3WS0A

N288q-n321q mutant beta-lactamase derived from chromohalobacter sp.560 (condition-1a)
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
357
structure length
357
Chain Sequence
QTREVLDPIVASLMEAQQIPGMAIALVRPEGTTISHYGAADRETGTPVDDDTLFEIGSLSKTLTATLASLAEVEGKLDFDAPVSRYLPELEGSAFDDISGLNLGTHTGGGLPLFVPDEVTDRASLMAWYREWQPTEPIGESRTYSNLGIGLLGLETAASLDGEFVPTMRAKVLAPLGMQDTWYDVPEARMADYAMGEDKDGQPTRVSPGVLDDEAYGIKTTAADLAKLVRANLHLADVDAELQQAIDATRQGHYRVGDMTQALIWEQYSLPVAPETLRAGQGYDMILEPNAAEALEPPQSPRDDVWVNKTGSTQGFGGYIVMLPGKHTGLVMLANKNYPNDARVEAAYRILSGLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Beta-lactamase
publication title Structure of a highly acidic beta-lactamase from the moderate halophile Chromohalobacter sp. 560 and the discovery of a Cs(+)-selective binding site
pubmed doi rcsb
source organism Chromohalobacter sp. 560
total genus 120
structure length 357
sequence length 357
chains with identical sequence B, C
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2014-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3ws0A00
5HARA 3S22A 3BLMA 3V3RA 1JWZA 4KG6A 2ZM8A 3ZVTA 4OPQA 3D4FA 4Q8IA 2IWCA 2WADA 5FQMA 4WZ5C 2ZQDA 5FI2A 3S4XA 5HFOA 2WKHA 3IH8A 1BULA 3ZG7B 1KE0A 1S6RA 4QU3A 3SS4A 4DRTA 3AGFA 4NK3A 3VP0A 3M2KA 4KZBA 3AGDA 4KZ9A 4N9KA 3IXHA 1PI4A 3C4OA 4E3NA 5GHXA 4RA7A 4XXRA 3UE1A 3ZCZA 1PI5A 4EBPA 5KMWA 5F1GA 1TDGA 3MBZA 1MPLA 1J9MA 1LLBA 2X02A 3WRTA 3BFDA 1JTDA 4R3JA 4EBNA 1K54C 2Q9NA 3IWIA 4UA7A 1KDWA 5HAQA 1KGFA 4WYYA 2HP5A 3IH9A 2Y2QA 3HLCA 4E3IA 3PAGA 4KZ8A 3MZFA 5TFQA 5FDHA 3FZCA 1HTZA 3N4IA 3UDXA 4P6BA 1XA7A 4MNRA 4O7DA 4S2OA 1EROA 3VP2A 1ES5A 2FFYA 3I7JA 4OLGA 4BD0A 3HLFA 2BG1A 4RX2A 4B4XA 1L0DA 5AQ7A 3LY3A 4OQHA 1DJAA 2ZM0A 5M18A 5CEBA 3CG5A 1K57C 1FCOA 1FR1A 3HLDA 3MXSA 2XGNA 3Q1FA 2WKIA 2Y2IA 4DDSA 1IEMA 1BLHA 3RXWA 3UPOA 2Y4AA 1E25A 1ONHA 1MWRA 3VSKA 2ZMAA 4KZ5A 4Y0OA 3UY6A 4RYEA 4FCFA 1IYPA 3Q7ZA 3LY4A 1NRFA 2OLVA 4JXVA 5FQ9A 3GQZA 5EPHA 3TOIA 1Y54A 4WELA 3SH8A 2Z2LB 4OONA 5A92A 5U47A 4PM8A 5EECA 4BLMA 3GRJA 5E2HA 4L0LA 5GLBA 5FATA 1MBLA 3A3JA 5HL1A 4MBKA 4KQRA 3HLEA 1FR6A 3LEZA 1EWZA 4S2IA 2EX9A 3OPHA 3WS1A 4JF4A 4MLLA 5A91A 2H0YA 1FQGA 1ONGA 3VP3A 2DRWA 3DTMA 4EWFA 3MFDA 4HESA 1I5QA 3WS4A 3VMAA 1WYCA 1TVFA 2HDQA 3GSGA 4KZ6A 5E2GA 4KENB 1L2SA 1I2SA 1KE3A 1H5XA 2J9PA 3A3DA 3C4PA 1YQSA 4DE3A 2ZQ7A 1YLWA 3QHYA 1ES3A 2CC1A 4R3BA 2ZQAA 3A3FA 5CHMA 4D2OA 5KSCA 1MXOA 4WZ5A 1L0GA 3NIAA 1W8QA 4WM9A 1IKIA 4KZ4A 3N8SA 2ZC6B 3NY4A 4GOGA 4C75A 5TGFA 1TEMA 1YMSA 4RVAA 4E3OA 1PZOA 1SDNA 2R9WA 3C7UA 3FWLA 4N92A 5DF9A 3ZFZA 4ZDXA 4FD8A 3BECA 2Y2LA 4ZAMA 3IWOA 3ZNTA 1JVJA 1NJ4A 4GDBA 3GMWA 4GN2A 1K54A 4U3TA 2WGVA 4N9LA 4PPRA 4QY6A 5F82A 4U0TA 2A49A 4GD6A 3O88A 1CI8A 4HBTA 1WYBA 2E8IA 3HUMA 3Q81A 4OH0A 3NBLA 1ESIA 3PBTA 3VP4A 3CMZA 4P85A 3UE0A 2P74A 1QMEA 2UWXA 4KZ7A 2V20A 3SS3A 1YLPA 3OZHA 2JCHA 3EQUA 4UHUA 1RCJA 4PM6A 4BL3A 3MKFA 4EQIA 1SKFA 1S0WA 4OPZA 4DKIA 4X6TA 1ES4A 1H8ZA 3O3VA 5E43A 3LCEA 1U60A 1RGZA 2HP6A 3ZG0A 2H5SA 1K57A 3ZG9B 3NI9A 1K56A 4JLFA 2Y2PA 3NDEA 2Y2HA 4P87A 1GHMA 2HDUA 4OP8A 1ES2A 2J9OA 4XUZA 3HLWA 5BOHA 3TSGA 3Q7VB 5EOOA 1NXYA 4OLDA 1K4FA 1KVMA 1RGYA 3G35A 1W5DA 4IVIA 5GLCA 3IF5A 4E3KA 2ZLYA 1W7FA 2QMIA 3OPLA 4JBFA 4KQQA 4JKTA 5IHVA 4EV4A 2H0TA 4MBFA 3MZDA 4JF6A 3O86A 1GHIA 4N1HA 2WKEA 5JYOA 5EOEA 5F83A 2RCXA 1SHVA 5CGWA 5EVIC 2PU2A 4EBLA 3IF6C 3BFGA 2WZXA 3WWXA 3OPRA 4YINA 2BLSA 2HDRA 4JXWA 3UN7A 3ZDJA 1YLTA 1PW8A 4K0WA 4PM9A 4JXGA 5CGSA 4DDYA 1XPBA 4MBHA 5JYPA 2Y55A 4IBRA 3BM6A 1KVLA 4IVKA 3IXBA 1LHYA 4LV2A 5E2FA 5D3OA 4A5RA 4BD1A 4WZ4A 1KGEA 2WZZA 2EXBA 3IF6B 2XD5A 5EVLA 1CEFA 4HBUA 3MKEA 1LI0A 1HD8A 5DTSA 4ZJ2A 3HUNA 2EX8A 1FCNA 2QZ6A 1AXBA 5AQAA 5M1AA 4R4SA 4E6XA 1PWGA 1O7EA 4X53A 1GHPA 1H8YA 2VGJA 4LV0A 4CJNA 3VOYA 3NC8A 3ZGAB 1ZG6A 1ERQA 4DXBA 2WAEA 2C6WB 2J7VA 3BFCA 2XLNA 5CGXA 3G32A 2EX6A 4S2NA 3PTEA 3UE3A 3Q07A 2WGWA 1N9BA 2C5WB 1MY8A 2WUQA 3OCLA 4Y7PA 3WS5A 3BRMA 4PM7A 4QB8A 3PAEA 1YLYA 4UA9A 2Q9MA 2X01A 5I94A 3OPPA 3P09A 5FASA 1MWSA 3NDGA 4PM5A 2ZM2A 1C3BA 5GHZA 3ITAA 4QJGA 4F94A 2XQZA 3BYDA 1K56D 2ZQ8A 3HREA 4N1XA 1K38A 2VGKA 2OV5A 3NCKA 5CTMA 1HVBA 3E2KA 4DXCA 4JPMA 4LV3A 1ESUA 1NZOA 4S2KA 3S1YA 1BZAA 3IHAA 3BLSA 1G6AA 4UAAA 5KZHA 1IYQA 3Q7VA 2IWBA 4BJPA 4QY5A 3M2JA 2Z2MB 4S2LA 5CRFA 1KDSA 5DF8A 5M19A 3QNCA 2ZQCA 1MWUA 4U0XA 3WS0A 4LENA 3FKWA 3PBNA 2WK0A 2J8YA 3DWZA 4S2NC 3G2YA 5J8XA 4OPYA 1DJCA 5DF7A 1NY0A 2EFXA 1DJBA 1L0FA 3A3IA 3IXDA 3W8KA 1K55A 1JWVA 3CJMA 3O87A 3N8RA 3IWQA 4B4ZA 4WMCA 3RXXA 1Z6FA 3GV9A 1W79A 3P98A 4GB7A 2V1ZA 3FYZA 4OOMA 3PBRA 2Y2GA 2ZD8A 3PBOA 4WEKA 1PWCA 2G2WA 2WGWB 2XDMA 1E3UA 5CXWA 1K25A 2B5RA 1YM1A 4OQIA 1O07A 3BEBA 3RJUA 1GA0A 2XH9A 5EVIA 3DW0A 5A93A 5KSHA 2WGIA 3IF6A 2HPBA 3VFFA 2I72A 3B3XA 3WS2A 1FSYA 5AQBA 3IQAA 1PZPA 4OP5A 4PMAA 4B88A 4QD4A 1IKGA 2DNSA 4ZJ1A 3IXGA 3IT9A 4BL2A 1XGJA 4GD8A 4E6WA 1TDLA 3Q82A 4Y0UA 3V39A 3VOZA 4OOYA 1K55C 1MWTA 2Y2OA 4EUZA 1PWDA 3QNBA 1ZG4A 3UDIA 3LO7A 4KZAA 5E2EA 4K0XA 3PBQA 3W4OA 1FOFA 3HVFA 1I2WA 1LI9A 2G2UA 4Z9QA 1WE4A 2R9XA 3V50A 3MXRA 1XKZA 2Y2NA 5GHYA 4OOLA 2XR0A 1BLCA 1M6KA 2JE5A 2EFUA 3G2ZA 2JBFA 3ITBA 3OCNA 3SS5A 1PYYA 2RL3A 5DTTA 1XXMA 2XEPA 4WBGA 4Y0TA 5F1FA 1Q2QA 1RP5A 4P0MA 1PIOA 1NYYA 4E3MA 1SCWA 1G68A 3V3SA 1ALQA 4FH2A 5CTNA 5CECA 4RX3A 1XA1A 3HBRA 3M6BA 4E3JA 1CK3A 1ERMA 1GA9A 1BT5A 2OSUA 3EQVA 1IELA 3UO9A 4OKPA 1ZKJA 4WEJA 4BENA 2QPNA 1BSGA 1VM1A 4ID4A 4OPRA 4KQOA 3SH9A 2Y59A 5EVIB 5FA7A 2X71A 1YMXA 2HDSA 1LL9A 1NZUA 5HW3A 3UPPA 3W4PA 3G4PA 4C6YA 4MEZA 5A90A 2ZC3B 2P9VB 4OVDA 3V5MA 4JF5A 5DVAA 4WMCD 1VQQA 5CHJA 2ZC5B 3CZDA 4R0QA 1SDEA 3AGEA 5FI6A 4KG2A 2ZQ9A 5FAQA 5HAPA 3VSLA 5FQKA 4DE0A 1M40A 3ZG5A 4X55A 1ZC2A 2XK1A 1E4DA 1CI9A 3GR2A 1FCMA 2WAFA 2Y2KA 4QHCA 3N7WA 1FSWA 4S2PA 1E3UD 1MKIA 5FSRA 5FI7A 4FSFA 4UA6A 5EVID 3HLBA 2Y91A 4NETA 1LL5A 1DY6A 2Y2JA 1HZOA 4GKUA 1GCEA 3HL9A 4LV1A 3VFHA 4X68A 2OLUA 3GVBA 2A3UA 4ZJ3A 3IHBA 4X69A 3ZHHA 2EXAA 3UPNA 2ZJ9A 4GNUA 1BUEA 2PU4A 2XFTA 3JYIA 5DTKA 4DE2A 4FH4A 1QMFA 4R1GA 3PBSA 3OC2A 1JTGA 1OMEA 4R4RA 4ZTKA 3W4QA 4JXSA 4M3KA 5FQQA 4DE1A 1BTLA 5GLAA 4YFMA 4GZBA 1BLPA 5G18A 1K6RA 1BLSA 4KG5A 4S2JA 3UNWA 4HEFA 3VP1A 5GL9A 4C3QA 5AQ9A 5FQIA 3WRZA 4K91A 5GLDA 1K4EA 4E3LA 4DF6A 5FAPA 2PBYA 1IYSA 4ZBEA 4OQGA 1PW1A 2JC7A 2Y2MA 2ZC7A 3BFFA 5EUAA 2WYXA 1EI5A 2GDNA 1XX2A 5CHUA 4LCLA 1XGIA 3G34A 3SOIA 1YT4A 4X56A 5FAOA 2XD1A 4S2MA 3A3EA 3TG9A 3ZG8B 1CEGA 1YLJA 3C7VA 5HX9A 2HP9A 1JWPA 2V2FF 3HLGA 2FFFB 4IBXA 2EX2A 3FKVA 4XUXA 4KZ3A 3C5AA 5CEDA 4H8RA 4IEDA 3E2LA 2XF3A 1YLZA 3ZNYA 1XP4A 1K6SA 2DCFA 3SH7A 1W8YA 3ISGA 1N4OA 3DWKA 1KE4A 1Q2PA 2IWDA 2P9VA 3FV7A 3G31A 3N6IA 3N8LA 3GTCA 4LCMA 5FQJA 3UDFA 4GDNA 2H10A 3G30A 5HAIA 3BFEA 3ZVWA 1L0EA 1NYMA 3HUOA 1KGGA 1IYOA 4R23A 4OQ0A 5CERA 4BQMA 2ZC4B 3M6HA 5EE8A 3MZEA 5L2FA 4CPKA 5TR7A 2XFSA
chains in the Genus database with same CATH superfamily
2OWJA 3VV4A 5HARA 3V3RA 1JWZA 2ZM8A 4OPQA 1TS0A 4WZ5C 3B42A 5FI2A 3S4XA 5L09A 3IH8A 3SS4A 4NK3A 4KZBA 4KZ9A 3TRCA 4RA7A 3A0SA 3UE1A 2OAQ1 1TDGA 5F1GA 3A0RA 1JTDA 4R3JA 2GJ3A 2L0WA 2GZAA 4O0PA 2G7UA 3IH9A 5HDSA 1S4RA 2Y2QA 2MJ6A 4KZ8A 5TFQA 1V9ZA 4HNBA 3VP2A 1YAXA 5AQ7A 4Y3IA 1FCOA 2XGNA 3E4PA 3Q1FA 3T4SA 2Q0OA 3RXWA 1ONHA 5AVFA 3VSKA 4RYEA 4FCFA 2OLVA 4JXVA 5EPHA 4D60A 1Y54A 4WELA 2W0NA 1UWNX 5EECA 2VKSA 5GLBA 3RTYA 3P01A 3MQOA 3A3JA 4BBUA 4HY8A 3LEZA 1EWZA 2EX9A 4R38A 3OPHA 2I9VA 4JF4A 2UV0E 4MLLA 5A91A 3VP3A 3IS2A 1IFQA 4HESA 2W27A 3WS4A 4HHDA 3K3CA 4AFIA 5E2GA 2ZL1B 4KENB 1XFNA 1KE3A 3C4PA 3H7WA 4DE3A 5EM0A 2W1RA 3QHYA 1ES3A 4R3BA 2ZQAA 5CHMA 1H0MA 4WZ5A 1L0GA 4KZ4A 3N8SA 1S1ZA 4GOGA 5TGFA 1JNUA 3C7UA 5EFWA 3ZFZA 4KUKA 3QP5A 1NJ4A 4GN2A 2WGVA 4QY6A 3BW6A 4HBTA 4GJ4A 2V8FA 3PBTA 3VP4A 1S1YA 2JCHA 4EQIA 1S0WA 4DKIA 4X6TA 1ES4A 1H8ZA 3FC7A 3UMEA 3ZG9B 3T4JA 2Y2HA 5I5LA 4OP8A 2J9OA 1P9RA 4XUZA 5G4ZA 4OLDA 1K4FA 1KVMA 3G35A 4YNRA 1W7FA 2V0WA 4JKTA 3L9KA 4JF6A 3O86A 1SKOB 2PD7A 3T1SA 4GHIA 2WKEA 5EOEA 2RCXA 5CGWA 3LIEA 3IF6C 2WZXA 3WWXA 3ZDJA 1Z09A 4JXGA 5CGSA 1XPBA 5JYPA 4IBRA 1KVLA 3IXBA 5D3OA 1MZUA 4DJ2A 5EVLA 2L4RA 4NG2A 4KUOA 5DTSA 1LL8A 1PWGA 1O7EA 3LI8A 1H8YA 4LV0A 4CJNA 3VOLA 3IX3A 4DXBA 3DTEA 1OTIA 3G32A 3PTEA 1HLUP 2WGWA 4Y7PA 1TS6A 5I94A 3KSGA 2Q9MA 3P09A 5FASA 1C3BA 5GHZA 4GS9B 3BYDA 4EEUA 2YKFA 1TF1A 5CTMA 5FEGA 4DXCA 2ZBBA 4S2KA 1G6AA 5KZHA 3NJAA 3Q7VA 4NXEA 3R4KA 1KDSA 1VEUA 3C30A 4S2NC 2FH5A 3A0VA 1FILA 5EM1A 4LGWA 1NY0A 2EFXA 2NUTC 3TJZC 1JWVA 3CJMA 3O87A 2INWA 2JKFA 4GB7A 1PWCA 1K25A 2B5RA 3LIAA 4BWIA 4QWOA 1KOUA 5A8BA 5A93A 3IF6A 2I72A 1FSYA 2Y8HA 1DRMA 3IQAA 1PZPA 5G4YA 4ZJ1A 4E6WA 1XGJA 4GD8A 1OT6A 3V39A 3VOZA 3VE3A 1ZG4A 3PBQA 1FOFA 3HVFA 2L1MA 3LIFA 3S7PA 1WE4A 3MXRA 3LGOA 4Y17A 5GHYA 4OOLA 2EFUA 2VEAA 3ITBA 2RL3A 2VK3A 1XJ3A 4E3MA 3BY8A 3JVUA 2EA9A 3M6BA 4E3JA 3UO9A 4HIAA 1ZKJA 2Y59A 5FA7A 2X71A 4Y5FA 4C6YA 4MEZA 4DN0A 4R0QA 5FI6A 4WLAA 5L07A 5FAQA 3VSLA 3B33A 4ZRRA 4QHCA 2WAFA 5FSRA 4IJGA 4FSFA 1DY6A 4GKUA 3HL9A 4PKYG 2OLUA 2A3UA 4X69A 3VE4A 2XFTA 5DTKA 4FH4A 3OC2A 5AVEA 4HJ3A 1BTLA 3LIBA 4YFMA 4HEFA 4C3QA 5AQ9A 5HPFA 4E3LA 1N9OA 4JGOA 2PAVP 4OQGA 3BFFA 2WYXA 1XGIA 3SOIA 5HWVA 2VV8A 4IHQA 5HX9A 2HP9A 3KX0X 4IBXA 3C5AA 3E2LA 4X25A 1K6SA 3DWKA 2P9VA 3N8LA 3QP1A 5DKKA 3UDFA 4GDNA 3DTIA 1IYOA 5CERA 2ZC4B 3MZEA 4CPKA 4O8GA 4KG6A 3ZVTA 4M4XA 4Q8IA 5FQMA 2WKHA 1BULA 1S6RA 3AGFA 3M2KA 3C4OA 4E3NA 3T1RA 4EBPA 4HH2A 1MPLA 3WRTA 3TW8A 1CF0A 4L9FA 1KDWA 4WYYA 2P08A 3HLCA 4E3IA 2W3GA 3S7NA 3T50A 3LR4A 1OTAA 4P6BA 1ES5A 3I7JA 4OLGA 4RX2A 4B4XA 2ZM0A 5M18A 1A0KA 2GX5A 2KOIA 3MXSA 2VLGA 4X1LA 1IEMA 3UPOA 1E25A 4KZ5A 3Q7ZA 1NRFA 1DP6A 3SH8A 4H6JA 2FZ0A 3BJNA 5U47A 4PM8A 3GRJA 4E04A 3FPWA 5HL1A 3NULA 4MBKA 4HJ6A 3F1NB 3ZYTA 1FR6A 4GHIB 4S2IA 3PHYA 3WS1A 4HJ4A 1DP8A 4I3IA 3T4TA 4EWFA 3MFDA 3LR3A 3VMAA 1G28A 3KO6A 1WYCA 2W3HA 4HP4A 1L2SA 1I2SA 2V1BA 1S4SA 3A3DA 2JKTI 1OJ5A 4D2OA 3A3FA 4F3LA 5KIZA 2ZC6B 3E4OA 3NY4A 3SZTA 1YMSA 4ARZA 4NXBA 2KDKA 3LIDA 3FWLA 1XJ4A 4NKPA 2Y2LA 4ZAMA 3IWOA 3ZNTA 2J3TC 3OBFA 4U3TA 3EGXC 4U0TA 1D1JA 3O88A 2E8IA 3HUMA 4LRXC 4OH0A 3NBLA 3H82B 4P85A 3EEAA 4RQ9A 3S7QA 1OPXA 3EQUA 4PM6A 4P6ZM 1SKFA 3O3VA 3LCEA 4Y15A 1RGZA 2HP6A 3TE8A 1K56A 4JLFA 2Y2PA 3NDEA 3TSGA 3Q7VB 5EOOA 2W1TB 5GLCA 1W5DA 4IVIA 2NUPC 3FPVA 1VEUB 4JBFA 5IHVA 3MR0A 4EV4A 1T1AA 3QP6A 1GHIA 4N1HA 5F83A 2XA7S 1SHVA 2QJ5A 3MSHA 1MKMA 2PBDP 3UN7A 1YLTA 4DDYA 3NECA 4MBHA 2EWWA 4XT2A 2Y55A 4BD1A 2WZZA 3IF6B 2XD5A 1LI0A 3HUNA 4R6LA 5M1AA 2KLIA 4X53A 3QP8A 1GHPA 1N9LA 3NC8A 2VZWA 4Y13A 1PFLA 3E98A 1ERQA 1OTEA 2HGVA 2P04A 2J7VA 3NOPC 2XLNA 2QYBA 3LEQA 3Q07A 3PXPA 2C5WB 4UA9A 4QB8A 3PAEA 3E0YA 4QJGA 3ICYA 4N1XA 2VGKA 2OV5A 2VGLM 2VV7A 3E2KA 4B9OA 2OAP1 1NWZA 1D06A 2IWBA 4QY5A 3M2JA 2Z2MB 5DF8A 1Y28A 4LENA 3EEHA 3PBNA 1NLZA 5J8XA 5DF7A 1T1BA 1DJBA 1L0FA 3IWQA 2BASA 4WMCA 3RXXA 1UWPX 4ESPA 3ZQ5A 3UB5P 1W79A 2VV6A 3LICA 2QHKA 3FYZA 2Y2GA 1F9IA 4PHTA 2XDMA 4EQ1A 5CXWA 4BBVA 1O07A 3BEBA 4JGRA 2WGIA 2HPBA 3GDIA 3VFFA 1LSVA 4PMAA 4QD4A 2M7VA 4BL2A 4Y0UA 1F2KA 1MWTA 4MCWA 4PAUA 3RFBA 4KZAA 5C5KA 4YWZA 1I2WA 1CJFA 3V50A 2Y2NA 4HH3A 1BLCA 2XR0A 4Y0TA 4UQIM 4WBGA 5F1FA 3R7WA 1SCWA 4JGPA 1OTBA 3HBRA 3MMHA 2YKHA 1BT5A 3T4QA 4BENA 1CQAA 4OPRA 4KQOA 2VGLS 5EVIB 3JPUA 1LL9A 3W4PA 2P9VB 2B02A 1H3QA 4JF5A 3V5MA 1GSXA 4MMNA 3E4QA 4WUJA 2ZQ9A 2Y79A 5HWTA 1M40A 2XK1A 1CI9A 3LR0A 1E3UD 2PR5A 3L7HA 1D7EA 5EVID 3UB7A 3VFHA 1V9YA 2JHEA 4X68A 4ZJ3A 2A24A 3IHBA 3UPNA 4GNUA 1BUEA 1PRQA 4EETB 5IS1A 4R1GA 3PBSA 1XFQA 1OMEA 2B18A 4M3KA 5FQQA 1S66L 2E8JA 3G6OA 1VETA 2PRFA 5DKLA 1BLSA 1OJGA 3VP1A 3FG8A 5GL9A 4FTXA 5FQIA 4K91A 4DF6A 2PBYA 4NXFA 2ZC7A 2H28A 1EI5A 1XX2A 3G34A 1ACFA 4X56A 3A3EA 3TG9A 3ZG8B 1JWPA 2V2FF 4XUXA 5CEDA 4IEDA 1XP4A 2DCFA 3SH7A 3FV7A 3G31A 3GTCA 2D01A 2H10A 3G30A 5HAIA 3HUOA 4R23A 4OQ0A 3M6HA 5L2FA 5TR7A 4Z1WA 3S7OA 5HFOA 3ZG7B 4DRTA 3BWLA 3AGDA 4N9KA 3IXHA 5KMWA 2GNXA 3MBZA 1F5MA 1T1CA 3IWIA 5J3WA 4F3LB 3MZFA 4ARZB 4G3WA 4QPRA 1XA7A 1EROA 2FFYA 3PR6A 4BD0A 3LY3A 4OQHA 5CX7A 5CEBA 5DFXA 4I3JA 3LYXA 4LRZE 2WKIA 3SW1A 4LPZA 3NHQA 2R78A 5HPIA 1BLHA 2ZMAA 4Y0OA 1IYPA 4GW9A 3LY4A 5F5YA 3UE6A 3CUEC 5FQ9A 4YOFA 1P9WA 3GQZA 3TOIA 3K2NA 2Z2LB 1G6OA 1XJ6A 4OONA 5A92A 5E2HA 4L0LA 2HZ5A 5FATA 4KQRA 2OWHA 3HLEA 5DFYA 1MC0A 1ONGA 4LRYC 2DRWA 3DTMA 2P7JA 4JGQA 1I5QA 2HDQA 1P97A 3GSGA 4B93A 1H5XA 4XT2B 1YQSA 2ZQ7A 1YLWA 1MXOA 3NIAA 1VB6A 1W8QA 1F98A 4C75A 1PZOA 1SDNA 4K08A 1YSPA 5DF9A 4ZDXA 4FD8A 2HJEA 4WF0A 3CHWP 1JVJA 3NOUC 3GMWA 4GDBA 4N9LA 3MXQA 5F82A 4X1MA 2A49A 4GD6A 1WYBA 4KQDA 5FL3A 3CMZA 2UWXA 3SS3A 2V20A 4I3AA 1YLPA 4UHUA 3MKFA 4OPZA 3IS2B 2HV1A 1UGUA 2LB9A 2V0UA 4Q0IA 3NI9A 1GHMA 2HDUA 1NLYA 3HLWA 5BOHA 4MN6A 1RGYA 3H7WB 4E3KA 3IF5A 2ZLYA 3DAVA 2QMIA 4KQQA 4MBFA 3IBRA 2VX8A 3CLOA 3CUEA 2J3TD 3CPTA 4I5SA 3OPRA 2BLSA 1LT0A 5HDCA 1PW8A 1XJ2A 3LFVA 2DMWA 4CLCC 3KSHA 4IVKA 5E2FA 1LHYA 4A5RA 2EXBA 3C2WA 1CEFA 2EX8A 3C38A 3KYEA 2QZ6A 3T4LA 5AQAA 4E6XA 2VGJA 4Y2FA 2K2NA 3BFCA 2AVXA 1N9NA 1N9BA 1MY8A 2WUQA 4II7A 4PM7A 4CQHA 1YLYA 1MWSA 4G3VA 2XSSA 2ZM2A 4PM5A 4F94A 2O99A 1X0OA 3MJQA 3NCKA 1HVBA 1ESUA 3S1YA 1L3LA 3IHAA 4UAAA 3D72A 4BJPA 4S2LA 3KSIA 3QNCA 4NXGA 2ZQCA 4U0XA 2O9BA 3FKWA 3F1PA 5HZHA 3DWZA 3G2YA 3IXDA 3CWFA 1K55A 3HJIA 2B95A 3N8RA 4B4ZA 4EESA 1Z6FA 2HF6A 5J7EA 2PYRA 2Z6CA 2V1ZA 2VA0A 4OOMA 3PBRA 4WEKA 3EGDC 2WGWB 1ODVA 3T12B 4OQIA 2M1CA 2EWVA 2A24B 2JKGA 3B3XA 4Q0JA 4CLCE 4B88A 1IKGA 4L9EA 3IXGA 3IT9A 4CLCA 3LUQA 4OOYA 3RH8B 2Y2OA 4EUZA 1PWDA 5HD5A 3D3OA 2Z6DA 2V1AA 3W4OA 1STZA 3P7NA 1ZTUA 4Z9QA 1XKZA 3EOIA 1M6KA 2JE5A 2JBFA 3SS5A 1PYYA 5DTTA 3MFXA 1Q2QA 3GECA 1PIOA 1K0KA 1G68A 1ALQA 4FH2A 5CTNA 1J3WA 5CECA 4RX3A 1XA1A 2BTFP 1CK3A 1GA9A 3EQVA 2LB5A 4WEJA 4G3KA 2QPNA 1BSGA 1W63M 2ACGA 1YMXA 1NZUA 5HW3A 3UPPA 3G4PA 4HOIA 2ZC3B 2QKPA 5DVAA 5CHJA 2ZC5B 4EUVA 3T1XA 5AJGA 3CZDA 1SDEA 3AGEA 1AWIA 4KG2A 3MQQA 5FQKA 4BMWA 2CMNA 4X55A 1E4DA 3GR2A 4DMZA 2Y2KA 4IUKA 1FSWA 3QP2A 3F1OA 4UA6A 3HLBA 2Y91A 2Y2JA 1HZOA 4LV1A 1P0ZA 4BBTA 1OT9A 2EXAA 1QMFA 5K5BA 1JTGA 1IOUA 4R4RA 4ZTKA 3W4QA 4JXSA 4P6ZS 4DE1A 5GLAA 4GZBA 4R70A 5G18A 4KG5A 3UNWA 5HDDA 5L8MA 5GLDA 1K4EA 1YSQA 1IYSA 4ZBEA 1PW1A 3QP4A 3LI9A 2GDNA 4LCLA 2JKRM 1VHMA 5FAOA 2XD1A 4S2MA 3IBJA 1YLJA 3W2ZA 2EX2A 3OLOA 4KZ3A 4H8RA 1N4OA 1KE4A 2IWDA 4GLQA 2W3DA 3ZVWA 2XRNA 1NYMA 2QWSA 3PYPA 4UEYA 4O01A 3T4KA 5TBMA 4L9GA 2XFSA 3S22A 3BLMA 3D4FA 2IWCA 2WADA 2ZQDA 1W63Q 1KE0A 4QU3A 3VP0A 3ULFA 1PI4A 5GHXA 4XXRA 3ZCZA 1PI5A 3D9YA 2X02A 1J9MA 1LLBA 1TS8A 3BFDA 4EBNA 1K54C 2Q9NA 4UA7A 5HAQA 1KGFA 2HP5A 1LSWA 3F1NA 3PAGA 5FDHA 3FZCA 1HTZA 3N4IA 3UDXA 4MNRA 4O7DA 4S2OA 3HLFA 2BG1A 1L0DA 4I38A 2PDRA 1DJAA 4MN5A 3CG5A 1K57C 1FR1A 3UB6A 3HLDA 4FUWA 4HQAA 4NEED 2Y2IA 4DDSA 2JKTM 3EWKA 2Y4AA 2O9AA 1MWRA 4HI4A 3UY6A 2HJ9C 4MN7A 3V67A 4BLMA 3C8CA 4IUHA 1TS7A 3IX4A 1MBLA 3H82A 3B47A 4WN5A 5F68A 3CPTB 2H0YA 1FQGA 3JVVA 3MS6A 1TVFA 3U2AA 2PYPA 5IT5A 5DJTA 4KZ6A 2J9PA 2W1TA 4ME4A 2CC1A 5KSCA 5TJJA 3CITA 2WKQA 4UQIS 1IKIA 1S67L 4WM9A 1YKDA 3BQ8A 1TEMA 4RVAA 4E3OA 2R9WA 2ZMFA 3CAXA 4N92A 3BECA 5HD3A 2JN7A 3UB9A 4H6JB 1EW0A 2IA2A 1K54A 4PPRA 1LSXA 1CI8A 1G5UA 3Q81A 3IX8A 2M7UA 1ESIA 3UE0A 2XROA 2P74A 1QMEA 4KZ7A 3OZHA 1RCJA 4BL3A 5E43A 5HL6A 1U60A 3ZG0A 2H5SA 1K57A 4P87A 5IU1A 1ES2A 2V9AA 4WL9A 1NXYA 5MC7A 4ETZA 3OPLA 2H0TA 3HCYA 3DTKA 3F1PB 3MZDA 4MDZA 3KYQA 5F69A 5JYOA 5EVIC 2PU2A 4EBLA 3O5YA 3BFGA 1Y4OA 4YINA 2HDRA 4JXWA 2PHYA 4K0WA 4PM9A 2ZL1A 4I39A 3BM6A 4LV2A 2WKRA 4WZ4A 1KGEA 1DP9A 1WA9A 4HBUA 3MKEA 1HD8A 4ZJ2A 1FCNA 2ZOHA 1AXBA 4R4SA 4CLCB 3VOYA 2V8CA 3ZGAB 1ZG6A 4HP9A 2WAEA 2C6WB 5DJUA 4DJ3A 5CGXA 2EX6A 4S2NA 3OOVA 3UE3A 3HJKA 3OCLA 3WS5A 3U4LP 3BRMA 1TD5A 2X01A 3OPPA 3NDGA 3ITAA 2XQZA 1K56D 2ZQ8A 3HREA 5FEFA 2K7SA 2OOLA 1K38A 4CLCD 4FOFA 2J3WA 4JPMA 4LV3A 4Q0HA 1NZOA 3UB8A 1BZAA 3BLSA 4EW7A 5EV0A 1IYQA 4EERA 1OTDA 4EU0A 4LFUA 3BY9A 5CRFA 5M19A 3LR5A 1MWUA 3WS0A 5J4EA 1SKOA 2WK0A 2J8YA 1BYWA 2O0YA 5HSQA 4OPYA 3BQAA 1DJCA 3W8KA 3A3IA 3GV9A 3P98A 3MQ0A 2ZD8A 3PBOA 3F1OB 2G2WA 1E3UA 1YM1A 3RJUA 1GA0A 2XH9A 5EVIA 3DW0A 5FDSA 5LBRA 5KSHA 2D02A 3WS2A 5AQBA 4OP5A 2DNSA 2PD8A 2ZMVA 1TDLA 3Q82A 1K55C 3UDIA 3QNBA 3LO7A 5E2EA 4K0XA 5L10A 1LI9A 2G2UA 2R9XA 4R3AA 3G2ZA 3OCNA 5F6AA 4GS9A 1XXMA 2XEPA 5EVEA 1RP5A 4P0MA 1NYYA 3V3SA 1PNEA 1GSVA 2JKRI 2WKPA 2PT7A 1ERMA 2OSUA 1IELA 1T18A 5HWWA 4OKPA 1VM1A 4ID4A 3SH9A 2HDSA 2W3FA 5A90A 4OVDA 4WMCD 1VQQA 1SZVA 3UMDA 5HAPA 3T4OA 1H8MA 3NOTC 4DE0A 5TBMB 3ZG5A 1ZC2A 1FCMA 3N7WA 4S2PA 2KX6A 1MKIA 5FI7A 2W3EA 4NETA 1LL5A 3T1QB 1ZHHB 1GCEA 3GVBA 3R7WB 3ZHHA 1GSWA 3KYZA 2ZJ9A 2VJWA 3JYIA 2PU4A 2XA7M 4DE2A 4PKYA 4LLOB 3KSFA 2K31A 1YPRA 1BLPA 1K6RA 4S2JA 2PR6A 4EEPA 1NRJA 3WRZA 4EXOA 5FAPA 2QJ7A 2JC7A 2Y2MA 1FIKA 5EUAA 3H9WA 1T19A 5CHUA 2O9CA 2A2LA 1YT4A 2J80A 3DBAA 3MF0A 1CEGA 3C7VA 3HLGA 2FFFB 3FKVA 3K3DA 3CI6A 2XF3A 1YLZA 3ZNYA 1W8YA 3ISGA 3N6IA 1Q2PA 4LCMA 5FQJA 3BFEA 2ZOIA 1L0EA 4ETXA 1KGGA 4BQMA 5EE8A 1VETB 4GCZA
chains in the Genus database with same CATH topology
5HARA 3S22A 3BLMA 3V3RA 1JWZA 4KG6A 2ZM8A 3ZVTA 4OPQA 3D4FA 4Q8IA 2IWCA 2WADA 5FQMA 4WZ5C 2ZQDA 5FI2A 3S4XA 5HFOA 2WKHA 3IH8A 1BULA 3ZG7B 1KE0A 1S6RA 4QU3A 3SS4A 4DRTA 3AGFA 4NK3A 3VP0A 3M2KA 4KZBA 3AGDA 4KZ9A 4N9KA 3IXHA 1PI4A 3C4OA 4E3NA 5GHXA 4RA7A 4XXRA 3UE1A 3ZCZA 1PI5A 4EBPA 5KMWA 5F1GA 1TDGA 3MBZA 1MPLA 1J9MA 1LLBA 2X02A 3WRTA 3BFDA 1JTDA 4R3JA 4EBNA 1K54C 2Q9NA 3IWIA 4UA7A 1KDWA 5HAQA 1KGFA 4WYYA 2HP5A 3IH9A 2Y2QA 3HLCA 4E3IA 3PAGA 4KZ8A 3MZFA 5TFQA 5FDHA 3FZCA 1HTZA 3N4IA 3UDXA 4P6BA 1XA7A 4MNRA 4O7DA 4S2OA 1EROA 3VP2A 1ES5A 2FFYA 3I7JA 4OLGA 4BD0A 3HLFA 2BG1A 4RX2A 4B4XA 1L0DA 5AQ7A 3LY3A 4OQHA 1DJAA 2ZM0A 5M18A 5CEBA 3CG5A 1K57C 1FCOA 1FR1A 3HLDA 3MXSA 2XGNA 3Q1FA 2WKIA 2Y2IA 4DDSA 1IEMA 1BLHA 3RXWA 3UPOA 2Y4AA 1E25A 1ONHA 1MWRA 3VSKA 2ZMAA 4KZ5A 4Y0OA 3UY6A 4RYEA 4FCFA 1IYPA 3Q7ZA 3LY4A 1NRFA 2OLVA 4JXVA 5FQ9A 3GQZA 5EPHA 3TOIA 1Y54A 4WELA 3SH8A 2Z2LB 4OONA 5A92A 5U47A 4PM8A 5EECA 4BLMA 3GRJA 5E2HA 4L0LA 5GLBA 5FATA 1MBLA 3A3JA 5HL1A 4MBKA 4KQRA 3HLEA 1FR6A 3LEZA 1EWZA 4S2IA 2EX9A 3OPHA 3WS1A 4JF4A 4MLLA 5A91A 2H0YA 1FQGA 1ONGA 3VP3A 2DRWA 3DTMA 4EWFA 3MFDA 4HESA 1I5QA 3WS4A 3VMAA 1WYCA 1TVFA 2HDQA 3GSGA 4KZ6A 5E2GA 4KENB 1L2SA 1I2SA 1KE3A 1H5XA 2J9PA 3A3DA 3C4PA 1YQSA 4DE3A 2ZQ7A 1YLWA 3QHYA 1ES3A 2CC1A 4R3BA 2ZQAA 3A3FA 5CHMA 4D2OA 5KSCA 1MXOA 4WZ5A 1L0GA 3NIAA 1W8QA 4WM9A 1IKIA 4KZ4A 3N8SA 2ZC6B 3NY4A 4GOGA 4C75A 5TGFA 1TEMA 1YMSA 4RVAA 4E3OA 1PZOA 1SDNA 2R9WA 3C7UA 3FWLA 4N92A 5DF9A 3ZFZA 4ZDXA 4FD8A 3BECA 2Y2LA 4ZAMA 3IWOA 3ZNTA 1JVJA 1NJ4A 4GDBA 3GMWA 4GN2A 1K54A 4U3TA 2WGVA 4N9LA 4PPRA 4QY6A 5F82A 4U0TA 2A49A 4GD6A 3O88A 1CI8A 4HBTA 1WYBA 2E8IA 3HUMA 3Q81A 4OH0A 3NBLA 1ESIA 3PBTA 3VP4A 3CMZA 4P85A 3UE0A 2P74A 1QMEA 2UWXA 4KZ7A 2V20A 3SS3A 1YLPA 3OZHA 2JCHA 3EQUA 4UHUA 1RCJA 4PM6A 4BL3A 3MKFA 4EQIA 1SKFA 1S0WA 4OPZA 4DKIA 4X6TA 1ES4A 1H8ZA 3O3VA 5E43A 3LCEA 1U60A 1RGZA 2HP6A 3ZG0A 2H5SA 1K57A 3ZG9B 3NI9A 1K56A 4JLFA 2Y2PA 3NDEA 2Y2HA 4P87A 1GHMA 2HDUA 4OP8A 1ES2A 2J9OA 4XUZA 3HLWA 5BOHA 3TSGA 3Q7VB 5EOOA 1NXYA 4OLDA 1K4FA 1KVMA 1RGYA 3G35A 1W5DA 4IVIA 5GLCA 3IF5A 4E3KA 2ZLYA 1W7FA 2QMIA 3OPLA 4JBFA 4KQQA 4JKTA 5IHVA 4EV4A 2H0TA 4MBFA 3MZDA 4JF6A 3O86A 1GHIA 4N1HA 2WKEA 5JYOA 5EOEA 5F83A 2RCXA 1SHVA 5CGWA 5EVIC 2PU2A 4EBLA 3IF6C 3BFGA 2WZXA 3WWXA 3OPRA 4YINA 2BLSA 2HDRA 4JXWA 3UN7A 3ZDJA 1YLTA 1PW8A 4K0WA 4PM9A 4JXGA 5CGSA 4DDYA 1XPBA 4MBHA 5JYPA 2Y55A 4IBRA 3BM6A 1KVLA 4IVKA 3IXBA 1LHYA 4LV2A 5E2FA 5D3OA 4A5RA 4BD1A 4WZ4A 1KGEA 2WZZA 2EXBA 3IF6B 2XD5A 5EVLA 1CEFA 4HBUA 3MKEA 1LI0A 1HD8A 5DTSA 4ZJ2A 3HUNA 2EX8A 1FCNA 2QZ6A 1AXBA 5AQAA 5M1AA 4R4SA 4E6XA 1PWGA 1O7EA 4X53A 1GHPA 1H8YA 2VGJA 4LV0A 4CJNA 3VOYA 3NC8A 3ZGAB 1ZG6A 1ERQA 4DXBA 2WAEA 2C6WB 2J7VA 3BFCA 2XLNA 5CGXA 3G32A 2EX6A 4S2NA 3PTEA 3UE3A 3Q07A 2WGWA 1N9BA 2C5WB 1MY8A 2WUQA 3OCLA 4Y7PA 3WS5A 3BRMA 4PM7A 4QB8A 3PAEA 1YLYA 4UA9A 2Q9MA 2X01A 5I94A 3OPPA 3P09A 5FASA 1MWSA 3NDGA 4PM5A 2ZM2A 1C3BA 5GHZA 3ITAA 4QJGA 4F94A 2XQZA 3BYDA 1K56D 2ZQ8A 3HREA 4N1XA 1K38A 2VGKA 2OV5A 3NCKA 5CTMA 1HVBA 3E2KA 4DXCA 4JPMA 4LV3A 1ESUA 1NZOA 4S2KA 3S1YA 1BZAA 3IHAA 3BLSA 1G6AA 4UAAA 5KZHA 1IYQA 3Q7VA 2IWBA 4BJPA 4QY5A 3M2JA 2Z2MB 4S2LA 5CRFA 1KDSA 5DF8A 5M19A 3QNCA 2ZQCA 1MWUA 4U0XA 3WS0A 4LENA 3FKWA 3PBNA 2WK0A 2J8YA 3DWZA 4S2NC 3G2YA 5J8XA 4OPYA 1DJCA 5DF7A 1NY0A 2EFXA 1DJBA 1L0FA 3A3IA 3IXDA 3W8KA 1K55A 1JWVA 3CJMA 3O87A 3N8RA 3IWQA 4B4ZA 4WMCA 3RXXA 1Z6FA 3GV9A 1W79A 3P98A 4GB7A 2V1ZA 3FYZA 4OOMA 3PBRA 2Y2GA 2ZD8A 3PBOA 4WEKA 1PWCA 2G2WA 2WGWB 2XDMA 1E3UA 5CXWA 1K25A 2B5RA 1YM1A 4OQIA 1O07A 3BEBA 3RJUA 1GA0A 2XH9A 5EVIA 3DW0A 5A93A 5KSHA 2WGIA 3IF6A 2HPBA 3VFFA 2I72A 3B3XA 3WS2A 1FSYA 5AQBA 3IQAA 1PZPA 4OP5A 4PMAA 4B88A 4QD4A 1IKGA 2DNSA 4ZJ1A 3IXGA 3IT9A 4BL2A 1XGJA 4GD8A 4E6WA 1TDLA 3Q82A 4Y0UA 3V39A 3VOZA 4OOYA 1K55C 1MWTA 2Y2OA 4EUZA 1PWDA 3QNBA 1ZG4A 3UDIA 3LO7A 4KZAA 5E2EA 4K0XA 3PBQA 3W4OA 1FOFA 3HVFA 1I2WA 1LI9A 2G2UA 4Z9QA 1WE4A 2R9XA 3V50A 3MXRA 1XKZA 2Y2NA 5GHYA 4OOLA 2XR0A 1BLCA 1M6KA 2JE5A 2EFUA 3G2ZA 2JBFA 3ITBA 3OCNA 3SS5A 1PYYA 2RL3A 5DTTA 1XXMA 2XEPA 4WBGA 4Y0TA 5F1FA 1Q2QA 1RP5A 4P0MA 1PIOA 1NYYA 4E3MA 1SCWA 1G68A 3V3SA 1ALQA 4FH2A 5CTNA 5CECA 4RX3A 1XA1A 3HBRA 3M6BA 4E3JA 1CK3A 1ERMA 1GA9A 1BT5A 2OSUA 3EQVA 1IELA 3UO9A 4OKPA 1ZKJA 4WEJA 4BENA 2QPNA 1BSGA 1VM1A 4ID4A 4OPRA 4KQOA 3SH9A 2Y59A 5EVIB 5FA7A 2X71A 1YMXA 2HDSA 1LL9A 1NZUA 5HW3A 3UPPA 3W4PA 3G4PA 4C6YA 4MEZA 5A90A 2ZC3B 2P9VB 4OVDA 3V5MA 4JF5A 5DVAA 4WMCD 1VQQA 5CHJA 2ZC5B 3CZDA 4R0QA 1SDEA 3AGEA 5FI6A 4KG2A 2ZQ9A 5FAQA 5HAPA 3VSLA 5FQKA 4DE0A 1M40A 3ZG5A 4X55A 1ZC2A 2XK1A 1E4DA 1CI9A 3GR2A 1FCMA 2WAFA 2Y2KA 4QHCA 3N7WA 1FSWA 4S2PA 1E3UD 1MKIA 5FSRA 5FI7A 4FSFA 4UA6A 5EVID 3HLBA 2Y91A 4NETA 1LL5A 1DY6A 2Y2JA 1HZOA 4GKUA 1GCEA 3HL9A 4LV1A 3VFHA 4X68A 2OLUA 3GVBA 2A3UA 4ZJ3A 3IHBA 4X69A 3ZHHA 2EXAA 3UPNA 2ZJ9A 4GNUA 1BUEA 2PU4A 2XFTA 3JYIA 5DTKA 4DE2A 4FH4A 1QMFA 4R1GA 3PBSA 3OC2A 1JTGA 1OMEA 4R4RA 4ZTKA 3W4QA 4JXSA 4M3KA 5FQQA 4DE1A 1BTLA 5GLAA 4YFMA 4GZBA 1BLPA 5G18A 1K6RA 1BLSA 4KG5A 4S2JA 3UNWA 4HEFA 3VP1A 5GL9A 4C3QA 5AQ9A 5FQIA 3WRZA 4K91A 5GLDA 1K4EA 4E3LA 4DF6A 5FAPA 2PBYA 1IYSA 4ZBEA 4OQGA 1PW1A 2JC7A 2Y2MA 2ZC7A 3BFFA 5EUAA 2WYXA 1EI5A 2GDNA 1XX2A 5CHUA 4LCLA 1XGIA 3G34A 3SOIA 1YT4A 4X56A 5FAOA 2XD1A 4S2MA 3A3EA 3TG9A 3ZG8B 1CEGA 1YLJA 3C7VA 5HX9A 2HP9A 1JWPA 2V2FF 3HLGA 2FFFB 4IBXA 2EX2A 3FKVA 4XUXA 4KZ3A 3C5AA 5CEDA 4H8RA 4IEDA 3E2LA 2XF3A 1YLZA 3ZNYA 1XP4A 1K6SA 2DCFA 3SH7A 1W8YA 3ISGA 1N4OA 3DWKA 1KE4A 1Q2PA 2IWDA 2P9VA 3FV7A 3G31A 3N6IA 3N8LA 3GTCA 4LCMA 5FQJA 3UDFA 4GDNA 2H10A 3G30A 5HAIA 3BFEA 3ZVWA 1L0EA 1NYMA 3HUOA 1KGGA 1IYOA 4R23A 4OQ0A 5CERA 4BQMA 2ZC4B 3M6HA 5EE8A 3MZEA 5L2FA 4CPKA 5TR7A 2XFSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HAR A;  3S22 A;  3BLM A;  3V3R A;  1JWZ A;  4KG6 A;  2ZM8 A;  3ZVT A;  4OPQ A;  3D4F A;  4Q8I A;  2IWC A;  2WAD A;  5FQM A;  4WZ5 C;  2ZQD A;  5FI2 A;  3S4X A;  5HFO A;  2WKH A;  3IH8 A;  1BUL A;  3ZG7 B;  1KE0 A;  1S6R A;  4QU3 A;  3SS4 A;  4DRT A;  3AGF A;  4NK3 A;  3VP0 A;  3M2K A;  4KZB A;  3AGD A;  4KZ9 A;  4N9K A;  3IXH A;  1PI4 A;  3C4O A;  4E3N A;  5GHX A;  4RA7 A;  4XXR A;  3UE1 A;  3ZCZ A;  1PI5 A;  4EBP A;  5KMW A;  5F1G A;  1TDG A;  3MBZ A;  1MPL A;  1J9M A;  1LLB A;  2X02 A;  3WRT A;  3BFD A;  1JTD A;  4R3J A;  4EBN A;  1K54 C;  2Q9N A;  3IWI A;  4UA7 A;  1KDW A;  5HAQ A;  1KGF A;  4WYY A;  2HP5 A;  3IH9 A;  2Y2Q A;  3HLC A;  4E3I A;  3PAG A;  4KZ8 A;  3MZF A;  5TFQ A;  5FDH A;  3FZC A;  1HTZ A;  3N4I A;  3UDX A;  4P6B A;  1XA7 A;  4MNR A;  4O7D A;  4S2O A;  1ERO A;  3VP2 A;  1ES5 A;  2FFY A;  3I7J A;  4OLG A;  4BD0 A;  3HLF A;  2BG1 A;  4RX2 A;  4B4X A;  1L0D A;  5AQ7 A;  3LY3 A;  4OQH A;  1DJA A;  2ZM0 A;  5M18 A;  5CEB A;  3CG5 A;  1K57 C;  1FCO A;  1FR1 A;  3HLD A;  3MXS A;  2XGN A;  3Q1F A;  2WKI A;  2Y2I A;  4DDS A;  1IEM A;  1BLH A;  3RXW A;  3UPO A;  2Y4A A;  1E25 A;  1ONH A;  1MWR A;  3VSK A;  2ZMA A;  4KZ5 A;  4Y0O A;  3UY6 A;  4RYE A;  4FCF A;  1IYP A;  3Q7Z A;  3LY4 A;  1NRF A;  2OLV A;  4JXV A;  5FQ9 A;  3GQZ A;  5EPH A;  3TOI A;  1Y54 A;  4WEL A;  3SH8 A;  2Z2L B;  4OON A;  5A92 A;  5U47 A;  4PM8 A;  5EEC A;  4BLM A;  3GRJ A;  5E2H A;  4L0L A;  5GLB A;  5FAT A;  1MBL A;  3A3J A;  5HL1 A;  4MBK A;  4KQR A;  3HLE A;  1FR6 A;  3LEZ A;  1EWZ A;  4S2I A;  2EX9 A;  3OPH A;  3WS1 A;  4JF4 A;  4MLL A;  5A91 A;  2H0Y A;  1FQG A;  1ONG A;  3VP3 A;  2DRW A;  3DTM A;  4EWF A;  3MFD A;  4HES A;  1I5Q A;  3WS4 A;  3VMA A;  1WYC A;  1TVF A;  2HDQ A;  3GSG A;  4KZ6 A;  5E2G A;  4KEN B;  1L2S A;  1I2S A;  1KE3 A;  1H5X A;  2J9P A;  3A3D A;  3C4P A;  1YQS A;  4DE3 A;  2ZQ7 A;  1YLW A;  3QHY A;  1ES3 A;  2CC1 A;  4R3B A;  2ZQA A;  3A3F A;  5CHM A;  4D2O A;  5KSC A;  1MXO A;  4WZ5 A;  1L0G A;  3NIA A;  1W8Q A;  4WM9 A;  1IKI A;  4KZ4 A;  3N8S A;  2ZC6 B;  3NY4 A;  4GOG A;  4C75 A;  5TGF A;  1TEM A;  1YMS A;  4RVA A;  4E3O A;  1PZO A;  1SDN A;  2R9W A;  3C7U A;  3FWL A;  4N92 A;  5DF9 A;  3ZFZ A;  4ZDX A;  4FD8 A;  3BEC A;  2Y2L A;  4ZAM A;  3IWO A;  3ZNT A;  1JVJ A;  1NJ4 A;  4GDB A;  3GMW A;  4GN2 A;  1K54 A;  4U3T A;  2WGV A;  4N9L A;  4PPR A;  4QY6 A;  5F82 A;  4U0T A;  2A49 A;  4GD6 A;  3O88 A;  1CI8 A;  4HBT A;  1WYB A;  2E8I A;  3HUM A;  3Q81 A;  4OH0 A;  3NBL A;  1ESI A;  3PBT A;  3VP4 A;  3CMZ A;  4P85 A;  3UE0 A;  2P74 A;  1QME A;  2UWX A;  4KZ7 A;  2V20 A;  3SS3 A;  1YLP A;  3OZH A;  2JCH A;  3EQU A;  4UHU A;  1RCJ A;  4PM6 A;  4BL3 A;  3MKF A;  4EQI A;  1SKF A;  1S0W A;  4OPZ A;  4DKI A;  4X6T A;  1ES4 A;  1H8Z A;  3O3V A;  5E43 A;  3LCE A;  1U60 A;  1RGZ A;  2HP6 A;  3ZG0 A;  2H5S A;  1K57 A;  3ZG9 B;  3NI9 A;  1K56 A;  4JLF A;  2Y2P A;  3NDE A;  2Y2H A;  4P87 A;  1GHM A;  2HDU A;  4OP8 A;  1ES2 A;  2J9O A;  4XUZ A;  3HLW A;  5BOH A;  3TSG A;  3Q7V B;  5EOO A;  1NXY A;  4OLD A;  1K4F A;  1KVM A;  1RGY A;  3G35 A;  1W5D A;  4IVI A;  5GLC A;  3IF5 A;  4E3K A;  2ZLY A;  1W7F A;  2QMI A;  3OPL A;  4JBF A;  4KQQ A;  4JKT A;  5IHV A;  4EV4 A;  2H0T A;  4MBF A;  3MZD A;  4JF6 A;  3O86 A;  1GHI A;  4N1H A;  2WKE A;  5JYO A;  5EOE A;  5F83 A;  2RCX A;  1SHV A;  5CGW A;  5EVI C;  2PU2 A;  4EBL A;  3IF6 C;  3BFG A;  2WZX A;  3WWX A;  3OPR A;  4YIN A;  2BLS A;  2HDR A;  4JXW A;  3UN7 A;  3ZDJ A;  1YLT A;  1PW8 A;  4K0W A;  4PM9 A;  4JXG A;  5CGS A;  4DDY A;  1XPB A;  4MBH A;  5JYP A;  2Y55 A;  4IBR A;  3BM6 A;  1KVL A;  4IVK A;  3IXB A;  1LHY A;  4LV2 A;  5E2F A;  5D3O A;  4A5R A;  4BD1 A;  4WZ4 A;  1KGE A;  2WZZ A;  2EXB A;  3IF6 B;  2XD5 A;  5EVL A;  1CEF A;  4HBU A;  3MKE A;  1LI0 A;  1HD8 A;  5DTS A;  4ZJ2 A;  3HUN A;  2EX8 A;  1FCN A;  2QZ6 A;  1AXB A;  5AQA A;  5M1A A;  4R4S A;  4E6X A;  1PWG A;  1O7E A;  4X53 A;  1GHP A;  1H8Y A;  2VGJ A;  4LV0 A;  4CJN A;  3VOY A;  3NC8 A;  3ZGA B;  1ZG6 A;  1ERQ A;  4DXB A;  2WAE A;  2C6W B;  2J7V A;  3BFC A;  2XLN A;  5CGX A;  3G32 A;  2EX6 A;  4S2N A;  3PTE A;  3UE3 A;  3Q07 A;  2WGW A;  1N9B A;  2C5W B;  1MY8 A;  2WUQ A;  3OCL A;  4Y7P A;  3WS5 A;  3BRM A;  4PM7 A;  4QB8 A;  3PAE A;  1YLY A;  4UA9 A;  2Q9M A;  2X01 A;  5I94 A;  3OPP A;  3P09 A;  5FAS A;  1MWS A;  3NDG A;  4PM5 A;  2ZM2 A;  1C3B A;  5GHZ A;  3ITA A;  4QJG A;  4F94 A;  2XQZ A;  3BYD A;  1K56 D;  2ZQ8 A;  3HRE A;  4N1X A;  1K38 A;  2VGK A;  2OV5 A;  3NCK A;  5CTM A;  1HVB A;  3E2K A;  4DXC A;  4JPM A;  4LV3 A;  1ESU A;  1NZO A;  4S2K A;  3S1Y A;  1BZA A;  3IHA A;  3BLS A;  1G6A A;  4UAA A;  5KZH A;  1IYQ A;  3Q7V A;  2IWB A;  4BJP A;  4QY5 A;  3M2J A;  2Z2M B;  4S2L A;  5CRF A;  1KDS A;  5DF8 A;  5M19 A;  3QNC A;  2ZQC A;  1MWU A;  4U0X A;  3WS0 A;  4LEN A;  3FKW A;  3PBN A;  2WK0 A;  2J8Y A;  3DWZ A;  4S2N C;  3G2Y A;  5J8X A;  4OPY A;  1DJC A;  5DF7 A;  1NY0 A;  2EFX A;  1DJB A;  1L0F A;  3A3I A;  3IXD A;  3W8K A;  1K55 A;  1JWV A;  3CJM A;  3O87 A;  3N8R A;  3IWQ A;  4B4Z A;  4WMC A;  3RXX A;  1Z6F A;  3GV9 A;  1W79 A;  3P98 A;  4GB7 A;  2V1Z A;  3FYZ A;  4OOM A;  3PBR A;  2Y2G A;  2ZD8 A;  3PBO A;  4WEK A;  1PWC A;  2G2W A;  2WGW B;  2XDM A;  1E3U A;  5CXW A;  1K25 A;  2B5R A;  1YM1 A;  4OQI A;  1O07 A;  3BEB A;  3RJU A;  1GA0 A;  2XH9 A;  5EVI A;  3DW0 A;  5A93 A;  5KSH A;  2WGI A;  3IF6 A;  2HPB A;  3VFF A;  2I72 A;  3B3X A;  3WS2 A;  1FSY A;  5AQB A;  3IQA A;  1PZP A;  4OP5 A;  4PMA A;  4B88 A;  4QD4 A;  1IKG A;  2DNS A;  4ZJ1 A;  3IXG A;  3IT9 A;  4BL2 A;  1XGJ A;  4GD8 A;  4E6W A;  1TDL A;  3Q82 A;  4Y0U A;  3V39 A;  3VOZ A;  4OOY A;  1K55 C;  1MWT A;  2Y2O A;  4EUZ A;  1PWD A;  3QNB A;  1ZG4 A;  3UDI A;  3LO7 A;  4KZA A;  5E2E A;  4K0X A;  3PBQ A;  3W4O A;  1FOF A;  3HVF A;  1I2W A;  1LI9 A;  2G2U A;  4Z9Q A;  1WE4 A;  2R9X A;  3V50 A;  3MXR A;  1XKZ A;  2Y2N A;  5GHY A;  4OOL A;  2XR0 A;  1BLC A;  1M6K A;  2JE5 A;  2EFU A;  3G2Z A;  2JBF A;  3ITB A;  3OCN A;  3SS5 A;  1PYY A;  2RL3 A;  5DTT A;  1XXM A;  2XEP A;  4WBG A;  4Y0T A;  5F1F A;  1Q2Q A;  1RP5 A;  4P0M A;  1PIO A;  1NYY A;  4E3M A;  1SCW A;  1G68 A;  3V3S A;  1ALQ A;  4FH2 A;  5CTN A;  5CEC A;  4RX3 A;  1XA1 A;  3HBR A;  3M6B A;  4E3J A;  1CK3 A;  1ERM A;  1GA9 A;  1BT5 A;  2OSU A;  3EQV A;  1IEL A;  3UO9 A;  4OKP A;  1ZKJ A;  4WEJ A;  4BEN A;  2QPN A;  1BSG A;  1VM1 A;  4ID4 A;  4OPR A;  4KQO A;  3SH9 A;  2Y59 A;  5EVI B;  5FA7 A;  2X71 A;  1YMX A;  2HDS A;  1LL9 A;  1NZU A;  5HW3 A;  3UPP A;  3W4P A;  3G4P A;  4C6Y A;  4MEZ A;  5A90 A;  2ZC3 B;  2P9V B;  4OVD A;  3V5M A;  4JF5 A;  5DVA A;  4WMC D;  1VQQ A;  5CHJ A;  2ZC5 B;  3CZD A;  4R0Q A;  1SDE A;  3AGE A;  5FI6 A;  4KG2 A;  2ZQ9 A;  5FAQ A;  5HAP A;  3VSL A;  5FQK A;  4DE0 A;  1M40 A;  3ZG5 A;  4X55 A;  1ZC2 A;  2XK1 A;  1E4D A;  1CI9 A;  3GR2 A;  1FCM A;  2WAF A;  2Y2K A;  4QHC A;  3N7W A;  1FSW A;  4S2P A;  1E3U D;  1MKI A;  5FSR A;  5FI7 A;  4FSF A;  4UA6 A;  5EVI D;  3HLB A;  2Y91 A;  4NET A;  1LL5 A;  1DY6 A;  2Y2J A;  1HZO A;  4GKU A;  1GCE A;  3HL9 A;  4LV1 A;  3VFH A;  4X68 A;  2OLU A;  3GVB A;  2A3U A;  4ZJ3 A;  3IHB A;  4X69 A;  3ZHH A;  2EXA A;  3UPN A;  2ZJ9 A;  4GNU A;  1BUE A;  2PU4 A;  2XFT A;  3JYI A;  5DTK A;  4DE2 A;  4FH4 A;  1QMF A;  4R1G A;  3PBS A;  3OC2 A;  1JTG A;  1OME A;  4R4R A;  4ZTK A;  3W4Q A;  4JXS A;  4M3K A;  5FQQ A;  4DE1 A;  1BTL A;  5GLA A;  4YFM A;  4GZB A;  1BLP A;  5G18 A;  1K6R A;  1BLS A;  4KG5 A;  4S2J A;  3UNW A;  4HEF A;  3VP1 A;  5GL9 A;  4C3Q A;  5AQ9 A;  5FQI A;  3WRZ A;  4K91 A;  5GLD A;  1K4E A;  4E3L A;  4DF6 A;  5FAP A;  2PBY A;  1IYS A;  4ZBE A;  4OQG A;  1PW1 A;  2JC7 A;  2Y2M A;  2ZC7 A;  3BFF A;  5EUA A;  2WYX A;  1EI5 A;  2GDN A;  1XX2 A;  5CHU A;  4LCL A;  1XGI A;  3G34 A;  3SOI A;  1YT4 A;  4X56 A;  5FAO A;  2XD1 A;  4S2M A;  3A3E A;  3TG9 A;  3ZG8 B;  1CEG A;  1YLJ A;  3C7V A;  5HX9 A;  2HP9 A;  1JWP A;  2V2F F;  3HLG A;  2FFF B;  4IBX A;  2EX2 A;  3FKV A;  4XUX A;  4KZ3 A;  3C5A A;  5CED A;  4H8R A;  4IED A;  3E2L A;  2XF3 A;  1YLZ A;  3ZNY A;  1XP4 A;  1K6S A;  2DCF A;  3SH7 A;  1W8Y A;  3ISG A;  1N4O A;  3DWK A;  1KE4 A;  1Q2P A;  2IWD A;  2P9V A;  3FV7 A;  3G31 A;  3N6I A;  3N8L A;  3GTC A;  4LCM A;  5FQJ A;  3UDF A;  4GDN A;  2H10 A;  3G30 A;  5HAI A;  3BFE A;  3ZVW A;  1L0E A;  1NYM A;  3HUO A;  1KGG A;  1IYO A;  4R23 A;  4OQ0 A;  5CER A;  4BQM A;  2ZC4 B;  3M6H A;  5EE8 A;  3MZE A;  5L2F A;  4CPK A;  5TR7 A;  2XFS A; 
#chains in the Genus database with same CATH topology
 2OWJ A;  3VV4 A;  5HAR A;  3V3R A;  1JWZ A;  2ZM8 A;  4OPQ A;  1TS0 A;  4WZ5 C;  3B42 A;  5FI2 A;  3S4X A;  5L09 A;  3IH8 A;  3SS4 A;  4NK3 A;  4KZB A;  4KZ9 A;  3TRC A;  4RA7 A;  3A0S A;  3UE1 A;  2OAQ 1;  1TDG A;  5F1G A;  3A0R A;  1JTD A;  4R3J A;  2GJ3 A;  2L0W A;  2GZA A;  4O0P A;  2G7U A;  3IH9 A;  5HDS A;  1S4R A;  2Y2Q A;  2MJ6 A;  4KZ8 A;  5TFQ A;  1V9Z A;  4HNB A;  3VP2 A;  1YAX A;  5AQ7 A;  4Y3I A;  1FCO A;  2XGN A;  3E4P A;  3Q1F A;  3T4S A;  2Q0O A;  3RXW A;  1ONH A;  5AVF A;  3VSK A;  4RYE A;  4FCF A;  2OLV A;  4JXV A;  5EPH A;  4D60 A;  1Y54 A;  4WEL A;  2W0N A;  1UWN X;  5EEC A;  2VKS A;  5GLB A;  3RTY A;  3P01 A;  3MQO A;  3A3J A;  4BBU A;  4HY8 A;  3LEZ A;  1EWZ A;  2EX9 A;  4R38 A;  3OPH A;  2I9V A;  4JF4 A;  2UV0 E;  4MLL A;  5A91 A;  3VP3 A;  3IS2 A;  1IFQ A;  4HES A;  2W27 A;  3WS4 A;  4HHD A;  3K3C A;  4AFI A;  5E2G A;  2ZL1 B;  4KEN B;  1XFN A;  1KE3 A;  3C4P A;  3H7W A;  4DE3 A;  5EM0 A;  2W1R A;  3QHY A;  1ES3 A;  4R3B A;  2ZQA A;  5CHM A;  1H0M A;  4WZ5 A;  1L0G A;  4KZ4 A;  3N8S A;  1S1Z A;  4GOG A;  5TGF A;  1JNU A;  3C7U A;  5EFW A;  3ZFZ A;  4KUK A;  3QP5 A;  1NJ4 A;  4GN2 A;  2WGV A;  4QY6 A;  3BW6 A;  4HBT A;  4GJ4 A;  2V8F A;  3PBT A;  3VP4 A;  1S1Y A;  2JCH A;  4EQI A;  1S0W A;  4DKI A;  4X6T A;  1ES4 A;  1H8Z A;  3FC7 A;  3UME A;  3ZG9 B;  3T4J A;  2Y2H A;  5I5L A;  4OP8 A;  2J9O A;  1P9R A;  4XUZ A;  5G4Z A;  4OLD A;  1K4F A;  1KVM A;  3G35 A;  4YNR A;  1W7F A;  2V0W A;  4JKT A;  3L9K A;  4JF6 A;  3O86 A;  1SKO B;  2PD7 A;  3T1S A;  4GHI A;  2WKE A;  5EOE A;  2RCX A;  5CGW A;  3LIE A;  3IF6 C;  2WZX A;  3WWX A;  3ZDJ A;  1Z09 A;  4JXG A;  5CGS A;  1XPB A;  5JYP A;  4IBR A;  1KVL A;  3IXB A;  5D3O A;  1MZU A;  4DJ2 A;  5EVL A;  2L4R A;  4NG2 A;  4KUO A;  5DTS A;  1LL8 A;  1PWG A;  1O7E A;  3LI8 A;  1H8Y A;  4LV0 A;  4CJN A;  3VOL A;  3IX3 A;  4DXB A;  3DTE A;  1OTI A;  3G32 A;  3PTE A;  1HLU P;  2WGW A;  4Y7P A;  1TS6 A;  5I94 A;  3KSG A;  2Q9M A;  3P09 A;  5FAS A;  1C3B A;  5GHZ A;  4GS9 B;  3BYD A;  4EEU A;  2YKF A;  1TF1 A;  5CTM A;  5FEG A;  4DXC A;  2ZBB A;  4S2K A;  1G6A A;  5KZH A;  3NJA A;  3Q7V A;  4NXE A;  3R4K A;  1KDS A;  1VEU A;  3C30 A;  4S2N C;  2FH5 A;  3A0V A;  1FIL A;  5EM1 A;  4LGW A;  1NY0 A;  2EFX A;  2NUT C;  3TJZ C;  1JWV A;  3CJM A;  3O87 A;  2INW A;  2JKF A;  4GB7 A;  1PWC A;  1K25 A;  2B5R A;  3LIA A;  4BWI A;  4QWO A;  1KOU A;  5A8B A;  5A93 A;  3IF6 A;  2I72 A;  1FSY A;  2Y8H A;  1DRM A;  3IQA A;  1PZP A;  5G4Y A;  4ZJ1 A;  4E6W A;  1XGJ A;  4GD8 A;  1OT6 A;  3V39 A;  3VOZ A;  3VE3 A;  1ZG4 A;  3PBQ A;  1FOF A;  3HVF A;  2L1M A;  3LIF A;  3S7P A;  1WE4 A;  3MXR A;  3LGO A;  4Y17 A;  5GHY A;  4OOL A;  2EFU A;  2VEA A;  3ITB A;  2RL3 A;  2VK3 A;  1XJ3 A;  4E3M A;  3BY8 A;  3JVU A;  2EA9 A;  3M6B A;  4E3J A;  3UO9 A;  4HIA A;  1ZKJ A;  2Y59 A;  5FA7 A;  2X71 A;  4Y5F A;  4C6Y A;  4MEZ A;  4DN0 A;  4R0Q A;  5FI6 A;  4WLA A;  5L07 A;  5FAQ A;  3VSL A;  3B33 A;  4ZRR A;  4QHC A;  2WAF A;  5FSR A;  4IJG A;  4FSF A;  1DY6 A;  4GKU A;  3HL9 A;  4PKY G;  2OLU A;  2A3U A;  4X69 A;  3VE4 A;  2XFT A;  5DTK A;  4FH4 A;  3OC2 A;  5AVE A;  4HJ3 A;  1BTL A;  3LIB A;  4YFM A;  4HEF A;  4C3Q A;  5AQ9 A;  5HPF A;  4E3L A;  1N9O A;  4JGO A;  2PAV P;  4OQG A;  3BFF A;  2WYX A;  1XGI A;  3SOI A;  5HWV A;  2VV8 A;  4IHQ A;  5HX9 A;  2HP9 A;  3KX0 X;  4IBX A;  3C5A A;  3E2L A;  4X25 A;  1K6S A;  3DWK A;  2P9V A;  3N8L A;  3QP1 A;  5DKK A;  3UDF A;  4GDN A;  3DTI A;  1IYO A;  5CER A;  2ZC4 B;  3MZE A;  4CPK A;  4O8G A;  4KG6 A;  3ZVT A;  4M4X A;  4Q8I A;  5FQM A;  2WKH A;  1BUL A;  1S6R A;  3AGF A;  3M2K A;  3C4O A;  4E3N A;  3T1R A;  4EBP A;  4HH2 A;  1MPL A;  3WRT A;  3TW8 A;  1CF0 A;  4L9F A;  1KDW A;  4WYY A;  2P08 A;  3HLC A;  4E3I A;  2W3G A;  3S7N A;  3T50 A;  3LR4 A;  1OTA A;  4P6B A;  1ES5 A;  3I7J A;  4OLG A;  4RX2 A;  4B4X A;  2ZM0 A;  5M18 A;  1A0K A;  2GX5 A;  2KOI A;  3MXS A;  2VLG A;  4X1L A;  1IEM A;  3UPO A;  1E25 A;  4KZ5 A;  3Q7Z A;  1NRF A;  1DP6 A;  3SH8 A;  4H6J A;  2FZ0 A;  3BJN A;  5U47 A;  4PM8 A;  3GRJ A;  4E04 A;  3FPW A;  5HL1 A;  3NUL A;  4MBK A;  4HJ6 A;  3F1N B;  3ZYT A;  1FR6 A;  4GHI B;  4S2I A;  3PHY A;  3WS1 A;  4HJ4 A;  1DP8 A;  4I3I A;  3T4T A;  4EWF A;  3MFD A;  3LR3 A;  3VMA A;  1G28 A;  3KO6 A;  1WYC A;  2W3H A;  4HP4 A;  1L2S A;  1I2S A;  2V1B A;  1S4S A;  3A3D A;  2JKT I;  1OJ5 A;  4D2O A;  3A3F A;  4F3L A;  5KIZ A;  2ZC6 B;  3E4O A;  3NY4 A;  3SZT A;  1YMS A;  4ARZ A;  4NXB A;  2KDK A;  3LID A;  3FWL A;  1XJ4 A;  4NKP A;  2Y2L A;  4ZAM A;  3IWO A;  3ZNT A;  2J3T C;  3OBF A;  4U3T A;  3EGX C;  4U0T A;  1D1J A;  3O88 A;  2E8I A;  3HUM A;  4LRX C;  4OH0 A;  3NBL A;  3H82 B;  4P85 A;  3EEA A;  4RQ9 A;  3S7Q A;  1OPX A;  3EQU A;  4PM6 A;  4P6Z M;  1SKF A;  3O3V A;  3LCE A;  4Y15 A;  1RGZ A;  2HP6 A;  3TE8 A;  1K56 A;  4JLF A;  2Y2P A;  3NDE A;  3TSG A;  3Q7V B;  5EOO A;  2W1T B;  5GLC A;  1W5D A;  4IVI A;  2NUP C;  3FPV A;  1VEU B;  4JBF A;  5IHV A;  3MR0 A;  4EV4 A;  1T1A A;  3QP6 A;  1GHI A;  4N1H A;  5F83 A;  2XA7 S;  1SHV A;  2QJ5 A;  3MSH A;  1MKM A;  2PBD P;  3UN7 A;  1YLT A;  4DDY A;  3NEC A;  4MBH A;  2EWW A;  4XT2 A;  2Y55 A;  4BD1 A;  2WZZ A;  3IF6 B;  2XD5 A;  1LI0 A;  3HUN A;  4R6L A;  5M1A A;  2KLI A;  4X53 A;  3QP8 A;  1GHP A;  1N9L A;  3NC8 A;  2VZW A;  4Y13 A;  1PFL A;  3E98 A;  1ERQ A;  1OTE A;  2HGV A;  2P04 A;  2J7V A;  3NOP C;  2XLN A;  2QYB A;  3LEQ A;  3Q07 A;  3PXP A;  2C5W B;  4UA9 A;  4QB8 A;  3PAE A;  3E0Y A;  4QJG A;  3ICY A;  4N1X A;  2VGK A;  2OV5 A;  2VGL M;  2VV7 A;  3E2K A;  4B9O A;  2OAP 1;  1NWZ A;  1D06 A;  2IWB A;  4QY5 A;  3M2J A;  2Z2M B;  5DF8 A;  1Y28 A;  4LEN A;  3EEH A;  3PBN A;  1NLZ A;  5J8X A;  5DF7 A;  1T1B A;  1DJB A;  1L0F A;  3IWQ A;  2BAS A;  4WMC A;  3RXX A;  1UWP X;  4ESP A;  3ZQ5 A;  3UB5 P;  1W79 A;  2VV6 A;  3LIC A;  2QHK A;  3FYZ A;  2Y2G A;  1F9I A;  4PHT A;  2XDM A;  4EQ1 A;  5CXW A;  4BBV A;  1O07 A;  3BEB A;  4JGR A;  2WGI A;  2HPB A;  3GDI A;  3VFF A;  1LSV A;  4PMA A;  4QD4 A;  2M7V A;  4BL2 A;  4Y0U A;  1F2K A;  1MWT A;  4MCW A;  4PAU A;  3RFB A;  4KZA A;  5C5K A;  4YWZ A;  1I2W A;  1CJF A;  3V50 A;  2Y2N A;  4HH3 A;  1BLC A;  2XR0 A;  4Y0T A;  4UQI M;  4WBG A;  5F1F A;  3R7W A;  1SCW A;  4JGP A;  1OTB A;  3HBR A;  3MMH A;  2YKH A;  1BT5 A;  3T4Q A;  4BEN A;  1CQA A;  4OPR A;  4KQO A;  2VGL S;  5EVI B;  3JPU A;  1LL9 A;  3W4P A;  2P9V B;  2B02 A;  1H3Q A;  4JF5 A;  3V5M A;  1GSX A;  4MMN A;  3E4Q A;  4WUJ A;  2ZQ9 A;  2Y79 A;  5HWT A;  1M40 A;  2XK1 A;  1CI9 A;  3LR0 A;  1E3U D;  2PR5 A;  3L7H A;  1D7E A;  5EVI D;  3UB7 A;  3VFH A;  1V9Y A;  2JHE A;  4X68 A;  4ZJ3 A;  2A24 A;  3IHB A;  3UPN A;  4GNU A;  1BUE A;  1PRQ A;  4EET B;  5IS1 A;  4R1G A;  3PBS A;  1XFQ A;  1OME A;  2B18 A;  4M3K A;  5FQQ A;  1S66 L;  2E8J A;  3G6O A;  1VET A;  2PRF A;  5DKL A;  1BLS A;  1OJG A;  3VP1 A;  3FG8 A;  5GL9 A;  4FTX A;  5FQI A;  4K91 A;  4DF6 A;  2PBY A;  4NXF A;  2ZC7 A;  2H28 A;  1EI5 A;  1XX2 A;  3G34 A;  1ACF A;  4X56 A;  3A3E A;  3TG9 A;  3ZG8 B;  1JWP A;  2V2F F;  4XUX A;  5CED A;  4IED A;  1XP4 A;  2DCF A;  3SH7 A;  3FV7 A;  3G31 A;  3GTC A;  2D01 A;  2H10 A;  3G30 A;  5HAI A;  3HUO A;  4R23 A;  4OQ0 A;  3M6H A;  5L2F A;  5TR7 A;  4Z1W A;  3S7O A;  5HFO A;  3ZG7 B;  4DRT A;  3BWL A;  3AGD A;  4N9K A;  3IXH A;  5KMW A;  2GNX A;  3MBZ A;  1F5M A;  1T1C A;  3IWI A;  5J3W A;  4F3L B;  3MZF A;  4ARZ B;  4G3W A;  4QPR A;  1XA7 A;  1ERO A;  2FFY A;  3PR6 A;  4BD0 A;  3LY3 A;  4OQH A;  5CX7 A;  5CEB A;  5DFX A;  4I3J A;  3LYX A;  4LRZ E;  2WKI A;  3SW1 A;  4LPZ A;  3NHQ A;  2R78 A;  5HPI A;  1BLH A;  2ZMA A;  4Y0O A;  1IYP A;  4GW9 A;  3LY4 A;  5F5Y A;  3UE6 A;  3CUE C;  5FQ9 A;  4YOF A;  1P9W A;  3GQZ A;  3TOI A;  3K2N A;  2Z2L B;  1G6O A;  1XJ6 A;  4OON A;  5A92 A;  5E2H A;  4L0L A;  2HZ5 A;  5FAT A;  4KQR A;  2OWH A;  3HLE A;  5DFY A;  1MC0 A;  1ONG A;  4LRY C;  2DRW A;  3DTM A;  2P7J A;  4JGQ A;  1I5Q A;  2HDQ A;  1P97 A;  3GSG A;  4B93 A;  1H5X A;  4XT2 B;  1YQS A;  2ZQ7 A;  1YLW A;  1MXO A;  3NIA A;  1VB6 A;  1W8Q A;  1F98 A;  4C75 A;  1PZO A;  1SDN A;  4K08 A;  1YSP A;  5DF9 A;  4ZDX A;  4FD8 A;  2HJE A;  4WF0 A;  3CHW P;  1JVJ A;  3NOU C;  3GMW A;  4GDB A;  4N9L A;  3MXQ A;  5F82 A;  4X1M A;  2A49 A;  4GD6 A;  1WYB A;  4KQD A;  5FL3 A;  3CMZ A;  2UWX A;  3SS3 A;  2V20 A;  4I3A A;  1YLP A;  4UHU A;  3MKF A;  4OPZ A;  3IS2 B;  2HV1 A;  1UGU A;  2LB9 A;  2V0U A;  4Q0I A;  3NI9 A;  1GHM A;  2HDU A;  1NLY A;  3HLW A;  5BOH A;  4MN6 A;  1RGY A;  3H7W B;  4E3K A;  3IF5 A;  2ZLY A;  3DAV A;  2QMI A;  4KQQ A;  4MBF A;  3IBR A;  2VX8 A;  3CLO A;  3CUE A;  2J3T D;  3CPT A;  4I5S A;  3OPR A;  2BLS A;  1LT0 A;  5HDC A;  1PW8 A;  1XJ2 A;  3LFV A;  2DMW A;  4CLC C;  3KSH A;  4IVK A;  5E2F A;  1LHY A;  4A5R A;  2EXB A;  3C2W A;  1CEF A;  2EX8 A;  3C38 A;  3KYE A;  2QZ6 A;  3T4L A;  5AQA A;  4E6X A;  2VGJ A;  4Y2F A;  2K2N A;  3BFC A;  2AVX A;  1N9N A;  1N9B A;  1MY8 A;  2WUQ A;  4II7 A;  4PM7 A;  4CQH A;  1YLY A;  1MWS A;  4G3V A;  2XSS A;  2ZM2 A;  4PM5 A;  4F94 A;  2O99 A;  1X0O A;  3MJQ A;  3NCK A;  1HVB A;  1ESU A;  3S1Y A;  1L3L A;  3IHA A;  4UAA A;  3D72 A;  4BJP A;  4S2L A;  3KSI A;  3QNC A;  4NXG A;  2ZQC A;  4U0X A;  2O9B A;  3FKW A;  3F1P A;  5HZH A;  3DWZ A;  3G2Y A;  3IXD A;  3CWF A;  1K55 A;  3HJI A;  2B95 A;  3N8R A;  4B4Z A;  4EES A;  1Z6F A;  2HF6 A;  5J7E A;  2PYR A;  2Z6C A;  2V1Z A;  2VA0 A;  4OOM A;  3PBR A;  4WEK A;  3EGD C;  2WGW B;  1ODV A;  3T12 B;  4OQI A;  2M1C A;  2EWV A;  2A24 B;  2JKG A;  3B3X A;  4Q0J A;  4CLC E;  4B88 A;  1IKG A;  4L9E A;  3IXG A;  3IT9 A;  4CLC A;  3LUQ A;  4OOY A;  3RH8 B;  2Y2O A;  4EUZ A;  1PWD A;  5HD5 A;  3D3O A;  2Z6D A;  2V1A A;  3W4O A;  1STZ A;  3P7N A;  1ZTU A;  4Z9Q A;  1XKZ A;  3EOI A;  1M6K A;  2JE5 A;  2JBF A;  3SS5 A;  1PYY A;  5DTT A;  3MFX A;  1Q2Q A;  3GEC A;  1PIO A;  1K0K A;  1G68 A;  1ALQ A;  4FH2 A;  5CTN A;  1J3W A;  5CEC A;  4RX3 A;  1XA1 A;  2BTF P;  1CK3 A;  1GA9 A;  3EQV A;  2LB5 A;  4WEJ A;  4G3K A;  2QPN A;  1BSG A;  1W63 M;  2ACG A;  1YMX A;  1NZU A;  5HW3 A;  3UPP A;  3G4P A;  4HOI A;  2ZC3 B;  2QKP A;  5DVA A;  5CHJ A;  2ZC5 B;  4EUV A;  3T1X A;  5AJG A;  3CZD A;  1SDE A;  3AGE A;  1AWI A;  4KG2 A;  3MQQ A;  5FQK A;  4BMW A;  2CMN A;  4X55 A;  1E4D A;  3GR2 A;  4DMZ A;  2Y2K A;  4IUK A;  1FSW A;  3QP2 A;  3F1O A;  4UA6 A;  3HLB A;  2Y91 A;  2Y2J A;  1HZO A;  4LV1 A;  1P0Z A;  4BBT A;  1OT9 A;  2EXA A;  1QMF A;  5K5B A;  1JTG A;  1IOU A;  4R4R A;  4ZTK A;  3W4Q A;  4JXS A;  4P6Z S;  4DE1 A;  5GLA A;  4GZB A;  4R70 A;  5G18 A;  4KG5 A;  3UNW A;  5HDD A;  5L8M A;  5GLD A;  1K4E A;  1YSQ A;  1IYS A;  4ZBE A;  1PW1 A;  3QP4 A;  3LI9 A;  2GDN A;  4LCL A;  2JKR M;  1VHM A;  5FAO A;  2XD1 A;  4S2M A;  3IBJ A;  1YLJ A;  3W2Z A;  2EX2 A;  3OLO A;  4KZ3 A;  4H8R A;  1N4O A;  1KE4 A;  2IWD A;  4GLQ A;  2W3D A;  3ZVW A;  2XRN A;  1NYM A;  2QWS A;  3PYP A;  4UEY A;  4O01 A;  3T4K A;  5TBM A;  4L9G A;  2XFS A;  3S22 A;  3BLM A;  3D4F A;  2IWC A;  2WAD A;  2ZQD A;  1W63 Q;  1KE0 A;  4QU3 A;  3VP0 A;  3ULF A;  1PI4 A;  5GHX A;  4XXR A;  3ZCZ A;  1PI5 A;  3D9Y A;  2X02 A;  1J9M A;  1LLB A;  1TS8 A;  3BFD A;  4EBN A;  1K54 C;  2Q9N A;  4UA7 A;  5HAQ A;  1KGF A;  2HP5 A;  1LSW A;  3F1N A;  3PAG A;  5FDH A;  3FZC A;  1HTZ A;  3N4I A;  3UDX A;  4MNR A;  4O7D A;  4S2O A;  3HLF A;  2BG1 A;  1L0D A;  4I38 A;  2PDR A;  1DJA A;  4MN5 A;  3CG5 A;  1K57 C;  1FR1 A;  3UB6 A;  3HLD A;  4FUW A;  4HQA A;  4NEE D;  2Y2I A;  4DDS A;  2JKT M;  3EWK A;  2Y4A A;  2O9A A;  1MWR A;  4HI4 A;  3UY6 A;  2HJ9 C;  4MN7 A;  3V67 A;  4BLM A;  3C8C A;  4IUH A;  1TS7 A;  3IX4 A;  1MBL A;  3H82 A;  3B47 A;  4WN5 A;  5F68 A;  3CPT B;  2H0Y A;  1FQG A;  3JVV A;  3MS6 A;  1TVF A;  3U2A A;  2PYP A;  5IT5 A;  5DJT A;  4KZ6 A;  2J9P A;  2W1T A;  4ME4 A;  2CC1 A;  5KSC A;  5TJJ A;  3CIT A;  2WKQ A;  4UQI S;  1IKI A;  1S67 L;  4WM9 A;  1YKD A;  3BQ8 A;  1TEM A;  4RVA A;  4E3O A;  2R9W A;  2ZMF A;  3CAX A;  4N92 A;  3BEC A;  5HD3 A;  2JN7 A;  3UB9 A;  4H6J B;  1EW0 A;  2IA2 A;  1K54 A;  4PPR A;  1LSX A;  1CI8 A;  1G5U A;  3Q81 A;  3IX8 A;  2M7U A;  1ESI A;  3UE0 A;  2XRO A;  2P74 A;  1QME A;  4KZ7 A;  3OZH A;  1RCJ A;  4BL3 A;  5E43 A;  5HL6 A;  1U60 A;  3ZG0 A;  2H5S A;  1K57 A;  4P87 A;  5IU1 A;  1ES2 A;  2V9A A;  4WL9 A;  1NXY A;  5MC7 A;  4ETZ A;  3OPL A;  2H0T A;  3HCY A;  3DTK A;  3F1P B;  3MZD A;  4MDZ A;  3KYQ A;  5F69 A;  5JYO A;  5EVI C;  2PU2 A;  4EBL A;  3O5Y A;  3BFG A;  1Y4O A;  4YIN A;  2HDR A;  4JXW A;  2PHY A;  4K0W A;  4PM9 A;  2ZL1 A;  4I39 A;  3BM6 A;  4LV2 A;  2WKR A;  4WZ4 A;  1KGE A;  1DP9 A;  1WA9 A;  4HBU A;  3MKE A;  1HD8 A;  4ZJ2 A;  1FCN A;  2ZOH A;  1AXB A;  4R4S A;  4CLC B;  3VOY A;  2V8C A;  3ZGA B;  1ZG6 A;  4HP9 A;  2WAE A;  2C6W B;  5DJU A;  4DJ3 A;  5CGX A;  2EX6 A;  4S2N A;  3OOV A;  3UE3 A;  3HJK A;  3OCL A;  3WS5 A;  3U4L P;  3BRM A;  1TD5 A;  2X01 A;  3OPP A;  3NDG A;  3ITA A;  2XQZ A;  1K56 D;  2ZQ8 A;  3HRE A;  5FEF A;  2K7S A;  2OOL A;  1K38 A;  4CLC D;  4FOF A;  2J3W A;  4JPM A;  4LV3 A;  4Q0H A;  1NZO A;  3UB8 A;  1BZA A;  3BLS A;  4EW7 A;  5EV0 A;  1IYQ A;  4EER A;  1OTD A;  4EU0 A;  4LFU A;  3BY9 A;  5CRF A;  5M19 A;  3LR5 A;  1MWU A;  3WS0 A;  5J4E A;  1SKO A;  2WK0 A;  2J8Y A;  1BYW A;  2O0Y A;  5HSQ A;  4OPY A;  3BQA A;  1DJC A;  3W8K A;  3A3I A;  3GV9 A;  3P98 A;  3MQ0 A;  2ZD8 A;  3PBO A;  3F1O B;  2G2W A;  1E3U A;  1YM1 A;  3RJU A;  1GA0 A;  2XH9 A;  5EVI A;  3DW0 A;  5FDS A;  5LBR A;  5KSH A;  2D02 A;  3WS2 A;  5AQB A;  4OP5 A;  2DNS A;  2PD8 A;  2ZMV A;  1TDL A;  3Q82 A;  1K55 C;  3UDI A;  3QNB A;  3LO7 A;  5E2E A;  4K0X A;  5L10 A;  1LI9 A;  2G2U A;  2R9X A;  4R3A A;  3G2Z A;  3OCN A;  5F6A A;  4GS9 A;  1XXM A;  2XEP A;  5EVE A;  1RP5 A;  4P0M A;  1NYY A;  3V3S A;  1PNE A;  1GSV A;  2JKR I;  2WKP A;  2PT7 A;  1ERM A;  2OSU A;  1IEL A;  1T18 A;  5HWW A;  4OKP A;  1VM1 A;  4ID4 A;  3SH9 A;  2HDS A;  2W3F A;  5A90 A;  4OVD A;  4WMC D;  1VQQ A;  1SZV A;  3UMD A;  5HAP A;  3T4O A;  1H8M A;  3NOT C;  4DE0 A;  5TBM B;  3ZG5 A;  1ZC2 A;  1FCM A;  3N7W A;  4S2P A;  2KX6 A;  1MKI A;  5FI7 A;  2W3E A;  4NET A;  1LL5 A;  3T1Q B;  1ZHH B;  1GCE A;  3GVB A;  3R7W B;  3ZHH A;  1GSW A;  3KYZ A;  2ZJ9 A;  2VJW A;  3JYI A;  2PU4 A;  2XA7 M;  4DE2 A;  4PKY A;  4LLO B;  3KSF A;  2K31 A;  1YPR A;  1BLP A;  1K6R A;  4S2J A;  2PR6 A;  4EEP A;  1NRJ A;  3WRZ A;  4EXO A;  5FAP A;  2QJ7 A;  2JC7 A;  2Y2M A;  1FIK A;  5EUA A;  3H9W A;  1T19 A;  5CHU A;  2O9C A;  2A2L A;  1YT4 A;  2J80 A;  3DBA A;  3MF0 A;  1CEG A;  3C7V A;  3HLG A;  2FFF B;  3FKV A;  3K3D A;  3CI6 A;  2XF3 A;  1YLZ A;  3ZNY A;  1W8Y A;  3ISG A;  3N6I A;  1Q2P A;  4LCM A;  5FQJ A;  3BFE A;  2ZOI A;  1L0E A;  4ETX A;  1KGG A;  4BQM A;  5EE8 A;  1VET B;  4GCZ A; 
#chains in the Genus database with same CATH homology
 5HAR A;  3S22 A;  3BLM A;  3V3R A;  1JWZ A;  4KG6 A;  2ZM8 A;  3ZVT A;  4OPQ A;  3D4F A;  4Q8I A;  2IWC A;  2WAD A;  5FQM A;  4WZ5 C;  2ZQD A;  5FI2 A;  3S4X A;  5HFO A;  2WKH A;  3IH8 A;  1BUL A;  3ZG7 B;  1KE0 A;  1S6R A;  4QU3 A;  3SS4 A;  4DRT A;  3AGF A;  4NK3 A;  3VP0 A;  3M2K A;  4KZB A;  3AGD A;  4KZ9 A;  4N9K A;  3IXH A;  1PI4 A;  3C4O A;  4E3N A;  5GHX A;  4RA7 A;  4XXR A;  3UE1 A;  3ZCZ A;  1PI5 A;  4EBP A;  5KMW A;  5F1G A;  1TDG A;  3MBZ A;  1MPL A;  1J9M A;  1LLB A;  2X02 A;  3WRT A;  3BFD A;  1JTD A;  4R3J A;  4EBN A;  1K54 C;  2Q9N A;  3IWI A;  4UA7 A;  1KDW A;  5HAQ A;  1KGF A;  4WYY A;  2HP5 A;  3IH9 A;  2Y2Q A;  3HLC A;  4E3I A;  3PAG A;  4KZ8 A;  3MZF A;  5TFQ A;  5FDH A;  3FZC A;  1HTZ A;  3N4I A;  3UDX A;  4P6B A;  1XA7 A;  4MNR A;  4O7D A;  4S2O A;  1ERO A;  3VP2 A;  1ES5 A;  2FFY A;  3I7J A;  4OLG A;  4BD0 A;  3HLF A;  2BG1 A;  4RX2 A;  4B4X A;  1L0D A;  5AQ7 A;  3LY3 A;  4OQH A;  1DJA A;  2ZM0 A;  5M18 A;  5CEB A;  3CG5 A;  1K57 C;  1FCO A;  1FR1 A;  3HLD A;  3MXS A;  2XGN A;  3Q1F A;  2WKI A;  2Y2I A;  4DDS A;  1IEM A;  1BLH A;  3RXW A;  3UPO A;  2Y4A A;  1E25 A;  1ONH A;  1MWR A;  3VSK A;  2ZMA A;  4KZ5 A;  4Y0O A;  3UY6 A;  4RYE A;  4FCF A;  1IYP A;  3Q7Z A;  3LY4 A;  1NRF A;  2OLV A;  4JXV A;  5FQ9 A;  3GQZ A;  5EPH A;  3TOI A;  1Y54 A;  4WEL A;  3SH8 A;  2Z2L B;  4OON A;  5A92 A;  5U47 A;  4PM8 A;  5EEC A;  4BLM A;  3GRJ A;  5E2H A;  4L0L A;  5GLB A;  5FAT A;  1MBL A;  3A3J A;  5HL1 A;  4MBK A;  4KQR A;  3HLE A;  1FR6 A;  3LEZ A;  1EWZ A;  4S2I A;  2EX9 A;  3OPH A;  3WS1 A;  4JF4 A;  4MLL A;  5A91 A;  2H0Y A;  1FQG A;  1ONG A;  3VP3 A;  2DRW A;  3DTM A;  4EWF A;  3MFD A;  4HES A;  1I5Q A;  3WS4 A;  3VMA A;  1WYC A;  1TVF A;  2HDQ A;  3GSG A;  4KZ6 A;  5E2G A;  4KEN B;  1L2S A;  1I2S A;  1KE3 A;  1H5X A;  2J9P A;  3A3D A;  3C4P A;  1YQS A;  4DE3 A;  2ZQ7 A;  1YLW A;  3QHY A;  1ES3 A;  2CC1 A;  4R3B A;  2ZQA A;  3A3F A;  5CHM A;  4D2O A;  5KSC A;  1MXO A;  4WZ5 A;  1L0G A;  3NIA A;  1W8Q A;  4WM9 A;  1IKI A;  4KZ4 A;  3N8S A;  2ZC6 B;  3NY4 A;  4GOG A;  4C75 A;  5TGF A;  1TEM A;  1YMS A;  4RVA A;  4E3O A;  1PZO A;  1SDN A;  2R9W A;  3C7U A;  3FWL A;  4N92 A;  5DF9 A;  3ZFZ A;  4ZDX A;  4FD8 A;  3BEC A;  2Y2L A;  4ZAM A;  3IWO A;  3ZNT A;  1JVJ A;  1NJ4 A;  4GDB A;  3GMW A;  4GN2 A;  1K54 A;  4U3T A;  2WGV A;  4N9L A;  4PPR A;  4QY6 A;  5F82 A;  4U0T A;  2A49 A;  4GD6 A;  3O88 A;  1CI8 A;  4HBT A;  1WYB A;  2E8I A;  3HUM A;  3Q81 A;  4OH0 A;  3NBL A;  1ESI A;  3PBT A;  3VP4 A;  3CMZ A;  4P85 A;  3UE0 A;  2P74 A;  1QME A;  2UWX A;  4KZ7 A;  2V20 A;  3SS3 A;  1YLP A;  3OZH A;  2JCH A;  3EQU A;  4UHU A;  1RCJ A;  4PM6 A;  4BL3 A;  3MKF A;  4EQI A;  1SKF A;  1S0W A;  4OPZ A;  4DKI A;  4X6T A;  1ES4 A;  1H8Z A;  3O3V A;  5E43 A;  3LCE A;  1U60 A;  1RGZ A;  2HP6 A;  3ZG0 A;  2H5S A;  1K57 A;  3ZG9 B;  3NI9 A;  1K56 A;  4JLF A;  2Y2P A;  3NDE A;  2Y2H A;  4P87 A;  1GHM A;  2HDU A;  4OP8 A;  1ES2 A;  2J9O A;  4XUZ A;  3HLW A;  5BOH A;  3TSG A;  3Q7V B;  5EOO A;  1NXY A;  4OLD A;  1K4F A;  1KVM A;  1RGY A;  3G35 A;  1W5D A;  4IVI A;  5GLC A;  3IF5 A;  4E3K A;  2ZLY A;  1W7F A;  2QMI A;  3OPL A;  4JBF A;  4KQQ A;  4JKT A;  5IHV A;  4EV4 A;  2H0T A;  4MBF A;  3MZD A;  4JF6 A;  3O86 A;  1GHI A;  4N1H A;  2WKE A;  5JYO A;  5EOE A;  5F83 A;  2RCX A;  1SHV A;  5CGW A;  5EVI C;  2PU2 A;  4EBL A;  3IF6 C;  3BFG A;  2WZX A;  3WWX A;  3OPR A;  4YIN A;  2BLS A;  2HDR A;  4JXW A;  3UN7 A;  3ZDJ A;  1YLT A;  1PW8 A;  4K0W A;  4PM9 A;  4JXG A;  5CGS A;  4DDY A;  1XPB A;  4MBH A;  5JYP A;  2Y55 A;  4IBR A;  3BM6 A;  1KVL A;  4IVK A;  3IXB A;  1LHY A;  4LV2 A;  5E2F A;  5D3O A;  4A5R A;  4BD1 A;  4WZ4 A;  1KGE A;  2WZZ A;  2EXB A;  3IF6 B;  2XD5 A;  5EVL A;  1CEF A;  4HBU A;  3MKE A;  1LI0 A;  1HD8 A;  5DTS A;  4ZJ2 A;  3HUN A;  2EX8 A;  1FCN A;  2QZ6 A;  1AXB A;  5AQA A;  5M1A A;  4R4S A;  4E6X A;  1PWG A;  1O7E A;  4X53 A;  1GHP A;  1H8Y A;  2VGJ A;  4LV0 A;  4CJN A;  3VOY A;  3NC8 A;  3ZGA B;  1ZG6 A;  1ERQ A;  4DXB A;  2WAE A;  2C6W B;  2J7V A;  3BFC A;  2XLN A;  5CGX A;  3G32 A;  2EX6 A;  4S2N A;  3PTE A;  3UE3 A;  3Q07 A;  2WGW A;  1N9B A;  2C5W B;  1MY8 A;  2WUQ A;  3OCL A;  4Y7P A;  3WS5 A;  3BRM A;  4PM7 A;  4QB8 A;  3PAE A;  1YLY A;  4UA9 A;  2Q9M A;  2X01 A;  5I94 A;  3OPP A;  3P09 A;  5FAS A;  1MWS A;  3NDG A;  4PM5 A;  2ZM2 A;  1C3B A;  5GHZ A;  3ITA A;  4QJG A;  4F94 A;  2XQZ A;  3BYD A;  1K56 D;  2ZQ8 A;  3HRE A;  4N1X A;  1K38 A;  2VGK A;  2OV5 A;  3NCK A;  5CTM A;  1HVB A;  3E2K A;  4DXC A;  4JPM A;  4LV3 A;  1ESU A;  1NZO A;  4S2K A;  3S1Y A;  1BZA A;  3IHA A;  3BLS A;  1G6A A;  4UAA A;  5KZH A;  1IYQ A;  3Q7V A;  2IWB A;  4BJP A;  4QY5 A;  3M2J A;  2Z2M B;  4S2L A;  5CRF A;  1KDS A;  5DF8 A;  5M19 A;  3QNC A;  2ZQC A;  1MWU A;  4U0X A;  3WS0 A;  4LEN A;  3FKW A;  3PBN A;  2WK0 A;  2J8Y A;  3DWZ A;  4S2N C;  3G2Y A;  5J8X A;  4OPY A;  1DJC A;  5DF7 A;  1NY0 A;  2EFX A;  1DJB A;  1L0F A;  3A3I A;  3IXD A;  3W8K A;  1K55 A;  1JWV A;  3CJM A;  3O87 A;  3N8R A;  3IWQ A;  4B4Z A;  4WMC A;  3RXX A;  1Z6F A;  3GV9 A;  1W79 A;  3P98 A;  4GB7 A;  2V1Z A;  3FYZ A;  4OOM A;  3PBR A;  2Y2G A;  2ZD8 A;  3PBO A;  4WEK A;  1PWC A;  2G2W A;  2WGW B;  2XDM A;  1E3U A;  5CXW A;  1K25 A;  2B5R A;  1YM1 A;  4OQI A;  1O07 A;  3BEB A;  3RJU A;  1GA0 A;  2XH9 A;  5EVI A;  3DW0 A;  5A93 A;  5KSH A;  2WGI A;  3IF6 A;  2HPB A;  3VFF A;  2I72 A;  3B3X A;  3WS2 A;  1FSY A;  5AQB A;  3IQA A;  1PZP A;  4OP5 A;  4PMA A;  4B88 A;  4QD4 A;  1IKG A;  2DNS A;  4ZJ1 A;  3IXG A;  3IT9 A;  4BL2 A;  1XGJ A;  4GD8 A;  4E6W A;  1TDL A;  3Q82 A;  4Y0U A;  3V39 A;  3VOZ A;  4OOY A;  1K55 C;  1MWT A;  2Y2O A;  4EUZ A;  1PWD A;  3QNB A;  1ZG4 A;  3UDI A;  3LO7 A;  4KZA A;  5E2E A;  4K0X A;  3PBQ A;  3W4O A;  1FOF A;  3HVF A;  1I2W A;  1LI9 A;  2G2U A;  4Z9Q A;  1WE4 A;  2R9X A;  3V50 A;  3MXR A;  1XKZ A;  2Y2N A;  5GHY A;  4OOL A;  2XR0 A;  1BLC A;  1M6K A;  2JE5 A;  2EFU A;  3G2Z A;  2JBF A;  3ITB A;  3OCN A;  3SS5 A;  1PYY A;  2RL3 A;  5DTT A;  1XXM A;  2XEP A;  4WBG A;  4Y0T A;  5F1F A;  1Q2Q A;  1RP5 A;  4P0M A;  1PIO A;  1NYY A;  4E3M A;  1SCW A;  1G68 A;  3V3S A;  1ALQ A;  4FH2 A;  5CTN A;  5CEC A;  4RX3 A;  1XA1 A;  3HBR A;  3M6B A;  4E3J A;  1CK3 A;  1ERM A;  1GA9 A;  1BT5 A;  2OSU A;  3EQV A;  1IEL A;  3UO9 A;  4OKP A;  1ZKJ A;  4WEJ A;  4BEN A;  2QPN A;  1BSG A;  1VM1 A;  4ID4 A;  4OPR A;  4KQO A;  3SH9 A;  2Y59 A;  5EVI B;  5FA7 A;  2X71 A;  1YMX A;  2HDS A;  1LL9 A;  1NZU A;  5HW3 A;  3UPP A;  3W4P A;  3G4P A;  4C6Y A;  4MEZ A;  5A90 A;  2ZC3 B;  2P9V B;  4OVD A;  3V5M A;  4JF5 A;  5DVA A;  4WMC D;  1VQQ A;  5CHJ A;  2ZC5 B;  3CZD A;  4R0Q A;  1SDE A;  3AGE A;  5FI6 A;  4KG2 A;  2ZQ9 A;  5FAQ A;  5HAP A;  3VSL A;  5FQK A;  4DE0 A;  1M40 A;  3ZG5 A;  4X55 A;  1ZC2 A;  2XK1 A;  1E4D A;  1CI9 A;  3GR2 A;  1FCM A;  2WAF A;  2Y2K A;  4QHC A;  3N7W A;  1FSW A;  4S2P A;  1E3U D;  1MKI A;  5FSR A;  5FI7 A;  4FSF A;  4UA6 A;  5EVI D;  3HLB A;  2Y91 A;  4NET A;  1LL5 A;  1DY6 A;  2Y2J A;  1HZO A;  4GKU A;  1GCE A;  3HL9 A;  4LV1 A;  3VFH A;  4X68 A;  2OLU A;  3GVB A;  2A3U A;  4ZJ3 A;  3IHB A;  4X69 A;  3ZHH A;  2EXA A;  3UPN A;  2ZJ9 A;  4GNU A;  1BUE A;  2PU4 A;  2XFT A;  3JYI A;  5DTK A;  4DE2 A;  4FH4 A;  1QMF A;  4R1G A;  3PBS A;  3OC2 A;  1JTG A;  1OME A;  4R4R A;  4ZTK A;  3W4Q A;  4JXS A;  4M3K A;  5FQQ A;  4DE1 A;  1BTL A;  5GLA A;  4YFM A;  4GZB A;  1BLP A;  5G18 A;  1K6R A;  1BLS A;  4KG5 A;  4S2J A;  3UNW A;  4HEF A;  3VP1 A;  5GL9 A;  4C3Q A;  5AQ9 A;  5FQI A;  3WRZ A;  4K91 A;  5GLD A;  1K4E A;  4E3L A;  4DF6 A;  5FAP A;  2PBY A;  1IYS A;  4ZBE A;  4OQG A;  1PW1 A;  2JC7 A;  2Y2M A;  2ZC7 A;  3BFF A;  5EUA A;  2WYX A;  1EI5 A;  2GDN A;  1XX2 A;  5CHU A;  4LCL A;  1XGI A;  3G34 A;  3SOI A;  1YT4 A;  4X56 A;  5FAO A;  2XD1 A;  4S2M A;  3A3E A;  3TG9 A;  3ZG8 B;  1CEG A;  1YLJ A;  3C7V A;  5HX9 A;  2HP9 A;  1JWP A;  2V2F F;  3HLG A;  2FFF B;  4IBX A;  2EX2 A;  3FKV A;  4XUX A;  4KZ3 A;  3C5A A;  5CED A;  4H8R A;  4IED A;  3E2L A;  2XF3 A;  1YLZ A;  3ZNY A;  1XP4 A;  1K6S A;  2DCF A;  3SH7 A;  1W8Y A;  3ISG A;  1N4O A;  3DWK A;  1KE4 A;  1Q2P A;  2IWD A;  2P9V A;  3FV7 A;  3G31 A;  3N6I A;  3N8L A;  3GTC A;  4LCM A;  5FQJ A;  3UDF A;  4GDN A;  2H10 A;  3G30 A;  5HAI A;  3BFE A;  3ZVW A;  1L0E A;  1NYM A;  3HUO A;  1KGG A;  1IYO A;  4R23 A;  4OQ0 A;  5CER A;  4BQM A;  2ZC4 B;  3M6H A;  5EE8 A;  3MZE A;  5L2F A;  4CPK A;  5TR7 A;  2XFS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...