;  2ZM0 A;  1KGE A;  2HP9 A;  3N4I A;  4ZAM A;  4UA7 A;  4C3Q A;  3QHY A;  3ZGA B;  3S1Y A;  2Y55 A;  2ZC3 B;  4O7D A;  4B4X A;  3QNC A;  3EQV A;  4P0M A;  5E2H A;  1S6R A;  2Y2M A;  4OP5 A;  5FDH A;  4R3J A;  2EX9 A;  2UWX A;  5FAS A;  3HBR A;  3G30 A;  3HUN A;  4QU3 A;  4RVA A;  3HLG A;  5FAQ A;  5CXW A;  3LEZ A;  1HVB A;  5E2F A;  2XK1 A;  4ZJ2 A;  4QJG A;  3S4X A;  5FI7 A;  2A3U A;  4EV4 A;  3CG5 A;  2EX6 A;  4HES A;  4IED A;  4X53 A;  2WGW A;  4OOM A;  5TFQ A;  4FH2 A;  2HP6 A;  3G35 A;  1Y54 A;  2H0Y A;  3BEB A;  1BLS A;  5DTT A;  3M2J A;  1ES2 A;  1OME A;  2J8Y A;  4BD0 A;  4EWF A;  4U0T A;  3NDG A;  4DE1 A;  1FQG A;  4KZ7 A;  4WYY A;  3DW0 A;  1CEF A;  1JTG A;  4E3M A;  3OPP A;  4KZ5 A;  2Y4A A;  3S22 A;  1L0E A;  4KG6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...