3WS0A

N288q-n321q mutant beta-lactamase derived from chromohalobacter sp.560 (condition-1a)
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
357
structure length
357
Chain Sequence
b'QTREVLDPIVASLMEAQQIPGMAIALVRPEGTTISHYGAADRETGTPVDDDTLFEIGSLSKTLTATLASLAEVEGKLDFDAPVSRYLPELEGSAFDDISGLNLGTHTGGGLPLFVPDEVTDRASLMAWYREWQPTEPIGESRTYSNLGIGLLGLETAASLDGEFVPTMRAKVLAPLGMQDTWYDVPEARMADYAMGEDKDGQPTRVSPGVLDDEAYGIKTTAADLAKLVRANLHLADVDAELQQAIDATRQGHYRVGDMTQALIWEQYSLPVAPETLRAGQGYDMILEPNAAEALEPPQSPRDDVWVNKTGSTQGFGGYIVMLPGKHTGLVMLANKNYPNDARVEAAYRILSGLGAI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase
publication title Structure of a highly acidic beta-lactamase from the moderate halophile Chromohalobacter sp. 560 and the discovery of a Cs(+)-selective binding site
pubmed doi rcsb
source organism Chromohalobacter sp. 560
molecule tags Hydrolase
total genus 120
structure length 357
sequence length 357
chains with identical sequence B, C
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2014-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3ws0A00
1K38A 1JWVA 3NIAA 5AQBA 5A91A 1FSWA 4N9KA 4YINA 3C7VA 1WE4A 5FQ9A 1K57C 3Q1FA 1TEMA 3A3DA 4GZBA 2R9XA 2XQZA 2FFFB 2Y2GA 2ZQAA 3FKVA 3MKEA 4PM7A 1W7FA 4Y0UA 3VMAA 1PI4A 4QJGA 1KE4A 2ZQ8A 1N9BA 4RA7A 5E43A 5FI2A 5JYOA 5KSHA 3NCKA 5HAPA 4UHUA 5CTMA 4BD0A 3V5MA 1I2SA 3AGDA 4Y0OA 2X02A 1H8ZA 1MKIA 3IHAA 5FQKA 5GHYA 5IHVA 1CI9A 1G6AA 2XFTA 5F83A 1K25A 3MZFA 1JVJA 5TGFA 1ZC2A 1PYYA 3FYZA 2V20A 2IWDA 2OV5A 4FSFA 2ZQ7A 5CERA 3UE3A 2H0YA 2ZQ9A 1SCWA 2H5SA 5DF9A 1FOFA 4OONA 3DW0A 3UE0A 4YFMA 5HAQA 4E3IA 1MY8A 3HUOA 3QNCA 3PBNA 1XGIA 2Z2MB 3EQUA 1J9MA 1L0DA 1OMEA 2XH9A 4N1XA 4L0LA 4WYYA 3VSLA 4MBFA 2A3UA 2Z2LB 5CHUA 3PBTA 4DDYA 2Y2LA 4KZ3A 1K6SA 1E3UD 1ESIA 3A3FA 3IH9A 1G68A 3O87A 2JBFA 3OCLA 4GKUA 1ERQA 2HDQA 4OP5A 4PMAA 2XK1A 2HPBA 1BUEA 3N8RA 3HLBA 5TR7A 5CEBA 4S2PA 2FFYA 4WMCA 4C6YA 1SHVA 2RL3A 4MNRA 4OPQA 4QB8A 3ZG0A 2ZLYA 4JPMA 4RYEA 3VOZA 3IXHA 1W8YA 3E2LA 1YLTA 1KGGA 3A3IA 5CGXA 5F1FA 1BSGA 1IYQA 2XDMA 1LLBA 1NY0A 3WRZA 5D3OA 2EX9A 2Y2JA 3EQVA 2WGWA 4X68A 5M18A 1K57A 1K54C 4B4XA 3TOIA 1VM1A 4P85A 1ZG4A 4JKTA 3SS4A 3ZGAB 1ES2A 3UO9A 5AQAA 1DJAA 1O7EA 2C6WB 3HBRA 4E6WA 3IWOA 1K55C 3BLMA 4OOMA 3NDEA 2A49A 3V3RA 3C7UA 2ZC3B 4NK3A 3Q07A 4B88A 3NC8A 1IKIA 1ZKJA 3Q81A 3LY3A 1KGEA 2WZZA 5EVID 1CK3A 4DKIA 2WADA 4U3TA 1LHYA 2V1ZA 5DF7A 4XXRA 5CHJA 4LV2A 4OQIA 3ZFZA 4BQMA 3M2JA 4U0XA 4K0WA 4GD6A 3W4PA 3G31A 3ZG8B 3OZHA 1YQSA 4FH2A 4JBFA 3I7JA 1PIOA 2HP5A 3UE1A 1CEGA 1YM1A 5BOHA 4X53A 2GDNA 1RGYA 4EV4A 2Y55A 3UPOA 3CZDA 1H8YA 1SKFA 1K4EA 5L2FA 1I5QA 2R9WA 1JTDA 1I2WA 5DVAA 5AQ9A 2V2FF 2J9PA 4KZAA 4JF4A 2OLVA 5FQIA 3WWXA 4UAAA 1MWUA 5HFOA 4LV0A 1FSYA 4K91A 5AQ7A 4BJPA 1IKGA 1BLSA 5DTTA 5FATA 4S2MA 3UN7A 3P98A 4HEFA 1IEMA 1QMEA 2QZ6A 1K6RA 2XR0A 4WM9A 4ZJ1A 3BYDA 1XX2A 3ISGA 4LV3A 1O07A 5F1GA 4BENA 4EWFA 3IT9A 4R4SA 2Y2MA 5GLDA 4N1HA 4PPRA 2ZMAA 1BT5A 2J7VA 3MZDA 1Y54A 4R1GA 3MBZA 1LL5A 3GVBA 4WEJA 5CEDA 4WBGA 1PWDA 1L0EA 3VSKA 2I72A 3GTCA 4OPYA 5CHMA 4HESA 4E3MA 3BFGA 5DTKA 4FCFA 1QMFA 5GHZA 3V3SA 3DWZA 1XA1A 3HLDA 2ZJ9A 3RJUA 1XXMA 4MLLA 4C3QA 2XF3A 2JC7A 1NJ4A 5A93A 3Q7VB 1GHIA 5EVLA 2HP6A 4JLFA 3G4PA 3IF5A 4PM5A 3ZNTA 3C4PA 2DNSA 3HLFA 4GB7A 4KZ4A 4OQHA 2ZM0A 2WGIA 3NBLA 2BG1A 4R4RA 3UPNA 1ES4A 4E3NA 2J9OA 4MBKA 3TSGA 3MZEA 4IBXA 1IYPA 3ZHHA 3BLSA 1Q2PA 2WUQA 4OPZA 1NXYA 2HDRA 4WMCD 1TVFA 3O86A 4QY6A 4R3JA 1CI8A 2Y4AA 4OQ0A 1DY6A 3FZCA 2HP9A 3ZG5A 4S2LA 4UA7A 2ZD8A 3S4XA 5FQJA 5FAQA 2PU4A 1NYMA 3OPPA 2G2UA 2WGVA 4EQIA 2P9VB 3WRTA 3E2KA 2RCXA 3SS5A 1BLPA 4LV1A 1Q2QA 2VGKA 4LCLA 2OSUA 1U60A 1NRFA 3A3JA 3OC2A 4P0MA 3IWIA 4PM9A 4E3LA 5I94A 4S2KA 1KDSA 2B5RA 4ZJ3A 3G30A 3SS3A 2ZM8A 4PM6A 1RP5A 3UDXA 3CMZA 3W4OA 4DF6A 4ZDXA 1GA0A 1MWRA 4R3BA 4KQQA 5FDHA 4OKPA 1K56A 4S2NC 5FSRA 3GSGA 4DE3A 1MPLA 2JCHA 1BZAA 3G2YA 4KENB 4DXBA 3DWKA 4R0QA 2EXAA 1C3BA 3LEZA 3VP2A 3W4QA 5FASA 3GMWA 3N7WA 1YLYA 2EFUA 3M6HA 4NETA 4Y0TA 3N4IA 2XD1A 4WELA 2E8IA 1ONHA 1XA7A 2Y59A 4OOYA 1GHPA 5FQQA 2C5WB 1W79A 3S22A 5CGWA 4CJNA 1FR1A 2IWCA 4JXGA 5FAOA 3RXXA 1KE0A 3SH9A 4GOGA 2DRWA 3BEBA 4E6XA 5DF8A 3HUNA 1HVBA 5KZHA 4FD8A 2QPNA 1GHMA 5CTNA 3V39A 3HLCA 4JF5A 1SDEA 4KZ5A 1XGJA 4KZ8A 1KVMA 3AGFA 2Q9NA 4WEKA 3GRJA 1W8QA 3HVFA 4C75A 1DJBA 4Z9QA 4E3OA 2ZQCA 5EECA 5G18A 5KSCA 1XPBA 2PBYA 4BLMA 3OPHA 3HLGA 1KVLA 4GDBA 4KQRA 2JE5A 4U0TA 4JXWA 3G2ZA 3UDFA 3IHBA 1RCJA 1K4FA 4MBHA 1EWZA 2WKEA 1KE3A 2VGJA 4JXSA 5U47A 4RVAA 1FCOA 2EXBA 5DTSA 4OP8A 3RXWA 2ZC5B 3ZDJA 4WZ5C 3OCNA 2XLNA 1BLCA 1EROA 1YMXA 5CXWA 4GD8A 4MEZA 3CJMA 3TG9A 3HL9A 2WK0A 5HARA 3S1YA 3G32A 4KZ7A 2QMIA 3C5AA 4Q8IA 1ZG6A 3PBQA 1YLWA 2ZC6B 3BECA 4P87A 1LI9A 4O7DA 4P6BA 5FQMA 2UWXA 2EX2A 1FCMA 2ZC7A 3M2KA 3MKFA 1YT4A 3VP4A 3PBOA 4KZ9A 4GN2A 4IVKA 5E2HA 1PW8A 1ONGA 3ZVWA 3IF6B 3WS1A 2X71A 2WKHA 4JF6A 4H8RA 4F94A 3ITAA 1XP4A 4BD1A 1MWSA 4QY5A 2Y2IA 4BL2A 1JWZA 3WS4A 4LENA 4S2NA 1YLPA 4R23A 3SOIA 2Y2HA 3WS5A 4E3KA 3Q7VA 5CECA 4UA9A 4KZBA 4GNUA 1LI0A 1BULA 4X69A 5EPHA 2H10A 5E2GA 3WS2A 1K54A 4S2JA 2PU2A 1WYCA 2WAFA 4S2OA 3BM6A 3ZNYA 5EOEA 1KGFA 4IVIA 5HX9A 1GCEA 4EBNA 4X55A 4PM8A 3VOYA 3ZCZA 1PW1A 1HD8A 3N8SA 1NZUA 4X56A 5EUAA 1K55A 1L2SA 1PI5A 5CGSA 2WYXA 3GV9A 2XGNA 2XFSA 5F82A 2XD5A 2XEPA 1YMSA 4ZAMA 1ALQA 3BFEA 3IQAA 4KG2A 1XKZA 1S0WA 1ESUA 3CG5A 1FR6A 3SH8A 3LO7A 3IXBA 4A5RA 5KMWA 2Y2NA 4HBUA 3QHYA 1PZOA 3UDIA 3VFFA 3GQZA 2H0TA 3NY4A 4Y7PA 2P9VA 4ZJ2A 1HTZA 4D2OA 4DXCA 4DDSA 3O3VA 3B3XA 3MXSA 3VP3A 1K56D 4M3KA 4OVDA 5EVIC 1NZOA 1GA9A 3IF6C 1BLHA 3O88A 3PAGA 3A3EA 4FH4A 4S2IA 1W5DA 3MXRA 2WKIA 3N6IA 2HDSA 1VQQA 4LCMA 1PWGA 4B4ZA 1FQGA 4ID4A 5CRFA 5GLBA 1LL9A 5JYPA 1PZPA 2J8YA 2Q9MA 4OPRA 5GLCA 4DE1A 4WZ5A 3G34A 2ZC4B 1CEFA 5A92A 3UNWA 3FKWA 3LY4A 5HAIA 3PAEA 3ITBA 4EUZA 2IWBA 5HW3A 3HLEA 4ZBEA 1BTLA 1M40A 4QHCA 1KDWA 4DRTA 3PBRA 3DTMA 3GR2A 1S6RA 3PBSA 4UA6A 3VP0A 4DE2A 5M19A 3Q82A 5GHXA 1EI5A 1M6KA 4OLGA 1L0FA 1E3UA 1Z6FA 1TDLA 4KG5A 3NI9A 4KZ6A 5FA7A 3SH7A 1E4DA 2BLSA 3MFDA 4ZTKA 5FAPA 3V50A 1WYBA 4HBTA 1SDNA 1HZOA 4XUZA 5EOOA 4OOLA 3OPLA 5TFQA 1YLJA 4IBRA 4E3JA 3M6BA 4JXVA 3FV7A 1TDGA 3P09A 1L0GA 3UY6A 2WGWB 1JWPA 2EX6A 4XUXA 5E2EA 3C4OA 3G35A 1MBLA 2HDUA 3ZG9B 1IYOA 2Y2KA 4QU3A 3BFCA 4RX2A 4K0XA 1NYYA 5FI7A 3ZG7B 3IH8A 4QD4A 2DCFA 3NDGA 1FCNA 3UPPA 2P74A 5J8XA 3IXDA 5GLAA 4KG6A 2Y2PA 1RGZA 3HLWA 3JYIA 4OLDA 2X01A 4IEDA 3FWLA 2G2WA 3HREA 4EBLA 3AGEA 3VFHA 4EBPA 1DJCA 2ZM2A 2ZQDA 4KQOA 4OQGA 3W8KA 5A90A 1PWCA 2EX8A 3N8LA 1IELA 1MWTA 3IXGA 4RX3A 5FI6A 4DE0A 3BRMA 3Q7ZA 4X6TA 3IWQA 1IYSA 5M1AA 1YLZA 2CC1A 3D4FA 4CPKA 1JTGA 4N92A 3WS0A 1MXOA 4N9LA 4WZ4A 1AXBA 5EVIA 1E25A 3OPRA 3HUMA 3IF6A 5GL9A 1ERMA 2WAEA 3BFDA 5EVIB 3QNBA 2Y2QA 2EFXA 2OLUA 1H5XA 3LCEA 4GDNA 3ZVTA 2Y91A 1N4OA 5E2FA 5EE8A 5HL1A 3VP1A 1ES5A 2Y2OA 3BFFA 4BL3A 1ES3A 3PTEA 4OH0A 2WZXA
chains in the Genus database with same CATH superfamily
1K38A 1F98A 5A91A 1FSWA 1K57C 3Q1FA 1ODVA 2UV0E 4HI4A 3CUEC 4B9OA 2R9XA 3FKVA 2AVXA 2FFFB 2ZQAA 1W7FA 1UWNX 4QJGA 5HD3A 1KE4A 2PAVP 4UHUA 3U2AA 5CTMA 1OPXA 4ESPA 1I2SA 1MKIA 4WLAA 5F83A 1JVJA 2VX8A 1ZC2A 2V20A 5CERA 3T4TA 2H5SA 1XJ2A 4OONA 4YFMA 5EVEA 5HAQA 3PBNA 3EQUA 2XH9A 4WYYA 3CITA 2D01A 4DDYA 2Y2LA 1K6SA 3CAXA 3OLOA 1ERQA 3T1SA 1G5UA 2HPBA 5HPFA 4LRZE 3HLBA 1K0KA 1OJGA 4WMCA 2QWSA 1SHVA 2RL3A 4JPMA 4RYEA 3A3IA 5HWVA 3EGDC 1BSGA 3F1OA 4CLCA 3WRZA 2WGWA 1K57A 3CUEA 4P85A 4JKTA 3LFVA 5AQAA 1DJAA 2C6WB 1Z09A 3NDEA 1S4SA 4MN7A 2XROA 3Q81A 3LY3A 1KGEA 5EVID 5HPIA 2W1TA 5DF7A 4XXRA 4K0WA 4GS9A 3CPTA 3G31A 5L07A 1VB6A 3OZHA 1YQSA 5HZHA 1PIOA 2EWWA 2ACGA 2HZ5A 1YM1A 5BOHA 3FG8A 1SKFA 4KZAA 1AWIA 1KOUA 3IS2B 4LV0A 1FSYA 1IKGA 3SW1A 2QZ6A 2XR0A 1L3LA 4LV3A 5F1GA 3GECA 3VOLA 2ZMAA 2J7VA 2MJ6A 1Y54A 3MBZA 4WEJA 4WBGA 1PWDA 2M7VA 3GTCA 1DP8A 5CHMA 4E3MA 2QJ5A 3HLDA 1XXMA 2JC7A 3BJNA 1S1ZA 2W3FA 3ZQ5A 2HP6A 4WUJA 3ZNTA 2DNSA 4HH2A 3HLFA 4HJ4A 2JHEA 4F3LA 4HY8A 1ES4A 3H7WA 4I5SA 3TSGA 1IYPA 3BLSA 4WMCD 4R3JA 1CI8A 4OQ0A 2VGLM 2W1RA 2ZD8A 2O9BA 4Y17A 1NLZA 1XFNA 2PU4A 2YKFA 3F1PB 3OPPA 4LV1A 3T4LA 5AVFA 4WF0A 1NRFA 3IWIA 4ZJ3A 3G30A 3A0VA 2ZM8A 4PM6A 3W4OA 3CMZA 1GA0A 4R3BA 5FDHA 4JGRA 2J3TD 3VV4A 3G6OA 3VP2A 5EV0A 1V9ZA 3N7WA 4UQIM 1YLYA 4P6ZM 2XD1A 1GSVA 1ONHA 3S22A 4CJNA 1GHPA 5FAOA 4NXGA 3QP6A 4GOGA 3QP4A 5DF8A 5F69A 5KZHA 2PT7A 1GHMA 3V39A 1SDEA 4KZ5A 3AGFA 1W8QA 3DBAA 3JPUA 3HVFA 2PR5A 4Z9QA 1XPBA 3OPHA 2ZMVA 1KVLA 4GDBA 1LSXA 5FL3A 4JXWA 1K4FA 2WKEA 4JXSA 5DTSA 4YNRA 1YMXA 5CXWA 3IX3A 3HL9A 2WK0A 1A0KA 1W63Q 3NULA 4Z1WA 1YLWA 4P87A 3UMDA 5FQMA 3BQ8A 1N9OA 3IF6B 4JF6A 1XP4A 4EEPA 1MWSA 4QY5A 2R78A 4LENA 1T19A 4R23A 4E3KA 3H82B 3Q7VA 4KZBA 4GNUA 1LI0A 1BULA 4BBUA 2WKRA 1WYCA 2WAFA 4EBNA 4PM8A 3VOYA 4HNBA 1HD8A 5EUAA 1PI5A 5CGSA 2XGNA 1YKDA 2XFSA 2XD5A 2VEAA 3BFEA 1XKZA 3CG5A 2EA9A 4A5RA 2Y2NA 4EESA 4Y7PA 2P9VA 3E4QA 4ZJ2A 4D2OA 4M3KA 4OVDA 2VZWA 4FH4A 3ZYTA 1VQQA 4LCMA 4B4ZA 1FQGA 1XJ6A 1PZPA 2Q9MA 3G34A 2VGLS 5A92A 1H0MA 3ITBA 5FEGA 2IWBA 1M40A 4DRTA 3DTMA 3PBSA 4JGPA 3VP0A 3Q82A 4OLGA 1M6KA 3PHYA 1E4DA 2BLSA 3MFDA 5FAPA 5EOOA 3S7NA 3T4KA 3A0RA 5HWTA 3M6BA 2ZL1A 2L1MA 3E4PA 4XUXA 5E2EA 1MBLA 4UQIS 3T4SA 2Y2KA 4QU3A 3BFCA 4P6ZS 4RX2A 1OTIA 3DTIA 3NDGA 2Y2PA 4OLDA 3V67A 3HREA 3AGEA 2ZM2A 4OQGA 3MSHA 4I3JA 2EX8A 1IELA 5FI6A 3BRMA 3MR0A 3D4FA 4CPKA 1JTGA 1S4RA 4N9LA 3T12B 5A8BA 1E25A 5GL9A 4FOFA 2WAEA 3TW8A 1N9NA 2JKTM 4R38A 2ZOHA 1H5XA 5TBMA 4GDNA 5HL1A 5EE8A 1N4OA 4H6JB 1ES5A 2HV1A 4OH0A 2WKQA 5AQBA 4N9KA 4YINA 3F1NB 3MKEA 4Y0UA 2Y79A 2PRFA 4PM7A 1PI4A 3LIBA 2W3HA 2YKHA 1S67L 3V5MA 4Y0OA 2Z6DA 5GHYA 1STZA 1OTAA 1K25A 3FYZA 4FSFA 3T1RA 2KLIA 1WA9A 3R7WA 3DW0A 4E04A 1MY8A 3HUOA 5L09A 2FH5A 2Z2MB 1OMEA 3VSLA 4MBFA 3HJKA 5CHUA 3IH9A 4HJ6A 3O87A 4GKUA 4L9FA 2HDQA 4OP5A 2HF6A 3N8RA 3C2WA 2Y8HA 3BQAA 3MQOA 1T1AA 4S2PA 4MNRA 3ZG0A 1D1JA 1W8YA 1YLTA 1IOUA 1LSVA 3UE6A 2QYBA 3GDIA 5DKKA 1K54C 1ZG4A 3ZGAB 1ES2A 1O7EA 4E6WA 1K55C 3D3OA 2PBDP 3C7UA 4NK3A 4I39A 4B88A 3NC8A 4DKIA 4U3TA 1LHYA 2JKRM 4OQIA 5HDSA 3M2JA 1DP9A 2V8FA 3ZG8B 4JBFA 2GNXA 3QP1A 3UE1A 4X53A 4IUHA 4EV4A 2VV8A 1JTDA 5G4YA 2V2FF 4DJ2A 1ZHHB 3MJQA 5HFOA 2QHKA 5DTTA 4WM9A 1K6RA 4ZJ1A 5F6AA 4BENA 4EWFA 4R4SA 1BT5A 3GVBA 3VSKA 1YSQA 4MMNA 3BFGA 5DTKA 4FCFA 1QMFA 4HOIA 5GHZA 3DWZA 4NXBA 3FPWA 4MLLA 4BMWA 2HJ9C 3OOVA 1TS0A 3C4PA 4GB7A 3FPVA 4OQHA 2ZM0A 3NBLA 4R4RA 3UPNA 1PFLA 3MZEA 4EUVA 1TVFA 2Y4AA 4QWOA 3FZCA 4IHQA 2HP9A 4GHIA 3EEHA 4UA7A 3ZG5A 1CQAA 5AJGA 4EQIA 2WGVA 3E0YA 3OC2A 4E3LA 4PM9A 1FIKA 4QPRA 4S2KA 2EWVA 3SS3A 4DF6A 1RP5A 3U4LP 4ZDXA 4KQQA 3NHQA 3GSGA 5HD5A 1MPLA 2JCHA 4DXBA 3DWKA 4R0QA 2EXAA 5DJTA 3LEZA 5FASA 1FILA 2IA2A 2EFUA 3N4IA 4X25A 5CGWA 4R70A 4RQ9A 2IWCA 1KE0A 5EFWA 3TRCA 2M1CA 2QPNA 3HLCA 1TS7A 3JVVA 2ZQCA 1TD5A 3BY9A 4DN0A 5DFYA 2HJEA 1S66L 3IX8A 3UDFA 1VHMA 1RCJA 1KE3A 4Y15A 3C30A 1GSXA 3LIDA 4GD8A 2V0WA 4KZ7A 2QMIA 3LIEA 4Q8IA 3PR6A 1LI9A 4P6BA 2EX2A 3M2KA 4XT2A 3VP4A 3PBOA 4IVKA 5E2HA 1P9RA 2X71A 2WKHA 1JWZA 3WS4A 1YLPA 3WS5A 1G28A 5CECA 2V1AA 3NOPC 2XA7M 3EGXC 4PKYG 2CMNA 2H10A 4YOFA 5E2GA 4S2JA 4S2OA 1OT9A 3ZCZA 4NEED 2LB9A 3N8SA 1SKOA 2WYXA 1VEUA 5IT5A 4K08A 2J3WA 1ALQA 1ESUA 3IXBA 3UDIA 2H0TA 4KQDA 1HTZA 4ZRRA 4DDSA 3O3VA 2NUTC 3VP3A 4CLCE 1NZOA 3T4QA 3O88A 3A3EA 3MXRA 3N6IA 1XJ4A 4ID4A 5CRFA 5GLBA 1LL9A 5JYPA 4DE1A 1CEFA 5J7EA 2KDKA 5HAIA 3PAEA 3NJAA 1YSPA 3HLEA 4QHCA 5IU1A 3BY8A 2H28A 4HH3A 1J3WA 3GR2A 1NRJA 5M19A 5JYOA 1L0FA 1Z6FA 3KYEA 1TDLA 3SH7A 3LYXA 3V50A 2VV7A 3RH8B 1SDNA 4ARZA 3T50A 5CX7A 5LBRA 4CLCB 2O99A 3FV7A 1TDGA 5EM1A 3IBJA 1L0GA 1LT0A 1JWPA 2WGWB 3C4OA 2HDUA 3ZG9B 1IYOA 1NYYA 5FI7A 3ZG7B 2DCFA 3UPPA 3KYQA 2P74A 3MXQA 4R3AA 5J8XA 3IXDA 4B93A 1RGZA 3HLWA 3JYIA 4D60A 2X01A 2G2WA 4EBLA 3VFHA 1DJCA 4KQOA 2W1TB 3LGOA 4DE0A 4BBTA 3HJIA 3IWQA 4FTXA 1YLZA 4GS9B 4N92A 3CPTB 3UB9A 3OPRA 1VETB 3HUMA 4HQAA 1ERMA 2K7SA 4H6JA 5IS1A 3VP1A 4BL3A 4UEYA 3LR0A 2VK3A 1JWVA 3F1NA 3C7VA 1WE4A 5FQ9A 2OWJA 1TEMA 5C5KA 1IFQA 4LGWA 4RA7A 5E43A 2B02A 5HL6A 1T1CA 1UGUA 3NCKA 5HAPA 4BD0A 2X02A 2P08A 5FQKA 3IHAA 5IHVA 1G6AA 2LB5A 3MZFA 1UWPX 2BASA 1PYYA 2I9VA 2PD7A 3T1XA 2O9AA 3UE3A 2ZQ9A 5DF9A 4HP4A 4NKPA 1FOFA 3LR3A 1T18A 3UE0A 1DP6A 3LICA 3QNCA 4F3LB 1XGIA 1L0DA 3H7WB 4L0LA 3E4OA 3PBTA 1Y28A 3A3FA 1XFQA 2JBFA 4GCZA 3ULFA 1BUEA 5J3WA 5TR7A 5CEBA 4EQ1A 2FFYA 4C6YA 4OPQA 2ZLYA 3VOZA 3IXHA 3E2LA 1KGGA 3T1QB 1NY0A 5D3OA 2EX9A 2A2LA 4KUOA 4X68A 5F5YA 4B4XA 1VM1A 1OTDA 4JGOA 1X0OA 3SS4A 3TE8A 2W27A 2L0WA 3BLMA 4OOMA 2A49A 3V3RA 3Q07A 1ZKJA 2V1BA 2A24A 4GJ4A 2V1ZA 4LV2A 3ZFZA 4U0XA 4GD6A 4FH2A 3I7JA 1CEGA 2GDNA 3UPOA 5L2FA 1K4EA 1I5QA 2R9WA 1I2WA 5DVAA 2J9PA 2OLVA 4MCWA 3BWLA 4UAAA 5AQ7A 4BJPA 1W63M 1BLSA 5FATA 3UN7A 3P98A 4Q0HA 2GZAA 3IT9A 2Y2MA 4IUKA 4N1HA 4GLQA 4R1GA 1LL5A 2I72A 4OPYA 3H9WA 3UB8A 3V3SA 1T1BA 2ZJ9A 2NUPC 4C3QA 3Q7VB 1GHIA 5EVLA 4FUWA 4JLFA 3G4PA 2W3GA 3E98A 1OTEA 4KZ4A 1BYWA 2BG1A 3CHWP 4E3NA 2J9OA 3ZHHA 1P9WA 4OPZA 4AFIA 5DFXA 4EETB 2HDRA 3O86A 4QY6A 5TJJA 1TS8A 3P7NA 1DY6A 4S2LA 1N9LA 3S4XA 5FQJA 5FEFA 1H8MA 3R4KA 2P9VB 5MC7A 3IX4A 2RCXA 3SS5A 3MF0A 1BLPA 2KX6A 3LIAA 2M7UA 2OSUA 1U60A 4ME4A 4O0PA 3B42A 3K2NA 2ZMFA 3A3JA 5I94A 2B5RA 3UDXA 1MWRA 4OKPA 5FSRA 5G4ZA 3W2ZA 4DE3A 3NOUC 3EOIA 1BZAA 3DAVA 1C3BA 3W4QA 2W3EA 3CWFA 1GSWA 3GMWA 4LFUA 4Y0TA 4WELA 5FQQA 2E8IA 2Y59A 2C5WB 1FR1A 4JXGA 3CLOA 3RXXA 3SH9A 2PDRA 4LPZA 3MFXA 5CTNA 4JF5A 4KZ8A 3KSFA 2Q9NA 4WEKA 4C75A 1DJBA 1P97A 4E3OA 5G18A 4LRYC 2V8CA 4BLMA 3HLGA 3ICYA 2JE5A 4U0TA 2VGJA 3IS2A 5U47A 4RVAA 1FCOA 3RXWA 2ZC5B 3RFBA 4WL9A 4WZ5C 3OCNA 1BLCA 1OTBA 3TG9A 2D02A 3FC7A 3S1YA 5HWWA 3S7QA 3EEAA 1ZG6A 2ZC6B 4MDZA 2VA0A 2UWXA 2K31A 2ZC7A 3MKFA 1YT4A 3LI8A 1ONGA 3ZVWA 3WS1A 1F9IA 3ITAA 4BD1A 4CLCC 2Y2IA 5TBMB 4BL2A 2L4RA 3SOIA 2Y2HA 4X69A 1K54A 3ZNYA 3BM6A 5EOEA 4IVIA 1GCEA 1PW1A 2J3TC 1NZUA 4X56A 1K55A 3BW6A 3GV9A 4Q0JA 5F82A 2DMWA 3IQAA 4KG2A 3O5YA 1S0WA 4EU0A 1PZOA 3MQQA 3P01A 3F1PA 3VFFA 3GQZA 5HSQA 3L7HA 3LUQA 3LIFA 1GA9A 3IF6C 1BLHA 3PAGA 4MN5A 3R7WB 2QKPA 2WKIA 5J4EA 3UMEA 2HDSA 3HCYA 5GLCA 4WZ5A 1HLUP 3FKWA 5DJUA 4Y2FA 3K3CA 4I3AA 4ZBEA 4R6LA 1KDWA 4IJGA 3PBRA 1S6RA 4G3KA 1EI5A 5HW3A 1E3UA 4KG5A 1PRQA 3NI9A 4KZ6A 4ZTKA 4O01A 1XJ3A 2BTFP 4YWZA 2E8JA 4HBTA 1D7EA 3K3DA 4OOLA 2GJ3A 3OPLA 4E3JA 4JXVA 1LL8A 3KSIA 3L9KA 3P09A 2PHYA 3UY6A 1NWZA 2EX6A 3D72A 3G35A 2JKTI 3IH8A 3SZTA 4QD4A 4Y13A 1EW0A 5GLAA 4KG6A 5DKLA 2P04A 4I38A 4ETZA 4IEDA 3W8KA 3N8LA 2VV6A 3IXGA 3Q7ZA 1IYSA 2CC1A 3LI9A 1H3QA 1VETA 1AXBA 2G7UA 2OOLA 2K2NA 3IF6A 3KYZA 4NG2A 1TF1A 5EVIB 2XSSA 2Y2QA 2EFXA 3KSGA 3ZVTA 2Y91A 2GX5A 3PTEA 3H82A 4X1LA 5HDDA 4EERA 3NIAA 4HP9A 4GZBA 3A3DA 2PR6A 2XQZA 2Y2GA 3VMAA 1CJFA 2HGVA 2ZQ8A 3EWKA 1N9BA 5FI2A 5KSHA 4PKYA 3MQ0A 1ACFA 1S1YA 3AGDA 3IBRA 1H8ZA 4G3WA 1CI9A 2XFTA 3UB5P 5TGFA 4X1MA 2OV5A 2IWDA 2ZQ7A 3B33A 2H0YA 1SCWA 1MZUA 2PYRA 4NXFA 4E3IA 2W0NA 5HDCA 4N1XA 1J9MA 2A3UA 2Z2LB 4KZ3A 1E3UD 1ESIA 1G68A 3OCLA 2J80A 4GHIB 4PMAA 1D06A 4CLCD 2XK1A 5KIZA 5AVEA 4QB8A 4Y5FA 2Q0OA 3S7OA 5F1FA 5CGXA 2JKRI 1IYQA 2XDMA 1LLBA 3F1OB 2Y2JA 3EQVA 5K5BA 5M18A 3TOIA 3UO9A 3HBRA 2VJWA 3IWOA 4Q0IA 2ZC3B 1IKIA 2WZZA 1CK3A 4WN5A 2WADA 4PHTA 5CHJA 4BQMA 3UB7A 3QP2A 4BWIA 3B47A 3W4PA 2HP5A 2OWHA 1RGYA 1TS6A 2Y55A 3PYPA 1LSWA 1H8YA 3CZDA 4L9GA 5AQ9A 4JF4A 5FQIA 3WWXA 1MWUA 3VE4A 5FDSA 4K91A 3KSHA 4S2MA 4HEFA 1IEMA 1QMEA 3BYDA 1XX2A 3ISGA 1O07A 4HIAA 2INWA 5GLDA 4PPRA 3MZDA 3QP8A 3C8CA 4JGQA 5CEDA 1L0EA 1JNUA 4G3VA 4XT2B 4HESA 2JKGA 1MKMA 4GW9A 1XA1A 3RJUA 2O9CA 3QP5A 2PYPA 2XF3A 1NJ4A 5A93A 3IF5A 2XA7S 4PM5A 3S7PA 3OBFA 4EEUA 2WGIA 2B95A 4LRXC 4MBKA 1SKOB 1VEUB 4IBXA 3NOTC 1Q2PA 2WUQA 1NXYA 2W3DA 2KOIA 3D9YA 4I3IA 1F5MA 5FAQA 1F2KA 1NYMA 2G2UA 3KX0X 3WRTA 3E2KA 2FZ0A 3CI6A 2OAP1 2PD8A 1Q2QA 2VGKA 4LCLA 3T4JA 4MN6A 4P0MA 3NECA 3DTEA 2JN7A 3LEQA 5L8MA 1KDSA 3TJZC 1YAXA 2VKSA 1K56A 4S2NC 3UB6A 4NXEA 3G2YA 4KENB 1YPRA 2B18A 3M6HA 4NETA 4ETXA 4Y3IA 1XA7A 4OOYA 1W79A 1DRMA 4DMZA 3PXPA 2DRWA 3BEBA 4E6XA 4ARZB 4BBVA 3HUNA 1HVBA 2O0YA 4FD8A 2XRNA 1XGJA 1KVMA 4KUKA 3LR4A 3GRJA 5EECA 1Y4OA 3C38A 5KSCA 2PBYA 4EW7A 3KO6A 4KQRA 1NLYA 3G2ZA 3IHBA 4MBHA 1EWZA 3A0SA 2EXBA 4OP8A 4CQHA 3ZDJA 2XLNA 1EROA 3T4OA 4MEZA 3CJMA 1V9YA 5HARA 2JKFA 3G32A 3C5AA 3PBQA 3BECA 3LR5A 4O7DA 3MS6A 1FCMA 3VE3A 4KZ9A 4GN2A 1PW8A 4H8RA 4F94A 4S2NA 5L10A 4UA9A 3DTKA 5EPHA 3WS2A 2PU2A 5HX9A 1KGFA 2VLGA 4X55A 2QJ7A 1L2SA 2XEPA 1YMSA 4II7A 4ZAMA 4HHDA 1FR6A 3SH8A 3LO7A 5KMWA 4HBUA 3QHYA 1CF0A 3NY4A 4DXCA 3MMHA 3B3XA 3MXSA 1K56D 5EVIC 4S2IA 1W5DA 2OAQ1 4PAUA 1G6OA 1ZTUA 1PWGA 4LLOB 3RTYA 2J8YA 4OPRA 2ZC4B 3UNWA 3LY4A 4EUZA 1BTLA 4M4XA 4L9EA 1P0ZA 4UA6A 4DE2A 5GHXA 2P7JA 2Z6CA 5FA7A 1WYBA 1HZOA 4XUZA 5F68A 5TFQA 1YLJA 4IBRA 1PNEA 2ZL1B 1OJ5A 2ZOIA 4K0XA 2ZBBA 1FCNA 3JVUA 2V0UA 3FWLA 4EBPA 4O8GA 2ZQDA 1OT6A 5I5LA 2A24B 1PWCA 5A90A 4RX3A 4EXOA 1MWTA 1SZVA 2V9AA 4X6TA 5M1AA 3WS0A 1MXOA 4WZ4A 5EVIA 5EM0A 3BFDA 3QNBA 4DJ3A 2WKPA 2OLUA 4HJ3A 3LCEA 5E2FA 2Y2OA 3BFFA 1ES3A 1MC0A 2WZXA
chains in the Genus database with same CATH topology
1K38A 1JWVA 3NIAA 5AQBA 5A91A 1FSWA 4N9KA 4YINA 3C7VA 1WE4A 5FQ9A 1K57C 3Q1FA 1TEMA 3A3DA 4GZBA 2R9XA 2XQZA 2FFFB 2Y2GA 2ZQAA 3FKVA 3MKEA 4PM7A 1W7FA 4Y0UA 3VMAA 1PI4A 4QJGA 1KE4A 2ZQ8A 1N9BA 4RA7A 5E43A 5FI2A 5JYOA 5KSHA 3NCKA 5HAPA 4UHUA 5CTMA 4BD0A 3V5MA 1I2SA 3AGDA 4Y0OA 2X02A 1H8ZA 1MKIA 3IHAA 5FQKA 5GHYA 5IHVA 1CI9A 1G6AA 2XFTA 5F83A 1K25A 3MZFA 1JVJA 5TGFA 1ZC2A 1PYYA 3FYZA 2V20A 2IWDA 2OV5A 4FSFA 2ZQ7A 5CERA 3UE3A 2H0YA 2ZQ9A 1SCWA 2H5SA 5DF9A 1FOFA 4OONA 3DW0A 3UE0A 4YFMA 5HAQA 4E3IA 1MY8A 3HUOA 3QNCA 3PBNA 1XGIA 2Z2MB 3EQUA 1J9MA 1L0DA 1OMEA 2XH9A 4N1XA 4L0LA 4WYYA 3VSLA 4MBFA 2A3UA 2Z2LB 5CHUA 3PBTA 4DDYA 2Y2LA 4KZ3A 1K6SA 1E3UD 1ESIA 3A3FA 3IH9A 1G68A 3O87A 2JBFA 3OCLA 4GKUA 1ERQA 2HDQA 4OP5A 4PMAA 2XK1A 2HPBA 1BUEA 3N8RA 3HLBA 5TR7A 5CEBA 4S2PA 2FFYA 4WMCA 4C6YA 1SHVA 2RL3A 4MNRA 4OPQA 4QB8A 3ZG0A 2ZLYA 4JPMA 4RYEA 3VOZA 3IXHA 1W8YA 3E2LA 1YLTA 1KGGA 3A3IA 5CGXA 5F1FA 1BSGA 1IYQA 2XDMA 1LLBA 1NY0A 3WRZA 5D3OA 2EX9A 2Y2JA 3EQVA 2WGWA 4X68A 5M18A 1K57A 1K54C 4B4XA 3TOIA 1VM1A 4P85A 1ZG4A 4JKTA 3SS4A 3ZGAB 1ES2A 3UO9A 5AQAA 1DJAA 1O7EA 2C6WB 3HBRA 4E6WA 3IWOA 1K55C 3BLMA 4OOMA 3NDEA 2A49A 3V3RA 3C7UA 2ZC3B 4NK3A 3Q07A 4B88A 3NC8A 1IKIA 1ZKJA 3Q81A 3LY3A 1KGEA 2WZZA 5EVID 1CK3A 4DKIA 2WADA 4U3TA 1LHYA 2V1ZA 5DF7A 4XXRA 5CHJA 4LV2A 4OQIA 3ZFZA 4BQMA 3M2JA 4U0XA 4K0WA 4GD6A 3W4PA 3G31A 3ZG8B 3OZHA 1YQSA 4FH2A 4JBFA 3I7JA 1PIOA 2HP5A 3UE1A 1CEGA 1YM1A 5BOHA 4X53A 2GDNA 1RGYA 4EV4A 2Y55A 3UPOA 3CZDA 1H8YA 1SKFA 1K4EA 5L2FA 1I5QA 2R9WA 1JTDA 1I2WA 5DVAA 5AQ9A 2V2FF 2J9PA 4KZAA 4JF4A 2OLVA 5FQIA 3WWXA 4UAAA 1MWUA 5HFOA 4LV0A 1FSYA 4K91A 5AQ7A 4BJPA 1IKGA 1BLSA 5DTTA 5FATA 4S2MA 3UN7A 3P98A 4HEFA 1IEMA 1QMEA 2QZ6A 1K6RA 2XR0A 4WM9A 4ZJ1A 3BYDA 1XX2A 3ISGA 4LV3A 1O07A 5F1GA 4BENA 4EWFA 3IT9A 4R4SA 2Y2MA 5GLDA 4N1HA 4PPRA 2ZMAA 1BT5A 2J7VA 3MZDA 1Y54A 4R1GA 3MBZA 1LL5A 3GVBA 4WEJA 5CEDA 4WBGA 1PWDA 1L0EA 3VSKA 2I72A 3GTCA 4OPYA 5CHMA 4HESA 4E3MA 3BFGA 5DTKA 4FCFA 1QMFA 5GHZA 3V3SA 3DWZA 1XA1A 3HLDA 2ZJ9A 3RJUA 1XXMA 4MLLA 4C3QA 2XF3A 2JC7A 1NJ4A 5A93A 3Q7VB 1GHIA 5EVLA 2HP6A 4JLFA 3G4PA 3IF5A 4PM5A 3ZNTA 3C4PA 2DNSA 3HLFA 4GB7A 4KZ4A 4OQHA 2ZM0A 2WGIA 3NBLA 2BG1A 4R4RA 3UPNA 1ES4A 4E3NA 2J9OA 4MBKA 3TSGA 3MZEA 4IBXA 1IYPA 3ZHHA 3BLSA 1Q2PA 2WUQA 4OPZA 1NXYA 2HDRA 4WMCD 1TVFA 3O86A 4QY6A 4R3JA 1CI8A 2Y4AA 4OQ0A 1DY6A 3FZCA 2HP9A 3ZG5A 4S2LA 4UA7A 2ZD8A 3S4XA 5FQJA 5FAQA 2PU4A 1NYMA 3OPPA 2G2UA 2WGVA 4EQIA 2P9VB 3WRTA 3E2KA 2RCXA 3SS5A 1BLPA 4LV1A 1Q2QA 2VGKA 4LCLA 2OSUA 1U60A 1NRFA 3A3JA 3OC2A 4P0MA 3IWIA 4PM9A 4E3LA 5I94A 4S2KA 1KDSA 2B5RA 4ZJ3A 3G30A 3SS3A 2ZM8A 4PM6A 1RP5A 3UDXA 3CMZA 3W4OA 4DF6A 4ZDXA 1GA0A 1MWRA 4R3BA 4KQQA 5FDHA 4OKPA 1K56A 4S2NC 5FSRA 3GSGA 4DE3A 1MPLA 2JCHA 1BZAA 3G2YA 4KENB 4DXBA 3DWKA 4R0QA 2EXAA 1C3BA 3LEZA 3VP2A 3W4QA 5FASA 3GMWA 3N7WA 1YLYA 2EFUA 3M6HA 4NETA 4Y0TA 3N4IA 2XD1A 4WELA 2E8IA 1ONHA 1XA7A 2Y59A 4OOYA 1GHPA 5FQQA 2C5WB 1W79A 3S22A 5CGWA 4CJNA 1FR1A 2IWCA 4JXGA 5FAOA 3RXXA 1KE0A 3SH9A 4GOGA 2DRWA 3BEBA 4E6XA 5DF8A 3HUNA 1HVBA 5KZHA 4FD8A 2QPNA 1GHMA 5CTNA 3V39A 3HLCA 4JF5A 1SDEA 4KZ5A 1XGJA 4KZ8A 1KVMA 3AGFA 2Q9NA 4WEKA 3GRJA 1W8QA 3HVFA 4C75A 1DJBA 4Z9QA 4E3OA 2ZQCA 5EECA 5G18A 5KSCA 1XPBA 2PBYA 4BLMA 3OPHA 3HLGA 1KVLA 4GDBA 4KQRA 2JE5A 4U0TA 4JXWA 3G2ZA 3UDFA 3IHBA 1RCJA 1K4FA 4MBHA 1EWZA 2WKEA 1KE3A 2VGJA 4JXSA 5U47A 4RVAA 1FCOA 2EXBA 5DTSA 4OP8A 3RXWA 2ZC5B 3ZDJA 4WZ5C 3OCNA 2XLNA 1BLCA 1EROA 1YMXA 5CXWA 4GD8A 4MEZA 3CJMA 3TG9A 3HL9A 2WK0A 5HARA 3S1YA 3G32A 4KZ7A 2QMIA 3C5AA 4Q8IA 1ZG6A 3PBQA 1YLWA 2ZC6B 3BECA 4P87A 1LI9A 4O7DA 4P6BA 5FQMA 2UWXA 2EX2A 1FCMA 2ZC7A 3M2KA 3MKFA 1YT4A 3VP4A 3PBOA 4KZ9A 4GN2A 4IVKA 5E2HA 1PW8A 1ONGA 3ZVWA 3IF6B 3WS1A 2X71A 2WKHA 4JF6A 4H8RA 4F94A 3ITAA 1XP4A 4BD1A 1MWSA 4QY5A 2Y2IA 4BL2A 1JWZA 3WS4A 4LENA 4S2NA 1YLPA 4R23A 3SOIA 2Y2HA 3WS5A 4E3KA 3Q7VA 5CECA 4UA9A 4KZBA 4GNUA 1LI0A 1BULA 4X69A 5EPHA 2H10A 5E2GA 3WS2A 1K54A 4S2JA 2PU2A 1WYCA 2WAFA 4S2OA 3BM6A 3ZNYA 5EOEA 1KGFA 4IVIA 5HX9A 1GCEA 4EBNA 4X55A 4PM8A 3VOYA 3ZCZA 1PW1A 1HD8A 3N8SA 1NZUA 4X56A 5EUAA 1K55A 1L2SA 1PI5A 5CGSA 2WYXA 3GV9A 2XGNA 2XFSA 5F82A 2XD5A 2XEPA 1YMSA 4ZAMA 1ALQA 3BFEA 3IQAA 4KG2A 1XKZA 1S0WA 1ESUA 3CG5A 1FR6A 3SH8A 3LO7A 3IXBA 4A5RA 5KMWA 2Y2NA 4HBUA 3QHYA 1PZOA 3UDIA 3VFFA 3GQZA 2H0TA 3NY4A 4Y7PA 2P9VA 4ZJ2A 1HTZA 4D2OA 4DXCA 4DDSA 3O3VA 3B3XA 3MXSA 3VP3A 1K56D 4M3KA 4OVDA 5EVIC 1NZOA 1GA9A 3IF6C 1BLHA 3O88A 3PAGA 3A3EA 4FH4A 4S2IA 1W5DA 3MXRA 2WKIA 3N6IA 2HDSA 1VQQA 4LCMA 1PWGA 4B4ZA 1FQGA 4ID4A 5CRFA 5GLBA 1LL9A 5JYPA 1PZPA 2J8YA 2Q9MA 4OPRA 5GLCA 4DE1A 4WZ5A 3G34A 2ZC4B 1CEFA 5A92A 3UNWA 3FKWA 3LY4A 5HAIA 3PAEA 3ITBA 4EUZA 2IWBA 5HW3A 3HLEA 4ZBEA 1BTLA 1M40A 4QHCA 1KDWA 4DRTA 3PBRA 3DTMA 3GR2A 1S6RA 3PBSA 4UA6A 3VP0A 4DE2A 5M19A 3Q82A 5GHXA 1EI5A 1M6KA 4OLGA 1L0FA 1E3UA 1Z6FA 1TDLA 4KG5A 3NI9A 4KZ6A 5FA7A 3SH7A 1E4DA 2BLSA 3MFDA 4ZTKA 5FAPA 3V50A 1WYBA 4HBTA 1SDNA 1HZOA 4XUZA 5EOOA 4OOLA 3OPLA 5TFQA 1YLJA 4IBRA 4E3JA 3M6BA 4JXVA 3FV7A 1TDGA 3P09A 1L0GA 3UY6A 2WGWB 1JWPA 2EX6A 4XUXA 5E2EA 3C4OA 3G35A 1MBLA 2HDUA 3ZG9B 1IYOA 2Y2KA 4QU3A 3BFCA 4RX2A 4K0XA 1NYYA 5FI7A 3ZG7B 3IH8A 4QD4A 2DCFA 3NDGA 1FCNA 3UPPA 2P74A 5J8XA 3IXDA 5GLAA 4KG6A 2Y2PA 1RGZA 3HLWA 3JYIA 4OLDA 2X01A 4IEDA 3FWLA 2G2WA 3HREA 4EBLA 3AGEA 3VFHA 4EBPA 1DJCA 2ZM2A 2ZQDA 4KQOA 4OQGA 3W8KA 5A90A 1PWCA 2EX8A 3N8LA 1IELA 1MWTA 3IXGA 4RX3A 5FI6A 4DE0A 3BRMA 3Q7ZA 4X6TA 3IWQA 1IYSA 5M1AA 1YLZA 2CC1A 3D4FA 4CPKA 1JTGA 4N92A 3WS0A 1MXOA 4N9LA 4WZ4A 1AXBA 5EVIA 1E25A 3OPRA 3HUMA 3IF6A 5GL9A 1ERMA 2WAEA 3BFDA 5EVIB 3QNBA 2Y2QA 2EFXA 2OLUA 1H5XA 3LCEA 4GDNA 3ZVTA 2Y91A 1N4OA 5E2FA 5EE8A 5HL1A 3VP1A 1ES5A 2Y2OA 3BFFA 4BL3A 1ES3A 3PTEA 4OH0A 2WZXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K38 A;  1JWV A;  3NIA A;  5AQB A;  5A91 A;  1FSW A;  4N9K A;  4YIN A;  3C7V A;  1WE4 A;  5FQ9 A;  1K57 C;  3Q1F A;  1TEM A;  3A3D A;  4GZB A;  2R9X A;  2XQZ A;  2FFF B;  2Y2G A;  2ZQA A;  3FKV A;  3MKE A;  4PM7 A;  1W7F A;  4Y0U A;  3VMA A;  1PI4 A;  4QJG A;  1KE4 A;  2ZQ8 A;  1N9B A;  4RA7 A;  5E43 A;  5FI2 A;  5JYO A;  5KSH A;  3NCK A;  5HAP A;  4UHU A;  5CTM A;  4BD0 A;  3V5M A;  1I2S A;  3AGD A;  4Y0O A;  2X02 A;  1H8Z A;  1MKI A;  3IHA A;  5FQK A;  5GHY A;  5IHV A;  1CI9 A;  1G6A A;  2XFT A;  5F83 A;  1K25 A;  3MZF A;  1JVJ A;  5TGF A;  1ZC2 A;  1PYY A;  3FYZ A;  2V20 A;  2IWD A;  2OV5 A;  4FSF A;  2ZQ7 A;  5CER A;  3UE3 A;  2H0Y A;  2ZQ9 A;  1SCW A;  2H5S A;  5DF9 A;  1FOF A;  4OON A;  3DW0 A;  3UE0 A;  4YFM A;  5HAQ A;  4E3I A;  1MY8 A;  3HUO A;  3QNC A;  3PBN A;  1XGI A;  2Z2M B;  3EQU A;  1J9M A;  1L0D A;  1OME A;  2XH9 A;  4N1X A;  4L0L A;  4WYY A;  3VSL A;  4MBF A;  2A3U A;  2Z2L B;  5CHU A;  3PBT A;  4DDY A;  2Y2L A;  4KZ3 A;  1K6S A;  1E3U D;  1ESI A;  3A3F A;  3IH9 A;  1G68 A;  3O87 A;  2JBF A;  3OCL A;  4GKU A;  1ERQ A;  2HDQ A;  4OP5 A;  4PMA A;  2XK1 A;  2HPB A;  1BUE A;  3N8R A;  3HLB A;  5TR7 A;  5CEB A;  4S2P A;  2FFY A;  4WMC A;  4C6Y A;  1SHV A;  2RL3 A;  4MNR A;  4OPQ A;  4QB8 A;  3ZG0 A;  2ZLY A;  4JPM A;  4RYE A;  3VOZ A;  3IXH A;  1W8Y A;  3E2L A;  1YLT A;  1KGG A;  3A3I A;  5CGX A;  5F1F A;  1BSG A;  1IYQ A;  2XDM A;  1LLB A;  1NY0 A;  3WRZ A;  5D3O A;  2EX9 A;  2Y2J A;  3EQV A;  2WGW A;  4X68 A;  5M18 A;  1K57 A;  1K54 C;  4B4X A;  3TOI A;  1VM1 A;  4P85 A;  1ZG4 A;  4JKT A;  3SS4 A;  3ZGA B;  1ES2 A;  3UO9 A;  5AQA A;  1DJA A;  1O7E A;  2C6W B;  3HBR A;  4E6W A;  3IWO A;  1K55 C;  3BLM A;  4OOM A;  3NDE A;  2A49 A;  3V3R A;  3C7U A;  2ZC3 B;  4NK3 A;  3Q07 A;  4B88 A;  3NC8 A;  1IKI A;  1ZKJ A;  3Q81 A;  3LY3 A;  1KGE A;  2WZZ A;  5EVI D;  1CK3 A;  4DKI A;  2WAD A;  4U3T A;  1LHY A;  2V1Z A;  5DF7 A;  4XXR A;  5CHJ A;  4LV2 A;  4OQI A;  3ZFZ A;  4BQM A;  3M2J A;  4U0X A;  4K0W A;  4GD6 A;  3W4P A;  3G31 A;  3ZG8 B;  3OZH A;  1YQS A;  4FH2 A;  4JBF A;  3I7J A;  1PIO A;  2HP5 A;  3UE1 A;  1CEG A;  1YM1 A;  5BOH A;  4X53 A;  2GDN A;  1RGY A;  4EV4 A;  2Y55 A;  3UPO A;  3CZD A;  1H8Y A;  1SKF A;  1K4E A;  5L2F A;  1I5Q A;  2R9W A;  1JTD A;  1I2W A;  5DVA A;  5AQ9 A;  2V2F F;  2J9P A;  4KZA A;  4JF4 A;  2OLV A;  5FQI A;  3WWX A;  4UAA A;  1MWU A;  5HFO A;  4LV0 A;  1FSY A;  4K91 A;  5AQ7 A;  4BJP A;  1IKG A;  1BLS A;  5DTT A;  5FAT A;  4S2M A;  3UN7 A;  3P98 A;  4HEF A;  1IEM A;  1QME A;  2QZ6 A;  1K6R A;  2XR0 A;  4WM9 A;  4ZJ1 A;  3BYD A;  1XX2 A;  3ISG A;  4LV3 A;  1O07 A;  5F1G A;  4BEN A;  4EWF A;  3IT9 A;  4R4S A;  2Y2M A;  5GLD A;  4N1H A;  4PPR A;  2ZMA A;  1BT5 A;  2J7V A;  3MZD A;  1Y54 A;  4R1G A;  3MBZ A;  1LL5 A;  3GVB A;  4WEJ A;  5CED A;  4WBG A;  1PWD A;  1L0E A;  3VSK A;  2I72 A;  3GTC A;  4OPY A;  5CHM A;  4HES A;  4E3M A;  3BFG A;  5DTK A;  4FCF A;  1QMF A;  5GHZ A;  3V3S A;  3DWZ A;  1XA1 A;  3HLD A;  2ZJ9 A;  3RJU A;  1XXM A;  4MLL A;  4C3Q A;  2XF3 A;  2JC7 A;  1NJ4 A;  5A93 A;  3Q7V B;  1GHI A;  5EVL A;  2HP6 A;  4JLF A;  3G4P A;  3IF5 A;  4PM5 A;  3ZNT A;  3C4P A;  2DNS A;  3HLF A;  4GB7 A;  4KZ4 A;  4OQH A;  2ZM0 A;  2WGI A;  3NBL A;  2BG1 A;  4R4R A;  3UPN A;  1ES4 A;  4E3N A;  2J9O A;  4MBK A;  3TSG A;  3MZE A;  4IBX A;  1IYP A;  3ZHH A;  3BLS A;  1Q2P A;  2WUQ A;  4OPZ A;  1NXY A;  2HDR A;  4WMC D;  1TVF A;  3O86 A;  4QY6 A;  4R3J A;  1CI8 A;  2Y4A A;  4OQ0 A;  1DY6 A;  3FZC A;  2HP9 A;  3ZG5 A;  4S2L A;  4UA7 A;  2ZD8 A;  3S4X A;  5FQJ A;  5FAQ A;  2PU4 A;  1NYM A;  3OPP A;  2G2U A;  2WGV A;  4EQI A;  2P9V B;  3WRT A;  3E2K A;  2RCX A;  3SS5 A;  1BLP A;  4LV1 A;  1Q2Q A;  2VGK A;  4LCL A;  2OSU A;  1U60 A;  1NRF A;  3A3J A;  3OC2 A;  4P0M A;  3IWI A;  4PM9 A;  4E3L A;  5I94 A;  4S2K A;  1KDS A;  2B5R A;  4ZJ3 A;  3G30 A;  3SS3 A;  2ZM8 A;  4PM6 A;  1RP5 A;  3UDX A;  3CMZ A;  3W4O A;  4DF6 A;  4ZDX A;  1GA0 A;  1MWR A;  4R3B A;  4KQQ A;  5FDH A;  4OKP A;  1K56 A;  4S2N C;  5FSR A;  3GSG A;  4DE3 A;  1MPL A;  2JCH A;  1BZA A;  3G2Y A;  4KEN B;  4DXB A;  3DWK A;  4R0Q A;  2EXA A;  1C3B A;  3LEZ A;  3VP2 A;  3W4Q A;  5FAS A;  3GMW A;  3N7W A;  1YLY A;  2EFU A;  3M6H A;  4NET A;  4Y0T A;  3N4I A;  2XD1 A;  4WEL A;  2E8I A;  1ONH A;  1XA7 A;  2Y59 A;  4OOY A;  1GHP A;  5FQQ A;  2C5W B;  1W79 A;  3S22 A;  5CGW A;  4CJN A;  1FR1 A;  2IWC A;  4JXG A;  5FAO A;  3RXX A;  1KE0 A;  3SH9 A;  4GOG A;  2DRW A;  3BEB A;  4E6X A;  5DF8 A;  3HUN A;  1HVB A;  5KZH A;  4FD8 A;  2QPN A;  1GHM A;  5CTN A;  3V39 A;  3HLC A;  4JF5 A;  1SDE A;  4KZ5 A;  1XGJ A;  4KZ8 A;  1KVM A;  3AGF A;  2Q9N A;  4WEK A;  3GRJ A;  1W8Q A;  3HVF A;  4C75 A;  1DJB A;  4Z9Q A;  4E3O A;  2ZQC A;  5EEC A;  5G18 A;  5KSC A;  1XPB A;  2PBY A;  4BLM A;  3OPH A;  3HLG A;  1KVL A;  4GDB A;  4KQR A;  2JE5 A;  4U0T A;  4JXW A;  3G2Z A;  3UDF A;  3IHB A;  1RCJ A;  1K4F A;  4MBH A;  1EWZ A;  2WKE A;  1KE3 A;  2VGJ A;  4JXS A;  5U47 A;  4RVA A;  1FCO A;  2EXB A;  5DTS A;  4OP8 A;  3RXW A;  2ZC5 B;  3ZDJ A;  4WZ5 C;  3OCN A;  2XLN A;  1BLC A;  1ERO A;  1YMX A;  5CXW A;  4GD8 A;  4MEZ A;  3CJM A;  3TG9 A;  3HL9 A;  2WK0 A;  5HAR A;  3S1Y A;  3G32 A;  4KZ7 A;  2QMI A;  3C5A A;  4Q8I A;  1ZG6 A;  3PBQ A;  1YLW A;  2ZC6 B;  3BEC A;  4P87 A;  1LI9 A;  4O7D A;  4P6B A;  5FQM A;  2UWX A;  2EX2 A;  1FCM A;  2ZC7 A;  3M2K A;  3MKF A;  1YT4 A;  3VP4 A;  3PBO A;  4KZ9 A;  4GN2 A;  4IVK A;  5E2H A;  1PW8 A;  1ONG A;  3ZVW A;  3IF6 B;  3WS1 A;  2X71 A;  2WKH A;  4JF6 A;  4H8R A;  4F94 A;  3ITA A;  1XP4 A;  4BD1 A;  1MWS A;  4QY5 A;  2Y2I A;  4BL2 A;  1JWZ A;  3WS4 A;  4LEN A;  4S2N A;  1YLP A;  4R23 A;  3SOI A;  2Y2H A;  3WS5 A;  4E3K A;  3Q7V A;  5CEC A;  4UA9 A;  4KZB A;  4GNU A;  1LI0 A;  1BUL A;  4X69 A;  5EPH A;  2H10 A;  5E2G A;  3WS2 A;  1K54 A;  4S2J A;  2PU2 A;  1WYC A;  2WAF A;  4S2O A;  3BM6 A;  3ZNY A;  5EOE A;  1KGF A;  4IVI A;  5HX9 A;  1GCE A;  4EBN A;  4X55 A;  4PM8 A;  3VOY A;  3ZCZ A;  1PW1 A;  1HD8 A;  3N8S A;  1NZU A;  4X56 A;  5EUA A;  1K55 A;  1L2S A;  1PI5 A;  5CGS A;  2WYX A;  3GV9 A;  2XGN A;  2XFS A;  5F82 A;  2XD5 A;  2XEP A;  1YMS A;  4ZAM A;  1ALQ A;  3BFE A;  3IQA A;  4KG2 A;  1XKZ A;  1S0W A;  1ESU A;  3CG5 A;  1FR6 A;  3SH8 A;  3LO7 A;  3IXB A;  4A5R A;  5KMW A;  2Y2N A;  4HBU A;  3QHY A;  1PZO A;  3UDI A;  3VFF A;  3GQZ A;  2H0T A;  3NY4 A;  4Y7P A;  2P9V A;  4ZJ2 A;  1HTZ A;  4D2O A;  4DXC A;  4DDS A;  3O3V A;  3B3X A;  3MXS A;  3VP3 A;  1K56 D;  4M3K A;  4OVD A;  5EVI C;  1NZO A;  1GA9 A;  3IF6 C;  1BLH A;  3O88 A;  3PAG A;  3A3E A;  4FH4 A;  4S2I A;  1W5D A;  3MXR A;  2WKI A;  3N6I A;  2HDS A;  1VQQ A;  4LCM A;  1PWG A;  4B4Z A;  1FQG A;  4ID4 A;  5CRF A;  5GLB A;  1LL9 A;  5JYP A;  1PZP A;  2J8Y A;  2Q9M A;  4OPR A;  5GLC A;  4DE1 A;  4WZ5 A;  3G34 A;  2ZC4 B;  1CEF A;  5A92 A;  3UNW A;  3FKW A;  3LY4 A;  5HAI A;  3PAE A;  3ITB A;  4EUZ A;  2IWB A;  5HW3 A;  3HLE A;  4ZBE A;  1BTL A;  1M40 A;  4QHC A;  1KDW A;  4DRT A;  3PBR A;  3DTM A;  3GR2 A;  1S6R A;  3PBS A;  4UA6 A;  3VP0 A;  4DE2 A;  5M19 A;  3Q82 A;  5GHX A;  1EI5 A;  1M6K A;  4OLG A;  1L0F A;  1E3U A;  1Z6F A;  1TDL A;  4KG5 A;  3NI9 A;  4KZ6 A;  5FA7 A;  3SH7 A;  1E4D A;  2BLS A;  3MFD A;  4ZTK A;  5FAP A;  3V50 A;  1WYB A;  4HBT A;  1SDN A;  1HZO A;  4XUZ A;  5EOO A;  4OOL A;  3OPL A;  5TFQ A;  1YLJ A;  4IBR A;  4E3J A;  3M6B A;  4JXV A;  3FV7 A;  1TDG A;  3P09 A;  1L0G A;  3UY6 A;  2WGW B;  1JWP A;  2EX6 A;  4XUX A;  5E2E A;  3C4O A;  3G35 A;  1MBL A;  2HDU A;  3ZG9 B;  1IYO A;  2Y2K A;  4QU3 A;  3BFC A;  4RX2 A;  4K0X A;  1NYY A;  5FI7 A;  3ZG7 B;  3IH8 A;  4QD4 A;  2DCF A;  3NDG A;  1FCN A;  3UPP A;  2P74 A;  5J8X A;  3IXD A;  5GLA A;  4KG6 A;  2Y2P A;  1RGZ A;  3HLW A;  3JYI A;  4OLD A;  2X01 A;  4IED A;  3FWL A;  2G2W A;  3HRE A;  4EBL A;  3AGE A;  3VFH A;  4EBP A;  1DJC A;  2ZM2 A;  2ZQD A;  4KQO A;  4OQG A;  3W8K A;  5A90 A;  1PWC A;  2EX8 A;  3N8L A;  1IEL A;  1MWT A;  3IXG A;  4RX3 A;  5FI6 A;  4DE0 A;  3BRM A;  3Q7Z A;  4X6T A;  3IWQ A;  1IYS A;  5M1A A;  1YLZ A;  2CC1 A;  3D4F A;  4CPK A;  1JTG A;  4N92 A;  3WS0 A;  1MXO A;  4N9L A;  4WZ4 A;  1AXB A;  5EVI A;  1E25 A;  3OPR A;  3HUM A;  3IF6 A;  5GL9 A;  1ERM A;  2WAE A;  3BFD A;  5EVI B;  3QNB A;  2Y2Q A;  2EFX A;  2OLU A;  1H5X A;  3LCE A;  4GDN A;  3ZVT A;  2Y91 A;  1N4O A;  5E2F A;  5EE8 A;  5HL1 A;  3VP1 A;  1ES5 A;  2Y2O A;  3BFF A;  4BL3 A;  1ES3 A;  3PTE A;  4OH0 A;  2WZX A; 
#chains in the Genus database with same CATH topology
 1K38 A;  1F98 A;  5A91 A;  1FSW A;  1K57 C;  3Q1F A;  1ODV A;  2UV0 E;  4HI4 A;  3CUE C;  4B9O A;  2R9X A;  3FKV A;  2AVX A;  2FFF B;  2ZQA A;  1W7F A;  1UWN X;  4QJG A;  5HD3 A;  1KE4 A;  2PAV P;  4UHU A;  3U2A A;  5CTM A;  1OPX A;  4ESP A;  1I2S A;  1MKI A;  4WLA A;  5F83 A;  1JVJ A;  2VX8 A;  1ZC2 A;  2V20 A;  5CER A;  3T4T A;  2H5S A;  1XJ2 A;  4OON A;  4YFM A;  5EVE A;  5HAQ A;  3PBN A;  3EQU A;  2XH9 A;  4WYY A;  3CIT A;  2D01 A;  4DDY A;  2Y2L A;  1K6S A;  3CAX A;  3OLO A;  1ERQ A;  3T1S A;  1G5U A;  2HPB A;  5HPF A;  4LRZ E;  3HLB A;  1K0K A;  1OJG A;  4WMC A;  2QWS A;  1SHV A;  2RL3 A;  4JPM A;  4RYE A;  3A3I A;  5HWV A;  3EGD C;  1BSG A;  3F1O A;  4CLC A;  3WRZ A;  2WGW A;  1K57 A;  3CUE A;  4P85 A;  4JKT A;  3LFV A;  5AQA A;  1DJA A;  2C6W B;  1Z09 A;  3NDE A;  1S4S A;  4MN7 A;  2XRO A;  3Q81 A;  3LY3 A;  1KGE A;  5EVI D;  5HPI A;  2W1T A;  5DF7 A;  4XXR A;  4K0W A;  4GS9 A;  3CPT A;  3G31 A;  5L07 A;  1VB6 A;  3OZH A;  1YQS A;  5HZH A;  1PIO A;  2EWW A;  2ACG A;  2HZ5 A;  1YM1 A;  5BOH A;  3FG8 A;  1SKF A;  4KZA A;  1AWI A;  1KOU A;  3IS2 B;  4LV0 A;  1FSY A;  1IKG A;  3SW1 A;  2QZ6 A;  2XR0 A;  1L3L A;  4LV3 A;  5F1G A;  3GEC A;  3VOL A;  2ZMA A;  2J7V A;  2MJ6 A;  1Y54 A;  3MBZ A;  4WEJ A;  4WBG A;  1PWD A;  2M7V A;  3GTC A;  1DP8 A;  5CHM A;  4E3M A;  2QJ5 A;  3HLD A;  1XXM A;  2JC7 A;  3BJN A;  1S1Z A;  2W3F A;  3ZQ5 A;  2HP6 A;  4WUJ A;  3ZNT A;  2DNS A;  4HH2 A;  3HLF A;  4HJ4 A;  2JHE A;  4F3L A;  4HY8 A;  1ES4 A;  3H7W A;  4I5S A;  3TSG A;  1IYP A;  3BLS A;  4WMC D;  4R3J A;  1CI8 A;  4OQ0 A;  2VGL M;  2W1R A;  2ZD8 A;  2O9B A;  4Y17 A;  1NLZ A;  1XFN A;  2PU4 A;  2YKF A;  3F1P B;  3OPP A;  4LV1 A;  3T4L A;  5AVF A;  4WF0 A;  1NRF A;  3IWI A;  4ZJ3 A;  3G30 A;  3A0V A;  2ZM8 A;  4PM6 A;  3W4O A;  3CMZ A;  1GA0 A;  4R3B A;  5FDH A;  4JGR A;  2J3T D;  3VV4 A;  3G6O A;  3VP2 A;  5EV0 A;  1V9Z A;  3N7W A;  4UQI M;  1YLY A;  4P6Z M;  2XD1 A;  1GSV A;  1ONH A;  3S22 A;  4CJN A;  1GHP A;  5FAO A;  4NXG A;  3QP6 A;  4GOG A;  3QP4 A;  5DF8 A;  5F69 A;  5KZH A;  2PT7 A;  1GHM A;  3V39 A;  1SDE A;  4KZ5 A;  3AGF A;  1W8Q A;  3DBA A;  3JPU A;  3HVF A;  2PR5 A;  4Z9Q A;  1XPB A;  3OPH A;  2ZMV A;  1KVL A;  4GDB A;  1LSX A;  5FL3 A;  4JXW A;  1K4F A;  2WKE A;  4JXS A;  5DTS A;  4YNR A;  1YMX A;  5CXW A;  3IX3 A;  3HL9 A;  2WK0 A;  1A0K A;  1W63 Q;  3NUL A;  4Z1W A;  1YLW A;  4P87 A;  3UMD A;  5FQM A;  3BQ8 A;  1N9O A;  3IF6 B;  4JF6 A;  1XP4 A;  4EEP A;  1MWS A;  4QY5 A;  2R78 A;  4LEN A;  1T19 A;  4R23 A;  4E3K A;  3H82 B;  3Q7V A;  4KZB A;  4GNU A;  1LI0 A;  1BUL A;  4BBU A;  2WKR A;  1WYC A;  2WAF A;  4EBN A;  4PM8 A;  3VOY A;  4HNB A;  1HD8 A;  5EUA A;  1PI5 A;  5CGS A;  2XGN A;  1YKD A;  2XFS A;  2XD5 A;  2VEA A;  3BFE A;  1XKZ A;  3CG5 A;  2EA9 A;  4A5R A;  2Y2N A;  4EES A;  4Y7P A;  2P9V A;  3E4Q A;  4ZJ2 A;  4D2O A;  4M3K A;  4OVD A;  2VZW A;  4FH4 A;  3ZYT A;  1VQQ A;  4LCM A;  4B4Z A;  1FQG A;  1XJ6 A;  1PZP A;  2Q9M A;  3G34 A;  2VGL S;  5A92 A;  1H0M A;  3ITB A;  5FEG A;  2IWB A;  1M40 A;  4DRT A;  3DTM A;  3PBS A;  4JGP A;  3VP0 A;  3Q82 A;  4OLG A;  1M6K A;  3PHY A;  1E4D A;  2BLS A;  3MFD A;  5FAP A;  5EOO A;  3S7N A;  3T4K A;  3A0R A;  5HWT A;  3M6B A;  2ZL1 A;  2L1M A;  3E4P A;  4XUX A;  5E2E A;  1MBL A;  4UQI S;  3T4S A;  2Y2K A;  4QU3 A;  3BFC A;  4P6Z S;  4RX2 A;  1OTI A;  3DTI A;  3NDG A;  2Y2P A;  4OLD A;  3V67 A;  3HRE A;  3AGE A;  2ZM2 A;  4OQG A;  3MSH A;  4I3J A;  2EX8 A;  1IEL A;  5FI6 A;  3BRM A;  3MR0 A;  3D4F A;  4CPK A;  1JTG A;  1S4R A;  4N9L A;  3T12 B;  5A8B A;  1E25 A;  5GL9 A;  4FOF A;  2WAE A;  3TW8 A;  1N9N A;  2JKT M;  4R38 A;  2ZOH A;  1H5X A;  5TBM A;  4GDN A;  5HL1 A;  5EE8 A;  1N4O A;  4H6J B;  1ES5 A;  2HV1 A;  4OH0 A;  2WKQ A;  5AQB A;  4N9K A;  4YIN A;  3F1N B;  3MKE A;  4Y0U A;  2Y79 A;  2PRF A;  4PM7 A;  1PI4 A;  3LIB A;  2W3H A;  2YKH A;  1S67 L;  3V5M A;  4Y0O A;  2Z6D A;  5GHY A;  1STZ A;  1OTA A;  1K25 A;  3FYZ A;  4FSF A;  3T1R A;  2KLI A;  1WA9 A;  3R7W A;  3DW0 A;  4E04 A;  1MY8 A;  3HUO A;  5L09 A;  2FH5 A;  2Z2M B;  1OME A;  3VSL A;  4MBF A;  3HJK A;  5CHU A;  3IH9 A;  4HJ6 A;  3O87 A;  4GKU A;  4L9F A;  2HDQ A;  4OP5 A;  2HF6 A;  3N8R A;  3C2W A;  2Y8H A;  3BQA A;  3MQO A;  1T1A A;  4S2P A;  4MNR A;  3ZG0 A;  1D1J A;  1W8Y A;  1YLT A;  1IOU A;  1LSV A;  3UE6 A;  2QYB A;  3GDI A;  5DKK A;  1K54 C;  1ZG4 A;  3ZGA B;  1ES2 A;  1O7E A;  4E6W A;  1K55 C;  3D3O A;  2PBD P;  3C7U A;  4NK3 A;  4I39 A;  4B88 A;  3NC8 A;  4DKI A;  4U3T A;  1LHY A;  2JKR M;  4OQI A;  5HDS A;  3M2J A;  1DP9 A;  2V8F A;  3ZG8 B;  4JBF A;  2GNX A;  3QP1 A;  3UE1 A;  4X53 A;  4IUH A;  4EV4 A;  2VV8 A;  1JTD A;  5G4Y A;  2V2F F;  4DJ2 A;  1ZHH B;  3MJQ A;  5HFO A;  2QHK A;  5DTT A;  4WM9 A;  1K6R A;  4ZJ1 A;  5F6A A;  4BEN A;  4EWF A;  4R4S A;  1BT5 A;  3GVB A;  3VSK A;  1YSQ A;  4MMN A;  3BFG A;  5DTK A;  4FCF A;  1QMF A;  4HOI A;  5GHZ A;  3DWZ A;  4NXB A;  3FPW A;  4MLL A;  4BMW A;  2HJ9 C;  3OOV A;  1TS0 A;  3C4P A;  4GB7 A;  3FPV A;  4OQH A;  2ZM0 A;  3NBL A;  4R4R A;  3UPN A;  1PFL A;  3MZE A;  4EUV A;  1TVF A;  2Y4A A;  4QWO A;  3FZC A;  4IHQ A;  2HP9 A;  4GHI A;  3EEH A;  4UA7 A;  3ZG5 A;  1CQA A;  5AJG A;  4EQI A;  2WGV A;  3E0Y A;  3OC2 A;  4E3L A;  4PM9 A;  1FIK A;  4QPR A;  4S2K A;  2EWV A;  3SS3 A;  4DF6 A;  1RP5 A;  3U4L P;  4ZDX A;  4KQQ A;  3NHQ A;  3GSG A;  5HD5 A;  1MPL A;  2JCH A;  4DXB A;  3DWK A;  4R0Q A;  2EXA A;  5DJT A;  3LEZ A;  5FAS A;  1FIL A;  2IA2 A;  2EFU A;  3N4I A;  4X25 A;  5CGW A;  4R70 A;  4RQ9 A;  2IWC A;  1KE0 A;  5EFW A;  3TRC A;  2M1C A;  2QPN A;  3HLC A;  1TS7 A;  3JVV A;  2ZQC A;  1TD5 A;  3BY9 A;  4DN0 A;  5DFY A;  2HJE A;  1S66 L;  3IX8 A;  3UDF A;  1VHM A;  1RCJ A;  1KE3 A;  4Y15 A;  3C30 A;  1GSX A;  3LID A;  4GD8 A;  2V0W A;  4KZ7 A;  2QMI A;  3LIE A;  4Q8I A;  3PR6 A;  1LI9 A;  4P6B A;  2EX2 A;  3M2K A;  4XT2 A;  3VP4 A;  3PBO A;  4IVK A;  5E2H A;  1P9R A;  2X71 A;  2WKH A;  1JWZ A;  3WS4 A;  1YLP A;  3WS5 A;  1G28 A;  5CEC A;  2V1A A;  3NOP C;  2XA7 M;  3EGX C;  4PKY G;  2CMN A;  2H10 A;  4YOF A;  5E2G A;  4S2J A;  4S2O A;  1OT9 A;  3ZCZ A;  4NEE D;  2LB9 A;  3N8S A;  1SKO A;  2WYX A;  1VEU A;  5IT5 A;  4K08 A;  2J3W A;  1ALQ A;  1ESU A;  3IXB A;  3UDI A;  2H0T A;  4KQD A;  1HTZ A;  4ZRR A;  4DDS A;  3O3V A;  2NUT C;  3VP3 A;  4CLC E;  1NZO A;  3T4Q A;  3O88 A;  3A3E A;  3MXR A;  3N6I A;  1XJ4 A;  4ID4 A;  5CRF A;  5GLB A;  1LL9 A;  5JYP A;  4DE1 A;  1CEF A;  5J7E A;  2KDK A;  5HAI A;  3PAE A;  3NJA A;  1YSP A;  3HLE A;  4QHC A;  5IU1 A;  3BY8 A;  2H28 A;  4HH3 A;  1J3W A;  3GR2 A;  1NRJ A;  5M19 A;  5JYO A;  1L0F A;  1Z6F A;  3KYE A;  1TDL A;  3SH7 A;  3LYX A;  3V50 A;  2VV7 A;  3RH8 B;  1SDN A;  4ARZ A;  3T50 A;  5CX7 A;  5LBR A;  4CLC B;  2O99 A;  3FV7 A;  1TDG A;  5EM1 A;  3IBJ A;  1L0G A;  1LT0 A;  1JWP A;  2WGW B;  3C4O A;  2HDU A;  3ZG9 B;  1IYO A;  1NYY A;  5FI7 A;  3ZG7 B;  2DCF A;  3UPP A;  3KYQ A;  2P74 A;  3MXQ A;  4R3A A;  5J8X A;  3IXD A;  4B93 A;  1RGZ A;  3HLW A;  3JYI A;  4D60 A;  2X01 A;  2G2W A;  4EBL A;  3VFH A;  1DJC A;  4KQO A;  2W1T B;  3LGO A;  4DE0 A;  4BBT A;  3HJI A;  3IWQ A;  4FTX A;  1YLZ A;  4GS9 B;  4N92 A;  3CPT B;  3UB9 A;  3OPR A;  1VET B;  3HUM A;  4HQA A;  1ERM A;  2K7S A;  4H6J A;  5IS1 A;  3VP1 A;  4BL3 A;  4UEY A;  3LR0 A;  2VK3 A;  1JWV A;  3F1N A;  3C7V A;  1WE4 A;  5FQ9 A;  2OWJ A;  1TEM A;  5C5K A;  1IFQ A;  4LGW A;  4RA7 A;  5E43 A;  2B02 A;  5HL6 A;  1T1C A;  1UGU A;  3NCK A;  5HAP A;  4BD0 A;  2X02 A;  2P08 A;  5FQK A;  3IHA A;  5IHV A;  1G6A A;  2LB5 A;  3MZF A;  1UWP X;  2BAS A;  1PYY A;  2I9V A;  2PD7 A;  3T1X A;  2O9A A;  3UE3 A;  2ZQ9 A;  5DF9 A;  4HP4 A;  4NKP A;  1FOF A;  3LR3 A;  1T18 A;  3UE0 A;  1DP6 A;  3LIC A;  3QNC A;  4F3L B;  1XGI A;  1L0D A;  3H7W B;  4L0L A;  3E4O A;  3PBT A;  1Y28 A;  3A3F A;  1XFQ A;  2JBF A;  4GCZ A;  3ULF A;  1BUE A;  5J3W A;  5TR7 A;  5CEB A;  4EQ1 A;  2FFY A;  4C6Y A;  4OPQ A;  2ZLY A;  3VOZ A;  3IXH A;  3E2L A;  1KGG A;  3T1Q B;  1NY0 A;  5D3O A;  2EX9 A;  2A2L A;  4KUO A;  4X68 A;  5F5Y A;  4B4X A;  1VM1 A;  1OTD A;  4JGO A;  1X0O A;  3SS4 A;  3TE8 A;  2W27 A;  2L0W A;  3BLM A;  4OOM A;  2A49 A;  3V3R A;  3Q07 A;  1ZKJ A;  2V1B A;  2A24 A;  4GJ4 A;  2V1Z A;  4LV2 A;  3ZFZ A;  4U0X A;  4GD6 A;  4FH2 A;  3I7J A;  1CEG A;  2GDN A;  3UPO A;  5L2F A;  1K4E A;  1I5Q A;  2R9W A;  1I2W A;  5DVA A;  2J9P A;  2OLV A;  4MCW A;  3BWL A;  4UAA A;  5AQ7 A;  4BJP A;  1W63 M;  1BLS A;  5FAT A;  3UN7 A;  3P98 A;  4Q0H A;  2GZA A;  3IT9 A;  2Y2M A;  4IUK A;  4N1H A;  4GLQ A;  4R1G A;  1LL5 A;  2I72 A;  4OPY A;  3H9W A;  3UB8 A;  3V3S A;  1T1B A;  2ZJ9 A;  2NUP C;  4C3Q A;  3Q7V B;  1GHI A;  5EVL A;  4FUW A;  4JLF A;  3G4P A;  2W3G A;  3E98 A;  1OTE A;  4KZ4 A;  1BYW A;  2BG1 A;  3CHW P;  4E3N A;  2J9O A;  3ZHH A;  1P9W A;  4OPZ A;  4AFI A;  5DFX A;  4EET B;  2HDR A;  3O86 A;  4QY6 A;  5TJJ A;  1TS8 A;  3P7N A;  1DY6 A;  4S2L A;  1N9L A;  3S4X A;  5FQJ A;  5FEF A;  1H8M A;  3R4K A;  2P9V B;  5MC7 A;  3IX4 A;  2RCX A;  3SS5 A;  3MF0 A;  1BLP A;  2KX6 A;  3LIA A;  2M7U A;  2OSU A;  1U60 A;  4ME4 A;  4O0P A;  3B42 A;  3K2N A;  2ZMF A;  3A3J A;  5I94 A;  2B5R A;  3UDX A;  1MWR A;  4OKP A;  5FSR A;  5G4Z A;  3W2Z A;  4DE3 A;  3NOU C;  3EOI A;  1BZA A;  3DAV A;  1C3B A;  3W4Q A;  2W3E A;  3CWF A;  1GSW A;  3GMW A;  4LFU A;  4Y0T A;  4WEL A;  5FQQ A;  2E8I A;  2Y59 A;  2C5W B;  1FR1 A;  4JXG A;  3CLO A;  3RXX A;  3SH9 A;  2PDR A;  4LPZ A;  3MFX A;  5CTN A;  4JF5 A;  4KZ8 A;  3KSF A;  2Q9N A;  4WEK A;  4C75 A;  1DJB A;  1P97 A;  4E3O A;  5G18 A;  4LRY C;  2V8C A;  4BLM A;  3HLG A;  3ICY A;  2JE5 A;  4U0T A;  2VGJ A;  3IS2 A;  5U47 A;  4RVA A;  1FCO A;  3RXW A;  2ZC5 B;  3RFB A;  4WL9 A;  4WZ5 C;  3OCN A;  1BLC A;  1OTB A;  3TG9 A;  2D02 A;  3FC7 A;  3S1Y A;  5HWW A;  3S7Q A;  3EEA A;  1ZG6 A;  2ZC6 B;  4MDZ A;  2VA0 A;  2UWX A;  2K31 A;  2ZC7 A;  3MKF A;  1YT4 A;  3LI8 A;  1ONG A;  3ZVW A;  3WS1 A;  1F9I A;  3ITA A;  4BD1 A;  4CLC C;  2Y2I A;  5TBM B;  4BL2 A;  2L4R A;  3SOI A;  2Y2H A;  4X69 A;  1K54 A;  3ZNY A;  3BM6 A;  5EOE A;  4IVI A;  1GCE A;  1PW1 A;  2J3T C;  1NZU A;  4X56 A;  1K55 A;  3BW6 A;  3GV9 A;  4Q0J A;  5F82 A;  2DMW A;  3IQA A;  4KG2 A;  3O5Y A;  1S0W A;  4EU0 A;  1PZO A;  3MQQ A;  3P01 A;  3F1P A;  3VFF A;  3GQZ A;  5HSQ A;  3L7H A;  3LUQ A;  3LIF A;  1GA9 A;  3IF6 C;  1BLH A;  3PAG A;  4MN5 A;  3R7W B;  2QKP A;  2WKI A;  5J4E A;  3UME A;  2HDS A;  3HCY A;  5GLC A;  4WZ5 A;  1HLU P;  3FKW A;  5DJU A;  4Y2F A;  3K3C A;  4I3A A;  4ZBE A;  4R6L A;  1KDW A;  4IJG A;  3PBR A;  1S6R A;  4G3K A;  1EI5 A;  5HW3 A;  1E3U A;  4KG5 A;  1PRQ A;  3NI9 A;  4KZ6 A;  4ZTK A;  4O01 A;  1XJ3 A;  2BTF P;  4YWZ A;  2E8J A;  4HBT A;  1D7E A;  3K3D A;  4OOL A;  2GJ3 A;  3OPL A;  4E3J A;  4JXV A;  1LL8 A;  3KSI A;  3L9K A;  3P09 A;  2PHY A;  3UY6 A;  1NWZ A;  2EX6 A;  3D72 A;  3G35 A;  2JKT I;  3IH8 A;  3SZT A;  4QD4 A;  4Y13 A;  1EW0 A;  5GLA A;  4KG6 A;  5DKL A;  2P04 A;  4I38 A;  4ETZ A;  4IED A;  3W8K A;  3N8L A;  2VV6 A;  3IXG A;  3Q7Z A;  1IYS A;  2CC1 A;  3LI9 A;  1H3Q A;  1VET A;  1AXB A;  2G7U A;  2OOL A;  2K2N A;  3IF6 A;  3KYZ A;  4NG2 A;  1TF1 A;  5EVI B;  2XSS A;  2Y2Q A;  2EFX A;  3KSG A;  3ZVT A;  2Y91 A;  2GX5 A;  3PTE A;  3H82 A;  4X1L A;  5HDD A;  4EER A;  3NIA A;  4HP9 A;  4GZB A;  3A3D A;  2PR6 A;  2XQZ A;  2Y2G A;  3VMA A;  1CJF A;  2HGV A;  2ZQ8 A;  3EWK A;  1N9B A;  5FI2 A;  5KSH A;  4PKY A;  3MQ0 A;  1ACF A;  1S1Y A;  3AGD A;  3IBR A;  1H8Z A;  4G3W A;  1CI9 A;  2XFT A;  3UB5 P;  5TGF A;  4X1M A;  2OV5 A;  2IWD A;  2ZQ7 A;  3B33 A;  2H0Y A;  1SCW A;  1MZU A;  2PYR A;  4NXF A;  4E3I A;  2W0N A;  5HDC A;  4N1X A;  1J9M A;  2A3U A;  2Z2L B;  4KZ3 A;  1E3U D;  1ESI A;  1G68 A;  3OCL A;  2J80 A;  4GHI B;  4PMA A;  1D06 A;  4CLC D;  2XK1 A;  5KIZ A;  5AVE A;  4QB8 A;  4Y5F A;  2Q0O A;  3S7O A;  5F1F A;  5CGX A;  2JKR I;  1IYQ A;  2XDM A;  1LLB A;  3F1O B;  2Y2J A;  3EQV A;  5K5B A;  5M18 A;  3TOI A;  3UO9 A;  3HBR A;  2VJW A;  3IWO A;  4Q0I A;  2ZC3 B;  1IKI A;  2WZZ A;  1CK3 A;  4WN5 A;  2WAD A;  4PHT A;  5CHJ A;  4BQM A;  3UB7 A;  3QP2 A;  4BWI A;  3B47 A;  3W4P A;  2HP5 A;  2OWH A;  1RGY A;  1TS6 A;  2Y55 A;  3PYP A;  1LSW A;  1H8Y A;  3CZD A;  4L9G A;  5AQ9 A;  4JF4 A;  5FQI A;  3WWX A;  1MWU A;  3VE4 A;  5FDS A;  4K91 A;  3KSH A;  4S2M A;  4HEF A;  1IEM A;  1QME A;  3BYD A;  1XX2 A;  3ISG A;  1O07 A;  4HIA A;  2INW A;  5GLD A;  4PPR A;  3MZD A;  3QP8 A;  3C8C A;  4JGQ A;  5CED A;  1L0E A;  1JNU A;  4G3V A;  4XT2 B;  4HES A;  2JKG A;  1MKM A;  4GW9 A;  1XA1 A;  3RJU A;  2O9C A;  3QP5 A;  2PYP A;  2XF3 A;  1NJ4 A;  5A93 A;  3IF5 A;  2XA7 S;  4PM5 A;  3S7P A;  3OBF A;  4EEU A;  2WGI A;  2B95 A;  4LRX C;  4MBK A;  1SKO B;  1VEU B;  4IBX A;  3NOT C;  1Q2P A;  2WUQ A;  1NXY A;  2W3D A;  2KOI A;  3D9Y A;  4I3I A;  1F5M A;  5FAQ A;  1F2K A;  1NYM A;  2G2U A;  3KX0 X;  3WRT A;  3E2K A;  2FZ0 A;  3CI6 A;  2OAP 1;  2PD8 A;  1Q2Q A;  2VGK A;  4LCL A;  3T4J A;  4MN6 A;  4P0M A;  3NEC A;  3DTE A;  2JN7 A;  3LEQ A;  5L8M A;  1KDS A;  3TJZ C;  1YAX A;  2VKS A;  1K56 A;  4S2N C;  3UB6 A;  4NXE A;  3G2Y A;  4KEN B;  1YPR A;  2B18 A;  3M6H A;  4NET A;  4ETX A;  4Y3I A;  1XA7 A;  4OOY A;  1W79 A;  1DRM A;  4DMZ A;  3PXP A;  2DRW A;  3BEB A;  4E6X A;  4ARZ B;  4BBV A;  3HUN A;  1HVB A;  2O0Y A;  4FD8 A;  2XRN A;  1XGJ A;  1KVM A;  4KUK A;  3LR4 A;  3GRJ A;  5EEC A;  1Y4O A;  3C38 A;  5KSC A;  2PBY A;  4EW7 A;  3KO6 A;  4KQR A;  1NLY A;  3G2Z A;  3IHB A;  4MBH A;  1EWZ A;  3A0S A;  2EXB A;  4OP8 A;  4CQH A;  3ZDJ A;  2XLN A;  1ERO A;  3T4O A;  4MEZ A;  3CJM A;  1V9Y A;  5HAR A;  2JKF A;  3G32 A;  3C5A A;  3PBQ A;  3BEC A;  3LR5 A;  4O7D A;  3MS6 A;  1FCM A;  3VE3 A;  4KZ9 A;  4GN2 A;  1PW8 A;  4H8R A;  4F94 A;  4S2N A;  5L10 A;  4UA9 A;  3DTK A;  5EPH A;  3WS2 A;  2PU2 A;  5HX9 A;  1KGF A;  2VLG A;  4X55 A;  2QJ7 A;  1L2S A;  2XEP A;  1YMS A;  4II7 A;  4ZAM A;  4HHD A;  1FR6 A;  3SH8 A;  3LO7 A;  5KMW A;  4HBU A;  3QHY A;  1CF0 A;  3NY4 A;  4DXC A;  3MMH A;  3B3X A;  3MXS A;  1K56 D;  5EVI C;  4S2I A;  1W5D A;  2OAQ 1;  4PAU A;  1G6O A;  1ZTU A;  1PWG A;  4LLO B;  3RTY A;  2J8Y A;  4OPR A;  2ZC4 B;  3UNW A;  3LY4 A;  4EUZ A;  1BTL A;  4M4X A;  4L9E A;  1P0Z A;  4UA6 A;  4DE2 A;  5GHX A;  2P7J A;  2Z6C A;  5FA7 A;  1WYB A;  1HZO A;  4XUZ A;  5F68 A;  5TFQ A;  1YLJ A;  4IBR A;  1PNE A;  2ZL1 B;  1OJ5 A;  2ZOI A;  4K0X A;  2ZBB A;  1FCN A;  3JVU A;  2V0U A;  3FWL A;  4EBP A;  4O8G A;  2ZQD A;  1OT6 A;  5I5L A;  2A24 B;  1PWC A;  5A90 A;  4RX3 A;  4EXO A;  1MWT A;  1SZV A;  2V9A A;  4X6T A;  5M1A A;  3WS0 A;  1MXO A;  4WZ4 A;  5EVI A;  5EM0 A;  3BFD A;  3QNB A;  4DJ3 A;  2WKP A;  2OLU A;  4HJ3 A;  3LCE A;  5E2F A;  2Y2O A;  3BFF A;  1ES3 A;  1MC0 A;  2WZX A; 
#chains in the Genus database with same CATH homology
 1K38 A;  1JWV A;  3NIA A;  5AQB A;  5A91 A;  1FSW A;  4N9K A;  4YIN A;  3C7V A;  1WE4 A;  5FQ9 A;  1K57 C;  3Q1F A;  1TEM A;  3A3D A;  4GZB A;  2R9X A;  2XQZ A;  2FFF B;  2Y2G A;  2ZQA A;  3FKV A;  3MKE A;  4PM7 A;  1W7F A;  4Y0U A;  3VMA A;  1PI4 A;  4QJG A;  1KE4 A;  2ZQ8 A;  1N9B A;  4RA7 A;  5E43 A;  5FI2 A;  5JYO A;  5KSH A;  3NCK A;  5HAP A;  4UHU A;  5CTM A;  4BD0 A;  3V5M A;  1I2S A;  3AGD A;  4Y0O A;  2X02 A;  1H8Z A;  1MKI A;  3IHA A;  5FQK A;  5GHY A;  5IHV A;  1CI9 A;  1G6A A;  2XFT A;  5F83 A;  1K25 A;  3MZF A;  1JVJ A;  5TGF A;  1ZC2 A;  1PYY A;  3FYZ A;  2V20 A;  2IWD A;  2OV5 A;  4FSF A;  2ZQ7 A;  5CER A;  3UE3 A;  2H0Y A;  2ZQ9 A;  1SCW A;  2H5S A;  5DF9 A;  1FOF A;  4OON A;  3DW0 A;  3UE0 A;  4YFM A;  5HAQ A;  4E3I A;  1MY8 A;  3HUO A;  3QNC A;  3PBN A;  1XGI A;  2Z2M B;  3EQU A;  1J9M A;  1L0D A;  1OME A;  2XH9 A;  4N1X A;  4L0L A;  4WYY A;  3VSL A;  4MBF A;  2A3U A;  2Z2L B;  5CHU A;  3PBT A;  4DDY A;  2Y2L A;  4KZ3 A;  1K6S A;  1E3U D;  1ESI A;  3A3F A;  3IH9 A;  1G68 A;  3O87 A;  2JBF A;  3OCL A;  4GKU A;  1ERQ A;  2HDQ A;  4OP5 A;  4PMA A;  2XK1 A;  2HPB A;  1BUE A;  3N8R A;  3HLB A;  5TR7 A;  5CEB A;  4S2P A;  2FFY A;  4WMC A;  4C6Y A;  1SHV A;  2RL3 A;  4MNR A;  4OPQ A;  4QB8 A;  3ZG0 A;  2ZLY A;  4JPM A;  4RYE A;  3VOZ A;  3IXH A;  1W8Y A;  3E2L A;  1YLT A;  1KGG A;  3A3I A;  5CGX A;  5F1F A;  1BSG A;  1IYQ A;  2XDM A;  1LLB A;  1NY0 A;  3WRZ A;  5D3O A;  2EX9 A;  2Y2J A;  3EQV A;  2WGW A;  4X68 A;  5M18 A;  1K57 A;  1K54 C;  4B4X A;  3TOI A;  1VM1 A;  4P85 A;  1ZG4 A;  4JKT A;  3SS4 A;  3ZGA B;  1ES2 A;  3UO9 A;  5AQA A;  1DJA A;  1O7E A;  2C6W B;  3HBR A;  4E6W A;  3IWO A;  1K55 C;  3BLM A;  4OOM A;  3NDE A;  2A49 A;  3V3R A;  3C7U A;  2ZC3 B;  4NK3 A;  3Q07 A;  4B88 A;  3NC8 A;  1IKI A;  1ZKJ A;  3Q81 A;  3LY3 A;  1KGE A;  2WZZ A;  5EVI D;  1CK3 A;  4DKI A;  2WAD A;  4U3T A;  1LHY A;  2V1Z A;  5DF7 A;  4XXR A;  5CHJ A;  4LV2 A;  4OQI A;  3ZFZ A;  4BQM A;  3M2J A;  4U0X A;  4K0W A;  4GD6 A;  3W4P A;  3G31 A;  3ZG8 B;  3OZH A;  1YQS A;  4FH2 A;  4JBF A;  3I7J A;  1PIO A;  2HP5 A;  3UE1 A;  1CEG A;  1YM1 A;  5BOH A;  4X53 A;  2GDN A;  1RGY A;  4EV4 A;  2Y55 A;  3UPO A;  3CZD A;  1H8Y A;  1SKF A;  1K4E A;  5L2F A;  1I5Q A;  2R9W A;  1JTD A;  1I2W A;  5DVA A;  5AQ9 A;  2V2F F;  2J9P A;  4KZA A;  4JF4 A;  2OLV A;  5FQI A;  3WWX A;  4UAA A;  1MWU A;  5HFO A;  4LV0 A;  1FSY A;  4K91 A;  5AQ7 A;  4BJP A;  1IKG A;  1BLS A;  5DTT A;  5FAT A;  4S2M A;  3UN7 A;  3P98 A;  4HEF A;  1IEM A;  1QME A;  2QZ6 A;  1K6R A;  2XR0 A;  4WM9 A;  4ZJ1 A;  3BYD A;  1XX2 A;  3ISG A;  4LV3 A;  1O07 A;  5F1G A;  4BEN A;  4EWF A;  3IT9 A;  4R4S A;  2Y2M A;  5GLD A;  4N1H A;  4PPR A;  2ZMA A;  1BT5 A;  2J7V A;  3MZD A;  1Y54 A;  4R1G A;  3MBZ A;  1LL5 A;  3GVB A;  4WEJ A;  5CED A;  4WBG A;  1PWD A;  1L0E A;  3VSK A;  2I72 A;  3GTC A;  4OPY A;  5CHM A;  4HES A;  4E3M A;  3BFG A;  5DTK A;  4FCF A;  1QMF A;  5GHZ A;  3V3S A;  3DWZ A;  1XA1 A;  3HLD A;  2ZJ9 A;  3RJU A;  1XXM A;  4MLL A;  4C3Q A;  2XF3 A;  2JC7 A;  1NJ4 A;  5A93 A;  3Q7V B;  1GHI A;  5EVL A;  2HP6 A;  4JLF A;  3G4P A;  3IF5 A;  4PM5 A;  3ZNT A;  3C4P A;  2DNS A;  3HLF A;  4GB7 A;  4KZ4 A;  4OQH A;  2ZM0 A;  2WGI A;  3NBL A;  2BG1 A;  4R4R A;  3UPN A;  1ES4 A;  4E3N A;  2J9O A;  4MBK A;  3TSG A;  3MZE A;  4IBX A;  1IYP A;  3ZHH A;  3BLS A;  1Q2P A;  2WUQ A;  4OPZ A;  1NXY A;  2HDR A;  4WMC D;  1TVF A;  3O86 A;  4QY6 A;  4R3J A;  1CI8 A;  2Y4A A;  4OQ0 A;  1DY6 A;  3FZC A;  2HP9 A;  3ZG5 A;  4S2L A;  4UA7 A;  2ZD8 A;  3S4X A;  5FQJ A;  5FAQ A;  2PU4 A;  1NYM A;  3OPP A;  2G2U A;  2WGV A;  4EQI A;  2P9V B;  3WRT A;  3E2K A;  2RCX A;  3SS5 A;  1BLP A;  4LV1 A;  1Q2Q A;  2VGK A;  4LCL A;  2OSU A;  1U60 A;  1NRF A;  3A3J A;  3OC2 A;  4P0M A;  3IWI A;  4PM9 A;  4E3L A;  5I94 A;  4S2K A;  1KDS A;  2B5R A;  4ZJ3 A;  3G30 A;  3SS3 A;  2ZM8 A;  4PM6 A;  1RP5 A;  3UDX A;  3CMZ A;  3W4O A;  4DF6 A;  4ZDX A;  1GA0 A;  1MWR A;  4R3B A;  4KQQ A;  5FDH A;  4OKP A;  1K56 A;  4S2N C;  5FSR A;  3GSG A;  4DE3 A;  1MPL A;  2JCH A;  1BZA A;  3G2Y A;  4KEN B;  4DXB A;  3DWK A;  4R0Q A;  2EXA A;  1C3B A;  3LEZ A;  3VP2 A;  3W4Q A;  5FAS A;  3GMW A;  3N7W A;  1YLY A;  2EFU A;  3M6H A;  4NET A;  4Y0T A;  3N4I A;  2XD1 A;  4WEL A;  2E8I A;  1ONH A;  1XA7 A;  2Y59 A;  4OOY A;  1GHP A;  5FQQ A;  2C5W B;  1W79 A;  3S22 A;  5CGW A;  4CJN A;  1FR1 A;  2IWC A;  4JXG A;  5FAO A;  3RXX A;  1KE0 A;  3SH9 A;  4GOG A;  2DRW A;  3BEB A;  4E6X A;  5DF8 A;  3HUN A;  1HVB A;  5KZH A;  4FD8 A;  2QPN A;  1GHM A;  5CTN A;  3V39 A;  3HLC A;  4JF5 A;  1SDE A;  4KZ5 A;  1XGJ A;  4KZ8 A;  1KVM A;  3AGF A;  2Q9N A;  4WEK A;  3GRJ A;  1W8Q A;  3HVF A;  4C75 A;  1DJB A;  4Z9Q A;  4E3O A;  2ZQC A;  5EEC A;  5G18 A;  5KSC A;  1XPB A;  2PBY A;  4BLM A;  3OPH A;  3HLG A;  1KVL A;  4GDB A;  4KQR A;  2JE5 A;  4U0T A;  4JXW A;  3G2Z A;  3UDF A;  3IHB A;  1RCJ A;  1K4F A;  4MBH A;  1EWZ A;  2WKE A;  1KE3 A;  2VGJ A;  4JXS A;  5U47 A;  4RVA A;  1FCO A;  2EXB A;  5DTS A;  4OP8 A;  3RXW A;  2ZC5 B;  3ZDJ A;  4WZ5 C;  3OCN A;  2XLN A;  1BLC A;  1ERO A;  1YMX A;  5CXW A;  4GD8 A;  4MEZ A;  3CJM A;  3TG9 A;  3HL9 A;  2WK0 A;  5HAR A;  3S1Y A;  3G32 A;  4KZ7 A;  2QMI A;  3C5A A;  4Q8I A;  1ZG6 A;  3PBQ A;  1YLW A;  2ZC6 B;  3BEC A;  4P87 A;  1LI9 A;  4O7D A;  4P6B A;  5FQM A;  2UWX A;  2EX2 A;  1FCM A;  2ZC7 A;  3M2K A;  3MKF A;  1YT4 A;  3VP4 A;  3PBO A;  4KZ9 A;  4GN2 A;  4IVK A;  5E2H A;  1PW8 A;  1ONG A;  3ZVW A;  3IF6 B;  3WS1 A;  2X71 A;  2WKH A;  4JF6 A;  4H8R A;  4F94 A;  3ITA A;  1XP4 A;  4BD1 A;  1MWS A;  4QY5 A;  2Y2I A;  4BL2 A;  1JWZ A;  3WS4 A;  4LEN A;  4S2N A;  1YLP A;  4R23 A;  3SOI A;  2Y2H A;  3WS5 A;  4E3K A;  3Q7V A;  5CEC A;  4UA9 A;  4KZB A;  4GNU A;  1LI0 A;  1BUL A;  4X69 A;  5EPH A;  2H10 A;  5E2G A;  3WS2 A;  1K54 A;  4S2J A;  2PU2 A;  1WYC A;  2WAF A;  4S2O A;  3BM6 A;  3ZNY A;  5EOE A;  1KGF A;  4IVI A;  5HX9 A;  1GCE A;  4EBN A;  4X55 A;  4PM8 A;  3VOY A;  3ZCZ A;  1PW1 A;  1HD8 A;  3N8S A;  1NZU A;  4X56 A;  5EUA A;  1K55 A;  1L2S A;  1PI5 A;  5CGS A;  2WYX A;  3GV9 A;  2XGN A;  2XFS A;  5F82 A;  2XD5 A;  2XEP A;  1YMS A;  4ZAM A;  1ALQ A;  3BFE A;  3IQA A;  4KG2 A;  1XKZ A;  1S0W A;  1ESU A;  3CG5 A;  1FR6 A;  3SH8 A;  3LO7 A;  3IXB A;  4A5R A;  5KMW A;  2Y2N A;  4HBU A;  3QHY A;  1PZO A;  3UDI A;  3VFF A;  3GQZ A;  2H0T A;  3NY4 A;  4Y7P A;  2P9V A;  4ZJ2 A;  1HTZ A;  4D2O A;  4DXC A;  4DDS A;  3O3V A;  3B3X A;  3MXS A;  3VP3 A;  1K56 D;  4M3K A;  4OVD A;  5EVI C;  1NZO A;  1GA9 A;  3IF6 C;  1BLH A;  3O88 A;  3PAG A;  3A3E A;  4FH4 A;  4S2I A;  1W5D A;  3MXR A;  2WKI A;  3N6I A;  2HDS A;  1VQQ A;  4LCM A;  1PWG A;  4B4Z A;  1FQG A;  4ID4 A;  5CRF A;  5GLB A;  1LL9 A;  5JYP A;  1PZP A;  2J8Y A;  2Q9M A;  4OPR A;  5GLC A;  4DE1 A;  4WZ5 A;  3G34 A;  2ZC4 B;  1CEF A;  5A92 A;  3UNW A;  3FKW A;  3LY4 A;  5HAI A;  3PAE A;  3ITB A;  4EUZ A;  2IWB A;  5HW3 A;  3HLE A;  4ZBE A;  1BTL A;  1M40 A;  4QHC A;  1KDW A;  4DRT A;  3PBR A;  3DTM A;  3GR2 A;  1S6R A;  3PBS A;  4UA6 A;  3VP0 A;  4DE2 A;  5M19 A;  3Q82 A;  5GHX A;  1EI5 A;  1M6K A;  4OLG A;  1L0F A;  1E3U A;  1Z6F A;  1TDL A;  4KG5 A;  3NI9 A;  4KZ6 A;  5FA7 A;  3SH7 A;  1E4D A;  2BLS A;  3MFD A;  4ZTK A;  5FAP A;  3V50 A;  1WYB A;  4HBT A;  1SDN A;  1HZO A;  4XUZ A;  5EOO A;  4OOL A;  3OPL A;  5TFQ A;  1YLJ A;  4IBR A;  4E3J A;  3M6B A;  4JXV A;  3FV7 A;  1TDG A;  3P09 A;  1L0G A;  3UY6 A;  2WGW B;  1JWP A;  2EX6 A;  4XUX A;  5E2E A;  3C4O A;  3G35 A;  1MBL A;  2HDU A;  3ZG9 B;  1IYO A;  2Y2K A;  4QU3 A;  3BFC A;  4RX2 A;  4K0X A;  1NYY A;  5FI7 A;  3ZG7 B;  3IH8 A;  4QD4 A;  2DCF A;  3NDG A;  1FCN A;  3UPP A;  2P74 A;  5J8X A;  3IXD A;  5GLA A;  4KG6 A;  2Y2P A;  1RGZ A;  3HLW A;  3JYI A;  4OLD A;  2X01 A;  4IED A;  3FWL A;  2G2W A;  3HRE A;  4EBL A;  3AGE A;  3VFH A;  4EBP A;  1DJC A;  2ZM2 A;  2ZQD A;  4KQO A;  4OQG A;  3W8K A;  5A90 A;  1PWC A;  2EX8 A;  3N8L A;  1IEL A;  1MWT A;  3IXG A;  4RX3 A;  5FI6 A;  4DE0 A;  3BRM A;  3Q7Z A;  4X6T A;  3IWQ A;  1IYS A;  5M1A A;  1YLZ A;  2CC1 A;  3D4F A;  4CPK A;  1JTG A;  4N92 A;  3WS0 A;  1MXO A;  4N9L A;  4WZ4 A;  1AXB A;  5EVI A;  1E25 A;  3OPR A;  3HUM A;  3IF6 A;  5GL9 A;  1ERM A;  2WAE A;  3BFD A;  5EVI B;  3QNB A;  2Y2Q A;  2EFX A;  2OLU A;  1H5X A;  3LCE A;  4GDN A;  3ZVT A;  2Y91 A;  1N4O A;  5E2F A;  5EE8 A;  5HL1 A;  3VP1 A;  1ES5 A;  2Y2O A;  3BFF A;  4BL3 A;  1ES3 A;  3PTE A;  4OH0 A;  2WZX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...